2VQFO

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2vqfO00
2AGAA 5H5NA 3J7AU 1AB3A 4JV5O 1HNWO 4DV6O 1I94O 5IWAO 4DV7O 2UXBO 1N33O 4OX9O 1R1BA 2VQEO 2ZKOA 4JI7O 1D2DA 5IT9N 5FLXN 4JI6O 4OPAA 4DV4O 1IBMO 4K0KO 2ZM6O 3RT3C 1FYJA 2FKXA 4KHPO 1X59A 4JI4O 4DUZO 4DV1O 4DR3O 2LW7A 4JI8O 2DOSA 4LF9O 1IBKO 4DR1O 2VQFO 3F5TA 2JRIA 3JAMN 5LMNO 2UXCO 4DUYO 4LFBO 1HNXO 4LF7O 4JI3O 4JI2O 1FKAO 3J80N 4DR5O 1F7YA 4B3MO 4AQYO 1XMOO 1N34O 1DK1A 3T1HO 1HR0O 3T1YO 4JI1O 2Z0AA 2UUAO 2UUBO 2UXDO 4LF8O 2UU9O 4A5UB 3OTOO 4LF6O 1AILA 1A32A 3M8AA 4X62O 1XNQO 4GKKO 4DV5O 4JI0O 5LMUO 5BR8O 2UUCO 4DV3O 1XEQA 4GKJO 5A2QN 1R6TA 1FJGO 4YY3O 4X66O 1IBLO 4X65O 4DR2O 1N32O 1XNRO 1KUQA 4B3TO 3J81N 4B3SO 4DR6O 4JI5O 4DV2O 4NXNO 1G1XB 2N74A 5BXZA 3R66A 1HNZO 1N36O 4B3RO 4NXMO 2E5LO 4LF4O 4LF5O 5BY1A 1YZBA 4DV0O 1NS1A 4LFCO 5LL6Y 4DR7O 4LFAO 2DJVA 1XMQO 4JYAO 4X64O 2HHHO 4YHHO 3O65A 2F4VO 4OPHA 4DR4O 1J5EO 3SDLA
chains in the Genus database with same CATH superfamily
4PJ0Z 1Q43A 3PJSK 1I0HA 1EZJA 1PP9H 2Q69A 1YHQV 3CCJV 1GN4A 1SZXA 2ZKOA 1NH2B 1D2DA 2KG7B 3AG2C 5KMGA 1Y76A 1NI8A 5JJEB 1M56B 2F23A 2NLJC 1MSDA 4B3TB 1QHTA 3TCUA 2ZXWC 4O2AB 2P06A 4LF9O 4YY3B 4J7KA 2P90A 4BWAA 3CCRV 4NB5A 2YEVA 3ZRVA 1SERA 3HR0A 1MZFA 3C90A 4JAAA 2QWOB 1VF7A 4QIWF 1NVPB 4JI7B 4D7SA 3NXSA 5ITZB 1OCRB 2RQ6A 3D3QA 3G6BA 4U7OA 3JD2A 2HFEC 2UXDO 2B1GA 3CCSV 4ABMA 1HR0B 4GKKO 1VQ5V 1N34B 4DV5O 1HDJA 5B1BC 4YXWG 3FB5C 1K4CC 2QM7A 3JATB 2CH7B 3MAQA 2QWRB 5KHGA 3JSNA 2E75B 4C7UA 4LH7A 1IBLO 2GSMB 3BFRA 5JQGA 5GTIZ 2C2AA 1FFTB 1N32O 1GN2A 4KHPB 5B1AB 3CRQA 1N36B 4GYCB 3N2KA 3ZMVA 2H94A 1I5XA 4WBNA 1V54C 4FFBB 3EVKA 1VF6A 1OCOC 2EX3A 1ZTEA 4LFCO 3OEHG 2BOCC 4JYAO 1QQCA 1Q82W 2LGQA 2ZNJA 2YICA 2IJKA 3OEEG 1Q6IA 1F4NA 2AGAA 4AILC 4E2LA 2W0FC 1KD1W 4IHJB 3SPGA 3VOUA 1KYOF 3BA9A 4JTAB 5KMGB 4MVUA 2YIBD 3ML0A 4P9OA 3JAKB 3TETA 2BTQA 4UCOA 3E86A 2XUMA 2QE7G 3SYOA 3OFNG 4PI0A 5GONA 1AI4A 1JR9A 3K79A 1VQ9V 4ZIBA 2A9HA 2H3OA 2RJZA 5ITZA 3ETQA 4LF8B 5J2UB 1EN4A 3T1HB 5AG2A 2ITDC 1P49A 1FXKC 4TOIA 1J5EB 1K34A 1CEZA 3L75H 5IYDO 1SQQH 5BR8O 4JF3A 4DUYB 3KCXA 2XAHA 3EFFK 2QDOA 4X66O 5IE9A 2A79B 3FAVB 5JVDB 2JEXA 1YTFB 3E35A 4P30A 5CA0A 4JI4B 3GWOA 2IJHA 3H1IH 4I4TA 4GX5A 2Q6AA 1DGSA 2Q7HA 4FZ0A 2GUZA 3P3NA 4RAIA 2WLHA 3ZRSA 3TXSA 1G1XB 4X1KA 4UV9A 4HBNA 1RFYA 2XAGA 2HG5C 3PN1A 3E2EA 2Y0PA 3JD0A 4XDKA 4DR4B 2F4VB 1EM1A 4ZHQB 2YXLA 3AK3A 3X2QC 5CBFA 2PUSA 5CA1B 4DV0B 3AG3C 1DTOA 4WFHA 4PDVA 2DWEC 5J2TB 2R9AA 3R65A 3CCQV 2VS0A 1AI7A 1BE3H 4DV4O 4LCUC 5KA5A 3CE2A 2RMKB 4PV1B 1K97A 2JS3A 4I9QA 2VQFB 3CCUV 1IBKO 4U3JA 4LNUB 3ZHSA 1H2NA 3LDEA 1M57C 3UT5B 3FKSG 2X6BA 4TT3G 2DQ0A 3CRCA 1COWG 5GW7A 1N4CA 3CC4V 1QNMA 2WAMA 3A2FA 3SJBC 2K9PA 1AJPA 4MS2A 5HFLA 3SJCC 4O4HA 2QGNA 3KKYA 4G28B 1SA0A 4CS2A 2OTLV 1KKCA 2HR3A 3HPLC 4LC1A 4TQDA 4LFBB 4I9WA 1R3JC 4L87A 3FFQA 1VQ8V 4P2ZA 3JD3A 1QCEA 4DK0A 4MVQA 4CC5A 5IYZB 1KC8W 1XHZA 3RYFB 4AHCA 2VRZA 1H2LA 4H33A 1AJQA 4NTXA 1FPOA 4KFMA 1IBMB 1YITV 1Y6XA 2OTJV 1VIBA 3K9SA 2PYLA 1BT8A 4B3RO 2IU3A 1SC5B 1TUBB 2DWDC 2CDYA 1Z2GA 4BW5A 5BY1A 3OTFA 4J42A 4J7JA 1XMQO 4RQFA 4B7EA 4GCZA 2KB1A 3T2MA 1AR5A 2FYUH 4PELA 2M6YA 5LXTA 3J7AU 4FVMA 4JV5O 2W6JG 2HP8A 3SYQA 2UUAB 4XDJA 5FNVA 2QA4V 1NR7A 3RYIA 1VF6C 1M1KW 4UB8Z 3ZHQA 4BW9A 1R6KA 1PL4A 3RYHA 3ZJZA 1NKDA 4DR6B 2RN9A 1NQTA 3GVMA 1YSCA 3E8HA 2WA3A 3H1HH 1P7GA 4JYCA 1YI2V 1QLEB 2UXCO 4WBNB 1HNXO 2XNDG 4PD4F 3JASB 1F23A 3J80N 4DR5O 4AQYO 4K35A 4BIUA 4LF6B 3CJHA 3ZHRA 4Z1VA 1VP7A 2UXBB 1PPJH 2QWQB 4MTOA 4R8CA 4JI1B 3ABKC 2UU9O 1WAZA 4K8ZA 2WLNA 1L8DA 2DN9A 2YIAA 2ZD9A 4AQYB 4B3MB 2WLLA 1QLEC 3D8CA 1KMIZ 1V55B 1TVKB 3CB2A 2CH7A 2YXHA 3BHPA 5H2FZ 4CC6A 4UCTA 3TXQA 1XL6A 2YIBA 2EIKC 2DYSC 2ZCEA 5JQGB 4LF4B 1P7BA 4X1IB 1S72V 1KBHA 1IVSA 5D5QA 4P9PA 3G71V 3CRMA 4B3SO 4DR6O 4K0KB 4DV2B 2EILB 1K73W 1S0VA 4R6ZA 5BXZA 1ZWIC 2YUAA 5CA0B 4UFZA 2ADPA 2F95B 3JALA 2ZE5A 3RYCA 2CAZC 1B04A 4MTXA 3ZMUA 5IY5B 1XQ8A 3T4DA 1GMGA 3L74H 3Q4HA 5K1XA 2PZSA 3QO7A 4QNHB 4YHHO 3O65A 2AW9A 4WF9V 3U10A 2MK3A 3B09A 2Q7GA 2JGDA 1HW7A 1RM1B 1AB3A 5C8YA 3HKCA 4O2BB 5H6QA 2LFSA 2XHBA 3D3IA 5H6RA 4OX9O 1MA1A 1JX9A 2WLIA 2Q5ZA 3HKDB 4QE7A 1IBMO 1FXVA 4MW3A 3JD4A 1SQGA 2A0LA 4J80A 3GB7C 3ASOC 2XASA 4OGQB 4RO2A 3JAWB 3MHSC 4CH3A 3OUSA 4IIJB 5C93A 4YJ3B 1YEWA 1KKDA 3ABMC 1XMOO 2VQEB 1CXZB 1SS3A 2X7RB 1N33B 5DN6G 1PV0A 5BMVB 2E76B 3ZN1A 3G4SV 1W0KG 2OCHA 1VQNV 1YF2A 3HKBA 3B40A 4JI0O 4UCUA 4D7TA 3ABTA 1E1RG 4X64B 1FFXA 5IJ9A 4R7CA 4GZRB 2L35A 4HYOA 5CN0A 5LGTA 1RPRA 1KUQA 2BTQB 4X8AA 4UCVA 1YXBA 2IM9A 2AHZA 2F43G 4JTDB 4ZOLB 2W0XA 5IYZA 2CGNA 1AVMA 5DM6V 1QR8A 4LP8A 4W4LA 2ZNIA 4GUNA 4X65B 3EXAA 4MT8A 5L3DA 2ZXWB 1SETA 2GDSA 5LL6Y 2Z3YA 4ZKIA 5EZYA 1XI1A 4TV8B 3CC7V 4DR4O 1ZUQA 4FZ1A 3W7TA 3RW0A 3CCMV 3LNNA 2P5OA 4YJ2A 1SF9A 3ETDA 2BSKB 5KA6A 2AXTZ 2V7QG 1XBLA 4H0LB 1R1BA 4CBCA 1M5IA 1AR1B 3JYCA 1KB9F 5FLXN 4TUYB 4WFEA 4RUEA 4NR1A 1WPBA 4JI4O 4DV1O 3A0HZ 5JCOA 4Z2WA 2PYJA 2B5UA 1WN7A 4DUYO 2VWKA 5JH7A 3JD1A 4JI0B 2WWWA 1Q86W 2R72A 3APQA 2ETNA 4NVPA 2Y69B 3K03A 4DV7B 2UUBO 1VQKV 1GN3A 3AG4B 1GM8A 3CMAV 1WA8A 1X4TA 5JJJB 2EZOA 3OMIB 1AJNA 2ILMA 3JARA 5DECA 4FPPA 4DR7B 1XOUA 3ASOB 1D5AA 2JIZG 2B9ZA 3HKEB 4I0XA 4I55B 4MVZA 5EYPA 1SQVH 3RYFA 3AK1A 2LQTA 1M9NA 4I50A 4LWSA 1L0NH 3TJTA 3ZX6A 4JAVA 2X6CA 2Y4TA 3FB8C 3W7WA 4DRXB 4O4LA 2LGWA 4H44B 2QKSA 3WG7C 5E1AC 3K58A 4DR7O 1HWYA 3K0GA 3ABUA 1M4UA 3JALB 4JPRA 1AROP 4H13B 2XAJA 4JYAB 1RSOA 3T1CA 2OCCB 4WFBV 3K0DA 4LFCB 4DYLA 5IJ0B 1OV9A 2UUBB 3S3XA 3P32A 1IXMA 3I56V 1K92A 2RNBA 2YDEA 2D3OW 2YSUB 4K0KO 4UUJC 1OCRC 1EFRG 3ZN0A 5KUMA 2XOKG 1XUQA 1JJ2U 1X59A 3VQXA 2IH3C 4MVSA 1VQOV 5EBWC 3VBBA 1PNMA 1VQ4V 4EKWA 4FFKA 1Y74B 3RN4A 1H2KA 5LMNO 1ZL8B 4JYYA 3APOA 1TUBA 3MHHC 4JI2O 3X2QB 4J11A 4J7ZA 2CTQA 5LBQA 1WB8A 4B3MO 2LO1A 2EIKB 1GAXA 4GKKB 3BA8A 1DK1A 2AHYA 1Z5VA 1HR0O 4JI1O 1R6NA 3CCVV 2UXDB 3S3WA 4DV6B 3WB0A 3ZHVA 4LF6O 4ASUG 1OCCC 3DC5A 4DR5B 1F4MA 3ZCCA 3FB6C 4NKGB 1HNXB 4ICGA 4Z1MG 5CB4A 3E8GA 1N8RW 5BZBA 1PKXA 3ZIAG 3HKEA 4YIPA 2HVJC 4X65O 3K59A 3ZRWA 2QTSA 3H1JH 3RYIB 3RYHB 3THOA 4JI5O 1GRJA 5FPOA 3K5NA 4CS4A 2WSSG 4DRXA 4JV5B 3AG2B 1FXKB 2W6IG 5EK0A 3OMNB 1OCZB 1BSMA 1D5NA 1YJNV 1Q8IA 3FX7A 2LJ2A 3B77A 5EC1C 4J10A 1XMQB 3OMAB 1XNQB 4CH5A 4O4JA 1Y4MA 5K1PA 1Z5WA 1VMGA 4TV9A 1I94O 2DYRB 3E83A 2YS8A 1WP8A 3B2EE 3LNMB 4B3RB 1XMOB 3AG4C 1JA8A 5IYBO 4YJ2B 5LGUA 4JI6O 3N2KB 3BPZA 5KHKA 3WU2Z 5F2VO 5KX5A 4CZZA 2ZM6O 4K8XA 4PA7A 1Q6HA 2XTAA 1YVWA 3KZIZ 2JJ2G 2OWOA 4DR1O 1VARA 1NTZH 2WLJA 2ADQB 4X20B 3IGAC 4LFBO 4IIJA 1WP7A 1NBMG 2ZM6B 3SGIA 4JI6B 3OD4A 1F7YA 3ZMTA 4X1YA 1US6A 4JYBA 5JWPA 2GBOA 2HJFC 1IDSA 4FLTA 4O4IA 3I5DA 1YCIA 1RSOB 4QE9A 2CGOA 3CSXA 1XNQO 5JCOC 2V4DA 3E89A 4E4EA 4PDRA 3E22A 1Q81W 3DXRA 5IJ9B 1BL8A 4FM1A 2EINC 4D6TH 1QU7A 2NN4A 5C8YB 1IBKB 4O2BA 2XT9A 3RVYA 4WFFA 2M7WA 2JS5A 3RFRA 1MABG 1CP9A 1TGOA 2EBOA 3ASNB 4JI5B 4I7ZB 4B3SB 1ZL8A 1UPGA 3UQ8A 2ZINA 3IJ4A 4LF4O 4MW8A 3P3PA 4DV0O 5IDJA 4AI8A 3WB2A 5JJNB 5KHJA 1IX9A 1QVFU 3H1LH 2F4VO 3SDLA 4TWKA 5H5NA 2UU9B 1GK9A 2YC0A 4DV6O 2GV9A 4N23A 3QTCA 5H9CA 1OZ0A 3CCLV 2ZIOA 2ZR3A 5LA6B 4JI2B 1ZAUA 1N0NA 5LMNB 2UXCB 4ZOLA 4X66B 3IC9A 4I5SA 4O4LB 3CYOA 1THZA 2PTMA 1JVMA 3JASA 4O2AA 4LF7O 4HZ3A 2EJRA 5BR8B 2HLDG 3NR7A 1JFFA 2AZ2A 1K7DA 4MTGA 1FS0G 2XAFA 3F5WC 3U0ZA 5GTHZ 4TQFA 3T1HO 3IAYA 4FFBA 4LF8O 1SZTA 1NVPD 2GTSA 1JCHA 4JGSA 1BZKA 2DW4A 1QVGU 1M56C 1LUVA 2IU0A 1WB7A 3L70H 1PNKA 3FD9A 3W7UA 4KP4A 3K5MA 3OM3B 1W0JG 2NR5A 3KCYA 2PGGA 2UXNA 5JVDA 3RWRD 4JZ2A 4JAUA 1W2BU 4IHJA 3UT5A 4I4TB 1BQZA 1VQLV 5L3CA 1NJIW 5B1BB 3OE7G 1WJZA 3LSQA 4X88A 2CTPA 3CRAA 3CWBH 4O4IB 1W59A 2IJJA 2OIGA 3SJAC 4J9ZB 1ROPA 2ZE6A 2OT5A 2AZ0A 2FL4A 4FMTA 4DV7O 4UVBA 2P7TC 4QGPA 2DQ3A 3VQWA 1TAEA 1R73A 4KHPO 1U96A 3STLC 3DSQA 1XNRB 5JH7B 3P30A 1LR1A 3H01A 3W7SA 1AP6A 4IYIA 4U3JB 2A06H 2QKAA 4X1KB 3F5TA 4GKJB 3OUFA 4DV1B 1H2SB 3M7MX 1PNLA 1H8EG 4DV4B 4DXWA 2QKCA 4ZI7B 1CPYA 1U97A 2YXYA 1N34O 3HB3B 3A8TA 2DMXA 3AK2A 1AI6A 4EEQA 4K3AA 1AILA 3B4SA 3F7YC 1S5LZ 3ETGA 1GN6A 4GT1A 3CXCU 1AP5A 5LOVA 4GLXA 1YIJV 1XEQA 4MVMA 1IZ3A 1BQ0A 3STZC 4YY3O 5L3EA 1MMMA 2Y4UA 1TUEB 1M57B 1NR1A 2ZE7A 3QO5A 3QG5A 3JAKA 4B3TO 1XL4A 3RVZA 5J9PC 1N0JA 3ICXA 2WLMA 2N74A 3SPJA 2BE3A 1TA8A 3UM7A 5FPRA 4F6EA 3L73H 1RPOA 5D5PA 1I5YA 3A0RA 3ZBHA 4LFAO 1G8MA 4HAMA 4X64O 4EB6B 1M93A 1VQPV 3ZEDA 4DW1A 2G38A 4PDLA 3TGUH 1SKVA 4B7KA 2QTOA 4W4KA 4LBEC 1LNQA 1B3QA 5IWAO 3G6EV 4FJCC 3K5LA 1N33O 3N2GA 3A0BZ 4NXMB 2EZPA 2PF4E 1FXHA 2VQEO 1HNZB 2WPDG 2A7WA 3ABMB 1QBZA 2Q67A 4B08A 4PHZA 1ZLZA 2X6AA 2XAQA 4DR3O 2LW7A 3ZS8C 5EBMC 4F6RA 2KSDA 3IFXA 5GONB 3H1KH 2Z5UA 2JRIA 3LDDA 4JI3O 4WFAV 2Y48A 4ZHQA 2ZDIA 4JASA 2L6LA 1R3IC 1SRYA 3N27A 2P4KA 3OR6C 4J9YB 3JAWA 1MZEA 2WA4A 4OX9B 3EHBB 3F7VC 3T4ZA 1DF4A 2GTAA 1A32A 5B1OA 5CB4B 2CUGA 2Q73A 2BTOA 2FMLA 3LSSA 5CBGA 2R70A 4HNAA 4YHHB 1R3LC 4KXRA 1TVKA 3L72H 2UUCO 1MSWD 5LOVB 2OYQA 4JTCB 5LYJB 1S3JA 1YJWV 1FJGO 2ZR2A 2RDCA 2OCCC 5L3FA 4TV9B 3FAVA 5KX5B 1FFXB 4FIPC 4MSWC 1AI5A 1MNGA 4RWUA 2P67A 2HVKC 4DV2O 5LP6C 3BVOA 2CK3G 2PY5A 2H8PC 3JSLA 4YIOA 1SQBH 1PM9A 3ZRXA 2E5LO 1G6UA 3SR2C 5BMVA 1YTFD 1YZBA 4LR3A 1IBLB 5LHGA 1NU1H 5LHHA 1F51A 3K3WA 2ODMA 4EB6A 2YI9A 2P4VA 5L3BA 4PA4A 3O9OA 1MOFA 5KHIA 1R3KC 2P6JA 1ZX3A 4NYKA 5EZYB 1Q5OA 3C3SA 3SYPA 3WB1A 1B6QA 3SYAA 1SESA 2UXBO 1EN5A 2KQXA 3ABKB 3AG1C 4DW0A 5KHHA 4QPJA 2LP7A 1YDXA 4OPAA 3CC2V 2X0LA 4DR2B 5KAFZ 3I55V 2DOSA 4UV8A 3K5OA 2GHYA 2F1MA 4U7NA 1NZ6A 3CJHB 3UKMA 3AG7A 1J95A 2FB5A 5B1NA 1FKAO 2EINB 2JEUA 2UXXA 5A9GA 3FYIB 3LSUA 5E79Z 3Q4HB 1DLBA 4UCSA 3BEHA 2QWNB 2BOBC 2D2CB 2Z0AA 2UUAO 1JOYA 4O4HB 4A5UB 3BABA 1V54B 4PA3A 1GKFA 4TUYA 4MVRA 1KU9A 1I7FA 1WLEA 1E79G 3JATA 5A2QN 3JCUZ 5L3GA 1O9GA 4GX1A 4FLUA 1NTMH 4BIOA 4TSFG 3JARB 4UB6Z 1E1QG 1Y67A 5FL7G 2PI5A 3CS5A 2Q7EA 3U11A 1BCCH 4FM2A 2P22C 2R9IA 4CH4A 1DF5A 2IBZH 3G67A 1ZSPA 2QM4A 3BCCH 4XDLA 3L71H 1JFFB 3B8NA 3BAAA 3OR7C 1NS1A 2JGDB 1S5HC 1V55C 5KUKA 2HHHO 4FK5C 3HKBB 3GWKC 2Q68A 5B3SB 2BSKA 5EYPB 5LGNA 2F93B 1VQMV 1Q7YW 3OGIB 3ZMSA 1XHXA 4X1IA 4ZBMA 1WPXA 3RYCB 1FJGB 2VQFO 4NTYA 2Q9LA 2KKWA 4X20A 1S5JA 1B06A 1JJOA 4DV3B 4FLZA 3JCZA 1M90W 3SPIA 1JPXA 5B1AC 4CS3A 4G27B 2YEVB 1NH2D 2NNUA 3MD0A 5IJ0A 1UFIA 2JJ1G 3AG1B 1HNWB 3IC7A 2VWJA 5B5EZ 4X62O 1JMKC 4GX0A 3HKDA 2PI4A 2WLLB 4G2KA 1HP8A 3D36C 1Y76B 1Y66A 3DXRB 4QJFB 2ZDIC 2Q8VA 3N2GB 3WG7B 1H38A 1Q3EA 2KG7A 1RP3B 3AEIA 1SQFA 1XREA 1Y74A 4JI8B 4DR3B 5LYJA 1MG1A 3J81N 2Q4PA 4FLWA 2QM8A 2JDIG 1L0LH 2Y69C 1HNZO 2B1IA 3CRRA 4UVCA 5HFMA 4TV8A 1NTKH 1Q90D 3UCSC 3CHXA 5LXTB 4Q6GA 1KQSU 1I08A 2QJ1A 5FNVB 1J5EO 1WA8B 4LFAB 5LP6A 2HJDA 3OTOB 3MDSA 3HKCB 1SQPH 2N05A 4MVOA 3SJQC 3T1YB 5J2TA 3ZHUA 4O4JB 4EFEA 2YIDA 5TISZ 5LA6A 3RT3C 3K06A 4PA9A 1UJWB 4DUZO 2OIEA 4FM0A 4JI8O 5B66Z 4F6RB 2ATKC 4JZGA 1T5EA 1XILA 3JAMN 5IYCO 3B8MA 1K8AW 3SYCA 5DEDA 4XBFA 1BS3A 3SPCA 1SQXH 2R9RB 1S76D 3K08A 4OXSA 2QSAA 1K5QA 1KECA 1PL0A 2ITCC 2EIMC 1XDCA 1JQ0A 3ABLC 5LMUO 4PA6A 3FYEB 1QR9A 2F66C 4DV3O 3W7XA 4GKJO 4RUFA 3OW2U 2WLKA 2ARHA 2E3CA 5CMUA 3OGCC 3OT7A 4LF5B 1VQ6V 5B3SC 1BHBA 1XNRO 2CTWA 3UO2A 4FLVA 3CXHF 2WLIB 4X89A 1K33A 3TK1A 2IW5A 2FTKA 1N36O 2ZE8A 1O9HA 3ABLB 1N32B 3KG2A 4LF5O 3QVNA 2DE0X 1VF5B 2DJVA 3RBZA 4BAYA 4DO2A 1VEWA 3E22B 5LMUB 1H8HG 4YJ3A 5EIBC 2ZT9B 4DV5B 2Y0IA 1EN6A 4I0XB 3CCEV 3CD6V 4IL6Z 5EIBD 3WFVA 2EILC 4JI7O 3E8BA 5IT9N 1K9MW 5IY5C 2ZQMA 4HNAB 4WCEV 2JGUA 3QF7A 1K5SA 5EC2C 2FKXA 3ZRWB 3ZHTA 1IURA 2GUZB 4LF9B 1OCZC 3CP1A 2V1DA 2IJIA 4F4LA 3AG3B 4X9QA 2EIJB 2EJ7A 4DUZB 1FD9A 1NT2B 2MW2B 1FAFA 4IGGA 1S77D 4RQEA 4LNUA 2EULA 2BCCH 4PDMA 3T1YO 4R50A 3K57A 3OTOO 3UO3A 3ASNC 3M8AA 3H9VA 5CA1A 3SPHA 2LFRA 4UVAA 4LF7B 3DC6A 1SA0B 4IT5A 4IYHA 4BR6A 3E8FA 1G4YB 1QLNA 3CPWU 4DR2O 4GX2A 4BIZA 2DYRC 4KL1A 4NXNB 5KLVH 2JVDA 3VQYA 4LH6A 1Q6UA 3M99B 3D36A 5KAIZ 4J41A 1OHHG 4PI2A 4CH6A 3OAAG 4KUMA 2Q0OC 2EIMB 1YJ9V 1P84F 1GO3F 4OPHA 4NTWA 3L9DA 2LW1A 4EFBA 1EBOA 1EZVH 2QEXV 4X62B 2ZIMA 1HNWO 2EIJC 5J2UA 2E5LB 1IXBA 4Q20A 3CEIA 5LP6B 2QR4A 1GM9A 1OCCB 3BY6A 3CMEV 1FYJA 1H2GA 3QNEA 3LDCA 3QO8A 2O57A 3CX5F 1GTOA 1OJHA 4I55A 1FXKA 3RGBA 4X1YB 1V9PA 2DYSB 1WNSA 2E74B 1KP3A 3C3TA 2UUCB 1BGYH 1BHAA 4DK1A 3K04A 4U3FH 1P4RA 2A3QA 3DTUB 5CA3A 1ENVA 1K4DC 2RCVA 1L1FA 3FB7C 5CBHA 4N21A 1GM7A 2CTRA 1AR4A 1K3EA 1OCOB 4UCRA 2K1EA 1VQ7V 4FLXA 2HHHB 4MTFA 4JI3B 3VQVA 4FLYA 1KP2A 5EBLC 4I50B 4LWSB 4UXNA 1R6TA 2HKOA 3LUTB 4DR1B 1ORQC 1RM1C 1GH6A 4L8JA 4WFGA 2QWPB 4ZI7A 4NXNO 1H2MA 2JK5C 3K9AA 3R66A 2YI8A 3ZMZA 4QPKA 4NXMO 3BRCA 3G80A 2Q0AA 5IWAB 1I94B 5LHIA 1BMFG 1URFA 2HEPA 2N04A 3DGEA 3ETEA 2CE4A 2IH1C 1LUWA 4H37A 1PD3A
chains in the Genus database with same CATH topology
2AGAA 5H5NA 3J7AU 1AB3A 4JV5O 1HNWO 4DV6O 1I94O 5IWAO 4DV7O 2UXBO 1N33O 4OX9O 1R1BA 2VQEO 2ZKOA 4JI7O 1D2DA 5IT9N 5FLXN 4JI6O 4OPAA 4DV4O 1IBMO 4K0KO 2ZM6O 3RT3C 1FYJA 2FKXA 4KHPO 1X59A 4JI4O 4DUZO 4DV1O 4DR3O 2LW7A 4JI8O 2DOSA 4LF9O 1IBKO 4DR1O 2VQFO 3F5TA 2JRIA 3JAMN 5LMNO 2UXCO 4DUYO 4LFBO 1HNXO 4LF7O 4JI3O 4JI2O 1FKAO 3J80N 4DR5O 1F7YA 4B3MO 4AQYO 1XMOO 1N34O 1DK1A 3T1HO 1HR0O 3T1YO 4JI1O 2Z0AA 2UUAO 2UUBO 2UXDO 4LF8O 2UU9O 4A5UB 3OTOO 4LF6O 1AILA 1A32A 3M8AA 4X62O 1XNQO 4GKKO 4DV5O 4JI0O 5LMUO 5BR8O 2UUCO 4DV3O 1XEQA 4GKJO 5A2QN 1R6TA 1FJGO 4YY3O 4X66O 1IBLO 4X65O 4DR2O 1N32O 1XNRO 1KUQA 4B3TO 3J81N 4B3SO 4DR6O 4JI5O 4DV2O 4NXNO 1G1XB 2N74A 5BXZA 3R66A 1HNZO 1N36O 4B3RO 4NXMO 2E5LO 4LF4O 4LF5O 5BY1A 1YZBA 4DV0O 1NS1A 4LFCO 5LL6Y 4DR7O 4LFAO 2DJVA 1XMQO 4JYAO 4X64O 2HHHO 4YHHO 3O65A 2F4VO 4OPHA 4DR4O 1J5EO 3SDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AGA A;  5H5N A;  3J7A U;  1AB3 A;  4JV5 O;  1HNW O;  4DV6 O;  1I94 O;  5IWA O;  4DV7 O;  2UXB O;  1N33 O;  4OX9 O;  1R1B A;  2VQE O;  2ZKO A;  4JI7 O;  1D2D A;  5IT9 N;  5FLX N;  4JI6 O;  4OPA A;  4DV4 O;  1IBM O;  4K0K O;  2ZM6 O;  3RT3 C;  1FYJ A;  2FKX A;  4KHP O;  1X59 A;  4JI4 O;  4DUZ O;  4DV1 O;  4DR3 O;  2LW7 A;  4JI8 O;  2DOS A;  4LF9 O;  1IBK O;  4DR1 O;  2VQF O;  3F5T A;  2JRI A;  3JAM N;  5LMN O;  2UXC O;  4DUY O;  4LFB O;  1HNX O;  4LF7 O;  4JI3 O;  4JI2 O;  1FKA O;  3J80 N;  4DR5 O;  1F7Y A;  4B3M O;  4AQY O;  1XMO O;  1N34 O;  1DK1 A;  3T1H O;  1HR0 O;  3T1Y O;  4JI1 O;  2Z0A A;  2UUA O;  2UUB O;  2UXD O;  4LF8 O;  2UU9 O;  4A5U B;  3OTO O;  4LF6 O;  1AIL A;  1A32 A;  3M8A A;  4X62 O;  1XNQ O;  4GKK O;  4DV5 O;  4JI0 O;  5LMU O;  5BR8 O;  2UUC O;  4DV3 O;  1XEQ A;  4GKJ O;  5A2Q N;  1R6T A;  1FJG O;  4YY3 O;  4X66 O;  1IBL O;  4X65 O;  4DR2 O;  1N32 O;  1XNR O;  1KUQ A;  4B3T O;  3J81 N;  4B3S O;  4DR6 O;  4JI5 O;  4DV2 O;  4NXN O;  1G1X B;  2N74 A;  5BXZ A;  3R66 A;  1HNZ O;  1N36 O;  4B3R O;  4NXM O;  2E5L O;  4LF4 O;  4LF5 O;  5BY1 A;  1YZB A;  4DV0 O;  1NS1 A;  4LFC O;  5LL6 Y;  4DR7 O;  4LFA O;  2DJV A;  1XMQ O;  4JYA O;  4X64 O;  2HHH O;  4YHH O;  3O65 A;  2F4V O;  4OPH A;  4DR4 O;  1J5E O;  3SDL A; 
#chains in the Genus database with same CATH topology
 4PJ0 Z;  1Q43 A;  3PJS K;  1I0H A;  1EZJ A;  1PP9 H;  2Q69 A;  1YHQ V;  3CCJ V;  1GN4 A;  1SZX A;  2ZKO A;  1NH2 B;  1D2D A;  2KG7 B;  3AG2 C;  5KMG A;  1Y76 A;  1NI8 A;  5JJE B;  1M56 B;  2F23 A;  2NLJ C;  1MSD A;  4B3T B;  1QHT A;  3TCU A;  2ZXW C;  4O2A B;  2P06 A;  4LF9 O;  4YY3 B;  4J7K A;  2P90 A;  4BWA A;  3CCR V;  4NB5 A;  2YEV A;  3ZRV A;  1SER A;  3HR0 A;  1MZF A;  3C90 A;  4JAA A;  2QWO B;  1VF7 A;  4QIW F;  1NVP B;  4JI7 B;  4D7S A;  3NXS A;  5ITZ B;  1OCR B;  2RQ6 A;  3D3Q A;  3G6B A;  4U7O A;  3JD2 A;  2HFE C;  2UXD O;  2B1G A;  3CCS V;  4ABM A;  1HR0 B;  4GKK O;  1VQ5 V;  1N34 B;  4DV5 O;  1HDJ A;  5B1B C;  4YXW G;  3FB5 C;  1K4C C;  2QM7 A;  3JAT B;  2CH7 B;  3MAQ A;  2QWR B;  5KHG A;  3JSN A;  2E75 B;  4C7U A;  4LH7 A;  1IBL O;  2GSM B;  3BFR A;  5JQG A;  5GTI Z;  2C2A A;  1FFT B;  1N32 O;  1GN2 A;  4KHP B;  5B1A B;  3CRQ A;  1N36 B;  4GYC B;  3N2K A;  3ZMV A;  2H94 A;  1I5X A;  4WBN A;  1V54 C;  4FFB B;  3EVK A;  1VF6 A;  1OCO C;  2EX3 A;  1ZTE A;  4LFC O;  3OEH G;  2BOC C;  4JYA O;  1QQC A;  1Q82 W;  2LGQ A;  2ZNJ A;  2YIC A;  2IJK A;  3OEE G;  1Q6I A;  1F4N A;  2AGA A;  4AIL C;  4E2L A;  2W0F C;  1KD1 W;  4IHJ B;  3SPG A;  3VOU A;  1KYO F;  3BA9 A;  4JTA B;  5KMG B;  4MVU A;  2YIB D;  3ML0 A;  4P9O A;  3JAK B;  3TET A;  2BTQ A;  4UCO A;  3E86 A;  2XUM A;  2QE7 G;  3SYO A;  3OFN G;  4PI0 A;  5GON A;  1AI4 A;  1JR9 A;  3K79 A;  1VQ9 V;  4ZIB A;  2A9H A;  2H3O A;  2RJZ A;  5ITZ A;  3ETQ A;  4LF8 B;  5J2U B;  1EN4 A;  3T1H B;  5AG2 A;  2ITD C;  1P49 A;  1FXK C;  4TOI A;  1J5E B;  1K34 A;  1CEZ A;  3L75 H;  5IYD O;  1SQQ H;  5BR8 O;  4JF3 A;  4DUY B;  3KCX A;  2XAH A;  3EFF K;  2QDO A;  4X66 O;  5IE9 A;  2A79 B;  3FAV B;  5JVD B;  2JEX A;  1YTF B;  3E35 A;  4P30 A;  5CA0 A;  4JI4 B;  3GWO A;  2IJH A;  3H1I H;  4I4T A;  4GX5 A;  2Q6A A;  1DGS A;  2Q7H A;  4FZ0 A;  2GUZ A;  3P3N A;  4RAI A;  2WLH A;  3ZRS A;  3TXS A;  1G1X B;  4X1K A;  4UV9 A;  4HBN A;  1RFY A;  2XAG A;  2HG5 C;  3PN1 A;  3E2E A;  2Y0P A;  3JD0 A;  4XDK A;  4DR4 B;  2F4V B;  1EM1 A;  4ZHQ B;  2YXL A;  3AK3 A;  3X2Q C;  5CBF A;  2PUS A;  5CA1 B;  4DV0 B;  3AG3 C;  1DTO A;  4WFH A;  4PDV A;  2DWE C;  5J2T B;  2R9A A;  3R65 A;  3CCQ V;  2VS0 A;  1AI7 A;  1BE3 H;  4DV4 O;  4LCU C;  5KA5 A;  3CE2 A;  2RMK B;  4PV1 B;  1K97 A;  2JS3 A;  4I9Q A;  2VQF B;  3CCU V;  1IBK O;  4U3J A;  4LNU B;  3ZHS A;  1H2N A;  3LDE A;  1M57 C;  3UT5 B;  3FKS G;  2X6B A;  4TT3 G;  2DQ0 A;  3CRC A;  1COW G;  5GW7 A;  1N4C A;  3CC4 V;  1QNM A;  2WAM A;  3A2F A;  3SJB C;  2K9P A;  1AJP A;  4MS2 A;  5HFL A;  3SJC C;  4O4H A;  2QGN A;  3KKY A;  4G28 B;  1SA0 A;  4CS2 A;  2OTL V;  1KKC A;  2HR3 A;  3HPL C;  4LC1 A;  4TQD A;  4LFB B;  4I9W A;  1R3J C;  4L87 A;  3FFQ A;  1VQ8 V;  4P2Z A;  3JD3 A;  1QCE A;  4DK0 A;  4MVQ A;  4CC5 A;  5IYZ B;  1KC8 W;  1XHZ A;  3RYF B;  4AHC A;  2VRZ A;  1H2L A;  4H33 A;  1AJQ A;  4NTX A;  1FPO A;  4KFM A;  1IBM B;  1YIT V;  1Y6X A;  2OTJ V;  1VIB A;  3K9S A;  2PYL A;  1BT8 A;  4B3R O;  2IU3 A;  1SC5 B;  1TUB B;  2DWD C;  2CDY A;  1Z2G A;  4BW5 A;  5BY1 A;  3OTF A;  4J42 A;  4J7J A;  1XMQ O;  4RQF A;  4B7E A;  4GCZ A;  2KB1 A;  3T2M A;  1AR5 A;  2FYU H;  4PEL A;  2M6Y A;  5LXT A;  3J7A U;  4FVM A;  4JV5 O;  2W6J G;  2HP8 A;  3SYQ A;  2UUA B;  4XDJ A;  5FNV A;  2QA4 V;  1NR7 A;  3RYI A;  1VF6 C;  1M1K W;  4UB8 Z;  3ZHQ A;  4BW9 A;  1R6K A;  1PL4 A;  3RYH A;  3ZJZ A;  1NKD A;  4DR6 B;  2RN9 A;  1NQT A;  3GVM A;  1YSC A;  3E8H A;  2WA3 A;  3H1H H;  1P7G A;  4JYC A;  1YI2 V;  1QLE B;  2UXC O;  4WBN B;  1HNX O;  2XND G;  4PD4 F;  3JAS B;  1F23 A;  3J80 N;  4DR5 O;  4AQY O;  4K35 A;  4BIU A;  4LF6 B;  3CJH A;  3ZHR A;  4Z1V A;  1VP7 A;  2UXB B;  1PPJ H;  2QWQ B;  4MTO A;  4R8C A;  4JI1 B;  3ABK C;  2UU9 O;  1WAZ A;  4K8Z A;  2WLN A;  1L8D A;  2DN9 A;  2YIA A;  2ZD9 A;  4AQY B;  4B3M B;  2WLL A;  1QLE C;  3D8C A;  1KMI Z;  1V55 B;  1TVK B;  3CB2 A;  2CH7 A;  2YXH A;  3BHP A;  5H2F Z;  4CC6 A;  4UCT A;  3TXQ A;  1XL6 A;  2YIB A;  2EIK C;  2DYS C;  2ZCE A;  5JQG B;  4LF4 B;  1P7B A;  4X1I B;  1S72 V;  1KBH A;  1IVS A;  5D5Q A;  4P9P A;  3G71 V;  3CRM A;  4B3S O;  4DR6 O;  4K0K B;  4DV2 B;  2EIL B;  1K73 W;  1S0V A;  4R6Z A;  5BXZ A;  1ZWI C;  2YUA A;  5CA0 B;  4UFZ A;  2ADP A;  2F95 B;  3JAL A;  2ZE5 A;  3RYC A;  2CAZ C;  1B04 A;  4MTX A;  3ZMU A;  5IY5 B;  1XQ8 A;  3T4D A;  1GMG A;  3L74 H;  3Q4H A;  5K1X A;  2PZS A;  3QO7 A;  4QNH B;  4YHH O;  3O65 A;  2AW9 A;  4WF9 V;  3U10 A;  2MK3 A;  3B09 A;  2Q7G A;  2JGD A;  1HW7 A;  1RM1 B;  1AB3 A;  5C8Y A;  3HKC A;  4O2B B;  5H6Q A;  2LFS A;  2XHB A;  3D3I A;  5H6R A;  4OX9 O;  1MA1 A;  1JX9 A;  2WLI A;  2Q5Z A;  3HKD B;  4QE7 A;  1IBM O;  1FXV A;  4MW3 A;  3JD4 A;  1SQG A;  2A0L A;  4J80 A;  3GB7 C;  3ASO C;  2XAS A;  4OGQ B;  4RO2 A;  3JAW B;  3MHS C;  4CH3 A;  3OUS A;  4IIJ B;  5C93 A;  4YJ3 B;  1YEW A;  1KKD A;  3ABM C;  1XMO O;  2VQE B;  1CXZ B;  1SS3 A;  2X7R B;  1N33 B;  5DN6 G;  1PV0 A;  5BMV B;  2E76 B;  3ZN1 A;  3G4S V;  1W0K G;  2OCH A;  1VQN V;  1YF2 A;  3HKB A;  3B40 A;  4JI0 O;  4UCU A;  4D7T A;  3ABT A;  1E1R G;  4X64 B;  1FFX A;  5IJ9 A;  4R7C A;  4GZR B;  2L35 A;  4HYO A;  5CN0 A;  5LGT A;  1RPR A;  1KUQ A;  2BTQ B;  4X8A A;  4UCV A;  1YXB A;  2IM9 A;  2AHZ A;  2F43 G;  4JTD B;  4ZOL B;  2W0X A;  5IYZ A;  2CGN A;  1AVM A;  5DM6 V;  1QR8 A;  4LP8 A;  4W4L A;  2ZNI A;  4GUN A;  4X65 B;  3EXA A;  4MT8 A;  5L3D A;  2ZXW B;  1SET A;  2GDS A;  5LL6 Y;  2Z3Y A;  4ZKI A;  5EZY A;  1XI1 A;  4TV8 B;  3CC7 V;  4DR4 O;  1ZUQ A;  4FZ1 A;  3W7T A;  3RW0 A;  3CCM V;  3LNN A;  2P5O A;  4YJ2 A;  1SF9 A;  3ETD A;  2BSK B;  5KA6 A;  2AXT Z;  2V7Q G;  1XBL A;  4H0L B;  1R1B A;  4CBC A;  1M5I A;  1AR1 B;  3JYC A;  1KB9 F;  5FLX N;  4TUY B;  4WFE A;  4RUE A;  4NR1 A;  1WPB A;  4JI4 O;  4DV1 O;  3A0H Z;  5JCO A;  4Z2W A;  2PYJ A;  2B5U A;  1WN7 A;  4DUY O;  2VWK A;  5JH7 A;  3JD1 A;  4JI0 B;  2WWW A;  1Q86 W;  2R72 A;  3APQ A;  2ETN A;  4NVP A;  2Y69 B;  3K03 A;  4DV7 B;  2UUB O;  1VQK V;  1GN3 A;  3AG4 B;  1GM8 A;  3CMA V;  1WA8 A;  1X4T A;  5JJJ B;  2EZO A;  3OMI B;  1AJN A;  2ILM A;  3JAR A;  5DEC A;  4FPP A;  4DR7 B;  1XOU A;  3ASO B;  1D5A A;  2JIZ G;  2B9Z A;  3HKE B;  4I0X A;  4I55 B;  4MVZ A;  5EYP A;  1SQV H;  3RYF A;  3AK1 A;  2LQT A;  1M9N A;  4I50 A;  4LWS A;  1L0N H;  3TJT A;  3ZX6 A;  4JAV A;  2X6C A;  2Y4T A;  3FB8 C;  3W7W A;  4DRX B;  4O4L A;  2LGW A;  4H44 B;  2QKS A;  3WG7 C;  5E1A C;  3K58 A;  4DR7 O;  1HWY A;  3K0G A;  3ABU A;  1M4U A;  3JAL B;  4JPR A;  1ARO P;  4H13 B;  2XAJ A;  4JYA B;  1RSO A;  3T1C A;  2OCC B;  4WFB V;  3K0D A;  4LFC B;  4DYL A;  5IJ0 B;  1OV9 A;  2UUB B;  3S3X A;  3P32 A;  1IXM A;  3I56 V;  1K92 A;  2RNB A;  2YDE A;  2D3O W;  2YSU B;  4K0K O;  4UUJ C;  1OCR C;  1EFR G;  3ZN0 A;  5KUM A;  2XOK G;  1XUQ A;  1JJ2 U;  1X59 A;  3VQX A;  2IH3 C;  4MVS A;  1VQO V;  5EBW C;  3VBB A;  1PNM A;  1VQ4 V;  4EKW A;  4FFK A;  1Y74 B;  3RN4 A;  1H2K A;  5LMN O;  1ZL8 B;  4JYY A;  3APO A;  1TUB A;  3MHH C;  4JI2 O;  3X2Q B;  4J11 A;  4J7Z A;  2CTQ A;  5LBQ A;  1WB8 A;  4B3M O;  2LO1 A;  2EIK B;  1GAX A;  4GKK B;  3BA8 A;  1DK1 A;  2AHY A;  1Z5V A;  1HR0 O;  4JI1 O;  1R6N A;  3CCV V;  2UXD B;  3S3W A;  4DV6 B;  3WB0 A;  3ZHV A;  4LF6 O;  4ASU G;  1OCC C;  3DC5 A;  4DR5 B;  1F4M A;  3ZCC A;  3FB6 C;  4NKG B;  1HNX B;  4ICG A;  4Z1M G;  5CB4 A;  3E8G A;  1N8R W;  5BZB A;  1PKX A;  3ZIA G;  3HKE A;  4YIP A;  2HVJ C;  4X65 O;  3K59 A;  3ZRW A;  2QTS A;  3H1J H;  3RYI B;  3RYH B;  3THO A;  4JI5 O;  1GRJ A;  5FPO A;  3K5N A;  4CS4 A;  2WSS G;  4DRX A;  4JV5 B;  3AG2 B;  1FXK B;  2W6I G;  5EK0 A;  3OMN B;  1OCZ B;  1BSM A;  1D5N A;  1YJN V;  1Q8I A;  3FX7 A;  2LJ2 A;  3B77 A;  5EC1 C;  4J10 A;  1XMQ B;  3OMA B;  1XNQ B;  4CH5 A;  4O4J A;  1Y4M A;  5K1P A;  1Z5W A;  1VMG A;  4TV9 A;  1I94 O;  2DYR B;  3E83 A;  2YS8 A;  1WP8 A;  3B2E E;  3LNM B;  4B3R B;  1XMO B;  3AG4 C;  1JA8 A;  5IYB O;  4YJ2 B;  5LGU A;  4JI6 O;  3N2K B;  3BPZ A;  5KHK A;  3WU2 Z;  5F2V O;  5KX5 A;  4CZZ A;  2ZM6 O;  4K8X A;  4PA7 A;  1Q6H A;  2XTA A;  1YVW A;  3KZI Z;  2JJ2 G;  2OWO A;  4DR1 O;  1VAR A;  1NTZ H;  2WLJ A;  2ADQ B;  4X20 B;  3IGA C;  4LFB O;  4IIJ A;  1WP7 A;  1NBM G;  2ZM6 B;  3SGI A;  4JI6 B;  3OD4 A;  1F7Y A;  3ZMT A;  4X1Y A;  1US6 A;  4JYB A;  5JWP A;  2GBO A;  2HJF C;  1IDS A;  4FLT A;  4O4I A;  3I5D A;  1YCI A;  1RSO B;  4QE9 A;  2CGO A;  3CSX A;  1XNQ O;  5JCO C;  2V4D A;  3E89 A;  4E4E A;  4PDR A;  3E22 A;  1Q81 W;  3DXR A;  5IJ9 B;  1BL8 A;  4FM1 A;  2EIN C;  4D6T H;  1QU7 A;  2NN4 A;  5C8Y B;  1IBK B;  4O2B A;  2XT9 A;  3RVY A;  4WFF A;  2M7W A;  2JS5 A;  3RFR A;  1MAB G;  1CP9 A;  1TGO A;  2EBO A;  3ASN B;  4JI5 B;  4I7Z B;  4B3S B;  1ZL8 A;  1UPG A;  3UQ8 A;  2ZIN A;  3IJ4 A;  4LF4 O;  4MW8 A;  3P3P A;  4DV0 O;  5IDJ A;  4AI8 A;  3WB2 A;  5JJN B;  5KHJ A;  1IX9 A;  1QVF U;  3H1L H;  2F4V O;  3SDL A;  4TWK A;  5H5N A;  2UU9 B;  1GK9 A;  2YC0 A;  4DV6 O;  2GV9 A;  4N23 A;  3QTC A;  5H9C A;  1OZ0 A;  3CCL V;  2ZIO A;  2ZR3 A;  5LA6 B;  4JI2 B;  1ZAU A;  1N0N A;  5LMN B;  2UXC B;  4ZOL A;  4X66 B;  3IC9 A;  4I5S A;  4O4L B;  3CYO A;  1THZ A;  2PTM A;  1JVM A;  3JAS A;  4O2A A;  4LF7 O;  4HZ3 A;  2EJR A;  5BR8 B;  2HLD G;  3NR7 A;  1JFF A;  2AZ2 A;  1K7D A;  4MTG A;  1FS0 G;  2XAF A;  3F5W C;  3U0Z A;  5GTH Z;  4TQF A;  3T1H O;  3IAY A;  4FFB A;  4LF8 O;  1SZT A;  1NVP D;  2GTS A;  1JCH A;  4JGS A;  1BZK A;  2DW4 A;  1QVG U;  1M56 C;  1LUV A;  2IU0 A;  1WB7 A;  3L70 H;  1PNK A;  3FD9 A;  3W7U A;  4KP4 A;  3K5M A;  3OM3 B;  1W0J G;  2NR5 A;  3KCY A;  2PGG A;  2UXN A;  5JVD A;  3RWR D;  4JZ2 A;  4JAU A;  1W2B U;  4IHJ A;  3UT5 A;  4I4T B;  1BQZ A;  1VQL V;  5L3C A;  1NJI W;  5B1B B;  3OE7 G;  1WJZ A;  3LSQ A;  4X88 A;  2CTP A;  3CRA A;  3CWB H;  4O4I B;  1W59 A;  2IJJ A;  2OIG A;  3SJA C;  4J9Z B;  1ROP A;  2ZE6 A;  2OT5 A;  2AZ0 A;  2FL4 A;  4FMT A;  4DV7 O;  4UVB A;  2P7T C;  4QGP A;  2DQ3 A;  3VQW A;  1TAE A;  1R73 A;  4KHP O;  1U96 A;  3STL C;  3DSQ A;  1XNR B;  5JH7 B;  3P30 A;  1LR1 A;  3H01 A;  3W7S A;  1AP6 A;  4IYI A;  4U3J B;  2A06 H;  2QKA A;  4X1K B;  3F5T A;  4GKJ B;  3OUF A;  4DV1 B;  1H2S B;  3M7M X;  1PNL A;  1H8E G;  4DV4 B;  4DXW A;  2QKC A;  4ZI7 B;  1CPY A;  1U97 A;  2YXY A;  1N34 O;  3HB3 B;  3A8T A;  2DMX A;  3AK2 A;  1AI6 A;  4EEQ A;  4K3A A;  1AIL A;  3B4S A;  3F7Y C;  1S5L Z;  3ETG A;  1GN6 A;  4GT1 A;  3CXC U;  1AP5 A;  5LOV A;  4GLX A;  1YIJ V;  1XEQ A;  4MVM A;  1IZ3 A;  1BQ0 A;  3STZ C;  4YY3 O;  5L3E A;  1MMM A;  2Y4U A;  1TUE B;  1M57 B;  1NR1 A;  2ZE7 A;  3QO5 A;  3QG5 A;  3JAK A;  4B3T O;  1XL4 A;  3RVZ A;  5J9P C;  1N0J A;  3ICX A;  2WLM A;  2N74 A;  3SPJ A;  2BE3 A;  1TA8 A;  3UM7 A;  5FPR A;  4F6E A;  3L73 H;  1RPO A;  5D5P A;  1I5Y A;  3A0R A;  3ZBH A;  4LFA O;  1G8M A;  4HAM A;  4X64 O;  4EB6 B;  1M93 A;  1VQP V;  3ZED A;  4DW1 A;  2G38 A;  4PDL A;  3TGU H;  1SKV A;  4B7K A;  2QTO A;  4W4K A;  4LBE C;  1LNQ A;  1B3Q A;  5IWA O;  3G6E V;  4FJC C;  3K5L A;  1N33 O;  3N2G A;  3A0B Z;  4NXM B;  2EZP A;  2PF4 E;  1FXH A;  2VQE O;  1HNZ B;  2WPD G;  2A7W A;  3ABM B;  1QBZ A;  2Q67 A;  4B08 A;  4PHZ A;  1ZLZ A;  2X6A A;  2XAQ A;  4DR3 O;  2LW7 A;  3ZS8 C;  5EBM C;  4F6R A;  2KSD A;  3IFX A;  5GON B;  3H1K H;  2Z5U A;  2JRI A;  3LDD A;  4JI3 O;  4WFA V;  2Y48 A;  4ZHQ A;  2ZDI A;  4JAS A;  2L6L A;  1R3I C;  1SRY A;  3N27 A;  2P4K A;  3OR6 C;  4J9Y B;  3JAW A;  1MZE A;  2WA4 A;  4OX9 B;  3EHB B;  3F7V C;  3T4Z A;  1DF4 A;  2GTA A;  1A32 A;  5B1O A;  5CB4 B;  2CUG A;  2Q73 A;  2BTO A;  2FML A;  3LSS A;  5CBG A;  2R70 A;  4HNA A;  4YHH B;  1R3L C;  4KXR A;  1TVK A;  3L72 H;  2UUC O;  1MSW D;  5LOV B;  2OYQ A;  4JTC B;  5LYJ B;  1S3J A;  1YJW V;  1FJG O;  2ZR2 A;  2RDC A;  2OCC C;  5L3F A;  4TV9 B;  3FAV A;  5KX5 B;  1FFX B;  4FIP C;  4MSW C;  1AI5 A;  1MNG A;  4RWU A;  2P67 A;  2HVK C;  4DV2 O;  5LP6 C;  3BVO A;  2CK3 G;  2PY5 A;  2H8P C;  3JSL A;  4YIO A;  1SQB H;  1PM9 A;  3ZRX A;  2E5L O;  1G6U A;  3SR2 C;  5BMV A;  1YTF D;  1YZB A;  4LR3 A;  1IBL B;  5LHG A;  1NU1 H;  5LHH A;  1F51 A;  3K3W A;  2ODM A;  4EB6 A;  2YI9 A;  2P4V A;  5L3B A;  4PA4 A;  3O9O A;  1MOF A;  5KHI A;  1R3K C;  2P6J A;  1ZX3 A;  4NYK A;  5EZY B;  1Q5O A;  3C3S A;  3SYP A;  3WB1 A;  1B6Q A;  3SYA A;  1SES A;  2UXB O;  1EN5 A;  2KQX A;  3ABK B;  3AG1 C;  4DW0 A;  5KHH A;  4QPJ A;  2LP7 A;  1YDX A;  4OPA A;  3CC2 V;  2X0L A;  4DR2 B;  5KAF Z;  3I55 V;  2DOS A;  4UV8 A;  3K5O A;  2GHY A;  2F1M A;  4U7N A;  1NZ6 A;  3CJH B;  3UKM A;  3AG7 A;  1J95 A;  2FB5 A;  5B1N A;  1FKA O;  2EIN B;  2JEU A;  2UXX A;  5A9G A;  3FYI B;  3LSU A;  5E79 Z;  3Q4H B;  1DLB A;  4UCS A;  3BEH A;  2QWN B;  2BOB C;  2D2C B;  2Z0A A;  2UUA O;  1JOY A;  4O4H B;  4A5U B;  3BAB A;  1V54 B;  4PA3 A;  1GKF A;  4TUY A;  4MVR A;  1KU9 A;  1I7F A;  1WLE A;  1E79 G;  3JAT A;  5A2Q N;  3JCU Z;  5L3G A;  1O9G A;  4GX1 A;  4FLU A;  1NTM H;  4BIO A;  4TSF G;  3JAR B;  4UB6 Z;  1E1Q G;  1Y67 A;  5FL7 G;  2PI5 A;  3CS5 A;  2Q7E A;  3U11 A;  1BCC H;  4FM2 A;  2P22 C;  2R9I A;  4CH4 A;  1DF5 A;  2IBZ H;  3G67 A;  1ZSP A;  2QM4 A;  3BCC H;  4XDL A;  3L71 H;  1JFF B;  3B8N A;  3BAA A;  3OR7 C;  1NS1 A;  2JGD B;  1S5H C;  1V55 C;  5KUK A;  2HHH O;  4FK5 C;  3HKB B;  3GWK C;  2Q68 A;  5B3S B;  2BSK A;  5EYP B;  5LGN A;  2F93 B;  1VQM V;  1Q7Y W;  3OGI B;  3ZMS A;  1XHX A;  4X1I A;  4ZBM A;  1WPX A;  3RYC B;  1FJG B;  2VQF O;  4NTY A;  2Q9L A;  2KKW A;  4X20 A;  1S5J A;  1B06 A;  1JJO A;  4DV3 B;  4FLZ A;  3JCZ A;  1M90 W;  3SPI A;  1JPX A;  5B1A C;  4CS3 A;  4G27 B;  2YEV B;  1NH2 D;  2NNU A;  3MD0 A;  5IJ0 A;  1UFI A;  2JJ1 G;  3AG1 B;  1HNW B;  3IC7 A;  2VWJ A;  5B5E Z;  4X62 O;  1JMK C;  4GX0 A;  3HKD A;  2PI4 A;  2WLL B;  4G2K A;  1HP8 A;  3D36 C;  1Y76 B;  1Y66 A;  3DXR B;  4QJF B;  2ZDI C;  2Q8V A;  3N2G B;  3WG7 B;  1H38 A;  1Q3E A;  2KG7 A;  1RP3 B;  3AEI A;  1SQF A;  1XRE A;  1Y74 A;  4JI8 B;  4DR3 B;  5LYJ A;  1MG1 A;  3J81 N;  2Q4P A;  4FLW A;  2QM8 A;  2JDI G;  1L0L H;  2Y69 C;  1HNZ O;  2B1I A;  3CRR A;  4UVC A;  5HFM A;  4TV8 A;  1NTK H;  1Q90 D;  3UCS C;  3CHX A;  5LXT B;  4Q6G A;  1KQS U;  1I08 A;  2QJ1 A;  5FNV B;  1J5E O;  1WA8 B;  4LFA B;  5LP6 A;  2HJD A;  3OTO B;  3MDS A;  3HKC B;  1SQP H;  2N05 A;  4MVO A;  3SJQ C;  3T1Y B;  5J2T A;  3ZHU A;  4O4J B;  4EFE A;  2YID A;  5TIS Z;  5LA6 A;  3RT3 C;  3K06 A;  4PA9 A;  1UJW B;  4DUZ O;  2OIE A;  4FM0 A;  4JI8 O;  5B66 Z;  4F6R B;  2ATK C;  4JZG A;  1T5E A;  1XIL A;  3JAM N;  5IYC O;  3B8M A;  1K8A W;  3SYC A;  5DED A;  4XBF A;  1BS3 A;  3SPC A;  1SQX H;  2R9R B;  1S76 D;  3K08 A;  4OXS A;  2QSA A;  1K5Q A;  1KEC A;  1PL0 A;  2ITC C;  2EIM C;  1XDC A;  1JQ0 A;  3ABL C;  5LMU O;  4PA6 A;  3FYE B;  1QR9 A;  2F66 C;  4DV3 O;  3W7X A;  4GKJ O;  4RUF A;  3OW2 U;  2WLK A;  2ARH A;  2E3C A;  5CMU A;  3OGC C;  3OT7 A;  4LF5 B;  1VQ6 V;  5B3S C;  1BHB A;  1XNR O;  2CTW A;  3UO2 A;  4FLV A;  3CXH F;  2WLI B;  4X89 A;  1K33 A;  3TK1 A;  2IW5 A;  2FTK A;  1N36 O;  2ZE8 A;  1O9H A;  3ABL B;  1N32 B;  3KG2 A;  4LF5 O;  3QVN A;  2DE0 X;  1VF5 B;  2DJV A;  3RBZ A;  4BAY A;  4DO2 A;  1VEW A;  3E22 B;  5LMU B;  1H8H G;  4YJ3 A;  5EIB C;  2ZT9 B;  4DV5 B;  2Y0I A;  1EN6 A;  4I0X B;  3CCE V;  3CD6 V;  4IL6 Z;  5EIB D;  3WFV A;  2EIL C;  4JI7 O;  3E8B A;  5IT9 N;  1K9M W;  5IY5 C;  2ZQM A;  4HNA B;  4WCE V;  2JGU A;  3QF7 A;  1K5S A;  5EC2 C;  2FKX A;  3ZRW B;  3ZHT A;  1IUR A;  2GUZ B;  4LF9 B;  1OCZ C;  3CP1 A;  2V1D A;  2IJI A;  4F4L A;  3AG3 B;  4X9Q A;  2EIJ B;  2EJ7 A;  4DUZ B;  1FD9 A;  1NT2 B;  2MW2 B;  1FAF A;  4IGG A;  1S77 D;  4RQE A;  4LNU A;  2EUL A;  2BCC H;  4PDM A;  3T1Y O;  4R50 A;  3K57 A;  3OTO O;  3UO3 A;  3ASN C;  3M8A A;  3H9V A;  5CA1 A;  3SPH A;  2LFR A;  4UVA A;  4LF7 B;  3DC6 A;  1SA0 B;  4IT5 A;  4IYH A;  4BR6 A;  3E8F A;  1G4Y B;  1QLN A;  3CPW U;  4DR2 O;  4GX2 A;  4BIZ A;  2DYR C;  4KL1 A;  4NXN B;  5KLV H;  2JVD A;  3VQY A;  4LH6 A;  1Q6U A;  3M99 B;  3D36 A;  5KAI Z;  4J41 A;  1OHH G;  4PI2 A;  4CH6 A;  3OAA G;  4KUM A;  2Q0O C;  2EIM B;  1YJ9 V;  1P84 F;  1GO3 F;  4OPH A;  4NTW A;  3L9D A;  2LW1 A;  4EFB A;  1EBO A;  1EZV H;  2QEX V;  4X62 B;  2ZIM A;  1HNW O;  2EIJ C;  5J2U A;  2E5L B;  1IXB A;  4Q20 A;  3CEI A;  5LP6 B;  2QR4 A;  1GM9 A;  1OCC B;  3BY6 A;  3CME V;  1FYJ A;  1H2G A;  3QNE A;  3LDC A;  3QO8 A;  2O57 A;  3CX5 F;  1GTO A;  1OJH A;  4I55 A;  1FXK A;  3RGB A;  4X1Y B;  1V9P A;  2DYS B;  1WNS A;  2E74 B;  1KP3 A;  3C3T A;  2UUC B;  1BGY H;  1BHA A;  4DK1 A;  3K04 A;  4U3F H;  1P4R A;  2A3Q A;  3DTU B;  5CA3 A;  1ENV A;  1K4D C;  2RCV A;  1L1F A;  3FB7 C;  5CBH A;  4N21 A;  1GM7 A;  2CTR A;  1AR4 A;  1K3E A;  1OCO B;  4UCR A;  2K1E A;  1VQ7 V;  4FLX A;  2HHH B;  4MTF A;  4JI3 B;  3VQV A;  4FLY A;  1KP2 A;  5EBL C;  4I50 B;  4LWS B;  4UXN A;  1R6T A;  2HKO A;  3LUT B;  4DR1 B;  1ORQ C;  1RM1 C;  1GH6 A;  4L8J A;  4WFG A;  2QWP B;  4ZI7 A;  4NXN O;  1H2M A;  2JK5 C;  3K9A A;  3R66 A;  2YI8 A;  3ZMZ A;  4QPK A;  4NXM O;  3BRC A;  3G80 A;  2Q0A A;  5IWA B;  1I94 B;  5LHI A;  1BMF G;  1URF A;  2HEP A;  2N04 A;  3DGE A;  3ETE A;  2CE4 A;  2IH1 C;  1LUW A;  4H37 A;  1PD3 A; 
#chains in the Genus database with same CATH homology
 2AGA A;  5H5N A;  3J7A U;  1AB3 A;  4JV5 O;  1HNW O;  4DV6 O;  1I94 O;  5IWA O;  4DV7 O;  2UXB O;  1N33 O;  4OX9 O;  1R1B A;  2VQE O;  2ZKO A;  4JI7 O;  1D2D A;  5IT9 N;  5FLX N;  4JI6 O;  4OPA A;  4DV4 O;  1IBM O;  4K0K O;  2ZM6 O;  3RT3 C;  1FYJ A;  2FKX A;  4KHP O;  1X59 A;  4JI4 O;  4DUZ O;  4DV1 O;  4DR3 O;  2LW7 A;  4JI8 O;  2DOS A;  4LF9 O;  1IBK O;  4DR1 O;  2VQF O;  3F5T A;  2JRI A;  3JAM N;  5LMN O;  2UXC O;  4DUY O;  4LFB O;  1HNX O;  4LF7 O;  4JI3 O;  4JI2 O;  1FKA O;  3J80 N;  4DR5 O;  1F7Y A;  4B3M O;  4AQY O;  1XMO O;  1N34 O;  1DK1 A;  3T1H O;  1HR0 O;  3T1Y O;  4JI1 O;  2Z0A A;  2UUA O;  2UUB O;  2UXD O;  4LF8 O;  2UU9 O;  4A5U B;  3OTO O;  4LF6 O;  1AIL A;  1A32 A;  3M8A A;  4X62 O;  1XNQ O;  4GKK O;  4DV5 O;  4JI0 O;  5LMU O;  5BR8 O;  2UUC O;  4DV3 O;  1XEQ A;  4GKJ O;  5A2Q N;  1R6T A;  1FJG O;  4YY3 O;  4X66 O;  1IBL O;  4X65 O;  4DR2 O;  1N32 O;  1XNR O;  1KUQ A;  4B3T O;  3J81 N;  4B3S O;  4DR6 O;  4JI5 O;  4DV2 O;  4NXN O;  1G1X B;  2N74 A;  5BXZ A;  3R66 A;  1HNZ O;  1N36 O;  4B3R O;  4NXM O;  2E5L O;  4LF4 O;  4LF5 O;  5BY1 A;  1YZB A;  4DV0 O;  1NS1 A;  4LFC O;  5LL6 Y;  4DR7 O;  4LFA O;  2DJV A;  1XMQ O;  4JYA O;  4X64 O;  2HHH O;  4YHH O;  3O65 A;  2F4V O;  4OPH A;  4DR4 O;  1J5E O;  3SDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...