2VQFO

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords 16S RRNA
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2vqfO00
2ZM6O 1FJGO 2UXDO 4X64O 4DV2O 4LFCO 4OPAA 5LL6Y 5IWAO 2JRIA 1IBMO 1XMQO 2DJVA 4X66O 1J5EO 4JI6O 2VQEO 3F5TA 4LF9O 3OTOO 1F7YA 4DR7O 4DR2O 1FKAO 1X59A 4JI8O 1XNRO 4DV0O 4DV5O 5BY1A 2UU9O 4DV4O 1XNQO 4JI0O 1AILA 3O65A 1R1BA 4JI2O 2UUBO 3JAMN 5H5NA 1KUQA 4JI1O 4DR6O 4AQYO 2UUCO 4LF5O 4LF8O 4DUZO 1AB3A 4NXNO 4JI5O 3R66A 1N34O 1XMOO 4JI7O 2N74A 4OPHA 4JI4O 4X65O 5A2QN 2ZKOA 4B3TO 1HNXO 4LF4O 4K0KO 5FLXN 4YHHO 2DOSA 4DV7O 4NXMO 1IBKO 1XEQA 1DK1A 4X62O 1N36O 1G1XB 4A5UB 3T1HO 1YZBA 5BR8O 4YY3O 2UXCO 2VQFO 1R6TA 1I94O 4LFAO 2AGAA 4OX9O 4DV1O 1D2DA 1HNWO 2UUAO 1HNZO 4DR4O 3T1YO 4DR5O 4LFBO 4DR3O 1FYJA 4LF6O 2E5LO 1N33O 2UXBO 3M8AA 1IBLO 1NS1A 2Z0AA 2FKXA 4LF7O 4B3MO 3J80N 4DR1O 4DV6O 1HR0O 1A32A 5LMUO 1N32O 4GKJO 4JYAO 4KHPO 5BXZA 3RT3C 3J7AU 4DUYO 2F4VO 3J81N 2LW7A 5LMNO 4JI3O 4B3RO 4DV3O 5IT9N 3SDLA 4JV5O 4GKKO 2HHHO 4B3SO
chains in the Genus database with same CATH superfamily
5KUMA 2ZM6O 3L75H 4K35A 1PD3A 2HLDG 4LFCO 2GV9A 2JRIA 3UO3A 3ZHVA 2BCCH 1W0JG 4JI6O 1BMFG 4LH7A 2EIKB 2DWDC 4UFZA 1N34B 5B1BB 4ZHQA 4IGGA 1Q7YW 2IJJA 3K06A 1G8MA 2GUZB 2RN9A 1YF2A 2BOCC 1Z5WA 5KHJA 3P3NA 4JI1O 3OGIB 4DR6O 3CD6V 1S5JA 1G4YB 2F43G 3OUFA 2YIDA 3UM7A 5B3SB 2GHYA 4J7KA 1X4TA 1ZL8B 1W0KG 1HNXO 2Q9LA 4YHHO 3G80A 3THOA 4GLXA 3ZRXA 5L3GA 2C2AA 4B3MB 3STLC 2PYLA 1NTKH 3OAAG 1N36B 1NVPD 1RP3B 3OTOB 4ZI7A 4W4LA 4DR3O 4QPKA 4PI2A 1BE3H 2QKAA 2YIBD 2EULA 4DV6O 2ZNJA 4UB6Z 4NKGB 1SA0B 2HG5C 2CTRA 4B7KA 4YJ3B 4U3JB 4UVCA 4OX9B 2F4VO 3IGAC 3K9AA 3AK1A 2JIZG 3EVKA 1JMKC 2W6JG 4RAIA 2OCCC 1UPGA 2F23A 5GTHZ 3AK2A 3ZBHA 3FD9A 5EC2C 3L74H 2VQEO 2YDEA 3CMEV 4JTAB 4MT8A 4O4JB 1GK9A 5JJEB 2JEUA 3RBZA 4H13B 2UU9O 3JALA 2WLMA 1QR9A 1R1BA 5LYJA 2UUBO 1K4CC 3ETGA 1PPJH 4KFMA 4ABMA 1YVWA 2CGOA 4IIJA 3AG3C 2EBOA 2V7QG 4MVSA 4NXNO 2CH7B 3GWKC 5JCOA 3ZN0A 2PUSA 5DM6V 3MD0A 4LF9B 3C3SA 4OPHA 4JI4O 3JCZA 4IYHA 2QWQB 1GN2A 4CH5A 4I0XA 4RQEA 5IYZA 5LMUB 1NI8A 1B3QA 1WA8A 2ZIMA 4X1KA 3BY6A 4J11A 1IBLB 2OTJV 2DYRC 3D3QA 4BAYA 4PA3A 3G67A 3UO2A 1K7DA 1I94O 3T1YB 3W7UA 2XAGA 4PDVA 3LSUA 4I9WA 2P5OA 2YICA 3P3PA 4X1YA 4DR3B 3ZHRA 3T1YO 1R3IC 4NR1A 2HVKC 1IBMB 2OT5A 3HKBB 3WB0A 1BCCH 1DF4A 5ITZA 3OE7G 1IDSA 5H2FZ 1U96A 1YTFD 5B1BC 1R73A 2G38A 1S77D 1TVKA 4N21A 1SERA 2IH3C 2XHBA 4JI6B 1I5XA 1HNXB 4UCSA 1K4DC 2WLIB 4I55B 3JD2A 1JVMA 1RPRA 2PI5A 3G4SV 1KECA 4GKKO 3B09A 4EFEA 3DGEA 3SPCA 2PGGA 4LNUA 4OPAA 2XAFA 1P49A 4O2BA 1MG1A 3E2EA 1KBHA 5EBLC 1NH2D 4DV1B 2P90A 1K9MW 1S3JA 3K04A 1MABG 1SA0A 3ETQA 1SQGA 5B5EZ 1ZAUA 4DV4O 2WA4A 1RFYA 4YXWG 3CRCA 1N0JA 5FL7G 5IYZB 3E8FA 3L72H 3CMAV 1NKDA 4OGQB 4AQYO 5CB4A 4GT1A 1GN4A 1GAXA 3E86A 3ZRVA 1YXBA 2PTMA 3LUTB 1H2NA 2A9HA 2QTOA 2IM9A 3VQYA 1LUVA 1XNRB 1N8RW 4K8ZA 4TQDA 3N27A 1M90W 2RJZA 4X1IA 5EZYA 2Q68A 3SJCC 3K5LA 2MW2B 4JI0B 1KKDA 1VQPV 2EX3A 3W7XA 3B8NA 2UUAB 3M99B 3RN4A 3JSLA 4DV4B 2Q8VA 2QM8A 3J80N 2QWRB 1N32O 4I4TB 1YCIA 4JYAO 1PM9A 4G2KA 4JI3B 2AZ0A 2JGDB 4HNAA 2D3OW 4Q20A 3VQVA 4WBNA 4DR4B 4FMTA 5J2TB 4JI3O 2BTOA 2EJRA 2UXDB 2RMKB 4L8JA 1M57C 4BIOA 1MNGA 5L3CA 3CS5A 4XDJA 1FJGO 1V55C 3CP1A 2P06A 1QQCA 2F95B 2Q7HA 4NTYA 2XT9A 3AG2B 2VWKA 2XNDG 4O4LB 4WF9V 4GX2A 5H9CA 1CEZA 1KP3A 3QNEA 3L73H 2EZPA 3CJHA 1NJIW 1JR9A 1THZA 4P30A 4HBNA 1NTZH 4PELA 3F7YC 4FLYA 4E4EA 4JI2O 3NR7A 3ICXA 4EKWA 4X66B 1WN7A 5CMUA 1TAEA 2EIKC 2VRZA 3K08A 3K5MA 5BMVA 4JI7B 2UUCB 3EXAA 4UCTA 4JI7O 3UQ8A 1FPOA 4B3TO 3K03A 4J9YB 3AG1C 4JYBA 4B3TB 3HKDA 1B06A 4PDRA 1VIBA 4UCVA 4JGSA 3K5OA 4PV1B 4BIUA 2WLKA 1GKFA 2RQ6A 5B3SC 4MTGA 2ILMA 3I55V 1GN6A 5C93A 1GH6A 1GM8A 1SF9A 1QBZA 4O2AB 4QNHB 2YXYA 3DC6A 1M5IA 4FLTA 3SGIA 4LF7O 2ETNA 3ASOB 4UXNA 1A32A 2E5LB 2KG7A 2ITDC 4DR7B 1Y76A 2WLLA 3CCMV 2QTSA 1YI2V 2X6CA 2WPDG 1SQVH 1OCZB 1FFXA 3SYOA 4LBEC 4B3RO 3JAWA 1PNLA 1RSOB 1TA8A 3O9OA 1FJGB 4FM0A 4P9OA 1JJ2U 3OMIB 5JWPA 1V54B 4QIWF 2ZQMA 4LWSB 2QM4A 1J5EO 1IBKB 5FPRA 1DLBA 3JD0A 4X20A 3MHHC 2JGDA 1UFIA 4X20B 4QJFB 4R6ZA 4W4KA 5KMGB 1EN5A 2OWOA 5K1XA 2W0XA 5J2TA 1KMIZ 5KUKA 4WFBV 1Y74B 2WAMA 3CC2V 1IXMA 2UUCO 3STZC 2Q7GA 5EC1C 4JI5O 1QU7A 3CWBH 3QF7A 4LCUC 1JQ0A 3WU2Z 3FB5C 5IJ9B 1M56B 1L8DA 4X1IB 4BR6A 4DO2A 1JJOA 2DOSA 5LOVA 1WP7A 2BTQB 2LQTA 3ABMC 3E35A 2JJ1G 1N36O 1VQ6V 1G1XB 1IXBA 1WA8B 5KA5A 1JX9A 4KXRA 4FLWA 1YZBA 2LFRA 1JFFA 1Y66A 1QHTA 2EIJC 3CHXA 3H01A 4DV6B 1N33O 2HR3A 3OD4A 4QE9A 2IBZH 5KLVH 2DYRB 1N33B 4J41A 2F1MA 1Q5OA 5JQGA 1K97A 2ZDIA 1Q86W 2XOKG 5BR8B 4JZGA 2GBOA 2YS8A 3E89A 5D5PA 2ZM6B 2WA3A 4B3SO 4NB5A 3IC9A 4ZIBA 2GSMB 3PN1A 2DN9A 4KHPB 2LP7A 4FPPA 4GCZA 1LNQA 3K9SA 1H2GA 2E76B 3CCSV 3N2GA 2Z3YA 4NXNB 1L0LH 2RDCA 4YY3B 2IU0A 2HHHB 2DQ0A 3ABTA 5BZBA 2PF4E 4U3JA 1PV0A 4IT5A 1FAFA 5LOVB 3KZIZ 3RYIA 3ZMZA 4FZ1A 4LFCB 2W0FC 2B9ZA 1Q8IA 3WG7C 2KB1A 3FYIB 4TOIA 1I7FA 4FVMA 1OHHG 1YDXA 1AI6A 4HNAB 2Y69C 5LHHA 2GTAA 2QKSA 4YHHB 2CDYA 5CBGA 3ZRWB 2OIGA 4CH6A 5LBQA 3ASOC 1Q6UA 4MSWC 1XEQA 2JDIG 2ZDIC 4H33A 2X7RB 5KHIA 1OCZC 3AEIA 4JI1B 3VOUA 3ABUA 4Z1MG 2LJ2A 2CGNA 3HB3B 3JD3A 5CA0A 5EYPB 3L71H 1MOFA 1PNKA 5GW7A 1FXVA 2KG7B 4DR5O 1OCRC 1IVSA 1V54C 2UXBO 4H0LB 5LA6B 2BTQA 4LNUB 4AQYB 1HDJA 2YSUB 3FB7C 4IYIA 1YJNV 3RT3C 3N2GB 2JGUA 4O4HB 3WB2A 4X1YB 2QGNA 1M9NA 4MW3A 3T1CA 1K5QA 1P4RA 1R6KA 4DR1B 2BSKA 2IJIA 1KD1W 2WLNA 5C8YB 3PJSK 3F5TA 3OTOO 1M56C 4PHZA 3SPGA 3JARA 4JYAB 4I7ZB 1LUWA 1M57B 2M7WA 3R65A 1V55B 2CH7A 4JASA 2P4VA 2ZE8A 3E8GA 1O9GA 3FFQA 4MVMA 3SPHA 3AG2C 3SJQC 1OV9A 1AR1B 1P7BA 1BT8A 2F93B 2Q0AA 1BSMA 1KU9A 1QVGU 5LXTA 4DUZB 3CC4V 4JYYA 2R72A 3OFNG 2RNBA 3C90A 2UU9B 3KCYA 4PJ0Z 3VQXA 1E1QG 4RO2A 4X1KB 5J9PC 4K3AA 2QE7G 5KA6A 4CZZA 2YXHA 4X89A 2XAQA 1KYOF 2R9RB 3CYOA 5TISZ 4UCUA 1XL6A 4D7SA 3E22A 1K33A 4U7NA 3AG1B 3B4SA 1EN4A 3DXRA 2ODMA 3KKYA 1WPBA 1K5SA 1VF7A 3CX5F 3TXSA 4D7TA 4U3FH 3ML0A 2Q4PA 1K73W 5CBFA 3S3XA 3OR7C 2A3QA 4WFGA 2QJ1A 5FNVA 2XTAA 4CS3A 1F23A 1YIJV 1SQBH 1X59A 3G6BA 2N05A 5CA1B 5LL6Y 3ZMUA 4JZ2A 5IY5B 4HYOA 5B1AC 4EB6A 5LGTA 4QPJA 2AHYA 2DW4A 2N04A 2DMXA 1VQKV 1ZWIC 2Y0PA 1Q6HA 3RYCB 3CCUV 3K59A 2EINC 5LXTB 1G6UA 4UCRA 1AP5A 4X8AA 1SQXH 5KMGA 5DN6G 1CPYA 5KX5B 3JD1A 3D36A 4LFAB 4FFKA 5B66Z 3JARB 4L87A 2IJKA 1I5YA 1OCRB 3HKBA 1TGOA 3P32A 1YHQV 1SQQH 5B1OA 3BFRA 4K0KB 3BCCH 3LNNA 4X65B 4GKJB 1QLEB 3N2KA 4LC1A 5CA3A 3OEHG 1IBKO 3BRCA 4R8CA 5EZYB 1K92A 1AJQA 3Q4HB 1YTFB 4O2BB 4DR6B 3ABKC 4HZ3A 1F4NA 4NYKA 2UXXA 5IJ0A 2UUAO 4I0XB 4LFBO 3LDDA 3B40A 1YJ9V 2E5LO 1AI7A 1XBLA 3ABMB 3APQA 1WP8A 2ZE6A 4ZBMA 1N32B 4YIPA 1XILA 1AJNA 1VQNV 1J95A 3OR6C 2BE3A 4WFHA 4FIPC 2EIJB 2HKOA 5E79Z 3RYHA 4TSFG 2L6LA 4MVUA 1XL4A 4YJ2B 1VQ9V 1E79G 4DV2O 1FFTB 4CS2A 1HW7A 3CCVV 1NU1H 2A06H 3B77A 3CCLV 5LHGA 4MTFA 3B2EE 4DR2O 1FS0G 1D5NA 1D5AA 4DV5O 1S76D 4PA6A 3JD4A 3NXSA 1JCHA 3ZMVA 2ZD9A 4J7JA 1URFA 3ZN1A 4FLUA 3JAMN 1H8EG 3N2KB 4JTCB 4AI8A 1Q82W 3VBBA 5J2UB 5BMVB 1JFFB 3BA8A 2ZE5A 3RYIB 1NBMG 2WSSG 5EBWC 3RYFB 2AW9A 5IYBO 3OTFA 3DTUB 1RPOA 2FL4A 5IJ0B 5L3FA 4DUYB 5A2QN 4K0KO 3SYPA 2YI8A 5IWAB 2Q73A 3P30A 3QO5A 1CP9A 4O4JA 5H6QA 3WG7B 2P4KA 3H1LH 2E74B 4HAMA 4O2AA 4X62B 1KQSU 2Y69B 2AXTZ 3GB7C 4OX9O 4DR2B 3BPZA 3ZRWA 1KC8W 4I5SA 3OM3B 4UV8A 3K0DA 4PD4F 3TJTA 2M6YA 3ZHSA 3I56V 1COWG 3HKEA 1FYJA 3MDSA 2ZXWB 1EN6A 1NS1A 5B1AB 2Q5ZA 1L0NH 3H1HH 1YSCA 4NVPA 2X6BA 4ZI7B 1VQ4V 4KHPO 2QSAA 1IURA 3BABA 1DGSA 4MVOA 2VQEB 4CH4A 2EJ7A 1IZ3A 2XAHA 4B3SB 4IHJA 4DV3O 3K79A 3D8CA 4I4TA 3AG7A 3WB1A 1ROPA 1DF5A 1TUEB 2IH1C 5IWAO 4QGPA 3GWOA 1BGYH 4FJCC 1IBMO 3L70H 5DEDA 1EZVH 4ASUG 3TCUA 3CRAA 1XMOB 4DR7O 3DSQA 4DYLA 3OMNB 1XNRO 2OCHA 3RYFA 1ZLZA 3CCRV 2QA4V 1QLEC 3CCJV 3BHPA 2Z5UA 1VARA 3O65A 1AR4A 4BIZA 5IJ9A 2HJDA 4JAAA 3UKMA 1Y74A 2PY5A 3A0HZ 1OCOC 1J5EB 3FB6C 1N0NA 2JK5C 2DQ3A 1N34O 4AHCA 3A0RA 2K1EA 2AZ2A 2ZKOA 5JJJB 4DV3B 2W6IG 2P67A 4FLZA 2VS0A 4J7ZA 4PA9A 4DK1A 4NXMO 1US6A 3JASA 4XBFA 3K58A 1EFRG 4CC5A 1S72V 4LF7B 1U97A 1SZTA 1NT2B 4JF3A 3QVNA 5IYCO 2WWWA 1PL4A 4UCOA 2CAZC 2DWEC 1R6NA 1YJWV 3JYCA 1HNZO 1FXKA 2B5UA 2JJ2G 1XQ8A 2DE0X 5EBMC 5AG2A 5C8YA 4UB8Z 1FD9A 4FLXA 4H44B 1OCCB 1Z2GA 1FXKB 1AI4A 2WLJA 4LF5B 3ZMSA 3RFRA 1TVKB 1AJPA 2WLLB 1HNWB 4LR3A 1FXHA 4R50A 2GTSA 1MA1A 3ZIAG 5LYJB 5JCOC 3Q4HA 2ZR3A 1E1RG 2LGQA 2ARHA 3A2FA 4JV5O 3AG4B 2YEVB 1R3KC 1H2SB 1GMGA 2PZSA 5EYPA 5KHHA 4TV9A 2D2CB 2AHZA 1WJZA 4LWSA 1K8AW 3IAYA 3JASB 4Z2WA 4LF9O 1BZKA 1FKAO 2ZINA 5BY1A 2YIAA 1ZUQA 2HP8A 3E83A 3T2MA 5EIBD 5IY5C 3QTCA 2CTPA 3JATA 5IDJA 4WFEA 4LF5O 4U7OA 2B1IA 4FFBB 4DUZO 2EINB 4GUNA 4RQFA 4C7UA 3R66A 3CB2A 1Y67A 3DXRB 3LDEA 4LF4O 3ZCCA 1H8HG 1Y4MA 1VQOV 4NXMB 4GX1A 1P84F 4LF4B 2DYSC 4MTXA 2H8PC 3ZEDA 3U0ZA 4A5UB 2EILC 2QKCA 1SETA 2H94A 1WLEA 2P22C 3CEIA 4YY3O 4EB6B 2HJFC 2HVJC 1AR5A 1NZ6A 2A7WA 1L1FA 4X88A 3FX7A 4DR4O 3X2QB 5K1PA 5KAFZ 3M8AA 2LFSA 1ZL8A 1H38A 4PDLA 1Q43A 1BL8A 5CA1A 1NR1A 3BAAA 5LMUO 5EIBC 3ZMTA 1MSDA 3ABKB 5IE9A 3H1JH 2QM7A 2ZR2A 4B7EA 2O57A 2VWJA 2LW7A 1W59A 2V1DA 3E22B 3K5NA 1AP6A 4H37A 1SESA 1MMMA 2BSKB 4O4LA 4X64O 1M4UA 1OCOB 2LO1A 4X66O 2WLIA 4I55A 1NQTA 1F7YA 4MVQA 3WFVA 2PYJA 2YC0A 3IJ4A 3F5WC 2NR5A 2UXCB 1VF6A 1Q81W 2ADQB 2Q0OC 5LHIA 1XNQO 1PL0A 4EFBA 2OTLV 4B3RB 4ICGA 4F4LA 3JAKB 1KUQA 1F51A 2VQFB 1NTMH 1GO3F 1EZJA 4UVBA 1SS3A 1BS3A 1SZXA 3JSNA 4JI8B 4O4IA 4LF8O 4J10A 1ORQC 4RWUA 1ZTEA 1JPXA 2BOBC 3OMAB 5KAIZ 2ATKC 4X65O 2UUBB 3L9DA 1OJHA 1YEWA 1LR1A 3W7WA 4P9PA 5FPOA 4YJ2A 1M1KW 4ZOLA 5JH7B 3T1HO 3FAVB 3F7VC 3APOA 4I50B 1VQ7V 5A9GA 4DXWA 2GDSA 2F4VB 1TUBA 4DV5B 4F6RA 4GX5A 5JH7A 1HNWO 3AG4C 4FLVA 2Q69A 5KX5A 3ABLB 2NNUA 1M93A 1HR0B 3T4ZA 1ZX3A 4DRXB 1XNQB 3E8BA 1IBLO 1HR0O 5LP6A 1NR7A 4YIOA 3OW2U 2ZIOA 3HPLC 4PDMA 4TV8A 1WPXA 5CA0B 4KUMA 1SKVA 2B1GA 3TK1A 4XDKA 5LMNO 2ZXWC 4DV2B 2QWNB 1Y76B 2CK3G 3SR2C 5LGNA 2X0LA 3A0BZ 5DECA 2LW1A 2RCVA 2P6JA 5JVDA 2WLHA 4TT3G 3RYCA 2P7TC 1AVMA 2V4DA 1T5EA 2QWPB 4GX0A 1WB7A 2Q6AA 4WFFA 5JJNB 2YUAA 4O4IB 5CN0A 4JI4B 4DV0O 1SQFA 4GKKB 4F6RB 3C3TA 4FM1A 3FAVA 1VQMV 1AILA 3OUSA 2DYSB 3CSXA 4F6EA 2UXNA 4WFAV 1XHZA 4JTDB 5H5NA 3SJAC 1Q3EA 4BW9A 4E2LA 2Y48A 3RVYA 1MZFA 5L3BA 3CJHB 2EZOA 3ASNB 5GONB 1AB3A 5L3EA 3IC7A 3JAKA 4QE7A 1VQ5V 3X2QC 1XMOO 5LMNB 1H2LA 3ZHUA 1UJWB 1QCEA 4IIJB 3CC7V 4DV7O 4GZRB 4JI2B 3CPWU 1IX9A 3UCSC 1R3LC 2UXCO 5LP6C 1R6TA 4JYCA 4LP8A 3T4DA 1VP7A 2AGAA 4K8XA 2F66C 5J2UA 4I50A 3UT5A 1ZSPA 1ENVA 4DW1A 1RM1B 1S0VA 3ZX6A 2LGWA 4B3MO 3UT5B 5E1AC 5LGUA 2PI4A 4Q6GA 3D3IA 5BXZA 5IYDO 1NH2B 4MVZA 2K9PA 3MHSC 3HKEB 2HHHO 1OCCC 1FXKC 1AI5A 4DR5B 1VF5B 2Y0IA 4RUFA 1XREA 1XMQO 3LDCA 1GM7A 1QNMA 3CE2A 1XMQB 3U11A 3ZJZA 3LSSA 2KQXA 1NVPB 3EHBB 3SYAA 4N23A 3ZS8C 4IHJB 4X9QA 5HFMA 4EEQA 4I9QA 2YEVA 4NTWA 1P7GA 4WBNB 4JI0O 1XOUA 1RSOA 2E75B 3D36C 1Y6XA 3KCXA 3FYEB 4CBCA 4TQFA 3FKSG 1DTOA 4B08A 4CH3A 4G28B 4MS2A 4NTXA 3ABLC 1EBOA 1F4MA 2N74A 1WAZA 5H6RA 4JV5B 3TGUH 4FFBA 4XDLA 5CBHA 5GONA 4DV7B 1GRJA 5D5QA 3CXCU 3K0GA 1BQZA 1I0HA 1S5LZ 5B1NA 2EIMB 2YXLA 1KP2A 4MW8A 4FM2A 2YIBA 4JAUA 4X62O 3ZHTA 1B6QA 3W7SA 4TV9B 3K57A 2ITCC 4UV9A 3BA9A 4CS4A 4DK0A 1BQ0A 2ADPA 2Q7EA 5F2VO 3G71V 2XASA 1YITV 2CUGA 1I94B 1KB9F 2ZE7A 1MSWD 3ZRSA 5LA6A 2CTQA 4TV8B 2HFEC 2FKXA 3RWRD 2EILB 4DR1O 3TXQA 2JEXA 1H2KA 1K3EA 4UVAA 1VMGA 1EM1A 3ETEA 2FB5A 3ZHQA 3G6EV 3RW0A 1PNMA 4O4HA 4DUYO 2R9IA 1WNSA 3A8TA 5GTIZ 3HKDB 1TUBB 2IU3A 3H1IH 2IW5A 3OGCC 3ASNC 2DJVA 3K3WA 3EFFK 4J42A 4GYCB 1Z5VA 1O9HA 1VF6C 3AG3B 3AK3A 3CXHF 1HWYA 4DW0A 2FMLA 3RYHB 1QVFU 1VEWA 2JVDA 1FFXB 1S5HC 1I08A 2QDOA 3H1KH 4UUJC 3VQWA 3S3WA 4JPRA 5LP6B 3LNMB 4YJ3A 4BWAA 2Y4TA 2Y4UA 4AILC 3IFXA 1SC5B 4WCEV 2CTWA 1JOYA 4LFBB 2UXBB 3ETDA 3H9VA 1RM1C 3RVZA 3BEHA 5FLXN 1WB8A 1XDCA 2NN4A 2NLJC 4BW5A 3KG2A 3BVOA 3OEEG 2KSDA 2A0LA 1SRYA 3QO8A 2H3OA 1DK1A 2IJHA 4JI5B 3CCQV 2ZNIA 5KHGA 1GTOA 3FB8C 2VQFO 5JQGB 4LFAO 2FYUH 1HNZB 4DV1O 1BHAA 1GN3A 2L35A 2ZT9B 2XAJA 1SQPH 3JATB 1VQLV 1R3JC 1XUQA 2KKWA 4J9ZB 2R70A 2YI9A 1HP8A 3B8MA 4ZKIA 2R9AA 4TUYA 2Z0AA 3HKCB 4MTOA 3LSQA 5FNVB 4KP4A 5L3DA 4D6TH 4GKJO 2X6AA 2Q67A 3HKCA 2JS3A 4TWKA 3J7AU 3GVMA 3W7TA 4LH6A 3JCUZ 5IT9N 2JS5A 3RGBA 3U10A 4X64B 2GUZA 3CRMA 4Z1VA 4KL1A 4PA7A 2UXDO 3QO7A 1Q6IA 3CRRA 2MK3A 3HR0A 2HEPA 3MAQA 4CC6A 3OT7A 1B04A 4JI8O 4LF8B 1Q90D 1QLNA 1PP9H 4FZ0A 3SJBC 2EIMC 1XHXA 3CRQA 1V9PA 4IL6Z 2A79B 1CXZB 3TETA 1AROP 5CB4B 5EK0A 2OYQA 2OCCB 4FK5C 4ZHQB 3T1HB 3M7MX 3QG5A 2ZCEA 5ITZB 3I5DA 4DRXA 1H2MA 4PI0A 4MVRA 4G27B 1JA8A 1W2BU 4TUYB 2CE4A 4P2ZA 1MZEA 5HFLA 1BHBA 1XI1A 3CCEV 3E8HA 5BR8O 4DV0B 1QR8A 1D2DA 1OZ0A 3JAWB 1VQ8V 2FTKA 3SPIA 4PA4A 2QEXV 4LF6O 2OIEA 5KHKA 4R7CA 4RUEA 1N4CA 5JVDB 3SPJA 4LF6B 4OXSA 1K34A 2QWOB 2E3CA 3SYCA 1PKXA 3J81N 3SYQA 4J80A 1KKCA 2XUMA 3SDLA 4ZOLB 2QR4A 3JALB 1GM9A 4JAVA 3DC5A
chains in the Genus database with same CATH topology
2ZM6O 1FJGO 2UXDO 4X64O 4DV2O 4LFCO 4OPAA 5LL6Y 5IWAO 2JRIA 1IBMO 1XMQO 2DJVA 4X66O 1J5EO 4JI6O 2VQEO 3F5TA 4LF9O 3OTOO 1F7YA 4DR7O 4DR2O 1FKAO 1X59A 4JI8O 1XNRO 4DV0O 4DV5O 5BY1A 2UU9O 4DV4O 1XNQO 4JI0O 1AILA 3O65A 1R1BA 4JI2O 2UUBO 3JAMN 5H5NA 1KUQA 4JI1O 4DR6O 4AQYO 2UUCO 4LF5O 4LF8O 4DUZO 1AB3A 4NXNO 4JI5O 3R66A 1N34O 1XMOO 4JI7O 2N74A 4OPHA 4JI4O 4X65O 5A2QN 2ZKOA 4B3TO 1HNXO 4LF4O 4K0KO 5FLXN 4YHHO 2DOSA 4DV7O 4NXMO 1IBKO 1XEQA 1DK1A 4X62O 1N36O 1G1XB 4A5UB 3T1HO 1YZBA 5BR8O 4YY3O 2UXCO 2VQFO 1R6TA 1I94O 4LFAO 2AGAA 4OX9O 4DV1O 1D2DA 1HNWO 2UUAO 1HNZO 4DR4O 3T1YO 4DR5O 4LFBO 4DR3O 1FYJA 4LF6O 2E5LO 1N33O 2UXBO 3M8AA 1IBLO 1NS1A 2Z0AA 2FKXA 4LF7O 4B3MO 3J80N 4DR1O 4DV6O 1HR0O 1A32A 5LMUO 1N32O 4GKJO 4JYAO 4KHPO 5BXZA 3RT3C 3J7AU 4DUYO 2F4VO 3J81N 2LW7A 5LMNO 4JI3O 4B3RO 4DV3O 5IT9N 3SDLA 4JV5O 4GKKO 2HHHO 4B3SO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZM6 O;  1FJG O;  2UXD O;  4X64 O;  4DV2 O;  4LFC O;  4OPA A;  5LL6 Y;  5IWA O;  2JRI A;  1IBM O;  1XMQ O;  2DJV A;  4X66 O;  1J5E O;  4JI6 O;  2VQE O;  3F5T A;  4LF9 O;  3OTO O;  1F7Y A;  4DR7 O;  4DR2 O;  1FKA O;  1X59 A;  4JI8 O;  1XNR O;  4DV0 O;  4DV5 O;  5BY1 A;  2UU9 O;  4DV4 O;  1XNQ O;  4JI0 O;  1AIL A;  3O65 A;  1R1B A;  4JI2 O;  2UUB O;  3JAM N;  5H5N A;  1KUQ A;  4JI1 O;  4DR6 O;  4AQY O;  2UUC O;  4LF5 O;  4LF8 O;  4DUZ O;  1AB3 A;  4NXN O;  4JI5 O;  3R66 A;  1N34 O;  1XMO O;  4JI7 O;  2N74 A;  4OPH A;  4JI4 O;  4X65 O;  5A2Q N;  2ZKO A;  4B3T O;  1HNX O;  4LF4 O;  4K0K O;  5FLX N;  4YHH O;  2DOS A;  4DV7 O;  4NXM O;  1IBK O;  1XEQ A;  1DK1 A;  4X62 O;  1N36 O;  1G1X B;  4A5U B;  3T1H O;  1YZB A;  5BR8 O;  4YY3 O;  2UXC O;  2VQF O;  1R6T A;  1I94 O;  4LFA O;  2AGA A;  4OX9 O;  4DV1 O;  1D2D A;  1HNW O;  2UUA O;  1HNZ O;  4DR4 O;  3T1Y O;  4DR5 O;  4LFB O;  4DR3 O;  1FYJ A;  4LF6 O;  2E5L O;  1N33 O;  2UXB O;  3M8A A;  1IBL O;  1NS1 A;  2Z0A A;  2FKX A;  4LF7 O;  4B3M O;  3J80 N;  4DR1 O;  4DV6 O;  1HR0 O;  1A32 A;  5LMU O;  1N32 O;  4GKJ O;  4JYA O;  4KHP O;  5BXZ A;  3RT3 C;  3J7A U;  4DUY O;  2F4V O;  3J81 N;  2LW7 A;  5LMN O;  4JI3 O;  4B3R O;  4DV3 O;  5IT9 N;  3SDL A;  4JV5 O;  4GKK O;  2HHH O;  4B3S O; 
#chains in the Genus database with same CATH topology
 5KUM A;  2ZM6 O;  3L75 H;  4K35 A;  1PD3 A;  2HLD G;  4LFC O;  2GV9 A;  2JRI A;  3UO3 A;  3ZHV A;  2BCC H;  1W0J G;  4JI6 O;  1BMF G;  4LH7 A;  2EIK B;  2DWD C;  4UFZ A;  1N34 B;  5B1B B;  4ZHQ A;  4IGG A;  1Q7Y W;  2IJJ A;  3K06 A;  1G8M A;  2GUZ B;  2RN9 A;  1YF2 A;  2BOC C;  1Z5W A;  5KHJ A;  3P3N A;  4JI1 O;  3OGI B;  4DR6 O;  3CD6 V;  1S5J A;  1G4Y B;  2F43 G;  3OUF A;  2YID A;  3UM7 A;  5B3S B;  2GHY A;  4J7K A;  1X4T A;  1ZL8 B;  1W0K G;  1HNX O;  2Q9L A;  4YHH O;  3G80 A;  3THO A;  4GLX A;  3ZRX A;  5L3G A;  2C2A A;  4B3M B;  3STL C;  2PYL A;  1NTK H;  3OAA G;  1N36 B;  1NVP D;  1RP3 B;  3OTO B;  4ZI7 A;  4W4L A;  4DR3 O;  4QPK A;  4PI2 A;  1BE3 H;  2QKA A;  2YIB D;  2EUL A;  4DV6 O;  2ZNJ A;  4UB6 Z;  4NKG B;  1SA0 B;  2HG5 C;  2CTR A;  4B7K A;  4YJ3 B;  4U3J B;  4UVC A;  4OX9 B;  2F4V O;  3IGA C;  3K9A A;  3AK1 A;  2JIZ G;  3EVK A;  1JMK C;  2W6J G;  4RAI A;  2OCC C;  1UPG A;  2F23 A;  5GTH Z;  3AK2 A;  3ZBH A;  3FD9 A;  5EC2 C;  3L74 H;  2VQE O;  2YDE A;  3CME V;  4JTA B;  4MT8 A;  4O4J B;  1GK9 A;  5JJE B;  2JEU A;  3RBZ A;  4H13 B;  2UU9 O;  3JAL A;  2WLM A;  1QR9 A;  1R1B A;  5LYJ A;  2UUB O;  1K4C C;  3ETG A;  1PPJ H;  4KFM A;  4ABM A;  1YVW A;  2CGO A;  4IIJ A;  3AG3 C;  2EBO A;  2V7Q G;  4MVS A;  4NXN O;  2CH7 B;  3GWK C;  5JCO A;  3ZN0 A;  2PUS A;  5DM6 V;  3MD0 A;  4LF9 B;  3C3S A;  4OPH A;  4JI4 O;  3JCZ A;  4IYH A;  2QWQ B;  1GN2 A;  4CH5 A;  4I0X A;  4RQE A;  5IYZ A;  5LMU B;  1NI8 A;  1B3Q A;  1WA8 A;  2ZIM A;  4X1K A;  3BY6 A;  4J11 A;  1IBL B;  2OTJ V;  2DYR C;  3D3Q A;  4BAY A;  4PA3 A;  3G67 A;  3UO2 A;  1K7D A;  1I94 O;  3T1Y B;  3W7U A;  2XAG A;  4PDV A;  3LSU A;  4I9W A;  2P5O A;  2YIC A;  3P3P A;  4X1Y A;  4DR3 B;  3ZHR A;  3T1Y O;  1R3I C;  4NR1 A;  2HVK C;  1IBM B;  2OT5 A;  3HKB B;  3WB0 A;  1BCC H;  1DF4 A;  5ITZ A;  3OE7 G;  1IDS A;  5H2F Z;  1U96 A;  1YTF D;  5B1B C;  1R73 A;  2G38 A;  1S77 D;  1TVK A;  4N21 A;  1SER A;  2IH3 C;  2XHB A;  4JI6 B;  1I5X A;  1HNX B;  4UCS A;  1K4D C;  2WLI B;  4I55 B;  3JD2 A;  1JVM A;  1RPR A;  2PI5 A;  3G4S V;  1KEC A;  4GKK O;  3B09 A;  4EFE A;  3DGE A;  3SPC A;  2PGG A;  4LNU A;  4OPA A;  2XAF A;  1P49 A;  4O2B A;  1MG1 A;  3E2E A;  1KBH A;  5EBL C;  1NH2 D;  4DV1 B;  2P90 A;  1K9M W;  1S3J A;  3K04 A;  1MAB G;  1SA0 A;  3ETQ A;  1SQG A;  5B5E Z;  1ZAU A;  4DV4 O;  2WA4 A;  1RFY A;  4YXW G;  3CRC A;  1N0J A;  5FL7 G;  5IYZ B;  3E8F A;  3L72 H;  3CMA V;  1NKD A;  4OGQ B;  4AQY O;  5CB4 A;  4GT1 A;  1GN4 A;  1GAX A;  3E86 A;  3ZRV A;  1YXB A;  2PTM A;  3LUT B;  1H2N A;  2A9H A;  2QTO A;  2IM9 A;  3VQY A;  1LUV A;  1XNR B;  1N8R W;  4K8Z A;  4TQD A;  3N27 A;  1M90 W;  2RJZ A;  4X1I A;  5EZY A;  2Q68 A;  3SJC C;  3K5L A;  2MW2 B;  4JI0 B;  1KKD A;  1VQP V;  2EX3 A;  3W7X A;  3B8N A;  2UUA B;  3M99 B;  3RN4 A;  3JSL A;  4DV4 B;  2Q8V A;  2QM8 A;  3J80 N;  2QWR B;  1N32 O;  4I4T B;  1YCI A;  4JYA O;  1PM9 A;  4G2K A;  4JI3 B;  2AZ0 A;  2JGD B;  4HNA A;  2D3O W;  4Q20 A;  3VQV A;  4WBN A;  4DR4 B;  4FMT A;  5J2T B;  4JI3 O;  2BTO A;  2EJR A;  2UXD B;  2RMK B;  4L8J A;  1M57 C;  4BIO A;  1MNG A;  5L3C A;  3CS5 A;  4XDJ A;  1FJG O;  1V55 C;  3CP1 A;  2P06 A;  1QQC A;  2F95 B;  2Q7H A;  4NTY A;  2XT9 A;  3AG2 B;  2VWK A;  2XND G;  4O4L B;  4WF9 V;  4GX2 A;  5H9C A;  1CEZ A;  1KP3 A;  3QNE A;  3L73 H;  2EZP A;  3CJH A;  1NJI W;  1JR9 A;  1THZ A;  4P30 A;  4HBN A;  1NTZ H;  4PEL A;  3F7Y C;  4FLY A;  4E4E A;  4JI2 O;  3NR7 A;  3ICX A;  4EKW A;  4X66 B;  1WN7 A;  5CMU A;  1TAE A;  2EIK C;  2VRZ A;  3K08 A;  3K5M A;  5BMV A;  4JI7 B;  2UUC B;  3EXA A;  4UCT A;  4JI7 O;  3UQ8 A;  1FPO A;  4B3T O;  3K03 A;  4J9Y B;  3AG1 C;  4JYB A;  4B3T B;  3HKD A;  1B06 A;  4PDR A;  1VIB A;  4UCV A;  4JGS A;  3K5O A;  4PV1 B;  4BIU A;  2WLK A;  1GKF A;  2RQ6 A;  5B3S C;  4MTG A;  2ILM A;  3I55 V;  1GN6 A;  5C93 A;  1GH6 A;  1GM8 A;  1SF9 A;  1QBZ A;  4O2A B;  4QNH B;  2YXY A;  3DC6 A;  1M5I A;  4FLT A;  3SGI A;  4LF7 O;  2ETN A;  3ASO B;  4UXN A;  1A32 A;  2E5L B;  2KG7 A;  2ITD C;  4DR7 B;  1Y76 A;  2WLL A;  3CCM V;  2QTS A;  1YI2 V;  2X6C A;  2WPD G;  1SQV H;  1OCZ B;  1FFX A;  3SYO A;  4LBE C;  4B3R O;  3JAW A;  1PNL A;  1RSO B;  1TA8 A;  3O9O A;  1FJG B;  4FM0 A;  4P9O A;  1JJ2 U;  3OMI B;  5JWP A;  1V54 B;  4QIW F;  2ZQM A;  4LWS B;  2QM4 A;  1J5E O;  1IBK B;  5FPR A;  1DLB A;  3JD0 A;  4X20 A;  3MHH C;  2JGD A;  1UFI A;  4X20 B;  4QJF B;  4R6Z A;  4W4K A;  5KMG B;  1EN5 A;  2OWO A;  5K1X A;  2W0X A;  5J2T A;  1KMI Z;  5KUK A;  4WFB V;  1Y74 B;  2WAM A;  3CC2 V;  1IXM A;  2UUC O;  3STZ C;  2Q7G A;  5EC1 C;  4JI5 O;  1QU7 A;  3CWB H;  3QF7 A;  4LCU C;  1JQ0 A;  3WU2 Z;  3FB5 C;  5IJ9 B;  1M56 B;  1L8D A;  4X1I B;  4BR6 A;  4DO2 A;  1JJO A;  2DOS A;  5LOV A;  1WP7 A;  2BTQ B;  2LQT A;  3ABM C;  3E35 A;  2JJ1 G;  1N36 O;  1VQ6 V;  1G1X B;  1IXB A;  1WA8 B;  5KA5 A;  1JX9 A;  4KXR A;  4FLW A;  1YZB A;  2LFR A;  1JFF A;  1Y66 A;  1QHT A;  2EIJ C;  3CHX A;  3H01 A;  4DV6 B;  1N33 O;  2HR3 A;  3OD4 A;  4QE9 A;  2IBZ H;  5KLV H;  2DYR B;  1N33 B;  4J41 A;  2F1M A;  1Q5O A;  5JQG A;  1K97 A;  2ZDI A;  1Q86 W;  2XOK G;  5BR8 B;  4JZG A;  2GBO A;  2YS8 A;  3E89 A;  5D5P A;  2ZM6 B;  2WA3 A;  4B3S O;  4NB5 A;  3IC9 A;  4ZIB A;  2GSM B;  3PN1 A;  2DN9 A;  4KHP B;  2LP7 A;  4FPP A;  4GCZ A;  1LNQ A;  3K9S A;  1H2G A;  2E76 B;  3CCS V;  3N2G A;  2Z3Y A;  4NXN B;  1L0L H;  2RDC A;  4YY3 B;  2IU0 A;  2HHH B;  2DQ0 A;  3ABT A;  5BZB A;  2PF4 E;  4U3J A;  1PV0 A;  4IT5 A;  1FAF A;  5LOV B;  3KZI Z;  3RYI A;  3ZMZ A;  4FZ1 A;  4LFC B;  2W0F C;  2B9Z A;  1Q8I A;  3WG7 C;  2KB1 A;  3FYI B;  4TOI A;  1I7F A;  4FVM A;  1OHH G;  1YDX A;  1AI6 A;  4HNA B;  2Y69 C;  5LHH A;  2GTA A;  2QKS A;  4YHH B;  2CDY A;  5CBG A;  3ZRW B;  2OIG A;  4CH6 A;  5LBQ A;  3ASO C;  1Q6U A;  4MSW C;  1XEQ A;  2JDI G;  2ZDI C;  4H33 A;  2X7R B;  5KHI A;  1OCZ C;  3AEI A;  4JI1 B;  3VOU A;  3ABU A;  4Z1M G;  2LJ2 A;  2CGN A;  3HB3 B;  3JD3 A;  5CA0 A;  5EYP B;  3L71 H;  1MOF A;  1PNK A;  5GW7 A;  1FXV A;  2KG7 B;  4DR5 O;  1OCR C;  1IVS A;  1V54 C;  2UXB O;  4H0L B;  5LA6 B;  2BTQ A;  4LNU B;  4AQY B;  1HDJ A;  2YSU B;  3FB7 C;  4IYI A;  1YJN V;  3RT3 C;  3N2G B;  2JGU A;  4O4H B;  3WB2 A;  4X1Y B;  2QGN A;  1M9N A;  4MW3 A;  3T1C A;  1K5Q A;  1P4R A;  1R6K A;  4DR1 B;  2BSK A;  2IJI A;  1KD1 W;  2WLN A;  5C8Y B;  3PJS K;  3F5T A;  3OTO O;  1M56 C;  4PHZ A;  3SPG A;  3JAR A;  4JYA B;  4I7Z B;  1LUW A;  1M57 B;  2M7W A;  3R65 A;  1V55 B;  2CH7 A;  4JAS A;  2P4V A;  2ZE8 A;  3E8G A;  1O9G A;  3FFQ A;  4MVM A;  3SPH A;  3AG2 C;  3SJQ C;  1OV9 A;  1AR1 B;  1P7B A;  1BT8 A;  2F93 B;  2Q0A A;  1BSM A;  1KU9 A;  1QVG U;  5LXT A;  4DUZ B;  3CC4 V;  4JYY A;  2R72 A;  3OFN G;  2RNB A;  3C90 A;  2UU9 B;  3KCY A;  4PJ0 Z;  3VQX A;  1E1Q G;  4RO2 A;  4X1K B;  5J9P C;  4K3A A;  2QE7 G;  5KA6 A;  4CZZ A;  2YXH A;  4X89 A;  2XAQ A;  1KYO F;  2R9R B;  3CYO A;  5TIS Z;  4UCU A;  1XL6 A;  4D7S A;  3E22 A;  1K33 A;  4U7N A;  3AG1 B;  3B4S A;  1EN4 A;  3DXR A;  2ODM A;  3KKY A;  1WPB A;  1K5S A;  1VF7 A;  3CX5 F;  3TXS A;  4D7T A;  4U3F H;  3ML0 A;  2Q4P A;  1K73 W;  5CBF A;  3S3X A;  3OR7 C;  2A3Q A;  4WFG A;  2QJ1 A;  5FNV A;  2XTA A;  4CS3 A;  1F23 A;  1YIJ V;  1SQB H;  1X59 A;  3G6B A;  2N05 A;  5CA1 B;  5LL6 Y;  3ZMU A;  4JZ2 A;  5IY5 B;  4HYO A;  5B1A C;  4EB6 A;  5LGT A;  4QPJ A;  2AHY A;  2DW4 A;  2N04 A;  2DMX A;  1VQK V;  1ZWI C;  2Y0P A;  1Q6H A;  3RYC B;  3CCU V;  3K59 A;  2EIN C;  5LXT B;  1G6U A;  4UCR A;  1AP5 A;  4X8A A;  1SQX H;  5KMG A;  5DN6 G;  1CPY A;  5KX5 B;  3JD1 A;  3D36 A;  4LFA B;  4FFK A;  5B66 Z;  3JAR B;  4L87 A;  2IJK A;  1I5Y A;  1OCR B;  3HKB A;  1TGO A;  3P32 A;  1YHQ V;  1SQQ H;  5B1O A;  3BFR A;  4K0K B;  3BCC H;  3LNN A;  4X65 B;  4GKJ B;  1QLE B;  3N2K A;  4LC1 A;  5CA3 A;  3OEH G;  1IBK O;  3BRC A;  4R8C A;  5EZY B;  1K92 A;  1AJQ A;  3Q4H B;  1YTF B;  4O2B B;  4DR6 B;  3ABK C;  4HZ3 A;  1F4N A;  4NYK A;  2UXX A;  5IJ0 A;  2UUA O;  4I0X B;  4LFB O;  3LDD A;  3B40 A;  1YJ9 V;  2E5L O;  1AI7 A;  1XBL A;  3ABM B;  3APQ A;  1WP8 A;  2ZE6 A;  4ZBM A;  1N32 B;  4YIP A;  1XIL A;  1AJN A;  1VQN V;  1J95 A;  3OR6 C;  2BE3 A;  4WFH A;  4FIP C;  2EIJ B;  2HKO A;  5E79 Z;  3RYH A;  4TSF G;  2L6L A;  4MVU A;  1XL4 A;  4YJ2 B;  1VQ9 V;  1E79 G;  4DV2 O;  1FFT B;  4CS2 A;  1HW7 A;  3CCV V;  1NU1 H;  2A06 H;  3B77 A;  3CCL V;  5LHG A;  4MTF A;  3B2E E;  4DR2 O;  1FS0 G;  1D5N A;  1D5A A;  4DV5 O;  1S76 D;  4PA6 A;  3JD4 A;  3NXS A;  1JCH A;  3ZMV A;  2ZD9 A;  4J7J A;  1URF A;  3ZN1 A;  4FLU A;  3JAM N;  1H8E G;  3N2K B;  4JTC B;  4AI8 A;  1Q82 W;  3VBB A;  5J2U B;  5BMV B;  1JFF B;  3BA8 A;  2ZE5 A;  3RYI B;  1NBM G;  2WSS G;  5EBW C;  3RYF B;  2AW9 A;  5IYB O;  3OTF A;  3DTU B;  1RPO A;  2FL4 A;  5IJ0 B;  5L3F A;  4DUY B;  5A2Q N;  4K0K O;  3SYP A;  2YI8 A;  5IWA B;  2Q73 A;  3P30 A;  3QO5 A;  1CP9 A;  4O4J A;  5H6Q A;  3WG7 B;  2P4K A;  3H1L H;  2E74 B;  4HAM A;  4O2A A;  4X62 B;  1KQS U;  2Y69 B;  2AXT Z;  3GB7 C;  4OX9 O;  4DR2 B;  3BPZ A;  3ZRW A;  1KC8 W;  4I5S A;  3OM3 B;  4UV8 A;  3K0D A;  4PD4 F;  3TJT A;  2M6Y A;  3ZHS A;  3I56 V;  1COW G;  3HKE A;  1FYJ A;  3MDS A;  2ZXW B;  1EN6 A;  1NS1 A;  5B1A B;  2Q5Z A;  1L0N H;  3H1H H;  1YSC A;  4NVP A;  2X6B A;  4ZI7 B;  1VQ4 V;  4KHP O;  2QSA A;  1IUR A;  3BAB A;  1DGS A;  4MVO A;  2VQE B;  4CH4 A;  2EJ7 A;  1IZ3 A;  2XAH A;  4B3S B;  4IHJ A;  4DV3 O;  3K79 A;  3D8C A;  4I4T A;  3AG7 A;  3WB1 A;  1ROP A;  1DF5 A;  1TUE B;  2IH1 C;  5IWA O;  4QGP A;  3GWO A;  1BGY H;  4FJC C;  1IBM O;  3L70 H;  5DED A;  1EZV H;  4ASU G;  3TCU A;  3CRA A;  1XMO B;  4DR7 O;  3DSQ A;  4DYL A;  3OMN B;  1XNR O;  2OCH A;  3RYF A;  1ZLZ A;  3CCR V;  2QA4 V;  1QLE C;  3CCJ V;  3BHP A;  2Z5U A;  1VAR A;  3O65 A;  1AR4 A;  4BIZ A;  5IJ9 A;  2HJD A;  4JAA A;  3UKM A;  1Y74 A;  2PY5 A;  3A0H Z;  1OCO C;  1J5E B;  3FB6 C;  1N0N A;  2JK5 C;  2DQ3 A;  1N34 O;  4AHC A;  3A0R A;  2K1E A;  2AZ2 A;  2ZKO A;  5JJJ B;  4DV3 B;  2W6I G;  2P67 A;  4FLZ A;  2VS0 A;  4J7Z A;  4PA9 A;  4DK1 A;  4NXM O;  1US6 A;  3JAS A;  4XBF A;  3K58 A;  1EFR G;  4CC5 A;  1S72 V;  4LF7 B;  1U97 A;  1SZT A;  1NT2 B;  4JF3 A;  3QVN A;  5IYC O;  2WWW A;  1PL4 A;  4UCO A;  2CAZ C;  2DWE C;  1R6N A;  1YJW V;  3JYC A;  1HNZ O;  1FXK A;  2B5U A;  2JJ2 G;  1XQ8 A;  2DE0 X;  5EBM C;  5AG2 A;  5C8Y A;  4UB8 Z;  1FD9 A;  4FLX A;  4H44 B;  1OCC B;  1Z2G A;  1FXK B;  1AI4 A;  2WLJ A;  4LF5 B;  3ZMS A;  3RFR A;  1TVK B;  1AJP A;  2WLL B;  1HNW B;  4LR3 A;  1FXH A;  4R50 A;  2GTS A;  1MA1 A;  3ZIA G;  5LYJ B;  5JCO C;  3Q4H A;  2ZR3 A;  1E1R G;  2LGQ A;  2ARH A;  3A2F A;  4JV5 O;  3AG4 B;  2YEV B;  1R3K C;  1H2S B;  1GMG A;  2PZS A;  5EYP A;  5KHH A;  4TV9 A;  2D2C B;  2AHZ A;  1WJZ A;  4LWS A;  1K8A W;  3IAY A;  3JAS B;  4Z2W A;  4LF9 O;  1BZK A;  1FKA O;  2ZIN A;  5BY1 A;  2YIA A;  1ZUQ A;  2HP8 A;  3E83 A;  3T2M A;  5EIB D;  5IY5 C;  3QTC A;  2CTP A;  3JAT A;  5IDJ A;  4WFE A;  4LF5 O;  4U7O A;  2B1I A;  4FFB B;  4DUZ O;  2EIN B;  4GUN A;  4RQF A;  4C7U A;  3R66 A;  3CB2 A;  1Y67 A;  3DXR B;  3LDE A;  4LF4 O;  3ZCC A;  1H8H G;  1Y4M A;  1VQO V;  4NXM B;  4GX1 A;  1P84 F;  4LF4 B;  2DYS C;  4MTX A;  2H8P C;  3ZED A;  3U0Z A;  4A5U B;  2EIL C;  2QKC A;  1SET A;  2H94 A;  1WLE A;  2P22 C;  3CEI A;  4YY3 O;  4EB6 B;  2HJF C;  2HVJ C;  1AR5 A;  1NZ6 A;  2A7W A;  1L1F A;  4X88 A;  3FX7 A;  4DR4 O;  3X2Q B;  5K1P A;  5KAF Z;  3M8A A;  2LFS A;  1ZL8 A;  1H38 A;  4PDL A;  1Q43 A;  1BL8 A;  5CA1 A;  1NR1 A;  3BAA A;  5LMU O;  5EIB C;  3ZMT A;  1MSD A;  3ABK B;  5IE9 A;  3H1J H;  2QM7 A;  2ZR2 A;  4B7E A;  2O57 A;  2VWJ A;  2LW7 A;  1W59 A;  2V1D A;  3E22 B;  3K5N A;  1AP6 A;  4H37 A;  1SES A;  1MMM A;  2BSK B;  4O4L A;  4X64 O;  1M4U A;  1OCO B;  2LO1 A;  4X66 O;  2WLI A;  4I55 A;  1NQT A;  1F7Y A;  4MVQ A;  3WFV A;  2PYJ A;  2YC0 A;  3IJ4 A;  3F5W C;  2NR5 A;  2UXC B;  1VF6 A;  1Q81 W;  2ADQ B;  2Q0O C;  5LHI A;  1XNQ O;  1PL0 A;  4EFB A;  2OTL V;  4B3R B;  4ICG A;  4F4L A;  3JAK B;  1KUQ A;  1F51 A;  2VQF B;  1NTM H;  1GO3 F;  1EZJ A;  4UVB A;  1SS3 A;  1BS3 A;  1SZX A;  3JSN A;  4JI8 B;  4O4I A;  4LF8 O;  4J10 A;  1ORQ C;  4RWU A;  1ZTE A;  1JPX A;  2BOB C;  3OMA B;  5KAI Z;  2ATK C;  4X65 O;  2UUB B;  3L9D A;  1OJH A;  1YEW A;  1LR1 A;  3W7W A;  4P9P A;  5FPO A;  4YJ2 A;  1M1K W;  4ZOL A;  5JH7 B;  3T1H O;  3FAV B;  3F7V C;  3APO A;  4I50 B;  1VQ7 V;  5A9G A;  4DXW A;  2GDS A;  2F4V B;  1TUB A;  4DV5 B;  4F6R A;  4GX5 A;  5JH7 A;  1HNW O;  3AG4 C;  4FLV A;  2Q69 A;  5KX5 A;  3ABL B;  2NNU A;  1M93 A;  1HR0 B;  3T4Z A;  1ZX3 A;  4DRX B;  1XNQ B;  3E8B A;  1IBL O;  1HR0 O;  5LP6 A;  1NR7 A;  4YIO A;  3OW2 U;  2ZIO A;  3HPL C;  4PDM A;  4TV8 A;  1WPX A;  5CA0 B;  4KUM A;  1SKV A;  2B1G A;  3TK1 A;  4XDK A;  5LMN O;  2ZXW C;  4DV2 B;  2QWN B;  1Y76 B;  2CK3 G;  3SR2 C;  5LGN A;  2X0L A;  3A0B Z;  5DEC A;  2LW1 A;  2RCV A;  2P6J A;  5JVD A;  2WLH A;  4TT3 G;  3RYC A;  2P7T C;  1AVM A;  2V4D A;  1T5E A;  2QWP B;  4GX0 A;  1WB7 A;  2Q6A A;  4WFF A;  5JJN B;  2YUA A;  4O4I B;  5CN0 A;  4JI4 B;  4DV0 O;  1SQF A;  4GKK B;  4F6R B;  3C3T A;  4FM1 A;  3FAV A;  1VQM V;  1AIL A;  3OUS A;  2DYS B;  3CSX A;  4F6E A;  2UXN A;  4WFA V;  1XHZ A;  4JTD B;  5H5N A;  3SJA C;  1Q3E A;  4BW9 A;  4E2L A;  2Y48 A;  3RVY A;  1MZF A;  5L3B A;  3CJH B;  2EZO A;  3ASN B;  5GON B;  1AB3 A;  5L3E A;  3IC7 A;  3JAK A;  4QE7 A;  1VQ5 V;  3X2Q C;  1XMO O;  5LMN B;  1H2L A;  3ZHU A;  1UJW B;  1QCE A;  4IIJ B;  3CC7 V;  4DV7 O;  4GZR B;  4JI2 B;  3CPW U;  1IX9 A;  3UCS C;  1R3L C;  2UXC O;  5LP6 C;  1R6T A;  4JYC A;  4LP8 A;  3T4D A;  1VP7 A;  2AGA A;  4K8X A;  2F66 C;  5J2U A;  4I50 A;  3UT5 A;  1ZSP A;  1ENV A;  4DW1 A;  1RM1 B;  1S0V A;  3ZX6 A;  2LGW A;  4B3M O;  3UT5 B;  5E1A C;  5LGU A;  2PI4 A;  4Q6G A;  3D3I A;  5BXZ A;  5IYD O;  1NH2 B;  4MVZ A;  2K9P A;  3MHS C;  3HKE B;  2HHH O;  1OCC C;  1FXK C;  1AI5 A;  4DR5 B;  1VF5 B;  2Y0I A;  4RUF A;  1XRE A;  1XMQ O;  3LDC A;  1GM7 A;  1QNM A;  3CE2 A;  1XMQ B;  3U11 A;  3ZJZ A;  3LSS A;  2KQX A;  1NVP B;  3EHB B;  3SYA A;  4N23 A;  3ZS8 C;  4IHJ B;  4X9Q A;  5HFM A;  4EEQ A;  4I9Q A;  2YEV A;  4NTW A;  1P7G A;  4WBN B;  4JI0 O;  1XOU A;  1RSO A;  2E75 B;  3D36 C;  1Y6X A;  3KCX A;  3FYE B;  4CBC A;  4TQF A;  3FKS G;  1DTO A;  4B08 A;  4CH3 A;  4G28 B;  4MS2 A;  4NTX A;  3ABL C;  1EBO A;  1F4M A;  2N74 A;  1WAZ A;  5H6R A;  4JV5 B;  3TGU H;  4FFB A;  4XDL A;  5CBH A;  5GON A;  4DV7 B;  1GRJ A;  5D5Q A;  3CXC U;  3K0G A;  1BQZ A;  1I0H A;  1S5L Z;  5B1N A;  2EIM B;  2YXL A;  1KP2 A;  4MW8 A;  4FM2 A;  2YIB A;  4JAU A;  4X62 O;  3ZHT A;  1B6Q A;  3W7S A;  4TV9 B;  3K57 A;  2ITC C;  4UV9 A;  3BA9 A;  4CS4 A;  4DK0 A;  1BQ0 A;  2ADP A;  2Q7E A;  5F2V O;  3G71 V;  2XAS A;  1YIT V;  2CUG A;  1I94 B;  1KB9 F;  2ZE7 A;  1MSW D;  3ZRS A;  5LA6 A;  2CTQ A;  4TV8 B;  2HFE C;  2FKX A;  3RWR D;  2EIL B;  4DR1 O;  3TXQ A;  2JEX A;  1H2K A;  1K3E A;  4UVA A;  1VMG A;  1EM1 A;  3ETE A;  2FB5 A;  3ZHQ A;  3G6E V;  3RW0 A;  1PNM A;  4O4H A;  4DUY O;  2R9I A;  1WNS A;  3A8T A;  5GTI Z;  3HKD B;  1TUB B;  2IU3 A;  3H1I H;  2IW5 A;  3OGC C;  3ASN C;  2DJV A;  3K3W A;  3EFF K;  4J42 A;  4GYC B;  1Z5V A;  1O9H A;  1VF6 C;  3AG3 B;  3AK3 A;  3CXH F;  1HWY A;  4DW0 A;  2FML A;  3RYH B;  1QVF U;  1VEW A;  2JVD A;  1FFX B;  1S5H C;  1I08 A;  2QDO A;  3H1K H;  4UUJ C;  3VQW A;  3S3W A;  4JPR A;  5LP6 B;  3LNM B;  4YJ3 A;  4BWA A;  2Y4T A;  2Y4U A;  4AIL C;  3IFX A;  1SC5 B;  4WCE V;  2CTW A;  1JOY A;  4LFB B;  2UXB B;  3ETD A;  3H9V A;  1RM1 C;  3RVZ A;  3BEH A;  5FLX N;  1WB8 A;  1XDC A;  2NN4 A;  2NLJ C;  4BW5 A;  3KG2 A;  3BVO A;  3OEE G;  2KSD A;  2A0L A;  1SRY A;  3QO8 A;  2H3O A;  1DK1 A;  2IJH A;  4JI5 B;  3CCQ V;  2ZNI A;  5KHG A;  1GTO A;  3FB8 C;  2VQF O;  5JQG B;  4LFA O;  2FYU H;  1HNZ B;  4DV1 O;  1BHA A;  1GN3 A;  2L35 A;  2ZT9 B;  2XAJ A;  1SQP H;  3JAT B;  1VQL V;  1R3J C;  1XUQ A;  2KKW A;  4J9Z B;  2R70 A;  2YI9 A;  1HP8 A;  3B8M A;  4ZKI A;  2R9A A;  4TUY A;  2Z0A A;  3HKC B;  4MTO A;  3LSQ A;  5FNV B;  4KP4 A;  5L3D A;  4D6T H;  4GKJ O;  2X6A A;  2Q67 A;  3HKC A;  2JS3 A;  4TWK A;  3J7A U;  3GVM A;  3W7T A;  4LH6 A;  3JCU Z;  5IT9 N;  2JS5 A;  3RGB A;  3U10 A;  4X64 B;  2GUZ A;  3CRM A;  4Z1V A;  4KL1 A;  4PA7 A;  2UXD O;  3QO7 A;  1Q6I A;  3CRR A;  2MK3 A;  3HR0 A;  2HEP A;  3MAQ A;  4CC6 A;  3OT7 A;  1B04 A;  4JI8 O;  4LF8 B;  1Q90 D;  1QLN A;  1PP9 H;  4FZ0 A;  3SJB C;  2EIM C;  1XHX A;  3CRQ A;  1V9P A;  4IL6 Z;  2A79 B;  1CXZ B;  3TET A;  1ARO P;  5CB4 B;  5EK0 A;  2OYQ A;  2OCC B;  4FK5 C;  4ZHQ B;  3T1H B;  3M7M X;  3QG5 A;  2ZCE A;  5ITZ B;  3I5D A;  4DRX A;  1H2M A;  4PI0 A;  4MVR A;  4G27 B;  1JA8 A;  1W2B U;  4TUY B;  2CE4 A;  4P2Z A;  1MZE A;  5HFL A;  1BHB A;  1XI1 A;  3CCE V;  3E8H A;  5BR8 O;  4DV0 B;  1QR8 A;  1D2D A;  1OZ0 A;  3JAW B;  1VQ8 V;  2FTK A;  3SPI A;  4PA4 A;  2QEX V;  4LF6 O;  2OIE A;  5KHK A;  4R7C A;  4RUE A;  1N4C A;  5JVD B;  3SPJ A;  4LF6 B;  4OXS A;  1K34 A;  2QWO B;  2E3C A;  3SYC A;  1PKX A;  3J81 N;  3SYQ A;  4J80 A;  1KKC A;  2XUM A;  3SDL A;  4ZOL B;  2QR4 A;  3JAL B;  1GM9 A;  4JAV A;  3DC5 A; 
#chains in the Genus database with same CATH homology
 2ZM6 O;  1FJG O;  2UXD O;  4X64 O;  4DV2 O;  4LFC O;  4OPA A;  5LL6 Y;  5IWA O;  2JRI A;  1IBM O;  1XMQ O;  2DJV A;  4X66 O;  1J5E O;  4JI6 O;  2VQE O;  3F5T A;  4LF9 O;  3OTO O;  1F7Y A;  4DR7 O;  4DR2 O;  1FKA O;  1X59 A;  4JI8 O;  1XNR O;  4DV0 O;  4DV5 O;  5BY1 A;  2UU9 O;  4DV4 O;  1XNQ O;  4JI0 O;  1AIL A;  3O65 A;  1R1B A;  4JI2 O;  2UUB O;  3JAM N;  5H5N A;  1KUQ A;  4JI1 O;  4DR6 O;  4AQY O;  2UUC O;  4LF5 O;  4LF8 O;  4DUZ O;  1AB3 A;  4NXN O;  4JI5 O;  3R66 A;  1N34 O;  1XMO O;  4JI7 O;  2N74 A;  4OPH A;  4JI4 O;  4X65 O;  5A2Q N;  2ZKO A;  4B3T O;  1HNX O;  4LF4 O;  4K0K O;  5FLX N;  4YHH O;  2DOS A;  4DV7 O;  4NXM O;  1IBK O;  1XEQ A;  1DK1 A;  4X62 O;  1N36 O;  1G1X B;  4A5U B;  3T1H O;  1YZB A;  5BR8 O;  4YY3 O;  2UXC O;  2VQF O;  1R6T A;  1I94 O;  4LFA O;  2AGA A;  4OX9 O;  4DV1 O;  1D2D A;  1HNW O;  2UUA O;  1HNZ O;  4DR4 O;  3T1Y O;  4DR5 O;  4LFB O;  4DR3 O;  1FYJ A;  4LF6 O;  2E5L O;  1N33 O;  2UXB O;  3M8A A;  1IBL O;  1NS1 A;  2Z0A A;  2FKX A;  4LF7 O;  4B3M O;  3J80 N;  4DR1 O;  4DV6 O;  1HR0 O;  1A32 A;  5LMU O;  1N32 O;  4GKJ O;  4JYA O;  4KHP O;  5BXZ A;  3RT3 C;  3J7A U;  4DUY O;  2F4V O;  3J81 N;  2LW7 A;  5LMN O;  4JI3 O;  4B3R O;  4DV3 O;  5IT9 N;  3SDL A;  4JV5 O;  4GKK O;  2HHH O;  4B3S O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...