2VQFO

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2vqfO00
4JI2O 4DV0O 4JYAO 1IBMO 4X66O 5BXZA 1R1BA 4OPAA 4JI0O 3RT3C 5LMUO 1J5EO 2UUAO 1N34O 1G1XB 1F7YA 2UXCO 3O65A 4OPHA 4DV7O 2UXBO 1HNXO 4DR2O 1N33O 2LW7A 1D2DA 4LF5O 4X64O 1XNQO 1XMOO 5IT9N 1NS1A 4DUZO 1XNRO 4DR4O 4NXMO 4DV5O 4LFBO 1FYJA 4GKJO 3R66A 2E5LO 4LFAO 3J81N 1X59A 1IBKO 3J7AU 4GKKO 4NXNO 4LF4O 1KUQA 4JV5O 4A5UB 4DV6O 5H5NA 1AILA 4AQYO 4X65O 3SDLA 4K0KO 4DR7O 4LF9O 2FKXA 5LMNO 1FKAO 2ZM6O 1A32A 3J80N 1IBLO 1AB3A 2N74A 3M8AA 1I94O 4B3SO 2VQFO 1N32O 3JAMN 4JI4O 3F5TA 1YZBA 4JI8O 2JRIA 2DJVA 4DR6O 1XMQO 2UXDO 2VQEO 1N36O 3T1HO 1FJGO 1DK1A 4B3RO 4DR5O 2ZKOA 4DUYO 2UUBO 4JI6O 4KHPO 2HHHO 4JI7O 2UUCO 4OX9O 4DV2O 5LL6Y 5BR8O 2UU9O 2F4VO 5FLXN 4DV3O 1R6TA 4YY3O 2DOSA 4JI1O 4DR1O 4X62O 4B3MO 4DV4O 4LF7O 4LF8O 5A2QN 2AGAA 1XEQA 4YHHO 1HNZO 1HR0O 3OTOO 3T1YO 4LF6O 2Z0AA 5IWAO 1HNWO 4JI3O 5BY1A 4B3TO 4LFCO 4DV1O 4DR3O 4JI5O
chains in the Genus database with same CATH superfamily
2AHYA 2MK3A 2OYQA 1WA8B 4OPAA 3FAVB 4EFEA 3RFRA 5IDJA 1F7YA 3JALA 4H0LB 1V9PA 2Y69C 2JK5C 3DC6A 3UQ8A 4UVAA 1XMOO 4JI0B 1K5QA 1THZA 3FYIB 4CBCA 4DV5O 2RCVA 5CN0A 4U3JB 3LSSA 2KKWA 2JGUA 1Y74A 4MTGA 2Q0AA 1AJQA 1T5EA 4GX2A 3RW0A 3P32A 4YJ3A 2QA4V 3ZCCA 3BY6A 1DF4A 3L70H 1EN6A 3SDLA 5L3DA 3ZX6A 3OGCC 1N8RW 3M99B 3E22A 4MVOA 4XDLA 1RPRA 4KUMA 5KHKA 3ABMC 1YJ9V 2R72A 2EULA 2P67A 3EHBB 4GX0A 4DR6O 4OX9B 4EFBA 3AG3B 4UCTA 4FLWA 3CSXA 4DR5O 2JDIG 1XL6A 1OCOB 2HHHO 2UU9O 3RYFA 3JATA 5IYZA 2D2CB 4FLTA 3HKCA 1I08A 4BWAA 2AHZA 3GB7C 4GUNA 3ZHUA 4B3MO 2WLHA 1K97A 4H33A 1M56C 4HZ3A 1RSOB 4JI3B 5A2QN 4IHJB 2L35A 4PHZA 1HDJA 2QWNB 4E2LA 2GUZA 4TSFG 1JVMA 4LFCO 4X66B 5KX5B 4PI0A 1SA0B 1IBMO 1FPOA 4XDKA 3ABKB 3K9SA 3K9AA 3SYPA 4JI0O 2EINC 4ZIBA 4W4KA 3O65A 2HJDA 3B4SA 2JIZG 1I7FA 1S5JA 4J7JA 3E35A 1MG1A 1H2SB 4X64O 4WFBV 4N21A 1NS1A 4DUZO 1G6UA 3ZHQA 3FX7A 5JWPA 1ZLZA 4RUFA 1VP7A 1H2NA 1F4MA 1SRYA 1NT2B 1S0VA 2CK3G 5IYBO 3JALB 4J9YB 4TOIA 2PYJA 1OCRB 4E4EA 3ZMZA 1I94B 1W2BU 2V4DA 3AG4C 4UB6Z 2OTJV 1Y74B 2ZIMA 1QVFU 1N32O 3G67A 4DV6B 1ZL8A 1BQ0A 1K34A 3OE7G 4KHPB 2P22C 4JAVA 4YJ3B 3C3SA 1BL8A 4DV2B 4GX5A 2LP7A 3APQA 1JCHA 2B1GA 5DN6G 4BIOA 5HFMA 3E22B 1Q43A 1SETA 3AK1A 3G6BA 3BVOA 4J41A 1HP8A 4YHHB 3E8HA 2ZDIC 3SPHA 2PI4A 1B06A 4DK0A 3CCUV 3FKSG 4UV9A 2G38A 4JYAB 2EILC 3E8BA 3H01A 5BY1A 3CB2A 4LC1A 3TGUH 3RYFB 3JATB 4JI1B 5IYZB 3H1KH 3CWBH 3HKCB 2WAMA 4UVBA 4MTOA 4DV4B 4NYKA 2NNUA 4Q20A 1S5HC 5JVDA 4J42A 3QTCA 1B04A 4GT1A 4AHCA 2IBZH 4LBEC 4G27B 1XNRB 4R7CA 2GUZB 1DGSA 3SYQA 1MABG 3B40A 1W59A 2E74B 4I50A 2R9IA 3OEHG 5LGUA 1O9GA 1K7DA 4KXRA 3J7AU 3UCSC 3T1CA 2DWEC 4DV6O 3E83A 1COWG 1MZEA 3WFVA 4P30A 2DN9A 3VQYA 5KA5A 4CS3A 1Y67A 1GRJA 1M56B 3WB2A 1R6NA 3MDSA 1ROPA 4JPRA 5K1PA 3I55V 3IGAC 3ETDA 1U97A 4O4LA 1AI4A 3K3WA 4MVRA 4JI7B 3T1HO 4ABMA 3VQWA 3CCVV 3VOUA 5IYCO 2VRZA 2P6JA 4NTXA 4UCUA 2RMKB 2QM8A 5EK0A 4WFGA 3HKDA 4TV9A 3LDCA 4JI1O 3ZHSA 2QE7G 2HP8A 1HNZB 1ZL8B 2ADQB 4DV4O 4LF7O 3ZS8C 1BCCH 1NR1A 4NTWA 3ZRWA 4XBFA 1PL4A 3QNEA 1VQNV 3CP1A 3B8NA 3TK1A 2XUMA 2QWQB 4DV0B 2K1EA 1E1RG 4IL6Z 3BPZA 1U96A 2VWKA 4EB6A 2UUAB 2HEPA 1KQSU 1SERA 4IYIA 4I55A 1GN3A 1R1BA 3H9VA 3K5MA 2OCCC 2IH1C 3JD4A 1XHZA 1H2LA 2FL4A 1OCZC 5L3EA 3RWRD 2C2AA 3W7WA 4FM2A 4JI2B 1D2DA 5GONA 5KLVH 1NI8A 3JAKA 4OXSA 5IT9N 2Q7GA 4X1YA 3DXRA 1Z5WA 1YSCA 1Q7YW 2CE4A 2LO1A 2RDCA 4RQFA 2JJ2G 5EC1C 5JVDB 1Y4MA 4HBNA 1QCEA 5JCOC 4JF3A 2JEUA 4JV5O 2WLLB 3KZIZ 1SQQH 1DF5A 4I0XA 5B1BC 5KUKA 2FKXA 4FVMA 4I50B 2ZE6A 4YJ2A 1Y6XA 3AK2A 4ZOLA 5LYJA 1RM1C 2VQFO 4FM1A 4WFAV 4JZGA 3OUFA 2E3CA 1K5SA 2VQEO 4MW8A 2QWOB 1MSWD 2M6YA 2WLJA 2DYSB 5LP6C 1MSDA 2QTSA 2X6CA 2M7WA 3A2FA 4JGSA 1BSMA 1IDSA 3WB0A 4O4LB 4PDRA 4X62O 2MW2B 1HNWB 2XAJA 2EIMB 1H2KA 2JS5A 2D3OW 1V55C 4OGQB 2BTQA 2DQ0A 1M9NA 3BA9A 3ASOC 2RJZA 4WFHA 2FYUH 4JI2O 1HWYA 1VQLV 3HKDB 2UXCB 3JASA 4TV9B 2GTAA 2A06H 4UXNA 3ABUA 3SYAA 4EEQA 1P84F 4O4HA 2YC0A 3ZRWB 2UXBO 1S72V 1V54C 1P7GA 4X1KA 2LW7A 3BABA 5B3SB 2RQ6A 2N04A 1KU9A 2K9PA 1R3JC 4EB6B 4W4LA 3CJHA 4H13B 4MW3A 1F51A 4I55B 4J80A 4FK5C 5J2UA 2AZ2A 1ZTEA 4C7UA 3QO7A 3L73H 1S76D 4I4TA 2KQXA 5GONB 1VQPV 2YIDA 3VBBA 1ZWIC 3JAKB 5IYDO 2XASA 3ICXA 4QGPA 4X1YB 3DXRB 1VQ7V 3OMAB 4GZRB 3M8AA 1PKXA 2PYLA 3QO8A 1NZ6A 1WNSA 3LNMB 1SKVA 2UUCB 2YICA 2CH7B 5B1OA 5A9GA 1VQ4V 3JD3A 1FJGO 1DK1A 1VMGA 1Q86W 4DUYO 4I0XB 3RYHA 3FB6C 1AI6A 3B8MA 2EIKB 2OCCB 2OCHA 1FXKA 5ITZA 5LL6Y 4ZOLB 5E79Z 5LYJB 1R3KC 1R6TA 2LGWA 4PV1B 4YY3O 1YDXA 4DR1O 3SPCA 2WPDG 2W6IG 2Y48A 1XHXA 1Z5VA 2DWDC 5IY5B 2E75B 2XAGA 4DRXA 1JOYA 2AZ0A 1S5LZ 2KSDA 4LR3A 1EZVH 2Z0AA 1K9MW 5B1AB 3QG5A 3VQXA 3LDDA 4B3TO 1LNQA 1L8DA 1D5NA 4UUJC 3UT5A 2GV9A 4QNHB 4JI5O 3U11A 5EIBC 4MVSA 1US6A 2HG5C 2VWJA 4FLZA 1HNXB 3UM7A 4FLXA 2V1DA 4G2KA 1GN2A 2ZR3A 3OUSA 1RM1B 1G4YB 3RN4A 1XOUA 1QR9A 5L3CA 4LFBB 1N33O 1GK9A 4GKJB 1TA8A 2BTQB 4LF5O 1VF6C 5JQGA 1XNQO 1Q6IA 1N4CA 1RP3B 4YIOA 3JASB 1GM7A 4R50A 5EBMC 3CMEV 3ZRXA 3ZHTA 4MVMA 5LOVA 4BIZA 1M1KW 4O4HB 5GW7A 1EZJA 2QKCA 4X1KB 3P3NA 3ZBHA 5KMGA 3THOA 3BRCA 4GX1A 3OAAG 4I7ZB 2UXNA 3ETGA 1WLEA 2H94A 2P4KA 1YJNV 1XMQB 3CJHB 3ZMSA 1V55B 3SPGA 3CX5F 4MVQA 4JI4O 2X6AA 2OT5A 3F5TA 3K0DA 4F4LA 3CRQA 4KFMA 1YITV 1W0JG 2GDSA 1KKDA 5J2UB 4UB8Z 1QVGU 2HFEC 2A79B 1AR1B 1XBLA 3STLC 1TGOA 1KD1W 4I4TB 1WJZA 3CRCA 5GTHZ 4NKGB 5BR8O 3N2GA 3CRAA 2ZQMA 2X6BA 3L71H 4X8AA 3OMIB 4F6EA 1FXHA 1PNKA 4O4JA 1NKDA 2Q68A 3KKYA 1TVKA 2X0LA 2LQTA 1VIBA 3RYHB 2F23A 5IWAO 2EX3A 1NH2D 1FXKB 5ITZB 3KG2A 2P06A 2IU0A 5LMUB 4FLUA 4UCVA 3ZRVA 2Y0PA 4DV7B 5EIBD 1J5EO 3HKEB 3R65A 1G1XB 2R9RB 4DRXB 3KCYA 3CCJV 3ZN1A 3QVNA 4NXMB 4IGGA 4ZHQA 3UT5B 4TV8A 2QKAA 2EJRA 1IZ3A 3AG2B 1N34B 4ZI7A 3TCUA 4HYOA 1IXBA 2DYRC 1KKCA 3Q4HA 4YIPA 2LFSA 3U10A 4DR7B 4RWUA 3L9DA 1TUBA 3DGEA 4U7OA 4Z1VA 4RAIA 3UKMA 5JQGB 2WSSG 2E5LB 3C90A 3BCCH 1A32A 1M5IA 5EC2C 1AB3A 2N05A 1NH2B 1XDCA 2B1IA 2XOKG 1H8EG 2Q7EA 4AQYB 2JRIA 4PA9A 5LOVB 3K03A 5KUMA 2R70A 1I0HA 4OX9O 4B3SB 5KMGB 4AILC 4FFBA 4P9PA 1ZAUA 3BFRA 3NXSA 3O9OA 5IJ0A 3SJQC 1BS3A 5L3GA 3W7UA 3FB8C 1WN7A 4DV1B 2ITCC 3EFFK 1JR9A 4AI8A 1H2MA 4JI3O 3KCXA 3N2GB 3TJTA 1P7BA 4B08A 5JJNB 2ZE7A 3CCRV 2FMLA 5L3BA 2A3QA 2Y69B 3TETA 4X66O 5BXZA 4DR2B 5FPOA 1N34O 4O4JB 4IIJA 4UVCA 1TVKB 4O2AA 4DR4B 4TT3G 4JYBA 3CPWU 4Z1MG 5K1XA 3CCSV 4LFAB 3W7XA 4Q6GA 1KECA 4LNUA 5BMVA 3JD2A 2JJ1G 1Q5OA 2E5LO 1SQGA 2PGGA 3IC7A 3LUTB 4BR6A 1BHBA 2OTLV 4K3AA 3A0HZ 4K0KB 1GTOA 4UCOA 1OCCC 3MAQA 4ICGA 4O4IA 3FB5C 3ABMB 2ZM6B 3L72H 2NLJC 4AQYO 3ETQA 3GWKC 3WG7C 4ZHQB 2ZDIA 1SZTA 1SS3A 3RBZA 2YUAA 3OEEG 1MNGA 4JI8B 1AJPA 2JGDA 2LFRA 4PD4F 3CRMA 1I94O 4B3SO 4ZI7B 4MT8A 3Q4HB 2ZCEA 2UUBB 2XAFA 2YXLA 2IW5A 4D7TA 1GH6A 2VS0A 2ZKOA 5H9CA 2PZSA 4D7SA 1TUBB 4KHPO 2O57A 3F7YC 1EN4A 4LWSA 2YSUB 2ZE8A 3EVKA 4DV2O 1RPOA 5LGNA 2EIJC 3IJ4A 4LF8B 5IE9A 1HR0B 4FPPA 2L6LA 5DM6V 4JTCB 4LF6B 2EJ7A 1PNLA 3A0RA 2YDEA 3OMNB 3ZMVA 4BAYA 4BIUA 4YHHO 5EYPA 1Q3EA 2EINB 1E1QG 3AG1C 2ODMA 2Q0OC 2YIBA 4FZ0A 4GYCB 1FAFA 4FFBB 3ML0A 4PDVA 4JYAO 2NR5A 4WFFA 2QDOA 3HB3B 2V7QG 5IJ0B 3W7SA 4JAUA 5LGTA 2QSAA 1VQOV 2Q73A 5CMUA 3P3PA 1IX9A 1S3JA 5CBGA 3I5DA 2Y0IA 1K3EA 4KP4A 1XNRO 3K5OA 4WCEV 1FYJA 3D3IA 5KHJA 1M90W 3R66A 4BW9A 4CS2A 4FLYA 3JD0A 5IJ9A 5LBQA 2BTOA 3ZJZA 3GWOA 2XNDG 1HW7A 1K4DC 5AG2A 3W7TA 3CHXA 4TQFA 1DLBA 4IIJB 3A8TA 1AP5A 1WPXA 3AG4B 3ZMTA 2ZR2A 4O2AB 1AILA 4DW1A 2IJHA 3E2EA 3B09A 1NVPD 3K59A 2DMXA 4UCSA 1PNMA 3ZN0A 2W0XA 4LNUB 5BMVB 4RO2A 2F93B 4B3RB 3PJSK 3K08A 1UJWB 4F6RA 1QLNA 1TUEB 4O2BA 4O4IB 2YIBD 1Q81W 1JA8A 1FXVA 3CD6V 4UV8A 4JI7O 3QO5A 2F66C 2CTPA 1P49A 2JGDB 1CPYA 4JTAB 2DOSA 2QR4A 2EILB 3M7MX 2E76B 3MD0A 1XEQA 3JD1A 1HNZO 1GM9A 1AVMA 2F4VB 4LWSB 4DV3B 5H2FZ 5JCOA 2QM7A 4I9WA 3DC5A 1BHAA 1AR5A 4DV0O 3K57A 1XL4A 2ADPA 3DTUB 2ZXWC 2UUAO 4MSWC 4J7ZA 2GTSA 1R3IC 1K8AW 5FNVA 3AG7A 2Q5ZA 2WWWA 4D6TH 5EYPB 3ABLC 4J7KA 1XREA 2HVJC 3B77A 5B66Z 3SYCA 2XAHA 4GKKB 3EXAA 3CE2A 4NXNB 4LF4B 2QM4A 1VQ8V 1KYOF 1FS0G 4TWKA 5LP6A 4X65B 3P30A 2YXYA 2PUSA 1AI7A 3FFQA 5LMNB 1J95A 2W0FC 3ZHVA 1VQKV 5H5NA 1JFFA 3CRRA 5LXTA 1IBLB 3RYIA 4NVPA 1FKAO 1NJIW 2DE0X 2XTAA 1Q90D 1O9HA 2ARHA 3RYCA 2UXDB 5IJ9B 2A7WA 4H37A 1SQBH 5CA0A 3G6EV 1CXZB 1WP8A 1P4RA 3X2QC 5KHIA 1F23A 4RUEA 2IU3A 3JSLA 3AG3C 2F4VO 1QNMA 1OHHG 5L3FA 3UO3A 2YIAA 1MOFA 2ATKC 4DV3O 5J2TA 2WLIA 3N27A 1LUVA 1N36B 3OTOB 3T1YB 2XAQA 4F6RB 1I5YA 2KG7A 1YTFD 4O2BB 1WAZA 1YHQV 5GTIZ 1RFYA 2H8PC 4X9QA 1HNWO 1AJNA 4YJ2B 1OCZB 1F4NA 4N23A 1SQVH 3ASNC 4HNAA 5D5PA 4WBNA 1DTOA 3E8FA 2UXCO 1WB8A 1XMOB 2Q6AA 4DR3B 2ZT9B 3ABKC 4DV5B 5LHHA 1SQXH 2CAZC 2GSMB 3SGIA 4LP8A 5E1AC 4PDLA 2R9AA 3H1IH 2Z3YA 1K92A 5B1BB 3E86A 2CGOA 3CCEV 5FNVB 3CC4V 4TQDA 1GN6A 1N0JA 4BW5A 2A0LA 1GKFA 4UFZA 3VQVA 1IBKB 1K4CC 1X4TA 4DR6B 2N74A 2OIEA 1N0NA 1R6KA 4MTFA 2FB5A 1OCRC 2F43G 3RVZA 3ZHRA 5LP6B 4FJCC 2DJVA 2HHHB 2IM9A 1N36O 2UU9B 1NQTA 1BGYH 1JFFB 1LUWA 5LXTB 2JS3A 1YEWA 3RYIB 2HVKC 2UUCO 5LA6A 1G8MA 1E79G 4JYCA 3IAYA 4B3MB 3GVMA 1YXBA 1YF2A 3RYCB 3ABLB 4JASA 5KAIZ 1VF6A 3ASOB 2PI5A 3CC7V 1YCIA 2P5OA 1QLEC 4P2ZA 3CMAV 1AROP 2KB1A 3JYCA 4LFCB 4FLVA 2YI9A 5CA0B 2YXHA 2LJ2A 3FD9A 1IBMB 5H6RA 1PV0A 3B2EE 3CXHF 4DR3O 3U0ZA 4I5SA 1L0LH 1V54B 5J2TB 3OR6C 2WLIB 3TXQA 4QPJA 3RT3C 3ZRSA 1H2GA 4CZZA 2KG7B 4X64B 1BZKA 4DW0A 4DUZB 1HNXO 1EM1A 4TUYA 5B1NA 5JH7A 2Q7HA 4R8CA 2QWPB 3L75H 4LFBO 4GKJO 2HKOA 4WFEA 3X2QB 1FFXA 3J81N 1X59A 4HNAB 1IBKO 2CUGA 4PI2A 4WBNB 4PA3A 1NTKH 2ZE5A 3NR7A 4H44B 3UO2A 1XQ8A 4ZKIA 3MHSC 4DYLA 3BEHA 1Q82W 3RVYA 3E8GA 2EBOA 1N32B 3ZEDA 1R3LC 1Q8IA 1SESA 5EBWC 1Q6HA 1EBOA 2P90A 2ETNA 2ZNIA 1WP7A 1XMQO 2Y4UA 3F7VC 1KMIZ 3ASNB 2YI8A 3CXCU 1KB9F 1VQ6V 3G71V 1KP3A 3LNNA 2QGNA 3T2MA 1UPGA 4GLXA 1GM8A 1SC5B 1IURA 1UFIA 4JI6B 1YIJV 2A9HA 1TAEA 1Y76A 3JCZA 1BQZA 1D5AA 1ORQC 5LA6B 4DK1A 4WF9V 2Y4TA 3I56V 1NTMH 4UCRA 5LMUO 3K5NA 2BCCH 1QR8A 5TISZ 3ZMUA 4NB5A 4DV7O 2WLKA 4U3FH 1ZUQA 2Z5UA 5DEDA 3N2KA 4Z2WA 1GMGA 5CBHA 3CC2V 2JEXA 4IYHA 1M57C 5EZYA 4NXMO 4I9QA 3LDEA 4DO2A 5LHGA 3K5LA 1VEWA 5C8YA 2CTWA 5JJEB 1CEZA 5BZBA 4NR1A 2P4VA 1URFA 1Y66A 4EKWA 1W0KG 3HPLC 4TUYB 3AK3A 5JH7B 1JQ0A 4DR7O 1QLEB 4MTXA 4B7EA 2IJJA 1Q6UA 1YI2V 3BA8A 4GCZA 1FFXB 3T1HB 2ZNJA 1MMMA 1B3QA 2XT9A 3RGBA 3HKBA 2ITDC 3K06A 4XDJA 1JMKC 1ENVA 4JI6O 4PA6A 1FD9A 4TV8B 5FLXN 4X20A 2WA3A 4LF7B 1GN4A 2DYSC 3D3QA 4CH6A 2QWRB 1YVWA 5C93A 3SYOA 1AP6A 2WLLA 1MA1A 1LR1A 4MVZA 1H38A 4CC6A 2B5UA 3ZIAG 5EBLC 4ZBMA 1KBHA 2GHYA 4DV1O 3WB1A 1VF7A 2EIMC 4LCUC 1NTZH 1KC8W 4B7KA 1OZ0A 3CCMV 5CB4A 3D8CA 2PTMA 2WLMA 1QU7A 3S3WA 3IFXA 1WPBA 2ILMA 1Y76B 4DR2O 3AEIA 4R6ZA 2DYRB 3T4ZA 4PA4A 1IXMA 2F95B 1K73W 4IT5A 4DR4O 4FFKA 4LFAO 4JV5B 3C3TA 2PY5A 1NBMG 3E89A 4HAMA 5B3SC 1NR7A 1L0NH 3OGIB 4X1IA 3A0BZ 2Q69A 3SJCC 4J11A 3QF7A 1KUQA 2YS8A 2ZIOA 3D36C 2AXTZ 4K0KO 2QEXV 3N2KB 2HR3A 4MS2A 3MHHC 2VQFB 2ZM6O 5EZYB 4FIPC 1GAXA 2VQEB 1YZBA 3SPJA 3H1JH 4JI8O 2BOCC 3CS5A 5C8YB 1VQ9V 4JTDB 4X89A 4CS4A 2WLNA 3DSQA 2UUBO 3FB7C 4KL1A 2CDYA 2H3OA 2EZOA 5CBFA 4X62B 3D36A 4JYYA 1GO3F 1QQCA 2DW4A 3APOA 2EIKC 2QJ1A 3OR7C 1MZFA 1M57B 3HKBB 4LF8O 1HR0O 3CEIA 1L1FA 4LF6O 3H1LH 4NTYA 5IY5C 3SJBC 4RQEA 3WU2Z 1K33A 2LW1A 5D5QA 4X20B 3JARA 4L8JA 3JAWA 4ASUG 5B1AC 2UXBB 4YXWG 3JSNA 3OW2U 2CH7A 2BSKA 5H6QA 4FZ1A 4J10A 1IVSA 1SQFA 1I5XA 4LH6A 4J9ZB 1OCCB 4G28B 5FPRA 3L74H 2AW9A 1PPJH 2X7RB 3BHPA 1NVPB 5FL7G 3WG7B 5CB4B 2ZINA 2HJFC 2F1MA 4PA7A 4K8ZA 1OV9A 1R73A 3OTFA 1JPXA 1PD3A 4QPKA 5CA3A 2OIGA 1YJWV 1KP2A 2CTQA 2BE3A 2YEVA 1VQMV 4MVUA 3J80N 2WA4A 2XHBA 3HR0A 1FJGB 1Z2GA 4U7NA 5CA1A 4PJ0Z 2EZPA 4LH7A 4CH5A 4DUYB 1JJ2U 4X1IB 4K8XA 1VARA 3K0GA 4LF9B 4B3RO 2W6JG 2EIJB 3CCQV 1EFRG 3BAAA 2LGQA 4CC5A 2QTOA 4YY3B 4DR1B 2RNBA 1BMFG 3F5WC 1WA8A 4JAAA 3LSQA 2B9ZA 1M4UA 3G80A 3FAVA 3AG1B 2QKSA 1PM9A 4B3TB 4PELA 2Q4PA 1OJHA 4JI5B 5KAFZ 1SQPH 1AI5A 2ZD9A 2Q67A 2IJIA 3H1HH 3ABTA 5KHGA 3SJAC 4X88A 4U3JA 1BT8A 3K04A 3JCUZ 4QIWF 3OM3B 4JZ2A 3S3XA 1OCOC 1FXKC 1N33B 1XI1A 3T4DA 4LF5B 1AR4A 5KHHA 2RN9A 4OPHA 3K58A 1XNQB 4PDMA 3FYEB 2OWOA 4QJFB 2UXXA 3OD4A 1WB7A 1EN5A 1SF9A 1B6QA 2BOBC 5HFLA 1XILA 3JARB 3JAWB 1FFTB 1S77D 2DQ3A 5KA6A 5JJJB 1M93A 3CCLV 3SPIA 4GKKO 4NXNO 4LF4O 1PL0A 4FMTA 2BSKB 4A5UB 4QE7A 3AG2C 4X65O 4QE9A 4LF9O 1QHTA 5LMNO 4L87A 4JI4B 1JX9A 4DXWA 5F2VO 1XUQA 1IBLO 2HLDG 2IH3C 2IJKA 1BE3H 5B5EZ 3JAMN 5LHIA 2Q8VA 2P7TC 3HKEA 1ZX3A 5DECA 1RSOA 1PP9H 3SR2C 2UXDO 4IHJA 2NN4A 5BR8B 1VQ5V 3TXSA 3ETEA 3IC9A 2FTKA 4K35A 1YTFB 2YEVB 5KX5A 2CTRA 1SA0A 3PN1A 4CH4A 4P9OA 2CGNA 1CP9A 3OT7A 5CA1B 4DR5B 1QBZA 1SZXA 3G4SV 4FM0A 1H8HG 5IWAB 5J9PC 2AGAA 2Q9LA 3K79A 2PF4E 1VF5B 1ZSPA 3OTOO 1JJOA 2ZXWB 3T1YO 3CYOA 4CH3A 1NU1H 3LSUA 2JVDA 3STZC 3OFNG 2GBOA 1J5EB
chains in the Genus database with same CATH topology
4JI2O 4DV0O 4JYAO 1IBMO 4X66O 5BXZA 1R1BA 4OPAA 4JI0O 3RT3C 5LMUO 1J5EO 2UUAO 1N34O 1G1XB 1F7YA 2UXCO 3O65A 4OPHA 4DV7O 2UXBO 1HNXO 4DR2O 1N33O 2LW7A 1D2DA 4LF5O 4X64O 1XNQO 1XMOO 5IT9N 1NS1A 4DUZO 1XNRO 4DR4O 4NXMO 4DV5O 4LFBO 1FYJA 4GKJO 3R66A 2E5LO 4LFAO 3J81N 1X59A 1IBKO 3J7AU 4GKKO 4NXNO 4LF4O 1KUQA 4JV5O 4A5UB 4DV6O 5H5NA 1AILA 4AQYO 4X65O 3SDLA 4K0KO 4DR7O 4LF9O 2FKXA 5LMNO 1FKAO 2ZM6O 1A32A 3J80N 1IBLO 1AB3A 2N74A 3M8AA 1I94O 4B3SO 2VQFO 1N32O 3JAMN 4JI4O 3F5TA 1YZBA 4JI8O 2JRIA 2DJVA 4DR6O 1XMQO 2UXDO 2VQEO 1N36O 3T1HO 1FJGO 1DK1A 4B3RO 4DR5O 2ZKOA 4DUYO 2UUBO 4JI6O 4KHPO 2HHHO 4JI7O 2UUCO 4OX9O 4DV2O 5LL6Y 5BR8O 2UU9O 2F4VO 5FLXN 4DV3O 1R6TA 4YY3O 2DOSA 4JI1O 4DR1O 4X62O 4B3MO 4DV4O 4LF7O 4LF8O 5A2QN 2AGAA 1XEQA 4YHHO 1HNZO 1HR0O 3OTOO 3T1YO 4LF6O 2Z0AA 5IWAO 1HNWO 4JI3O 5BY1A 4B3TO 4LFCO 4DV1O 4DR3O 4JI5O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JI2 O;  4DV0 O;  4JYA O;  1IBM O;  4X66 O;  5BXZ A;  1R1B A;  4OPA A;  4JI0 O;  3RT3 C;  5LMU O;  1J5E O;  2UUA O;  1N34 O;  1G1X B;  1F7Y A;  2UXC O;  3O65 A;  4OPH A;  4DV7 O;  2UXB O;  1HNX O;  4DR2 O;  1N33 O;  2LW7 A;  1D2D A;  4LF5 O;  4X64 O;  1XNQ O;  1XMO O;  5IT9 N;  1NS1 A;  4DUZ O;  1XNR O;  4DR4 O;  4NXM O;  4DV5 O;  4LFB O;  1FYJ A;  4GKJ O;  3R66 A;  2E5L O;  4LFA O;  3J81 N;  1X59 A;  1IBK O;  3J7A U;  4GKK O;  4NXN O;  4LF4 O;  1KUQ A;  4JV5 O;  4A5U B;  4DV6 O;  5H5N A;  1AIL A;  4AQY O;  4X65 O;  3SDL A;  4K0K O;  4DR7 O;  4LF9 O;  2FKX A;  5LMN O;  1FKA O;  2ZM6 O;  1A32 A;  3J80 N;  1IBL O;  1AB3 A;  2N74 A;  3M8A A;  1I94 O;  4B3S O;  2VQF O;  1N32 O;  3JAM N;  4JI4 O;  3F5T A;  1YZB A;  4JI8 O;  2JRI A;  2DJV A;  4DR6 O;  1XMQ O;  2UXD O;  2VQE O;  1N36 O;  3T1H O;  1FJG O;  1DK1 A;  4B3R O;  4DR5 O;  2ZKO A;  4DUY O;  2UUB O;  4JI6 O;  4KHP O;  2HHH O;  4JI7 O;  2UUC O;  4OX9 O;  4DV2 O;  5LL6 Y;  5BR8 O;  2UU9 O;  2F4V O;  5FLX N;  4DV3 O;  1R6T A;  4YY3 O;  2DOS A;  4JI1 O;  4DR1 O;  4X62 O;  4B3M O;  4DV4 O;  4LF7 O;  4LF8 O;  5A2Q N;  2AGA A;  1XEQ A;  4YHH O;  1HNZ O;  1HR0 O;  3OTO O;  3T1Y O;  4LF6 O;  2Z0A A;  5IWA O;  1HNW O;  4JI3 O;  5BY1 A;  4B3T O;  4LFC O;  4DV1 O;  4DR3 O;  4JI5 O; 
#chains in the Genus database with same CATH topology
 2AHY A;  2MK3 A;  2OYQ A;  1WA8 B;  4OPA A;  3FAV B;  4EFE A;  3RFR A;  5IDJ A;  1F7Y A;  3JAL A;  4H0L B;  1V9P A;  2Y69 C;  2JK5 C;  3DC6 A;  3UQ8 A;  4UVA A;  1XMO O;  4JI0 B;  1K5Q A;  1THZ A;  3FYI B;  4CBC A;  4DV5 O;  2RCV A;  5CN0 A;  4U3J B;  3LSS A;  2KKW A;  2JGU A;  1Y74 A;  4MTG A;  2Q0A A;  1AJQ A;  1T5E A;  4GX2 A;  3RW0 A;  3P32 A;  4YJ3 A;  2QA4 V;  3ZCC A;  3BY6 A;  1DF4 A;  3L70 H;  1EN6 A;  3SDL A;  5L3D A;  3ZX6 A;  3OGC C;  1N8R W;  3M99 B;  3E22 A;  4MVO A;  4XDL A;  1RPR A;  4KUM A;  5KHK A;  3ABM C;  1YJ9 V;  2R72 A;  2EUL A;  2P67 A;  3EHB B;  4GX0 A;  4DR6 O;  4OX9 B;  4EFB A;  3AG3 B;  4UCT A;  4FLW A;  3CSX A;  4DR5 O;  2JDI G;  1XL6 A;  1OCO B;  2HHH O;  2UU9 O;  3RYF A;  3JAT A;  5IYZ A;  2D2C B;  4FLT A;  3HKC A;  1I08 A;  4BWA A;  2AHZ A;  3GB7 C;  4GUN A;  3ZHU A;  4B3M O;  2WLH A;  1K97 A;  4H33 A;  1M56 C;  4HZ3 A;  1RSO B;  4JI3 B;  5A2Q N;  4IHJ B;  2L35 A;  4PHZ A;  1HDJ A;  2QWN B;  4E2L A;  2GUZ A;  4TSF G;  1JVM A;  4LFC O;  4X66 B;  5KX5 B;  4PI0 A;  1SA0 B;  1IBM O;  1FPO A;  4XDK A;  3ABK B;  3K9S A;  3K9A A;  3SYP A;  4JI0 O;  2EIN C;  4ZIB A;  4W4K A;  3O65 A;  2HJD A;  3B4S A;  2JIZ G;  1I7F A;  1S5J A;  4J7J A;  3E35 A;  1MG1 A;  1H2S B;  4X64 O;  4WFB V;  4N21 A;  1NS1 A;  4DUZ O;  1G6U A;  3ZHQ A;  3FX7 A;  5JWP A;  1ZLZ A;  4RUF A;  1VP7 A;  1H2N A;  1F4M A;  1SRY A;  1NT2 B;  1S0V A;  2CK3 G;  5IYB O;  3JAL B;  4J9Y B;  4TOI A;  2PYJ A;  1OCR B;  4E4E A;  3ZMZ A;  1I94 B;  1W2B U;  2V4D A;  3AG4 C;  4UB6 Z;  2OTJ V;  1Y74 B;  2ZIM A;  1QVF U;  1N32 O;  3G67 A;  4DV6 B;  1ZL8 A;  1BQ0 A;  1K34 A;  3OE7 G;  4KHP B;  2P22 C;  4JAV A;  4YJ3 B;  3C3S A;  1BL8 A;  4DV2 B;  4GX5 A;  2LP7 A;  3APQ A;  1JCH A;  2B1G A;  5DN6 G;  4BIO A;  5HFM A;  3E22 B;  1Q43 A;  1SET A;  3AK1 A;  3G6B A;  3BVO A;  4J41 A;  1HP8 A;  4YHH B;  3E8H A;  2ZDI C;  3SPH A;  2PI4 A;  1B06 A;  4DK0 A;  3CCU V;  3FKS G;  4UV9 A;  2G38 A;  4JYA B;  2EIL C;  3E8B A;  3H01 A;  5BY1 A;  3CB2 A;  4LC1 A;  3TGU H;  3RYF B;  3JAT B;  4JI1 B;  5IYZ B;  3H1K H;  3CWB H;  3HKC B;  2WAM A;  4UVB A;  4MTO A;  4DV4 B;  4NYK A;  2NNU A;  4Q20 A;  1S5H C;  5JVD A;  4J42 A;  3QTC A;  1B04 A;  4GT1 A;  4AHC A;  2IBZ H;  4LBE C;  4G27 B;  1XNR B;  4R7C A;  2GUZ B;  1DGS A;  3SYQ A;  1MAB G;  3B40 A;  1W59 A;  2E74 B;  4I50 A;  2R9I A;  3OEH G;  5LGU A;  1O9G A;  1K7D A;  4KXR A;  3J7A U;  3UCS C;  3T1C A;  2DWE C;  4DV6 O;  3E83 A;  1COW G;  1MZE A;  3WFV A;  4P30 A;  2DN9 A;  3VQY A;  5KA5 A;  4CS3 A;  1Y67 A;  1GRJ A;  1M56 B;  3WB2 A;  1R6N A;  3MDS A;  1ROP A;  4JPR A;  5K1P A;  3I55 V;  3IGA C;  3ETD A;  1U97 A;  4O4L A;  1AI4 A;  3K3W A;  4MVR A;  4JI7 B;  3T1H O;  4ABM A;  3VQW A;  3CCV V;  3VOU A;  5IYC O;  2VRZ A;  2P6J A;  4NTX A;  4UCU A;  2RMK B;  2QM8 A;  5EK0 A;  4WFG A;  3HKD A;  4TV9 A;  3LDC A;  4JI1 O;  3ZHS A;  2QE7 G;  2HP8 A;  1HNZ B;  1ZL8 B;  2ADQ B;  4DV4 O;  4LF7 O;  3ZS8 C;  1BCC H;  1NR1 A;  4NTW A;  3ZRW A;  4XBF A;  1PL4 A;  3QNE A;  1VQN V;  3CP1 A;  3B8N A;  3TK1 A;  2XUM A;  2QWQ B;  4DV0 B;  2K1E A;  1E1R G;  4IL6 Z;  3BPZ A;  1U96 A;  2VWK A;  4EB6 A;  2UUA B;  2HEP A;  1KQS U;  1SER A;  4IYI A;  4I55 A;  1GN3 A;  1R1B A;  3H9V A;  3K5M A;  2OCC C;  2IH1 C;  3JD4 A;  1XHZ A;  1H2L A;  2FL4 A;  1OCZ C;  5L3E A;  3RWR D;  2C2A A;  3W7W A;  4FM2 A;  4JI2 B;  1D2D A;  5GON A;  5KLV H;  1NI8 A;  3JAK A;  4OXS A;  5IT9 N;  2Q7G A;  4X1Y A;  3DXR A;  1Z5W A;  1YSC A;  1Q7Y W;  2CE4 A;  2LO1 A;  2RDC A;  4RQF A;  2JJ2 G;  5EC1 C;  5JVD B;  1Y4M A;  4HBN A;  1QCE A;  5JCO C;  4JF3 A;  2JEU A;  4JV5 O;  2WLL B;  3KZI Z;  1SQQ H;  1DF5 A;  4I0X A;  5B1B C;  5KUK A;  2FKX A;  4FVM A;  4I50 B;  2ZE6 A;  4YJ2 A;  1Y6X A;  3AK2 A;  4ZOL A;  5LYJ A;  1RM1 C;  2VQF O;  4FM1 A;  4WFA V;  4JZG A;  3OUF A;  2E3C A;  1K5S A;  2VQE O;  4MW8 A;  2QWO B;  1MSW D;  2M6Y A;  2WLJ A;  2DYS B;  5LP6 C;  1MSD A;  2QTS A;  2X6C A;  2M7W A;  3A2F A;  4JGS A;  1BSM A;  1IDS A;  3WB0 A;  4O4L B;  4PDR A;  4X62 O;  2MW2 B;  1HNW B;  2XAJ A;  2EIM B;  1H2K A;  2JS5 A;  2D3O W;  1V55 C;  4OGQ B;  2BTQ A;  2DQ0 A;  1M9N A;  3BA9 A;  3ASO C;  2RJZ A;  4WFH A;  2FYU H;  4JI2 O;  1HWY A;  1VQL V;  3HKD B;  2UXC B;  3JAS A;  4TV9 B;  2GTA A;  2A06 H;  4UXN A;  3ABU A;  3SYA A;  4EEQ A;  1P84 F;  4O4H A;  2YC0 A;  3ZRW B;  2UXB O;  1S72 V;  1V54 C;  1P7G A;  4X1K A;  2LW7 A;  3BAB A;  5B3S B;  2RQ6 A;  2N04 A;  1KU9 A;  2K9P A;  1R3J C;  4EB6 B;  4W4L A;  3CJH A;  4H13 B;  4MW3 A;  1F51 A;  4I55 B;  4J80 A;  4FK5 C;  5J2U A;  2AZ2 A;  1ZTE A;  4C7U A;  3QO7 A;  3L73 H;  1S76 D;  4I4T A;  2KQX A;  5GON B;  1VQP V;  2YID A;  3VBB A;  1ZWI C;  3JAK B;  5IYD O;  2XAS A;  3ICX A;  4QGP A;  4X1Y B;  3DXR B;  1VQ7 V;  3OMA B;  4GZR B;  3M8A A;  1PKX A;  2PYL A;  3QO8 A;  1NZ6 A;  1WNS A;  3LNM B;  1SKV A;  2UUC B;  2YIC A;  2CH7 B;  5B1O A;  5A9G A;  1VQ4 V;  3JD3 A;  1FJG O;  1DK1 A;  1VMG A;  1Q86 W;  4DUY O;  4I0X B;  3RYH A;  3FB6 C;  1AI6 A;  3B8M A;  2EIK B;  2OCC B;  2OCH A;  1FXK A;  5ITZ A;  5LL6 Y;  4ZOL B;  5E79 Z;  5LYJ B;  1R3K C;  1R6T A;  2LGW A;  4PV1 B;  4YY3 O;  1YDX A;  4DR1 O;  3SPC A;  2WPD G;  2W6I G;  2Y48 A;  1XHX A;  1Z5V A;  2DWD C;  5IY5 B;  2E75 B;  2XAG A;  4DRX A;  1JOY A;  2AZ0 A;  1S5L Z;  2KSD A;  4LR3 A;  1EZV H;  2Z0A A;  1K9M W;  5B1A B;  3QG5 A;  3VQX A;  3LDD A;  4B3T O;  1LNQ A;  1L8D A;  1D5N A;  4UUJ C;  3UT5 A;  2GV9 A;  4QNH B;  4JI5 O;  3U11 A;  5EIB C;  4MVS A;  1US6 A;  2HG5 C;  2VWJ A;  4FLZ A;  1HNX B;  3UM7 A;  4FLX A;  2V1D A;  4G2K A;  1GN2 A;  2ZR3 A;  3OUS A;  1RM1 B;  1G4Y B;  3RN4 A;  1XOU A;  1QR9 A;  5L3C A;  4LFB B;  1N33 O;  1GK9 A;  4GKJ B;  1TA8 A;  2BTQ B;  4LF5 O;  1VF6 C;  5JQG A;  1XNQ O;  1Q6I A;  1N4C A;  1RP3 B;  4YIO A;  3JAS B;  1GM7 A;  4R50 A;  5EBM C;  3CME V;  3ZRX A;  3ZHT A;  4MVM A;  5LOV A;  4BIZ A;  1M1K W;  4O4H B;  5GW7 A;  1EZJ A;  2QKC A;  4X1K B;  3P3N A;  3ZBH A;  5KMG A;  3THO A;  3BRC A;  4GX1 A;  3OAA G;  4I7Z B;  2UXN A;  3ETG A;  1WLE A;  2H94 A;  2P4K A;  1YJN V;  1XMQ B;  3CJH B;  3ZMS A;  1V55 B;  3SPG A;  3CX5 F;  4MVQ A;  4JI4 O;  2X6A A;  2OT5 A;  3F5T A;  3K0D A;  4F4L A;  3CRQ A;  4KFM A;  1YIT V;  1W0J G;  2GDS A;  1KKD A;  5J2U B;  4UB8 Z;  1QVG U;  2HFE C;  2A79 B;  1AR1 B;  1XBL A;  3STL C;  1TGO A;  1KD1 W;  4I4T B;  1WJZ A;  3CRC A;  5GTH Z;  4NKG B;  5BR8 O;  3N2G A;  3CRA A;  2ZQM A;  2X6B A;  3L71 H;  4X8A A;  3OMI B;  4F6E A;  1FXH A;  1PNK A;  4O4J A;  1NKD A;  2Q68 A;  3KKY A;  1TVK A;  2X0L A;  2LQT A;  1VIB A;  3RYH B;  2F23 A;  5IWA O;  2EX3 A;  1NH2 D;  1FXK B;  5ITZ B;  3KG2 A;  2P06 A;  2IU0 A;  5LMU B;  4FLU A;  4UCV A;  3ZRV A;  2Y0P A;  4DV7 B;  5EIB D;  1J5E O;  3HKE B;  3R65 A;  1G1X B;  2R9R B;  4DRX B;  3KCY A;  3CCJ V;  3ZN1 A;  3QVN A;  4NXM B;  4IGG A;  4ZHQ A;  3UT5 B;  4TV8 A;  2QKA A;  2EJR A;  1IZ3 A;  3AG2 B;  1N34 B;  4ZI7 A;  3TCU A;  4HYO A;  1IXB A;  2DYR C;  1KKC A;  3Q4H A;  4YIP A;  2LFS A;  3U10 A;  4DR7 B;  4RWU A;  3L9D A;  1TUB A;  3DGE A;  4U7O A;  4Z1V A;  4RAI A;  3UKM A;  5JQG B;  2WSS G;  2E5L B;  3C90 A;  3BCC H;  1A32 A;  1M5I A;  5EC2 C;  1AB3 A;  2N05 A;  1NH2 B;  1XDC A;  2B1I A;  2XOK G;  1H8E G;  2Q7E A;  4AQY B;  2JRI A;  4PA9 A;  5LOV B;  3K03 A;  5KUM A;  2R70 A;  1I0H A;  4OX9 O;  4B3S B;  5KMG B;  4AIL C;  4FFB A;  4P9P A;  1ZAU A;  3BFR A;  3NXS A;  3O9O A;  5IJ0 A;  3SJQ C;  1BS3 A;  5L3G A;  3W7U A;  3FB8 C;  1WN7 A;  4DV1 B;  2ITC C;  3EFF K;  1JR9 A;  4AI8 A;  1H2M A;  4JI3 O;  3KCX A;  3N2G B;  3TJT A;  1P7B A;  4B08 A;  5JJN B;  2ZE7 A;  3CCR V;  2FML A;  5L3B A;  2A3Q A;  2Y69 B;  3TET A;  4X66 O;  5BXZ A;  4DR2 B;  5FPO A;  1N34 O;  4O4J B;  4IIJ A;  4UVC A;  1TVK B;  4O2A A;  4DR4 B;  4TT3 G;  4JYB A;  3CPW U;  4Z1M G;  5K1X A;  3CCS V;  4LFA B;  3W7X A;  4Q6G A;  1KEC A;  4LNU A;  5BMV A;  3JD2 A;  2JJ1 G;  1Q5O A;  2E5L O;  1SQG A;  2PGG A;  3IC7 A;  3LUT B;  4BR6 A;  1BHB A;  2OTL V;  4K3A A;  3A0H Z;  4K0K B;  1GTO A;  4UCO A;  1OCC C;  3MAQ A;  4ICG A;  4O4I A;  3FB5 C;  3ABM B;  2ZM6 B;  3L72 H;  2NLJ C;  4AQY O;  3ETQ A;  3GWK C;  3WG7 C;  4ZHQ B;  2ZDI A;  1SZT A;  1SS3 A;  3RBZ A;  2YUA A;  3OEE G;  1MNG A;  4JI8 B;  1AJP A;  2JGD A;  2LFR A;  4PD4 F;  3CRM A;  1I94 O;  4B3S O;  4ZI7 B;  4MT8 A;  3Q4H B;  2ZCE A;  2UUB B;  2XAF A;  2YXL A;  2IW5 A;  4D7T A;  1GH6 A;  2VS0 A;  2ZKO A;  5H9C A;  2PZS A;  4D7S A;  1TUB B;  4KHP O;  2O57 A;  3F7Y C;  1EN4 A;  4LWS A;  2YSU B;  2ZE8 A;  3EVK A;  4DV2 O;  1RPO A;  5LGN A;  2EIJ C;  3IJ4 A;  4LF8 B;  5IE9 A;  1HR0 B;  4FPP A;  2L6L A;  5DM6 V;  4JTC B;  4LF6 B;  2EJ7 A;  1PNL A;  3A0R A;  2YDE A;  3OMN B;  3ZMV A;  4BAY A;  4BIU A;  4YHH O;  5EYP A;  1Q3E A;  2EIN B;  1E1Q G;  3AG1 C;  2ODM A;  2Q0O C;  2YIB A;  4FZ0 A;  4GYC B;  1FAF A;  4FFB B;  3ML0 A;  4PDV A;  4JYA O;  2NR5 A;  4WFF A;  2QDO A;  3HB3 B;  2V7Q G;  5IJ0 B;  3W7S A;  4JAU A;  5LGT A;  2QSA A;  1VQO V;  2Q73 A;  5CMU A;  3P3P A;  1IX9 A;  1S3J A;  5CBG A;  3I5D A;  2Y0I A;  1K3E A;  4KP4 A;  1XNR O;  3K5O A;  4WCE V;  1FYJ A;  3D3I A;  5KHJ A;  1M90 W;  3R66 A;  4BW9 A;  4CS2 A;  4FLY A;  3JD0 A;  5IJ9 A;  5LBQ A;  2BTO A;  3ZJZ A;  3GWO A;  2XND G;  1HW7 A;  1K4D C;  5AG2 A;  3W7T A;  3CHX A;  4TQF A;  1DLB A;  4IIJ B;  3A8T A;  1AP5 A;  1WPX A;  3AG4 B;  3ZMT A;  2ZR2 A;  4O2A B;  1AIL A;  4DW1 A;  2IJH A;  3E2E A;  3B09 A;  1NVP D;  3K59 A;  2DMX A;  4UCS A;  1PNM A;  3ZN0 A;  2W0X A;  4LNU B;  5BMV B;  4RO2 A;  2F93 B;  4B3R B;  3PJS K;  3K08 A;  1UJW B;  4F6R A;  1QLN A;  1TUE B;  4O2B A;  4O4I B;  2YIB D;  1Q81 W;  1JA8 A;  1FXV A;  3CD6 V;  4UV8 A;  4JI7 O;  3QO5 A;  2F66 C;  2CTP A;  1P49 A;  2JGD B;  1CPY A;  4JTA B;  2DOS A;  2QR4 A;  2EIL B;  3M7M X;  2E76 B;  3MD0 A;  1XEQ A;  3JD1 A;  1HNZ O;  1GM9 A;  1AVM A;  2F4V B;  4LWS B;  4DV3 B;  5H2F Z;  5JCO A;  2QM7 A;  4I9W A;  3DC5 A;  1BHA A;  1AR5 A;  4DV0 O;  3K57 A;  1XL4 A;  2ADP A;  3DTU B;  2ZXW C;  2UUA O;  4MSW C;  4J7Z A;  2GTS A;  1R3I C;  1K8A W;  5FNV A;  3AG7 A;  2Q5Z A;  2WWW A;  4D6T H;  5EYP B;  3ABL C;  4J7K A;  1XRE A;  2HVJ C;  3B77 A;  5B66 Z;  3SYC A;  2XAH A;  4GKK B;  3EXA A;  3CE2 A;  4NXN B;  4LF4 B;  2QM4 A;  1VQ8 V;  1KYO F;  1FS0 G;  4TWK A;  5LP6 A;  4X65 B;  3P30 A;  2YXY A;  2PUS A;  1AI7 A;  3FFQ A;  5LMN B;  1J95 A;  2W0F C;  3ZHV A;  1VQK V;  5H5N A;  1JFF A;  3CRR A;  5LXT A;  1IBL B;  3RYI A;  4NVP A;  1FKA O;  1NJI W;  2DE0 X;  2XTA A;  1Q90 D;  1O9H A;  2ARH A;  3RYC A;  2UXD B;  5IJ9 B;  2A7W A;  4H37 A;  1SQB H;  5CA0 A;  3G6E V;  1CXZ B;  1WP8 A;  1P4R A;  3X2Q C;  5KHI A;  1F23 A;  4RUE A;  2IU3 A;  3JSL A;  3AG3 C;  2F4V O;  1QNM A;  1OHH G;  5L3F A;  3UO3 A;  2YIA A;  1MOF A;  2ATK C;  4DV3 O;  5J2T A;  2WLI A;  3N27 A;  1LUV A;  1N36 B;  3OTO B;  3T1Y B;  2XAQ A;  4F6R B;  1I5Y A;  2KG7 A;  1YTF D;  4O2B B;  1WAZ A;  1YHQ V;  5GTI Z;  1RFY A;  2H8P C;  4X9Q A;  1HNW O;  1AJN A;  4YJ2 B;  1OCZ B;  1F4N A;  4N23 A;  1SQV H;  3ASN C;  4HNA A;  5D5P A;  4WBN A;  1DTO A;  3E8F A;  2UXC O;  1WB8 A;  1XMO B;  2Q6A A;  4DR3 B;  2ZT9 B;  3ABK C;  4DV5 B;  5LHH A;  1SQX H;  2CAZ C;  2GSM B;  3SGI A;  4LP8 A;  5E1A C;  4PDL A;  2R9A A;  3H1I H;  2Z3Y A;  1K92 A;  5B1B B;  3E86 A;  2CGO A;  3CCE V;  5FNV B;  3CC4 V;  4TQD A;  1GN6 A;  1N0J A;  4BW5 A;  2A0L A;  1GKF A;  4UFZ A;  3VQV A;  1IBK B;  1K4C C;  1X4T A;  4DR6 B;  2N74 A;  2OIE A;  1N0N A;  1R6K A;  4MTF A;  2FB5 A;  1OCR C;  2F43 G;  3RVZ A;  3ZHR A;  5LP6 B;  4FJC C;  2DJV A;  2HHH B;  2IM9 A;  1N36 O;  2UU9 B;  1NQT A;  1BGY H;  1JFF B;  1LUW A;  5LXT B;  2JS3 A;  1YEW A;  3RYI B;  2HVK C;  2UUC O;  5LA6 A;  1G8M A;  1E79 G;  4JYC A;  3IAY A;  4B3M B;  3GVM A;  1YXB A;  1YF2 A;  3RYC B;  3ABL B;  4JAS A;  5KAI Z;  1VF6 A;  3ASO B;  2PI5 A;  3CC7 V;  1YCI A;  2P5O A;  1QLE C;  4P2Z A;  3CMA V;  1ARO P;  2KB1 A;  3JYC A;  4LFC B;  4FLV A;  2YI9 A;  5CA0 B;  2YXH A;  2LJ2 A;  3FD9 A;  1IBM B;  5H6R A;  1PV0 A;  3B2E E;  3CXH F;  4DR3 O;  3U0Z A;  4I5S A;  1L0L H;  1V54 B;  5J2T B;  3OR6 C;  2WLI B;  3TXQ A;  4QPJ A;  3RT3 C;  3ZRS A;  1H2G A;  4CZZ A;  2KG7 B;  4X64 B;  1BZK A;  4DW0 A;  4DUZ B;  1HNX O;  1EM1 A;  4TUY A;  5B1N A;  5JH7 A;  2Q7H A;  4R8C A;  2QWP B;  3L75 H;  4LFB O;  4GKJ O;  2HKO A;  4WFE A;  3X2Q B;  1FFX A;  3J81 N;  1X59 A;  4HNA B;  1IBK O;  2CUG A;  4PI2 A;  4WBN B;  4PA3 A;  1NTK H;  2ZE5 A;  3NR7 A;  4H44 B;  3UO2 A;  1XQ8 A;  4ZKI A;  3MHS C;  4DYL A;  3BEH A;  1Q82 W;  3RVY A;  3E8G A;  2EBO A;  1N32 B;  3ZED A;  1R3L C;  1Q8I A;  1SES A;  5EBW C;  1Q6H A;  1EBO A;  2P90 A;  2ETN A;  2ZNI A;  1WP7 A;  1XMQ O;  2Y4U A;  3F7V C;  1KMI Z;  3ASN B;  2YI8 A;  3CXC U;  1KB9 F;  1VQ6 V;  3G71 V;  1KP3 A;  3LNN A;  2QGN A;  3T2M A;  1UPG A;  4GLX A;  1GM8 A;  1SC5 B;  1IUR A;  1UFI A;  4JI6 B;  1YIJ V;  2A9H A;  1TAE A;  1Y76 A;  3JCZ A;  1BQZ A;  1D5A A;  1ORQ C;  5LA6 B;  4DK1 A;  4WF9 V;  2Y4T A;  3I56 V;  1NTM H;  4UCR A;  5LMU O;  3K5N A;  2BCC H;  1QR8 A;  5TIS Z;  3ZMU A;  4NB5 A;  4DV7 O;  2WLK A;  4U3F H;  1ZUQ A;  2Z5U A;  5DED A;  3N2K A;  4Z2W A;  1GMG A;  5CBH A;  3CC2 V;  2JEX A;  4IYH A;  1M57 C;  5EZY A;  4NXM O;  4I9Q A;  3LDE A;  4DO2 A;  5LHG A;  3K5L A;  1VEW A;  5C8Y A;  2CTW A;  5JJE B;  1CEZ A;  5BZB A;  4NR1 A;  2P4V A;  1URF A;  1Y66 A;  4EKW A;  1W0K G;  3HPL C;  4TUY B;  3AK3 A;  5JH7 B;  1JQ0 A;  4DR7 O;  1QLE B;  4MTX A;  4B7E A;  2IJJ A;  1Q6U A;  1YI2 V;  3BA8 A;  4GCZ A;  1FFX B;  3T1H B;  2ZNJ A;  1MMM A;  1B3Q A;  2XT9 A;  3RGB A;  3HKB A;  2ITD C;  3K06 A;  4XDJ A;  1JMK C;  1ENV A;  4JI6 O;  4PA6 A;  1FD9 A;  4TV8 B;  5FLX N;  4X20 A;  2WA3 A;  4LF7 B;  1GN4 A;  2DYS C;  3D3Q A;  4CH6 A;  2QWR B;  1YVW A;  5C93 A;  3SYO A;  1AP6 A;  2WLL A;  1MA1 A;  1LR1 A;  4MVZ A;  1H38 A;  4CC6 A;  2B5U A;  3ZIA G;  5EBL C;  4ZBM A;  1KBH A;  2GHY A;  4DV1 O;  3WB1 A;  1VF7 A;  2EIM C;  4LCU C;  1NTZ H;  1KC8 W;  4B7K A;  1OZ0 A;  3CCM V;  5CB4 A;  3D8C A;  2PTM A;  2WLM A;  1QU7 A;  3S3W A;  3IFX A;  1WPB A;  2ILM A;  1Y76 B;  4DR2 O;  3AEI A;  4R6Z A;  2DYR B;  3T4Z A;  4PA4 A;  1IXM A;  2F95 B;  1K73 W;  4IT5 A;  4DR4 O;  4FFK A;  4LFA O;  4JV5 B;  3C3T A;  2PY5 A;  1NBM G;  3E89 A;  4HAM A;  5B3S C;  1NR7 A;  1L0N H;  3OGI B;  4X1I A;  3A0B Z;  2Q69 A;  3SJC C;  4J11 A;  3QF7 A;  1KUQ A;  2YS8 A;  2ZIO A;  3D36 C;  2AXT Z;  4K0K O;  2QEX V;  3N2K B;  2HR3 A;  4MS2 A;  3MHH C;  2VQF B;  2ZM6 O;  5EZY B;  4FIP C;  1GAX A;  2VQE B;  1YZB A;  3SPJ A;  3H1J H;  4JI8 O;  2BOC C;  3CS5 A;  5C8Y B;  1VQ9 V;  4JTD B;  4X89 A;  4CS4 A;  2WLN A;  3DSQ A;  2UUB O;  3FB7 C;  4KL1 A;  2CDY A;  2H3O A;  2EZO A;  5CBF A;  4X62 B;  3D36 A;  4JYY A;  1GO3 F;  1QQC A;  2DW4 A;  3APO A;  2EIK C;  2QJ1 A;  3OR7 C;  1MZF A;  1M57 B;  3HKB B;  4LF8 O;  1HR0 O;  3CEI A;  1L1F A;  4LF6 O;  3H1L H;  4NTY A;  5IY5 C;  3SJB C;  4RQE A;  3WU2 Z;  1K33 A;  2LW1 A;  5D5Q A;  4X20 B;  3JAR A;  4L8J A;  3JAW A;  4ASU G;  5B1A C;  2UXB B;  4YXW G;  3JSN A;  3OW2 U;  2CH7 A;  2BSK A;  5H6Q A;  4FZ1 A;  4J10 A;  1IVS A;  1SQF A;  1I5X A;  4LH6 A;  4J9Z B;  1OCC B;  4G28 B;  5FPR A;  3L74 H;  2AW9 A;  1PPJ H;  2X7R B;  3BHP A;  1NVP B;  5FL7 G;  3WG7 B;  5CB4 B;  2ZIN A;  2HJF C;  2F1M A;  4PA7 A;  4K8Z A;  1OV9 A;  1R73 A;  3OTF A;  1JPX A;  1PD3 A;  4QPK A;  5CA3 A;  2OIG A;  1YJW V;  1KP2 A;  2CTQ A;  2BE3 A;  2YEV A;  1VQM V;  4MVU A;  3J80 N;  2WA4 A;  2XHB A;  3HR0 A;  1FJG B;  1Z2G A;  4U7N A;  5CA1 A;  4PJ0 Z;  2EZP A;  4LH7 A;  4CH5 A;  4DUY B;  1JJ2 U;  4X1I B;  4K8X A;  1VAR A;  3K0G A;  4LF9 B;  4B3R O;  2W6J G;  2EIJ B;  3CCQ V;  1EFR G;  3BAA A;  2LGQ A;  4CC5 A;  2QTO A;  4YY3 B;  4DR1 B;  2RNB A;  1BMF G;  3F5W C;  1WA8 A;  4JAA A;  3LSQ A;  2B9Z A;  1M4U A;  3G80 A;  3FAV A;  3AG1 B;  2QKS A;  1PM9 A;  4B3T B;  4PEL A;  2Q4P A;  1OJH A;  4JI5 B;  5KAF Z;  1SQP H;  1AI5 A;  2ZD9 A;  2Q67 A;  2IJI A;  3H1H H;  3ABT A;  5KHG A;  3SJA C;  4X88 A;  4U3J A;  1BT8 A;  3K04 A;  3JCU Z;  4QIW F;  3OM3 B;  4JZ2 A;  3S3X A;  1OCO C;  1FXK C;  1N33 B;  1XI1 A;  3T4D A;  4LF5 B;  1AR4 A;  5KHH A;  2RN9 A;  4OPH A;  3K58 A;  1XNQ B;  4PDM A;  3FYE B;  2OWO A;  4QJF B;  2UXX A;  3OD4 A;  1WB7 A;  1EN5 A;  1SF9 A;  1B6Q A;  2BOB C;  5HFL A;  1XIL A;  3JAR B;  3JAW B;  1FFT B;  1S77 D;  2DQ3 A;  5KA6 A;  5JJJ B;  1M93 A;  3CCL V;  3SPI A;  4GKK O;  4NXN O;  4LF4 O;  1PL0 A;  4FMT A;  2BSK B;  4A5U B;  4QE7 A;  3AG2 C;  4X65 O;  4QE9 A;  4LF9 O;  1QHT A;  5LMN O;  4L87 A;  4JI4 B;  1JX9 A;  4DXW A;  5F2V O;  1XUQ A;  1IBL O;  2HLD G;  2IH3 C;  2IJK A;  1BE3 H;  5B5E Z;  3JAM N;  5LHI A;  2Q8V A;  2P7T C;  3HKE A;  1ZX3 A;  5DEC A;  1RSO A;  1PP9 H;  3SR2 C;  2UXD O;  4IHJ A;  2NN4 A;  5BR8 B;  1VQ5 V;  3TXS A;  3ETE A;  3IC9 A;  2FTK A;  4K35 A;  1YTF B;  2YEV B;  5KX5 A;  2CTR A;  1SA0 A;  3PN1 A;  4CH4 A;  4P9O A;  2CGN A;  1CP9 A;  3OT7 A;  5CA1 B;  4DR5 B;  1QBZ A;  1SZX A;  3G4S V;  4FM0 A;  1H8H G;  5IWA B;  5J9P C;  2AGA A;  2Q9L A;  3K79 A;  2PF4 E;  1VF5 B;  1ZSP A;  3OTO O;  1JJO A;  2ZXW B;  3T1Y O;  3CYO A;  4CH3 A;  1NU1 H;  3LSU A;  2JVD A;  3STZ C;  3OFN G;  2GBO A;  1J5E B; 
#chains in the Genus database with same CATH homology
 4JI2 O;  4DV0 O;  4JYA O;  1IBM O;  4X66 O;  5BXZ A;  1R1B A;  4OPA A;  4JI0 O;  3RT3 C;  5LMU O;  1J5E O;  2UUA O;  1N34 O;  1G1X B;  1F7Y A;  2UXC O;  3O65 A;  4OPH A;  4DV7 O;  2UXB O;  1HNX O;  4DR2 O;  1N33 O;  2LW7 A;  1D2D A;  4LF5 O;  4X64 O;  1XNQ O;  1XMO O;  5IT9 N;  1NS1 A;  4DUZ O;  1XNR O;  4DR4 O;  4NXM O;  4DV5 O;  4LFB O;  1FYJ A;  4GKJ O;  3R66 A;  2E5L O;  4LFA O;  3J81 N;  1X59 A;  1IBK O;  3J7A U;  4GKK O;  4NXN O;  4LF4 O;  1KUQ A;  4JV5 O;  4A5U B;  4DV6 O;  5H5N A;  1AIL A;  4AQY O;  4X65 O;  3SDL A;  4K0K O;  4DR7 O;  4LF9 O;  2FKX A;  5LMN O;  1FKA O;  2ZM6 O;  1A32 A;  3J80 N;  1IBL O;  1AB3 A;  2N74 A;  3M8A A;  1I94 O;  4B3S O;  2VQF O;  1N32 O;  3JAM N;  4JI4 O;  3F5T A;  1YZB A;  4JI8 O;  2JRI A;  2DJV A;  4DR6 O;  1XMQ O;  2UXD O;  2VQE O;  1N36 O;  3T1H O;  1FJG O;  1DK1 A;  4B3R O;  4DR5 O;  2ZKO A;  4DUY O;  2UUB O;  4JI6 O;  4KHP O;  2HHH O;  4JI7 O;  2UUC O;  4OX9 O;  4DV2 O;  5LL6 Y;  5BR8 O;  2UU9 O;  2F4V O;  5FLX N;  4DV3 O;  1R6T A;  4YY3 O;  2DOS A;  4JI1 O;  4DR1 O;  4X62 O;  4B3M O;  4DV4 O;  4LF7 O;  4LF8 O;  5A2Q N;  2AGA A;  1XEQ A;  4YHH O;  1HNZ O;  1HR0 O;  3OTO O;  3T1Y O;  4LF6 O;  2Z0A A;  5IWA O;  1HNW O;  4JI3 O;  5BY1 A;  4B3T O;  4LFC O;  4DV1 O;  4DR3 O;  4JI5 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...