2VQHA

Crystal structure of porb from corynebacterium glutamicum (crystal form ii)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
LSPQYNWVACGILEGGLKAAGVLEEGQYNRELAEAIAAKGEGFWTTQFPQIGDWNEDQAAALADRAQTCGLVKADT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN CGL0972
publication title A Putative Alpha-Helical Porin from Corynebacterium Glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Membrane protein
total genus 28
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11565 PorB Alpha helical Porin B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1280 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vqhA00
2VQHA 2VQLA 2VQGA
chains in the Genus database with same CATH superfamily
1K78A 2DOEA 2FXAA 2P81A 3JRCA 1MSEC 1S5LC 4BS9A 1HF0A 3NWSA 2FOKA 4NC6A 4RA2A 1K78B 3L1PA 3E6BA 4YIIA 3S3MA 3W6VA 2YX7A 1GVJA 3P9CA 2D45A 4KDPA 4HEA2 1Y0NA 2KRCA 5KAIC 3OSGA 1A6QA 4OINF 3HKZN 4DBQA 3LSTA 5K7FA 1I50J 2JA5J 3L7WA 1XMXA 3CO7C 2DBBA 3FXKA 4KIBA 2W7NA 3S3OA 1ENHA 2DLLA 1VQMI 2HR3A 4DOZA 4M3EA 4U88A 3RPQA 3K4MA 2ZJQF 1O4XA 1OISA 4II2A 4GDFA 2GXGA 4F52A 2JMWA 2RAEA 2KL4A 2K40A 4HRIA 4I02A 3F8MA 3ZMVA 2P6TA 1Y39A 4BL0B 2CUEA 2M4GA 1R4NB 3OL4A 2GAUA 4ANJA 2NS8A 1QNTA 1UCRA 2E36A 2ZNYA 5HLHA 1JUPA 2P5VA 2ZC2A 1D8KA 1YLFA 3OS1A 1HW2A 5D6EA 4HDVA 3IKTA 2HYJA 1W36D 3DPTA 2IP2A 3ASOH 2DA3A 2CV0A 4NB5A 3MCZA 1D5VA 5K5QA 1U0JA 4D9JA 1LFPA 3GEZA 3OR2C 2GWRA 3PM1A 3SZGA 3DU6A 1MJBA 2Y0MA 1I3QJ 1OYWA 2V26A 2M8GX 1ZAOA 2KP6A 1BJZA 1IN4A 5AIQA 2M0MA 4ZZLA 4S05A 3GO5A 2CG4A 3Q5FA 2STWA 4OIOF 1DGRM 1FMVA 3KEOA 1K79A 3PO3J 2QSHX 2AQFA 3DEUA 2H1KA 2AO9A 3G1LA 2YS9A 1Y1WJ 4NHJA 4GO1A 2X9DA 1LVKA 4UUVA 1ERDA 4ZYDA 1TC3C 2FBKA 1X3ZB 3F8NA 4Y33A 3W2WA 2R7OA 2LBFB 4EQQA 2RN7A 3WGIA 4RBOA 1R00A 1FZPB 3O2PE 2CWEA 3DXJF 2PMHA 1R1VA 5IT9K 4UUTA 1KQ0A 3DTIA 4RLFA 3DTKA 4Y3OA 3FM5A 3PIOF 1HOMA 3IC7A 1BR4A 2P8TA 1HDPA 1SANA 1REPC 4M74A 3ZQLA 3ZMTA 5FFXA 4PSXA 1Y8QB 2VC0A 2KISA 3M3YJ 3E6MA 2RQPA 4UY8I 2MD5A 4TV7A 1TWAJ 1XN7A 5B1AH 2XC7A 2DQRA 5D4SA 3U9GA 4MQVA 4UB8C 1JKQC 1ZLKA 2R7WA 4MTEA 2GIVA 2O6GE 4L5EA 1TZLA 2M87A 2FMYA 4N4OB 1MZBA 2VJ4A 5E3NA 1UHMA 3L2RA 2X51A 3DQVC 1MSFC 3CF5F 3BG3A 4A3CJ 1KU2A 2QF7A 3LSPA 3I55I 1ON2A 4N4NB 1SC7A 2XAHA 4PK4A 5J6XA 2DA4A 3HTSB 5E3OA 4FX4A 1I39A 2CQ7A 2XAJA 4OU0A 2R5ZA 2NOGA 1KZHA 2BHYA 3WTYC 1WPKA 4RM3A 2KLOA 4XLAA 1FYLA 2PLYA 2VBZA 3MZ8A 3I0TA 2QEXI 3H5AA 4F91B 2XV4S 4CZZA 3F8FA 5KK1A 3WTVC 2R5ZB 3K6GA 3VYUB 4IHYA 3I54A 5GPAA 2TCTA 3HSFA 4LD5A 2EV6A 2DFFA 1Q1VA 4DBRA 1G6NA 4Q4ZF 1WI3A 3FMRA 5FKKA 2KPMA 1MDMA 1YYVA 1OYIA 4ASNA 3GTPJ 4ENKA 4UVBA 2ISZA 2LKSA 2VKEA 1UB9A 3I3LA 4G6QA 4XL9A 5BOXA 2P7VB 4U7BA 3AG4H 2DPUA 2D2WA 1LKXA 2WY7Q 4FISA 5KNLA 4XONA 2WTEA 3RZOJ 5TISC 3BQZA 1JHHA 2R7FA 2V6EA 1FNNA 2CQKA 4A12A 2NVXJ 3WTXC 3EPZA 3CCVI 2VQLA 2XVCA 3BG9A 3QRFF 5J3LA 2R5YB 3RIRA 4M3GA 5IT3A 3J81K 2M2EA 1LDKB 1XD7A 4OMYA 4PUSA 2CQQA 1JUMA 2OPTA 4WK8F 5KCMA 3QYFA 2QKMB 1X1PA 3CMMA 3WU2C 2IS1A 2G0EA 2BVMA 5DEQA 4D1QA 1KGSA 1AA7A 1S29A 1T56A 1IDYA 5FROA 2MYSA 2XF5A 1ZQ3P 3WTWC 3E5XA 3I4MJ 5D4RA 4XM3A 2HU9A 2GZWA 4L9JA 2EFNA 3SZPA 1WJEA 2GOXB 2R7RA 3F21A 3R0JA 5FKNA 3WHCA 3GFIA 1MJ9A 1E2XA 2KFDA 4W1UA 1RRJA 2V9VA 4ZDLA 4UVCA 2HS5A 4XSZF 2KJBA 3RQ4A 2Q0OA 1S7EA 3F3XA 4X0GA 3G1MA 3FXRA 3VSLA 3PL8A 2MC3A 5LHGA 2CJJA 3B6AA 1J75A 2XF7A 5B3SH 4S04A 4KNYA 5FRNA 4HDUA 1SFXA 4ESJA 4GYGA 4F7ZA 3ECHA 1QO0D 4PJLA 4KN4X 3T0YA 1YI2I 4HX8A 4B43A 2ME6A 2YSRA 3S32A 1IO2A 3GZNB 3VFZA 2F48A 4HNVA 2QCOA 3ONQA 3W2VA 3KLNA 2E1MC 5C4XJ 1ITYA 4XOTA 2BY3A 3A1YA 2K4BA 4JK1X 2UXNA 2EJRA 1U8BA 1G8XA 1DQUA 1YS7A 3S1QJ 1IUYA 3L2WA 5BPIA 5EEAA 2DPDA 4XIDA 2CFOA 2ZSIB 2KIQA 3BR1A 3G73A 2CUZA 2KQRA 1FBQA 3H9GA 2L01A 1Y1VJ 2HQAA 4A3DJ 1U2WA 1SAXA 4XQFA 3RCOA 1Z3YA 5E1XA 2A68F 1KU3A 4FQGA 2VOOA 2M45A 1WQ2A 3T8TA 1OLTA 2A6EF 4CZCA 2UWMA 3RYRA 3MFKA 4FE4A 4ON0A 1PP7U 1SVOA 4A3IJ 3GZ5A 4HAMA 1LJ9A 3A01A 3JR9A 2PMUA 4RAFA 4C3JJ 1ACIA 3A01B 1H89C 3HUGA 2KIMA 4KMFA 1V4RA 1SMYF 1WJCA 1VQPI 4B44A 4A3LJ 3S2HJ 3BT9A 1QU3A 1D3YA 3GWZA 1FT9A 1F1ZA 1Z3XA 3RZDJ 1AKHB 1YQAA 2Z16A 4RMNA 3I53A 3K10A 2Z9OA 5DUIA 2WV0A 4WXHA 2RKHA 1X1BA 3KE2A 3HOWJ 2AXTC 4UUSA 2DT6A 3C2GA 2NXNB 4AVPA 5LRSA 2E1MB 4B3XA 3Q0VA 2BBYA 4C3HJ 5GTHC 2F4IA 4II3A 4G8XA 5HLGA 1YG2A 1MKMA 4Y17A 5BNGA 4M6YA 1XMAA 2QBYA 2VT2A 3ZPLA 4DGWB 3E6DA 2N8GA 2V1NA 2M4KA 5IYDJ 2QQ8A 1YJNI 1F5TA 2LR8A 2Y69H 2J5OA 2PX9A 1ULYA 1MIJA 1UMQA 4IQ4A 3CCSI 4YFXF 3F0CA 2O0YA 2EILH 2XF6A 5F6FA 1XX5A 5E17F 3K1NA 1WZ2A 1R22A 4FTHA 1IW7F 3U1KA 2EWNA 1EF4A 3FZVA 3OYEA 1ETKA 5F0FA 2W85A 1RPWA 4PFOA 5D5WB 5DUKA 1D0ZA 1GVDA 2BYVE 2KT0A 4BE2A 2NRAC 3CC4I 4G7OF 3TO7A 1ZG1A 2XGDA 4A3BJ 5F1RA 3MZYA 1YE9A 2ID3A 1LQ1A 2K9LA 2E34A 3BJAA 3KYCB 2V1DA 2Y0SN 1OFCX 3QP5A 4JOMA 1BIBA 1R4MB 2JRTA 2DK8A 2DQLA 3VODA 3GFJA 4XN3A 1R71A 5J47A 4KYWA 2VN2A 4BY1J 2DMPA 3JAMZ 4RB0A 2HVRA 2CW0F 3QP6A 3ASNH 3PIPF 4KITB 2GOMA 3K9TA 1LVAA 2R3SA 3ESWB 2M3AA 4OIQF 5HLTA 1O7LA 3OSFA 3QPSA 2M0CA 3V7RA 1VQ5I 2ZNZA 4RGXA 2DJIA 3QU6A 1KU9A 2MGQA 4HG2A 4MFDA 3RYPA 4LB5A 3IH3A 5CVRA 5CVIA 1X1AA 3M8EA 4AYBN 2P0WA 5IP7J 2L7MP 4E7KA 2B0LA 4IVNA 1STZA 3MVPA 5EGOA 1CGPA 4DYRA 3FHNA 4BXUA 4JBAA 2DN0A 4EM2A 1D1AA 2ISYA 3KZIC 1HA8A 1DP7P 3E1SA 1HQCA 2VXDA 3L2UA 3HPGA 5D5XB 3P5JA 1IRXA 2IGOA 4JP0A 2P5LC 1WWXA 2MW8A 3HHGA 1EJ9A 2KZVA 2F5FA 4XLNF 2CSOA 1RKTA 2CW8A 1EH8A 1TL8A 2L02A 2MH2A 2BW3A 1BJAA 4WWCA 4HLYA 2B9SA 4LJZF 1K4SA 1W36C 3V4GA 4XRFA 4BU2A 2E60A 2HQ5A 4YFNF 5FB2A 2CU7A 1V55H 3CLQA 3QOPA 2QYOA 3OS2A 1VQLI 2BW3B 2Q2EA 2CV1A 3GVAA 2DDAA 1A35A 3T8RA 3RDIA 2F4OB 2Q2EB 1TQPA 4Q48A 1FOKA 1RC9A 4BXFA 1DDNA 2NYXA 4PJJA 1OMIA 3CMYA 4Y13A 1GT0C 2TRTA 3TW7A 1AHDP 1N78A 3OYIA 2L7FP 3VOEA 1SVMA 2X48A 2IA2A 1FYKA 3S14J 2BY0A 2M1BA 4ZYHA 5ILSA 5FLXK 5TJJA 3E6CC 4HLXA 1NK3P 3CCUI 1TP4A 2J5PA 2FJ1A 1CQTA 4UXNA 2HYGD 3RPUA 2V79A 2XRLA 5JR3A 4M71A 4Z2YA 2KRFA 4IQJA 3TO6A 5IP6A 2LH9A 1SD6A 4NNJA 5LLQA 2H09A 2LK2A 1UAAA 4I2OA 2EB7A 2QLZA 3LNQA 3H35A 3I9V2 1JGSA 1ZYRF 3DPUA 3G3ZA 1JKPC 5DM6F 2A5YB 2VQHA 4OAYA 4CDGA 1J2XA 5H2FC 3MD2A 2RV8A 4HX4A 1WJBA 1FOWA 1D0XA 2G7UA 1AU7A 3K4NA 1SVLA 4UB6C 5LD2C 1KA8A 4XKVA 2VB6A 3GLLA 5IT9Z 3EYIA 2AHQA 3JRFA 1R5HA 2X6OA 1MJAA 2VASA 4BQQA 3VDXA 4BEHA 4I0BA 3RJPA 3IAS2 1KQ9A 1G3WA 1UG0A 4LG3A 3RKYA 2B63J 2CFXA 2NVYJ 4L0YB 3K1PA 3LQRA 2DXIA 2F2EA 1ETYA 4CCLA 1JUSA 1I5ZA 4BEHB 4LGWA 2VL8A 5HLIA 2D5VA 3HB9A 3JTHA 2A6HF 2I5UA 1B72A 2KJCA 4GRIA 2FX0A 2OCEA 4P55A 1WJFA 2O5RA 4LG0B 3U21A 1H9GA 4BKXA 3F8BA 2ECCA 4UHTA 1LFBA 4Y52J 4PSWA 1BI1A 3A4CA 1FYMA 3WTUC 3OIPA 2HOTA 3TOBA 1QQIA 3SJMA 1LB2A 2L3DA 4P1WA 2UZKA 2V4JC 2JT1A 2CYYA 2DT7B 2LRDA 2IJLA 1LEBA 2LFBA 2LOOA 3I4PA 2K86A 2ZCWA 1YRNA 4A3KJ 1YFHA 2JWTA 3S17J 1F4KA 2FNPA 1JHFA 2IRFG 3SZTA 3OYNA 3KP3A 1LE8A 3GTOJ 2LDUA 3MWMA 1YRNB 4DQ2A 3OV8A 2EV5A 2M9HA 1RZ4A 3NARA 2EZLA 1MD0A 2ZFUA 1RI7A 3OYKA 5D5VB 5B5EC 1H9TA 2CMPA 2LMDA 2H94A 5HODA 2DAOA 1T98A 4XLEA 3WE2A 3OOPA 2EV0A 3PSFA 2QKLB 1P6RA 5L3GA 2DYRH 3S15J 2W00A 4CICA 1TT5B 4HF0A 2R93J 4WXDA 2JVGA 1U78A 4P9UA 4AIKA 1BR1A 4H4KC 2E2IJ 4A93J 1TTYA 4J19A 2UV1A 5K1YA 2W4SA 3KP6A 5EZGA 2DA2A 4I6ZA 5GPCA 3J80K 3ISPA 1GXQA 1VQOI 2JA2A 2EFQA 4Y7NJ 2ICWG 1AOYA 1B9MA 1HLVA 4D5CA 5FJ8J 4Z6YA 4WCGA 1T39A 1HKTA 5ED4A 2ZKZA 2Y75A 4AD9A 5HS8A 1IZ1A 2FNAA 4A3MJ 2BEOA 3MKWB 3O6BB 2R4GA 5IYCJ 1K6YA 1H8AC 2YUSA 4JYKA 2E7WA 1D8JA 2O7OA 2M7BA 3BTCA 1MNEA 1TQMA 1PP8F 2L7KA 1R36A 1VF9A 4AC0A 1FTTA 3RPUD 3V8KA 3SFZA 2QM3A 2ZXHA 3ZQHA 2LREA 3EDPA 5EEGA 2FRHA 1F43A 3K7AJ 2X6WA 2EBIA 4Y15A 4HSRA 1P7IA 2L4MA 1R49A 4J00A 1GDTA 1ZGWA 1XCVA 2MABA 4G6TB 2VONA 3MKYB 3JRGA 1YX3A 4FHTA 2HZTA 4XRSG 3JTGA 2Z33A 4XMYA 3LOCA 4A0YA 1WRJA 3QYBA 2XHKA 3OYHA 1BBYA 3CMAI 3KLOA 4ZTJA 1J5YA 1P92A 4PJNA 1BIAA 2VE9A 1VQ8I 3JRDA 3DBHB 3BG5A 1ZARA 3GFMA 3QPTA 4BHPA 2HGCA 2P6SA 2HTJA 4XKCA 3R4KA 2DA6A 3H3ZA 2G7HA 1FIAA 2VJJA 2CQXA 1OCZH 3TDUC 2OC6A 3M4OJ 3G2BA 3VB2A 5JI6A 1C0WA 2RGVA 5BMZA 3BR3A 2BV6A 2DDBA 2A5WA 2HNHA 4E7SA 1VFCA 1MBEA 2LBFA 3HYIA 3W6KB 4N9HA 3F6OA 1K7AA 1WKMA 3UR3C 2XGEA 1U9NA 2VKDA 4L5IA 4XN0A 3K4JA 4BXXJ 3FXUA 4EVIA 2FF4A 4BDZA 3I64A 4MNUA 1QRYA 1LFUP 1IF1A 3QOEA 2HXIA 2MA3A 3HOXJ 4U0VA 2R7UA 1WJ5A 3ULQB 4EGYA 3CCMI 4QTRA 3T5XA 2D1VA 2Z5UA 3HOYJ 5KHDA 1ON1A 1FBSA 4LOCA 2WB1A 3WGHA 2FOWA 4AU7A 2VODA 2WC2A 2GBYA 1WHUA 4BHCA 3BJ6A 4DW6A 1I3AA 2BGCA 3KP5A 1JE8A 3CUOA 3CO6C 1R9TJ 2X6YA 4E6KG 4CGZA 2Z99A 4OOIA 2KHMA 4XK4A 1RUNA 1UG2A 2VUMJ 3OIQA 3TL4X 2FD5A 4DYQA 2LTPA 4CYDA 4H0EA 4U0WA 2WY8Q 3E5UA 2AXLA 3VPRA 3ABTA 4EATA 4ZC3A 5DD4A 5FKMA 1H88C 1VQ7I 3RKWA 2NVQJ 2RNJA 2STTA 1FSEA 3D1NI 3ZQIA 1OYYA 4CCNA 4XORA 3QWLA 1G59A 1Q1HA 4OIPF 2E1CA 2X1CA 2ZO4A 2CO5A 4KT5C 1FMWA 5F08A 1CF7A 2COBA 2BOLA 3KZZA 1VQ4I 4XR6A 4G9YA 1E3PA 1BOAA 1X3UA 2IGKA 3E7LA 1ZH5A 2E5ZA 1CF7B 4ENMA 4RLQA 5GP9A 1MBKA 3TP3A 1R1UA 2PMZA 4NDLA 2JPBA 3OYLA 1UFMA 1SEUA 3W2AA 2XB5A 5E8GA 1EKEA 1R58A 2ZSHB 4XSXF 2C6YA 1B1BA 3DKWA 1A6IA 1PUFB 2QGUA 1BW5A 9ANTA 1QGPA 4GXOA 2R5YA 3OY9A 4NBQA 1G4DA 1K61A 5D8LB 1BW6A 1PYVA 1YOVB 2BY1A 3L2CA 1XS9A 1MMNA 2W24A 3CQZJ 5F0CA 3GUDA 5IY5H 3LSMA 3H1CA 1Z05A 1S3JA 2WAQA 3OYBA 5CQGA 3TBIA 3E0JB 1ETXA 1WH5A 4GYIA 5EJCA 2LF7A 1OKRA 3P9IA 2K9QA 3LSRA 2HFHA 2A6TA 1KQ8A 2L4AA 4CUGA 4M9ZA 2E1OA 2VOPA 1R6RA 2QSGX 2LVSA 4LIUA 3M1EA 1FWZA 2IAIA 3OOUA 1QZYA 3S93A 2EQRA 1BN5A 3Q0UA 1YIOA 2V9KA 1A5JA 2QQBA 1HKSA 3ZRGA 4A3JJ 1FTZA 2QQ9A 5F04A 4HA8A 1QHGA 4XRMA 4IRIA 5LBQA 1ZREA 1YTYA 4HF1A 2JUCA 2DU9A 1E17A 1RR8C 3OYAA 3LL7A 1TW3A 4BACA 1FIPA 2JUGA 4B48A 2WAEA 4PJ0C 2ZXWH 2K7LA 4NC8A 2Q8KA 4IZZA 1LEAA 2BZTA 5FKOA 1MMGA 4G7ZF 2HYFA 1OQYA 3V7CA 5F64A 2ZMEC 1ETVA 2RREA 2X0LA 1W5CC 4HV6A 3IL2A 1G3TA 2K5CA 2I8DA 5J4YA 2GA2A 1VQ6I 2ECBA 2V9PA 3HKZA 4MO7A 3ZMSA 4XICA 2KRHA 5CPRB 2PBIA 2BVLA 3IHUA 2Y9ZA 5J1UA 2DTZA 3F23A 2EA2A 3PNYA 1U6GA 1RUOA 3ZCOA 3BZCA 2RQQA 4YELA 3HGGA 3TOAA 1H0MA 3FKIJ 5ICCA 2Y2ZA 3D5RC 4B4CA 2DMNA 2JZYA 4HV5A 2CV2A 1IRFA 3VYTB 1ZGAA 2NAZA 2OQGA 4MEYF 4ETSA 4IX7A 1IJWC 2VLAA 4HF2A 3IV5A 4G12A 3O3KA 3LFKA 5FD6A 4BBRJ 4IJAA 1R5GA 4BJ6C 2JSPA 2VBXA 3K0LA 4V19K 1OCTC 3F72A 5FLXZ 4X6AJ 4F93B 1NH3A 1TNTA 1HC8A 2P5KA 2QZ8A 1IN7A 3VEPA 3H3UA 4HW0A 2HPMA 5C44J 3PUBA 5FLMJ 4CSWA 1AKHA 2VPRA 4KFCA 3HXLA 3E3VA 4X1EA 2CS3A 2XUBA 3IRQA 5CKTA 3ZN0A 2XIGA 3I56I 2DA1A 2ZMEB 5HNHA 5CVUA 2HEOA 3HOSA 4ZDOA 3KP2A 4LFUA 1XGMA 1WGXA 1I6HJ 4P96A 1V5FA 2BXZA 3ZMUA 1O3SA 4F92B 2EZIA 4M3DA 5CYVA 1Z7UA 3CF2A 1XPXA 3G1OA 4A0ZA 4CYCB 5LGNA 4LK0F 4RB1A 1HKQA 1ZN2A 2X4HA 3C2BA 5DS9A 3AAFA 2QA4I 2LY2A 5DV5A 4B47A 1G3SA 1FX7A 2ETHA 1W0TA 1ETOA 1XSDA 2VXZA 2O8KA 3EUHC 1U9OA 3CZ6A 1S7OA 2F4MB 3BCBA 1BC8C 2CQNA 1L3LA 3JW4A 5HS9A 2DJNA 2Y31A 3IUOA 2MLGA 1X2MA 2QQAA 4KIFA 1UJ8A 3GFLA 2XPUA 2HVQA 4RB2C 4BGDA 4BY7J 1QPMA 1KYZA 3KIOA 2IEKA 2EIMH 2GQQA 3IWFA 1MNMC 2KDZA 2XASA 4XBFA 1YIJI 1VZ0A 2IA0A 1ZGJA 3FKJA 1K6OA 1QZZA 5CVVA 4CCMA 4C9YA 1HSJA 1XG1A 1SMTA 1GHCA 5IP9J 3VWBA 3BP8A 1XSVA 1JXSA 2ZXIA 1G2HA 1T33A 2IXSA 3S2DJ 2Q1ZB 3WGGA 2XPWA 4HBLA 4BQOA 3R6SA 2CGPA 3EUAA 4ITVA 4J01A 1IV6A 5ICGA 1GLNA 3WTTC 4M3FA 3ZGKA 3HL2A 2CRGA 2HKXA 4B1RA 4EV0A 4PZJA 4G6DA 3KZYA 1B4AA 5A2QK 3K2ZA 5ICFA 3D5LA 3BG7A 2R7XA 3IP4B 3U2RA 4D5FA 2H6BA 2R7VA 3B6CA 2IGMA 2R0QC 1JT0A 3GTMJ 3DCFA 3EUHA 4Y4RA 4OMZA 1S9HA 1P2FA 5EG0A 1DGWY 3LFUA 1MMAA 1VQ9I 1SFKA 3SEQA 1JI8A 4AUXA 3N05A 1WVRA 1OPCA 1IXRC 4HZFA 5HS7A 5EG0B 4B3AA 1IRZA 4HSTA 1DPRA 3MEXA 4A6DA 2JSCA 1VTNC 3DFGA 3IRRA 2JA8J 3BTLA 1B9NA 3V8JA 1A36A 5IOYA 3TP0A 5LFAA 5FFZA 1X1CA 1XB4A 4MIMA 4KN7X 2VC1A 1PUEE 1BI0A 1U5TC 2ZJRF 5IPAA 5GAHJ 3DKXA 3J7YJ 3HRMA 3CJTB 3CTAA 2A61A 2EA4A 3RI4A 1J59A 1ZRDA 2LY9A 5C4JJ 2K9NA 3FXMA 3FXLA 4UV9A 4U87A 2YX4A 3KP7A 4D0PA 2EZKA 1HSTA 4QWQA 4KICA 2FBHA 1U3EM 5GAEJ 2HDWA 3WODF 4YFKF 2OCCH 2DFHA 3C3WA 4UNOA 1YW7A 3JRIA 4QPQA 4L5JA 3SXYA 2KIFA 4JQFA 3N97A 2MG4A 4DYCA 1WI9A 3OYCA 2VI6A 3GBGA 3L2VA 4LMYA 4UV8A 3OYJA 2ME0A 2PG4A 4R79A 5FRMA 1N75A 1NHAA 3HG9A 4HOBA 4IRGA 4MTDA 1OCOH 1WSUA 3CP8A 5JHFA 3K4BA 4ESBA 1FY7A 5FD5A 4Q5SF 4A69C 4E7LA 1Z91A 3ML6A 1LPQA 3AG2H 4BHBA 1B8IB 5CVJA 1VQKI 3B73A 3DP7A 1YITI 1Z21A 2LKPA 1USTA 4IPAA 3HRUA 1U5TA 2HQNA 3DV8A 4A3FJ 2KIUA 3LWFA 1IUFA 3CLOA 5CJ9A 3BCAA 1APLC 4C2MJ 1T2KA 3IH2A 2HI3A 1T6SA 1U5TB 3QYEA 1ZLJA 3LSIA 1A04A 1XGNA 1J7KA 1RNLA 4JX5A 2IS4A 4MLOA 1OCRH 1BM9A 1V5GA 5M5YJ 4M6VA 2OF7A 3S1RJ 1ZHFA 4AVZA 4CHUA 1ZELA 3BR2A 4A5MA 1I6XA 4L9NA 4E4HA 1PJRA 3K70C 3CJQB 2MC4A 2X1DA 3C18A 2IW5A 2E5NA 1SFEA 2PI0A 4JX4A 3AL0C 4YIFA 1WCMJ 1RIOH 1EH7A 2HOEA 2M7AA 2WADA 3RKQA 1ZTRA 1QVUA 3H0GJ 1O3RA 4LG0A 2GLOA 2DO7A 1W7PB 4KA4A 4BBSJ 3CDLA 4XKWA 2WAFA 2XDVA 1HXDA 4ZZDA 1P4XA 1ONVA 4I98B 1LNWA 2FU4A 5HDNA 5LEJA 2H27A 4PCQA 5BPDA 3M8FA 3CDHA 5F0HA 3BR0A 3SHFA 3GYHX 3JRAA 3I59B 3TMOA 1T38A 2NVUB 3HEFA 4FASD 1F9NA 3A2KA 2Y30A 3LA3A 3A02A 3H5NA 2QSFX 2XB0X 3NAUA 1B6AA 1VI0A 4KUMA 4O5VA 3EUKL 1YS6A 2E71A 2XPVA 2HQRA 3SDBA 4U7DA 2OTLI 3Q3SA 3PJRA 4AIJA 1JGGA 3HM5A 4DIQA 1ODDA 3WU0A 5JFRA 2DMQA 4BDYA 3ZQ7A 4E7IA 2ZFWA 2HKOA 1MBFA 3W6JB 3BJOA 1YX5A 4EJVA 4U0YA 4FCYA 2OZ6A 3ZQCA 2LSOA 3I58A 2WAQN 5B1BH 3E97A 5HNFA 2K9SA 2CUFA 3SQNA 1GV2A 4R1HA 5E3MA 4MQ9F 2LF8A 4K2EA 2EPFA 4EGZA 1YJWI 4XLCA 1D1BA 1BI2A 5LEKA 4I76A 1A31A 2KMUA 1WH7A 1LDJA 1TWCJ 2R7DA 3WE3A 5DDGA 5BS6A 1Y0UA 3JAMK 2RDPA 3MAJA 3KYDB 3AL0B 3ERMA 2DMTA 3PSIA 3V8LA 3Q9VA 1ORKA 5C3EJ 4LK1F 3H3VK 2XKPA 1I1SA 1F36A 1OR7C 3PFIA 4A3GJ 3J81Z 2WA0A 4HPQA 3FWEA 4GFBA 2Y0SA 3BLYA 2OU2A 4NUBA 3CCYA 1S72I 1YHQI 2HWVA 2LC2A 1DU6A 3JSOA 4RGSA 3FISA 1TLHB 3ZOBA 2W1OA 3ABMH 2DCEA 2DFIA 2GXAA 3HTUA 1Z9CA 3BC8A 4BH9A 2KZGA 2R7ZJ 1Z7LA 1FBUA 3A0BC 2LKXA 3FXJA 5J1YA 2DW4A 2V1UA 4EJOA 4HQEA 4E7JA 2HTSA 2L0KA 2QVOA 3OYGA 3BZKA 1IRGA 1B59A 2CW7A 2XAFA 1POGA 2E7XA 3FXOA 3FHZA 1O57A 3TDZC 1MH4A 1W0UA 1XTAA 1Z77A 2VBWA 3E5QA 1XC5A 4N9IA 4YEJA 4EMSA 1YJ9I 2EZHA 1Z67A 4ZYGA 1BL0A 4AYBA 4W97A 2XSDC 3K4LA 2DODA 4GCVA 1HDDC 1IN5A 3HSRA 3J7ZI 2K9MA 3MQ0A 4BQAA 3ABUA 1R7JA 1XGSA 4HNUA 2G9WA 4A6EA 1Y6IA 2IT0A 1FJLA 1MBJA 2OD5A 3GXOA 1TWHJ 2VT3A 4CCJA 2COMA 1OR7A 5E8IA 3LAJA 1L0OC 3HJEA 2M8EA 2P4WA 4BUPA 5FLVA 4EJWA 1FOXA 1XMKA 2XRNA 5EDNA 3MZHA 4CH7A 3OYFA 1W5TA 1W7PD 1JT6A 1XGOA 3F9KA 3OS0A 3M9AA 2W82A 3B02A 3CJNA 1ETWA 3M07A 1NG7A 4ABZA 1UHWA 1K4TA 1Z6RA 1X58A 2O03A 1IXCA 2A05A 2DK5A 3KEQA 3LQQA 4RGRA 1I1GA 4PJMA 5HVQC 1N77A 5JLXA 1X4OA 2TDXA 1P4WA 2WWYA 2EFOA 5H20A 4F3QA 2FA5A 2PEXA 3MKZA 3GX4X 1J0RA 2V6CA 1EH6A 1TW2A 2H8WA 3RSNA 3LA7A 2XAQA 4HQMA 1QA6A 5ILVA 1X2NA 4EM1A 1RR7A 3LA2A 3K69A 1XDSA 3S3NA 2BHZA 1AWCA 3NRVA 2H1LA 3G4SI 5AIPA 1ZKGA 3WG7H 4XLPF 4YRVA 3OIOA 5M5WJ 1S6LA 1BI3A 1DP3A 1BA5A 2CH0A 4XLHA 3CCRI 4IHTA 1FLIA 5JLWA 1E3HA 3QODA 5DCMA 2IA1A 2OUMA 1P9QC 1Z6TA 3CCLI 2RC4A 1YO5C 3COAC 3S1NJ 2OQRA 3K70D 1S8NA 5BQTA 4M9SA 1OCCH 3CCQI 3WU1B 2WV1A 5DCMB 2GA1A 1EA3A 2XAUA 4QSHA 1V5EA 2BE5F 2ZXJA 3M1CA 3SEZA 5GTIC 2Y48A 3BTJA 2DTRA 2VKVA 3DLLF 2L2OA 3ZN1A 5DD8A 3HGYA 2PN6A 2IVMA 5LHHA 3H36A 3OYDA 3EYYA 1ZG5A 2MFZA 4C2UA 4LLLA 3RKXA 3ERED 1IC8A 1TQIA 1FPQA 3SYTA 2M34A 4ZDPA 3O8HA 3S1MJ 3VSKA 3KETA 2IS2A 1K83J 5E20A 3TQNA 4MGRA 4IO9F 1ETQA 4ZYAA 3H9QA 3DPLC 2ZJ2A 4IOCF 3BWGA 3P7NA 5K5RA 3IH4A 2QUFA 3MMYB 5K7HA 1MMSA 1Z1DA 3ZMDA 5H6QA 2L7ZA 1FP2A 2V1XA 5DM7F 2F5DA 1NG6A 1PUFA 3RQIA 2JPCA 2DYSH 2O8XA 2Z3YA 5JHUA 2MH9A 2NVTJ 2W25A 3QU3A 2B7EA 3DBRB 3F8CA 5E18F 3HDDA 1R5ID 1QHHD 4KMUX 3OWTA 2JA6J 3KP4A 1JTYA 1IV8A 4RDUA 2ZBKA 1TT0A 3HHHA 1IG7A 1IAWA 1JKRC 4BQNA 4L18B 4XNFA 5K7ZA 3TO9A 2IS6A 2L9VA 5E79C 4WX9A 4I0AA 2YU3A 1JTXA 2XAGA 3ZR8X 2H6CA 4LLGF 2PJRA 3W3CA 2Z1DA 2HOSA 1QBJA 3GTLJ 5H6RA 4C3IJ 2NS7A 2PFBA 2X85A 3ELKA 2VE8A 2PJRB 3BROA 3DU5A 3FK7A 4ZYEA 3HOTA 1MDMB 4IKFA 2Y9YA 3N4MA 2XGXA 4MHGA 5A2QZ 2FE3A 3L00A 4A2UA 4BJ5C 4YIRX 4DNCA 3F22A 5E3LA 3CC2I 4P5OA 4RAGA 1SD7A 2F5VA 1YW8A 2HVSA 3I4NJ 1X4PA 3IAM2 3Q0WA 4CXFA 4L0ZB 1J09A 4QLCU 4KISA 2VPLA 1FC3A 1ZRCA 4QPOA 3DEEA 3CESA 2MD0A 3T1BA 3R0AA 5K5OA 1TBXA 2JJ7A 2QENA 4PFPA 5F1JA 3V42A 3S8PA 3CCJI 3BG6A 4FETA 4FE7A 4EM0B 2OA4A 1ZR4A 1UELB 1M1EB 3R61A 1T8IA 1E3OC 4V2FA 4BE1A 1TWGJ 4RS8A 3TEDA 2ZB9A 1VNDA 2JK3A 4IHSA 3MKLA 1FSHA 1KYWA 2DOAA 2LD5A 2YU9J 1U8RA 4M73A 3I71A 4LLNA 2LLKA 4V2GA 1GUUA 2E2HJ 2XROA 5L3DA 1SFUA 2UUZA 1N25A 5EYRA 3QPLA 4CA0A 3AKZA 5F27A 2A69F 1P4AA 3GCMA 2FQ4A 4AIHA 3HOVJ 3PQKA 2JA7J 2M5WA 4I09A 2EK5A 2EIKH 1IDZA 1DPUA 1TWFJ 5AONA 3GTKJ 1QZEA 2X6XA 2O3FA 4IF4A 1X3WB 4F55A 3C2HA 5J1RA 1WJDA 3DBLB 4E70A 3HRSA 3PNVA 2GM4A 4LB6B 3K4KA 2MBFA 3BR5A 5KAFC 2DFEA 3DLAA 3NQOA 3JRBA 3DF8A 4D7MA 2LNBA 4ENJA 1D0YA 3LSGA 1IN8A 3FIWA 5TRDA 4IHVA 3AG1H 4M9XA 3OR1C 3HBLA 1Y56A 2EFPA 4PDKA 5GADJ 4BE0A 3FX3A 2X1EA 4NQWA 4OAZA 1JJ8C 5IYBJ 2CUJA 3KFWX 3CCEI 5DCFA 2BXYA 5E1WA 3L2QA 2E2JJ 3PNTA 2HOAA 2W48A 2ZMEA 5J4VA 3DKYA 1I27A 1WFXA 4NQWB 4AM3A 1IN6A 3A03A 5HDKA 1SD4A 3LSJA 3K1MA 3G6EI 3TGNA 3SDGA 5CQEA 2JQ7A 2DOFA 2YPRA 2K3FA 4CYCA 3HIFA 3JRHA 2EFWA 1UZCA 3LSKA 3OL3A 4FX0A 3HSEA 1ZG3A 3FBNB 4A3EJ 2OJED 2AS5F 2NNNA 4RGUA 3I5UA 5LRRA 5J8CA 1MNDA 3BR6A 5B66C 1DUXC 1J9IA 1HCRA 4QIWN 2ACJA 3WG9A 5M3MJ 3H0DA 3HUGB 1JJ6C 2FSWA 1MH3A 4IHXA 1XDUA 5J8FA 2W57A 2JRMA 4OWRB 3BTIA 2IGNA 4DJAA 2F5EA 5DYMA 2R7SA 2ELHA 2EIJH 1KU7A 3CUQC 1O7FA 1MW7A 3FBIB 2L5QA 3BY6A 5JVGF 2RNGA 3D5SC 4RAZA 4UUSB 1DU0A 5EF6A 3H92A 3CDIA 2VBYA 1YW9A 2Z2SB 3H9JA 4NC7A 1OCPA 4RAYA 3GW2A 1RESA 1BC7C 4PGGA 5ILUA 3GTJJ 4O3MA 4M72A 2YR2A 5L3EA 4XKBA 4YG2F 1FOYA 2M30A 5D8KB 3DWLE 5LGUA 4GGGA 2FQ3A 2QBYB 3GTGJ 1HW5A 5E1ZB 1S7AA 2ID6A 5M3FJ 3ABKH 2IPQX 1T95A 4BYYA 1E0EA 3OYMA 1G3YA 2A3SA 3ECOA 4L9TA 3FDYA 3CJRB 3HC7A 3FMQA 3GTQJ 3SFIA 1EV7A 3JREA 2EH3A 4FT8A 1LUJB 2IBDA 3ZP5A 3IWZA 2GXBA 2JVHA 2R92J 4HX7A 5GAGJ 6PAXA 3EQLF 5M5XJ 2FMLA 3TKYA 3LAPA 3HOUJ 3CUQA 3UNGC 2DMUA 4B8XA 4EEFG 4M6XA 1PVEA 1X1DA 4ZTFA 2VQCA 2PJPA 2EINH 1OJLA 5EZHA 3ROUA 3M7GA 1QPIA 3CUQB 2K85A 4M3BA 1GV5A 1TNSA 2R7QA 1R23A 1W5SA 3J80Z 3CC7I 3S16J 2FUG2 2LYCA 2VKHA 3PUFA 4O6JA 3JCUC 2W84A 3FF5A 2ELKA 2NOJB 2R7TA 2GIZA 5EEHA 1PDNC 1MMDA 4ENNA 3ZMZA 3WTSC 5LHIA 2XKOA 3DTEA 4R8HA 2KKOA 4ZJZA 4XRSA 3KEYA 4CCOA 3HRTA 4N0BA 5D5UB 3C7JA 4Q47A 1W1WE 3HOZJ 4MFEA 4S0HB 2KDOA 3OMYA 4BAYA 2E35A 2L9RA 2WBMA 3GMEA 5FKLA 3REOA 2VIXA 5EGOB 5CLSA 5L3FA 1NTCA 5J40A 2K3PA 4ESFA 2DA7A 2L9NA 2HDCA 1T08B 2ZJPF 4E7ZA 2PQ8A 2JN6A 3PQJA 3ZQFA 4IXAA 2HDDA 3CMEI 4JX6A 5D6FA 4XLFA 2HPIA 4D7NA 3RTRA 3WTZA 5JVTA 2L9SA 1B8IA 3ZQQA 2O9LA 4C2TA 4WXCA 2LP0A 3LMMA 3BPVA 2E1NA 4LITA 1MBHA 3KX2A 3MN2A 4A5NA 1X19A 3VYSB 2P7CB 2FBIA 2HZDA 3BPXA 1SFOJ 2D1HA 1D5YA 1O3QA 1O3TA 1GXPA 1ZR2A 3ABLH 4DZPA 4KJZA 3R60A 3KYLA 1IXSB 3LSHA 3AG3H 2VJ5A 3QQAA 4MEXF 3U1DA 3GLXA 2AQEA 3V7SA 2ADUA 5KVRA 2OV7A 4IL6C 2F5CA 1KONA 1JKOC 3L09A 2MSYA 4P9FA 3A0HC 3QPHA 4KT6A 2WB1N 4IEJA 3Q9SA 2UXXA 1USSA 1V3FA 1XSXA 2L54A 1NK2P 2DI3A 4EJTA 4ZH4F 3GZ6A 4EJUA 3NWTA 3X2QH 1MGTA 4CCKA 3FK6A 2K27A 4C30A 2BY2A 4AIDA 4I01A 4BJTA 4OIRF 3C1DA 4IRHA 1ZK8A 1FP1D 4CO8A 2ELJA 2JTVA 2DT5A 3BOQA 1P7JA 3ZQGA 5LGTA 1Z0XA 4G7HF 4E7HA 2VJIA 3NEUA 1W7PA 3FM3A 3KPHA 5ICEA 3EETA 1ZRFA 2MLKA 3PFYA 2XSJC 3HZJA 1V54H 4I99C 1D1CA 4L9VA 1HBXG 2I10A 3O8GA 3S2WA 2QWWA 1BR2A 3DEWA 3I59A 3J7AO 1UHSA 1RKWA 5DTDA 4I7HA 1T0FC 2ESNA 5ERIA 1RETA 1QVTA 1VQNI 3PO2J 3ZXSA 5HOOA 4LIVA 4A0XA 4BNCA 2PMZN 3F6VA 2OTJI 2H8RA 4HYEA 2OAZA 3QAHA 2RVCA 1LDDA 2VQGA 3WHBA 3CD6I 3K2AA 2NS0A 3H5RA 2K4JA 3KCCA 3VYRB 4WF2A 5FGMA 4HNTA 2HXOA 1XCBA 2A07F 1SAUA 1IGNA 1SD5A 1B72B 4IOAF 4XOPA 2DA5A 2V7FA 2FEZA 3K4CA 3GF2A 2E19A 5HDGA 4RM2A 4PGHA 5TGTA 1R1TA 3AFHA 1WJAA 3BQYA 1Y8RB 4G94A 3L9FA 3J7AY 3P9KA 3BZ6A 1HW1A 2LY1A 3CP2A 3IKVA 3TW6A 1FEXA 2OBPA 5L3BA 4RB3C 3UKGA 1W4MA 2O61A 1BOBA 3D0SA 3G71I 3BDDA 2XGCA 4UVAA 4DZJA 4B09A 2OZUA 3FMSA 1MBGA 2F6CA 2NNYA 2LG4A 3JSPA 5L3CA 2ESHA 2K02A 1T0FA 5FO5A 3HPHA 3M8JA 4IHWA 4AWXB 3FXQA 1LE8B 4KIGA 5IOZA
chains in the Genus database with same CATH topology
4BU2A 3HXLA 2E60A 3OS2A 2BW3B 2CS3A 4BS9A 2CV1A 5CKTA 1NG6A 5HNHA 3NWSA 3HOSA 4ZDOA 3S3MA 2Q2EB 1QHHD 1V5FA 4BXFA 3OWTA 4F92B 4PJJA 3CF2A 4HEA2 1TT0A 1N78A 4BQNA 2KRCA 4XNFA 3OYIA 2IS6A 4DBQA 3ZR8X 2LY2A 4B47A 2W7NA 2PJRA 3W3CA 3S3OA 2Z1DA 2VXZA 3EUHC 4DOZA 3CZ6A 3BCBA 3K4MA 2X85A 4II2A 2PJRB 4F52A 3DU5A 3IUOA 3HOTA 2KL4A 4IKFA 4IQJA 4HRIA 2LH9A 4BJ5C 4NNJA 2HVQA 4BL0B 1UAAA 2M4GA 4BGDA 3OL4A 4P5OA 3H35A 3I9V2 3DPUA 2F5VA 2VQHA 1VZ0A 4OAYA 2HVSA 3OS1A 1X4PA 3FKJA 3IAM2 4CCMA 3MD2A 4C9YA 1J09A 1WJBA 1W36D 3DPTA 4KISA 2VPLA 3VWBA 1D0XA 2CV0A 4QPOA 3K4NA 2ZXIA 3DEEA 3CESA 2MD0A 5LD2C 4XKVA 2VB6A 1U0JA 2IXSA 4D9JA 1LFPA 4PFPA 3OR2C 2Q1ZB 3V42A 3S8PA 2VASA 4BQOA 3BG6A 4BQQA 4FETA 3SZGA 3VDXA 4BEHA 3DU6A 3EUAA 3IAS2 4ITVA 4J01A 1GLNA 1UELB 4LG3A 1UG0A 2V26A 3ZGKA 3HL2A 2KP6A 2DXIA 4CCLA 2M0MA 4BE1A 4BEHB 3D5LA 2VL8A 1DGRM 1FMVA 3BG7A 2R7XA 3IP4B 2R7VA 2IGMA 2AQFA 2DOAA 4GRIA 4Y4RA 1S9HA 1DGWY 1WJFA 2O5RA 1LVKA 3LFUA 1MMAA 3U21A 1SFKA 1ERDA 3SEQA 1JI8A 2UUZA 4Y33A 3W2WA 4CA0A 3AKZA 3N05A 2R7OA 4PSWA 2LBFB 3A4CA 4HSTA 3OIPA 4P1WA 3DTIA 2V4JC 4RLFA 3DTKA 4Y3OA 2X6XA 4F55A 3C2HA 5LFAA 1WJDA 1BR4A 2DT7B 2LRDA 1X1CA 3PNVA 2LOOA 3K4KA 4PSXA 3DLAA 3DKXA 1D0YA 3LSGA 3OYNA 3OR1C 4BE0A 1Y56A 2XC7A 4OAZA 2X1EA 2CUJA 4U87A 2ZFUA 3L2QA 3OYKA 2R7WA 3PNTA 1TZLA 3DKYA 2CMPA 4N4OB 1WFXA 4NQWB 2VJ4A 2HDWA 4XLEA 3L2RA 2X51A 3PSFA 3DQVC 2QKLB 4QPQA 2W00A 4N4NB 5CQEA 4JQFA 2JVGA 1BR1A 4H4KC 4PK4A 3OYCA 2UV1A 3GBGA 2W4SA 3L2VA 3LSKA 3OYJA 3OL3A 4R79A 5FRMA 2JA2A 1N75A 2KLOA 3FBNB 3HG9A 4RM3A 4XLAA 1MNDA 3CP8A 3H5AA 4F91B 5JHFA 3K4BA 3K6GA 3VYUB 3MKWB 3H0DA 3HUGB 2R4GA 4E7LA 4DBRA 1K6YA 2KPMA 4OWRB 1Z21A 2IGNA 2M7BA 4DJAA 2R7SA 3I3LA 4XL9A 1MNEA 4U7BA 2L7KA 1MW7A 3FBIB 1LKXA 2L5QA 2WY7Q 3RPUD 5KNLA 2ZXHA 2LREA 2RNGA 3BCAA 3D5SC 4XONA 2V6EA 3QYEA 3LSIA 3EPZA 2X6WA 2VQLA 2Z2SB 3H9JA 4NC7A 4HSRA 2IS4A 4MLOA 1V5GA 1LDKB 4PUSA 4J00A 2MABA 4G6TB 5KCMA 3MKYB 3QYFA 4AVZA 2QKMB 3CMMA 4XKBA 2IS1A 1ZELA 1YX3A 2BVMA 4D1QA 3DWLE 4XMYA 3QYBA 1AA7A 4E4HA 1PJRA 3OYHA 3K70C 3CJQB 5FROA 4ZTJA 2MYSA 2XF5A 4PJNA 2MC4A 2X1DA 4XM3A 1T95A 2E5NA 1E0EA 3OYMA 2HU9A 1WJEA 2GOXB 4XKCA 3FDYA 2R7RA 3AL0C 3CJRB 2VJJA 3HC7A 2M7AA 2WADA 2OC6A 3G2BA 4ZDLA 3RQ4A 2A5WA 4XKWA 2WAFA 4X0GA 2XDVA 2HNHA 2JVHA 3VSLA 3PL8A 4E7SA 2LBFA 2XF7A 3UR3C 5FRNA 2VKDA 4XN0A 3UNGC 3K4JA 4PJLA 3TMOA 4BDZA 1X1DA 4FASD 4ZTFA 2VQCA 3QOEA 3A2KA 4B43A 3S32A 3H5NA 2R7UA 1WJ5A 3ONQA 3W2VA 3EUKL 2E1MC 2R7QA 3SDBA 4XOTA 3PJRA 3A1YA 4DIQA 2FUG2 2LYCA 2VKHA 5KHDA 4BDYA 4E7IA 2NOJB 2WB1A 1G8XA 1DQUA 2R7TA 4AU7A 3L2WA 1MMDA 1YX5A 2CFOA 2ZSIB 2X6YA 2CUZA 2KQRA 3DTEA 4E6KG 2KHMA 3H9GA 4ZJZA 3KEYA 4CCOA 3OIQA 3TL4X 5HNFA 2HQAA 4XQFA 2WY8Q 1Z3YA 3RCOA 4XLCA 2KDOA 3OMYA 1D1BA 4EATA 4ZC3A 1OLTA 2KMUA 4CZCA 2UWMA 2WBMA 3AL0B 2VIXA 4CCNA 4XORA 3PSIA 2K3PA 2L9NA 1G59A 2X1CA 4E7ZA 1FMWA 1OR7C 2WA0A 4HPQA 2BOLA 2Y0SA 3BLYA 2HPIA 4XLFA 4XR6A 4NUBA 3RTRA 1WJCA 2L9SA 4B44A 3ZQQA 2IGKA 2LC2A 2E5ZA 4C2TA 2W1OA 4RLQA 1QU3A 2DCEA 3LMMA 4LITA 2PMZA 3OYLA 3KX2A 1Z3XA 3BC8A 1X19A 3VYSB 1Z7LA 3W2AA 2Z16A 4RMNA 3K10A 2HZDA 2ZSHB 1X1BA 4E7JA 4KJZA 3KYLA 3OYGA 2DT6A 3LSHA 3C2GA 2CW7A 2VJ5A 2E1MB 4B3XA 3OY9A 2AQEA 1PYVA 1MMNA 4YEJA 2F4IA 2OV7A 4II3A 3LSMA 1KONA 2WAQA 3OYBA 4AYBA 5CQGA 3TBIA 3E0JB 3K4LA 4KT6A 4DGWB 2A6TA 2K9MA 4CUGA 2V1NA 2M4KA 4HNUA 1Y6IA 3NWTA 4CCKA 1R6RA 4LIUA 4IQ4A 4C30A 3OOUA 3S93A 4BJTA 2XF6A 4CCJA 2V9KA 2ELJA 3ZRGA 4E7HA 4BUPA 2VJIA 3OYEA 1QHGA 4PFOA 4CH7A 3OYFA 1D0ZA 3F9KA 3PFYA 2XSJC 3OS0A 4BE2A 2W82A 1NG7A 1D1CA 1YE9A 2K9LA 3OYAA 1BR2A 3LL7A 4BACA 2JUGA 4PJMA 4B48A 5HVQC 1N77A 2WAEA 1X4OA 4NC8A 4JOMA 4F3QA 4IZZA 3MKZA 1MMGA 1T0FC 4XN3A 3ZXSA 2RREA 5HOOA 3RSNA 4LIVA 2K5CA 2I8DA 3S3NA 2HVRA 3HKZA 2KRHA 4YRVA 2VQGA 5CPRB 2BVLA 4KITB 3H5RA 2GOMA 3VYRB 1DP3A 4HNTA 2CH0A 2M3AA 4XLHA 5HLTA 1SAUA 3PNYA 4XOPA 2V7FA 3QODA 2DJIA 3ZCOA 2OUMA 3K4CA 1P9QC 2RQQA 4HG2A 4YELA 3K70D 4RM2A 5TGTA 3AFHA 1X1AA 2P0WA 1WJAA 4E7KA 3D5RC 2CV2A 3J7AY 1EA3A 2XAUA 1V5EA 3VYTB 2LY1A 3CP2A 3M1CA 3SEZA 3FHNA 2L2OA 4IX7A 1D1AA 2VLAA 3OYDA 1HA8A 3E1SA 1BOBA 2MFZA 2VXDA 3L2UA 4C2UA 3HPGA 4BJ6C 3SYTA 4ZDPA 3VSKA 2IS2A 1IRXA 2IGOA 2JSPA 2KZVA 4F93B 2F6CA 4ZYAA 2LG4A 2CW8A 3H9QA 3DPLC 2HPMA 3HPHA 2BW3A 3M8JA 3PUBA 4CSWA 3MMYB 4ANJA 1W36C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQH A;  2VQL A;  2VQG A; 
#chains in the Genus database with same CATH topology
 1K78 A;  2DOE A;  2FXA A;  2P81 A;  3JRC A;  1MSE C;  1S5L C;  4BS9 A;  1HF0 A;  3NWS A;  2FOK A;  4NC6 A;  4RA2 A;  1K78 B;  3L1P A;  3E6B A;  4YII A;  3S3M A;  3W6V A;  2YX7 A;  1GVJ A;  3P9C A;  2D45 A;  4KDP A;  4HEA 2;  1Y0N A;  2KRC A;  5KAI C;  3OSG A;  1A6Q A;  4OIN F;  3HKZ N;  4DBQ A;  3LST A;  5K7F A;  1I50 J;  2JA5 J;  3L7W A;  1XMX A;  3CO7 C;  2DBB A;  3FXK A;  4KIB A;  2W7N A;  3S3O A;  1ENH A;  2DLL A;  1VQM I;  2HR3 A;  4DOZ A;  4M3E A;  4U88 A;  3RPQ A;  3K4M A;  2ZJQ F;  1O4X A;  1OIS A;  4II2 A;  4GDF A;  2GXG A;  4F52 A;  2JMW A;  2RAE A;  2KL4 A;  2K40 A;  4HRI A;  4I02 A;  3F8M A;  3ZMV A;  2P6T A;  1Y39 A;  4BL0 B;  2CUE A;  2M4G A;  1R4N B;  3OL4 A;  2GAU A;  4ANJ A;  2NS8 A;  1QNT A;  1UCR A;  2E36 A;  2ZNY A;  5HLH A;  1JUP A;  2P5V A;  2ZC2 A;  1D8K A;  1YLF A;  3OS1 A;  1HW2 A;  5D6E A;  4HDV A;  3IKT A;  2HYJ A;  1W36 D;  3DPT A;  2IP2 A;  3ASO H;  2DA3 A;  2CV0 A;  4NB5 A;  3MCZ A;  1D5V A;  5K5Q A;  1U0J A;  4D9J A;  1LFP A;  3GEZ A;  3OR2 C;  2GWR A;  3PM1 A;  3SZG A;  3DU6 A;  1MJB A;  2Y0M A;  1I3Q J;  1OYW A;  2V26 A;  2M8G X;  1ZAO A;  2KP6 A;  1BJZ A;  1IN4 A;  5AIQ A;  2M0M A;  4ZZL A;  4S05 A;  3GO5 A;  2CG4 A;  3Q5F A;  2STW A;  4OIO F;  1DGR M;  1FMV A;  3KEO A;  1K79 A;  3PO3 J;  2QSH X;  2AQF A;  3DEU A;  2H1K A;  2AO9 A;  3G1L A;  2YS9 A;  1Y1W J;  4NHJ A;  4GO1 A;  2X9D A;  1LVK A;  4UUV A;  1ERD A;  4ZYD A;  1TC3 C;  2FBK A;  1X3Z B;  3F8N A;  4Y33 A;  3W2W A;  2R7O A;  2LBF B;  4EQQ A;  2RN7 A;  3WGI A;  4RBO A;  1R00 A;  1FZP B;  3O2P E;  2CWE A;  3DXJ F;  2PMH A;  1R1V A;  5IT9 K;  4UUT A;  1KQ0 A;  3DTI A;  4RLF A;  3DTK A;  4Y3O A;  3FM5 A;  3PIO F;  1HOM A;  3IC7 A;  1BR4 A;  2P8T A;  1HDP A;  1SAN A;  1REP C;  4M74 A;  3ZQL A;  3ZMT A;  5FFX A;  4PSX A;  1Y8Q B;  2VC0 A;  2KIS A;  3M3Y J;  3E6M A;  2RQP A;  4UY8 I;  2MD5 A;  4TV7 A;  1TWA J;  1XN7 A;  5B1A H;  2XC7 A;  2DQR A;  5D4S A;  3U9G A;  4MQV A;  4UB8 C;  1JKQ C;  1ZLK A;  2R7W A;  4MTE A;  2GIV A;  2O6G E;  4L5E A;  1TZL A;  2M87 A;  2FMY A;  4N4O B;  1MZB A;  2VJ4 A;  5E3N A;  1UHM A;  3L2R A;  2X51 A;  3DQV C;  1MSF C;  3CF5 F;  3BG3 A;  4A3C J;  1KU2 A;  2QF7 A;  3LSP A;  3I55 I;  1ON2 A;  4N4N B;  1SC7 A;  2XAH A;  4PK4 A;  5J6X A;  2DA4 A;  3HTS B;  5E3O A;  4FX4 A;  1I39 A;  2CQ7 A;  2XAJ A;  4OU0 A;  2R5Z A;  2NOG A;  1KZH A;  2BHY A;  3WTY C;  1WPK A;  4RM3 A;  2KLO A;  4XLA A;  1FYL A;  2PLY A;  2VBZ A;  3MZ8 A;  3I0T A;  2QEX I;  3H5A A;  4F91 B;  2XV4 S;  4CZZ A;  3F8F A;  5KK1 A;  3WTV C;  2R5Z B;  3K6G A;  3VYU B;  4IHY A;  3I54 A;  5GPA A;  2TCT A;  3HSF A;  4LD5 A;  2EV6 A;  2DFF A;  1Q1V A;  4DBR A;  1G6N A;  4Q4Z F;  1WI3 A;  3FMR A;  5FKK A;  2KPM A;  1MDM A;  1YYV A;  1OYI A;  4ASN A;  3GTP J;  4ENK A;  4UVB A;  2ISZ A;  2LKS A;  2VKE A;  1UB9 A;  3I3L A;  4G6Q A;  4XL9 A;  5BOX A;  2P7V B;  4U7B A;  3AG4 H;  2DPU A;  2D2W A;  1LKX A;  2WY7 Q;  4FIS A;  5KNL A;  4XON A;  2WTE A;  3RZO J;  5TIS C;  3BQZ A;  1JHH A;  2R7F A;  2V6E A;  1FNN A;  2CQK A;  4A12 A;  2NVX J;  3WTX C;  3EPZ A;  3CCV I;  2VQL A;  2XVC A;  3BG9 A;  3QRF F;  5J3L A;  2R5Y B;  3RIR A;  4M3G A;  5IT3 A;  3J81 K;  2M2E A;  1LDK B;  1XD7 A;  4OMY A;  4PUS A;  2CQQ A;  1JUM A;  2OPT A;  4WK8 F;  5KCM A;  3QYF A;  2QKM B;  1X1P A;  3CMM A;  3WU2 C;  2IS1 A;  2G0E A;  2BVM A;  5DEQ A;  4D1Q A;  1KGS A;  1AA7 A;  1S29 A;  1T56 A;  1IDY A;  5FRO A;  2MYS A;  2XF5 A;  1ZQ3 P;  3WTW C;  3E5X A;  3I4M J;  5D4R A;  4XM3 A;  2HU9 A;  2GZW A;  4L9J A;  2EFN A;  3SZP A;  1WJE A;  2GOX B;  2R7R A;  3F21 A;  3R0J A;  5FKN A;  3WHC A;  3GFI A;  1MJ9 A;  1E2X A;  2KFD A;  4W1U A;  1RRJ A;  2V9V A;  4ZDL A;  4UVC A;  2HS5 A;  4XSZ F;  2KJB A;  3RQ4 A;  2Q0O A;  1S7E A;  3F3X A;  4X0G A;  3G1M A;  3FXR A;  3VSL A;  3PL8 A;  2MC3 A;  5LHG A;  2CJJ A;  3B6A A;  1J75 A;  2XF7 A;  5B3S H;  4S04 A;  4KNY A;  5FRN A;  4HDU A;  1SFX A;  4ESJ A;  4GYG A;  4F7Z A;  3ECH A;  1QO0 D;  4PJL A;  4KN4 X;  3T0Y A;  1YI2 I;  4HX8 A;  4B43 A;  2ME6 A;  2YSR A;  3S32 A;  1IO2 A;  3GZN B;  3VFZ A;  2F48 A;  4HNV A;  2QCO A;  3ONQ A;  3W2V A;  3KLN A;  2E1M C;  5C4X J;  1ITY A;  4XOT A;  2BY3 A;  3A1Y A;  2K4B A;  4JK1 X;  2UXN A;  2EJR A;  1U8B A;  1G8X A;  1DQU A;  1YS7 A;  3S1Q J;  1IUY A;  3L2W A;  5BPI A;  5EEA A;  2DPD A;  4XID A;  2CFO A;  2ZSI B;  2KIQ A;  3BR1 A;  3G73 A;  2CUZ A;  2KQR A;  1FBQ A;  3H9G A;  2L01 A;  1Y1V J;  2HQA A;  4A3D J;  1U2W A;  1SAX A;  4XQF A;  3RCO A;  1Z3Y A;  5E1X A;  2A68 F;  1KU3 A;  4FQG A;  2VOO A;  2M45 A;  1WQ2 A;  3T8T A;  1OLT A;  2A6E F;  4CZC A;  2UWM A;  3RYR A;  3MFK A;  4FE4 A;  4ON0 A;  1PP7 U;  1SVO A;  4A3I J;  3GZ5 A;  4HAM A;  1LJ9 A;  3A01 A;  3JR9 A;  2PMU A;  4RAF A;  4C3J J;  1ACI A;  3A01 B;  1H89 C;  3HUG A;  2KIM A;  4KMF A;  1V4R A;  1SMY F;  1WJC A;  1VQP I;  4B44 A;  4A3L J;  3S2H J;  3BT9 A;  1QU3 A;  1D3Y A;  3GWZ A;  1FT9 A;  1F1Z A;  1Z3X A;  3RZD J;  1AKH B;  1YQA A;  2Z16 A;  4RMN A;  3I53 A;  3K10 A;  2Z9O A;  5DUI A;  2WV0 A;  4WXH A;  2RKH A;  1X1B A;  3KE2 A;  3HOW J;  2AXT C;  4UUS A;  2DT6 A;  3C2G A;  2NXN B;  4AVP A;  5LRS A;  2E1M B;  4B3X A;  3Q0V A;  2BBY A;  4C3H J;  5GTH C;  2F4I A;  4II3 A;  4G8X A;  5HLG A;  1YG2 A;  1MKM A;  4Y17 A;  5BNG A;  4M6Y A;  1XMA A;  2QBY A;  2VT2 A;  3ZPL A;  4DGW B;  3E6D A;  2N8G A;  2V1N A;  2M4K A;  5IYD J;  2QQ8 A;  1YJN I;  1F5T A;  2LR8 A;  2Y69 H;  2J5O A;  2PX9 A;  1ULY A;  1MIJ A;  1UMQ A;  4IQ4 A;  3CCS I;  4YFX F;  3F0C A;  2O0Y A;  2EIL H;  2XF6 A;  5F6F A;  1XX5 A;  5E17 F;  3K1N A;  1WZ2 A;  1R22 A;  4FTH A;  1IW7 F;  3U1K A;  2EWN A;  1EF4 A;  3FZV A;  3OYE A;  1ETK A;  5F0F A;  2W85 A;  1RPW A;  4PFO A;  5D5W B;  5DUK A;  1D0Z A;  1GVD A;  2BYV E;  2KT0 A;  4BE2 A;  2NRA C;  3CC4 I;  4G7O F;  3TO7 A;  1ZG1 A;  2XGD A;  4A3B J;  5F1R A;  3MZY A;  1YE9 A;  2ID3 A;  1LQ1 A;  2K9L A;  2E34 A;  3BJA A;  3KYC B;  2V1D A;  2Y0S N;  1OFC X;  3QP5 A;  4JOM A;  1BIB A;  1R4M B;  2JRT A;  2DK8 A;  2DQL A;  3VOD A;  3GFJ A;  4XN3 A;  1R71 A;  5J47 A;  4KYW A;  2VN2 A;  4BY1 J;  2DMP A;  3JAM Z;  4RB0 A;  2HVR A;  2CW0 F;  3QP6 A;  3ASN H;  3PIP F;  4KIT B;  2GOM A;  3K9T A;  1LVA A;  2R3S A;  3ESW B;  2M3A A;  4OIQ F;  5HLT A;  1O7L A;  3OSF A;  3QPS A;  2M0C A;  3V7R A;  1VQ5 I;  2ZNZ A;  4RGX A;  2DJI A;  3QU6 A;  1KU9 A;  2MGQ A;  4HG2 A;  4MFD A;  3RYP A;  4LB5 A;  3IH3 A;  5CVR A;  5CVI A;  1X1A A;  3M8E A;  4AYB N;  2P0W A;  5IP7 J;  2L7M P;  4E7K A;  2B0L A;  4IVN A;  1STZ A;  3MVP A;  5EGO A;  1CGP A;  4DYR A;  3FHN A;  4BXU A;  4JBA A;  2DN0 A;  4EM2 A;  1D1A A;  2ISY A;  3KZI C;  1HA8 A;  1DP7 P;  3E1S A;  1HQC A;  2VXD A;  3L2U A;  3HPG A;  5D5X B;  3P5J A;  1IRX A;  2IGO A;  4JP0 A;  2P5L C;  1WWX A;  2MW8 A;  3HHG A;  1EJ9 A;  2KZV A;  2F5F A;  4XLN F;  2CSO A;  1RKT A;  2CW8 A;  1EH8 A;  1TL8 A;  2L02 A;  2MH2 A;  2BW3 A;  1BJA A;  4WWC A;  4HLY A;  2B9S A;  4LJZ F;  1K4S A;  1W36 C;  3V4G A;  4XRF A;  4BU2 A;  2E60 A;  2HQ5 A;  4YFN F;  5FB2 A;  2CU7 A;  1V55 H;  3CLQ A;  3QOP A;  2QYO A;  3OS2 A;  1VQL I;  2BW3 B;  2Q2E A;  2CV1 A;  3GVA A;  2DDA A;  1A35 A;  3T8R A;  3RDI A;  2F4O B;  2Q2E B;  1TQP A;  4Q48 A;  1FOK A;  1RC9 A;  4BXF A;  1DDN A;  2NYX A;  4PJJ A;  1OMI A;  3CMY A;  4Y13 A;  1GT0 C;  2TRT A;  3TW7 A;  1AHD P;  1N78 A;  3OYI A;  2L7F P;  3VOE A;  1SVM A;  2X48 A;  2IA2 A;  1FYK A;  3S14 J;  2BY0 A;  2M1B A;  4ZYH A;  5ILS A;  5FLX K;  5TJJ A;  3E6C C;  4HLX A;  1NK3 P;  3CCU I;  1TP4 A;  2J5P A;  2FJ1 A;  1CQT A;  4UXN A;  2HYG D;  3RPU A;  2V79 A;  2XRL A;  5JR3 A;  4M71 A;  4Z2Y A;  2KRF A;  4IQJ A;  3TO6 A;  5IP6 A;  2LH9 A;  1SD6 A;  4NNJ A;  5LLQ A;  2H09 A;  2LK2 A;  1UAA A;  4I2O A;  2EB7 A;  2QLZ A;  3LNQ A;  3H35 A;  3I9V 2;  1JGS A;  1ZYR F;  3DPU A;  3G3Z A;  1JKP C;  5DM6 F;  2A5Y B;  2VQH A;  4OAY A;  4CDG A;  1J2X A;  5H2F C;  3MD2 A;  2RV8 A;  4HX4 A;  1WJB A;  1FOW A;  1D0X A;  2G7U A;  1AU7 A;  3K4N A;  1SVL A;  4UB6 C;  5LD2 C;  1KA8 A;  4XKV A;  2VB6 A;  3GLL A;  5IT9 Z;  3EYI A;  2AHQ A;  3JRF A;  1R5H A;  2X6O A;  1MJA A;  2VAS A;  4BQQ A;  3VDX A;  4BEH A;  4I0B A;  3RJP A;  3IAS 2;  1KQ9 A;  1G3W A;  1UG0 A;  4LG3 A;  3RKY A;  2B63 J;  2CFX A;  2NVY J;  4L0Y B;  3K1P A;  3LQR A;  2DXI A;  2F2E A;  1ETY A;  4CCL A;  1JUS A;  1I5Z A;  4BEH B;  4LGW A;  2VL8 A;  5HLI A;  2D5V A;  3HB9 A;  3JTH A;  2A6H F;  2I5U A;  1B72 A;  2KJC A;  4GRI A;  2FX0 A;  2OCE A;  4P55 A;  1WJF A;  2O5R A;  4LG0 B;  3U21 A;  1H9G A;  4BKX A;  3F8B A;  2ECC A;  4UHT A;  1LFB A;  4Y52 J;  4PSW A;  1BI1 A;  3A4C A;  1FYM A;  3WTU C;  3OIP A;  2HOT A;  3TOB A;  1QQI A;  3SJM A;  1LB2 A;  2L3D A;  4P1W A;  2UZK A;  2V4J C;  2JT1 A;  2CYY A;  2DT7 B;  2LRD A;  2IJL A;  1LEB A;  2LFB A;  2LOO A;  3I4P A;  2K86 A;  2ZCW A;  1YRN A;  4A3K J;  1YFH A;  2JWT A;  3S17 J;  1F4K A;  2FNP A;  1JHF A;  2IRF G;  3SZT A;  3OYN A;  3KP3 A;  1LE8 A;  3GTO J;  2LDU A;  3MWM A;  1YRN B;  4DQ2 A;  3OV8 A;  2EV5 A;  2M9H A;  1RZ4 A;  3NAR A;  2EZL A;  1MD0 A;  2ZFU A;  1RI7 A;  3OYK A;  5D5V B;  5B5E C;  1H9T A;  2CMP A;  2LMD A;  2H94 A;  5HOD A;  2DAO A;  1T98 A;  4XLE A;  3WE2 A;  3OOP A;  2EV0 A;  3PSF A;  2QKL B;  1P6R A;  5L3G A;  2DYR H;  3S15 J;  2W00 A;  4CIC A;  1TT5 B;  4HF0 A;  2R93 J;  4WXD A;  2JVG A;  1U78 A;  4P9U A;  4AIK A;  1BR1 A;  4H4K C;  2E2I J;  4A93 J;  1TTY A;  4J19 A;  2UV1 A;  5K1Y A;  2W4S A;  3KP6 A;  5EZG A;  2DA2 A;  4I6Z A;  5GPC A;  3J80 K;  3ISP A;  1GXQ A;  1VQO I;  2JA2 A;  2EFQ A;  4Y7N J;  2ICW G;  1AOY A;  1B9M A;  1HLV A;  4D5C A;  5FJ8 J;  4Z6Y A;  4WCG A;  1T39 A;  1HKT A;  5ED4 A;  2ZKZ A;  2Y75 A;  4AD9 A;  5HS8 A;  1IZ1 A;  2FNA A;  4A3M J;  2BEO A;  3MKW B;  3O6B B;  2R4G A;  5IYC J;  1K6Y A;  1H8A C;  2YUS A;  4JYK A;  2E7W A;  1D8J A;  2O7O A;  2M7B A;  3BTC A;  1MNE A;  1TQM A;  1PP8 F;  2L7K A;  1R36 A;  1VF9 A;  4AC0 A;  1FTT A;  3RPU D;  3V8K A;  3SFZ A;  2QM3 A;  2ZXH A;  3ZQH A;  2LRE A;  3EDP A;  5EEG A;  2FRH A;  1F43 A;  3K7A J;  2X6W A;  2EBI A;  4Y15 A;  4HSR A;  1P7I A;  2L4M A;  1R49 A;  4J00 A;  1GDT A;  1ZGW A;  1XCV A;  2MAB A;  4G6T B;  2VON A;  3MKY B;  3JRG A;  1YX3 A;  4FHT A;  2HZT A;  4XRS G;  3JTG A;  2Z33 A;  4XMY A;  3LOC A;  4A0Y A;  1WRJ A;  3QYB A;  2XHK A;  3OYH A;  1BBY A;  3CMA I;  3KLO A;  4ZTJ A;  1J5Y A;  1P92 A;  4PJN A;  1BIA A;  2VE9 A;  1VQ8 I;  3JRD A;  3DBH B;  3BG5 A;  1ZAR A;  3GFM A;  3QPT A;  4BHP A;  2HGC A;  2P6S A;  2HTJ A;  4XKC A;  3R4K A;  2DA6 A;  3H3Z A;  2G7H A;  1FIA A;  2VJJ A;  2CQX A;  1OCZ H;  3TDU C;  2OC6 A;  3M4O J;  3G2B A;  3VB2 A;  5JI6 A;  1C0W A;  2RGV A;  5BMZ A;  3BR3 A;  2BV6 A;  2DDB A;  2A5W A;  2HNH A;  4E7S A;  1VFC A;  1MBE A;  2LBF A;  3HYI A;  3W6K B;  4N9H A;  3F6O A;  1K7A A;  1WKM A;  3UR3 C;  2XGE A;  1U9N A;  2VKD A;  4L5I A;  4XN0 A;  3K4J A;  4BXX J;  3FXU A;  4EVI A;  2FF4 A;  4BDZ A;  3I64 A;  4MNU A;  1QRY A;  1LFU P;  1IF1 A;  3QOE A;  2HXI A;  2MA3 A;  3HOX J;  4U0V A;  2R7U A;  1WJ5 A;  3ULQ B;  4EGY A;  3CCM I;  4QTR A;  3T5X A;  2D1V A;  2Z5U A;  3HOY J;  5KHD A;  1ON1 A;  1FBS A;  4LOC A;  2WB1 A;  3WGH A;  2FOW A;  4AU7 A;  2VOD A;  2WC2 A;  2GBY A;  1WHU A;  4BHC A;  3BJ6 A;  4DW6 A;  1I3A A;  2BGC A;  3KP5 A;  1JE8 A;  3CUO A;  3CO6 C;  1R9T J;  2X6Y A;  4E6K G;  4CGZ A;  2Z99 A;  4OOI A;  2KHM A;  4XK4 A;  1RUN A;  1UG2 A;  2VUM J;  3OIQ A;  3TL4 X;  2FD5 A;  4DYQ A;  2LTP A;  4CYD A;  4H0E A;  4U0W A;  2WY8 Q;  3E5U A;  2AXL A;  3VPR A;  3ABT A;  4EAT A;  4ZC3 A;  5DD4 A;  5FKM A;  1H88 C;  1VQ7 I;  3RKW A;  2NVQ J;  2RNJ A;  2STT A;  1FSE A;  3D1N I;  3ZQI A;  1OYY A;  4CCN A;  4XOR A;  3QWL A;  1G59 A;  1Q1H A;  4OIP F;  2E1C A;  2X1C A;  2ZO4 A;  2CO5 A;  4KT5 C;  1FMW A;  5F08 A;  1CF7 A;  2COB A;  2BOL A;  3KZZ A;  1VQ4 I;  4XR6 A;  4G9Y A;  1E3P A;  1BOA A;  1X3U A;  2IGK A;  3E7L A;  1ZH5 A;  2E5Z A;  1CF7 B;  4ENM A;  4RLQ A;  5GP9 A;  1MBK A;  3TP3 A;  1R1U A;  2PMZ A;  4NDL A;  2JPB A;  3OYL A;  1UFM A;  1SEU A;  3W2A A;  2XB5 A;  5E8G A;  1EKE A;  1R58 A;  2ZSH B;  4XSX F;  2C6Y A;  1B1B A;  3DKW A;  1A6I A;  1PUF B;  2QGU A;  1BW5 A;  9ANT A;  1QGP A;  4GXO A;  2R5Y A;  3OY9 A;  4NBQ A;  1G4D A;  1K61 A;  5D8L B;  1BW6 A;  1PYV A;  1YOV B;  2BY1 A;  3L2C A;  1XS9 A;  1MMN A;  2W24 A;  3CQZ J;  5F0C A;  3GUD A;  5IY5 H;  3LSM A;  3H1C A;  1Z05 A;  1S3J A;  2WAQ A;  3OYB A;  5CQG A;  3TBI A;  3E0J B;  1ETX A;  1WH5 A;  4GYI A;  5EJC A;  2LF7 A;  1OKR A;  3P9I A;  2K9Q A;  3LSR A;  2HFH A;  2A6T A;  1KQ8 A;  2L4A A;  4CUG A;  4M9Z A;  2E1O A;  2VOP A;  1R6R A;  2QSG X;  2LVS A;  4LIU A;  3M1E A;  1FWZ A;  2IAI A;  3OOU A;  1QZY A;  3S93 A;  2EQR A;  1BN5 A;  3Q0U A;  1YIO A;  2V9K A;  1A5J A;  2QQB A;  1HKS A;  3ZRG A;  4A3J J;  1FTZ A;  2QQ9 A;  5F04 A;  4HA8 A;  1QHG A;  4XRM A;  4IRI A;  5LBQ A;  1ZRE A;  1YTY A;  4HF1 A;  2JUC A;  2DU9 A;  1E17 A;  1RR8 C;  3OYA A;  3LL7 A;  1TW3 A;  4BAC A;  1FIP A;  2JUG A;  4B48 A;  2WAE A;  4PJ0 C;  2ZXW H;  2K7L A;  4NC8 A;  2Q8K A;  4IZZ A;  1LEA A;  2BZT A;  5FKO A;  1MMG A;  4G7Z F;  2HYF A;  1OQY A;  3V7C A;  5F64 A;  2ZME C;  1ETV A;  2RRE A;  2X0L A;  1W5C C;  4HV6 A;  3IL2 A;  1G3T A;  2K5C A;  2I8D A;  5J4Y A;  2GA2 A;  1VQ6 I;  2ECB A;  2V9P A;  3HKZ A;  4MO7 A;  3ZMS A;  4XIC A;  2KRH A;  5CPR B;  2PBI A;  2BVL A;  3IHU A;  2Y9Z A;  5J1U A;  2DTZ A;  3F23 A;  2EA2 A;  3PNY A;  1U6G A;  1RUO A;  3ZCO A;  3BZC A;  2RQQ A;  4YEL A;  3HGG A;  3TOA A;  1H0M A;  3FKI J;  5ICC A;  2Y2Z A;  3D5R C;  4B4C A;  2DMN A;  2JZY A;  4HV5 A;  2CV2 A;  1IRF A;  3VYT B;  1ZGA A;  2NAZ A;  2OQG A;  4MEY F;  4ETS A;  4IX7 A;  1IJW C;  2VLA A;  4HF2 A;  3IV5 A;  4G12 A;  3O3K A;  3LFK A;  5FD6 A;  4BBR J;  4IJA A;  1R5G A;  4BJ6 C;  2JSP A;  2VBX A;  3K0L A;  4V19 K;  1OCT C;  3F72 A;  5FLX Z;  4X6A J;  4F93 B;  1NH3 A;  1TNT A;  1HC8 A;  2P5K A;  2QZ8 A;  1IN7 A;  3VEP A;  3H3U A;  4HW0 A;  2HPM A;  5C44 J;  3PUB A;  5FLM J;  4CSW A;  1AKH A;  2VPR A;  4KFC A;  3HXL A;  3E3V A;  4X1E A;  2CS3 A;  2XUB A;  3IRQ A;  5CKT A;  3ZN0 A;  2XIG A;  3I56 I;  2DA1 A;  2ZME B;  5HNH A;  5CVU A;  2HEO A;  3HOS A;  4ZDO A;  3KP2 A;  4LFU A;  1XGM A;  1WGX A;  1I6H J;  4P96 A;  1V5F A;  2BXZ A;  3ZMU A;  1O3S A;  4F92 B;  2EZI A;  4M3D A;  5CYV A;  1Z7U A;  3CF2 A;  1XPX A;  3G1O A;  4A0Z A;  4CYC B;  5LGN A;  4LK0 F;  4RB1 A;  1HKQ A;  1ZN2 A;  2X4H A;  3C2B A;  5DS9 A;  3AAF A;  2QA4 I;  2LY2 A;  5DV5 A;  4B47 A;  1G3S A;  1FX7 A;  2ETH A;  1W0T A;  1ETO A;  1XSD A;  2VXZ A;  2O8K A;  3EUH C;  1U9O A;  3CZ6 A;  1S7O A;  2F4M B;  3BCB A;  1BC8 C;  2CQN A;  1L3L A;  3JW4 A;  5HS9 A;  2DJN A;  2Y31 A;  3IUO A;  2MLG A;  1X2M A;  2QQA A;  4KIF A;  1UJ8 A;  3GFL A;  2XPU A;  2HVQ A;  4RB2 C;  4BGD A;  4BY7 J;  1QPM A;  1KYZ A;  3KIO A;  2IEK A;  2EIM H;  2GQQ A;  3IWF A;  1MNM C;  2KDZ A;  2XAS A;  4XBF A;  1YIJ I;  1VZ0 A;  2IA0 A;  1ZGJ A;  3FKJ A;  1K6O A;  1QZZ A;  5CVV A;  4CCM A;  4C9Y A;  1HSJ A;  1XG1 A;  1SMT A;  1GHC A;  5IP9 J;  3VWB A;  3BP8 A;  1XSV A;  1JXS A;  2ZXI A;  1G2H A;  1T33 A;  2IXS A;  3S2D J;  2Q1Z B;  3WGG A;  2XPW A;  4HBL A;  4BQO A;  3R6S A;  2CGP A;  3EUA A;  4ITV A;  4J01 A;  1IV6 A;  5ICG A;  1GLN A;  3WTT C;  4M3F A;  3ZGK A;  3HL2 A;  2CRG A;  2HKX A;  4B1R A;  4EV0 A;  4PZJ A;  4G6D A;  3KZY A;  1B4A A;  5A2Q K;  3K2Z A;  5ICF A;  3D5L A;  3BG7 A;  2R7X A;  3IP4 B;  3U2R A;  4D5F A;  2H6B A;  2R7V A;  3B6C A;  2IGM A;  2R0Q C;  1JT0 A;  3GTM J;  3DCF A;  3EUH A;  4Y4R A;  4OMZ A;  1S9H A;  1P2F A;  5EG0 A;  1DGW Y;  3LFU A;  1MMA A;  1VQ9 I;  1SFK A;  3SEQ A;  1JI8 A;  4AUX A;  3N05 A;  1WVR A;  1OPC A;  1IXR C;  4HZF A;  5HS7 A;  5EG0 B;  4B3A A;  1IRZ A;  4HST A;  1DPR A;  3MEX A;  4A6D A;  2JSC A;  1VTN C;  3DFG A;  3IRR A;  2JA8 J;  3BTL A;  1B9N A;  3V8J A;  1A36 A;  5IOY A;  3TP0 A;  5LFA A;  5FFZ A;  1X1C A;  1XB4 A;  4MIM A;  4KN7 X;  2VC1 A;  1PUE E;  1BI0 A;  1U5T C;  2ZJR F;  5IPA A;  5GAH J;  3DKX A;  3J7Y J;  3HRM A;  3CJT B;  3CTA A;  2A61 A;  2EA4 A;  3RI4 A;  1J59 A;  1ZRD A;  2LY9 A;  5C4J J;  2K9N A;  3FXM A;  3FXL A;  4UV9 A;  4U87 A;  2YX4 A;  3KP7 A;  4D0P A;  2EZK A;  1HST A;  4QWQ A;  4KIC A;  2FBH A;  1U3E M;  5GAE J;  2HDW A;  3WOD F;  4YFK F;  2OCC H;  2DFH A;  3C3W A;  4UNO A;  1YW7 A;  3JRI A;  4QPQ A;  4L5J A;  3SXY A;  2KIF A;  4JQF A;  3N97 A;  2MG4 A;  4DYC A;  1WI9 A;  3OYC A;  2VI6 A;  3GBG A;  3L2V A;  4LMY A;  4UV8 A;  3OYJ A;  2ME0 A;  2PG4 A;  4R79 A;  5FRM A;  1N75 A;  1NHA A;  3HG9 A;  4HOB A;  4IRG A;  4MTD A;  1OCO H;  1WSU A;  3CP8 A;  5JHF A;  3K4B A;  4ESB A;  1FY7 A;  5FD5 A;  4Q5S F;  4A69 C;  4E7L A;  1Z91 A;  3ML6 A;  1LPQ A;  3AG2 H;  4BHB A;  1B8I B;  5CVJ A;  1VQK I;  3B73 A;  3DP7 A;  1YIT I;  1Z21 A;  2LKP A;  1UST A;  4IPA A;  3HRU A;  1U5T A;  2HQN A;  3DV8 A;  4A3F J;  2KIU A;  3LWF A;  1IUF A;  3CLO A;  5CJ9 A;  3BCA A;  1APL C;  4C2M J;  1T2K A;  3IH2 A;  2HI3 A;  1T6S A;  1U5T B;  3QYE A;  1ZLJ A;  3LSI A;  1A04 A;  1XGN A;  1J7K A;  1RNL A;  4JX5 A;  2IS4 A;  4MLO A;  1OCR H;  1BM9 A;  1V5G A;  5M5Y J;  4M6V A;  2OF7 A;  3S1R J;  1ZHF A;  4AVZ A;  4CHU A;  1ZEL A;  3BR2 A;  4A5M A;  1I6X A;  4L9N A;  4E4H A;  1PJR A;  3K70 C;  3CJQ B;  2MC4 A;  2X1D A;  3C18 A;  2IW5 A;  2E5N A;  1SFE A;  2PI0 A;  4JX4 A;  3AL0 C;  4YIF A;  1WCM J;  1RIO H;  1EH7 A;  2HOE A;  2M7A A;  2WAD A;  3RKQ A;  1ZTR A;  1QVU A;  3H0G J;  1O3R A;  4LG0 A;  2GLO A;  2DO7 A;  1W7P B;  4KA4 A;  4BBS J;  3CDL A;  4XKW A;  2WAF A;  2XDV A;  1HXD A;  4ZZD A;  1P4X A;  1ONV A;  4I98 B;  1LNW A;  2FU4 A;  5HDN A;  5LEJ A;  2H27 A;  4PCQ A;  5BPD A;  3M8F A;  3CDH A;  5F0H A;  3BR0 A;  3SHF A;  3GYH X;  3JRA A;  3I59 B;  3TMO A;  1T38 A;  2NVU B;  3HEF A;  4FAS D;  1F9N A;  3A2K A;  2Y30 A;  3LA3 A;  3A02 A;  3H5N A;  2QSF X;  2XB0 X;  3NAU A;  1B6A A;  1VI0 A;  4KUM A;  4O5V A;  3EUK L;  1YS6 A;  2E71 A;  2XPV A;  2HQR A;  3SDB A;  4U7D A;  2OTL I;  3Q3S A;  3PJR A;  4AIJ A;  1JGG A;  3HM5 A;  4DIQ A;  1ODD A;  3WU0 A;  5JFR A;  2DMQ A;  4BDY A;  3ZQ7 A;  4E7I A;  2ZFW A;  2HKO A;  1MBF A;  3W6J B;  3BJO A;  1YX5 A;  4EJV A;  4U0Y A;  4FCY A;  2OZ6 A;  3ZQC A;  2LSO A;  3I58 A;  2WAQ N;  5B1B H;  3E97 A;  5HNF A;  2K9S A;  2CUF A;  3SQN A;  1GV2 A;  4R1H A;  5E3M A;  4MQ9 F;  2LF8 A;  4K2E A;  2EPF A;  4EGZ A;  1YJW I;  4XLC A;  1D1B A;  1BI2 A;  5LEK A;  4I76 A;  1A31 A;  2KMU A;  1WH7 A;  1LDJ A;  1TWC J;  2R7D A;  3WE3 A;  5DDG A;  5BS6 A;  1Y0U A;  3JAM K;  2RDP A;  3MAJ A;  3KYD B;  3AL0 B;  3ERM A;  2DMT A;  3PSI A;  3V8L A;  3Q9V A;  1ORK A;  5C3E J;  4LK1 F;  3H3V K;  2XKP A;  1I1S A;  1F36 A;  1OR7 C;  3PFI A;  4A3G J;  3J81 Z;  2WA0 A;  4HPQ A;  3FWE A;  4GFB A;  2Y0S A;  3BLY A;  2OU2 A;  4NUB A;  3CCY A;  1S72 I;  1YHQ I;  2HWV A;  2LC2 A;  1DU6 A;  3JSO A;  4RGS A;  3FIS A;  1TLH B;  3ZOB A;  2W1O A;  3ABM H;  2DCE A;  2DFI A;  2GXA A;  3HTU A;  1Z9C A;  3BC8 A;  4BH9 A;  2KZG A;  2R7Z J;  1Z7L A;  1FBU A;  3A0B C;  2LKX A;  3FXJ A;  5J1Y A;  2DW4 A;  2V1U A;  4EJO A;  4HQE A;  4E7J A;  2HTS A;  2L0K A;  2QVO A;  3OYG A;  3BZK A;  1IRG A;  1B59 A;  2CW7 A;  2XAF A;  1POG A;  2E7X A;  3FXO A;  3FHZ A;  1O57 A;  3TDZ C;  1MH4 A;  1W0U A;  1XTA A;  1Z77 A;  2VBW A;  3E5Q A;  1XC5 A;  4N9I A;  4YEJ A;  4EMS A;  1YJ9 I;  2EZH A;  1Z67 A;  4ZYG A;  1BL0 A;  4AYB A;  4W97 A;  2XSD C;  3K4L A;  2DOD A;  4GCV A;  1HDD C;  1IN5 A;  3HSR A;  3J7Z I;  2K9M A;  3MQ0 A;  4BQA A;  3ABU A;  1R7J A;  1XGS A;  4HNU A;  2G9W A;  4A6E A;  1Y6I A;  2IT0 A;  1FJL A;  1MBJ A;  2OD5 A;  3GXO A;  1TWH J;  2VT3 A;  4CCJ A;  2COM A;  1OR7 A;  5E8I A;  3LAJ A;  1L0O C;  3HJE A;  2M8E A;  2P4W A;  4BUP A;  5FLV A;  4EJW A;  1FOX A;  1XMK A;  2XRN A;  5EDN A;  3MZH A;  4CH7 A;  3OYF A;  1W5T A;  1W7P D;  1JT6 A;  1XGO A;  3F9K A;  3OS0 A;  3M9A A;  2W82 A;  3B02 A;  3CJN A;  1ETW A;  3M07 A;  1NG7 A;  4ABZ A;  1UHW A;  1K4T A;  1Z6R A;  1X58 A;  2O03 A;  1IXC A;  2A05 A;  2DK5 A;  3KEQ A;  3LQQ A;  4RGR A;  1I1G A;  4PJM A;  5HVQ C;  1N77 A;  5JLX A;  1X4O A;  2TDX A;  1P4W A;  2WWY A;  2EFO A;  5H20 A;  4F3Q A;  2FA5 A;  2PEX A;  3MKZ A;  3GX4 X;  1J0R A;  2V6C A;  1EH6 A;  1TW2 A;  2H8W A;  3RSN A;  3LA7 A;  2XAQ A;  4HQM A;  1QA6 A;  5ILV A;  1X2N A;  4EM1 A;  1RR7 A;  3LA2 A;  3K69 A;  1XDS A;  3S3N A;  2BHZ A;  1AWC A;  3NRV A;  2H1L A;  3G4S I;  5AIP A;  1ZKG A;  3WG7 H;  4XLP F;  4YRV A;  3OIO A;  5M5W J;  1S6L A;  1BI3 A;  1DP3 A;  1BA5 A;  2CH0 A;  4XLH A;  3CCR I;  4IHT A;  1FLI A;  5JLW A;  1E3H A;  3QOD A;  5DCM A;  2IA1 A;  2OUM A;  1P9Q C;  1Z6T A;  3CCL I;  2RC4 A;  1YO5 C;  3COA C;  3S1N J;  2OQR A;  3K70 D;  1S8N A;  5BQT A;  4M9S A;  1OCC H;  3CCQ I;  3WU1 B;  2WV1 A;  5DCM B;  2GA1 A;  1EA3 A;  2XAU A;  4QSH A;  1V5E A;  2BE5 F;  2ZXJ A;  3M1C A;  3SEZ A;  5GTI C;  2Y48 A;  3BTJ A;  2DTR A;  2VKV A;  3DLL F;  2L2O A;  3ZN1 A;  5DD8 A;  3HGY A;  2PN6 A;  2IVM A;  5LHH A;  3H36 A;  3OYD A;  3EYY A;  1ZG5 A;  2MFZ A;  4C2U A;  4LLL A;  3RKX A;  3ERE D;  1IC8 A;  1TQI A;  1FPQ A;  3SYT A;  2M34 A;  4ZDP A;  3O8H A;  3S1M J;  3VSK A;  3KET A;  2IS2 A;  1K83 J;  5E20 A;  3TQN A;  4MGR A;  4IO9 F;  1ETQ A;  4ZYA A;  3H9Q A;  3DPL C;  2ZJ2 A;  4IOC F;  3BWG A;  3P7N A;  5K5R A;  3IH4 A;  2QUF A;  3MMY B;  5K7H A;  1MMS A;  1Z1D A;  3ZMD A;  5H6Q A;  2L7Z A;  1FP2 A;  2V1X A;  5DM7 F;  2F5D A;  1NG6 A;  1PUF A;  3RQI A;  2JPC A;  2DYS H;  2O8X A;  2Z3Y A;  5JHU A;  2MH9 A;  2NVT J;  2W25 A;  3QU3 A;  2B7E A;  3DBR B;  3F8C A;  5E18 F;  3HDD A;  1R5I D;  1QHH D;  4KMU X;  3OWT A;  2JA6 J;  3KP4 A;  1JTY A;  1IV8 A;  4RDU A;  2ZBK A;  1TT0 A;  3HHH A;  1IG7 A;  1IAW A;  1JKR C;  4BQN A;  4L18 B;  4XNF A;  5K7Z A;  3TO9 A;  2IS6 A;  2L9V A;  5E79 C;  4WX9 A;  4I0A A;  2YU3 A;  1JTX A;  2XAG A;  3ZR8 X;  2H6C A;  4LLG F;  2PJR A;  3W3C A;  2Z1D A;  2HOS A;  1QBJ A;  3GTL J;  5H6R A;  4C3I J;  2NS7 A;  2PFB A;  2X85 A;  3ELK A;  2VE8 A;  2PJR B;  3BRO A;  3DU5 A;  3FK7 A;  4ZYE A;  3HOT A;  1MDM B;  4IKF A;  2Y9Y A;  3N4M A;  2XGX A;  4MHG A;  5A2Q Z;  2FE3 A;  3L00 A;  4A2U A;  4BJ5 C;  4YIR X;  4DNC A;  3F22 A;  5E3L A;  3CC2 I;  4P5O A;  4RAG A;  1SD7 A;  2F5V A;  1YW8 A;  2HVS A;  3I4N J;  1X4P A;  3IAM 2;  3Q0W A;  4CXF A;  4L0Z B;  1J09 A;  4QLC U;  4KIS A;  2VPL A;  1FC3 A;  1ZRC A;  4QPO A;  3DEE A;  3CES A;  2MD0 A;  3T1B A;  3R0A A;  5K5O A;  1TBX A;  2JJ7 A;  2QEN A;  4PFP A;  5F1J A;  3V42 A;  3S8P A;  3CCJ I;  3BG6 A;  4FET A;  4FE7 A;  4EM0 B;  2OA4 A;  1ZR4 A;  1UEL B;  1M1E B;  3R61 A;  1T8I A;  1E3O C;  4V2F A;  4BE1 A;  1TWG J;  4RS8 A;  3TED A;  2ZB9 A;  1VND A;  2JK3 A;  4IHS A;  3MKL A;  1FSH A;  1KYW A;  2DOA A;  2LD5 A;  2YU9 J;  1U8R A;  4M73 A;  3I71 A;  4LLN A;  2LLK A;  4V2G A;  1GUU A;  2E2H J;  2XRO A;  5L3D A;  1SFU A;  2UUZ A;  1N25 A;  5EYR A;  3QPL A;  4CA0 A;  3AKZ A;  5F27 A;  2A69 F;  1P4A A;  3GCM A;  2FQ4 A;  4AIH A;  3HOV J;  3PQK A;  2JA7 J;  2M5W A;  4I09 A;  2EK5 A;  2EIK H;  1IDZ A;  1DPU A;  1TWF J;  5AON A;  3GTK J;  1QZE A;  2X6X A;  2O3F A;  4IF4 A;  1X3W B;  4F55 A;  3C2H A;  5J1R A;  1WJD A;  3DBL B;  4E70 A;  3HRS A;  3PNV A;  2GM4 A;  4LB6 B;  3K4K A;  2MBF A;  3BR5 A;  5KAF C;  2DFE A;  3DLA A;  3NQO A;  3JRB A;  3DF8 A;  4D7M A;  2LNB A;  4ENJ A;  1D0Y A;  3LSG A;  1IN8 A;  3FIW A;  5TRD A;  4IHV A;  3AG1 H;  4M9X A;  3OR1 C;  3HBL A;  1Y56 A;  2EFP A;  4PDK A;  5GAD J;  4BE0 A;  3FX3 A;  2X1E A;  4NQW A;  4OAZ A;  1JJ8 C;  5IYB J;  2CUJ A;  3KFW X;  3CCE I;  5DCF A;  2BXY A;  5E1W A;  3L2Q A;  2E2J J;  3PNT A;  2HOA A;  2W48 A;  2ZME A;  5J4V A;  3DKY A;  1I27 A;  1WFX A;  4NQW B;  4AM3 A;  1IN6 A;  3A03 A;  5HDK A;  1SD4 A;  3LSJ A;  3K1M A;  3G6E I;  3TGN A;  3SDG A;  5CQE A;  2JQ7 A;  2DOF A;  2YPR A;  2K3F A;  4CYC A;  3HIF A;  3JRH A;  2EFW A;  1UZC A;  3LSK A;  3OL3 A;  4FX0 A;  3HSE A;  1ZG3 A;  3FBN B;  4A3E J;  2OJE D;  2AS5 F;  2NNN A;  4RGU A;  3I5U A;  5LRR A;  5J8C A;  1MND A;  3BR6 A;  5B66 C;  1DUX C;  1J9I A;  1HCR A;  4QIW N;  2ACJ A;  3WG9 A;  5M3M J;  3H0D A;  3HUG B;  1JJ6 C;  2FSW A;  1MH3 A;  4IHX A;  1XDU A;  5J8F A;  2W57 A;  2JRM A;  4OWR B;  3BTI A;  2IGN A;  4DJA A;  2F5E A;  5DYM A;  2R7S A;  2ELH A;  2EIJ H;  1KU7 A;  3CUQ C;  1O7F A;  1MW7 A;  3FBI B;  2L5Q A;  3BY6 A;  5JVG F;  2RNG A;  3D5S C;  4RAZ A;  4UUS B;  1DU0 A;  5EF6 A;  3H92 A;  3CDI A;  2VBY A;  1YW9 A;  2Z2S B;  3H9J A;  4NC7 A;  1OCP A;  4RAY A;  3GW2 A;  1RES A;  1BC7 C;  4PGG A;  5ILU A;  3GTJ J;  4O3M A;  4M72 A;  2YR2 A;  5L3E A;  4XKB A;  4YG2 F;  1FOY A;  2M30 A;  5D8K B;  3DWL E;  5LGU A;  4GGG A;  2FQ3 A;  2QBY B;  3GTG J;  1HW5 A;  5E1Z B;  1S7A A;  2ID6 A;  5M3F J;  3ABK H;  2IPQ X;  1T95 A;  4BYY A;  1E0E A;  3OYM A;  1G3Y A;  2A3S A;  3ECO A;  4L9T A;  3FDY A;  3CJR B;  3HC7 A;  3FMQ A;  3GTQ J;  3SFI A;  1EV7 A;  3JRE A;  2EH3 A;  4FT8 A;  1LUJ B;  2IBD A;  3ZP5 A;  3IWZ A;  2GXB A;  2JVH A;  2R92 J;  4HX7 A;  5GAG J;  6PAX A;  3EQL F;  5M5X J;  2FML A;  3TKY A;  3LAP A;  3HOU J;  3CUQ A;  3UNG C;  2DMU A;  4B8X A;  4EEF G;  4M6X A;  1PVE A;  1X1D A;  4ZTF A;  2VQC A;  2PJP A;  2EIN H;  1OJL A;  5EZH A;  3ROU A;  3M7G A;  1QPI A;  3CUQ B;  2K85 A;  4M3B A;  1GV5 A;  1TNS A;  2R7Q A;  1R23 A;  1W5S A;  3J80 Z;  3CC7 I;  3S16 J;  2FUG 2;  2LYC A;  2VKH A;  3PUF A;  4O6J A;  3JCU C;  2W84 A;  3FF5 A;  2ELK A;  2NOJ B;  2R7T A;  2GIZ A;  5EEH A;  1PDN C;  1MMD A;  4ENN A;  3ZMZ A;  3WTS C;  5LHI A;  2XKO A;  3DTE A;  4R8H A;  2KKO A;  4ZJZ A;  4XRS A;  3KEY A;  4CCO A;  3HRT A;  4N0B A;  5D5U B;  3C7J A;  4Q47 A;  1W1W E;  3HOZ J;  4MFE A;  4S0H B;  2KDO A;  3OMY A;  4BAY A;  2E35 A;  2L9R A;  2WBM A;  3GME A;  5FKL A;  3REO A;  2VIX A;  5EGO B;  5CLS A;  5L3F A;  1NTC A;  5J40 A;  2K3P A;  4ESF A;  2DA7 A;  2L9N A;  2HDC A;  1T08 B;  2ZJP F;  4E7Z A;  2PQ8 A;  2JN6 A;  3PQJ A;  3ZQF A;  4IXA A;  2HDD A;  3CME I;  4JX6 A;  5D6F A;  4XLF A;  2HPI A;  4D7N A;  3RTR A;  3WTZ A;  5JVT A;  2L9S A;  1B8I A;  3ZQQ A;  2O9L A;  4C2T A;  4WXC A;  2LP0 A;  3LMM A;  3BPV A;  2E1N A;  4LIT A;  1MBH A;  3KX2 A;  3MN2 A;  4A5N A;  1X19 A;  3VYS B;  2P7C B;  2FBI A;  2HZD A;  3BPX A;  1SFO J;  2D1H A;  1D5Y A;  1O3Q A;  1O3T A;  1GXP A;  1ZR2 A;  3ABL H;  4DZP A;  4KJZ A;  3R60 A;  3KYL A;  1IXS B;  3LSH A;  3AG3 H;  2VJ5 A;  3QQA A;  4MEX F;  3U1D A;  3GLX A;  2AQE A;  3V7S A;  2ADU A;  5KVR A;  2OV7 A;  4IL6 C;  2F5C A;  1KON A;  1JKO C;  3L09 A;  2MSY A;  4P9F A;  3A0H C;  3QPH A;  4KT6 A;  2WB1 N;  4IEJ A;  3Q9S A;  2UXX A;  1USS A;  1V3F A;  1XSX A;  2L54 A;  1NK2 P;  2DI3 A;  4EJT A;  4ZH4 F;  3GZ6 A;  4EJU A;  3NWT A;  3X2Q H;  1MGT A;  4CCK A;  3FK6 A;  2K27 A;  4C30 A;  2BY2 A;  4AID A;  4I01 A;  4BJT A;  4OIR F;  3C1D A;  4IRH A;  1ZK8 A;  1FP1 D;  4CO8 A;  2ELJ A;  2JTV A;  2DT5 A;  3BOQ A;  1P7J A;  3ZQG A;  5LGT A;  1Z0X A;  4G7H F;  4E7H A;  2VJI A;  3NEU A;  1W7P A;  3FM3 A;  3KPH A;  5ICE A;  3EET A;  1ZRF A;  2MLK A;  3PFY A;  2XSJ C;  3HZJ A;  1V54 H;  4I99 C;  1D1C A;  4L9V A;  1HBX G;  2I10 A;  3O8G A;  3S2W A;  2QWW A;  1BR2 A;  3DEW A;  3I59 A;  3J7A O;  1UHS A;  1RKW A;  5DTD A;  4I7H A;  1T0F C;  2ESN A;  5ERI A;  1RET A;  1QVT A;  1VQN I;  3PO2 J;  3ZXS A;  5HOO A;  4LIV A;  4A0X A;  4BNC A;  2PMZ N;  3F6V A;  2OTJ I;  2H8R A;  4HYE A;  2OAZ A;  3QAH A;  2RVC A;  1LDD A;  2VQG A;  3WHB A;  3CD6 I;  3K2A A;  2NS0 A;  3H5R A;  2K4J A;  3KCC A;  3VYR B;  4WF2 A;  5FGM A;  4HNT A;  2HXO A;  1XCB A;  2A07 F;  1SAU A;  1IGN A;  1SD5 A;  1B72 B;  4IOA F;  4XOP A;  2DA5 A;  2V7F A;  2FEZ A;  3K4C A;  3GF2 A;  2E19 A;  5HDG A;  4RM2 A;  4PGH A;  5TGT A;  1R1T A;  3AFH A;  1WJA A;  3BQY A;  1Y8R B;  4G94 A;  3L9F A;  3J7A Y;  3P9K A;  3BZ6 A;  1HW1 A;  2LY1 A;  3CP2 A;  3IKV A;  3TW6 A;  1FEX A;  2OBP A;  5L3B A;  4RB3 C;  3UKG A;  1W4M A;  2O61 A;  1BOB A;  3D0S A;  3G71 I;  3BDD A;  2XGC A;  4UVA A;  4DZJ A;  4B09 A;  2OZU A;  3FMS A;  1MBG A;  2F6C A;  2NNY A;  2LG4 A;  3JSP A;  5L3C A;  2ESH A;  2K02 A;  1T0F A;  5FO5 A;  3HPH A;  3M8J A;  4IHW A;  4AWX B;  3FXQ A;  1LE8 B;  4KIG A;  5IOZ A; 
#chains in the Genus database with same CATH homology
 4BU2 A;  3HXL A;  2E60 A;  3OS2 A;  2BW3 B;  2CS3 A;  4BS9 A;  2CV1 A;  5CKT A;  1NG6 A;  5HNH A;  3NWS A;  3HOS A;  4ZDO A;  3S3M A;  2Q2E B;  1QHH D;  1V5F A;  4BXF A;  3OWT A;  4F92 B;  4PJJ A;  3CF2 A;  4HEA 2;  1TT0 A;  1N78 A;  4BQN A;  2KRC A;  4XNF A;  3OYI A;  2IS6 A;  4DBQ A;  3ZR8 X;  2LY2 A;  4B47 A;  2W7N A;  2PJR A;  3W3C A;  3S3O A;  2Z1D A;  2VXZ A;  3EUH C;  4DOZ A;  3CZ6 A;  3BCB A;  3K4M A;  2X85 A;  4II2 A;  2PJR B;  4F52 A;  3DU5 A;  3IUO A;  3HOT A;  2KL4 A;  4IKF A;  4IQJ A;  4HRI A;  2LH9 A;  4BJ5 C;  4NNJ A;  2HVQ A;  4BL0 B;  1UAA A;  2M4G A;  4BGD A;  3OL4 A;  4P5O A;  3H35 A;  3I9V 2;  3DPU A;  2F5V A;  2VQH A;  1VZ0 A;  4OAY A;  2HVS A;  3OS1 A;  1X4P A;  3FKJ A;  3IAM 2;  4CCM A;  3MD2 A;  4C9Y A;  1J09 A;  1WJB A;  1W36 D;  3DPT A;  4KIS A;  2VPL A;  3VWB A;  1D0X A;  2CV0 A;  4QPO A;  3K4N A;  2ZXI A;  3DEE A;  3CES A;  2MD0 A;  5LD2 C;  4XKV A;  2VB6 A;  1U0J A;  2IXS A;  4D9J A;  1LFP A;  4PFP A;  3OR2 C;  2Q1Z B;  3V42 A;  3S8P A;  2VAS A;  4BQO A;  3BG6 A;  4BQQ A;  4FET A;  3SZG A;  3VDX A;  4BEH A;  3DU6 A;  3EUA A;  3IAS 2;  4ITV A;  4J01 A;  1GLN A;  1UEL B;  4LG3 A;  1UG0 A;  2V26 A;  3ZGK A;  3HL2 A;  2KP6 A;  2DXI A;  4CCL A;  2M0M A;  4BE1 A;  4BEH B;  3D5L A;  2VL8 A;  1DGR M;  1FMV A;  3BG7 A;  2R7X A;  3IP4 B;  2R7V A;  2IGM A;  2AQF A;  2DOA A;  4GRI A;  4Y4R A;  1S9H A;  1DGW Y;  1WJF A;  2O5R A;  1LVK A;  3LFU A;  1MMA A;  3U21 A;  1SFK A;  1ERD A;  3SEQ A;  1JI8 A;  2UUZ A;  4Y33 A;  3W2W A;  4CA0 A;  3AKZ A;  3N05 A;  2R7O A;  4PSW A;  2LBF B;  3A4C A;  4HST A;  3OIP A;  4P1W A;  3DTI A;  2V4J C;  4RLF A;  3DTK A;  4Y3O A;  2X6X A;  4F55 A;  3C2H A;  5LFA A;  1WJD A;  1BR4 A;  2DT7 B;  2LRD A;  1X1C A;  3PNV A;  2LOO A;  3K4K A;  4PSX A;  3DLA A;  3DKX A;  1D0Y A;  3LSG A;  3OYN A;  3OR1 C;  4BE0 A;  1Y56 A;  2XC7 A;  4OAZ A;  2X1E A;  2CUJ A;  4U87 A;  2ZFU A;  3L2Q A;  3OYK A;  2R7W A;  3PNT A;  1TZL A;  3DKY A;  2CMP A;  4N4O B;  1WFX A;  4NQW B;  2VJ4 A;  2HDW A;  4XLE A;  3L2R A;  2X51 A;  3PSF A;  3DQV C;  2QKL B;  4QPQ A;  2W00 A;  4N4N B;  5CQE A;  4JQF A;  2JVG A;  1BR1 A;  4H4K C;  4PK4 A;  3OYC A;  2UV1 A;  3GBG A;  2W4S A;  3L2V A;  3LSK A;  3OYJ A;  3OL3 A;  4R79 A;  5FRM A;  2JA2 A;  1N75 A;  2KLO A;  3FBN B;  3HG9 A;  4RM3 A;  4XLA A;  1MND A;  3CP8 A;  3H5A A;  4F91 B;  5JHF A;  3K4B A;  3K6G A;  3VYU B;  3MKW B;  3H0D A;  3HUG B;  2R4G A;  4E7L A;  4DBR A;  1K6Y A;  2KPM A;  4OWR B;  1Z21 A;  2IGN A;  2M7B A;  4DJA A;  2R7S A;  3I3L A;  4XL9 A;  1MNE A;  4U7B A;  2L7K A;  1MW7 A;  3FBI B;  1LKX A;  2L5Q A;  2WY7 Q;  3RPU D;  5KNL A;  2ZXH A;  2LRE A;  2RNG A;  3BCA A;  3D5S C;  4XON A;  2V6E A;  3QYE A;  3LSI A;  3EPZ A;  2X6W A;  2VQL A;  2Z2S B;  3H9J A;  4NC7 A;  4HSR A;  2IS4 A;  4MLO A;  1V5G A;  1LDK B;  4PUS A;  4J00 A;  2MAB A;  4G6T B;  5KCM A;  3MKY B;  3QYF A;  4AVZ A;  2QKM B;  3CMM A;  4XKB A;  2IS1 A;  1ZEL A;  1YX3 A;  2BVM A;  4D1Q A;  3DWL E;  4XMY A;  3QYB A;  1AA7 A;  4E4H A;  1PJR A;  3OYH A;  3K70 C;  3CJQ B;  5FRO A;  4ZTJ A;  2MYS A;  2XF5 A;  4PJN A;  2MC4 A;  2X1D A;  4XM3 A;  1T95 A;  2E5N A;  1E0E A;  3OYM A;  2HU9 A;  1WJE A;  2GOX B;  4XKC A;  3FDY A;  2R7R A;  3AL0 C;  3CJR B;  2VJJ A;  3HC7 A;  2M7A A;  2WAD A;  2OC6 A;  3G2B A;  4ZDL A;  3RQ4 A;  2A5W A;  4XKW A;  2WAF A;  4X0G A;  2XDV A;  2HNH A;  2JVH A;  3VSL A;  3PL8 A;  4E7S A;  2LBF A;  2XF7 A;  3UR3 C;  5FRN A;  2VKD A;  4XN0 A;  3UNG C;  3K4J A;  4PJL A;  3TMO A;  4BDZ A;  1X1D A;  4FAS D;  4ZTF A;  2VQC A;  3QOE A;  3A2K A;  4B43 A;  3S32 A;  3H5N A;  2R7U A;  1WJ5 A;  3ONQ A;  3W2V A;  3EUK L;  2E1M C;  2R7Q A;  3SDB A;  4XOT A;  3PJR A;  3A1Y A;  4DIQ A;  2FUG 2;  2LYC A;  2VKH A;  5KHD A;  4BDY A;  4E7I A;  2NOJ B;  2WB1 A;  1G8X A;  1DQU A;  2R7T A;  4AU7 A;  3L2W A;  1MMD A;  1YX5 A;  2CFO A;  2ZSI B;  2X6Y A;  2CUZ A;  2KQR A;  3DTE A;  4E6K G;  2KHM A;  3H9G A;  4ZJZ A;  3KEY A;  4CCO A;  3OIQ A;  3TL4 X;  5HNF A;  2HQA A;  4XQF A;  2WY8 Q;  1Z3Y A;  3RCO A;  4XLC A;  2KDO A;  3OMY A;  1D1B A;  4EAT A;  4ZC3 A;  1OLT A;  2KMU A;  4CZC A;  2UWM A;  2WBM A;  3AL0 B;  2VIX A;  4CCN A;  4XOR A;  3PSI A;  2K3P A;  2L9N A;  1G59 A;  2X1C A;  4E7Z A;  1FMW A;  1OR7 C;  2WA0 A;  4HPQ A;  2BOL A;  2Y0S A;  3BLY A;  2HPI A;  4XLF A;  4XR6 A;  4NUB A;  3RTR A;  1WJC A;  2L9S A;  4B44 A;  3ZQQ A;  2IGK A;  2LC2 A;  2E5Z A;  4C2T A;  2W1O A;  4RLQ A;  1QU3 A;  2DCE A;  3LMM A;  4LIT A;  2PMZ A;  3OYL A;  3KX2 A;  1Z3X A;  3BC8 A;  1X19 A;  3VYS B;  1Z7L A;  3W2A A;  2Z16 A;  4RMN A;  3K10 A;  2HZD A;  2ZSH B;  1X1B A;  4E7J A;  4KJZ A;  3KYL A;  3OYG A;  2DT6 A;  3LSH A;  3C2G A;  2CW7 A;  2VJ5 A;  2E1M B;  4B3X A;  3OY9 A;  2AQE A;  1PYV A;  1MMN A;  4YEJ A;  2F4I A;  2OV7 A;  4II3 A;  3LSM A;  1KON A;  2WAQ A;  3OYB A;  4AYB A;  5CQG A;  3TBI A;  3E0J B;  3K4L A;  4KT6 A;  4DGW B;  2A6T A;  2K9M A;  4CUG A;  2V1N A;  2M4K A;  4HNU A;  1Y6I A;  3NWT A;  4CCK A;  1R6R A;  4LIU A;  4IQ4 A;  4C30 A;  3OOU A;  3S93 A;  4BJT A;  2XF6 A;  4CCJ A;  2V9K A;  2ELJ A;  3ZRG A;  4E7H A;  4BUP A;  2VJI A;  3OYE A;  1QHG A;  4PFO A;  4CH7 A;  3OYF A;  1D0Z A;  3F9K A;  3PFY A;  2XSJ C;  3OS0 A;  4BE2 A;  2W82 A;  1NG7 A;  1D1C A;  1YE9 A;  2K9L A;  3OYA A;  1BR2 A;  3LL7 A;  4BAC A;  2JUG A;  4PJM A;  4B48 A;  5HVQ C;  1N77 A;  2WAE A;  1X4O A;  4NC8 A;  4JOM A;  4F3Q A;  4IZZ A;  3MKZ A;  1MMG A;  1T0F C;  4XN3 A;  3ZXS A;  2RRE A;  5HOO A;  3RSN A;  4LIV A;  2K5C A;  2I8D A;  3S3N A;  2HVR A;  3HKZ A;  2KRH A;  4YRV A;  2VQG A;  5CPR B;  2BVL A;  4KIT B;  3H5R A;  2GOM A;  3VYR B;  1DP3 A;  4HNT A;  2CH0 A;  2M3A A;  4XLH A;  5HLT A;  1SAU A;  3PNY A;  4XOP A;  2V7F A;  3QOD A;  2DJI A;  3ZCO A;  2OUM A;  3K4C A;  1P9Q C;  2RQQ A;  4HG2 A;  4YEL A;  3K70 D;  4RM2 A;  5TGT A;  3AFH A;  1X1A A;  2P0W A;  1WJA A;  4E7K A;  3D5R C;  2CV2 A;  3J7A Y;  1EA3 A;  2XAU A;  1V5E A;  3VYT B;  2LY1 A;  3CP2 A;  3M1C A;  3SEZ A;  3FHN A;  2L2O A;  4IX7 A;  1D1A A;  2VLA A;  3OYD A;  1HA8 A;  3E1S A;  1BOB A;  2MFZ A;  2VXD A;  3L2U A;  4C2U A;  3HPG A;  4BJ6 C;  3SYT A;  4ZDP A;  3VSK A;  2IS2 A;  1IRX A;  2IGO A;  2JSP A;  2KZV A;  4F93 B;  2F6C A;  4ZYA A;  2LG4 A;  2CW8 A;  3H9Q A;  3DPL C;  2HPM A;  3HPH A;  2BW3 A;  3M8J A;  3PUB A;  4CSW A;  3MMY B;  4ANJ A;  1W36 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...