2VQFO

Modified uridines with c5-methylene substituents at the first position of the trna anticodon stabilize u-g wobble pairing during decoding
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S RRNA
publication title Modified Uridines with C5-Methylene Substituents at the First Position of the tRNA Anticodon Stabilize U.G Wobble Pairing During Decoding.
pubmed doi rcsb
molecule tags Ribosome
total genus 34
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-03-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 2vqfO00
1F7YA 1XMQO 5LMUO 1XMOO 1KUQA 4DV1O 2UXBO 3F5TA 4LFCO 4JI0O 4X66O 4AQYO 2AGAA 2VQFO 2HHHO 4NXNO 4JV5O 2UUCO 1XNQO 4DV7O 4DR5O 4YY3O 2VQEO 3J81N 4JI4O 3J7AU 4LF5O 4JYAO 4DUYO 2DOSA 4DR2O 4B3RO 2UXCO 4X64O 4OX9O 1N33O 4JI7O 4OPAA 2UU9O 1HNWO 4K0KO 4JI3O 2ZKOA 1I94O 4LFAO 5FLXN 3T1HO 4B3TO 1D2DA 2UUAO 3SDLA 1NS1A 4LF8O 1IBMO 4DR6O 4DV2O 4DR7O 3RT3C 3O65A 2N74A 4A5UB 4LF4O 1N34O 4OPHA 5IWAO 1FJGO 1IBLO 2E5LO 2LW7A 1G1XB 4DR3O 3M8AA 3T1YO 1AB3A 4GKJO 1A32A 5A2QN 2ZM6O 4JI2O 5LMNO 5BY1A 1YZBA 4JI6O 4B3MO 4DV3O 4YHHO 1XNRO 2Z0AA 1FYJA 4LF7O 4GKKO 1HNXO 4DV5O 4LF6O 1FKAO 4NXMO 4X65O 4JI5O 4LFBO 1N36O 4DV4O 2UXDO 5BXZA 4DV6O 1IBKO 4DV0O 4X62O 4JI8O 1R6TA 3OTOO 1HNZO 2F4VO 4DR4O 3J80N 4LF9O 5BR8O 3JAMN 2JRIA 5IT9N 1XEQA 1AILA 5H5NA 4DR1O 1X59A 1R1BA 2FKXA 1DK1A 5LL6Y 2DJVA 1HR0O 2UUBO 4B3SO 3R66A 1N32O 4DUZO 1J5EO 4JI1O 4KHPO
chains in the Genus database with same CATH superfamily
1Y74B 4YIOA 2QEXV 4XDLA 5C8YB 3ETEA 3AK3A 4CH4A 2Q7GA 1G4YB 1QVFU 4BIZA 4IT5A 1IXMA 4LFCO 5H6QA 3BHPA 4JGSA 3CXCU 1HNXB 4PDRA 2ODMA 3CB2A 1YEWA 4NXMB 2HVKC 3SYCA 3RYCA 3CMEV 1AJQA 4W4LA 2EZOA 4WFFA 4DUYO 3ZHQA 1PP9H 2ILMA 5F2VO 1BGYH 3OGCC 2D2CB 4TV8B 5GTIZ 2ZM6B 3CE2A 3RYFA 4FFBA 4LF9B 2IW5A 5CMUA 4DRXB 4LF8O 2YUAA 2A7WA 1H2GA 2QWPB 4CZZA 1RPRA 1QHTA 3WFVA 4PDLA 1J5EB 4Z2WA 4OPHA 2IJHA 2A06H 1Y66A 5KX5A 4J41A 4BR6A 2CAZC 3DXRA 2BOBC 1K3EA 1A32A 1LR1A 1S5JA 3RBZA 1ZTEA 3TXSA 1VF5B 5JH7A 1MOFA 2XAQA 3H1HH 4DR5B 1GN2A 3AK1A 2Q0OC 3DC6A 5DECA 4JI7B 1ZSPA 1E79G 3CC7V 2UXBB 1S5LZ 5CN0A 5KLVH 2PTMA 4X20B 4I50A 4D7TA 2YEVA 4JYBA 1N34B 1CP9A 3MDSA 3CRMA 4B7KA 4LP8A 1FJGB 2UUBO 4WFBV 2HKOA 1VEWA 5GONA 3KG2A 4QPKA 4CS4A 1Q8IA 1NTMH 2BTQA 3I55V 1M9NA 1WP8A 2ZNIA 3IFXA 4GKKB 2DE0X 3CP1A 3ZHTA 2R70A 2YDEA 1SRYA 3OEEG 4Q6GA 4QIWF 4R7CA 4NTXA 4ZI7A 4WF9V 1VQ4V 4F4LA 1O9HA 1N33O 1PV0A 1R3JC 1P7BA 1TAEA 5B1OA 1WP7A 3K08A 3CCEV 4H13B 2K1EA 2YIBA 3RYIA 3SDLA 3CCJV 5LHIA 4WFAV 4DK1A 1SQGA 4FJCC 3ZS8C 3HPLC 5EBMC 3OUSA 4P9OA 1Q6HA 4LF4O 5LMUB 3DSQA 2CE4A 5CBFA 1Z5WA 2E5LO 3NR7A 2QKSA 1JFFB 4QJFB 2NR5A 4ZOLB 3H1IH 3U11A 1NH2B 1JJ2U 3ZX6A 3A0BZ 4U3FH 3UM7A 4FMTA 2F93B 3C3SA 5LGUA 4DV3O 4I55B 2VQFB 2HHHB 4MVZA 1XNRO 5JJEB 3LNNA 2B9ZA 1FXVA 1SZXA 1FYJA 3ZHSA 1HNXO 1K4CC 3UO2A 4NXMO 1RM1B 4FM1A 4JI1B 4XDKA 2RCVA 2ZDIC 5LXTB 4DR2B 4MVSA 5B1BB 1RM1C 1ZLZA 4CC6A 1EM1A 5L3GA 1IXBA 2UUAB 5JJNB 1QLEB 4LF9O 4MVUA 3WB2A 4DV2B 3K03A 2FYUH 2YS8A 1PNKA 3L70H 1QLEC 5EYPA 4X9QA 5IWAB 2GUZB 1V55C 1J5EO 3A2FA 1XHXA 1F7YA 4OX9B 4ZIBA 5ITZB 1VMGA 4O4LA 3STZC 1SQBH 4J42A 2X6AA 2GTAA 1Y76B 1TUEB 1YJ9V 1WAZA 3AG4B 1NR1A 4K35A 4IGGA 3RFRA 4N21A 1Q82W 1N8RW 4RUEA 2R9IA 3L73H 4DR5O 1R3LC 3CJHB 4JI7O 3KKYA 3QF7A 4IIJA 3CC4V 4DR4B 3OAAG 3BABA 2JGUA 3EXAA 5HFMA 4UCTA 2HEPA 2IH3C 1YCIA 5J2UB 3T4ZA 1NKDA 3JATA 3K5MA 1H2MA 2JEXA 3TJTA 4I9QA 1MNGA 4H0LB 3UKMA 2KSDA 1L1FA 1N34O 2X0LA 3BEHA 1FJGO 1NI8A 4DV1B 3AG2B 3ML0A 5LHGA 2HVJC 3I56V 3N2KB 4NB5A 5JCOC 2OTLV 2QTOA 1KC8W 2Y0IA 2KG7B 2K9PA 4JYCA 1YXBA 3P30A 1B04A 2JJ1G 3CRQA 4GKKO 1VIBA 3RGBA 3K06A 4GCZA 5DN6G 4X64B 3S3WA 1HNWB 2W0FC 2KQXA 2HJFC 3K0GA 2G38A 2QKAA 2PI5A 5LP6A 3ABLB 1WNSA 4X66B 4J9ZB 3FKSG 5IJ0B 3RVYA 2NNUA 2A9HA 3K5LA 2WWWA 1IBLB 1F4NA 1HWYA 4ZKIA 1QU7A 5EIBD 1F23A 5LMUO 4O4HB 5FL7G 1YJNV 1MSDA 3F5TA 4AI8A 4EFBA 5E79Z 4RQFA 2CTRA 2XUMA 3LSSA 5IYZB 3OMAB 3H1LH 2AGAA 2VQFO 2HHHO 3W7WA 1W0JG 3E89A 3D3QA 1YTFB 4X1KA 2CDYA 3JSLA 1N36B 3FYEB 1EN5A 4DR2O 2DYSB 1AI5A 1K5QA 4JI2B 2AZ0A 2L35A 4JYYA 5FLXN 1NQTA 1K73W 3BFRA 2Q6AA 1D2DA 2UUAO 2N04A 4FM0A 1ORQC 4UVBA 3QTCA 3EFFK 1KKDA 4DV2O 4FLZA 2ADPA 5IWAO 5IYDO 4K8ZA 1MA1A 1G1XB 2CH7A 1BS3A 5EBWC 5LOVB 2XAFA 5KHIA 5B1AB 1GO3F 1PNLA 4JI6O 4I9WA 3SYPA 4NXNB 1SQPH 4PELA 5B1AC 1QNMA 4EB6A 4Q20A 3WB0A 5L3CA 2QSAA 2X7RB 4MTOA 2DW4A 1SF9A 2R72A 3FAVA 3N2GA 5H6RA 2OIGA 4D7SA 5KAFZ 4DR4O 5KX5B 4G27B 5KHJA 2EJ7A 3G80A 3WG7B 2HR3A 3DXRB 1VQMV 3OFNG 3A0HZ 3N27A 1XEQA 1FXKA 3JALA 3WG7C 3P3NA 1VQ8V 2MW2B 2BOCC 3DC5A 2ZXWC 2M6YA 4KHPO 2XHBA 3OW2U 5K1XA 4DV1O 2WLIA 4GKJB 3ASOB 3UO3A 3FD9A 4AILC 2YSUB 3PN1A 4IYIA 4BIOA 4UV9A 3ASOC 1PD3A 1JA8A 4TV9A 3JD2A 1DLBA 4MVRA 3D3IA 1NU1H 4JAVA 1K7DA 1F51A 1GTOA 4WFEA 4X64O 2YEVB 1M5IA 1HNWO 1HW7A 1NVPB 1K5SA 4HAMA 5GONB 4YIPA 1QR9A 2HJDA 2P06A 2EZPA 5KA6A 1HR0B 4PHZA 3LNMB 2EX3A 2BTQB 1XMQB 1J95A 5IJ9A 1IBLO 4PI0A 2LW7A 2Y0PA 1M90W 4FLVA 3K0DA 3JCZA 3OMIB 2ZNJA 3U10A 5DM6V 5BY1A 3JASA 3TGUH 3DGEA 2P6JA 3HKEA 1IX9A 4I0XB 5BMVA 1NT2B 1N36O 1BCCH 2QJ1A 1Q90D 2ZIOA 3T1HB 1VQ7V 2CTPA 4UUJC 2V4DA 2MK3A 1M57B 2Z3YA 1CXZB 4MW8A 1BSMA 1KB9F 4LBEC 2JS3A 2UXXA 2DN9A 1M57C 3ZHUA 4FVMA 4LH6A 1L0LH 1OZ0A 1NR7A 3B2EE 4X8AA 1CPYA 5LYJA 5LMNB 1BQZA 4G2KA 2EILB 2QE7G 1V9PA 2A3QA 4G28B 2ZIMA 4YHHB 2P7TC 2PGGA 5L3EA 2LP7A 4LF7B 2EILC 1VQKV 2R9AA 4NXNO 2XAGA 4LF4B 2X6BA 4YJ2A 1FPOA 1KP2A 2PUSA 1B06A 2JEUA 3QG5A 4O2AB 3Q4HA 2DOSA 4QE7A 1IBKB 3OT7A 5EYPB 5EK0A 3MD0A 4OPAA 2ZKOA 2ZQMA 1NTKH 4DV3B 2WPDG 1XNRB 4O2BA 4UCOA 3R65A 3QO7A 1H8HG 3CPWU 3PJSK 1KP3A 4R8CA 3P32A 3RT3C 3ZRWB 1MZEA 4B3SB 2LO1A 4A5UB 4MSWC 4RAIA 3FB7C 4XBFA 5DEDA 3THOA 2WA4A 3HKDA 4DW0A 1WB8A 4WBNB 2YXYA 1DF4A 1M93A 3K5OA 4PA4A 1TA8A 4GKJO 4TUYB 4YXWG 4K8XA 2JIZG 5B1NA 3RVZA 3CCRV 4PA6A 4IIJB 4JV5B 3JAWB 4YJ3B 1FKAO 2QA4V 5GTHZ 4OXSA 2BE3A 4BAYA 1K34A 5CA1A 2HFEC 4LCUC 1SQVH 1EN4A 2CGNA 1M56B 3APQA 5KAIZ 2QR4A 4TT3G 4TQDA 2CTQA 1IBMB 2XOKG 3G67A 3T4DA 1M56C 1H2KA 1HR0O 3ZRVA 1E1RG 1PKXA 4X89A 1XMQO 3SJBC 2DQ0A 1MABG 2AHYA 1DGSA 2Q0AA 4UB6Z 2YXHA 1FXHA 3AG1B 4DV5B 2HLDG 1GKFA 3SYQA 4HBNA 3AG1C 2UXDB 1K8AW 3J7AU 4B7EA 5LP6C 4DV0B 1KBHA 1KYOF 4QGPA 5EZYA 4LWSB 1ZWIC 4IL6Z 3CCMV 3T1HO 3L9DA 3IJ4A 3UT5B 2OCHA 5KMGA 1RPOA 2JGDB 3HKBB 3CEIA 4LR3A 3I5DA 2F95B 2BCCH 4I4TA 4KP4A 3ZRSA 3QO8A 4RQEA 4DUZB 1SQXH 1NH2D 2P67A 3L74H 1D5NA 1W0KG 4GX2A 5KHHA 4RO2A 3B8MA 5LMNO 1VP7A 1YZBA 1VQLV 1NJIW 4YHHO 3VOUA 2RNBA 1XNQB 3CCUV 3C90A 4LF7O 4CBCA 3ZRXA 3JD0A 3L75H 1EBOA 2AHZA 5CBHA 3FFQA 1TUBB 4WFHA 3JYCA 5H2FZ 4F6RA 4PI2A 1IBKO 3SJAC 1ZAUA 5BR8O 2FL4A 3L71H 2CH7B 3D36A 4GX0A 3B40A 1L8DA 1R1BA 4UB8Z 2R9RB 3RYHA 2ZD9A 4B3SO 1EFRG 3ABKB 4X1YA 3JAKA 4MVOA 2DMXA 3ABKC 2LW1A 2WLLA 5EC2C 2Q68A 1Q6IA 2E74B 3ZMVA 1JX9A 3FAVB 4JI0O 1V55B 3E8HA 3IGAC 3LDEA 4UVCA 4JV5O 4LFBB 5B5EZ 2YC0A 1WJZA 5JVDA 5CA3A 1GM7A 3NXSA 2IJKA 4J80A 3TCUA 1FXKB 1FD9A 3JALB 4JI8B 1OV9A 1VQPV 1BL8A 2ZR2A 1Q7YW 1FXKC 4NTWA 1VQ6V 3BRCA 3QNEA 4JI6B 3UQ8A 2CK3G 2WLIB 4DR1B 3SPGA 2P4KA 1IBMO 1RFYA 2EINB 4PV1B 2IU3A 2BTOA 1VQNV 4GT1A 3RW0A 3A0RA 1N4CA 2EINC 4TV9B 4WCEV 4NR1A 3G71V 4JTAB 1JPXA 1F4MA 3ZN1A 1FFTB 2XAHA 4DV5O 2VQEB 1U96A 5JWPA 4KHPB 2N05A 5CA0B 2UXDO 4CS3A 1WA8A 4LFAB 4J10A 3DTUB 1K9MW 4DV0O 4JAUA 5IJ9B 3BA8A 4JZ2A 1BT8A 3CWBH 4J7KA 1YHQV 1X59A 1H8EG 1DK1A 5LL6Y 3JASB 4DUZO 3AG3B 2PY5A 5IE9A 1RP3B 2NLJC 4MVMA 3HKEB 5LHHA 3T1YB 3OR7C 3AG3C 5LA6A 5BMVB 3IC9A 3JARA 3E8BA 4FLWA 1AJPA 1QR8A 2AXTZ 2DQ3A 4FIPC 1GM9A 4X1IB 1W2BU 3ABMB 4DW1A 4FLYA 1S3JA 1SQQH 2ATKC 1Z2GA 2OYQA 4X65B 1XNQO 1SC5B 3SPHA 4EFEA 4MS2A 1KQSU 1M4UA 1GRJA 2QM4A 2Y69C 3ABMC 2YXLA 3CS5A 1LUWA 3ZIAG 2Q8VA 1IURA 2UXCO 2F43G 3K59A 2BSKA 2DWDC 4HZ3A 1TVKA 1PL0A 2KKWA 3TXQA 4U7NA 2YIDA 1M1KW 5LYJB 2EIKC 2EJRA 3B09A 3ICXA 3CYOA 3JD1A 4MTGA 1XMOB 2DYRC 2OT5A 4UCSA 2XAJA 3CXHF 4O4IA 2IH1C 4KUMA 1R3KC 4R6ZA 3K5NA 1K33A 3SJCC 2GV9A 4ASUG 1AR1B 4DV7B 1MSWD 4YY3B 4LFBO 5L3FA 4O2BB 4B3RB 4FM2A 1E1QG 1D5AA 1QQCA 2B1GA 1YSCA 3AEIA 4K0KB 3LDDA 4JI8O 3RYCB 1SETA 4UCRA 3KCYA 3CCSV 3OR6C 4KFMA 3JAMN 1URFA 4DR6B 2E75B 3CCVV 1AILA 1SS3A 5H5NA 4DR1O 3RYFB 4FFBB 2LQTA 4ZOLA 1I5YA 4J11A 5FPRA 3R66A 4LC1A 3W7XA 2ZT9B 3E86A 2WLMA 5J9PC 2IJIA 1WPXA 1XHZA 4PDVA 5CA1B 2PYJA 1Y4MA 2GTSA 3EHBB 4R50A 4AQYO 2ZXWB 2UXNA 2QTSA 1NBMG 1OCRC 2VQEO 3J81N 1NVPD 5JH7B 2PI4A 4CS2A 1Q6UA 3MAQA 4IYHA 1GN6A 5CB4A 4LFAO 1XUQA 2ITDC 1R6NA 2GUZA 2QM7A 1QBZA 3K3WA 3H9VA 4KXRA 1H2NA 1GK9A 4DR7O 2LGQA 3O65A 4P9PA 4FLXA 3BA9A 4AHCA 1GN3A 3SJQC 3HB3B 4I50B 4KL1A 1G6UA 3F7YC 3TK1A 1R6KA 3OM3B 3T1YO 1EZVH 4PA9A 2Q7HA 4U7OA 2IU0A 1K97A 5HFLA 2UUCB 1AI6A 3CJHA 2L6LA 3K58A 5JQGA 3ZMZA 4X65O 2NN4A 5KMGB 5LBQA 2X6CA 5J2UA 2ZE7A 4Z1VA 3CHXA 5B3SB 4GX1A 4L8JA 3IC7A 3EVKA 4FLTA 2YI8A 3G4SV 5B3SC 3J80N 4ZI7B 3K9AA 1NTZH 2Q4PA 4MVQA 1I5XA 5JJJB 2Q67A 4J9YB 3SR2C 1RSOA 2JK5C 2Q69A 2DJVA 3U0ZA 3CD6V 4RUFA 3RYIB 3D8CA 1XMOO 2Q7EA 1KUQA 2KG7A 2O57A 3ZBHA 3M99B 1P4RA 5B66Z 2F66C 4CC5A 2FMLA 3JSNA 1AR4A 3WU2Z 2WLNA 4F6RB 2H3OA 4ZBMA 4EKWA 3LSUA 1S5HC 4MW3A 4N23A 3AG7A 4E4EA 4DV7O 3H1JH 4DK0A 4YY3O 3QO5A 3W7UA 4DV6B 4B3RO 1I7FA 5IJ0A 3APOA 3RYHB 3ZHRA 4K0KO 1HNZB 2QKCA 3H01A 1S0VA 3ETGA 3D36C 2AZ2A 1T5EA 4ZHQA 3CMAV 2QWNB 1GAXA 3X2QB 3B8NA 4X1YB 2E3CA 3LUTB 4DR6O 4U3JA 1FS0G 1N0NA 3X2QC 3VQWA 2WLLB 1BE3H 3ZMUA 1H38A 1GN4A 3GB7C 3SYAA 1OCOB 4O4JA 2RDCA 3RWRD 3B4SA 2PF4E 1QLNA 1YF2A 1OCOC 5BR8B 1OCCC 4QNHB 1P84F 3CRRA 1SA0A 4O4LB 3E22A 4LF5B 1AI7A 3L72H 4Z1MG 2A79B 2OTJV 1BZKA 3KZIZ 1I94B 4RWUA 4UCVA 1FFXA 4PA7A 4JZGA 4JI0B 1KKCA 1ZL8A 2ZE6A 3F7VC 1HP8A 2VWKA 1K4DC 1QCEA 2QGNA 5LOVA 1Q43A 1TGOA 3FB5C 2Y48A 1H2SB 2HP8A 2IJJA 3JATB 4D6TH 1VARA 2F23A 1XBLA 2LGWA 1PM9A 1JMKC 5BZBA 1WA8B 4JPRA 3CRAA 3OGIB 4LF6B 3OEHG 3MHHC 2UUCO 2KB1A 5IY5B 4CH6A 4DV4B 2CUGA 3AK2A 3LDCA 3K57A 2VS0A 1BMFG 5IY5C 1JR9A 4NYKA 1R73A 1HDJA 5KUMA 1COWG 1DF5A 1EZJA 1THZA 4HYOA 1ZUQA 2W0XA 5IYBO 5LA6B 4C7UA 3KCXA 4HNAA 2ITCC 4UFZA 3JARB 4I7ZB 5LP6B 2Q9LA 1XL4A 2F1MA 4EEQA 3JCUZ 1KU9A 2QDOA 3VBBA 1L0NH 1WB7A 2RQ6A 1JQ0A 3MHSC 1UPGA 1AVMA 2BSKB 2GDSA 5IYCO 4BW5A 2VWJA 1TVKB 4JI5O 2FTKA 3ABTA 2UU9B 4DV6O 3K79A 4X1KB 1YJWV 4FFKA 2A0LA 3STLC 4B3TB 4GX5A 1HNZO 2B1IA 5AG2A 1R3IC 1VQOV 1JJOA 4O4IB 5J2TA 1BHAA 2FB5A 1WN7A 1O9GA 2FKXA 1WLEA 3ZMSA 1Q86W 1AI4A 5E1AC 2OCCB 3ZN0A 3CCQV 1YVWA 2UXCB 3RN4A 2RJZA 4IHJA 1W59A 2OCCC 3VQVA 5FNVA 4I0XA 5H9CA 4UV8A 4LNUA 3A8TA 2Y4UA 1Y6XA 3BY6A 1YDXA 3B77A 1ROPA 4DYLA 3HKCA 1Z5VA 3ASNB 5L3DA 3SGIA 2ZR3A 1PPJH 5EBLC 1H2LA 1KD1W 4JI4O 3JD3A 3ASNC 5LGTA 4LF5O 1ZX3A 4X62B 3OTOB 1I94O 4EB6B 3W7TA 5CBGA 4P2ZA 3E83A 3K04A 3ABUA 3CX5F 3N2GB 4NVPA 1V54B 4I5SA 4QE9A 4PJ0Z 1N32B 3SYOA 1VF7A 3ETDA 1V54C 2WLJA 5D5PA 1LNQA 3C3TA 3ZJZA 1VF6A 5B1BC 3T2MA 1AROP 3BVOA 1I0HA 4OGQB 1AB3A 2WLHA 1VQ5V 2ZM6O 2P5OA 3M7MX 3WB1A 3T1CA 4O2AA 1Y74A 2Z0AA 1AR5A 4TWKA 5C8YA 5CB4B 4LF6O 2E76B 1U97A 2B5UA 2WSSG 4XDJA 2PYLA 1IDSA 4DV4O 2ZE8A 1CEZA 4GYCB 2JS5A 4MT8A 3ZRWA 4JASA 2DWEC 3OTFA 1LUVA 1XREA 4BIUA 1EN6A 4W4KA 2JRIA 1SERA 2CGOA 4AQYB 3O9OA 4WBNA 3IAYA 3AG4C 4TV8A 1OCZB 1JVMA 4TUYA 3UCSC 1XQ8A 1YIJV 2ZINA 5C93A 4H44B 1JOYA 5LGNA 1GMGA 1OCZC 4DRXA 1X4TA 2JDIG 5JQGB 2UXBO 1Q3EA 4GZRB 3JAWA 3CCLV 4YJ3A 1QVGU 1KMIZ 4H37A 1YI2V 3ZCCA 2GBOA 5GW7A 4DR7B 4QPJA 3SPCA 3E2EA 4ABMA 1SZTA 3JD4A 5KHGA 1AP5A 4X88A 1RSOB 2UU9O 1Y67A 3AG2C 3CRCA 2OWOA 3W7SA 1OJHA 3F5WC 4JAAA 1YTFD 2CTWA 4MTXA 4B3TO 2GSMB 3VQXA 2AW9A 2Y69B 5KUKA 3OD4A 3G6BA 3VQYA 4PA3A 1MMMA 2ZCEA 4X20A 2XNDG 3E8FA 2C2AA 2P4VA 1S76D 2EULA 4UCUA 5EC1C 1XL6A 3BPZA 4JF3A 4FPPA 2D3OW 2EIKB 4UXNA 2EIMB 3ABLC 4NKGB 2QM8A 2H8PC 2DYRB 4LWSA 4ZHQB 2EIMC 2VRZA 2Z5UA 4JYAB 3UT5A 1ENVA 3GWOA 4ICGA 1WPBA 2JGDA 3HKBA 4U3JB 1VQ9V 4JI3B 3E8GA 4X62O 1R6TA 4YJ2B 3OTOO 3CC2V 3HR0A 3Q4HB 4O4JB 5D5QA 4J7JA 1PL4A 4E2LA 4TQFA 2H94A 5KHKA 4K3AA 1N32O 4JI1O 2OIEA 3FYIB 4DR3B 1SA0B 2W6IG 3E22B 4B08A 1B6QA 3K9SA 2DYSC 2Q73A 1OHHG 4B3MB 4WFGA 3OUFA 1JCHA 3OE7G 1TUBA 3HKDB 2Q5ZA 4TSFG 4CH5A 2ZE5A 1JFFA 5EIBC 1FFXB 1BQ0A 4FLUA 1ZL8B 2XTAA 2P90A 4CH3A 4OX9O 4I55A 2IBZH 2YI9A 2ZDIA 1NZ6A 2PZSA 2F4VB 1DTOA 1GM8A 5LXTA 1UFIA 1Q81W 2ADQB 3ZHVA 1OCRB 1XI1A 1MZFA 1GH6A 4FK5C 3FX7A 2M7WA 5TISZ 3M8AA 1SQFA 3TETA 4LFCB 5A2QN 3GVMA 4FZ1A 4BW9A 1BHBA 3ZEDA 5ITZA 3ETQA 4DUYB 1FAFA 1XILA 2JVDA 1Y76A 1PNMA 2EBOA 4HNAB 1SKVA 2QWRB 3SPIA 3FB8C 2W6JG 5L3BA 4JTCB 3QVNA 4LF8B 2WLKA 2YIBD 2V1DA 5IT9N 3BAAA 3OMNB 5EZYB 3S3XA 1Q5OA 2XASA 2RN9A 3LSQA 4JTDB 1N0JA 4I4TB 4P30A 2XT9A 4UVAA 4J7ZA 2LJ2A 3CSXA 5FPOA 2JJ2G 5CA0A 2QWQB 4X66O 5JCOA 1XOUA 4FZ0A 4GLXA 5KA5A 1B3QA 3N2KA 4DO2A 2QWOB 4MTFA 4JYAO 5J2TB 5IDJA 2V7QG 2ETNA 4JI3O 1UJWB 3E35A 3SPJA 1SESA 1NS1A 4IHJB 1YITV 5A9GA 3P3PA 1S72V 5FNVB 4LH7A 2UUBB 2N74A 4JI5B 4LNUB 1US6A 4L87A 4X1IA 1S77D 3HKCB 2EIJB 1AJNA 1MG1A 1IZ3A 4DR3O 2WAMA 2Y4TA 2YIAA 3FB6C 2GHYA 4JI2O 2EIJC 2IM9A 4B3MO 3H1KH 4GUNA 3JAKB 1AP6A 5K1PA 4O4HA 2WA3A 4TOIA 1IVSA 3BCCH 1P49A 1K92A 4F6EA 4H33A 1KECA 2LFSA 4NTYA 1N33B 5BXZA 2ARHA 5IYZA 1G8MA 1OCCB 3GWKC 5JVDB 1I08A 2F4VO 2RMKB 2LFRA 1XDCA 4BWAA 3G6EV 2P22C 1P7GA 4DXWA 3ZMTA 2HG5C 1VF6C 2E5LB 4JI4B 2YICA 4PDMA 4PD4F
chains in the Genus database with same CATH topology
1F7YA 1XMQO 5LMUO 1XMOO 1KUQA 4DV1O 2UXBO 3F5TA 4LFCO 4JI0O 4X66O 4AQYO 2AGAA 2VQFO 2HHHO 4NXNO 4JV5O 2UUCO 1XNQO 4DV7O 4DR5O 4YY3O 2VQEO 3J81N 4JI4O 3J7AU 4LF5O 4JYAO 4DUYO 2DOSA 4DR2O 4B3RO 2UXCO 4X64O 4OX9O 1N33O 4JI7O 4OPAA 2UU9O 1HNWO 4K0KO 4JI3O 2ZKOA 1I94O 4LFAO 5FLXN 3T1HO 4B3TO 1D2DA 2UUAO 3SDLA 1NS1A 4LF8O 1IBMO 4DR6O 4DV2O 4DR7O 3RT3C 3O65A 2N74A 4A5UB 4LF4O 1N34O 4OPHA 5IWAO 1FJGO 1IBLO 2E5LO 2LW7A 1G1XB 4DR3O 3M8AA 3T1YO 1AB3A 4GKJO 1A32A 5A2QN 2ZM6O 4JI2O 5LMNO 5BY1A 1YZBA 4JI6O 4B3MO 4DV3O 4YHHO 1XNRO 2Z0AA 1FYJA 4LF7O 4GKKO 1HNXO 4DV5O 4LF6O 1FKAO 4NXMO 4X65O 4JI5O 4LFBO 1N36O 4DV4O 2UXDO 5BXZA 4DV6O 1IBKO 4DV0O 4X62O 4JI8O 1R6TA 3OTOO 1HNZO 2F4VO 4DR4O 3J80N 4LF9O 5BR8O 3JAMN 2JRIA 5IT9N 1XEQA 1AILA 5H5NA 4DR1O 1X59A 1R1BA 2FKXA 1DK1A 5LL6Y 2DJVA 1HR0O 2UUBO 4B3SO 3R66A 1N32O 4DUZO 1J5EO 4JI1O 4KHPO
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1F7Y A;  1XMQ O;  5LMU O;  1XMO O;  1KUQ A;  4DV1 O;  2UXB O;  3F5T A;  4LFC O;  4JI0 O;  4X66 O;  4AQY O;  2AGA A;  2VQF O;  2HHH O;  4NXN O;  4JV5 O;  2UUC O;  1XNQ O;  4DV7 O;  4DR5 O;  4YY3 O;  2VQE O;  3J81 N;  4JI4 O;  3J7A U;  4LF5 O;  4JYA O;  4DUY O;  2DOS A;  4DR2 O;  4B3R O;  2UXC O;  4X64 O;  4OX9 O;  1N33 O;  4JI7 O;  4OPA A;  2UU9 O;  1HNW O;  4K0K O;  4JI3 O;  2ZKO A;  1I94 O;  4LFA O;  5FLX N;  3T1H O;  4B3T O;  1D2D A;  2UUA O;  3SDL A;  1NS1 A;  4LF8 O;  1IBM O;  4DR6 O;  4DV2 O;  4DR7 O;  3RT3 C;  3O65 A;  2N74 A;  4A5U B;  4LF4 O;  1N34 O;  4OPH A;  5IWA O;  1FJG O;  1IBL O;  2E5L O;  2LW7 A;  1G1X B;  4DR3 O;  3M8A A;  3T1Y O;  1AB3 A;  4GKJ O;  1A32 A;  5A2Q N;  2ZM6 O;  4JI2 O;  5LMN O;  5BY1 A;  1YZB A;  4JI6 O;  4B3M O;  4DV3 O;  4YHH O;  1XNR O;  2Z0A A;  1FYJ A;  4LF7 O;  4GKK O;  1HNX O;  4DV5 O;  4LF6 O;  1FKA O;  4NXM O;  4X65 O;  4JI5 O;  4LFB O;  1N36 O;  4DV4 O;  2UXD O;  5BXZ A;  4DV6 O;  1IBK O;  4DV0 O;  4X62 O;  4JI8 O;  1R6T A;  3OTO O;  1HNZ O;  2F4V O;  4DR4 O;  3J80 N;  4LF9 O;  5BR8 O;  3JAM N;  2JRI A;  5IT9 N;  1XEQ A;  1AIL A;  5H5N A;  4DR1 O;  1X59 A;  1R1B A;  2FKX A;  1DK1 A;  5LL6 Y;  2DJV A;  1HR0 O;  2UUB O;  4B3S O;  3R66 A;  1N32 O;  4DUZ O;  1J5E O;  4JI1 O;  4KHP O; 
#chains in the Genus database with same CATH topology
 1Y74 B;  4YIO A;  2QEX V;  4XDL A;  5C8Y B;  3ETE A;  3AK3 A;  4CH4 A;  2Q7G A;  1G4Y B;  1QVF U;  4BIZ A;  4IT5 A;  1IXM A;  4LFC O;  5H6Q A;  3BHP A;  4JGS A;  3CXC U;  1HNX B;  4PDR A;  2ODM A;  3CB2 A;  1YEW A;  4NXM B;  2HVK C;  3SYC A;  3RYC A;  3CME V;  1AJQ A;  4W4L A;  2EZO A;  4WFF A;  4DUY O;  3ZHQ A;  1PP9 H;  2ILM A;  5F2V O;  1BGY H;  3OGC C;  2D2C B;  4TV8 B;  5GTI Z;  2ZM6 B;  3CE2 A;  3RYF A;  4FFB A;  4LF9 B;  2IW5 A;  5CMU A;  4DRX B;  4LF8 O;  2YUA A;  2A7W A;  1H2G A;  2QWP B;  4CZZ A;  1RPR A;  1QHT A;  3WFV A;  4PDL A;  1J5E B;  4Z2W A;  4OPH A;  2IJH A;  2A06 H;  1Y66 A;  5KX5 A;  4J41 A;  4BR6 A;  2CAZ C;  3DXR A;  2BOB C;  1K3E A;  1A32 A;  1LR1 A;  1S5J A;  3RBZ A;  1ZTE A;  3TXS A;  1VF5 B;  5JH7 A;  1MOF A;  2XAQ A;  3H1H H;  4DR5 B;  1GN2 A;  3AK1 A;  2Q0O C;  3DC6 A;  5DEC A;  4JI7 B;  1ZSP A;  1E79 G;  3CC7 V;  2UXB B;  1S5L Z;  5CN0 A;  5KLV H;  2PTM A;  4X20 B;  4I50 A;  4D7T A;  2YEV A;  4JYB A;  1N34 B;  1CP9 A;  3MDS A;  3CRM A;  4B7K A;  4LP8 A;  1FJG B;  2UUB O;  4WFB V;  2HKO A;  1VEW A;  5GON A;  3KG2 A;  4QPK A;  4CS4 A;  1Q8I A;  1NTM H;  2BTQ A;  3I55 V;  1M9N A;  1WP8 A;  2ZNI A;  3IFX A;  4GKK B;  2DE0 X;  3CP1 A;  3ZHT A;  2R70 A;  2YDE A;  1SRY A;  3OEE G;  4Q6G A;  4QIW F;  4R7C A;  4NTX A;  4ZI7 A;  4WF9 V;  1VQ4 V;  4F4L A;  1O9H A;  1N33 O;  1PV0 A;  1R3J C;  1P7B A;  1TAE A;  5B1O A;  1WP7 A;  3K08 A;  3CCE V;  4H13 B;  2K1E A;  2YIB A;  3RYI A;  3SDL A;  3CCJ V;  5LHI A;  4WFA V;  4DK1 A;  1SQG A;  4FJC C;  3ZS8 C;  3HPL C;  5EBM C;  3OUS A;  4P9O A;  1Q6H A;  4LF4 O;  5LMU B;  3DSQ A;  2CE4 A;  5CBF A;  1Z5W A;  2E5L O;  3NR7 A;  2QKS A;  1JFF B;  4QJF B;  2NR5 A;  4ZOL B;  3H1I H;  3U11 A;  1NH2 B;  1JJ2 U;  3ZX6 A;  3A0B Z;  4U3F H;  3UM7 A;  4FMT A;  2F93 B;  3C3S A;  5LGU A;  4DV3 O;  4I55 B;  2VQF B;  2HHH B;  4MVZ A;  1XNR O;  5JJE B;  3LNN A;  2B9Z A;  1FXV A;  1SZX A;  1FYJ A;  3ZHS A;  1HNX O;  1K4C C;  3UO2 A;  4NXM O;  1RM1 B;  4FM1 A;  4JI1 B;  4XDK A;  2RCV A;  2ZDI C;  5LXT B;  4DR2 B;  4MVS A;  5B1B B;  1RM1 C;  1ZLZ A;  4CC6 A;  1EM1 A;  5L3G A;  1IXB A;  2UUA B;  5JJN B;  1QLE B;  4LF9 O;  4MVU A;  3WB2 A;  4DV2 B;  3K03 A;  2FYU H;  2YS8 A;  1PNK A;  3L70 H;  1QLE C;  5EYP A;  4X9Q A;  5IWA B;  2GUZ B;  1V55 C;  1J5E O;  3A2F A;  1XHX A;  1F7Y A;  4OX9 B;  4ZIB A;  5ITZ B;  1VMG A;  4O4L A;  3STZ C;  1SQB H;  4J42 A;  2X6A A;  2GTA A;  1Y76 B;  1TUE B;  1YJ9 V;  1WAZ A;  3AG4 B;  1NR1 A;  4K35 A;  4IGG A;  3RFR A;  4N21 A;  1Q82 W;  1N8R W;  4RUE A;  2R9I A;  3L73 H;  4DR5 O;  1R3L C;  3CJH B;  4JI7 O;  3KKY A;  3QF7 A;  4IIJ A;  3CC4 V;  4DR4 B;  3OAA G;  3BAB A;  2JGU A;  3EXA A;  5HFM A;  4UCT A;  2HEP A;  2IH3 C;  1YCI A;  5J2U B;  3T4Z A;  1NKD A;  3JAT A;  3K5M A;  1H2M A;  2JEX A;  3TJT A;  4I9Q A;  1MNG A;  4H0L B;  3UKM A;  2KSD A;  1L1F A;  1N34 O;  2X0L A;  3BEH A;  1FJG O;  1NI8 A;  4DV1 B;  3AG2 B;  3ML0 A;  5LHG A;  2HVJ C;  3I56 V;  3N2K B;  4NB5 A;  5JCO C;  2OTL V;  2QTO A;  1KC8 W;  2Y0I A;  2KG7 B;  2K9P A;  4JYC A;  1YXB A;  3P30 A;  1B04 A;  2JJ1 G;  3CRQ A;  4GKK O;  1VIB A;  3RGB A;  3K06 A;  4GCZ A;  5DN6 G;  4X64 B;  3S3W A;  1HNW B;  2W0F C;  2KQX A;  2HJF C;  3K0G A;  2G38 A;  2QKA A;  2PI5 A;  5LP6 A;  3ABL B;  1WNS A;  4X66 B;  4J9Z B;  3FKS G;  5IJ0 B;  3RVY A;  2NNU A;  2A9H A;  3K5L A;  2WWW A;  1IBL B;  1F4N A;  1HWY A;  4ZKI A;  1QU7 A;  5EIB D;  1F23 A;  5LMU O;  4O4H B;  5FL7 G;  1YJN V;  1MSD A;  3F5T A;  4AI8 A;  4EFB A;  5E79 Z;  4RQF A;  2CTR A;  2XUM A;  3LSS A;  5IYZ B;  3OMA B;  3H1L H;  2AGA A;  2VQF O;  2HHH O;  3W7W A;  1W0J G;  3E89 A;  3D3Q A;  1YTF B;  4X1K A;  2CDY A;  3JSL A;  1N36 B;  3FYE B;  1EN5 A;  4DR2 O;  2DYS B;  1AI5 A;  1K5Q A;  4JI2 B;  2AZ0 A;  2L35 A;  4JYY A;  5FLX N;  1NQT A;  1K73 W;  3BFR A;  2Q6A A;  1D2D A;  2UUA O;  2N04 A;  4FM0 A;  1ORQ C;  4UVB A;  3QTC A;  3EFF K;  1KKD A;  4DV2 O;  4FLZ A;  2ADP A;  5IWA O;  5IYD O;  4K8Z A;  1MA1 A;  1G1X B;  2CH7 A;  1BS3 A;  5EBW C;  5LOV B;  2XAF A;  5KHI A;  5B1A B;  1GO3 F;  1PNL A;  4JI6 O;  4I9W A;  3SYP A;  4NXN B;  1SQP H;  4PEL A;  5B1A C;  1QNM A;  4EB6 A;  4Q20 A;  3WB0 A;  5L3C A;  2QSA A;  2X7R B;  4MTO A;  2DW4 A;  1SF9 A;  2R72 A;  3FAV A;  3N2G A;  5H6R A;  2OIG A;  4D7S A;  5KAF Z;  4DR4 O;  5KX5 B;  4G27 B;  5KHJ A;  2EJ7 A;  3G80 A;  3WG7 B;  2HR3 A;  3DXR B;  1VQM V;  3OFN G;  3A0H Z;  3N27 A;  1XEQ A;  1FXK A;  3JAL A;  3WG7 C;  3P3N A;  1VQ8 V;  2MW2 B;  2BOC C;  3DC5 A;  2ZXW C;  2M6Y A;  4KHP O;  2XHB A;  3OW2 U;  5K1X A;  4DV1 O;  2WLI A;  4GKJ B;  3ASO B;  3UO3 A;  3FD9 A;  4AIL C;  2YSU B;  3PN1 A;  4IYI A;  4BIO A;  4UV9 A;  3ASO C;  1PD3 A;  1JA8 A;  4TV9 A;  3JD2 A;  1DLB A;  4MVR A;  3D3I A;  1NU1 H;  4JAV A;  1K7D A;  1F51 A;  1GTO A;  4WFE A;  4X64 O;  2YEV B;  1M5I A;  1HNW O;  1HW7 A;  1NVP B;  1K5S A;  4HAM A;  5GON B;  4YIP A;  1QR9 A;  2HJD A;  2P06 A;  2EZP A;  5KA6 A;  1HR0 B;  4PHZ A;  3LNM B;  2EX3 A;  2BTQ B;  1XMQ B;  1J95 A;  5IJ9 A;  1IBL O;  4PI0 A;  2LW7 A;  2Y0P A;  1M90 W;  4FLV A;  3K0D A;  3JCZ A;  3OMI B;  2ZNJ A;  3U10 A;  5DM6 V;  5BY1 A;  3JAS A;  3TGU H;  3DGE A;  2P6J A;  3HKE A;  1IX9 A;  4I0X B;  5BMV A;  1NT2 B;  1N36 O;  1BCC H;  2QJ1 A;  1Q90 D;  2ZIO A;  3T1H B;  1VQ7 V;  2CTP A;  4UUJ C;  2V4D A;  2MK3 A;  1M57 B;  2Z3Y A;  1CXZ B;  4MW8 A;  1BSM A;  1KB9 F;  4LBE C;  2JS3 A;  2UXX A;  2DN9 A;  1M57 C;  3ZHU A;  4FVM A;  4LH6 A;  1L0L H;  1OZ0 A;  1NR7 A;  3B2E E;  4X8A A;  1CPY A;  5LYJ A;  5LMN B;  1BQZ A;  4G2K A;  2EIL B;  2QE7 G;  1V9P A;  2A3Q A;  4G28 B;  2ZIM A;  4YHH B;  2P7T C;  2PGG A;  5L3E A;  2LP7 A;  4LF7 B;  2EIL C;  1VQK V;  2R9A A;  4NXN O;  2XAG A;  4LF4 B;  2X6B A;  4YJ2 A;  1FPO A;  1KP2 A;  2PUS A;  1B06 A;  2JEU A;  3QG5 A;  4O2A B;  3Q4H A;  2DOS A;  4QE7 A;  1IBK B;  3OT7 A;  5EYP B;  5EK0 A;  3MD0 A;  4OPA A;  2ZKO A;  2ZQM A;  1NTK H;  4DV3 B;  2WPD G;  1XNR B;  4O2B A;  4UCO A;  3R65 A;  3QO7 A;  1H8H G;  3CPW U;  3PJS K;  1KP3 A;  4R8C A;  3P32 A;  3RT3 C;  3ZRW B;  1MZE A;  4B3S B;  2LO1 A;  4A5U B;  4MSW C;  4RAI A;  3FB7 C;  4XBF A;  5DED A;  3THO A;  2WA4 A;  3HKD A;  4DW0 A;  1WB8 A;  4WBN B;  2YXY A;  1DF4 A;  1M93 A;  3K5O A;  4PA4 A;  1TA8 A;  4GKJ O;  4TUY B;  4YXW G;  4K8X A;  2JIZ G;  5B1N A;  3RVZ A;  3CCR V;  4PA6 A;  4IIJ B;  4JV5 B;  3JAW B;  4YJ3 B;  1FKA O;  2QA4 V;  5GTH Z;  4OXS A;  2BE3 A;  4BAY A;  1K34 A;  5CA1 A;  2HFE C;  4LCU C;  1SQV H;  1EN4 A;  2CGN A;  1M56 B;  3APQ A;  5KAI Z;  2QR4 A;  4TT3 G;  4TQD A;  2CTQ A;  1IBM B;  2XOK G;  3G67 A;  3T4D A;  1M56 C;  1H2K A;  1HR0 O;  3ZRV A;  1E1R G;  1PKX A;  4X89 A;  1XMQ O;  3SJB C;  2DQ0 A;  1MAB G;  2AHY A;  1DGS A;  2Q0A A;  4UB6 Z;  2YXH A;  1FXH A;  3AG1 B;  4DV5 B;  2HLD G;  1GKF A;  3SYQ A;  4HBN A;  3AG1 C;  2UXD B;  1K8A W;  3J7A U;  4B7E A;  5LP6 C;  4DV0 B;  1KBH A;  1KYO F;  4QGP A;  5EZY A;  4LWS B;  1ZWI C;  4IL6 Z;  3CCM V;  3T1H O;  3L9D A;  3IJ4 A;  3UT5 B;  2OCH A;  5KMG A;  1RPO A;  2JGD B;  3HKB B;  3CEI A;  4LR3 A;  3I5D A;  2F95 B;  2BCC H;  4I4T A;  4KP4 A;  3ZRS A;  3QO8 A;  4RQE A;  4DUZ B;  1SQX H;  1NH2 D;  2P67 A;  3L74 H;  1D5N A;  1W0K G;  4GX2 A;  5KHH A;  4RO2 A;  3B8M A;  5LMN O;  1VP7 A;  1YZB A;  1VQL V;  1NJI W;  4YHH O;  3VOU A;  2RNB A;  1XNQ B;  3CCU V;  3C90 A;  4LF7 O;  4CBC A;  3ZRX A;  3JD0 A;  3L75 H;  1EBO A;  2AHZ A;  5CBH A;  3FFQ A;  1TUB B;  4WFH A;  3JYC A;  5H2F Z;  4F6R A;  4PI2 A;  1IBK O;  3SJA C;  1ZAU A;  5BR8 O;  2FL4 A;  3L71 H;  2CH7 B;  3D36 A;  4GX0 A;  3B40 A;  1L8D A;  1R1B A;  4UB8 Z;  2R9R B;  3RYH A;  2ZD9 A;  4B3S O;  1EFR G;  3ABK B;  4X1Y A;  3JAK A;  4MVO A;  2DMX A;  3ABK C;  2LW1 A;  2WLL A;  5EC2 C;  2Q68 A;  1Q6I A;  2E74 B;  3ZMV A;  1JX9 A;  3FAV B;  4JI0 O;  1V55 B;  3E8H A;  3IGA C;  3LDE A;  4UVC A;  4JV5 O;  4LFB B;  5B5E Z;  2YC0 A;  1WJZ A;  5JVD A;  5CA3 A;  1GM7 A;  3NXS A;  2IJK A;  4J80 A;  3TCU A;  1FXK B;  1FD9 A;  3JAL B;  4JI8 B;  1OV9 A;  1VQP V;  1BL8 A;  2ZR2 A;  1Q7Y W;  1FXK C;  4NTW A;  1VQ6 V;  3BRC A;  3QNE A;  4JI6 B;  3UQ8 A;  2CK3 G;  2WLI B;  4DR1 B;  3SPG A;  2P4K A;  1IBM O;  1RFY A;  2EIN B;  4PV1 B;  2IU3 A;  2BTO A;  1VQN V;  4GT1 A;  3RW0 A;  3A0R A;  1N4C A;  2EIN C;  4TV9 B;  4WCE V;  4NR1 A;  3G71 V;  4JTA B;  1JPX A;  1F4M A;  3ZN1 A;  1FFT B;  2XAH A;  4DV5 O;  2VQE B;  1U96 A;  5JWP A;  4KHP B;  2N05 A;  5CA0 B;  2UXD O;  4CS3 A;  1WA8 A;  4LFA B;  4J10 A;  3DTU B;  1K9M W;  4DV0 O;  4JAU A;  5IJ9 B;  3BA8 A;  4JZ2 A;  1BT8 A;  3CWB H;  4J7K A;  1YHQ V;  1X59 A;  1H8E G;  1DK1 A;  5LL6 Y;  3JAS B;  4DUZ O;  3AG3 B;  2PY5 A;  5IE9 A;  1RP3 B;  2NLJ C;  4MVM A;  3HKE B;  5LHH A;  3T1Y B;  3OR7 C;  3AG3 C;  5LA6 A;  5BMV B;  3IC9 A;  3JAR A;  3E8B A;  4FLW A;  1AJP A;  1QR8 A;  2AXT Z;  2DQ3 A;  4FIP C;  1GM9 A;  4X1I B;  1W2B U;  3ABM B;  4DW1 A;  4FLY A;  1S3J A;  1SQQ H;  2ATK C;  1Z2G A;  2OYQ A;  4X65 B;  1XNQ O;  1SC5 B;  3SPH A;  4EFE A;  4MS2 A;  1KQS U;  1M4U A;  1GRJ A;  2QM4 A;  2Y69 C;  3ABM C;  2YXL A;  3CS5 A;  1LUW A;  3ZIA G;  2Q8V A;  1IUR A;  2UXC O;  2F43 G;  3K59 A;  2BSK A;  2DWD C;  4HZ3 A;  1TVK A;  1PL0 A;  2KKW A;  3TXQ A;  4U7N A;  2YID A;  1M1K W;  5LYJ B;  2EIK C;  2EJR A;  3B09 A;  3ICX A;  3CYO A;  3JD1 A;  4MTG A;  1XMO B;  2DYR C;  2OT5 A;  4UCS A;  2XAJ A;  3CXH F;  4O4I A;  2IH1 C;  4KUM A;  1R3K C;  4R6Z A;  3K5N A;  1K33 A;  3SJC C;  2GV9 A;  4ASU G;  1AR1 B;  4DV7 B;  1MSW D;  4YY3 B;  4LFB O;  5L3F A;  4O2B B;  4B3R B;  4FM2 A;  1E1Q G;  1D5A A;  1QQC A;  2B1G A;  1YSC A;  3AEI A;  4K0K B;  3LDD A;  4JI8 O;  3RYC B;  1SET A;  4UCR A;  3KCY A;  3CCS V;  3OR6 C;  4KFM A;  3JAM N;  1URF A;  4DR6 B;  2E75 B;  3CCV V;  1AIL A;  1SS3 A;  5H5N A;  4DR1 O;  3RYF B;  4FFB B;  2LQT A;  4ZOL A;  1I5Y A;  4J11 A;  5FPR A;  3R66 A;  4LC1 A;  3W7X A;  2ZT9 B;  3E86 A;  2WLM A;  5J9P C;  2IJI A;  1WPX A;  1XHZ A;  4PDV A;  5CA1 B;  2PYJ A;  1Y4M A;  2GTS A;  3EHB B;  4R50 A;  4AQY O;  2ZXW B;  2UXN A;  2QTS A;  1NBM G;  1OCR C;  2VQE O;  3J81 N;  1NVP D;  5JH7 B;  2PI4 A;  4CS2 A;  1Q6U A;  3MAQ A;  4IYH A;  1GN6 A;  5CB4 A;  4LFA O;  1XUQ A;  2ITD C;  1R6N A;  2GUZ A;  2QM7 A;  1QBZ A;  3K3W A;  3H9V A;  4KXR A;  1H2N A;  1GK9 A;  4DR7 O;  2LGQ A;  3O65 A;  4P9P A;  4FLX A;  3BA9 A;  4AHC A;  1GN3 A;  3SJQ C;  3HB3 B;  4I50 B;  4KL1 A;  1G6U A;  3F7Y C;  3TK1 A;  1R6K A;  3OM3 B;  3T1Y O;  1EZV H;  4PA9 A;  2Q7H A;  4U7O A;  2IU0 A;  1K97 A;  5HFL A;  2UUC B;  1AI6 A;  3CJH A;  2L6L A;  3K58 A;  5JQG A;  3ZMZ A;  4X65 O;  2NN4 A;  5KMG B;  5LBQ A;  2X6C A;  5J2U A;  2ZE7 A;  4Z1V A;  3CHX A;  5B3S B;  4GX1 A;  4L8J A;  3IC7 A;  3EVK A;  4FLT A;  2YI8 A;  3G4S V;  5B3S C;  3J80 N;  4ZI7 B;  3K9A A;  1NTZ H;  2Q4P A;  4MVQ A;  1I5X A;  5JJJ B;  2Q67 A;  4J9Y B;  3SR2 C;  1RSO A;  2JK5 C;  2Q69 A;  2DJV A;  3U0Z A;  3CD6 V;  4RUF A;  3RYI B;  3D8C A;  1XMO O;  2Q7E A;  1KUQ A;  2KG7 A;  2O57 A;  3ZBH A;  3M99 B;  1P4R A;  5B66 Z;  2F66 C;  4CC5 A;  2FML A;  3JSN A;  1AR4 A;  3WU2 Z;  2WLN A;  4F6R B;  2H3O A;  4ZBM A;  4EKW A;  3LSU A;  1S5H C;  4MW3 A;  4N23 A;  3AG7 A;  4E4E A;  4DV7 O;  3H1J H;  4DK0 A;  4YY3 O;  3QO5 A;  3W7U A;  4DV6 B;  4B3R O;  1I7F A;  5IJ0 A;  3APO A;  3RYH B;  3ZHR A;  4K0K O;  1HNZ B;  2QKC A;  3H01 A;  1S0V A;  3ETG A;  3D36 C;  2AZ2 A;  1T5E A;  4ZHQ A;  3CMA V;  2QWN B;  1GAX A;  3X2Q B;  3B8N A;  4X1Y B;  2E3C A;  3LUT B;  4DR6 O;  4U3J A;  1FS0 G;  1N0N A;  3X2Q C;  3VQW A;  2WLL B;  1BE3 H;  3ZMU A;  1H38 A;  1GN4 A;  3GB7 C;  3SYA A;  1OCO B;  4O4J A;  2RDC A;  3RWR D;  3B4S A;  2PF4 E;  1QLN A;  1YF2 A;  1OCO C;  5BR8 B;  1OCC C;  4QNH B;  1P84 F;  3CRR A;  1SA0 A;  4O4L B;  3E22 A;  4LF5 B;  1AI7 A;  3L72 H;  4Z1M G;  2A79 B;  2OTJ V;  1BZK A;  3KZI Z;  1I94 B;  4RWU A;  4UCV A;  1FFX A;  4PA7 A;  4JZG A;  4JI0 B;  1KKC A;  1ZL8 A;  2ZE6 A;  3F7V C;  1HP8 A;  2VWK A;  1K4D C;  1QCE A;  2QGN A;  5LOV A;  1Q43 A;  1TGO A;  3FB5 C;  2Y48 A;  1H2S B;  2HP8 A;  2IJJ A;  3JAT B;  4D6T H;  1VAR A;  2F23 A;  1XBL A;  2LGW A;  1PM9 A;  1JMK C;  5BZB A;  1WA8 B;  4JPR A;  3CRA A;  3OGI B;  4LF6 B;  3OEH G;  3MHH C;  2UUC O;  2KB1 A;  5IY5 B;  4CH6 A;  4DV4 B;  2CUG A;  3AK2 A;  3LDC A;  3K57 A;  2VS0 A;  1BMF G;  5IY5 C;  1JR9 A;  4NYK A;  1R73 A;  1HDJ A;  5KUM A;  1COW G;  1DF5 A;  1EZJ A;  1THZ A;  4HYO A;  1ZUQ A;  2W0X A;  5IYB O;  5LA6 B;  4C7U A;  3KCX A;  4HNA A;  2ITC C;  4UFZ A;  3JAR B;  4I7Z B;  5LP6 B;  2Q9L A;  1XL4 A;  2F1M A;  4EEQ A;  3JCU Z;  1KU9 A;  2QDO A;  3VBB A;  1L0N H;  1WB7 A;  2RQ6 A;  1JQ0 A;  3MHS C;  1UPG A;  1AVM A;  2BSK B;  2GDS A;  5IYC O;  4BW5 A;  2VWJ A;  1TVK B;  4JI5 O;  2FTK A;  3ABT A;  2UU9 B;  4DV6 O;  3K79 A;  4X1K B;  1YJW V;  4FFK A;  2A0L A;  3STL C;  4B3T B;  4GX5 A;  1HNZ O;  2B1I A;  5AG2 A;  1R3I C;  1VQO V;  1JJO A;  4O4I B;  5J2T A;  1BHA A;  2FB5 A;  1WN7 A;  1O9G A;  2FKX A;  1WLE A;  3ZMS A;  1Q86 W;  1AI4 A;  5E1A C;  2OCC B;  3ZN0 A;  3CCQ V;  1YVW A;  2UXC B;  3RN4 A;  2RJZ A;  4IHJ A;  1W59 A;  2OCC C;  3VQV A;  5FNV A;  4I0X A;  5H9C A;  4UV8 A;  4LNU A;  3A8T A;  2Y4U A;  1Y6X A;  3BY6 A;  1YDX A;  3B77 A;  1ROP A;  4DYL A;  3HKC A;  1Z5V A;  3ASN B;  5L3D A;  3SGI A;  2ZR3 A;  1PPJ H;  5EBL C;  1H2L A;  1KD1 W;  4JI4 O;  3JD3 A;  3ASN C;  5LGT A;  4LF5 O;  1ZX3 A;  4X62 B;  3OTO B;  1I94 O;  4EB6 B;  3W7T A;  5CBG A;  4P2Z A;  3E83 A;  3K04 A;  3ABU A;  3CX5 F;  3N2G B;  4NVP A;  1V54 B;  4I5S A;  4QE9 A;  4PJ0 Z;  1N32 B;  3SYO A;  1VF7 A;  3ETD A;  1V54 C;  2WLJ A;  5D5P A;  1LNQ A;  3C3T A;  3ZJZ A;  1VF6 A;  5B1B C;  3T2M A;  1ARO P;  3BVO A;  1I0H A;  4OGQ B;  1AB3 A;  2WLH A;  1VQ5 V;  2ZM6 O;  2P5O A;  3M7M X;  3WB1 A;  3T1C A;  4O2A A;  1Y74 A;  2Z0A A;  1AR5 A;  4TWK A;  5C8Y A;  5CB4 B;  4LF6 O;  2E76 B;  1U97 A;  2B5U A;  2WSS G;  4XDJ A;  2PYL A;  1IDS A;  4DV4 O;  2ZE8 A;  1CEZ A;  4GYC B;  2JS5 A;  4MT8 A;  3ZRW A;  4JAS A;  2DWE C;  3OTF A;  1LUV A;  1XRE A;  4BIU A;  1EN6 A;  4W4K A;  2JRI A;  1SER A;  2CGO A;  4AQY B;  3O9O A;  4WBN A;  3IAY A;  3AG4 C;  4TV8 A;  1OCZ B;  1JVM A;  4TUY A;  3UCS C;  1XQ8 A;  1YIJ V;  2ZIN A;  5C93 A;  4H44 B;  1JOY A;  5LGN A;  1GMG A;  1OCZ C;  4DRX A;  1X4T A;  2JDI G;  5JQG B;  2UXB O;  1Q3E A;  4GZR B;  3JAW A;  3CCL V;  4YJ3 A;  1QVG U;  1KMI Z;  4H37 A;  1YI2 V;  3ZCC A;  2GBO A;  5GW7 A;  4DR7 B;  4QPJ A;  3SPC A;  3E2E A;  4ABM A;  1SZT A;  3JD4 A;  5KHG A;  1AP5 A;  4X88 A;  1RSO B;  2UU9 O;  1Y67 A;  3AG2 C;  3CRC A;  2OWO A;  3W7S A;  1OJH A;  3F5W C;  4JAA A;  1YTF D;  2CTW A;  4MTX A;  4B3T O;  2GSM B;  3VQX A;  2AW9 A;  2Y69 B;  5KUK A;  3OD4 A;  3G6B A;  3VQY A;  4PA3 A;  1MMM A;  2ZCE A;  4X20 A;  2XND G;  3E8F A;  2C2A A;  2P4V A;  1S76 D;  2EUL A;  4UCU A;  5EC1 C;  1XL6 A;  3BPZ A;  4JF3 A;  4FPP A;  2D3O W;  2EIK B;  4UXN A;  2EIM B;  3ABL C;  4NKG B;  2QM8 A;  2H8P C;  2DYR B;  4LWS A;  4ZHQ B;  2EIM C;  2VRZ A;  2Z5U A;  4JYA B;  3UT5 A;  1ENV A;  3GWO A;  4ICG A;  1WPB A;  2JGD A;  3HKB A;  4U3J B;  1VQ9 V;  4JI3 B;  3E8G A;  4X62 O;  1R6T A;  4YJ2 B;  3OTO O;  3CC2 V;  3HR0 A;  3Q4H B;  4O4J B;  5D5Q A;  4J7J A;  1PL4 A;  4E2L A;  4TQF A;  2H94 A;  5KHK A;  4K3A A;  1N32 O;  4JI1 O;  2OIE A;  3FYI B;  4DR3 B;  1SA0 B;  2W6I G;  3E22 B;  4B08 A;  1B6Q A;  3K9S A;  2DYS C;  2Q73 A;  1OHH G;  4B3M B;  4WFG A;  3OUF A;  1JCH A;  3OE7 G;  1TUB A;  3HKD B;  2Q5Z A;  4TSF G;  4CH5 A;  2ZE5 A;  1JFF A;  5EIB C;  1FFX B;  1BQ0 A;  4FLU A;  1ZL8 B;  2XTA A;  2P90 A;  4CH3 A;  4OX9 O;  4I55 A;  2IBZ H;  2YI9 A;  2ZDI A;  1NZ6 A;  2PZS A;  2F4V B;  1DTO A;  1GM8 A;  5LXT A;  1UFI A;  1Q81 W;  2ADQ B;  3ZHV A;  1OCR B;  1XI1 A;  1MZF A;  1GH6 A;  4FK5 C;  3FX7 A;  2M7W A;  5TIS Z;  3M8A A;  1SQF A;  3TET A;  4LFC B;  5A2Q N;  3GVM A;  4FZ1 A;  4BW9 A;  1BHB A;  3ZED A;  5ITZ A;  3ETQ A;  4DUY B;  1FAF A;  1XIL A;  2JVD A;  1Y76 A;  1PNM A;  2EBO A;  4HNA B;  1SKV A;  2QWR B;  3SPI A;  3FB8 C;  2W6J G;  5L3B A;  4JTC B;  3QVN A;  4LF8 B;  2WLK A;  2YIB D;  2V1D A;  5IT9 N;  3BAA A;  3OMN B;  5EZY B;  3S3X A;  1Q5O A;  2XAS A;  2RN9 A;  3LSQ A;  4JTD B;  1N0J A;  4I4T B;  4P30 A;  2XT9 A;  4UVA A;  4J7Z A;  2LJ2 A;  3CSX A;  5FPO A;  2JJ2 G;  5CA0 A;  2QWQ B;  4X66 O;  5JCO A;  1XOU A;  4FZ0 A;  4GLX A;  5KA5 A;  1B3Q A;  3N2K A;  4DO2 A;  2QWO B;  4MTF A;  4JYA O;  5J2T B;  5IDJ A;  2V7Q G;  2ETN A;  4JI3 O;  1UJW B;  3E35 A;  3SPJ A;  1SES A;  1NS1 A;  4IHJ B;  1YIT V;  5A9G A;  3P3P A;  1S72 V;  5FNV B;  4LH7 A;  2UUB B;  2N74 A;  4JI5 B;  4LNU B;  1US6 A;  4L87 A;  4X1I A;  1S77 D;  3HKC B;  2EIJ B;  1AJN A;  1MG1 A;  1IZ3 A;  4DR3 O;  2WAM A;  2Y4T A;  2YIA A;  3FB6 C;  2GHY A;  4JI2 O;  2EIJ C;  2IM9 A;  4B3M O;  3H1K H;  4GUN A;  3JAK B;  1AP6 A;  5K1P A;  4O4H A;  2WA3 A;  4TOI A;  1IVS A;  3BCC H;  1P49 A;  1K92 A;  4F6E A;  4H33 A;  1KEC A;  2LFS A;  4NTY A;  1N33 B;  5BXZ A;  2ARH A;  5IYZ A;  1G8M A;  1OCC B;  3GWK C;  5JVD B;  1I08 A;  2F4V O;  2RMK B;  2LFR A;  1XDC A;  4BWA A;  3G6E V;  2P22 C;  1P7G A;  4DXW A;  3ZMT A;  2HG5 C;  1VF6 C;  2E5L B;  4JI4 B;  2YIC A;  4PDM A;  4PD4 F; 
#chains in the Genus database with same CATH homology
 1F7Y A;  1XMQ O;  5LMU O;  1XMO O;  1KUQ A;  4DV1 O;  2UXB O;  3F5T A;  4LFC O;  4JI0 O;  4X66 O;  4AQY O;  2AGA A;  2VQF O;  2HHH O;  4NXN O;  4JV5 O;  2UUC O;  1XNQ O;  4DV7 O;  4DR5 O;  4YY3 O;  2VQE O;  3J81 N;  4JI4 O;  3J7A U;  4LF5 O;  4JYA O;  4DUY O;  2DOS A;  4DR2 O;  4B3R O;  2UXC O;  4X64 O;  4OX9 O;  1N33 O;  4JI7 O;  4OPA A;  2UU9 O;  1HNW O;  4K0K O;  4JI3 O;  2ZKO A;  1I94 O;  4LFA O;  5FLX N;  3T1H O;  4B3T O;  1D2D A;  2UUA O;  3SDL A;  1NS1 A;  4LF8 O;  1IBM O;  4DR6 O;  4DV2 O;  4DR7 O;  3RT3 C;  3O65 A;  2N74 A;  4A5U B;  4LF4 O;  1N34 O;  4OPH A;  5IWA O;  1FJG O;  1IBL O;  2E5L O;  2LW7 A;  1G1X B;  4DR3 O;  3M8A A;  3T1Y O;  1AB3 A;  4GKJ O;  1A32 A;  5A2Q N;  2ZM6 O;  4JI2 O;  5LMN O;  5BY1 A;  1YZB A;  4JI6 O;  4B3M O;  4DV3 O;  4YHH O;  1XNR O;  2Z0A A;  1FYJ A;  4LF7 O;  4GKK O;  1HNX O;  4DV5 O;  4LF6 O;  1FKA O;  4NXM O;  4X65 O;  4JI5 O;  4LFB O;  1N36 O;  4DV4 O;  2UXD O;  5BXZ A;  4DV6 O;  1IBK O;  4DV0 O;  4X62 O;  4JI8 O;  1R6T A;  3OTO O;  1HNZ O;  2F4V O;  4DR4 O;  3J80 N;  4LF9 O;  5BR8 O;  3JAM N;  2JRI A;  5IT9 N;  1XEQ A;  1AIL A;  5H5N A;  4DR1 O;  1X59 A;  1R1B A;  2FKX A;  1DK1 A;  5LL6 Y;  2DJV A;  1HR0 O;  2UUB O;  4B3S O;  3R66 A;  1N32 O;  4DUZ O;  1J5E O;  4JI1 O;  4KHP O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...