2VQFM

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
125
structure length
125
Chain Sequence
ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEAEVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQRTRTNARTRKGPRKTVAGKKKAPRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 33
structure length 125
sequence length 125
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
M PF00416 Ribosomal_S13 Ribosomal protein S13/S18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.50 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 2vqfM01
4.10.910.10 Few Secondary Structures Irregular 30s ribosomal protein s13; domain 2 30s ribosomal protein s13, domain 2 2vqfM02
1L1TA 3OTOM 4NRVA 1L2DA 3C58A 4PDIA 2F5SA 3U6SA 1PJIA 3J7AS 4PDGA 2OPFA 4DV4M 1XMQM 3U6EA 4LF6M 3VK7A 4DV3M 4KHPM 4G4RA 4DR5M 4DV5M 2UUCM 5IWAM 4GKKM 3JAMS 5ITXA 4LF9M 5LMNM 4YHHM 4DR4M 5ITTA 4YY3M 3TWLA 3A46A 1N34M 4LFCM 1L2CA 3GPUA 2XZUA 2UUAM 2OQ4A 4DV2M 3SAVA 3U6MA 3JR5A 3T1HM 3SARA 4LFAM 5BR8M 4JI0M 2ZM6M 3GPXA 3T1YM 1IBKM 4OX9M 3SASA 3A45A 4LF8M 1R2ZA 5FLXS 1EE8A 4G4OA 4B3MM 2EA0A 4DR1M 1J5EM 4ITQA 1PJJA 4G4NA 4LFBM 2F5QA 1N36M 1HNWM 3JR4A 2Q2EB 4DR7M 1TDZA 1MX0A 2F5PA 2VQFM 3DOAA 4JI1M 4GKJM 1N33M 1IBLM 4JI2M 4X62M 4X66M 4NRWA 4PCZA 4JI6M 3VK8A 2F5OA 4LF5M 4NXNM 4K0KM 3U6LA 1NNJA 1XNQM 4DUZM 4DV1M 4DR2M 3U6DA 5IT9S 4LF7M 1K3XA 3U6PA 3SAUA 3GQ4A 4PD2A 3GQ5A 1R2YA 1Z59A 5A2QS 5ITXE 5ITRA 1MU5A 4CISA 4JI3M 4JI7M 2ZBKB 1XMOM 4JYAM 1N32M 2UXDM 4B3RM 1XC8A 4LF4M 4DR6M 3SAWA 1HNXM 4X64M 3J81S 4DUYM 1L1ZA 4JV5M 1Q39A 4JI8M 2XZFA 1TDHA 5ITYA 4AQYM 1Z5BA 1K3WA 1HR0M 1Z5CA 2UXBM 4B3TM 3GO8A 3GPPA 2UXCM 3GPYA 2UU9M 3J80S 3U6CA 1HNZM 4X65M 3U6QA 4NXMM 3SATA 4MB7A 3W0FA 3SBJA 1Q3CA 5ITQA 2HHHM 4DV7M 1K82A 4JI5M 3TWMA 1L2BA 4DR3M 4G4QA 2E5LM 1I94M 1FJGM 1Q3BA 3GP1A 1KFVA 3A42A 1PM5A 5LMUM 4B3SM 4DV6M 1Z5AA 4DV0M 3U6OA 2F4VM 1IBMM 3GQ3A 2VQEM 4JI4M 2F5NA 1XNRM 3TWKA 2UUBM 2HKJA 5ITUA
chains in the Genus database with same CATH superfamily
3RGSA 3OTOM 2CFOA 4NRVA 2VIIA 3U6SA 1OIZA 3KOWE 5C1BA 1QANA 4GITA 4DV4M 2FFJA 1IM2A 4M9ZA 1SXJE 4F1IA 2RGHA 2CV1A 1G71A 4QHSA 1NNUC 1DGHB 1Q02A 1DGGA 1NO1A 1SXJB 3K8ZA 4DR5M 4KHPM 3GRUA 1I4WA 2DENA 2DNAA 1WHCA 1HQCA 2CHVA 4L4UA 4RNAA 4YHHM 1C7YA 3V76A 2R45A 2MROB 4HLQA 2J7NA 4FVMA 1JQJC 2VF8A 3A46A 2OOAA 3HU3A 1L2CA 1PGYA 4B7HA 2ZANA 2I7NA 3U61B 4LJ6A 1AIPC 2DHYA 3JR5A 3SARA 5BR8M 4FCVA 2XEPA 3SASA 2CUZA 3A45A 4LJ7A 2R44A 2KRKA 1EE8A 1R7RA 1QDRA 1QAQA 4G4OA 2K47A 4B3MM 1PJTA 2YQZA 4DR1M 3GRVA 3HJ8A 7CATA 2V1UA 3K92A 2F5QA 4I4LA 2VDBB 3FRHA 3UMMA 4IIWA 1DO2A 2D7GA 1OAIA 2Q2EB 5EXPA 3T38A 1TDZA 2QQ8A 3KDSE 1IY2A 2KZSA 4IBCA 1J09A 3HHWA 4GKJM 2CP8A 2FE8A 4D80A 4JI2M 2LH0A 4X66M 3KSJA 1GL6A 4X62M 4JI6M 1JB0F 1T43A 4AI6A 2C98A 3VDPA 2I7PA 2GNOA 1UM8A 2QNJA 3SFZA 3GLGE 1QYRA 3EIEA 4S12A 3DZDA 4DUZM 1MJGM 3U6DA 3FUVA 3H4JA 1E94E 4LJ8A 2R4EA 1ZMUA 4QHTA 3U6PA 3E9SA 2JY5A 1CUKA 1TR8A 1Z59A 2Z4RA 3KS4A 1JR3D 3PNVA 4GMQA 4IBFA 1G41A 3FUXA 4JN6A 4QOSA 5ITXE 2R0IA 3K9PA 1XMOM 2FH0A 1N32M 4DBGB 3J2PB 4GHAA 1HNXM 1DGFA 5C18A 1L1ZA 3R8FA 1Q39A 2EUCA 3GLIE 1V92A 1XWIA 4IBKA 1HR0M 5EQTA 3ZH9B 4D81A 4B3TM 1NV8A 1DGHA 1TH2A 2X4AA 3E4RA 3HGIA 2R46A 3C9PA 2UU9M 1PJQA 4BLCA 5BPVA 1HNZM 2XGNA 2LHGA 3PFIA 4KT0F 2RRUA 5EJCA 3LQRA 5L8RF 2JZ0A 4M0WA 2Z3XA 1VEGA 3W0FA 1Q3CA 4R71A 5ITQA 3RGPA 3R9XB 3FRIA 3UK6A 3TWMA 1L2BA 5FSWA 1OQYA 1I94M 1N77A 4ZPXA 2Y21A 2ZAMA 1ZMVA 4RF1A 5KO3A 2RKOA 4B3SM 3DFZA 4DV6M 3HY5A 1IBMM 2L2DA 1W5TA 1OFHA 3FE3A 1DGBA 4FCWA 4JI4M 4FWDA 1IXZA 2JNHA 4AKGA 3CF0A 3SMPA 3TWKA 4XK8F 5ITUA 2LVQD 1WR1B 1TTEA 2JY6B 2X8AA 3CF6E 4P17A 1L1TA 1L2DA 1NHWC 2Z8YM 3U60B 4PDIA 5KPRA 1PJIA 3T15A 3J7AS 3KOYE 2OPFA 1HQYE 3AOGA 4GC9A 3VK7A 4UN2B 4DV3M 4G4RA 1ZV1A 4Z8XA 2QP9X 3M6AA 2UUCM 5EP3A 4EIWA 2JXNA 2QHOB 4LF9M 1R5LA 2JWSA 5H37D 1A5TA 2NQ8C 2R62A 2O5RA 4L6V6 1GKIA 3RE8A 2L09A 4YY3M 4IJEA 1P3QQ 4M9SA 1VEKA 1IN8A 1IQPA 3AOEC 4LRTA 3W67A 2P5TA 1NY5A 1SG9A 2L7HA 1VEJA 2DI0A 3U6MA 3T1HM 3B9PA 4LFAM 1R6BX 3HU2A 1F4IA 3K2LA 3GPXA 1IBKM 3BXWA 3M0EA 2HCBA 4JXJA 4LF8M 1AUAA 4BB9A 3LVVA 4A3VB 1GJTA 4Z6YA 4LG2A 4G4NA 4LFBM 2DHRA 1WXQA 5KPZA 4NSOB 1N36M 3K9OA 3FTFA 1HNWM 4HL4A 1IY1A 3KW6A 3THGA 3DOAA 4NOOB 2K6BA 1N33M 3GLGA 1HT1E 3KOZE 3NBXX 4I8OA 1OTRA 3B74A 5EXTA 1GABA 4MGYE 3TQSA 4LF5M 4BBAA 3C3DA 3KFUG 4NXNM 3QWLA 4LJ9A 3U6LA 3FTCA 1NNJA 2Y0QA 1T3TA 4DV1M 2CHGA 3I51A 4DR2M 5IT9S 2M5ZA 4ANRA 3AFHA 3BBZA 3L2AA 3SAUA 3K1JA 5A2QS 2RGOA 5ITRA 2MGWA 2K0BX 4JI3M 2UXDM 4Y28F 4B3RM 3SHFA 1Z6TA 3DA1A 2YFQA 1ZAEA 3C3EA 3VLFB 1GL7A 1HJPA 4F2LA 1JR3A 1HT2E 3KOXE 1MN3A 2DZNB 2Y0TA 1NJFA 4MGHA 1LTMA 2KNVA 2XSZA 4GH9A 5E6JA 1IXRC 2CE7A 2EKFA 2UXBM 4AKHA 2R4JA 1D0LA 3GPPA 3GLHE 3GPYA 1IN6A 2WSEF 4MH0E 4PT5A 4OVZA 1H6UA 3TE6A 1C1KA 3U6QA 2APLA 3FD9A 1YSYA 4GEWA 3SYKA 2BWBA 3SATA 3UZUA 2FOIC 4XGIA 4MB7A 1IN7A 4WURA 3H4MA 3SBJA 4DV7M 1XXHB 1ORYB 2HAKA 4JI5M 1XXHE 2CV2A 2LTUA 5KPTA 2JA2A 1EIJA 1S3SA 2ZAOA 2X49A 1NV9A 2LWXA 4IBEA 4QNRA 3GP1A 2JUJA 3GLFE 3IG5A 1FNNA 3HU1A 3U5ZB 1PM5A 4LJ4A 2BJVA 4OU7A 1TF0B 2V1CA 4DV0M 2F4VM 8CATA 1WJ7A 1OKSA 2MJ5B 4I81A 3FKEA 2DWZB 2VQEM 2BNKA 2F5NA 2Z7JA 1OFIA 5KQ8A 5FTMA 5JI3E 2V6ZM 3KP0E 1VDDA 1R4GA 3SYLA 2KEBA 1D0KA 1D0MA 1NJGA 2KNAA 3MMPA 3NBIA 1J7KA 3D8LA 2DAKA 3GLGB 2F5SA 1QAOA 5FTNA 3AKZA 2HWJA 2M60A 3U6EA 1G8PA 1G59A 4LF6M 1QUTA 4NC6A 5E26A 4DV5M 2A5YB 5IWAM 2KW0A 1QAMA 2JP7A 3HJSA 5EP1A 3JAMS 5ITXA 4GKKM 3UGJA 3PNYA 2JZ1A 2ZTCA 4P16A 4AG6A 5DYGA 4B7GA 1PRBA 2UUAM 1E32A 1G3IA 4L16A 3ZCBB 2OQ4A 4DV2M 1QZEA 2J7OA 2MR9A 3E46A 4MGKE 2LNHC 2LVPC 2G5GX 5GKNA 2YNMD 3SAVA 3AJIB 4LGMA 1NSFA 3T1YM 1R2ZA 4OW0A 5FLXS 2W82A 2CRUA 2L6OA 3I4YA 2EA0A 2C9OA 4LJAA 3WHLA 2QCUA 3AV0A 4L8RC 3LMMA 2F5PA 4QOZC 4JI1M 3J7BA 2DVWB 1GLNA 2LVNC 2R18A 4B7FA 3FYCA 5FTJA 5IREB 3VK8A 2F5OA 3EIHA 4IBDA 4FCTA 4R7GA 2ZTDA 3I01M 1XNQM 2XFSA 2EKKA 2CV0A 1XB2B 4KODA 3CF2A 3QYBA 3VDUA 1SXJA 2L7IA 3NWLA 4PD2A 4GC5A 3GRRA 5EXXA 2C99A 3HJQA 3U60A 1R2YA 1LV7A 3KS8A 2QSFX 2ZBKB 3HHYA 1V34A 2C9CA 1IN5A 4DR6M 1OJLA 3FYDA 4CIZA 3M7GA 2G8LA 3J81S 4DUYM 4AKIA 2H1RA 3U61A 4JV5M 3VFDA 3T6PA 4AZFA 4JI8M 1TDHA 5ITYA 3MK6A 1TGUA 2DAGA 4CHTB 5DNYA 2OO9A 1Z5BA 3L25A 3HX3A 4LY6A 1Z5CA 1ZMWA 1K3WA 4TUWA 3PVSA 3F92A 4HEOA 3GO8A 2UXCM 1QQWA 1IY0A 3IG8A 3ZC7B 4LZJA 1IFYA 2LXEA 1L8QA 3L26A 2KNZA 1DV0A 4G3OA 4I5SA 3GLFA 4NXMM 1EFUB 2QBYA 3KXEC 3FTEA 2HHHM 2LBCA 2OOBA 1WGLA 1GVNA 1V33A 3FUTA 3L27A 5FTKA 2HL7A 3WHKA 1PJSA 4IJFA 2E5LM 1NY6A 1VQ1A 1OAOC 4R3DA 1QZMA 4IBGA 5JI2E 1BVSA 2DAIA 2KXEA 2QZ4A 1OIPA 2YR0A 3VKHA 4MGZE 4IBIA 2CHQA 3HWSA 1E9RA 4NSRA 1XNRM 4M9XA 3CTWB 4CGYB 1SXJC 2UUBM 2HKJA 2XSZD 1G4AE 2DAMA 3IHPA 4D82A 3C58A 2LHCA 2R6FA 3HZJA 4KLNA 4PDGA 1XMQM 1T6OA 4GHLA 3BOSA 1NVMA 1X37A 2EJSA 2DZLA 2KZUA 3MJ5A 2QENA 2Z4SA 3GLIB 4LGYA 3QAUA 2FNAA 5LMNM 1DO0A 2C96A 4DR4M 5ITTA 2VF7A 5EXSA 3FTDA 1Y8GA 3MHVC 3TWLA 1N34M 4LFCM 3W68A 2CEAA 3GPUA 2XZUA 1JR3E 2L4EA 2XH9A 4GRIA 2WZJA 3TPZA 3AL0C 2LVAA 1D2NA 4L15A 1TH4A 2BWEA 2EO2A 4G6ZA 4LRSA 3LCVB 2KDLA 4JI0M 2ZM6M 4OX9M 4IBJA 3GLHA 4NL4H 3SMSA 3W0LB 2Y20A 4FWHA 2ERCA 4OVZB 5EP2A 3LCUA 1TH3A 2DWMA 1J5EM 4ITQA 1PJJA 3B89A 2LVOC 1KSFX 3HKPA 4LCBA 1IXSB 2WSFF 3JR4A 4DR7M 3LQQA 2BJWA 1XXHA 1MX0A 1YLAA 3CGWA 4GIPA 4IBBA 4QNMA 1KYIA 2VQFM 1N78A 1IBLM 3SHGB 2AHMA 3QYEA 3HHXA 1QDTA 1QUSA 4PCZA 2L4FA 4NRWA 3GLFB 4AG5A 3E21A 3U5ZA 2QBYB 1W5SA 2DWLA 2J5YA 4K0KM 3FUWA 2N35A 3KVWA 4Q7JA 4KO8A 3ILKA 4FWGA 1VDLA 3B7ZA 2XFTA 4LF7M 1K3XA 2XLJA 3Q8XA 2FS1A 1QVRA 4RKUF 2KA6B 4MGIE 3GQ4A 2G3QA 3TL4X 3GQ5A 3LVWA 1VG5A 3HHZA 2B3TA 4CISA 4WP2A 4JYAM 1GO5A 4JI7M 2DAEA 5DYIA 2DWNA 3L29A 1YUBA 1XC8A 4LF4M 3SAWA 2MH8A 4X64M 3Q8GA 2KRUA 2K9DA 3UJNA 2DXIA 5IZ7D 1XHBA 1UFZA 2XZFA 3B7NA 4AQYM 4WW0A 5DFLA 1ZQ9A 2KHHA 4RF0A 3RFWA 5F3WA 4CJ6A 2QPAA 3AOEA 2H5XA 3IECA 4FW9A 3J80S 3GLIA 2R65A 3U6CA 4X65M 1IN4A 3KSXA 3PXGA 3SC3A 2D7EA 4AW4A 2XF3A 5FTLA 1NHGC 2JY7A 4L78A 1GJSA 2O25A 4II7A 4LJ5A 2WSCF 4MM3B 2C5RA 1K82A 3VKGA 5EP4A 2CWBA 4DR3M 4G4QA 2GQFA 1E9SA 1WGNA 4LZZA 2JY8A 1FJGM 1Q3BA 1KFVA 3L28A 3A42A 4W5WA 3ZQJA 5KQDA 5LMUM 3GLHB 3U6OA 1Z5AA 1WIVA 3D8BA 3I04M 1YE9A 3I4VA 2DZOB 2O01F 1RU3A 3FUUA 2D7HA 3LW5F 3GQ3A 4REZA 3B7QA 3KP1E 3J27B 1IXSA 4FD2A 2DKLA 4B08A 1SXJD 3GRYA 4M0DA 3A98B 4XBOA 1MU5A 1N75A
chains in the Genus database with same CATH topology
3RGSA 3OTOM 2CFOA 4NRVA 2VIIA 3U6SA 3KOWE 5C1BA 1QANA 4GITA 4DV4M 2FFJA 1IM2A 4M9ZA 1SXJE 2CV1A 2RGHA 4QHSA 1NNUC 1DGHB 1SXJB 1DGGA 3K8ZA 4DR5M 4KHPM 3GRUA 1I4WA 1HQCA 2CHVA 4L4UA 4RNAA 4YHHM 2R45A 4HLQA 2J7NA 4FVMA 1JQJC 3A46A 3HU3A 1L2CA 4B7HA 2ZANA 2I7NA 3U61B 4LJ6A 3JR5A 3SARA 5BR8M 4FCVA 2XEPA 3SASA 2CUZA 3A45A 4LJ7A 2KRKA 1EE8A 1R7RA 1QAQA 4G4OA 2K47A 4B3MM 2YQZA 4DR1M 3GRVA 3HJ8A 7CATA 2V1UA 3K92A 2F5QA 4I4LA 3UMMA 4IIWA 1DO2A 2D7GA 2Q2EB 5EXPA 3T38A 1TDZA 3KDSE 1IY2A 2KZSA 4IBCA 1J09A 3HHWA 4GKJM 2FE8A 4D80A 4JI2M 2LH0A 4X66M 3KSJA 1GL6A 4X62M 4JI6M 4AI6A 2C98A 3VDPA 2I7PA 1UM8A 3SFZA 1QYRA 3EIEA 4S12A 3DZDA 4DUZM 3U6DA 3FUVA 1E94E 4LJ8A 2R4EA 4QHTA 3U6PA 3E9SA 1Z59A 3TQSA 2Z4RA 3KS4A 4QOSA 1JR3D 3PNVA 4GMQA 4IBFA 1G41A 3FUXA 4JN6A 5ITXE 1XMOM 1N32M 3J2PB 4GHAA 1HNXM 1DGFA 5C18A 1L1ZA 3R8FA 1Q39A 2EUCA 1XWIA 4IBKA 1HR0M 5EQTA 3ZH9B 4D81A 4B3TM 1TH2A 1DGHA 2X4AA 3E4RA 3HGIA 2R46A 2UU9M 4BLCA 5BPVA 1HNZM 2XGNA 3PFIA 5EJCA 3LQRA 4M0WA 2Z3XA 3W0FA 1Q3CA 5ITQA 3RGPA 3R9XB 3UK6A 3TWMA 1L2BA 5FSWA 1I94M 1N77A 4ZPXA 2Y21A 2ZAMA 5KO3A 4RF1A 2RKOA 4B3SM 3DFZA 4DV6M 1IBMM 1W5TA 1OFHA 4FCWA 1DGBA 4JI4M 4FWDA 1IXZA 4AKGA 3CF0A 3SMPA 3TWKA 5ITUA 3CF6E 2X8AA 1L1TA 1L2DA 1NHWC 3U60B 4PDIA 5KPRA 1PJIA 3T15A 3J7AS 3KOYE 2OPFA 1HQYE 3AOGA 4GC9A 3VK7A 4DV3M 4G4RA 4Z8XA 2QP9X 3M6AA 2UUCM 5EP3A 4EIWA 4LF9M 5H37D 2NQ8C 2R62A 2O5RA 1GKIA 3RE8A 2L09A 4YY3M 4IJEA 4M9SA 1IN8A 1IQPA 3AOEC 4LRTA 2P5TA 1NY5A 2L7HA 3U6MA 3T1HM 3B9PA 4LFAM 1R6BX 3HU2A 3K2LA 3GPXA 1IBKM 4JXJA 3M0EA 2HCBA 4LF8M 4BB9A 3LVVA 4A3VB 4Z6YA 4LG2A 4G4NA 4LFBM 2DHRA 1WXQA 5KPZA 4NSOB 1N36M 3FTFA 1HNWM 4HL4A 1IY1A 3KW6A 3THGA 3DOAA 4NOOB 1N33M 3GLGA 1HT1E 3KOZE 4I8OA 5EXTA 4MGYE 4LF5M 4BBAA 3KFUG 4NXNM 3QWLA 4LJ9A 3U6LA 3FTCA 1NNJA 2Y0QA 1T3TA 4DV1M 2CHGA 3I51A 4DR2M 5IT9S 2M5ZA 3AFHA 3L2AA 3SAUA 3K1JA 5A2QS 2RGOA 5ITRA 4JI3M 2UXDM 4B3RM 3SHFA 1Z6TA 3DA1A 2YFQA 1ZAEA 3VLFB 1GL7A 1JR3A 1HT2E 3KOXE 2DZNB 2Y0TA 1NJFA 4MGHA 4GH9A 2XSZA 5E6JA 1IXRC 2CE7A 2UXBM 4AKHA 2R4JA 3GPPA 3GPYA 1IN6A 4MH0E 4PT5A 4OVZA 1H6UA 3TE6A 1C1KA 3U6QA 3FD9A 1YSYA 3SYKA 3SATA 3UZUA 2FOIC 4XGIA 4MB7A 1IN7A 4WURA 3H4MA 3SBJA 4DV7M 1XXHB 1ORYB 4JI5M 2CV2A 5KPTA 2JA2A 1S3SA 2ZAOA 2X49A 4QNRA 2LWXA 4IBEA 3GP1A 3IG5A 1FNNA 3HU1A 3U5ZB 1PM5A 4LJ4A 2BJVA 4OU7A 2V1CA 4DV0M 2F4VM 8CATA 4I81A 3FKEA 2DWZB 2VQEM 2BNKA 2F5NA 2Z7JA 1OFIA 5KQ8A 5FTMA 5JI3E 2V6ZM 3KP0E 1VDDA 3SYLA 2KEBA 1NJGA 3NBIA 1J7KA 3D8LA 3GLGB 2F5SA 1QAOA 5FTNA 3AKZA 3U6EA 2M60A 1G8PA 1G59A 4LF6M 5E26A 4DV5M 2A5YB 5IWAM 2KW0A 1QAMA 3HJSA 3JAMS 5EP1A 4GKKM 5ITXA 3UGJA 3PNYA 4P16A 4AG6A 5DYGA 4B7GA 2UUAM 1E32A 1G3IA 4L16A 3ZCBB 2OQ4A 4DV2M 2J7OA 4MGKE 3SAVA 2LNHC 2G5GX 5GKNA 2YNMD 3AJIB 4LGMA 1NSFA 3T1YM 1R2ZA 4OW0A 5FLXS 2W82A 2L6OA 3I4YA 2EA0A 2C9OA 4LJAA 3WHLA 2QCUA 3AV0A 4L8RC 3LMMA 2F5PA 4QOZC 4JI1M 3J7BA 2DVWB 1GLNA 2R18A 4B7FA 3FYCA 5FTJA 5IREB 3VK8A 2F5OA 3EIHA 4IBDA 4FCTA 4R7GA 1XNQM 2XFSA 2CV0A 4KODA 3CF2A 3VDUA 1SXJA 2L7IA 3NWLA 4PD2A 4GC5A 3GRRA 5EXXA 2C99A 3HJQA 3U60A 1R2YA 1LV7A 3KS8A 2ZBKB 3HHYA 2C9CA 1IN5A 4DR6M 1OJLA 3FYDA 3M7GA 2G8LA 3J81S 4DUYM 4AKIA 2H1RA 3U61A 4JV5M 3VFDA 4AZFA 4JI8M 1TDHA 5ITYA 3MK6A 1TGUA 4CHTB 5DNYA 3L25A 1Z5BA 1K3WA 4LY6A 1Z5CA 4TUWA 3PVSA 3GO8A 2UXCM 1QQWA 1IY0A 3IG8A 3ZC7B 4LZJA 2LXEA 1L8QA 3L26A 4I5SA 3GLFA 4NXMM 2QBYA 3KXEC 3FTEA 2HHHM 1GVNA 3FUTA 3L27A 5FTKA 2HL7A 3WHKA 4IJFA 2E5LM 1NY6A 4R3DA 1QZMA 4IBGA 5JI2E 2KXEA 2QZ4A 2YR0A 3VKHA 4MGZE 4IBIA 2CHQA 3HWSA 1E9RA 4NSRA 1XNRM 4M9XA 3CTWB 4CGYB 1SXJC 2UUBM 2HKJA 2XSZD 1G4AE 4D82A 3C58A 4KLNA 4PDGA 1XMQM 4GHLA 3BOSA 1NVMA 1X37A 2KZUA 3MJ5A 2QENA 2Z4SA 3GLIB 4LGYA 3QAUA 2FNAA 5LMNM 1DO0A 2C96A 4DR4M 5ITTA 5EXSA 3FTDA 3MHVC 3TWLA 1N34M 4LFCM 2CEAA 3GPUA 2XZUA 4GRIA 3TPZA 2XH9A 3AL0C 1D2NA 4L15A 1TH4A 4LRSA 2EO2A 4G6ZA 4JI0M 2ZM6M 4OX9M 4IBJA 3GLHA 4NL4H 3SMSA 3W0LB 2Y20A 4FWHA 2ERCA 4OVZB 5EP2A 1TH3A 2DWMA 1J5EM 4ITQA 1PJJA 1KSFX 3HKPA 4LCBA 1IXSB 3JR4A 4DR7M 3LQQA 2BJWA 1XXHA 1MX0A 4GIPA 4IBBA 4QNMA 1N78A 1KYIA 2VQFM 1IBLM 3SHGB 2AHMA 3HHXA 4NRWA 4PCZA 3GLFB 4AG5A 3U5ZA 2QBYB 1W5SA 2DWLA 4K0KM 3FUWA 3KVWA 4KO8A 3ILKA 4FWGA 2XFTA 4LF7M 1K3XA 2XLJA 3Q8XA 1QVRA 2KA6B 4MGIE 3GQ4A 3TL4X 3GQ5A 3LVWA 3HHZA 4CISA 4JYAM 4JI7M 2DWNA 5DYIA 3L29A 1YUBA 1XC8A 4LF4M 3SAWA 4X64M 2KRUA 3UJNA 2DXIA 5IZ7D 1XHBA 2XZFA 4AQYM 4WW0A 1ZQ9A 4RF0A 3RFWA 5F3WA 2QPAA 3AOEA 3J80S 4FW9A 3GLIA 2R65A 3U6CA 4X65M 1IN4A 3KSXA 3PXGA 3SC3A 2D7EA 4AW4A 2XF3A 5FTLA 1NHGC 4L78A 4II7A 2C5RA 4LJ5A 4MM3B 1K82A 3VKGA 5EP4A 4DR3M 4G4QA 1E9SA 4LZZA 1FJGM 1Q3BA 1KFVA 3L28A 3A42A 4W5WA 5KQDA 5LMUM 3GLHB 3U6OA 1Z5AA 3D8BA 1YE9A 3I4VA 2DZOB 3FUUA 3GQ3A 2D7HA 4REZA 3KP1E 3J27B 4FD2A 4B08A 1SXJD 3GRYA 4M0DA 3A98B 4XBOA 1MU5A 1N75A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1L1T A;  3OTO M;  4NRV A;  1L2D A;  3C58 A;  4PDI A;  2F5S A;  3U6S A;  1PJI A;  3J7A S;  4PDG A;  2OPF A;  4DV4 M;  1XMQ M;  3U6E A;  4LF6 M;  3VK7 A;  4DV3 M;  4KHP M;  4G4R A;  4DR5 M;  4DV5 M;  2UUC M;  5IWA M;  4GKK M;  3JAM S;  5ITX A;  4LF9 M;  5LMN M;  4YHH M;  4DR4 M;  5ITT A;  4YY3 M;  3TWL A;  3A46 A;  1N34 M;  4LFC M;  1L2C A;  3GPU A;  2XZU A;  2UUA M;  2OQ4 A;  4DV2 M;  3SAV A;  3U6M A;  3JR5 A;  3T1H M;  3SAR A;  4LFA M;  5BR8 M;  4JI0 M;  2ZM6 M;  3GPX A;  3T1Y M;  1IBK M;  4OX9 M;  3SAS A;  3A45 A;  4LF8 M;  1R2Z A;  5FLX S;  1EE8 A;  4G4O A;  4B3M M;  2EA0 A;  4DR1 M;  1J5E M;  4ITQ A;  1PJJ A;  4G4N A;  4LFB M;  2F5Q A;  1N36 M;  1HNW M;  3JR4 A;  2Q2E B;  4DR7 M;  1TDZ A;  1MX0 A;  2F5P A;  2VQF M;  3DOA A;  4JI1 M;  4GKJ M;  1N33 M;  1IBL M;  4JI2 M;  4X62 M;  4X66 M;  4NRW A;  4PCZ A;  4JI6 M;  3VK8 A;  2F5O A;  4LF5 M;  4NXN M;  4K0K M;  3U6L A;  1NNJ A;  1XNQ M;  4DUZ M;  4DV1 M;  4DR2 M;  3U6D A;  5IT9 S;  4LF7 M;  1K3X A;  3U6P A;  3SAU A;  3GQ4 A;  4PD2 A;  3GQ5 A;  1R2Y A;  1Z59 A;  5A2Q S;  5ITX E;  5ITR A;  1MU5 A;  4CIS A;  4JI3 M;  4JI7 M;  2ZBK B;  1XMO M;  4JYA M;  1N32 M;  2UXD M;  4B3R M;  1XC8 A;  4LF4 M;  4DR6 M;  3SAW A;  1HNX M;  4X64 M;  3J81 S;  4DUY M;  1L1Z A;  4JV5 M;  1Q39 A;  4JI8 M;  2XZF A;  1TDH A;  5ITY A;  4AQY M;  1Z5B A;  1K3W A;  1HR0 M;  1Z5C A;  2UXB M;  4B3T M;  3GO8 A;  3GPP A;  2UXC M;  3GPY A;  2UU9 M;  3J80 S;  3U6C A;  1HNZ M;  4X65 M;  3U6Q A;  4NXM M;  3SAT A;  4MB7 A;  3W0F A;  3SBJ A;  1Q3C A;  5ITQ A;  2HHH M;  4DV7 M;  1K82 A;  4JI5 M;  3TWM A;  1L2B A;  4DR3 M;  4G4Q A;  2E5L M;  1I94 M;  1FJG M;  1Q3B A;  3GP1 A;  1KFV A;  3A42 A;  1PM5 A;  5LMU M;  4B3S M;  4DV6 M;  1Z5A A;  4DV0 M;  3U6O A;  2F4V M;  1IBM M;  3GQ3 A;  2VQE M;  4JI4 M;  2F5N A;  1XNR M;  3TWK A;  2UUB M;  2HKJ A;  5ITU A; 
#chains in the Genus database with same CATH topology
 3RGS A;  3OTO M;  2CFO A;  4NRV A;  2VII A;  3U6S A;  1OIZ A;  3KOW E;  5C1B A;  1QAN A;  4GIT A;  4DV4 M;  2FFJ A;  1IM2 A;  4M9Z A;  1SXJ E;  4F1I A;  2RGH A;  2CV1 A;  1G71 A;  4QHS A;  1NNU C;  1DGH B;  1Q02 A;  1DGG A;  1NO1 A;  1SXJ B;  3K8Z A;  4DR5 M;  4KHP M;  3GRU A;  1I4W A;  2DEN A;  2DNA A;  1WHC A;  1HQC A;  2CHV A;  4L4U A;  4RNA A;  4YHH M;  1C7Y A;  3V76 A;  2R45 A;  2MRO B;  4HLQ A;  2J7N A;  4FVM A;  1JQJ C;  2VF8 A;  3A46 A;  2OOA A;  3HU3 A;  1L2C A;  1PGY A;  4B7H A;  2ZAN A;  2I7N A;  3U61 B;  4LJ6 A;  1AIP C;  2DHY A;  3JR5 A;  3SAR A;  5BR8 M;  4FCV A;  2XEP A;  3SAS A;  2CUZ A;  3A45 A;  4LJ7 A;  2R44 A;  2KRK A;  1EE8 A;  1R7R A;  1QDR A;  1QAQ A;  4G4O A;  2K47 A;  4B3M M;  1PJT A;  2YQZ A;  4DR1 M;  3GRV A;  3HJ8 A;  7CAT A;  2V1U A;  3K92 A;  2F5Q A;  4I4L A;  2VDB B;  3FRH A;  3UMM A;  4IIW A;  1DO2 A;  2D7G A;  1OAI A;  2Q2E B;  5EXP A;  3T38 A;  1TDZ A;  2QQ8 A;  3KDS E;  1IY2 A;  2KZS A;  4IBC A;  1J09 A;  3HHW A;  4GKJ M;  2CP8 A;  2FE8 A;  4D80 A;  4JI2 M;  2LH0 A;  4X66 M;  3KSJ A;  1GL6 A;  4X62 M;  4JI6 M;  1JB0 F;  1T43 A;  4AI6 A;  2C98 A;  3VDP A;  2I7P A;  2GNO A;  1UM8 A;  2QNJ A;  3SFZ A;  3GLG E;  1QYR A;  3EIE A;  4S12 A;  3DZD A;  4DUZ M;  1MJG M;  3U6D A;  3FUV A;  3H4J A;  1E94 E;  4LJ8 A;  2R4E A;  1ZMU A;  4QHT A;  3U6P A;  3E9S A;  2JY5 A;  1CUK A;  1TR8 A;  1Z59 A;  2Z4R A;  3KS4 A;  1JR3 D;  3PNV A;  4GMQ A;  4IBF A;  1G41 A;  3FUX A;  4JN6 A;  4QOS A;  5ITX E;  2R0I A;  3K9P A;  1XMO M;  2FH0 A;  1N32 M;  4DBG B;  3J2P B;  4GHA A;  1HNX M;  1DGF A;  5C18 A;  1L1Z A;  3R8F A;  1Q39 A;  2EUC A;  3GLI E;  1V92 A;  1XWI A;  4IBK A;  1HR0 M;  5EQT A;  3ZH9 B;  4D81 A;  4B3T M;  1NV8 A;  1DGH A;  1TH2 A;  2X4A A;  3E4R A;  3HGI A;  2R46 A;  3C9P A;  2UU9 M;  1PJQ A;  4BLC A;  5BPV A;  1HNZ M;  2XGN A;  2LHG A;  3PFI A;  4KT0 F;  2RRU A;  5EJC A;  3LQR A;  5L8R F;  2JZ0 A;  4M0W A;  2Z3X A;  1VEG A;  3W0F A;  1Q3C A;  4R71 A;  5ITQ A;  3RGP A;  3R9X B;  3FRI A;  3UK6 A;  3TWM A;  1L2B A;  5FSW A;  1OQY A;  1I94 M;  1N77 A;  4ZPX A;  2Y21 A;  2ZAM A;  1ZMV A;  4RF1 A;  5KO3 A;  2RKO A;  4B3S M;  3DFZ A;  4DV6 M;  3HY5 A;  1IBM M;  2L2D A;  1W5T A;  1OFH A;  3FE3 A;  1DGB A;  4FCW A;  4JI4 M;  4FWD A;  1IXZ A;  2JNH A;  4AKG A;  3CF0 A;  3SMP A;  3TWK A;  4XK8 F;  5ITU A;  2LVQ D;  1WR1 B;  1TTE A;  2JY6 B;  2X8A A;  3CF6 E;  4P17 A;  1L1T A;  1L2D A;  1NHW C;  2Z8Y M;  3U60 B;  4PDI A;  5KPR A;  1PJI A;  3T15 A;  3J7A S;  3KOY E;  2OPF A;  1HQY E;  3AOG A;  4GC9 A;  3VK7 A;  4UN2 B;  4DV3 M;  4G4R A;  1ZV1 A;  4Z8X A;  2QP9 X;  3M6A A;  2UUC M;  5EP3 A;  4EIW A;  2JXN A;  2QHO B;  4LF9 M;  1R5L A;  2JWS A;  5H37 D;  1A5T A;  2NQ8 C;  2R62 A;  2O5R A;  4L6V 6;  1GKI A;  3RE8 A;  2L09 A;  4YY3 M;  4IJE A;  1P3Q Q;  4M9S A;  1VEK A;  1IN8 A;  1IQP A;  3AOE C;  4LRT A;  3W67 A;  2P5T A;  1NY5 A;  1SG9 A;  2L7H A;  1VEJ A;  2DI0 A;  3U6M A;  3T1H M;  3B9P A;  4LFA M;  1R6B X;  3HU2 A;  1F4I A;  3K2L A;  3GPX A;  1IBK M;  3BXW A;  3M0E A;  2HCB A;  4JXJ A;  4LF8 M;  1AUA A;  4BB9 A;  3LVV A;  4A3V B;  1GJT A;  4Z6Y A;  4LG2 A;  4G4N A;  4LFB M;  2DHR A;  1WXQ A;  5KPZ A;  4NSO B;  1N36 M;  3K9O A;  3FTF A;  1HNW M;  4HL4 A;  1IY1 A;  3KW6 A;  3THG A;  3DOA A;  4NOO B;  2K6B A;  1N33 M;  3GLG A;  1HT1 E;  3KOZ E;  3NBX X;  4I8O A;  1OTR A;  3B74 A;  5EXT A;  1GAB A;  4MGY E;  3TQS A;  4LF5 M;  4BBA A;  3C3D A;  3KFU G;  4NXN M;  3QWL A;  4LJ9 A;  3U6L A;  3FTC A;  1NNJ A;  2Y0Q A;  1T3T A;  4DV1 M;  2CHG A;  3I51 A;  4DR2 M;  5IT9 S;  2M5Z A;  4ANR A;  3AFH A;  3BBZ A;  3L2A A;  3SAU A;  3K1J A;  5A2Q S;  2RGO A;  5ITR A;  2MGW A;  2K0B X;  4JI3 M;  2UXD M;  4Y28 F;  4B3R M;  3SHF A;  1Z6T A;  3DA1 A;  2YFQ A;  1ZAE A;  3C3E A;  3VLF B;  1GL7 A;  1HJP A;  4F2L A;  1JR3 A;  1HT2 E;  3KOX E;  1MN3 A;  2DZN B;  2Y0T A;  1NJF A;  4MGH A;  1LTM A;  2KNV A;  2XSZ A;  4GH9 A;  5E6J A;  1IXR C;  2CE7 A;  2EKF A;  2UXB M;  4AKH A;  2R4J A;  1D0L A;  3GPP A;  3GLH E;  3GPY A;  1IN6 A;  2WSE F;  4MH0 E;  4PT5 A;  4OVZ A;  1H6U A;  3TE6 A;  1C1K A;  3U6Q A;  2APL A;  3FD9 A;  1YSY A;  4GEW A;  3SYK A;  2BWB A;  3SAT A;  3UZU A;  2FOI C;  4XGI A;  4MB7 A;  1IN7 A;  4WUR A;  3H4M A;  3SBJ A;  4DV7 M;  1XXH B;  1ORY B;  2HAK A;  4JI5 M;  1XXH E;  2CV2 A;  2LTU A;  5KPT A;  2JA2 A;  1EIJ A;  1S3S A;  2ZAO A;  2X49 A;  1NV9 A;  2LWX A;  4IBE A;  4QNR A;  3GP1 A;  2JUJ A;  3GLF E;  3IG5 A;  1FNN A;  3HU1 A;  3U5Z B;  1PM5 A;  4LJ4 A;  2BJV A;  4OU7 A;  1TF0 B;  2V1C A;  4DV0 M;  2F4V M;  8CAT A;  1WJ7 A;  1OKS A;  2MJ5 B;  4I81 A;  3FKE A;  2DWZ B;  2VQE M;  2BNK A;  2F5N A;  2Z7J A;  1OFI A;  5KQ8 A;  5FTM A;  5JI3 E;  2V6Z M;  3KP0 E;  1VDD A;  1R4G A;  3SYL A;  2KEB A;  1D0K A;  1D0M A;  1NJG A;  2KNA A;  3MMP A;  3NBI A;  1J7K A;  3D8L A;  2DAK A;  3GLG B;  2F5S A;  1QAO A;  5FTN A;  3AKZ A;  2HWJ A;  2M60 A;  3U6E A;  1G8P A;  1G59 A;  4LF6 M;  1QUT A;  4NC6 A;  5E26 A;  4DV5 M;  2A5Y B;  5IWA M;  2KW0 A;  1QAM A;  2JP7 A;  3HJS A;  5EP1 A;  3JAM S;  5ITX A;  4GKK M;  3UGJ A;  3PNY A;  2JZ1 A;  2ZTC A;  4P16 A;  4AG6 A;  5DYG A;  4B7G A;  1PRB A;  2UUA M;  1E32 A;  1G3I A;  4L16 A;  3ZCB B;  2OQ4 A;  4DV2 M;  1QZE A;  2J7O A;  2MR9 A;  3E46 A;  4MGK E;  2LNH C;  2LVP C;  2G5G X;  5GKN A;  2YNM D;  3SAV A;  3AJI B;  4LGM A;  1NSF A;  3T1Y M;  1R2Z A;  4OW0 A;  5FLX S;  2W82 A;  2CRU A;  2L6O A;  3I4Y A;  2EA0 A;  2C9O A;  4LJA A;  3WHL A;  2QCU A;  3AV0 A;  4L8R C;  3LMM A;  2F5P A;  4QOZ C;  4JI1 M;  3J7B A;  2DVW B;  1GLN A;  2LVN C;  2R18 A;  4B7F A;  3FYC A;  5FTJ A;  5IRE B;  3VK8 A;  2F5O A;  3EIH A;  4IBD A;  4FCT A;  4R7G A;  2ZTD A;  3I01 M;  1XNQ M;  2XFS A;  2EKK A;  2CV0 A;  1XB2 B;  4KOD A;  3CF2 A;  3QYB A;  3VDU A;  1SXJ A;  2L7I A;  3NWL A;  4PD2 A;  4GC5 A;  3GRR A;  5EXX A;  2C99 A;  3HJQ A;  3U60 A;  1R2Y A;  1LV7 A;  3KS8 A;  2QSF X;  2ZBK B;  3HHY A;  1V34 A;  2C9C A;  1IN5 A;  4DR6 M;  1OJL A;  3FYD A;  4CIZ A;  3M7G A;  2G8L A;  3J81 S;  4DUY M;  4AKI A;  2H1R A;  3U61 A;  4JV5 M;  3VFD A;  3T6P A;  4AZF A;  4JI8 M;  1TDH A;  5ITY A;  3MK6 A;  1TGU A;  2DAG A;  4CHT B;  5DNY A;  2OO9 A;  1Z5B A;  3L25 A;  3HX3 A;  4LY6 A;  1Z5C A;  1ZMW A;  1K3W A;  4TUW A;  3PVS A;  3F92 A;  4HEO A;  3GO8 A;  2UXC M;  1QQW A;  1IY0 A;  3IG8 A;  3ZC7 B;  4LZJ A;  1IFY A;  2LXE A;  1L8Q A;  3L26 A;  2KNZ A;  1DV0 A;  4G3O A;  4I5S A;  3GLF A;  4NXM M;  1EFU B;  2QBY A;  3KXE C;  3FTE A;  2HHH M;  2LBC A;  2OOB A;  1WGL A;  1GVN A;  1V33 A;  3FUT A;  3L27 A;  5FTK A;  2HL7 A;  3WHK A;  1PJS A;  4IJF A;  2E5L M;  1NY6 A;  1VQ1 A;  1OAO C;  4R3D A;  1QZM A;  4IBG A;  5JI2 E;  1BVS A;  2DAI A;  2KXE A;  2QZ4 A;  1OIP A;  2YR0 A;  3VKH A;  4MGZ E;  4IBI A;  2CHQ A;  3HWS A;  1E9R A;  4NSR A;  1XNR M;  4M9X A;  3CTW B;  4CGY B;  1SXJ C;  2UUB M;  2HKJ A;  2XSZ D;  1G4A E;  2DAM A;  3IHP A;  4D82 A;  3C58 A;  2LHC A;  2R6F A;  3HZJ A;  4KLN A;  4PDG A;  1XMQ M;  1T6O A;  4GHL A;  3BOS A;  1NVM A;  1X37 A;  2EJS A;  2DZL A;  2KZU A;  3MJ5 A;  2QEN A;  2Z4S A;  3GLI B;  4LGY A;  3QAU A;  2FNA A;  5LMN M;  1DO0 A;  2C96 A;  4DR4 M;  5ITT A;  2VF7 A;  5EXS A;  3FTD A;  1Y8G A;  3MHV C;  3TWL A;  1N34 M;  4LFC M;  3W68 A;  2CEA A;  3GPU A;  2XZU A;  1JR3 E;  2L4E A;  2XH9 A;  4GRI A;  2WZJ A;  3TPZ A;  3AL0 C;  2LVA A;  1D2N A;  4L15 A;  1TH4 A;  2BWE A;  2EO2 A;  4G6Z A;  4LRS A;  3LCV B;  2KDL A;  4JI0 M;  2ZM6 M;  4OX9 M;  4IBJ A;  3GLH A;  4NL4 H;  3SMS A;  3W0L B;  2Y20 A;  4FWH A;  2ERC A;  4OVZ B;  5EP2 A;  3LCU A;  1TH3 A;  2DWM A;  1J5E M;  4ITQ A;  1PJJ A;  3B89 A;  2LVO C;  1KSF X;  3HKP A;  4LCB A;  1IXS B;  2WSF F;  3JR4 A;  4DR7 M;  3LQQ A;  2BJW A;  1XXH A;  1MX0 A;  1YLA A;  3CGW A;  4GIP A;  4IBB A;  4QNM A;  1KYI A;  2VQF M;  1N78 A;  1IBL M;  3SHG B;  2AHM A;  3QYE A;  3HHX A;  1QDT A;  1QUS A;  4PCZ A;  2L4F A;  4NRW A;  3GLF B;  4AG5 A;  3E21 A;  3U5Z A;  2QBY B;  1W5S A;  2DWL A;  2J5Y A;  4K0K M;  3FUW A;  2N35 A;  3KVW A;  4Q7J A;  4KO8 A;  3ILK A;  4FWG A;  1VDL A;  3B7Z A;  2XFT A;  4LF7 M;  1K3X A;  2XLJ A;  3Q8X A;  2FS1 A;  1QVR A;  4RKU F;  2KA6 B;  4MGI E;  3GQ4 A;  2G3Q A;  3TL4 X;  3GQ5 A;  3LVW A;  1VG5 A;  3HHZ A;  2B3T A;  4CIS A;  4WP2 A;  4JYA M;  1GO5 A;  4JI7 M;  2DAE A;  5DYI A;  2DWN A;  3L29 A;  1YUB A;  1XC8 A;  4LF4 M;  3SAW A;  2MH8 A;  4X64 M;  3Q8G A;  2KRU A;  2K9D A;  3UJN A;  2DXI A;  5IZ7 D;  1XHB A;  1UFZ A;  2XZF A;  3B7N A;  4AQY M;  4WW0 A;  5DFL A;  1ZQ9 A;  2KHH A;  4RF0 A;  3RFW A;  5F3W A;  4CJ6 A;  2QPA A;  3AOE A;  2H5X A;  3IEC A;  4FW9 A;  3J80 S;  3GLI A;  2R65 A;  3U6C A;  4X65 M;  1IN4 A;  3KSX A;  3PXG A;  3SC3 A;  2D7E A;  4AW4 A;  2XF3 A;  5FTL A;  1NHG C;  2JY7 A;  4L78 A;  1GJS A;  2O25 A;  4II7 A;  4LJ5 A;  2WSC F;  4MM3 B;  2C5R A;  1K82 A;  3VKG A;  5EP4 A;  2CWB A;  4DR3 M;  4G4Q A;  2GQF A;  1E9S A;  1WGN A;  4LZZ A;  2JY8 A;  1FJG M;  1Q3B A;  1KFV A;  3L28 A;  3A42 A;  4W5W A;  3ZQJ A;  5KQD A;  5LMU M;  3GLH B;  3U6O A;  1Z5A A;  1WIV A;  3D8B A;  3I04 M;  1YE9 A;  3I4V A;  2DZO B;  2O01 F;  1RU3 A;  3FUU A;  2D7H A;  3LW5 F;  3GQ3 A;  4REZ A;  3B7Q A;  3KP1 E;  3J27 B;  1IXS A;  4FD2 A;  2DKL A;  4B08 A;  1SXJ D;  3GRY A;  4M0D A;  3A98 B;  4XBO A;  1MU5 A;  1N75 A; 
#chains in the Genus database with same CATH homology
 3RGS A;  3OTO M;  2CFO A;  4NRV A;  2VII A;  3U6S A;  3KOW E;  5C1B A;  1QAN A;  4GIT A;  4DV4 M;  2FFJ A;  1IM2 A;  4M9Z A;  1SXJ E;  2CV1 A;  2RGH A;  4QHS A;  1NNU C;  1DGH B;  1SXJ B;  1DGG A;  3K8Z A;  4DR5 M;  4KHP M;  3GRU A;  1I4W A;  1HQC A;  2CHV A;  4L4U A;  4RNA A;  4YHH M;  2R45 A;  4HLQ A;  2J7N A;  4FVM A;  1JQJ C;  3A46 A;  3HU3 A;  1L2C A;  4B7H A;  2ZAN A;  2I7N A;  3U61 B;  4LJ6 A;  3JR5 A;  3SAR A;  5BR8 M;  4FCV A;  2XEP A;  3SAS A;  2CUZ A;  3A45 A;  4LJ7 A;  2KRK A;  1EE8 A;  1R7R A;  1QAQ A;  4G4O A;  2K47 A;  4B3M M;  2YQZ A;  4DR1 M;  3GRV A;  3HJ8 A;  7CAT A;  2V1U A;  3K92 A;  2F5Q A;  4I4L A;  3UMM A;  4IIW A;  1DO2 A;  2D7G A;  2Q2E B;  5EXP A;  3T38 A;  1TDZ A;  3KDS E;  1IY2 A;  2KZS A;  4IBC A;  1J09 A;  3HHW A;  4GKJ M;  2FE8 A;  4D80 A;  4JI2 M;  2LH0 A;  4X66 M;  3KSJ A;  1GL6 A;  4X62 M;  4JI6 M;  4AI6 A;  2C98 A;  3VDP A;  2I7P A;  1UM8 A;  3SFZ A;  1QYR A;  3EIE A;  4S12 A;  3DZD A;  4DUZ M;  3U6D A;  3FUV A;  1E94 E;  4LJ8 A;  2R4E A;  4QHT A;  3U6P A;  3E9S A;  1Z59 A;  3TQS A;  2Z4R A;  3KS4 A;  4QOS A;  1JR3 D;  3PNV A;  4GMQ A;  4IBF A;  1G41 A;  3FUX A;  4JN6 A;  5ITX E;  1XMO M;  1N32 M;  3J2P B;  4GHA A;  1HNX M;  1DGF A;  5C18 A;  1L1Z A;  3R8F A;  1Q39 A;  2EUC A;  1XWI A;  4IBK A;  1HR0 M;  5EQT A;  3ZH9 B;  4D81 A;  4B3T M;  1TH2 A;  1DGH A;  2X4A A;  3E4R A;  3HGI A;  2R46 A;  2UU9 M;  4BLC A;  5BPV A;  1HNZ M;  2XGN A;  3PFI A;  5EJC A;  3LQR A;  4M0W A;  2Z3X A;  3W0F A;  1Q3C A;  5ITQ A;  3RGP A;  3R9X B;  3UK6 A;  3TWM A;  1L2B A;  5FSW A;  1I94 M;  1N77 A;  4ZPX A;  2Y21 A;  2ZAM A;  5KO3 A;  4RF1 A;  2RKO A;  4B3S M;  3DFZ A;  4DV6 M;  1IBM M;  1W5T A;  1OFH A;  4FCW A;  1DGB A;  4JI4 M;  4FWD A;  1IXZ A;  4AKG A;  3CF0 A;  3SMP A;  3TWK A;  5ITU A;  3CF6 E;  2X8A A;  1L1T A;  1L2D A;  1NHW C;  3U60 B;  4PDI A;  5KPR A;  1PJI A;  3T15 A;  3J7A S;  3KOY E;  2OPF A;  1HQY E;  3AOG A;  4GC9 A;  3VK7 A;  4DV3 M;  4G4R A;  4Z8X A;  2QP9 X;  3M6A A;  2UUC M;  5EP3 A;  4EIW A;  4LF9 M;  5H37 D;  2NQ8 C;  2R62 A;  2O5R A;  1GKI A;  3RE8 A;  2L09 A;  4YY3 M;  4IJE A;  4M9S A;  1IN8 A;  1IQP A;  3AOE C;  4LRT A;  2P5T A;  1NY5 A;  2L7H A;  3U6M A;  3T1H M;  3B9P A;  4LFA M;  1R6B X;  3HU2 A;  3K2L A;  3GPX A;  1IBK M;  4JXJ A;  3M0E A;  2HCB A;  4LF8 M;  4BB9 A;  3LVV A;  4A3V B;  4Z6Y A;  4LG2 A;  4G4N A;  4LFB M;  2DHR A;  1WXQ A;  5KPZ A;  4NSO B;  1N36 M;  3FTF A;  1HNW M;  4HL4 A;  1IY1 A;  3KW6 A;  3THG A;  3DOA A;  4NOO B;  1N33 M;  3GLG A;  1HT1 E;  3KOZ E;  4I8O A;  5EXT A;  4MGY E;  4LF5 M;  4BBA A;  3KFU G;  4NXN M;  3QWL A;  4LJ9 A;  3U6L A;  3FTC A;  1NNJ A;  2Y0Q A;  1T3T A;  4DV1 M;  2CHG A;  3I51 A;  4DR2 M;  5IT9 S;  2M5Z A;  3AFH A;  3L2A A;  3SAU A;  3K1J A;  5A2Q S;  2RGO A;  5ITR A;  4JI3 M;  2UXD M;  4B3R M;  3SHF A;  1Z6T A;  3DA1 A;  2YFQ A;  1ZAE A;  3VLF B;  1GL7 A;  1JR3 A;  1HT2 E;  3KOX E;  2DZN B;  2Y0T A;  1NJF A;  4MGH A;  4GH9 A;  2XSZ A;  5E6J A;  1IXR C;  2CE7 A;  2UXB M;  4AKH A;  2R4J A;  3GPP A;  3GPY A;  1IN6 A;  4MH0 E;  4PT5 A;  4OVZ A;  1H6U A;  3TE6 A;  1C1K A;  3U6Q A;  3FD9 A;  1YSY A;  3SYK A;  3SAT A;  3UZU A;  2FOI C;  4XGI A;  4MB7 A;  1IN7 A;  4WUR A;  3H4M A;  3SBJ A;  4DV7 M;  1XXH B;  1ORY B;  4JI5 M;  2CV2 A;  5KPT A;  2JA2 A;  1S3S A;  2ZAO A;  2X49 A;  4QNR A;  2LWX A;  4IBE A;  3GP1 A;  3IG5 A;  1FNN A;  3HU1 A;  3U5Z B;  1PM5 A;  4LJ4 A;  2BJV A;  4OU7 A;  2V1C A;  4DV0 M;  2F4V M;  8CAT A;  4I81 A;  3FKE A;  2DWZ B;  2VQE M;  2BNK A;  2F5N A;  2Z7J A;  1OFI A;  5KQ8 A;  5FTM A;  5JI3 E;  2V6Z M;  3KP0 E;  1VDD A;  3SYL A;  2KEB A;  1NJG A;  3NBI A;  1J7K A;  3D8L A;  3GLG B;  2F5S A;  1QAO A;  5FTN A;  3AKZ A;  3U6E A;  2M60 A;  1G8P A;  1G59 A;  4LF6 M;  5E26 A;  4DV5 M;  2A5Y B;  5IWA M;  2KW0 A;  1QAM A;  3HJS A;  3JAM S;  5EP1 A;  4GKK M;  5ITX A;  3UGJ A;  3PNY A;  4P16 A;  4AG6 A;  5DYG A;  4B7G A;  2UUA M;  1E32 A;  1G3I A;  4L16 A;  3ZCB B;  2OQ4 A;  4DV2 M;  2J7O A;  4MGK E;  3SAV A;  2LNH C;  2G5G X;  5GKN A;  2YNM D;  3AJI B;  4LGM A;  1NSF A;  3T1Y M;  1R2Z A;  4OW0 A;  5FLX S;  2W82 A;  2L6O A;  3I4Y A;  2EA0 A;  2C9O A;  4LJA A;  3WHL A;  2QCU A;  3AV0 A;  4L8R C;  3LMM A;  2F5P A;  4QOZ C;  4JI1 M;  3J7B A;  2DVW B;  1GLN A;  2R18 A;  4B7F A;  3FYC A;  5FTJ A;  5IRE B;  3VK8 A;  2F5O A;  3EIH A;  4IBD A;  4FCT A;  4R7G A;  1XNQ M;  2XFS A;  2CV0 A;  4KOD A;  3CF2 A;  3VDU A;  1SXJ A;  2L7I A;  3NWL A;  4PD2 A;  4GC5 A;  3GRR A;  5EXX A;  2C99 A;  3HJQ A;  3U60 A;  1R2Y A;  1LV7 A;  3KS8 A;  2ZBK B;  3HHY A;  2C9C A;  1IN5 A;  4DR6 M;  1OJL A;  3FYD A;  3M7G A;  2G8L A;  3J81 S;  4DUY M;  4AKI A;  2H1R A;  3U61 A;  4JV5 M;  3VFD A;  4AZF A;  4JI8 M;  1TDH A;  5ITY A;  3MK6 A;  1TGU A;  4CHT B;  5DNY A;  3L25 A;  1Z5B A;  1K3W A;  4LY6 A;  1Z5C A;  4TUW A;  3PVS A;  3GO8 A;  2UXC M;  1QQW A;  1IY0 A;  3IG8 A;  3ZC7 B;  4LZJ A;  2LXE A;  1L8Q A;  3L26 A;  4I5S A;  3GLF A;  4NXM M;  2QBY A;  3KXE C;  3FTE A;  2HHH M;  1GVN A;  3FUT A;  3L27 A;  5FTK A;  2HL7 A;  3WHK A;  4IJF A;  2E5L M;  1NY6 A;  4R3D A;  1QZM A;  4IBG A;  5JI2 E;  2KXE A;  2QZ4 A;  2YR0 A;  3VKH A;  4MGZ E;  4IBI A;  2CHQ A;  3HWS A;  1E9R A;  4NSR A;  1XNR M;  4M9X A;  3CTW B;  4CGY B;  1SXJ C;  2UUB M;  2HKJ A;  2XSZ D;  1G4A E;  4D82 A;  3C58 A;  4KLN A;  4PDG A;  1XMQ M;  4GHL A;  3BOS A;  1NVM A;  1X37 A;  2KZU A;  3MJ5 A;  2QEN A;  2Z4S A;  3GLI B;  4LGY A;  3QAU A;  2FNA A;  5LMN M;  1DO0 A;  2C96 A;  4DR4 M;  5ITT A;  5EXS A;  3FTD A;  3MHV C;  3TWL A;  1N34 M;  4LFC M;  2CEA A;  3GPU A;  2XZU A;  4GRI A;  3TPZ A;  2XH9 A;  3AL0 C;  1D2N A;  4L15 A;  1TH4 A;  4LRS A;  2EO2 A;  4G6Z A;  4JI0 M;  2ZM6 M;  4OX9 M;  4IBJ A;  3GLH A;  4NL4 H;  3SMS A;  3W0L B;  2Y20 A;  4FWH A;  2ERC A;  4OVZ B;  5EP2 A;  1TH3 A;  2DWM A;  1J5E M;  4ITQ A;  1PJJ A;  1KSF X;  3HKP A;  4LCB A;  1IXS B;  3JR4 A;  4DR7 M;  3LQQ A;  2BJW A;  1XXH A;  1MX0 A;  4GIP A;  4IBB A;  4QNM A;  1N78 A;  1KYI A;  2VQF M;  1IBL M;  3SHG B;  2AHM A;  3HHX A;  4NRW A;  4PCZ A;  3GLF B;  4AG5 A;  3U5Z A;  2QBY B;  1W5S A;  2DWL A;  4K0K M;  3FUW A;  3KVW A;  4KO8 A;  3ILK A;  4FWG A;  2XFT A;  4LF7 M;  1K3X A;  2XLJ A;  3Q8X A;  1QVR A;  2KA6 B;  4MGI E;  3GQ4 A;  3TL4 X;  3GQ5 A;  3LVW A;  3HHZ A;  4CIS A;  4JYA M;  4JI7 M;  2DWN A;  5DYI A;  3L29 A;  1YUB A;  1XC8 A;  4LF4 M;  3SAW A;  4X64 M;  2KRU A;  3UJN A;  2DXI A;  5IZ7 D;  1XHB A;  2XZF A;  4AQY M;  4WW0 A;  1ZQ9 A;  4RF0 A;  3RFW A;  5F3W A;  2QPA A;  3AOE A;  3J80 S;  4FW9 A;  3GLI A;  2R65 A;  3U6C A;  4X65 M;  1IN4 A;  3KSX A;  3PXG A;  3SC3 A;  2D7E A;  4AW4 A;  2XF3 A;  5FTL A;  1NHG C;  4L78 A;  4II7 A;  2C5R A;  4LJ5 A;  4MM3 B;  1K82 A;  3VKG A;  5EP4 A;  4DR3 M;  4G4Q A;  1E9S A;  4LZZ A;  1FJG M;  1Q3B A;  1KFV A;  3L28 A;  3A42 A;  4W5W A;  5KQD A;  5LMU M;  3GLH B;  3U6O A;  1Z5A A;  3D8B A;  1YE9 A;  3I4V A;  2DZO B;  3FUU A;  3GQ3 A;  2D7H A;  4REZ A;  3KP1 E;  3J27 B;  4FD2 A;  4B08 A;  1SXJ D;  3GRY A;  4M0D A;  3A98 B;  4XBO A;  1MU5 A;  1N75 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...