2VQFM

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
b'ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 33
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2vqfM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2vqfM02
3GPUA 1Z5BA 1J5EM 4LF5M 4NRVA 3T1HM 5ITYA 4JI5M 1XNQM 4OX9M 3J80S 4B3TM 1FJGM 2UUCM 4G4RA 1XMQM 1IBMM 4PDIA 3OTOM 4PDGA 3W0FA 4DUZM 2OQ4A 4X62M 2ZM6M 4LF4M 2OPFA 5A2QS 1I94M 1HNWM 3A42A 3GQ4A 1PJJA 2E5LM 2UXDM 4LFCM 3SASA 1K3WA 3GPYA 4DUYM 4DV1M 4DR5M 1PJIA 4DR7M 1HR0M 3T1YM 4JV5M 1L2BA 2VQFM 3SATA 4LF6M 2HKJA 2EA0A 3GPXA 1K82A 5ITUA 3SAVA 1Z5AA 2VQEM 4LF9M 4NXMM 1Q39A 3J7AS 4YY3M 4JI6M 3U6MA 4JI2M 4NRWA 4X65M 4G4QA 3VK7A 2UUBM 2F5PA 5ITXA 1TDHA 3JR5A 4LFBM 1Q3CA 3A45A 3A46A 4K0KM 1R2YA 5LMNM 1N36M 4JI1M 4DV6M 4B3MM 4DV3M 1XNRM 4JI7M 4DR6M 1N32M 3JAMS 1NNJA 1N34M 4G4NA 4DV4M 1L2CA 1TDZA 1IBKM 1L2DA 3GQ5A 1R2ZA 3SAUA 4JI3M 3U6CA 1K3XA 2F4VM 2F5QA 4NXNM 4DV2M 5ITRA 2F5NA 1MX0A 3JR4A 4JYAM 5IT9S 4JI4M 4DR3M 2XZUA 3U6QA 4GKJM 4AQYM 3VK8A 5BR8M 4DR2M 3TWMA 4YHHM 4LFAM 1Z59A 4DV7M 3SARA 5LMUM 3TWKA 1MU5A 2F5OA 4GKKM 4LF7M 4CISA 1Z5CA 1XMOM 4B3RM 3SBJA 1EE8A 1L1TA 4LF8M 3GQ3A 4B3SM 3DOAA 3J81S 4PD2A 3U6DA 5ITTA 1PM5A 2Q2EB 3SAWA 5FLXS 4DR4M 3U6LA 4JI8M 1HNXM 5IWAM 3U6SA 1HNZM 3GP1A 2ZBKB 2UXBM 4X66M 3U6OA 5ITQA 3TWLA 3C58A 2HHHM 5ITXE 4DR1M 2XZFA 1KFVA 3U6PA 1XC8A 2UXCM 1N33M 3GO8A 4DV0M 4X64M 2F5SA 2UUAM 4KHPM 1L1ZA 4MB7A 4DV5M 4G4OA 3GPPA 4ITQA 1IBLM 2UU9M 4JI0M 4PCZA 3U6EA 1Q3BA
chains in the Genus database with same CATH superfamily
3GPUA 1Z5BA 4JN6A 1SXJB 2X8AA 3T1HM 1GABA 4JI5M 2KNVA 5FTMA 1XNQM 1YUBA 3U61A 2YQZA 3J80S 3UK6A 4GMQA 2JP7A 2J7OA 4QNRA 3PNVA 4FCVA 5IZ7D 3W0FA 3C3DA 4UN2B 2AHMA 2C98A 2ZM6M 4LG2A 5A2QS 4IJEA 2FS1A 3MHVC 3VDPA 3A42A 2QBYB 3PXGA 4CJ6A 2KNAA 4L15A 1N75A 3M7GA 3FYDA 1GVNA 1IM2A 1ORYB 4I8OA 3U60B 3T1YM 4RF1A 4JV5M 3SATA 2DAIA 4LF6M 2HKJA 1E9SA 5FTNA 3RFWA 1K82A 3FTDA 4Z6YA 5EXXA 1GKIA 5KO3A 1Z5AA 4LF9M 3FRHA 4KT0F 3KSJA 1V34A 3J7AS 4P16A 4FCTA 4Y28F 3HJSA 4JI2M 4QOSA 2V1CA 5IREB 3GLGE 2LVNC 2KEBA 4OU7A 2DZNB 2O01F 2UUBM 3W0LB 2XSZD 2ZAOA 3RGPA 1Q3CA 1OAIA 3A45A 3LQQA 4K0KM 2APLA 4F2LA 5LMNM 4JI1M 3R9XB 2LTUA 3K8ZA 5EXPA 4DV3M 2QHOB 1JR3A 2CP8A 3NBXX 2LWXA 1YLAA 1ZMWA 1L2CA 1TDZA 1R5LA 1QUTA 2ZAMA 4HLQA 1TH2A 5KPZA 2FOIC 2GNOA 1MJGM 3U6CA 1K3XA 1QDRA 3QWLA 2VIIA 1TF0B 2N35A 3AOEA 2C9CA 3THGA 3ZCBB 5GKNA 3HY5A 4OVZB 4D82A 1QZEA 1HQYE 2XZUA 2EKKA 3L2AA 2Z3XA 3U6QA 1C7YA 2KXEA 3KP0E 3VK8A 2M5ZA 1VG5A 3HKPA 1IQPA 4YHHM 2CEAA 2Y0QA 3FTEA 1NY6A 3J7BA 4KODA 3E4RA 5KPTA 4JXJA 4ANRA 3CGWA 3SFZA 2EJSA 2WSCF 2DZLA 3SARA 3TWKA 4GHLA 4LF7M 2JZ0A 4CISA 3HGIA 4B3RM 1G4AE 2OOBA 1CUKA 2RGHA 1PJQA 1XXHE 2DNAA 5EQTA 2VF8A 5E26A 4B3SM 4LF8M 1IN8A 2YR0A 3E9SA 3HU2A 2Q2EB 3GLGA 3K9PA 4AKHA 2HCBA 4LZZA 4DR4M 4IBDA 3RGSA 5IWAM 3HU3A 1IXSB 2V6ZM 2BWBA 4QOZC 2GQFA 1VDLA 1TTEA 4FW9A 3TWLA 3L26A 3FTFA 3B74A 5KQDA 5EXTA 1OTRA 4G6ZA 3WHKA 1XC8A 3BOSA 3L25A 2UXCM 1N33M 2KA6B 2R45A 1OQYA 3I4VA 3D8LA 1OIZA 3TPZA 2I7PA 3FUWA 2BJWA 4IBFA 1NJFA 4XGIA 5EXSA 4JI0M 3H4JA 2DENA 3GLIE 1QYRA 1IN4A 1NJGA 3FTCA 1IXRC 2EKFA 3AKZA 3HJQA 2CV1A 3KS8A 3GLFE 1J5EM 2L6OA 4NRVA 2MROB 4OX9M 1FJGM 3ZC7B 1XMQM 2C96A 4AG5A 3VKGA 3SHFA 3T38A 3OTOM 4R3DA 4L8RC 1QUSA 1RU3A 1NNUC 2P5TA 3SMSA 1WHCA 5L8RF 4LCBA 4LF4M 3GRRA 2OPFA 3PNYA 4B7FA 2LHGA 2ZANA 3HX3A 4CHTB 1PJJA 2UXDM 1SXJC 1HT2E 1NHGC 1QQWA 4LJ4A 1IXZA 1QANA 3AFHA 3GPYA 4DUYM 4LFCM 4BLCA 1S3SA 4GITA 1ZQ9A 1FNNA 3KOYE 1HR0M 2CV0A 1JR3D 3IECA 1XXHA 2G3QA 4LJAA 1NY5A 2HWJA 4LRSA 1L2BA 1P3QQ 2DAEA 4MGZE 2EA0A 3CTWB 5ITUA 4P17A 3AOEC 3SAVA 4NXMM 2CHQA 2G8LA 4L16A 4IBEA 4I5SA 2CFOA 2WSEF 3MJ5A 3KOXE 4NRWA 2NQ8C 2K47A 4R7GA 4G4QA 3VK7A 4QHSA 3JR5A 5F3WA 5FTJA 5C18A 4HL4A 2C5RA 2DWNA 3A46A 5BPVA 1OKSA 2R62A 4RF0A 2L7IA 2EUCA 5JI3E 2RRUA 4B3MM 3ILKA 1XNRM 2JY6B 4NSOB 5EP2A 4II7A 4JI7M 4DR6M 1GO5A 2X49A 1NNJA 1EFUB 2L09A 1WXQA 1R2ZA 3KSXA 1OIPA 4NOOB 3GLFA 4LZJA 1JB0F 4W5WA 4MGHA 4NC6A 2RKOA 2VF7A 2LHCA 2Z4SA 3K9OA 4OW0A 2F4VM 3GLHB 2K0BX 3B7QA 3KP1E 2JY8A 3SYLA 4DV2M 2F5NA 1ZV1A 3GRVA 2QPAA 2LVPC 2VDBB 2QENA 2ERCA 4DR3M 3SMPA 3J27B 2HAKA 4GHAA 4PT5A 4GKJM 5BR8M 3ZH9B 1T3TA 2KDLA 1GL7A 1DGHA 1XWIA 3FKEA 4IJFA 3UGJA 1DGGA 2OO9A 4DV7M 2DXIA 2X4AA 1NHWC 1YE9A 2MH8A 2CV2A 3C9PA 3MMPA 3QYEA 3H4MA 2FE8A 1WGNA 2MJ5B 1L1TA 2R6FA 2KHHA 4MH0E 4KO8A 3HZJA 3VLFB 5FTLA 3UZUA 3U6DA 4GEWA 3TL4X 4M9ZA 3SAWA 4KLNA 2J5YA 1DGFA 3SYKA 3AV0A 2L7HA 4G3OA 3LQRA 1MN3A 3GP1A 3EIHA 4X66M 1Q02A 2I7NA 5FTKA 3U5ZA 2HHHM 2JY7A 1KYIA 4L78A 4XBOA 5ITXE 1ZMUA 5DYIA 1KFVA 2XH9A 3IG8A 4GRIA 1NVMA 2L4FA 4M0WA 1GJSA 1GLNA 3L29A 3QAUA 2UUAM 3K1JA 2FNAA 3KOWE 4Z8XA 3M0EA 4MB7A 3PFIA 2DI0A 4BBAA 1VEJA 4ITQA 1IN5A 2CE7A 4PCZA 2L4EA 1GJTA 2KNZA 3KXEC 1OFHA 4LJ9A 4TUWA 1V92A 3KW6A 4FD2A 1HQCA 4LF5M 3KS4A 1G8PA 1OAOC 3LCVB 4LJ7A 4PDIA 2QBYA 1QAMA 5FSWA 2YFQA 3DZDA 3U61B 4R71A 4X62M 5H37D 5DFLA 4B7HA 3J2PB 4GIPA 4CIZA 2Z7JA 1I94M 1HNWM 1C1KA 3HWSA 3GQ4A 3BBZA 1G59A 2QSFX 3KFUG 2JUJA 1LV7A 1GL6A 4DR5M 5EP1A 2JY5A 1PJIA 2DAMA 1E32A 2DWMA 4RKUF 2CUZA 4S12A 4AZFA 1IY1A 3GPXA 1V33A 2V1UA 4IBGA 2VQEM 2CWBA 3AL0C 3SHGB 1SG9A 5EP3A 2H1RA 3FUVA 4LRTA 4QHTA 5DNYA 2QNJA 2R46A 4I81A 2LXEA 4X65M 2Z4RA 4AI6A 5ITXA 4LGYA 1TDHA 4LY6A 1IN7A 3A98B 2KZUA 3CF6E 2LVQD 5KPRA 1G71A 4IBKA 4DV6M 3B7NA 1H6UA 1KSFX 4IBJA 5E6JA 2JXNA 1N32M 3JAMS 1TH4A 1DO2A 1ZMVA 3VFDA 1N34M 4G4NA 2XFTA 4IBCA 4XK8F 2BNKA 3T6PA 4LJ5A 1A5TA 1IBKM 4AKGA 1J09A 3AJIB 2FH0A 4JI3M 2JNHA 2O5RA 2D7EA 3DFZA 4LJ6A 1HJPA 2F5QA 4FWHA 4NXNM 2R18A 4FVMA 5ITRA 3DA1A 2MR9A 3KVWA 3PVSA 3JR4A 4L6V6 4JI4M 1X37A 2KRUA 1YSYA 5EJCA 5KQ8A 1OFIA 3NBIA 3BXWA 3TWMA 1BVSA 4AKIA 1DGBA 1OJLA 3HU1A 1J7KA 1VEKA 1EIJA 2DWZB 4LJ8A 5JI2E 3B9PA 3TQSA 2F5OA 3Q8GA 3LVVA 3GLIA 2XGNA 1IY2A 1XMOM 3SBJA 1EE8A 4B08A 1QZMA 1SXJE 2BJVA 1PJSA 2JZ1A 3DOAA 3QYBA 3J81S 2FFJA 2XFSA 5ITTA 1IXSA 2K9DA 1WIVA 5FLXS 1G41A 2R44A 4GH9A 2OOAA 3U6LA 1WGLA 2XLJA 1HNXM 1E9RA 1TGUA 4JI8M 3U6SA 2C9OA 1HNZM 3W68A 3LVWA 2UXBM 2QP9X 3SC3A 2DVWB 4NL4H 5ITQA 3D8BA 3GLGB 4ZPXA 2XZFA 3F92A 2LH0A 3U6PA 4A3VB 1E94E 4B7GA 2DWLA 3LMMA 2R65A 3Q8XA 4REZA 3GRUA 3RE8A 4X64M 1R6BX 2F5SA 1L1ZA 4DV5M 4G4OA 2UU9M 3U6EA 1PRBA 1PGYA 3LW5F 4M9SA 3GRYA 1Q3BA 3FRIA 3GLHE 1LTMA 2YNMD 4MGKE 4CGYB 1AUAA 4HEOA 4EIWA 4F1IA 5ITYA 1QVRA 2C99A 3T15A 4BB9A 1VQ1A 1DV0A 1QDTA 4B3TM 2QQ8A 2CRUA 3KDSE 3L28A 2UUCM 1WJ7A 4G4RA 1IBMM 1R4GA 2XEPA 8CATA 3LCUA 4PDGA 2M60A 4AG6A 2KZSA 4DUZM 2OQ4A 1QAQA 2Y0TA 3VDUA 2EO2A 3I04M 3FE3A 4L4UA 1D0MA 2E5LM 3FUUA 3FUXA 3B89A 3SASA 1K3WA 2QZ4A 4DV1M 3K92A 4DR7M 2DKLA 1F4IA 2KW0A 5EP4A 4QNMA 4AW4A 1SXJA 2J7NA 1IN6A 2VQFM 5DYGA 2ZTDA 1NV8A 4IBBA 4Q7JA 1AIPC 3E21A 1Q39A 1XXHB 2G5GX 3AOGA 4YY3M 4JI6M 3U6MA 1Z6TA 2WSFF 3FD9A 1NO1A 4GC9A 3K2LA 3TE6A 2ZTCA 1L8QA 2F5PA 4LGMA 1D0LA 2R4EA 3B7ZA 4LFBM 2DAGA 2Z8YM 1R2YA 1HT1E 1VDDA 1N36M 1NV9A 2LNHC 3CF0A 3HHWA 2Y20A 3U60A 2L2DA 4I4LA 2D7HA 2A5YB 2DZOB 4D80A 3ZQJA 1UM8A 3E46A 4DV4M 3EIEA 3HHZA 1IY0A 2DHYA 2JWSA 1W5TA 3GLHA 3GQ5A 1L2DA 4MGYE 3SAUA 1NSFA 2MGWA 5C1BA 2O25A 2CHGA 2DHRA 3GLIB 1T43A 2XF3A 3VKHA 4MM3B 2LBCA 3W67A 3I01M 3GLFB 5IT9S 2K6BA 1MX0A 3HHYA 4JYAM 1N78A 2HL7A 2XSZA 3HJ8A 4WP2A 4FCWA 3IHPA 1IFYA 1TR8A 4AQYM 3R8FA 3WHLA 4DR2M 2LVAA 1JQJC 2Y21A 3I4YA 1QAOA 1TH3A 2JA2A 2LVOC 2R4JA 1Z59A 4LFAM 1XHBA 2B3TA 4M9XA 1T6OA 5LMUM 1MU5A 4GKKM 2D7GA 1D0KA 1DGHB 1PJTA 1Z5CA 3MK6A 3HHXA 1D2NA 2RGOA 7CATA 3GQ3A 3FYCA 4GC5A 4PD2A 4OVZA 3FUTA 1PM5A 1R7RA 4IBIA 2QCUA 1WR1B 1I4WA 4FWGA 1XB2B 2R0IA 3IG5A 2CHVA 2ZBKB 3V76A 3C3EA 2KRKA 2DAKA 3U6OA 3C58A 1DO0A 4WW0A 4DR1M 3KOZE 1W5SA 4M0DA 3GO8A 3UJNA 2H5XA 3U5ZB 4DV0M 4D81A 1N77A 4DBGB 3UMMA 4KHPM 2W82A 4MGIE 3M6AA 4WURA 1UFZA 3GPPA 2BWEA 1VEGA 2WZJA 1JR3E 4NSRA 1G3IA 4RNAA 1Y8GA 3L27A 1IBLM 4IIWA 4FWDA 3CF2A 3I51A 1SXJD 1ZAEA 3NWLA
chains in the Genus database with same CATH topology
3GPUA 1Z5BA 4JN6A 1SXJB 2X8AA 3T1HM 4JI5M 5FTMA 1XNQM 1YUBA 3U61A 2YQZA 3J80S 3UK6A 4GMQA 2J7OA 4QNRA 3PNVA 4FCVA 5IZ7D 3W0FA 2AHMA 2C98A 2ZM6M 4LG2A 5A2QS 4IJEA 3MHVC 3VDPA 3A42A 2QBYB 3PXGA 4L15A 1N75A 3M7GA 3FYDA 1GVNA 1IM2A 1ORYB 4I8OA 3U60B 3T1YM 4RF1A 4JV5M 3SATA 4LF6M 2HKJA 1E9SA 5FTNA 3RFWA 1K82A 3FTDA 4Z6YA 5EXXA 1GKIA 5KO3A 1Z5AA 4LF9M 3KSJA 3J7AS 4P16A 4FCTA 3HJSA 4JI2M 4QOSA 2V1CA 5IREB 2KEBA 4OU7A 2DZNB 2UUBM 3W0LB 2XSZD 2ZAOA 3RGPA 1Q3CA 3A45A 3LQQA 4K0KM 5LMNM 4JI1M 3R9XB 3K8ZA 5EXPA 4DV3M 1JR3A 2LWXA 1L2CA 1TDZA 2ZAMA 4HLQA 1TH2A 5KPZA 2FOIC 3U6CA 1K3XA 3QWLA 2VIIA 3AOEA 2C9CA 3THGA 3ZCBB 5GKNA 4D82A 4OVZB 1HQYE 2XZUA 3L2AA 2Z3XA 3U6QA 2KXEA 3KP0E 3VK8A 2M5ZA 3HKPA 1IQPA 4YHHM 2Y0QA 2CEAA 3FTEA 3J7BA 1NY6A 4KODA 3E4RA 5KPTA 4JXJA 3SFZA 3SARA 3TWKA 4GHLA 4LF7M 4CISA 3HGIA 4B3RM 1G4AE 4LF8M 2RGHA 5EQTA 4B3SM 5E26A 1IN8A 2YR0A 3E9SA 3HU2A 2Q2EB 3GLGA 4AKHA 2HCBA 4LZZA 4DR4M 4IBDA 3RGSA 5IWAM 3HU3A 1IXSB 2V6ZM 4QOZC 4FW9A 3TWLA 3L26A 3FTFA 5KQDA 5EXTA 4G6ZA 3WHKA 1XC8A 3BOSA 3L25A 2UXCM 1N33M 2KA6B 2R45A 3I4VA 3D8LA 3TPZA 2I7PA 3FUWA 2BJWA 4IBFA 1NJFA 4XGIA 5EXSA 4JI0M 1QYRA 1IN4A 1NJGA 3FTCA 1IXRC 3KS8A 3AKZA 3HJQA 2CV1A 1J5EM 2L6OA 4NRVA 4OX9M 1FJGM 3ZC7B 1XMQM 2C96A 4AG5A 3VKGA 3SHFA 3T38A 3OTOM 4R3DA 4L8RC 2P5TA 1NNUC 3SMSA 4LCBA 4LF4M 3GRRA 2OPFA 3PNYA 4B7FA 2ZANA 4CHTB 1PJJA 2UXDM 1SXJC 1HT2E 1NHGC 1QQWA 4LJ4A 1QANA 1IXZA 3AFHA 3GPYA 4DUYM 4LFCM 4BLCA 1S3SA 4GITA 1ZQ9A 1FNNA 3KOYE 1HR0M 2CV0A 1JR3D 1XXHA 4LJAA 1NY5A 1L2BA 4LRSA 2EA0A 4MGZE 3CTWB 5ITUA 3AOEC 3SAVA 4NXMM 2CHQA 2G8LA 4L16A 4IBEA 4I5SA 2CFOA 3MJ5A 3KOXE 4NRWA 2NQ8C 2K47A 4R7GA 4G4QA 3VK7A 4QHSA 3JR5A 5F3WA 5FTJA 5C18A 4HL4A 2C5RA 2DWNA 3A46A 5BPVA 2R62A 4RF0A 2L7IA 2EUCA 5JI3E 4B3MM 3ILKA 1XNRM 4NSOB 5EP2A 4II7A 4JI7M 4DR6M 2X49A 1NNJA 2L09A 1WXQA 1R2ZA 3KSXA 3GLFA 4NOOB 4LZJA 4W5WA 4MGHA 2RKOA 2Z4SA 4OW0A 2F4VM 3GLHB 3KP1E 4DV2M 3SYLA 2F5NA 3GRVA 2QPAA 2QENA 2ERCA 4DR3M 3SMPA 3J27B 4GHAA 4PT5A 4GKJM 5BR8M 3ZH9B 1T3TA 1XWIA 1GL7A 1DGHA 4IJFA 3FKEA 3UGJA 1DGGA 4DV7M 2DXIA 2X4AA 1NHWC 1YE9A 2CV2A 3H4MA 2FE8A 1L1TA 4MH0E 4KO8A 3VLFB 5FTLA 3UZUA 3U6DA 3TL4X 4M9ZA 3SAWA 4KLNA 1DGFA 3SYKA 3AV0A 2L7HA 3LQRA 3GP1A 3EIHA 4X66M 2I7NA 5FTKA 3U5ZA 2HHHM 1KYIA 4L78A 4XBOA 5ITXE 5DYIA 1KFVA 2XH9A 3IG8A 4GRIA 1NVMA 4M0WA 1GLNA 3L29A 3QAUA 2UUAM 3K1JA 2FNAA 3KOWE 4Z8XA 3M0EA 4MB7A 3PFIA 4BBAA 4ITQA 1IN5A 2CE7A 4PCZA 3KXEC 1OFHA 4LJ9A 4TUWA 3KW6A 4FD2A 1HQCA 4LF5M 3KS4A 1G8PA 4LJ7A 4PDIA 2QBYA 1QAMA 5FSWA 2YFQA 3DZDA 3U61B 4X62M 5H37D 4B7HA 3J2PB 4GIPA 1I94M 2Z7JA 1HNWM 1C1KA 3HWSA 3GQ4A 1G59A 3KFUG 1LV7A 1GL6A 4DR5M 5EP1A 1PJIA 1E32A 2DWMA 2CUZA 4S12A 4AZFA 1IY1A 3GPXA 2V1UA 4IBGA 2VQEM 3AL0C 3SHGB 5EP3A 2H1RA 3FUVA 4LRTA 4QHTA 5DNYA 2R46A 4I81A 2LXEA 4X65M 2Z4RA 4AI6A 5ITXA 4LGYA 1TDHA 4LY6A 1IN7A 3A98B 2KZUA 3CF6E 5KPRA 4IBKA 4DV6M 1H6UA 1KSFX 4IBJA 5E6JA 1N32M 3JAMS 1TH4A 1DO2A 3VFDA 1N34M 4G4NA 2XFTA 4IBCA 2BNKA 4LJ5A 1IBKM 4AKGA 1J09A 3AJIB 4JI3M 2O5RA 2D7EA 3DFZA 4LJ6A 2F5QA 4FWHA 4NXNM 2R18A 4FVMA 5ITRA 3DA1A 3KVWA 3PVSA 3JR4A 4JI4M 1X37A 2KRUA 1YSYA 5EJCA 5KQ8A 1OFIA 3NBIA 3TWMA 4AKIA 1DGBA 1OJLA 3HU1A 1J7KA 2DWZB 4LJ8A 5JI2E 3B9PA 3TQSA 2F5OA 3LVVA 3GLIA 2XGNA 1IY2A 1XMOM 3SBJA 1EE8A 4B08A 1QZMA 1SXJE 2BJVA 3DOAA 3J81S 2FFJA 2XFSA 5ITTA 5FLXS 1G41A 4GH9A 3U6LA 2XLJA 1HNXM 1E9RA 1TGUA 4JI8M 3U6SA 2C9OA 1HNZM 2UXBM 3LVWA 2QP9X 3SC3A 2DVWB 4NL4H 5ITQA 3D8BA 3GLGB 4ZPXA 2XZFA 2LH0A 3U6PA 4A3VB 1E94E 4B7GA 2DWLA 3LMMA 2R65A 3Q8XA 4REZA 3GRUA 3RE8A 4X64M 1R6BX 2F5SA 1L1ZA 4DV5M 4G4OA 2UU9M 3U6EA 4M9SA 3GRYA 1Q3BA 4MGKE 2YNMD 4CGYB 4EIWA 5ITYA 1QVRA 2C99A 3T15A 4BB9A 4B3TM 3L28A 3KDSE 2UUCM 4G4RA 1IBMM 2XEPA 8CATA 4PDGA 2M60A 4AG6A 2KZSA 4DUZM 2OQ4A 1QAQA 2Y0TA 3VDUA 2EO2A 4L4UA 2E5LM 3FUUA 3FUXA 3SASA 1K3WA 2QZ4A 4DV1M 3K92A 4DR7M 2KW0A 5EP4A 4QNMA 4AW4A 1SXJA 2J7NA 1IN6A 2VQFM 5DYGA 4IBBA 1Q39A 1XXHB 2G5GX 3AOGA 4YY3M 4JI6M 3U6MA 1Z6TA 3FD9A 4GC9A 3K2LA 3TE6A 1L8QA 2F5PA 4LGMA 2R4EA 4LFBM 1R2YA 1HT1E 1VDDA 1N36M 3CF0A 2LNHC 3HHWA 2Y20A 3U60A 4I4LA 2D7HA 2A5YB 2DZOB 4D80A 1UM8A 4DV4M 3EIEA 3HHZA 1IY0A 3GLHA 1L2DA 1W5TA 3GQ5A 4MGYE 3SAUA 1NSFA 5C1BA 2CHGA 2DHRA 3GLIB 2XF3A 3VKHA 4MM3B 3GLFB 5IT9S 1MX0A 3HHYA 4JYAM 1N78A 2HL7A 2XSZA 3HJ8A 4FCWA 4AQYM 3R8FA 3WHLA 4DR2M 1JQJC 2Y21A 3I4YA 1QAOA 1TH3A 2JA2A 2R4JA 4LFAM 1Z59A 1XHBA 4M9XA 5LMUM 1MU5A 4GKKM 2D7GA 1Z5CA 1DGHB 3MK6A 3HHXA 1D2NA 2RGOA 7CATA 3GQ3A 3FYCA 4GC5A 4PD2A 4OVZA 3FUTA 1PM5A 1R7RA 4IBIA 2QCUA 1I4WA 4FWGA 3IG5A 2CHVA 2ZBKB 2KRKA 3U6OA 3C58A 1DO0A 4WW0A 4DR1M 3KOZE 1W5SA 4M0DA 3GO8A 3UJNA 3U5ZB 4DV0M 4D81A 1N77A 3UMMA 4KHPM 2W82A 4MGIE 3M6AA 4WURA 3GPPA 4RNAA 4NSRA 1IBLM 1G3IA 3L27A 4IIWA 4FWDA 3CF2A 3I51A 1SXJD 1ZAEA 3NWLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GPU A;  1Z5B A;  1J5E M;  4LF5 M;  4NRV A;  3T1H M;  5ITY A;  4JI5 M;  1XNQ M;  4OX9 M;  3J80 S;  4B3T M;  1FJG M;  2UUC M;  4G4R A;  1XMQ M;  1IBM M;  4PDI A;  3OTO M;  4PDG A;  3W0F A;  4DUZ M;  2OQ4 A;  4X62 M;  2ZM6 M;  4LF4 M;  2OPF A;  5A2Q S;  1I94 M;  1HNW M;  3A42 A;  3GQ4 A;  1PJJ A;  2E5L M;  2UXD M;  4LFC M;  3SAS A;  1K3W A;  3GPY A;  4DUY M;  4DV1 M;  4DR5 M;  1PJI A;  4DR7 M;  1HR0 M;  3T1Y M;  4JV5 M;  1L2B A;  2VQF M;  3SAT A;  4LF6 M;  2HKJ A;  2EA0 A;  3GPX A;  1K82 A;  5ITU A;  3SAV A;  1Z5A A;  2VQE M;  4LF9 M;  4NXM M;  1Q39 A;  3J7A S;  4YY3 M;  4JI6 M;  3U6M A;  4JI2 M;  4NRW A;  4X65 M;  4G4Q A;  3VK7 A;  2UUB M;  2F5P A;  5ITX A;  1TDH A;  3JR5 A;  4LFB M;  1Q3C A;  3A45 A;  3A46 A;  4K0K M;  1R2Y A;  5LMN M;  1N36 M;  4JI1 M;  4DV6 M;  4B3M M;  4DV3 M;  1XNR M;  4JI7 M;  4DR6 M;  1N32 M;  3JAM S;  1NNJ A;  1N34 M;  4G4N A;  4DV4 M;  1L2C A;  1TDZ A;  1IBK M;  1L2D A;  3GQ5 A;  1R2Z A;  3SAU A;  4JI3 M;  3U6C A;  1K3X A;  2F4V M;  2F5Q A;  4NXN M;  4DV2 M;  5ITR A;  2F5N A;  1MX0 A;  3JR4 A;  4JYA M;  5IT9 S;  4JI4 M;  4DR3 M;  2XZU A;  3U6Q A;  4GKJ M;  4AQY M;  3VK8 A;  5BR8 M;  4DR2 M;  3TWM A;  4YHH M;  4LFA M;  1Z59 A;  4DV7 M;  3SAR A;  5LMU M;  3TWK A;  1MU5 A;  2F5O A;  4GKK M;  4LF7 M;  4CIS A;  1Z5C A;  1XMO M;  4B3R M;  3SBJ A;  1EE8 A;  1L1T A;  4LF8 M;  3GQ3 A;  4B3S M;  3DOA A;  3J81 S;  4PD2 A;  3U6D A;  5ITT A;  1PM5 A;  2Q2E B;  3SAW A;  5FLX S;  4DR4 M;  3U6L A;  4JI8 M;  1HNX M;  5IWA M;  3U6S A;  1HNZ M;  3GP1 A;  2ZBK B;  2UXB M;  4X66 M;  3U6O A;  5ITQ A;  3TWL A;  3C58 A;  2HHH M;  5ITX E;  4DR1 M;  2XZF A;  1KFV A;  3U6P A;  1XC8 A;  2UXC M;  1N33 M;  3GO8 A;  4DV0 M;  4X64 M;  2F5S A;  2UUA M;  4KHP M;  1L1Z A;  4MB7 A;  4DV5 M;  4G4O A;  3GPP A;  4ITQ A;  1IBL M;  2UU9 M;  4JI0 M;  4PCZ A;  3U6E A;  1Q3B A; 
#chains in the Genus database with same CATH topology
 3GPU A;  1Z5B A;  4JN6 A;  1SXJ B;  2X8A A;  3T1H M;  1GAB A;  4JI5 M;  2KNV A;  5FTM A;  1XNQ M;  1YUB A;  3U61 A;  2YQZ A;  3J80 S;  3UK6 A;  4GMQ A;  2JP7 A;  2J7O A;  4QNR A;  3PNV A;  4FCV A;  5IZ7 D;  3W0F A;  3C3D A;  4UN2 B;  2AHM A;  2C98 A;  2ZM6 M;  4LG2 A;  5A2Q S;  4IJE A;  2FS1 A;  3MHV C;  3VDP A;  3A42 A;  2QBY B;  3PXG A;  4CJ6 A;  2KNA A;  4L15 A;  1N75 A;  3M7G A;  3FYD A;  1GVN A;  1IM2 A;  1ORY B;  4I8O A;  3U60 B;  3T1Y M;  4RF1 A;  4JV5 M;  3SAT A;  2DAI A;  4LF6 M;  2HKJ A;  1E9S A;  5FTN A;  3RFW A;  1K82 A;  3FTD A;  4Z6Y A;  5EXX A;  1GKI A;  5KO3 A;  1Z5A A;  4LF9 M;  3FRH A;  4KT0 F;  3KSJ A;  1V34 A;  3J7A S;  4P16 A;  4FCT A;  4Y28 F;  3HJS A;  4JI2 M;  4QOS A;  2V1C A;  5IRE B;  3GLG E;  2LVN C;  2KEB A;  4OU7 A;  2DZN B;  2O01 F;  2UUB M;  3W0L B;  2XSZ D;  2ZAO A;  3RGP A;  1Q3C A;  1OAI A;  3A45 A;  3LQQ A;  4K0K M;  2APL A;  4F2L A;  5LMN M;  4JI1 M;  3R9X B;  2LTU A;  3K8Z A;  5EXP A;  4DV3 M;  2QHO B;  1JR3 A;  2CP8 A;  3NBX X;  2LWX A;  1YLA A;  1ZMW A;  1L2C A;  1TDZ A;  1R5L A;  1QUT A;  2ZAM A;  4HLQ A;  1TH2 A;  5KPZ A;  2FOI C;  2GNO A;  1MJG M;  3U6C A;  1K3X A;  1QDR A;  3QWL A;  2VII A;  1TF0 B;  2N35 A;  3AOE A;  2C9C A;  3THG A;  3ZCB B;  5GKN A;  3HY5 A;  4OVZ B;  4D82 A;  1QZE A;  1HQY E;  2XZU A;  2EKK A;  3L2A A;  2Z3X A;  3U6Q A;  1C7Y A;  2KXE A;  3KP0 E;  3VK8 A;  2M5Z A;  1VG5 A;  3HKP A;  1IQP A;  4YHH M;  2CEA A;  2Y0Q A;  3FTE A;  1NY6 A;  3J7B A;  4KOD A;  3E4R A;  5KPT A;  4JXJ A;  4ANR A;  3CGW A;  3SFZ A;  2EJS A;  2WSC F;  2DZL A;  3SAR A;  3TWK A;  4GHL A;  4LF7 M;  2JZ0 A;  4CIS A;  3HGI A;  4B3R M;  1G4A E;  2OOB A;  1CUK A;  2RGH A;  1PJQ A;  1XXH E;  2DNA A;  5EQT A;  2VF8 A;  5E26 A;  4B3S M;  4LF8 M;  1IN8 A;  2YR0 A;  3E9S A;  3HU2 A;  2Q2E B;  3GLG A;  3K9P A;  4AKH A;  2HCB A;  4LZZ A;  4DR4 M;  4IBD A;  3RGS A;  5IWA M;  3HU3 A;  1IXS B;  2V6Z M;  2BWB A;  4QOZ C;  2GQF A;  1VDL A;  1TTE A;  4FW9 A;  3TWL A;  3L26 A;  3FTF A;  3B74 A;  5KQD A;  5EXT A;  1OTR A;  4G6Z A;  3WHK A;  1XC8 A;  3BOS A;  3L25 A;  2UXC M;  1N33 M;  2KA6 B;  2R45 A;  1OQY A;  3I4V A;  3D8L A;  1OIZ A;  3TPZ A;  2I7P A;  3FUW A;  2BJW A;  4IBF A;  1NJF A;  4XGI A;  5EXS A;  4JI0 M;  3H4J A;  2DEN A;  3GLI E;  1QYR A;  1IN4 A;  1NJG A;  3FTC A;  1IXR C;  2EKF A;  3AKZ A;  3HJQ A;  2CV1 A;  3KS8 A;  3GLF E;  1J5E M;  2L6O A;  4NRV A;  2MRO B;  4OX9 M;  1FJG M;  3ZC7 B;  1XMQ M;  2C96 A;  4AG5 A;  3VKG A;  3SHF A;  3T38 A;  3OTO M;  4R3D A;  4L8R C;  1QUS A;  1RU3 A;  1NNU C;  2P5T A;  3SMS A;  1WHC A;  5L8R F;  4LCB A;  4LF4 M;  3GRR A;  2OPF A;  3PNY A;  4B7F A;  2LHG A;  2ZAN A;  3HX3 A;  4CHT B;  1PJJ A;  2UXD M;  1SXJ C;  1HT2 E;  1NHG C;  1QQW A;  4LJ4 A;  1IXZ A;  1QAN A;  3AFH A;  3GPY A;  4DUY M;  4LFC M;  4BLC A;  1S3S A;  4GIT A;  1ZQ9 A;  1FNN A;  3KOY E;  1HR0 M;  2CV0 A;  1JR3 D;  3IEC A;  1XXH A;  2G3Q A;  4LJA A;  1NY5 A;  2HWJ A;  4LRS A;  1L2B A;  1P3Q Q;  2DAE A;  4MGZ E;  2EA0 A;  3CTW B;  5ITU A;  4P17 A;  3AOE C;  3SAV A;  4NXM M;  2CHQ A;  2G8L A;  4L16 A;  4IBE A;  4I5S A;  2CFO A;  2WSE F;  3MJ5 A;  3KOX E;  4NRW A;  2NQ8 C;  2K47 A;  4R7G A;  4G4Q A;  3VK7 A;  4QHS A;  3JR5 A;  5F3W A;  5FTJ A;  5C18 A;  4HL4 A;  2C5R A;  2DWN A;  3A46 A;  5BPV A;  1OKS A;  2R62 A;  4RF0 A;  2L7I A;  2EUC A;  5JI3 E;  2RRU A;  4B3M M;  3ILK A;  1XNR M;  2JY6 B;  4NSO B;  5EP2 A;  4II7 A;  4JI7 M;  4DR6 M;  1GO5 A;  2X49 A;  1NNJ A;  1EFU B;  2L09 A;  1WXQ A;  1R2Z A;  3KSX A;  1OIP A;  4NOO B;  3GLF A;  4LZJ A;  1JB0 F;  4W5W A;  4MGH A;  4NC6 A;  2RKO A;  2VF7 A;  2LHC A;  2Z4S A;  3K9O A;  4OW0 A;  2F4V M;  3GLH B;  2K0B X;  3B7Q A;  3KP1 E;  2JY8 A;  3SYL A;  4DV2 M;  2F5N A;  1ZV1 A;  3GRV A;  2QPA A;  2LVP C;  2VDB B;  2QEN A;  2ERC A;  4DR3 M;  3SMP A;  3J27 B;  2HAK A;  4GHA A;  4PT5 A;  4GKJ M;  5BR8 M;  3ZH9 B;  1T3T A;  2KDL A;  1GL7 A;  1DGH A;  1XWI A;  3FKE A;  4IJF A;  3UGJ A;  1DGG A;  2OO9 A;  4DV7 M;  2DXI A;  2X4A A;  1NHW C;  1YE9 A;  2MH8 A;  2CV2 A;  3C9P A;  3MMP A;  3QYE A;  3H4M A;  2FE8 A;  1WGN A;  2MJ5 B;  1L1T A;  2R6F A;  2KHH A;  4MH0 E;  4KO8 A;  3HZJ A;  3VLF B;  5FTL A;  3UZU A;  3U6D A;  4GEW A;  3TL4 X;  4M9Z A;  3SAW A;  4KLN A;  2J5Y A;  1DGF A;  3SYK A;  3AV0 A;  2L7H A;  4G3O A;  3LQR A;  1MN3 A;  3GP1 A;  3EIH A;  4X66 M;  1Q02 A;  2I7N A;  5FTK A;  3U5Z A;  2HHH M;  2JY7 A;  1KYI A;  4L78 A;  4XBO A;  5ITX E;  1ZMU A;  5DYI A;  1KFV A;  2XH9 A;  3IG8 A;  4GRI A;  1NVM A;  2L4F A;  4M0W A;  1GJS A;  1GLN A;  3L29 A;  3QAU A;  2UUA M;  3K1J A;  2FNA A;  3KOW E;  4Z8X A;  3M0E A;  4MB7 A;  3PFI A;  2DI0 A;  4BBA A;  1VEJ A;  4ITQ A;  1IN5 A;  2CE7 A;  4PCZ A;  2L4E A;  1GJT A;  2KNZ A;  3KXE C;  1OFH A;  4LJ9 A;  4TUW A;  1V92 A;  3KW6 A;  4FD2 A;  1HQC A;  4LF5 M;  3KS4 A;  1G8P A;  1OAO C;  3LCV B;  4LJ7 A;  4PDI A;  2QBY A;  1QAM A;  5FSW A;  2YFQ A;  3DZD A;  3U61 B;  4R71 A;  4X62 M;  5H37 D;  5DFL A;  4B7H A;  3J2P B;  4GIP A;  4CIZ A;  2Z7J A;  1I94 M;  1HNW M;  1C1K A;  3HWS A;  3GQ4 A;  3BBZ A;  1G59 A;  2QSF X;  3KFU G;  2JUJ A;  1LV7 A;  1GL6 A;  4DR5 M;  5EP1 A;  2JY5 A;  1PJI A;  2DAM A;  1E32 A;  2DWM A;  4RKU F;  2CUZ A;  4S12 A;  4AZF A;  1IY1 A;  3GPX A;  1V33 A;  2V1U A;  4IBG A;  2VQE M;  2CWB A;  3AL0 C;  3SHG B;  1SG9 A;  5EP3 A;  2H1R A;  3FUV A;  4LRT A;  4QHT A;  5DNY A;  2QNJ A;  2R46 A;  4I81 A;  2LXE A;  4X65 M;  2Z4R A;  4AI6 A;  5ITX A;  4LGY A;  1TDH A;  4LY6 A;  1IN7 A;  3A98 B;  2KZU A;  3CF6 E;  2LVQ D;  5KPR A;  1G71 A;  4IBK A;  4DV6 M;  3B7N A;  1H6U A;  1KSF X;  4IBJ A;  5E6J A;  2JXN A;  1N32 M;  3JAM S;  1TH4 A;  1DO2 A;  1ZMV A;  3VFD A;  1N34 M;  4G4N A;  2XFT A;  4IBC A;  4XK8 F;  2BNK A;  3T6P A;  4LJ5 A;  1A5T A;  1IBK M;  4AKG A;  1J09 A;  3AJI B;  2FH0 A;  4JI3 M;  2JNH A;  2O5R A;  2D7E A;  3DFZ A;  4LJ6 A;  1HJP A;  2F5Q A;  4FWH A;  4NXN M;  2R18 A;  4FVM A;  5ITR A;  3DA1 A;  2MR9 A;  3KVW A;  3PVS A;  3JR4 A;  4L6V 6;  4JI4 M;  1X37 A;  2KRU A;  1YSY A;  5EJC A;  5KQ8 A;  1OFI A;  3NBI A;  3BXW A;  3TWM A;  1BVS A;  4AKI A;  1DGB A;  1OJL A;  3HU1 A;  1J7K A;  1VEK A;  1EIJ A;  2DWZ B;  4LJ8 A;  5JI2 E;  3B9P A;  3TQS A;  2F5O A;  3Q8G A;  3LVV A;  3GLI A;  2XGN A;  1IY2 A;  1XMO M;  3SBJ A;  1EE8 A;  4B08 A;  1QZM A;  1SXJ E;  2BJV A;  1PJS A;  2JZ1 A;  3DOA A;  3QYB A;  3J81 S;  2FFJ A;  2XFS A;  5ITT A;  1IXS A;  2K9D A;  1WIV A;  5FLX S;  1G41 A;  2R44 A;  4GH9 A;  2OOA A;  3U6L A;  1WGL A;  2XLJ A;  1HNX M;  1E9R A;  1TGU A;  4JI8 M;  3U6S A;  2C9O A;  1HNZ M;  3W68 A;  3LVW A;  2UXB M;  2QP9 X;  3SC3 A;  2DVW B;  4NL4 H;  5ITQ A;  3D8B A;  3GLG B;  4ZPX A;  2XZF A;  3F92 A;  2LH0 A;  3U6P A;  4A3V B;  1E94 E;  4B7G A;  2DWL A;  3LMM A;  2R65 A;  3Q8X A;  4REZ A;  3GRU A;  3RE8 A;  4X64 M;  1R6B X;  2F5S A;  1L1Z A;  4DV5 M;  4G4O A;  2UU9 M;  3U6E A;  1PRB A;  1PGY A;  3LW5 F;  4M9S A;  3GRY A;  1Q3B A;  3FRI A;  3GLH E;  1LTM A;  2YNM D;  4MGK E;  4CGY B;  1AUA A;  4HEO A;  4EIW A;  4F1I A;  5ITY A;  1QVR A;  2C99 A;  3T15 A;  4BB9 A;  1VQ1 A;  1DV0 A;  1QDT A;  4B3T M;  2QQ8 A;  2CRU A;  3KDS E;  3L28 A;  2UUC M;  1WJ7 A;  4G4R A;  1IBM M;  1R4G A;  2XEP A;  8CAT A;  3LCU A;  4PDG A;  2M60 A;  4AG6 A;  2KZS A;  4DUZ M;  2OQ4 A;  1QAQ A;  2Y0T A;  3VDU A;  2EO2 A;  3I04 M;  3FE3 A;  4L4U A;  1D0M A;  2E5L M;  3FUU A;  3FUX A;  3B89 A;  3SAS A;  1K3W A;  2QZ4 A;  4DV1 M;  3K92 A;  4DR7 M;  2DKL A;  1F4I A;  2KW0 A;  5EP4 A;  4QNM A;  4AW4 A;  1SXJ A;  2J7N A;  1IN6 A;  2VQF M;  5DYG A;  2ZTD A;  1NV8 A;  4IBB A;  4Q7J A;  1AIP C;  3E21 A;  1Q39 A;  1XXH B;  2G5G X;  3AOG A;  4YY3 M;  4JI6 M;  3U6M A;  1Z6T A;  2WSF F;  3FD9 A;  1NO1 A;  4GC9 A;  3K2L A;  3TE6 A;  2ZTC A;  1L8Q A;  2F5P A;  4LGM A;  1D0L A;  2R4E A;  3B7Z A;  4LFB M;  2DAG A;  2Z8Y M;  1R2Y A;  1HT1 E;  1VDD A;  1N36 M;  1NV9 A;  2LNH C;  3CF0 A;  3HHW A;  2Y20 A;  3U60 A;  2L2D A;  4I4L A;  2D7H A;  2A5Y B;  2DZO B;  4D80 A;  3ZQJ A;  1UM8 A;  3E46 A;  4DV4 M;  3EIE A;  3HHZ A;  1IY0 A;  2DHY A;  2JWS A;  1W5T A;  3GLH A;  3GQ5 A;  1L2D A;  4MGY E;  3SAU A;  1NSF A;  2MGW A;  5C1B A;  2O25 A;  2CHG A;  2DHR A;  3GLI B;  1T43 A;  2XF3 A;  3VKH A;  4MM3 B;  2LBC A;  3W67 A;  3I01 M;  3GLF B;  5IT9 S;  2K6B A;  1MX0 A;  3HHY A;  4JYA M;  1N78 A;  2HL7 A;  2XSZ A;  3HJ8 A;  4WP2 A;  4FCW A;  3IHP A;  1IFY A;  1TR8 A;  4AQY M;  3R8F A;  3WHL A;  4DR2 M;  2LVA A;  1JQJ C;  2Y21 A;  3I4Y A;  1QAO A;  1TH3 A;  2JA2 A;  2LVO C;  2R4J A;  1Z59 A;  4LFA M;  1XHB A;  2B3T A;  4M9X A;  1T6O A;  5LMU M;  1MU5 A;  4GKK M;  2D7G A;  1D0K A;  1DGH B;  1PJT A;  1Z5C A;  3MK6 A;  3HHX A;  1D2N A;  2RGO A;  7CAT A;  3GQ3 A;  3FYC A;  4GC5 A;  4PD2 A;  4OVZ A;  3FUT A;  1PM5 A;  1R7R A;  4IBI A;  2QCU A;  1WR1 B;  1I4W A;  4FWG A;  1XB2 B;  2R0I A;  3IG5 A;  2CHV A;  2ZBK B;  3V76 A;  3C3E A;  2KRK A;  2DAK A;  3U6O A;  3C58 A;  1DO0 A;  4WW0 A;  4DR1 M;  3KOZ E;  1W5S A;  4M0D A;  3GO8 A;  3UJN A;  2H5X A;  3U5Z B;  4DV0 M;  4D81 A;  1N77 A;  4DBG B;  3UMM A;  4KHP M;  2W82 A;  4MGI E;  3M6A A;  4WUR A;  1UFZ A;  3GPP A;  2BWE A;  1VEG A;  2WZJ A;  1JR3 E;  4NSR A;  1G3I A;  4RNA A;  1Y8G A;  3L27 A;  1IBL M;  4IIW A;  4FWD A;  3CF2 A;  3I51 A;  1SXJ D;  1ZAE A;  3NWL A; 
#chains in the Genus database with same CATH homology
 3GPU A;  1Z5B A;  4JN6 A;  1SXJ B;  2X8A A;  3T1H M;  4JI5 M;  5FTM A;  1XNQ M;  1YUB A;  3U61 A;  2YQZ A;  3J80 S;  3UK6 A;  4GMQ A;  2J7O A;  4QNR A;  3PNV A;  4FCV A;  5IZ7 D;  3W0F A;  2AHM A;  2C98 A;  2ZM6 M;  4LG2 A;  5A2Q S;  4IJE A;  3MHV C;  3VDP A;  3A42 A;  2QBY B;  3PXG A;  4L15 A;  1N75 A;  3M7G A;  3FYD A;  1GVN A;  1IM2 A;  1ORY B;  4I8O A;  3U60 B;  3T1Y M;  4RF1 A;  4JV5 M;  3SAT A;  4LF6 M;  2HKJ A;  1E9S A;  5FTN A;  3RFW A;  1K82 A;  3FTD A;  4Z6Y A;  5EXX A;  1GKI A;  5KO3 A;  1Z5A A;  4LF9 M;  3KSJ A;  3J7A S;  4P16 A;  4FCT A;  3HJS A;  4JI2 M;  4QOS A;  2V1C A;  5IRE B;  2KEB A;  4OU7 A;  2DZN B;  2UUB M;  3W0L B;  2XSZ D;  2ZAO A;  3RGP A;  1Q3C A;  3A45 A;  3LQQ A;  4K0K M;  5LMN M;  4JI1 M;  3R9X B;  3K8Z A;  5EXP A;  4DV3 M;  1JR3 A;  2LWX A;  1L2C A;  1TDZ A;  2ZAM A;  4HLQ A;  1TH2 A;  5KPZ A;  2FOI C;  3U6C A;  1K3X A;  3QWL A;  2VII A;  3AOE A;  2C9C A;  3THG A;  3ZCB B;  5GKN A;  4D82 A;  4OVZ B;  1HQY E;  2XZU A;  3L2A A;  2Z3X A;  3U6Q A;  2KXE A;  3KP0 E;  3VK8 A;  2M5Z A;  3HKP A;  1IQP A;  4YHH M;  2Y0Q A;  2CEA A;  3FTE A;  3J7B A;  1NY6 A;  4KOD A;  3E4R A;  5KPT A;  4JXJ A;  3SFZ A;  3SAR A;  3TWK A;  4GHL A;  4LF7 M;  4CIS A;  3HGI A;  4B3R M;  1G4A E;  4LF8 M;  2RGH A;  5EQT A;  4B3S M;  5E26 A;  1IN8 A;  2YR0 A;  3E9S A;  3HU2 A;  2Q2E B;  3GLG A;  4AKH A;  2HCB A;  4LZZ A;  4DR4 M;  4IBD A;  3RGS A;  5IWA M;  3HU3 A;  1IXS B;  2V6Z M;  4QOZ C;  4FW9 A;  3TWL A;  3L26 A;  3FTF A;  5KQD A;  5EXT A;  4G6Z A;  3WHK A;  1XC8 A;  3BOS A;  3L25 A;  2UXC M;  1N33 M;  2KA6 B;  2R45 A;  3I4V A;  3D8L A;  3TPZ A;  2I7P A;  3FUW A;  2BJW A;  4IBF A;  1NJF A;  4XGI A;  5EXS A;  4JI0 M;  1QYR A;  1IN4 A;  1NJG A;  3FTC A;  1IXR C;  3KS8 A;  3AKZ A;  3HJQ A;  2CV1 A;  1J5E M;  2L6O A;  4NRV A;  4OX9 M;  1FJG M;  3ZC7 B;  1XMQ M;  2C96 A;  4AG5 A;  3VKG A;  3SHF A;  3T38 A;  3OTO M;  4R3D A;  4L8R C;  2P5T A;  1NNU C;  3SMS A;  4LCB A;  4LF4 M;  3GRR A;  2OPF A;  3PNY A;  4B7F A;  2ZAN A;  4CHT B;  1PJJ A;  2UXD M;  1SXJ C;  1HT2 E;  1NHG C;  1QQW A;  4LJ4 A;  1QAN A;  1IXZ A;  3AFH A;  3GPY A;  4DUY M;  4LFC M;  4BLC A;  1S3S A;  4GIT A;  1ZQ9 A;  1FNN A;  3KOY E;  1HR0 M;  2CV0 A;  1JR3 D;  1XXH A;  4LJA A;  1NY5 A;  1L2B A;  4LRS A;  2EA0 A;  4MGZ E;  3CTW B;  5ITU A;  3AOE C;  3SAV A;  4NXM M;  2CHQ A;  2G8L A;  4L16 A;  4IBE A;  4I5S A;  2CFO A;  3MJ5 A;  3KOX E;  4NRW A;  2NQ8 C;  2K47 A;  4R7G A;  4G4Q A;  3VK7 A;  4QHS A;  3JR5 A;  5F3W A;  5FTJ A;  5C18 A;  4HL4 A;  2C5R A;  2DWN A;  3A46 A;  5BPV A;  2R62 A;  4RF0 A;  2L7I A;  2EUC A;  5JI3 E;  4B3M M;  3ILK A;  1XNR M;  4NSO B;  5EP2 A;  4II7 A;  4JI7 M;  4DR6 M;  2X49 A;  1NNJ A;  2L09 A;  1WXQ A;  1R2Z A;  3KSX A;  3GLF A;  4NOO B;  4LZJ A;  4W5W A;  4MGH A;  2RKO A;  2Z4S A;  4OW0 A;  2F4V M;  3GLH B;  3KP1 E;  4DV2 M;  3SYL A;  2F5N A;  3GRV A;  2QPA A;  2QEN A;  2ERC A;  4DR3 M;  3SMP A;  3J27 B;  4GHA A;  4PT5 A;  4GKJ M;  5BR8 M;  3ZH9 B;  1T3T A;  1XWI A;  1GL7 A;  1DGH A;  4IJF A;  3FKE A;  3UGJ A;  1DGG A;  4DV7 M;  2DXI A;  2X4A A;  1NHW C;  1YE9 A;  2CV2 A;  3H4M A;  2FE8 A;  1L1T A;  4MH0 E;  4KO8 A;  3VLF B;  5FTL A;  3UZU A;  3U6D A;  3TL4 X;  4M9Z A;  3SAW A;  4KLN A;  1DGF A;  3SYK A;  3AV0 A;  2L7H A;  3LQR A;  3GP1 A;  3EIH A;  4X66 M;  2I7N A;  5FTK A;  3U5Z A;  2HHH M;  1KYI A;  4L78 A;  4XBO A;  5ITX E;  5DYI A;  1KFV A;  2XH9 A;  3IG8 A;  4GRI A;  1NVM A;  4M0W A;  1GLN A;  3L29 A;  3QAU A;  2UUA M;  3K1J A;  2FNA A;  3KOW E;  4Z8X A;  3M0E A;  4MB7 A;  3PFI A;  4BBA A;  4ITQ A;  1IN5 A;  2CE7 A;  4PCZ A;  3KXE C;  1OFH A;  4LJ9 A;  4TUW A;  3KW6 A;  4FD2 A;  1HQC A;  4LF5 M;  3KS4 A;  1G8P A;  4LJ7 A;  4PDI A;  2QBY A;  1QAM A;  5FSW A;  2YFQ A;  3DZD A;  3U61 B;  4X62 M;  5H37 D;  4B7H A;  3J2P B;  4GIP A;  1I94 M;  2Z7J A;  1HNW M;  1C1K A;  3HWS A;  3GQ4 A;  1G59 A;  3KFU G;  1LV7 A;  1GL6 A;  4DR5 M;  5EP1 A;  1PJI A;  1E32 A;  2DWM A;  2CUZ A;  4S12 A;  4AZF A;  1IY1 A;  3GPX A;  2V1U A;  4IBG A;  2VQE M;  3AL0 C;  3SHG B;  5EP3 A;  2H1R A;  3FUV A;  4LRT A;  4QHT A;  5DNY A;  2R46 A;  4I81 A;  2LXE A;  4X65 M;  2Z4R A;  4AI6 A;  5ITX A;  4LGY A;  1TDH A;  4LY6 A;  1IN7 A;  3A98 B;  2KZU A;  3CF6 E;  5KPR A;  4IBK A;  4DV6 M;  1H6U A;  1KSF X;  4IBJ A;  5E6J A;  1N32 M;  3JAM S;  1TH4 A;  1DO2 A;  3VFD A;  1N34 M;  4G4N A;  2XFT A;  4IBC A;  2BNK A;  4LJ5 A;  1IBK M;  4AKG A;  1J09 A;  3AJI B;  4JI3 M;  2O5R A;  2D7E A;  3DFZ A;  4LJ6 A;  2F5Q A;  4FWH A;  4NXN M;  2R18 A;  4FVM A;  5ITR A;  3DA1 A;  3KVW A;  3PVS A;  3JR4 A;  4JI4 M;  1X37 A;  2KRU A;  1YSY A;  5EJC A;  5KQ8 A;  1OFI A;  3NBI A;  3TWM A;  4AKI A;  1DGB A;  1OJL A;  3HU1 A;  1J7K A;  2DWZ B;  4LJ8 A;  5JI2 E;  3B9P A;  3TQS A;  2F5O A;  3LVV A;  3GLI A;  2XGN A;  1IY2 A;  1XMO M;  3SBJ A;  1EE8 A;  4B08 A;  1QZM A;  1SXJ E;  2BJV A;  3DOA A;  3J81 S;  2FFJ A;  2XFS A;  5ITT A;  5FLX S;  1G41 A;  4GH9 A;  3U6L A;  2XLJ A;  1HNX M;  1E9R A;  1TGU A;  4JI8 M;  3U6S A;  2C9O A;  1HNZ M;  2UXB M;  3LVW A;  2QP9 X;  3SC3 A;  2DVW B;  4NL4 H;  5ITQ A;  3D8B A;  3GLG B;  4ZPX A;  2XZF A;  2LH0 A;  3U6P A;  4A3V B;  1E94 E;  4B7G A;  2DWL A;  3LMM A;  2R65 A;  3Q8X A;  4REZ A;  3GRU A;  3RE8 A;  4X64 M;  1R6B X;  2F5S A;  1L1Z A;  4DV5 M;  4G4O A;  2UU9 M;  3U6E A;  4M9S A;  3GRY A;  1Q3B A;  4MGK E;  2YNM D;  4CGY B;  4EIW A;  5ITY A;  1QVR A;  2C99 A;  3T15 A;  4BB9 A;  4B3T M;  3L28 A;  3KDS E;  2UUC M;  4G4R A;  1IBM M;  2XEP A;  8CAT A;  4PDG A;  2M60 A;  4AG6 A;  2KZS A;  4DUZ M;  2OQ4 A;  1QAQ A;  2Y0T A;  3VDU A;  2EO2 A;  4L4U A;  2E5L M;  3FUU A;  3FUX A;  3SAS A;  1K3W A;  2QZ4 A;  4DV1 M;  3K92 A;  4DR7 M;  2KW0 A;  5EP4 A;  4QNM A;  4AW4 A;  1SXJ A;  2J7N A;  1IN6 A;  2VQF M;  5DYG A;  4IBB A;  1Q39 A;  1XXH B;  2G5G X;  3AOG A;  4YY3 M;  4JI6 M;  3U6M A;  1Z6T A;  3FD9 A;  4GC9 A;  3K2L A;  3TE6 A;  1L8Q A;  2F5P A;  4LGM A;  2R4E A;  4LFB M;  1R2Y A;  1HT1 E;  1VDD A;  1N36 M;  3CF0 A;  2LNH C;  3HHW A;  2Y20 A;  3U60 A;  4I4L A;  2D7H A;  2A5Y B;  2DZO B;  4D80 A;  1UM8 A;  4DV4 M;  3EIE A;  3HHZ A;  1IY0 A;  3GLH A;  1L2D A;  1W5T A;  3GQ5 A;  4MGY E;  3SAU A;  1NSF A;  5C1B A;  2CHG A;  2DHR A;  3GLI B;  2XF3 A;  3VKH A;  4MM3 B;  3GLF B;  5IT9 S;  1MX0 A;  3HHY A;  4JYA M;  1N78 A;  2HL7 A;  2XSZ A;  3HJ8 A;  4FCW A;  4AQY M;  3R8F A;  3WHL A;  4DR2 M;  1JQJ C;  2Y21 A;  3I4Y A;  1QAO A;  1TH3 A;  2JA2 A;  2R4J A;  4LFA M;  1Z59 A;  1XHB A;  4M9X A;  5LMU M;  1MU5 A;  4GKK M;  2D7G A;  1Z5C A;  1DGH B;  3MK6 A;  3HHX A;  1D2N A;  2RGO A;  7CAT A;  3GQ3 A;  3FYC A;  4GC5 A;  4PD2 A;  4OVZ A;  3FUT A;  1PM5 A;  1R7R A;  4IBI A;  2QCU A;  1I4W A;  4FWG A;  3IG5 A;  2CHV A;  2ZBK B;  2KRK A;  3U6O A;  3C58 A;  1DO0 A;  4WW0 A;  4DR1 M;  3KOZ E;  1W5S A;  4M0D A;  3GO8 A;  3UJN A;  3U5Z B;  4DV0 M;  4D81 A;  1N77 A;  3UMM A;  4KHP M;  2W82 A;  4MGI E;  3M6A A;  4WUR A;  3GPP A;  4RNA A;  4NSR A;  1IBL M;  1G3I A;  3L27 A;  4IIW A;  4FWD A;  3CF2 A;  3I51 A;  1SXJ D;  1ZAE A;  3NWL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...