2VQHA

Crystal structure of porb from corynebacterium glutamicum (crystal form ii)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
b'LSPQYNWVACGILEGGLKAAGVLEEGQYNRELAEAIAAKGEGFWTTQFPQIGDWNEDQAAALADRAQTCGLVKADT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN CGL0972
publication title A Putative Alpha-Helical Porin from Corynebacterium Glutamicum.
pubmed doi rcsb
source organism Corynebacterium glutamicum
molecule tags Membrane protein
total genus 28
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11565 PorB Alpha helical Porin B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1280 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vqhA00
2VQLA 2VQHA 2VQGA
chains in the Genus database with same CATH superfamily
3BY6A 3FXQA 4I76A 1IJWC 1R1VA 3ZQGA 4G7ZF 5TISC 2COBA 2HYFA 1X4OA 2WB1N 5J6XA 2V1XA 3S32A 2KRFA 5FLXK 3GVAA 2X48A 3E5XA 2KISA 2LY9A 3F0CA 4HOBA 3LOCA 1HW1A 5JI6A 3BR1A 1JKQC 3CDLA 1ZR4A 3W6JB 1LE8A 1HSTA 2G0EA 5GPAA 2RQPA 2ID3A 4ZC3A 3IKTA 3MN2A 4F55A 2DFHA 5TJJA 4AU7A 3PO2J 2R5YA 1FIAA 4ZTJA 5L3GA 4P5OA 4FE4A 3JTHA 4GYGA 3ZN1A 5A2QZ 1S9HA 5AIQA 1Y1VJ 2DJNA 2VBXA 2X85A 5FKNA 1VTNC 1G3TA 3CUQB 1DUXC 3NEUA 3GTOJ 2HTJA 1PJRA 2M5WA 5AIPA 2ELJA 5LGNA 4IHSA 1PP8F 3RCOA 2XPWA 2XROA 1QHHD 2XDVA 3DKWA 1SFXA 1JJ6C 4FCYA 2ZMEC 5LHHA 1XB4A 2KKOA 4ZDOA 2W25A 2VJ4A 1ZGAA 1ZLJA 2ADUA 1UB9A 3RPUD 4AWXB 2WB1A 4MTEA 1XG1A 3V7RA 4DJAA 4DW6A 1TWCJ 2DQLA 2EIKH 3A02A 3BPXA 3FXMA 3RYPA 2P5VA 3A03A 3CCEI 4JX5A 4M6XA 4WXCA 3K4KA 2DPUA 1BI0A 2H09A 3Q0WA 3I55I 2O0YA 3BP8A 3EETA 1HW2A 1FBSA 2UXNA 1T08B 2NXNB 4BHCA 1SANA 3CC7I 2VXDA 3Q5FA 3IH4A 1TW2A 3TP3A 2A5YB 1YRNA 2R7SA 4BQNA 1EKEA 1YX3A 3FISA 4BE1A 1XSDA 2NRAC 4QIWN 5KHDA 1HKTA 5DM7F 4V2GA 1USSA 2VKDA 2DTRA 3IWZA 4FE7A 1WI3A 2PMUA 1K6OA 4I02A 1WCMJ 4N0BA 1VQLI 3ZQFA 5FGMA 2OCCH 1S6LA 2VLAA 1WJFA 4XSZF 4NNJA 5F1JA 5K1YA 4OIOF 3ULQB 3X2QH 3P5JA 1OCOH 3HHHA 2CW0F 3MEXA 3BPVA 4CUGA 5LBQA 2BXYA 1ACIA 4UY8I 1U5TB 3MZHA 4X0GA 2K3FA 3K4JA 4Z6YA 2KDZA 1KU2A 1QHGA 3S1RJ 3I58A 1B8IA 1B1BA 2Y9ZA 2BV6A 1UHMA 2X51A 1R5ID 3JAMZ 3G1OA 3P7NA 3ZQ7A 4F3QA 2RVCA 1ZGWA 2BZTA 3V42A 2XRNA 2MSYA 1WI9A 1KU7A 3A01B 4A6EA 4ESJA 1U2WA 2KT0A 2ME0A 2H8RA 4RLQA 3SDGA 3HG9A 2QSFX 3VEPA 1CF7A 2R5ZA 5LLQA 2JQ7A 2FBIA 5ILUA 3BR5A 4LLGF 1X1PA 2QKMB 5LRSA 1YQAA 1IAWA 2JTVA 4DBQA 4IO9F 1NHAA 5KAFC 3E5QA 1N77A 1X4PA 2OUMA 5IOZA 2CH0A 1GDTA 1EH6A 1P7IA 2W00A 1BR1A 5F0HA 3WU1B 3S2DJ 2XAQA 4P55A 3G4SI 4ABZA 4L18B 5EEGA 3HB9A 2W1OA 5TGTA 1ZR2A 3DF8A 5K5QA 2HFHA 1WJDA 4Y15A 3GLXA 4LMYA 1JKPC 3ZXSA 5FD6A 3HOWJ 1AWCA 4E7ZA 3VOEA 1TT5B 4B48A 1NH3A 4U88A 2M34A 2H27A 4LLNA 4BEHB 1I5ZA 3I59B 4ANJA 2CU7A 2K85A 3GCMA 2K9MA 1JGGA 2GZWA 4A6DA 3KEOA 3QPHA 2CRGA 3I56I 3DLLF 4GFBA 2M9HA 4YFXF 3GFJA 5E8IA 4Y17A 3AKZA 5FROA 4BQQA 1MBKA 2PN6A 1I1SA 1YJNI 4W1UA 4PZJA 2K40A 1XSXA 1B4AA 4XLPF 4PJNA 2DOFA 3D5SC 3KP5A 3RQIA 1U9OA 3C2GA 2VONA 1MJBA 3FXLA 5C44J 4HPQA 3I64A 1SAUA 3GX4X 2ESNA 3OWTA 3K1MA 1TQMA 4BGDA 1LDDA 3JCUC 1MDMA 3CJTB 2LREA 3GTGJ 1OCZH 2IAIA 4IOAF 3RKYA 2L9RA 3OR1C 2IBDA 3NWSA 3QU3A 3IL2A 2DMQA 1YS6A 3ZMTA 1YLFA 2K86A 2VOPA 2OU2A 2PG4A 2L4AA 2FBKA 3DPUA 4I7HA 5H2FC 1ETQA 4CCLA 5EGOA 1F36A 2F5FA 3EUHA 2DMTA 5CVJA 4XN0A 1XTAA 4AM3A 3OYAA 3KZYA 4EJOA 4RM2A 1PDNC 1LVKA 3CLQA 1FYKA 1DPRA 3VWBA 3MMYB 3HOTA 1N78A 2XASA 2OZUA 3K4MA 4RDUA 4IOCF 2DAOA 2A5WA 2GXBA 1IDZA 4XRSG 4I0AA 4PGGA 1MBJA 4BJTA 3COAC 3MCZA 1U8BA 1S72I 2HPMA 2K9QA 3OS2A 3A0HC 2DCEA 2JUCA 3IAM2 3PUFA 2CV2A 1IRGA 3PFIA 1CGPA 1LVAA 3DKYA 3TOAA 1BI1A 1OYIA 1APLC 2H6CA 2HNHA 3HZJA 3PIOF 3H36A 1HDDC 1IXSB 4L9VA 1K83J 1PVEA 2ZMEB 4A3CJ 4B47A 1YW9A 4BE2A 5FKKA 1S7EA 4MNUA 3DQVC 1FC3A 3QAHA 4DYCA 2VODA 3F8BA 1EF4A 3HGYA 1K4SA 5HNFA 4YG2F 4BNCA 3QP5A 1PUFB 3MFKA 2MD0A 2VE8A 4ITVA 5IYBJ 5JVTA 4ZDPA 3AG3H 2LKPA 2M3AA 3J7YJ 4R1HA 1R5HA 3LL7A 3DBLB 3OIOA 2FUG2 3QP6A 2M7BA 4E7LA 2AHQA 2CQ7A 1O7FA 2KFDA 3JTGA 1E17A 1VQ8I 5JHUA 4A3KJ 1FMWA 3I4NJ 1OCPA 4JQFA 5F0CA 1BA5A 5FJ8J 3WE2A 5CQEA 3HPGA 3UR3C 3RPUA 2WTEA 4ON0A 4XIDA 1O3QA 3FF5A 3FMQA 1A04A 5D8LB 3A2KA 2FOKA 1QO0D 2WA0A 2R7WA 2HS5A 2QQ9A 1MZBA 1XPXA 2JSCA 3DBHB 5E3LA 3S1NJ 3TL4X 2OD5A 3JSOA 1WGXA 3U1DA 2FNAA 4HX7A 1M1EB 2GA1A 1SD5A 3M1CA 4LFUA 3V4GA 3LFUA 4BBRJ 2XGCA 2F5DA 1XSVA 1FZPB 1DP3A 1TWFJ 2EFNA 3SJMA 4YIIA 3J7AY 1JKRC 2BBYA 4H4KC 4W97A 1I27A 3IP4B 1VQ7I 2A05A 5J3LA 3G73A 4KFCA 5HS8A 1F1ZA 5CVRA 4FISA 3VYRB 1LPQA 2QSHX 2DA3A 2YS9A 3BZKA 2VC1A 4B3XA 2X6OA 3K2AA 2JRMA 2DQRA 2E1MC 1FBQA 3U2RA 2W84A 2E5NA 5B5EC 2IW5A 2YX7A 3PSFA 3JSPA 2CFOA 2TDXA 2DU9A 3HUGA 4I01A 2XSDC 2A07F 1L3LA 3W2VA 1X58A 1P2FA 5IP7J 3HOUJ 2E1OA 1ZLKA 3OYKA 4Y52J 1QA6A 2OJED 1DU6A 1LEBA 4C2MJ 2OC6A 2NNNA 3BJOA 4GXOA 3ABUA 3K7AJ 3K4CA 4K2EA 4RGUA 5DV5A 4CCNA 2J5OA 2JA2A 3WTZA 3RTRA 2HOAA 2Z1DA 2K4JA 1IZ1A 4XBFA 4QLCU 3RSNA 4ENMA 3VB2A 4XICA 4ENJA 1D0XA 2DBBA 2DI3A 4CZZA 2IRFG 3WGIA 4D7MA 5IP9J 2UV1A 3ML6A 2Y9YA 2NOJB 1KQ9A 2QKLB 2H1KA 3JRIA 3BTJA 1EH8A 3RIRA 4CH7A 2IEKA 1IN6A 5E1XA 3ZMDA 3RZDJ 2EFWA 2Q1ZB 4CXFA 5IT9Z 2MH9A 4FT8A 1RR8C 4E7HA 2HQ5A 2X4HA 4PFPA 2M7AA 2Z16A 3DBRB 2ME6A 3A0BC 4J19A 1POGA 4GRIA 4C3JJ 4Q48A 4A93J 4XLHA 2MC3A 2ISYA 4I99C 1WJEA 1MSEC 1T33A 2DXIA 4MO7A 3S16J 4MFDA 5EG0B 2OA4A 3JRCA 3AG2H 4A3GJ 5BPDA 1SMTA 4Q47A 1YX5A 2X6YA 1VQNI 3LQQA 2L7KA 2IS4A 1MIJA 3F72A 2MFZA 1F9NA 3B6AA 3BC8A 4D5FA 3ZP5A 1Z21A 2XRLA 2LK2A 4A3EJ 1SD7A 1JE8A 4B43A 2QF7A 5DDGA 4ZYHA 3BQZA 1BN5A 1ZRCA 2BYVE 4U7BA 4JOMA 2IA0A 4QPQA 4D0PA 4DZPA 3OSGA 1O3RA 2HKXA 3EUKL 2P7VB 4OMYA 2IS1A 3HOYJ 1D1CA 5HDGA 1MNDA 4BAYA 1TTYA 1ENHA 3CDHA 3TW6A 3ZPLA 4DOZA 2PBIA 1XDSA 2R7QA 3O2PE 1AKHB 1KONA 2D2WA 4HYEA 2NS8A 3M07A 2ZJQF 2DA1A 3CUQA 4DYQA 3ASOH 3GZ5A 1A6QA 3V7SA 1B9MA 2IVMA 3J81K 1QVUA 2ZXJA 3ZN0A 3ASNH 1MH3A 2XV4S 3GO5A 1HKQA 4EVIA 3L2RA 4OAYA 3VYUB 1FTZA 1YIJI 2WY7Q 1J5YA 5FRMA 2JMWA 3FK7A 4RAGA 2QLZA 1YFHA 3OR2C 1VZ0A 4II3A 1B9NA 4HLXA 1T56A 4XNFA 3OYEA 1TBXA 3EUAA 1R5GA 4C9YA 3SEQA 5KVRA 5IYCJ 2RQQA 4OWRB 3VPRA 2L4MA 5K7ZA 1MJ9A 1XC5A 5BOXA 4BH9A 4O3MA 3K9TA 1R1UA 3ZMUA 3Q3SA 3ABTA 4XKBA 4Q4ZF 3QRFF 2F5VA 3CCLI 2YU3A 4BE0A 3TEDA 5DD4A 5DEQA 2ZB9A 5GPCA 1R00A 1HXDA 2O7OA 2MA3A 3DKXA 5ILVA 3WTVC 1R23A 3SFIA 3FMSA 3IKVA 2MH2A 3T0YA 2VBWA 4KT6A 2LVSA 3RJPA 2X1EA 2Z33A 1UELB 4IVNA 3ZQQA 1FJLA 3M9AA 2Y0SN 3CC4I 3F8FA 3FXUA 3N4MA 4A3FJ 2QA4I 3BWGA 1ETVA 2DPDA 2PMZN 2LY2A 3SEZA 3SZGA 1L0OC 3QOPA 3FK6A 1HSJA 1U8RA 4RGSA 4CHUA 3H3VK 3HPHA 1TWAJ 1U5TA 2RN7A 3K1PA 2O3FA 1OR7C 3AAFA 2OZ6A 5ICEA 1S7OA 3CJQB 5M5YJ 1SC7A 3QYBA 1ETXA 4EM0B 3TDZC 1IN8A 2DMUA 3HHGA 1FP2A 4CYCB 4HDVA 3CCSI 3SHFA 1YJWI 1LNWA 4G94A 1IRFA 1XMAA 2KP6A 3A01A 3S3OA 2NVUB 2Y31A 1T0FC 3JRBA 2GIVA 2HOSA 2HWVA 4HA8A 1XS9A 1EA3A 4M6VA 3HYIA 2JSPA 4S04A 4XOPA 1VQ6I 2OAZA 3U1KA 1IRZA 4OIPF 4B3AA 2FE3A 2EZHA 1WRJA 5H6QA 2AQEA 2L9NA 4LK0F 5HDKA 3GFMA 4UNOA 2FD5A 3H0DA 2COMA 3PM1A 3T8TA 2D1HA 2E1MB 1OQYA 1Y8RB 2GBYA 3Q9VA 5J47A 2CWEA 3B6CA 1S5LC 4R8HA 4EGZA 3B73A 2CS3A 4A5NA 1S3JA 2AS5F 3PO3J 1XD7A 2YSRA 1E3PA 2YR2A 1DP7P 1STZA 3JREA 4AIJA 4XRFA 1F43A 1JJ8C 3KYLA 3HTSB 2HPIA 1NK2P 4ZYAA 3VFZA 4L9NA 1GXPA 2BOLA 2E60A 2MLKA 4BEHA 3DU6A 2IPQX 2R7UA 3JR9A 2UWMA 5D6FA 2V26A 2X9DA 4BS9A 1V55H 1T98A 1Z77A 2E2JJ 2EPFA 1TQPA 3J7ZI 1JKOC 3WTXC 3JRHA 2LSOA 1SFKA 2H8WA 1Y0UA 5GAGJ 1N25A 2HDDA 5B1BH 2KRCA 4X1EA 3K70C 5DUKA 2JPCA 2TRTA 2VUMJ 3I4MJ 4ZZDA 3ABKH 2RDPA 3L2UA 4XKWA 4PJJA 4RGXA 4A5MA 2BHZA 2E35A 3GTPJ 5D5UB 3CQZJ 3NRVA 5GADJ 2C6YA 3BROA 3S2WA 3OSFA 2KHMA 4DNCA 2B63J 2YU9J 4C3HJ 1FWZA 4MTDA 2L3DA 3HRSA 2DOAA 2NAZA 4DBRA 3CD6I 4KA4A 2DJIA 1TC3C 1ETYA 4JK1X 1KZHA 2AO9A 3VYSB 3ONQA 2UZKA 2VJIA 4G12A 3LSJA 4P9FA 2VKHA 3W6KB 2ISZA 3BG7A 3VYTB 5BPIA 1O3TA 1I1GA 1X2NA 4ZZLA 1V4RA 4AIDA 4FETA 2Q2EB 3OL3A 4G6DA 5ICCA 4BHBA 2R7FA 4A3JJ 4EATA 3RI4A 2JA7J 1IDYA 4E4HA 2FQ4A 3CMYA 1IV6A 3WGHA 2V9PA 2HYGD 3J80K 3PNVA 3KCCA 1ZG5A 2VJJA 4KITB 3KEQA 1JUSA 4UB8C 2RV8A 3IRRA 2K7LA 4GYIA 3IRQA 1FOKA 2KL4A 5BMZA 1KYZA 4QPOA 1WJBA 1JXSA 1QBJA 2V9VA 2HDCA 1GHCA 3WE3A 2KIUA 2HQRA 1FSEA 4XRMA 3KPHA 3H5NA 3L7WA 1FOYA 3BJAA 3OYHA 1BL0A 2ZMEA 2ZJRF 1WJAA 3WODF 1U9NA 3WTSC 2FA5A 2O6GE 1J9IA 3H5AA 5M5WJ 4CDGA 4XN3A 1LDKB 3E5UA 4IQ4A 1HDPA 5KNLA 3GZNB 2HU9A 1PUFA 2L7FP 1W7PB 1Z3YA 3F22A 5LRRA 3TBIA 4G6QA 4XRSA 5H6RA 2IGKA 4KJZA 3BTLA 2LY1A 3ERMA 2V1NA 3KLNA 4M72A 3DWLE 3SZTA 5F04A 5IYDJ 3P9CA 3LA7A 1WSUA 3HOVJ 2LKXA 2IXSA 3JW4A 1DPUA 1D1BA 3DPTA 5LEKA 2A6TA 4FASD 3CLOA 3LSGA 4LGWA 4Y13A 1VQMI 5J4YA 1GVDA 2KZGA 3CCMI 3G71I 2WAQN 4C2UA 3H9JA 2CSOA 4ESBA 2BE5F 3OYFA 3T8RA 3V8KA 3TW7A 4YEJA 1SAXA 2PJPA 1X3ZB 1X19A 1R22A 1G3WA 3GBGA 2BGCA 3O8GA 3S8PA 2M4KA 4G9YA 4CCMA 4D5CA 1ORKA 5LD2C 1FYLA 3DXJF 2XB0X 2EK5A 2XAHA 1PYVA 2XF7A 1RI7A 5E1WA 2KPMA 3RYRA 3NWTA 1Y0NA 2KDOA 3BT9A 4L5JA 5K5RA 3OL4A 4LIUA 2K3PA 2ZFWA 5BQTA 1JTYA 5A2QK 2JK3A 3D5LA 4EEFG 5K7FA 3FXKA 2DA5A 2XUBA 1IXRC 3M1EA 1R58A 3WTWC 4XLCA 2JA8J 4EJVA 2KJCA 2IP2A 2MABA 3DTKA 1BC7C 4E7JA 4UVAA 2TCTA 5JR3A 5E17F 3R60A 1T2KA 2GWRA 2E1CA 2G7UA 1S8NA 4HSRA 4MGRA 1YS7A 5M5XJ 4H0EA 1Y39A 1XMXA 3OYDA 3M4OJ 2QEXI 4PGHA 3FIWA 5D5XB 3PJRA 3GF2A 5B3SH 1ZN2A 4EJTA 1I6HJ 1EJ9A 4M3EA 4AUXA 2HR3A 4UUSA 5HLTA 2CFXA 2OQRA 3H3ZA 1OMIA 1QPMA 2F6CA 3MAJA 3OYNA 4UV8A 2WAEA 4EQQA 2O8XA 2WAQA 4A3DJ 1BIAA 5FKOA 1QVTA 4KMFA 2EV0A 2OPTA 1ZK8A 3WU0A 5CLSA 4KDPA 2WV0A 3TQNA 2EA4A 2HVSA 1Q1VA 5F6FA 5FO5A 3S3MA 4D7NA 3ERED 3CMAI 2LC2A 4UUTA 1SD6A 1MKMA 3RDIA 3JRAA 1GV2A 5CJ9A 4WXDA 4MQ9F 3OYCA 2BY1A 1IXCA 1YIOA 5L3DA 2R5YB 3S15J 1MMSA 2OCEA 4NUBA 4BHPA 2E2HJ 2VBZA 1IF1A 3NQOA 5JVGF 4XK4A 2FSWA 4B4CA 4OAZA 4B8XA 2UXXA 4RAFA 3GTKJ 4XOTA 2DK5A 2DODA 2V6CA 1BR2A 1LDJA 2CG4A 1MD0A 4L0ZB 5DD8A 4XLEA 2HQAA 4LIVA 3G1MA 4M6YA 2PQ8A 4CCJA 1IN4A 2M45A 4IHTA 3WG7H 2EQRA 1OLTA 4JP0A 3KEYA 1IGNA 3PQJA 4HAMA 4M9XA 4YIRX 2V79A 2LBFB 2ZFUA 3ZQIA 2H6BA 4ZJZA 3EYIA 4NC6A 3M8FA 3BG5A 5IY5H 4OIRF 4KIFA 2V7FA 5EG0A 3JAMK 1S29A 2DN0A 2LR8A 2Z3YA 2CV1A 2FJ1A 4BBSJ 3PUBA 4A0YA 2M87A 2MYSA 3HTUA 4CZCA 2X6WA 5J1YA 3GWZA 2R92J 2FQ3A 5FKMA 2K4BA 3IHUA 1R7JA 4HG2A 4M74A 1SFUA 2F4IA 3LSTA 3DP7A 4HX8A 3LA3A 5EEHA 3ZQCA 2ZNYA 4J00A 1R71A 2H94A 2RKHA 4GDFA 3OIQA 2ZXWH 3O8HA 3H5RA 3EYYA 3BCAA 3SXYA 1I39A 3R4KA 1H88C 1RETA 1TP4A 2W7NA 1T8IA 2A69F 4HV6A 1ETKA 4N9IA 4OINF 4BDZA 3S14J 3IUOA 1B72B 1E3HA 4PDKA 1W7PD 5L3FA 3RKQA 1AU7A 2JWTA 2GAUA 2LYCA 2FF4A 2VBYA 3DCFA 2ZXHA 4WF2A 2KQRA 1S7AA 4BYYA 4U87A 5HS7A 2A6HF 2ZC2A 3A1YA 3CJNA 1EH7A 2LP0A 4BXFA 4IHXA 5HS9A 2D45A 1RRJA 5CVVA 4XMYA 3F21A 2LOOA 3FKJA 3GTMJ 2BHYA 1P7JA 3AL0C 2EZLA 1FEXA 5CPRB 1MBFA 2ZSIB 3LAJA 3E6CC 1ITYA 1HQCA 2XAFA 2QWWA 1G2HA 3L00A 1FBUA 1FOXA 3FM3A 4XORA 3EPZA 1Z6RA 3LSIA 3FKIJ 1TNSA 5D5WB 2O8KA 3HEFA 4XKVA 1D5YA 1IN5A 2Q0OA 3QU6A 1FT9A 1YTYA 3ZQLA 4L5EA 2R5ZB 4XSXF 2ZBKA 3FX3A 3UNGC 1H9TA 2R7XA 5DCMB 5J4VA 2JN6A 4CGZA 5HOOA 3QOEA 2V9KA 5F1RA 3HOSA 3T5XA 4FTHA 1F5TA 1T39A 2VE9A 2BXZA 1ERDA 1IUFA 1JTXA 1YW7A 4LOCA 3CUOA 1ZQ3P 4B1RA 1WKMA 4KN4X 1Y8QB 4B09A 1MNEA 4KNYA 1Q1HA 1OISA 5CVIA 4BACA 4HDUA 2XKPA 4XLFA 2Y75A 2DT5A 2CUZA 2VB6A 4YIFA 2R0QC 4RM3A 4ZDLA 5IP6A 5E20A 4V2FA 1Z9CA 2P7CB 2ACJA 1UG2A 2QVOA 3ZQHA 3WHBA 4M3DA 4DIQA 5ILSA 1YITI 1GVJA 4MLOA 1I6XA 2M8EA 4AYBN 2CQKA 2DA7A 2JT1A 3ZR8X 2KMUA 5BNGA 3R0AA 4CYCA 4PJMA 3JRDA 4IRHA 4DZJA 3KYCB 2XF6A 3LA2A 3OY9A 2P6SA 3RPQA 1KU9A 2MC4A 2VKEA 2B9SA 2ICWG 3Q9SA 3IH2A 4EM1A 3WTTC 4ZTFA 2QYOA 2YUSA 3QODA 4JBAA 1W1WE 5E1ZB 4Y33A 1U3EM 1WJCA 2YX4A 1QZYA 2L5QA 2ZXIA 3GTQJ 2WADA 1SD4A 4WWCA 1FSHA 1WVRA 3FDYA 2DMPA 3K6GA 1DGRM 2XF5A 3SYTA 4XLAA 4AVZA 1IRXA 1D5VA 2PJRB 1BOAA 4YELA 3CCRI 1ZG1A 3S1QJ 1YOVB 2IA2A 4BU2A 3ZMVA 1TW3A 3CO6C 2RAEA 2VL8A 2Z9OA 5DM6F 2KZVA 3P9IA 3LWFA 4D1QA 2RNGA 4LG0B 2NNYA 4C30A 2L0KA 1D1AA 4XKCA 1OCTC 1XGNA 1ZYRF 2MBFA 2XGXA 4LJZF 4U0WA 3GTJJ 1RR7A 3K70D 2WWYA 3FXRA 2VPLA 4AYBA 2LD5A 1ZARA 4ESFA 2O9LA 2HOEA 3HIFA 4WK8F 2Z2SB 3D1NI 1ZRFA 1R4MB 5GAHJ 2IGOA 2X6XA 5GP9A 3AFHA 2E5ZA 4P9UA 1R9TJ 4MFEA 3OYMA 4PSWA 1TL8A 3N97A 4F7ZA 3VODA 2WV1A 1A5JA 4HEA2 4UUVA 3H1CA 2ZSHB 4HNTA 4CCKA 3C7JA 4HNUA 2FBHA 3FMRA 3BR2A 1YJ9I 3K4NA 2OQGA 1YG2A 4V19K 2CQXA 2P5KA 1TNTA 1I50J 2VIXA 2F5EA 1Z1DA 2EZIA 4KISA 3CP2A 2FXAA 2R4GA 4G6TB 5DS9A 2VQGA 2EB7A 4P1WA 2OTJI 1W5SA 1IN7A 3E6DA 5FRNA 3BCBA 3A4CA 1X1CA 4RB1A 3CC2I 4AD9A 4AIHA 1HOMA 4LD5A 3I5UA 2R3SA 3ECOA 4BQOA 1ZRDA 1D3YA 2YPRA 3H92A 3UKGA 3BZ6A 6PAXA 3BG6A 2XAUA 4M3FA 1IC8A 3OMYA 3H9GA 1O3SA 1P4XA 3S2HJ 1MMGA 2MGQA 3PQKA 2QM3A 1Y1WJ 5FLXZ 1J59A 2EH3A 3HC7A 3OYIA 2E19A 1GT0C 4DYRA 5JLXA 3PNYA 3PL8A 1BIBA 1ZELA 2K9NA 3KP4A 2Q2EA 4A12A 4BKXA 4BXUA 1BR4A 5ICFA 1YI2I 1QPIA 3HM5A 2HXIA 1MMAA 2J5PA 3C2HA 3ZGKA 2EIJH 3HGGA 2O5RA 1ETWA 3CF2A 4M9SA 1ON1A 1W5TA 2BW3B 2CW8A 2EJRA 1MMNA 3KETA 2MLGA 1TWGJ 1OCCH 2F2EA 2QQ8A 4ETSA 4CYDA 3ABMH 4I0BA 4IJAA 1VQPI 2QQBA 1BJAA 2DW4A 3VSKA 2LDUA 2N8GA 1JUMA 1RUOA 1V5FA 2QQAA 3BTIA 1TT0A 5C4JJ 1RNLA 5GTHC 1Z0XA 2XSJC 1ULYA 3D0SA 4HF0A 4M73A 2BVLA 1LFPA 1ETOA 4HZFA 3CESA 3GFIA 2IT0A 2HGCA 3AL0B 5IT9K 3MD2A 1W7PA 2DOEA 3GYHX 1U78A 3ECHA 4JX6A 2XIGA 5D4SA 2Z99A 1H89C 3TO6A 5L3BA 1HCRA 3L09A 2DYSH 5HNHA 5KK1A 3C18A 3L2VA 3CF5F 3WHCA 3TKYA 3NAUA 3MQ0A 4XONA 3E0JB 2CJJA 4BJ6C 2M8GX 1RIOH 4EJWA 1ONVA 4U0YA 1GXQA 5LHGA 3J80Z 4XM3A 2JVGA 3E6BA 3WTUC 3LNQA 1MSFC 4GCVA 3F8CA 4F91B 4MHGA 3LSMA 2CV0A 4UVCA 1RKTA 2LMDA 3WU2C 1OCRH 3TDUC 1QU3A 2IJLA 3DV8A 5GTIC 4HF2A 2VQHA 1K78B 2PI0A 1J09A 2R7OA 1TQIA 2E7XA 3Q0VA 2IGMA 1SVMA 2ZO4A 4I09A 4PCQA 2FNPA 3F8MA 1FMVA 3GZ6A 3DU5A 3CZ6A 2OBPA 1V3FA 2MG4A 5EYRA 2JVHA 3BDDA 4HV5A 4IHWA 4TV7A 1OR7A 1HBXG 1BJZA 1ZH5A 5KAIC 3I3LA 1X1AA 2D5VA 3QWLA 2W4SA 2ZJPF 3S3NA 3QYEA 4OOIA 4FX0A 4NBQA 1U0JA 3DEWA 3I59A 3EDPA 2R7VA 2JA5J 3BQYA 1VQ9I 3E1SA 1MBHA 1T0FA 1OFCX 2NVYJ 3K4BA 2CQNA 2DDAA 1B6AA 1HC8A 1WPKA 3DEEA 4U7DA 5CVUA 2FMLA 3BR0A 2HQNA 1MMDA 2VPRA 4EJUA 4IQJA 1MNMC 3KYDB 4PJ0C 3OYJA 3FHNA 1FY7A 5D6EA 1J2XA 2EINH 1FIPA 1BBYA 1R4NB 1AA7A 4XL9A 1R1TA 1P4WA 4NQWB 3HSRA 2FMYA 3K2ZA 3CP8A 4LB6B 2F48A 3I53A 1UG0A 4RB0A 1RZ4A 4KMUX 3KP7A 3HRMA 4UHTA 2BY2A 1HLVA 2NVXJ 3K1NA 5F0FA 1SEUA 1QNTA 3WTYC 2GA2A 5D4RA 4G7HF 4CICA 2B7EA 2M4GA 2O03A 2Y30A 4OU0A 2WC2A 3DTIA 3QPLA 1BOBA 3HOXJ 5BS6A 5E3OA 1SFEA 5FLVA 3E7LA 2L54A 3GEZA 1W0UA 2K9SA 2XAJA 2DT6A 2A68F 5L3CA 3IAS2 1KQ0A 2E36A 2CO5A 1YHQI 5GAEJ 2LBFA 3KX2A 4RMNA 2A6EF 1WH7A 1O57A 3CTAA 3REOA 4GGGA 2XC7A 2EFOA 4IHVA 4O6JA 2HI3A 1UFMA 2DDBA 1X3UA 4PSXA 2CGPA 2ETHA 2ELHA 2QBYB 1J7KA 4ZH4F 2CQQA 3DTEA 2NOGA 1W36C 1K7AA 4KYWA 2DFEA 3AG4H 3S1MJ 1O7LA 2M0CA 2XHKA 2I10A 4HLYA 4MEYF 1ZREA 2BVMA 2FOWA 4ASNA 3R0JA 5B1AH 1EV7A 5HLIA 4DGWB 2XB5A 3KLOA 4EMSA 2BEOA 1KA8A 1X3WB 5JFRA 2RGVA 1DQUA 4RBOA 4A3LJ 1YE9A 1Z7UA 3G6EI 3O3KA 3Q0UA 1FX7A 3IH3A 2RREA 4Y4RA 3M3YJ 2ZJ2A 1W5CC 4HQMA 5J8FA 1KU3A 5H20A 1UMQA 1B72A 1T95A 2HVRA 4ZYGA 4I6ZA 1DDNA 5F27A 3U21A 2DFFA 4WX9A 3V7CA 5EJCA 4L0YB 1RUNA 1R6RA 4M3GA 4EV0A 4LITA 4QWQA 2M1BA 4O5VA 2EBIA 2EWNA 1W4MA 1Z05A 3MKZA 2F5CA 4PK4A 4HF1A 4IX7A 1TZLA 2JUGA 3L2CA 5E3MA 5DTDA 3OOPA 1ZAOA 3MKWB 2VC0A 2G7HA 2XVCA 3HRUA 1FYMA 3HSEA 1XGOA 4LB5A 2HOTA 2EV6A 2HKOA 1QRYA 2VN2A 2STTA 3QQAA 4A3BJ 1A35A 2E1NA 2CUJA 2ID6A 4KN7X 4BY1J 2ELKA 1K6YA 1SMYF 2JZYA 3WG9A 2DA4A 3BG3A 2M0MA 3S93A 1WH5A 5DCMA 5EZHA 2P8TA 2R7ZJ 1OKRA 2HEOA 5HODA 2IA1A 3R61A 2V4JC 1VFCA 3PFYA 3H0GJ 2GLOA 3HSFA 3KZIC 1JI8A 1XDUA 2DMNA 1G3SA 3U9GA 4U0VA 1WWXA 2R7DA 2IGNA 3TMOA 3GXOA 3SZPA 4L9TA 3M8EA 1T38A 2VT2A 1KQ8A 3IC7A 1V54H 2FX0A 2W82A 3KIOA 2X1DA 1MW7A 2L7ZA 3CCYA 1T6SA 3EQLF 2K02A 2HDWA 2VKVA 1LEAA 1RC9A 5FD5A 4IZZA 1AOYA 2H1LA 2XAGA 3H3UA 3I54A 4IRGA 2LRDA 2PEXA 2XKOA 3LMMA 3PSIA 1R36A 4YRVA 1F4KA 1UCRA 2EA2A 3TO9A 1Z6TA 3CCVI 2FRHA 1LE8B 4F93B 4NB5A 3TOBA 3MZ8A 2W24A 1VQOI 3EUHC 4S05A 1RKWA 4NDLA 1I3QJ 2HVQA 3FBIB 1X1DA 2HYJA 3QYFA 3LAPA 1WZ2A 2WY8Q 1AHDP 2GOMA 2KIQA 2Y48A 1D8KA 4AC0A 1HF0A 1TWHJ 2R7TA 3HRTA 5C4XJ 4BXXJ 2GIZA 1XCBA 5J1UA 2LLKA 4WXHA 3BLYA 4MQVA 2P5LC 2B0LA 4R79A 2E7WA 4UB6C 1UHWA 3WGGA 2PJRA 4N9HA 4RLFA 1H0MA 3KE2A 4X6AJ 5HLHA 5IT3A 2W85A 3FXOA 5EF6A 3OYBA 3BG9A 2XPVA 3LSKA 4LG0A 1W0TA 1D8JA 1QGPA 5M3FJ 1UAAA 3MKYB 3OV8A 1JHHA 2ZKZA 1J0RA 2PMHA 3ISPA 1G59A 2FU4A 1I3AA 1H9GA 3JRFA 1MJAA 5B66C 1K4TA 1G4DA 5ED4A 2R93J 2HZTA 2L02A 5LGTA 4MEXF 4HW0A 4A0ZA 4A3MJ 2RC4A 1LUJB 3L2QA 4OIQF 2CUEA 2KIMA 4RAYA 5ICGA 1LQ1A 1YRNB 2E2IJ 1NK3P 3RQ4A 2XGDA 3MWMA 1AKHA 4ENNA 1XCVA 3HBLA 1BC8C 1D0ZA 3ABLH 1HW5A 3RKXA 3C3WA 4ZYEA 1G3YA 3F23A 3FBNB 3DFGA 4BUPA 2L2OA 4RS8A 2BY0A 1A36A 4LK1F 2ECBA 4MIMA 3OS1A 2VOOA 4CO8A 5HVQC 4KUMA 4N4OB 3ELKA 3SDBA 2QGUA 2X1CA 4RA2A 3HL2A 1IUYA 1XGSA 5EEAA 1B8IB 2Y0MA 4UV9A 2MW8A 4PUSA 1N75A 2P6TA 1WFXA 4QTRA 5EDNA 4LLLA 3W6VA 2QUFA 9ANTA 3H9QA 1D0YA 1SFOJ 1NG7A 3SFZA 1UHSA 2LH9A 3ZRGA 5FFZA 4PJLA 2KIFA 2W48A 2F4OB 3L9FA 4RB3C 1K61A 3HOZJ 3PNTA 5LGUA 4XQFA 2DTZA 1CF7B 2PLYA 1ON2A 3ZMSA 2EZKA 1V5GA 4CA0A 4JX4A 2RNJA 1K79A 1OYYA 1FP1D 2DA6A 4IRIA 1HKSA 1YYVA 3TP0A 1MH4A 3SQNA 2BW3A 3RZOJ 4C3IJ 4FQGA 3H35A 5J1RA 2HZDA 1HA8A 3F6OA 3LQRA 5FB2A 4UVBA 1Z67A 1LB2A 3PIPF 2K27A 2I8DA 1IW7F 1RPWA 2ESHA 3ZCOA 3FXJA 3DEUA 3J81Z 3M8JA 1GUUA 2STWA 4L9JA 2DYRH 4HX4A 1IV8A 3KFWX 3QPSA 2GOXB 3E6MA 2AXTC 5C3EJ 1ODDA 4Y7NJ 5JHFA 3G3ZA 3B02A 2EV5A 3N05A 4HSTA 2E34A 3D5RC 3LFKA 2NVTJ 5L3EA 4F52A 4CSWA 3FHZA 5HLGA 1ZGJA 2L9VA 3OYGA 4E7KA 1FTTA 3O6BB 1JUPA 3HKZN 1OYWA 3JRGA 3FM5A 2W57A 3MZYA 1LFUP 2DFIA 3IWFA 2QENA 5D8KB 1MGTA 4OMZA 4B44A 4UUSB 2DK8A 1WQ2A 2VQCA 1REPC 1DU0A 1QQIA 2VQLA 1ZKGA 3R6SA 4IEJA 5E18F 5E79C 4YFKF 1X1BA 3NARA 3OOUA 5E3NA 2Y2ZA 5CKTA 2IS2A 4F92B 2DO7A 1MBGA 2XGEA 3KP3A 1P9QC 2CMPA 2L7MP 1IO2A 5FKLA 3MVPA 3GTLJ 1LJ9A 1XMKA 4WCGA 1K78A 1Y6IA 1OPCA 4AIKA 1C0WA 1SVLA 2LF8A 3L1PA 4QSHA 4N4NB 4G8XA 3ZMZA 1VNDA 5EZGA 3I9V2 2I5UA 2FEZA 3DPLC 1VQKI 4RGRA 3G1LA 5AONA 3VDXA 4ZYDA 2NS0A 1E3OC 4IHYA 1ZTRA 4KICA 5FLMJ 1VF9A 4E7IA 2WAFA 3CMMA 3M7GA 2K5CA 4KIBA 4RAZA 5IOYA 4JYKA 1MDMB 4GO1A 2DA2A 3GLLA 1DGWY 1BW6A 5ERIA 3CMEI 2AXLA 5DCFA 1YO5C 2VASA 1FPQA 3CUQC 4E70A 2LKSA 2DT7B 3T1BA 2ZCWA 3G2BA 2G9WA 3HKZA 1LFBA 2VT3A 3V8LA 5K5OA 3BR6A 4RB2C 5TRDA 1O4XA 2O61A 5EGOB 3LSPA 5IPAA 2IS6A 2ZNZA 3FZVA 1UZCA 3OYLA 4P96A 2L01A 4C2TA 1QZZA 2CW7A 3GW2A 4KT5C 1Z91A 2GXGA 2NYXA 2GM4A 5M3MJ 4II2A 5DUIA 3HJEA 1OJLA 2EFQA 1BI2A 3I4PA 4HRIA 2K9LA 4Y3OA 4LG3A 1PP7U 2QZ8A 3BR3A 3L2WA 4HBLA 2L9SA 2LTPA 3BZCA 4IXAA 1NTCA 3TGNA 3K10A 3W3CA 2V1DA 5LEJA 4G7OF 2VJ5A 4BDYA 3BOQA 4BQAA 3CCUI 4FHTA 5J40A 3K0LA 3GUDA 4D9JA 3HDDA 4L5IA 4M9ZA 4S0HB 1Y56A 2ECCA 3RKWA 4NQWA 1BW5A 1XGMA 3ZOBA 2QSGX 4EGYA 3FWEA 1UJ8A 4FX4A 1V5EA 1VQ5I 2HXOA 2R7RA 1U6GA 2P81A 1X2MA 5D5VB 3GFLA 4IKFA 1B59A 2PFBA 4IPAA 2PX9A 3J7AO 4ENKA 3ROUA 1GLNA 3E3VA 2NS7A 2GQQA 3IV5A 2LNBA 1XN7A 3C1DA 2HTSA 3F6VA 1W36D 3K69A 5DYMA 4KIGA 3ESWB 2UUZA 2M2EA 1A31A 4NC8A 2Q8KA 1VQ4I 2CUFA 1U5TC 4YFNF 2EFPA 2F4MB 3HXLA 3KP6A 1J75A 4I2OA 5K7HA 2NVQJ 1E2XA 1WHUA 3W2AA 4A2UA 4A69C 2A61A 2JRTA 4IL6C 2LFBA 2P0WA 2BY3A 2MD5A 3GMEA 2QBYA 1FLIA 3C2BA 4CCOA 2VI6A 3I0TA 5HDNA 1E0EA 2EILH 2Y69H 3E97A 1ZG3A 5FFXA 3K4LA 3KZZA 1BM9A 2QCOA 5E8GA 1JGSA 3CO7C 5F64A 2KJBA 1PUEE 1A6IA 2LF7A 3OIPA 4BJ5C 3MKLA 3S17J 2KRHA 5J8CA 1MBEA 2OV7A 4PFOA 4XLNF 1ZHFA 4M3BA 1JT6A 4AVPA 2EIMH 2JPBA 1BI3A 4UXNA 5KCMA 4A3IJ 3V8JA 4EM2A 3F9KA 2V1UA 2LG4A 2JJ7A 1CQTA 2XPUA 3HUGB 1G8XA 3W2WA 3DLAA 1P6RA 2AQFA 3KP2A 4HQEA 1R49A 1KGSA 4E6KG 1RESA 2M30A 2OF7A 1XX5A 5JLWA 3LSRA 4IF4A 4BL0B 1LKXA 2D1VA 1KYWA 1YW8A 1FNNA 2X0LA 3CCJI 4NHJA 3BTCA 2JA6J 4XR6A 1NG6A 3TO7A 1QZEA 1SVOA 2V6EA 4HNVA 2GXAA 2Z5UA 4Q5SF 4E7SA 4Z2YA 3P9KA 3OS0A 3AG1H 2VXZA 3LSHA 5F08A 1WJ5A 4J01A 2OTLI 4DQ2A 3CCQI 1FOWA 2WBMA 3I71A 2P4WA 1Z7LA 3BJ6A 5CQGA 1JHFA 3CJRB 4BY7J 4NC7A 2A3SA 1GV5A 1VI0A 2DLLA 3F8NA 5LHIA 2KLOA 1H8AC 1IG7A 5CYVA 2E71A 3F3XA 1G6NA 3CDIA 4I98B 2Y0SA 1P4AA 3VSLA 1P92A 1TLHB 1USTA 1Z3XA 3QPTA 2PMZA 1JT0A 4A0XA 2CYYA 5LFAA 4M71A
chains in the Genus database with same CATH topology
4QPQA 3EUKL 2IS1A 3A1YA 4BXFA 1D1CA 2M0MA 1MNDA 4XMYA 3S93A 1X4OA 4DOZA 2LOOA 3FKJA 2R7QA 1KONA 3S32A 3AL0C 5CPRB 2ZSIB 2V4JC 3PFYA 1JI8A 4XORA 3EPZA 3LSIA 2IGNA 3TMOA 3L2RA 4OAYA 4XKVA 3VYUB 2WY7Q 5FRMA 3OR2C 4ZC3A 1VZ0A 4II3A 2W82A 2X1DA 4F55A 1MW7A 4AU7A 4ZTJA 4P5OA 3UNGC 2R7XA 4XNFA 3OYEA 2HDWA 1S9HA 3EUAA 2X85A 5HOOA 4C9YA 4IZZA 3SEQA 3QOEA 2V9KA 3HOSA 2RQQA 4OWRB 2LRDA 1PJRA 3LMMA 1ERDA 3PSIA 4YRVA 2ELJA 3RCOA 4F93B 1QHHD 1MNEA 2XDVA 4XKBA 4BACA 4XLFA 3EUHC 2F5VA 4BE0A 2CUZA 2VB6A 4RM3A 4ZDLA 4ZDOA 2HVQA 3FBIB 1X1DA 2VJ4A 3DKXA 3QYFA 3RPUD 2WB1A 2WY8Q 4DIQA 2GOMA 4KT6A 2R7TA 4DJAA 2X1EA 4MLOA 1UELB 3ZQQA 3ZR8X 2KMUA 3BLYA 4PJMA 3K4KA 4R79A 2XF6A 3OY9A 2MC4A 4ZTFA 2PJRA 4RLFA 2LY2A 3SEZA 3SZGA 3QODA 2VXDA 3HPHA 3OYBA 1OR7C 4Y33A 3LSKA 2R7SA 1WJCA 4BQNA 1YX3A 4BE1A 1UAAA 3MKYB 3CJQB 5KHDA 2L5QA 3QYBA 2VKDA 2ZXIA 2WADA 1G59A 2VLAA 1WJFA 3FDYA 3K6GA 4NNJA 1DGRM 2XF5A 3SYTA 4XLAA 4AVZA 2KP6A 1IRXA 3S3OA 5LFAA 2PJRB 1T0FC 4YELA 4BU2A 3L2QA 1EA3A 2VL8A 4CUGA 2JSPA 2KZVA 4X0GA 3K4JA 4XOPA 2RNGA 4D1QA 4C30A 4XKCA 1D1AA 1QHGA 3RQ4A 3K70D 2AQEA 2L9NA 2X51A 2VPLA 4AYBA 3H0DA 2E1MB 2Z2SB 1D0ZA 4F3QA 2IGOA 2X6XA 3V42A 2CS3A 3FBNB 3AFHA 2E5ZA 4BUPA 4RLQA 2L2OA 3OYMA 4PSWA 3OS1A 3HG9A 5HVQC 3SDBA 4N4OB 4HEA2 2X1CA 2ZSHB 4HNTA 4CCKA 3KYLA 4HNUA 3HL2A 2HPIA 2QKMB 3K4NA 4ZYAA 4PUSA 1N75A 2BOLA 1WFXA 2VIXA 4DBQA 2E60A 4KISA 3CP2A 4BEHA 3DU6A 2R4GA 4G6TB 1N77A 1X4PA 3H9QA 2OUMA 2UWMA 2CH0A 2VQGA 4P1WA 2R7UA 1D0YA 2V26A 4BS9A 1NG7A 2W00A 1BR1A 2LH9A 3ZRGA 4PJLA 5FRNA 3BCBA 3A4CA 1X1CA 1SFKA 3PNTA 2W1OA 4XQFA 5TGTA 4BQOA 4CA0A 1V5GA 2KRCA 3BG6A 3K70C 1WJDA 2XAUA 3ZXSA 3OMYA 2BW3A 3H9GA 4B48A 4E7ZA 3L2UA 3H35A 4BEHB 4XKWA 2HZDA 4PJJA 1HA8A 4ANJA 1MMGA 2K9MA 3HC7A 3OYIA 2I8DA 3PNYA 3ZCOA 3PL8A 3M8JA 1ZELA 2KHMA 1BR4A 3AKZA 2GOXB 1MMAA 3C2HA 5JHFA 3ZGKA 5FROA 4BQQA 2O5RA 2DOAA 3N05A 3CF2A 4HSTA 4DBRA 2BW3B 2DJIA 2CW8A 3D5RC 1MMNA 4PJNA 4F52A 4CSWA 3D5SC 3VYSB 3OYGA 3C2GA 3ONQA 4E7KA 2VJIA 2VKHA 3BG7A 3VYTB 4HPQA 3VSKA 4FETA 2Q2EB 3OL3A 1V5FA 1SAUA 4B44A 4EATA 4E4HA 1TT0A 2VQCA 3OWTA 2VQLA 3PNVA 4BGDA 2XSJC 2BVLA 2VJJA 1X1BA 1LFPA 2LREA 3OOUA 3CESA 4KITB 2IS2A 5CKTA 3AL0B 4F92B 3OR1C 1P9QC 2CMPA 3NWSA 3MD2A 2KL4A 4QPOA 1WJBA 1Y6IA 4N4NB 3I9V2 3DPUA 3DPLC 3VDXA 4CCLA 5HNHA 3H5NA 3OYHA 3L2VA 4XN0A 1WJAA 4XONA 3E0JB 3OYAA 4BJ6C 4E7IA 2WAFA 3CMMA 3H5AA 2K5CA 4RM2A 1LVKA 4XM3A 2JVGA 4XN3A 1LDKB 3MMYB 4IQ4A 1DGWY 3HOTA 3VWBA 1N78A 3K4MA 4F91B 2HU9A 5KNLA 2A5WA 4BJTA 2VASA 3LSMA 2CV0A 1Z3YA 2HPMA 3TBIA 1QU3A 3OS2A 2DCEA 2DT7B 3IAM2 3G2BA 2VQHA 1J09A 2R7OA 2CV2A 2IGKA 3HKZA 4KJZA 2LY1A 2V1NA 3DKYA 2IGMA 3DWLE 2HNHA 2IXSA 1D1BA 2IS6A 3DPTA 1FMVA 2A6TA 4B47A 4FASD 3DU5A 3LSGA 3OYLA 3CZ6A 4BE2A 4C2TA 2CW7A 3DQVC 2JVHA 4II2A 4C2UA 3H9JA 5HNFA 3I3LA 3OYFA 1X1AA 4YEJA 4HRIA 2MD0A 2K9LA 4ITVA 4Y3OA 4ZDPA 4LG3A 2W4SA 3S3NA 1X19A 3QYEA 3L2WA 2M3AA 3GBGA 2L9SA 3LL7A 1U0JA 3S8PA 2FUG2 2M4KA 2M7BA 4E7LA 2R7VA 4CCMA 5LD2C 3K10A 3W3CA 2VJ5A 1FMWA 4BDYA 1PYVA 2XF7A 3E1SA 2KPMA 4JQFA 4D9JA 3NWTA 2KDOA 1Y56A 3OL4A 5CQEA 3HPGA 4LIUA 3K4BA 3UR3C 2K3PA 1V5EA 3D5LA 3A2KA 2R7RA 2WA0A 3DEEA 2R7WA 4XLCA 1MMDA 2MABA 3TL4X 4IQJA 4IKFA 3DTKA 3OYJA 3FHNA 4E7JA 1GLNA 3M1CA 3LFUA 4HSRA 3OYDA 1AA7A 4XL9A 3PJRA 1W36D 4NQWB 2UUZA 4NC8A 1DP3A 5HLTA 3CP8A 2F6CA 3OYNA 3J7AY 4H4KC 1UG0A 2WAEA 2WAQA 3IP4B 3HXLA 3W2AA 3VYRB 4B3XA 2P0WA 2HVSA 2E1MC 2M4GA 3S3MA 4CCOA 2LC2A 1E0EA 2E5NA 3DTIA 1BOBA 3K4LA 3PSFA 2CFOA 3OYCA 3W2VA 2DT6A 3OIPA 4BJ5C 3IAS2 4NUBA 2KRHA 2LBFA 3KX2A 3OYKA 4RMNA 2OV7A 4PFOA 4OAZA 2XC7A 4XOTA 2OC6A 3K4CA 1BR2A 4PSXA 4CCNA 2JA2A 5KCMA 3DTEA 4XLEA 3RTRA 2HQAA 4LIVA 1W36C 3F9KA 2LG4A 2Z1DA 4CCJA 3RSNA 3HUGB 1G8XA 1D0XA 1OLTA 3W2WA 3DLAA 2AQFA 2BVMA 3KEYA 2UV1A 4E6KG 4DGWB 2NOJB 2LBFB 2ZFUA 4ZJZA 2QKLB 1DQUA 4BL0B 1LKXA 2V7FA 1YE9A 2CV1A 4CH7A 2RREA 4XR6A 3PUBA 4Y4RA 2MYSA 1NG6A 2Q1ZB 4CZCA 2V6EA 2X6WA 4E7HA 4E7SA 1T95A 2HVRA 4PFPA 2M7AA 2Z16A 3OS0A 2VXZA 3LSHA 3U21A 1WJ5A 4J01A 4HG2A 4GRIA 2F4IA 2WBMA 4XLHA 1Z7LA 5CQGA 4J00A 1R6RA 3CJRB 4LITA 4NC7A 1WJEA 3OIQA 2DXIA 3MKZA 3H5RA 4PK4A 4IX7A 1TZLA 2JUGA 3BCAA 2KLOA 2W7NA 3MKWB 1YX5A 2X6YA 2L7KA 4BDZA 3IUOA 2IS4A 2MFZA 2Y0SA 3BC8A 3VSLA 1Z21A 1Z3XA 2LYCA 4B43A 2CUJA 2ZXHA 2PMZA 2KQRA 4U7BA 4U87A 4JOMA 1K6YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQL A;  2VQH A;  2VQG A; 
#chains in the Genus database with same CATH topology
 3BY6 A;  3FXQ A;  4I76 A;  1IJW C;  1R1V A;  3ZQG A;  4G7Z F;  5TIS C;  2COB A;  2HYF A;  1X4O A;  2WB1 N;  5J6X A;  2V1X A;  3S32 A;  2KRF A;  5FLX K;  3GVA A;  2X48 A;  3E5X A;  2KIS A;  2LY9 A;  3F0C A;  4HOB A;  3LOC A;  1HW1 A;  5JI6 A;  3BR1 A;  1JKQ C;  3CDL A;  1ZR4 A;  3W6J B;  1LE8 A;  1HST A;  2G0E A;  5GPA A;  2RQP A;  2ID3 A;  4ZC3 A;  3IKT A;  3MN2 A;  4F55 A;  2DFH A;  5TJJ A;  4AU7 A;  3PO2 J;  2R5Y A;  1FIA A;  4ZTJ A;  5L3G A;  4P5O A;  4FE4 A;  3JTH A;  4GYG A;  3ZN1 A;  5A2Q Z;  1S9H A;  5AIQ A;  1Y1V J;  2DJN A;  2VBX A;  2X85 A;  5FKN A;  1VTN C;  1G3T A;  3CUQ B;  1DUX C;  3NEU A;  3GTO J;  2HTJ A;  1PJR A;  2M5W A;  5AIP A;  2ELJ A;  5LGN A;  4IHS A;  1PP8 F;  3RCO A;  2XPW A;  2XRO A;  1QHH D;  2XDV A;  3DKW A;  1SFX A;  1JJ6 C;  4FCY A;  2ZME C;  5LHH A;  1XB4 A;  2KKO A;  4ZDO A;  2W25 A;  2VJ4 A;  1ZGA A;  1ZLJ A;  2ADU A;  1UB9 A;  3RPU D;  4AWX B;  2WB1 A;  4MTE A;  1XG1 A;  3V7R A;  4DJA A;  4DW6 A;  1TWC J;  2DQL A;  2EIK H;  3A02 A;  3BPX A;  3FXM A;  3RYP A;  2P5V A;  3A03 A;  3CCE I;  4JX5 A;  4M6X A;  4WXC A;  3K4K A;  2DPU A;  1BI0 A;  2H09 A;  3Q0W A;  3I55 I;  2O0Y A;  3BP8 A;  3EET A;  1HW2 A;  1FBS A;  2UXN A;  1T08 B;  2NXN B;  4BHC A;  1SAN A;  3CC7 I;  2VXD A;  3Q5F A;  3IH4 A;  1TW2 A;  3TP3 A;  2A5Y B;  1YRN A;  2R7S A;  4BQN A;  1EKE A;  1YX3 A;  3FIS A;  4BE1 A;  1XSD A;  2NRA C;  4QIW N;  5KHD A;  1HKT A;  5DM7 F;  4V2G A;  1USS A;  2VKD A;  2DTR A;  3IWZ A;  4FE7 A;  1WI3 A;  2PMU A;  1K6O A;  4I02 A;  1WCM J;  4N0B A;  1VQL I;  3ZQF A;  5FGM A;  2OCC H;  1S6L A;  2VLA A;  1WJF A;  4XSZ F;  4NNJ A;  5F1J A;  5K1Y A;  4OIO F;  3ULQ B;  3X2Q H;  3P5J A;  1OCO H;  3HHH A;  2CW0 F;  3MEX A;  3BPV A;  4CUG A;  5LBQ A;  2BXY A;  1ACI A;  4UY8 I;  1U5T B;  3MZH A;  4X0G A;  2K3F A;  3K4J A;  4Z6Y A;  2KDZ A;  1KU2 A;  1QHG A;  3S1R J;  3I58 A;  1B8I A;  1B1B A;  2Y9Z A;  2BV6 A;  1UHM A;  2X51 A;  1R5I D;  3JAM Z;  3G1O A;  3P7N A;  3ZQ7 A;  4F3Q A;  2RVC A;  1ZGW A;  2BZT A;  3V42 A;  2XRN A;  2MSY A;  1WI9 A;  1KU7 A;  3A01 B;  4A6E A;  4ESJ A;  1U2W A;  2KT0 A;  2ME0 A;  2H8R A;  4RLQ A;  3SDG A;  3HG9 A;  2QSF X;  3VEP A;  1CF7 A;  2R5Z A;  5LLQ A;  2JQ7 A;  2FBI A;  5ILU A;  3BR5 A;  4LLG F;  1X1P A;  2QKM B;  5LRS A;  1YQA A;  1IAW A;  2JTV A;  4DBQ A;  4IO9 F;  1NHA A;  5KAF C;  3E5Q A;  1N77 A;  1X4P A;  2OUM A;  5IOZ A;  2CH0 A;  1GDT A;  1EH6 A;  1P7I A;  2W00 A;  1BR1 A;  5F0H A;  3WU1 B;  3S2D J;  2XAQ A;  4P55 A;  3G4S I;  4ABZ A;  4L18 B;  5EEG A;  3HB9 A;  2W1O A;  5TGT A;  1ZR2 A;  3DF8 A;  5K5Q A;  2HFH A;  1WJD A;  4Y15 A;  3GLX A;  4LMY A;  1JKP C;  3ZXS A;  5FD6 A;  3HOW J;  1AWC A;  4E7Z A;  3VOE A;  1TT5 B;  4B48 A;  1NH3 A;  4U88 A;  2M34 A;  2H27 A;  4LLN A;  4BEH B;  1I5Z A;  3I59 B;  4ANJ A;  2CU7 A;  2K85 A;  3GCM A;  2K9M A;  1JGG A;  2GZW A;  4A6D A;  3KEO A;  3QPH A;  2CRG A;  3I56 I;  3DLL F;  4GFB A;  2M9H A;  4YFX F;  3GFJ A;  5E8I A;  4Y17 A;  3AKZ A;  5FRO A;  4BQQ A;  1MBK A;  2PN6 A;  1I1S A;  1YJN I;  4W1U A;  4PZJ A;  2K40 A;  1XSX A;  1B4A A;  4XLP F;  4PJN A;  2DOF A;  3D5S C;  3KP5 A;  3RQI A;  1U9O A;  3C2G A;  2VON A;  1MJB A;  3FXL A;  5C44 J;  4HPQ A;  3I64 A;  1SAU A;  3GX4 X;  2ESN A;  3OWT A;  3K1M A;  1TQM A;  4BGD A;  1LDD A;  3JCU C;  1MDM A;  3CJT B;  2LRE A;  3GTG J;  1OCZ H;  2IAI A;  4IOA F;  3RKY A;  2L9R A;  3OR1 C;  2IBD A;  3NWS A;  3QU3 A;  3IL2 A;  2DMQ A;  1YS6 A;  3ZMT A;  1YLF A;  2K86 A;  2VOP A;  2OU2 A;  2PG4 A;  2L4A A;  2FBK A;  3DPU A;  4I7H A;  5H2F C;  1ETQ A;  4CCL A;  5EGO A;  1F36 A;  2F5F A;  3EUH A;  2DMT A;  5CVJ A;  4XN0 A;  1XTA A;  4AM3 A;  3OYA A;  3KZY A;  4EJO A;  4RM2 A;  1PDN C;  1LVK A;  3CLQ A;  1FYK A;  1DPR A;  3VWB A;  3MMY B;  3HOT A;  1N78 A;  2XAS A;  2OZU A;  3K4M A;  4RDU A;  4IOC F;  2DAO A;  2A5W A;  2GXB A;  1IDZ A;  4XRS G;  4I0A A;  4PGG A;  1MBJ A;  4BJT A;  3COA C;  3MCZ A;  1U8B A;  1S72 I;  2HPM A;  2K9Q A;  3OS2 A;  3A0H C;  2DCE A;  2JUC A;  3IAM 2;  3PUF A;  2CV2 A;  1IRG A;  3PFI A;  1CGP A;  1LVA A;  3DKY A;  3TOA A;  1BI1 A;  1OYI A;  1APL C;  2H6C A;  2HNH A;  3HZJ A;  3PIO F;  3H36 A;  1HDD C;  1IXS B;  4L9V A;  1K83 J;  1PVE A;  2ZME B;  4A3C J;  4B47 A;  1YW9 A;  4BE2 A;  5FKK A;  1S7E A;  4MNU A;  3DQV C;  1FC3 A;  3QAH A;  4DYC A;  2VOD A;  3F8B A;  1EF4 A;  3HGY A;  1K4S A;  5HNF A;  4YG2 F;  4BNC A;  3QP5 A;  1PUF B;  3MFK A;  2MD0 A;  2VE8 A;  4ITV A;  5IYB J;  5JVT A;  4ZDP A;  3AG3 H;  2LKP A;  2M3A A;  3J7Y J;  4R1H A;  1R5H A;  3LL7 A;  3DBL B;  3OIO A;  2FUG 2;  3QP6 A;  2M7B A;  4E7L A;  2AHQ A;  2CQ7 A;  1O7F A;  2KFD A;  3JTG A;  1E17 A;  1VQ8 I;  5JHU A;  4A3K J;  1FMW A;  3I4N J;  1OCP A;  4JQF A;  5F0C A;  1BA5 A;  5FJ8 J;  3WE2 A;  5CQE A;  3HPG A;  3UR3 C;  3RPU A;  2WTE A;  4ON0 A;  4XID A;  1O3Q A;  3FF5 A;  3FMQ A;  1A04 A;  5D8L B;  3A2K A;  2FOK A;  1QO0 D;  2WA0 A;  2R7W A;  2HS5 A;  2QQ9 A;  1MZB A;  1XPX A;  2JSC A;  3DBH B;  5E3L A;  3S1N J;  3TL4 X;  2OD5 A;  3JSO A;  1WGX A;  3U1D A;  2FNA A;  4HX7 A;  1M1E B;  2GA1 A;  1SD5 A;  3M1C A;  4LFU A;  3V4G A;  3LFU A;  4BBR J;  2XGC A;  2F5D A;  1XSV A;  1FZP B;  1DP3 A;  1TWF J;  2EFN A;  3SJM A;  4YII A;  3J7A Y;  1JKR C;  2BBY A;  4H4K C;  4W97 A;  1I27 A;  3IP4 B;  1VQ7 I;  2A05 A;  5J3L A;  3G73 A;  4KFC A;  5HS8 A;  1F1Z A;  5CVR A;  4FIS A;  3VYR B;  1LPQ A;  2QSH X;  2DA3 A;  2YS9 A;  3BZK A;  2VC1 A;  4B3X A;  2X6O A;  3K2A A;  2JRM A;  2DQR A;  2E1M C;  1FBQ A;  3U2R A;  2W84 A;  2E5N A;  5B5E C;  2IW5 A;  2YX7 A;  3PSF A;  3JSP A;  2CFO A;  2TDX A;  2DU9 A;  3HUG A;  4I01 A;  2XSD C;  2A07 F;  1L3L A;  3W2V A;  1X58 A;  1P2F A;  5IP7 J;  3HOU J;  2E1O A;  1ZLK A;  3OYK A;  4Y52 J;  1QA6 A;  2OJE D;  1DU6 A;  1LEB A;  4C2M J;  2OC6 A;  2NNN A;  3BJO A;  4GXO A;  3ABU A;  3K7A J;  3K4C A;  4K2E A;  4RGU A;  5DV5 A;  4CCN A;  2J5O A;  2JA2 A;  3WTZ A;  3RTR A;  2HOA A;  2Z1D A;  2K4J A;  1IZ1 A;  4XBF A;  4QLC U;  3RSN A;  4ENM A;  3VB2 A;  4XIC A;  4ENJ A;  1D0X A;  2DBB A;  2DI3 A;  4CZZ A;  2IRF G;  3WGI A;  4D7M A;  5IP9 J;  2UV1 A;  3ML6 A;  2Y9Y A;  2NOJ B;  1KQ9 A;  2QKL B;  2H1K A;  3JRI A;  3BTJ A;  1EH8 A;  3RIR A;  4CH7 A;  2IEK A;  1IN6 A;  5E1X A;  3ZMD A;  3RZD J;  2EFW A;  2Q1Z B;  4CXF A;  5IT9 Z;  2MH9 A;  4FT8 A;  1RR8 C;  4E7H A;  2HQ5 A;  2X4H A;  4PFP A;  2M7A A;  2Z16 A;  3DBR B;  2ME6 A;  3A0B C;  4J19 A;  1POG A;  4GRI A;  4C3J J;  4Q48 A;  4A93 J;  4XLH A;  2MC3 A;  2ISY A;  4I99 C;  1WJE A;  1MSE C;  1T33 A;  2DXI A;  4MO7 A;  3S16 J;  4MFD A;  5EG0 B;  2OA4 A;  3JRC A;  3AG2 H;  4A3G J;  5BPD A;  1SMT A;  4Q47 A;  1YX5 A;  2X6Y A;  1VQN I;  3LQQ A;  2L7K A;  2IS4 A;  1MIJ A;  3F72 A;  2MFZ A;  1F9N A;  3B6A A;  3BC8 A;  4D5F A;  3ZP5 A;  1Z21 A;  2XRL A;  2LK2 A;  4A3E J;  1SD7 A;  1JE8 A;  4B43 A;  2QF7 A;  5DDG A;  4ZYH A;  3BQZ A;  1BN5 A;  1ZRC A;  2BYV E;  4U7B A;  4JOM A;  2IA0 A;  4QPQ A;  4D0P A;  4DZP A;  3OSG A;  1O3R A;  2HKX A;  3EUK L;  2P7V B;  4OMY A;  2IS1 A;  3HOY J;  1D1C A;  5HDG A;  1MND A;  4BAY A;  1TTY A;  1ENH A;  3CDH A;  3TW6 A;  3ZPL A;  4DOZ A;  2PBI A;  1XDS A;  2R7Q A;  3O2P E;  1AKH B;  1KON A;  2D2W A;  4HYE A;  2NS8 A;  3M07 A;  2ZJQ F;  2DA1 A;  3CUQ A;  4DYQ A;  3ASO H;  3GZ5 A;  1A6Q A;  3V7S A;  1B9M A;  2IVM A;  3J81 K;  1QVU A;  2ZXJ A;  3ZN0 A;  3ASN H;  1MH3 A;  2XV4 S;  3GO5 A;  1HKQ A;  4EVI A;  3L2R A;  4OAY A;  3VYU B;  1FTZ A;  1YIJ I;  2WY7 Q;  1J5Y A;  5FRM A;  2JMW A;  3FK7 A;  4RAG A;  2QLZ A;  1YFH A;  3OR2 C;  1VZ0 A;  4II3 A;  1B9N A;  4HLX A;  1T56 A;  4XNF A;  3OYE A;  1TBX A;  3EUA A;  1R5G A;  4C9Y A;  3SEQ A;  5KVR A;  5IYC J;  2RQQ A;  4OWR B;  3VPR A;  2L4M A;  5K7Z A;  1MJ9 A;  1XC5 A;  5BOX A;  4BH9 A;  4O3M A;  3K9T A;  1R1U A;  3ZMU A;  3Q3S A;  3ABT A;  4XKB A;  4Q4Z F;  3QRF F;  2F5V A;  3CCL I;  2YU3 A;  4BE0 A;  3TED A;  5DD4 A;  5DEQ A;  2ZB9 A;  5GPC A;  1R00 A;  1HXD A;  2O7O A;  2MA3 A;  3DKX A;  5ILV A;  3WTV C;  1R23 A;  3SFI A;  3FMS A;  3IKV A;  2MH2 A;  3T0Y A;  2VBW A;  4KT6 A;  2LVS A;  3RJP A;  2X1E A;  2Z33 A;  1UEL B;  4IVN A;  3ZQQ A;  1FJL A;  3M9A A;  2Y0S N;  3CC4 I;  3F8F A;  3FXU A;  3N4M A;  4A3F J;  2QA4 I;  3BWG A;  1ETV A;  2DPD A;  2PMZ N;  2LY2 A;  3SEZ A;  3SZG A;  1L0O C;  3QOP A;  3FK6 A;  1HSJ A;  1U8R A;  4RGS A;  4CHU A;  3H3V K;  3HPH A;  1TWA J;  1U5T A;  2RN7 A;  3K1P A;  2O3F A;  1OR7 C;  3AAF A;  2OZ6 A;  5ICE A;  1S7O A;  3CJQ B;  5M5Y J;  1SC7 A;  3QYB A;  1ETX A;  4EM0 B;  3TDZ C;  1IN8 A;  2DMU A;  3HHG A;  1FP2 A;  4CYC B;  4HDV A;  3CCS I;  3SHF A;  1YJW I;  1LNW A;  4G94 A;  1IRF A;  1XMA A;  2KP6 A;  3A01 A;  3S3O A;  2NVU B;  2Y31 A;  1T0F C;  3JRB A;  2GIV A;  2HOS A;  2HWV A;  4HA8 A;  1XS9 A;  1EA3 A;  4M6V A;  3HYI A;  2JSP A;  4S04 A;  4XOP A;  1VQ6 I;  2OAZ A;  3U1K A;  1IRZ A;  4OIP F;  4B3A A;  2FE3 A;  2EZH A;  1WRJ A;  5H6Q A;  2AQE A;  2L9N A;  4LK0 F;  5HDK A;  3GFM A;  4UNO A;  2FD5 A;  3H0D A;  2COM A;  3PM1 A;  3T8T A;  2D1H A;  2E1M B;  1OQY A;  1Y8R B;  2GBY A;  3Q9V A;  5J47 A;  2CWE A;  3B6C A;  1S5L C;  4R8H A;  4EGZ A;  3B73 A;  2CS3 A;  4A5N A;  1S3J A;  2AS5 F;  3PO3 J;  1XD7 A;  2YSR A;  1E3P A;  2YR2 A;  1DP7 P;  1STZ A;  3JRE A;  4AIJ A;  4XRF A;  1F43 A;  1JJ8 C;  3KYL A;  3HTS B;  2HPI A;  1NK2 P;  4ZYA A;  3VFZ A;  4L9N A;  1GXP A;  2BOL A;  2E60 A;  2MLK A;  4BEH A;  3DU6 A;  2IPQ X;  2R7U A;  3JR9 A;  2UWM A;  5D6F A;  2V26 A;  2X9D A;  4BS9 A;  1V55 H;  1T98 A;  1Z77 A;  2E2J J;  2EPF A;  1TQP A;  3J7Z I;  1JKO C;  3WTX C;  3JRH A;  2LSO A;  1SFK A;  2H8W A;  1Y0U A;  5GAG J;  1N25 A;  2HDD A;  5B1B H;  2KRC A;  4X1E A;  3K70 C;  5DUK A;  2JPC A;  2TRT A;  2VUM J;  3I4M J;  4ZZD A;  3ABK H;  2RDP A;  3L2U A;  4XKW A;  4PJJ A;  4RGX A;  4A5M A;  2BHZ A;  2E35 A;  3GTP J;  5D5U B;  3CQZ J;  3NRV A;  5GAD J;  2C6Y A;  3BRO A;  3S2W A;  3OSF A;  2KHM A;  4DNC A;  2B63 J;  2YU9 J;  4C3H J;  1FWZ A;  4MTD A;  2L3D A;  3HRS A;  2DOA A;  2NAZ A;  4DBR A;  3CD6 I;  4KA4 A;  2DJI A;  1TC3 C;  1ETY A;  4JK1 X;  1KZH A;  2AO9 A;  3VYS B;  3ONQ A;  2UZK A;  2VJI A;  4G12 A;  3LSJ A;  4P9F A;  2VKH A;  3W6K B;  2ISZ A;  3BG7 A;  3VYT B;  5BPI A;  1O3T A;  1I1G A;  1X2N A;  4ZZL A;  1V4R A;  4AID A;  4FET A;  2Q2E B;  3OL3 A;  4G6D A;  5ICC A;  4BHB A;  2R7F A;  4A3J J;  4EAT A;  3RI4 A;  2JA7 J;  1IDY A;  4E4H A;  2FQ4 A;  3CMY A;  1IV6 A;  3WGH A;  2V9P A;  2HYG D;  3J80 K;  3PNV A;  3KCC A;  1ZG5 A;  2VJJ A;  4KIT B;  3KEQ A;  1JUS A;  4UB8 C;  2RV8 A;  3IRR A;  2K7L A;  4GYI A;  3IRQ A;  1FOK A;  2KL4 A;  5BMZ A;  1KYZ A;  4QPO A;  1WJB A;  1JXS A;  1QBJ A;  2V9V A;  2HDC A;  1GHC A;  3WE3 A;  2KIU A;  2HQR A;  1FSE A;  4XRM A;  3KPH A;  3H5N A;  3L7W A;  1FOY A;  3BJA A;  3OYH A;  1BL0 A;  2ZME A;  2ZJR F;  1WJA A;  3WOD F;  1U9N A;  3WTS C;  2FA5 A;  2O6G E;  1J9I A;  3H5A A;  5M5W J;  4CDG A;  4XN3 A;  1LDK B;  3E5U A;  4IQ4 A;  1HDP A;  5KNL A;  3GZN B;  2HU9 A;  1PUF A;  2L7F P;  1W7P B;  1Z3Y A;  3F22 A;  5LRR A;  3TBI A;  4G6Q A;  4XRS A;  5H6R A;  2IGK A;  4KJZ A;  3BTL A;  2LY1 A;  3ERM A;  2V1N A;  3KLN A;  4M72 A;  3DWL E;  3SZT A;  5F04 A;  5IYD J;  3P9C A;  3LA7 A;  1WSU A;  3HOV J;  2LKX A;  2IXS A;  3JW4 A;  1DPU A;  1D1B A;  3DPT A;  5LEK A;  2A6T A;  4FAS D;  3CLO A;  3LSG A;  4LGW A;  4Y13 A;  1VQM I;  5J4Y A;  1GVD A;  2KZG A;  3CCM I;  3G71 I;  2WAQ N;  4C2U A;  3H9J A;  2CSO A;  4ESB A;  2BE5 F;  3OYF A;  3T8R A;  3V8K A;  3TW7 A;  4YEJ A;  1SAX A;  2PJP A;  1X3Z B;  1X19 A;  1R22 A;  1G3W A;  3GBG A;  2BGC A;  3O8G A;  3S8P A;  2M4K A;  4G9Y A;  4CCM A;  4D5C A;  1ORK A;  5LD2 C;  1FYL A;  3DXJ F;  2XB0 X;  2EK5 A;  2XAH A;  1PYV A;  2XF7 A;  1RI7 A;  5E1W A;  2KPM A;  3RYR A;  3NWT A;  1Y0N A;  2KDO A;  3BT9 A;  4L5J A;  5K5R A;  3OL4 A;  4LIU A;  2K3P A;  2ZFW A;  5BQT A;  1JTY A;  5A2Q K;  2JK3 A;  3D5L A;  4EEF G;  5K7F A;  3FXK A;  2DA5 A;  2XUB A;  1IXR C;  3M1E A;  1R58 A;  3WTW C;  4XLC A;  2JA8 J;  4EJV A;  2KJC A;  2IP2 A;  2MAB A;  3DTK A;  1BC7 C;  4E7J A;  4UVA A;  2TCT A;  5JR3 A;  5E17 F;  3R60 A;  1T2K A;  2GWR A;  2E1C A;  2G7U A;  1S8N A;  4HSR A;  4MGR A;  1YS7 A;  5M5X J;  4H0E A;  1Y39 A;  1XMX A;  3OYD A;  3M4O J;  2QEX I;  4PGH A;  3FIW A;  5D5X B;  3PJR A;  3GF2 A;  5B3S H;  1ZN2 A;  4EJT A;  1I6H J;  1EJ9 A;  4M3E A;  4AUX A;  2HR3 A;  4UUS A;  5HLT A;  2CFX A;  2OQR A;  3H3Z A;  1OMI A;  1QPM A;  2F6C A;  3MAJ A;  3OYN A;  4UV8 A;  2WAE A;  4EQQ A;  2O8X A;  2WAQ A;  4A3D J;  1BIA A;  5FKO A;  1QVT A;  4KMF A;  2EV0 A;  2OPT A;  1ZK8 A;  3WU0 A;  5CLS A;  4KDP A;  2WV0 A;  3TQN A;  2EA4 A;  2HVS A;  1Q1V A;  5F6F A;  5FO5 A;  3S3M A;  4D7N A;  3ERE D;  3CMA I;  2LC2 A;  4UUT A;  1SD6 A;  1MKM A;  3RDI A;  3JRA A;  1GV2 A;  5CJ9 A;  4WXD A;  4MQ9 F;  3OYC A;  2BY1 A;  1IXC A;  1YIO A;  5L3D A;  2R5Y B;  3S15 J;  1MMS A;  2OCE A;  4NUB A;  4BHP A;  2E2H J;  2VBZ A;  1IF1 A;  3NQO A;  5JVG F;  4XK4 A;  2FSW A;  4B4C A;  4OAZ A;  4B8X A;  2UXX A;  4RAF A;  3GTK J;  4XOT A;  2DK5 A;  2DOD A;  2V6C A;  1BR2 A;  1LDJ A;  2CG4 A;  1MD0 A;  4L0Z B;  5DD8 A;  4XLE A;  2HQA A;  4LIV A;  3G1M A;  4M6Y A;  2PQ8 A;  4CCJ A;  1IN4 A;  2M45 A;  4IHT A;  3WG7 H;  2EQR A;  1OLT A;  4JP0 A;  3KEY A;  1IGN A;  3PQJ A;  4HAM A;  4M9X A;  4YIR X;  2V79 A;  2LBF B;  2ZFU A;  3ZQI A;  2H6B A;  4ZJZ A;  3EYI A;  4NC6 A;  3M8F A;  3BG5 A;  5IY5 H;  4OIR F;  4KIF A;  2V7F A;  5EG0 A;  3JAM K;  1S29 A;  2DN0 A;  2LR8 A;  2Z3Y A;  2CV1 A;  2FJ1 A;  4BBS J;  3PUB A;  4A0Y A;  2M87 A;  2MYS A;  3HTU A;  4CZC A;  2X6W A;  5J1Y A;  3GWZ A;  2R92 J;  2FQ3 A;  5FKM A;  2K4B A;  3IHU A;  1R7J A;  4HG2 A;  4M74 A;  1SFU A;  2F4I A;  3LST A;  3DP7 A;  4HX8 A;  3LA3 A;  5EEH A;  3ZQC A;  2ZNY A;  4J00 A;  1R71 A;  2H94 A;  2RKH A;  4GDF A;  3OIQ A;  2ZXW H;  3O8H A;  3H5R A;  3EYY A;  3BCA A;  3SXY A;  1I39 A;  3R4K A;  1H88 C;  1RET A;  1TP4 A;  2W7N A;  1T8I A;  2A69 F;  4HV6 A;  1ETK A;  4N9I A;  4OIN F;  4BDZ A;  3S14 J;  3IUO A;  1B72 B;  1E3H A;  4PDK A;  1W7P D;  5L3F A;  3RKQ A;  1AU7 A;  2JWT A;  2GAU A;  2LYC A;  2FF4 A;  2VBY A;  3DCF A;  2ZXH A;  4WF2 A;  2KQR A;  1S7A A;  4BYY A;  4U87 A;  5HS7 A;  2A6H F;  2ZC2 A;  3A1Y A;  3CJN A;  1EH7 A;  2LP0 A;  4BXF A;  4IHX A;  5HS9 A;  2D45 A;  1RRJ A;  5CVV A;  4XMY A;  3F21 A;  2LOO A;  3FKJ A;  3GTM J;  2BHY A;  1P7J A;  3AL0 C;  2EZL A;  1FEX A;  5CPR B;  1MBF A;  2ZSI B;  3LAJ A;  3E6C C;  1ITY A;  1HQC A;  2XAF A;  2QWW A;  1G2H A;  3L00 A;  1FBU A;  1FOX A;  3FM3 A;  4XOR A;  3EPZ A;  1Z6R A;  3LSI A;  3FKI J;  1TNS A;  5D5W B;  2O8K A;  3HEF A;  4XKV A;  1D5Y A;  1IN5 A;  2Q0O A;  3QU6 A;  1FT9 A;  1YTY A;  3ZQL A;  4L5E A;  2R5Z B;  4XSX F;  2ZBK A;  3FX3 A;  3UNG C;  1H9T A;  2R7X A;  5DCM B;  5J4V A;  2JN6 A;  4CGZ A;  5HOO A;  3QOE A;  2V9K A;  5F1R A;  3HOS A;  3T5X A;  4FTH A;  1F5T A;  1T39 A;  2VE9 A;  2BXZ A;  1ERD A;  1IUF A;  1JTX A;  1YW7 A;  4LOC A;  3CUO A;  1ZQ3 P;  4B1R A;  1WKM A;  4KN4 X;  1Y8Q B;  4B09 A;  1MNE A;  4KNY A;  1Q1H A;  1OIS A;  5CVI A;  4BAC A;  4HDU A;  2XKP A;  4XLF A;  2Y75 A;  2DT5 A;  2CUZ A;  2VB6 A;  4YIF A;  2R0Q C;  4RM3 A;  4ZDL A;  5IP6 A;  5E20 A;  4V2F A;  1Z9C A;  2P7C B;  2ACJ A;  1UG2 A;  2QVO A;  3ZQH A;  3WHB A;  4M3D A;  4DIQ A;  5ILS A;  1YIT I;  1GVJ A;  4MLO A;  1I6X A;  2M8E A;  4AYB N;  2CQK A;  2DA7 A;  2JT1 A;  3ZR8 X;  2KMU A;  5BNG A;  3R0A A;  4CYC A;  4PJM A;  3JRD A;  4IRH A;  4DZJ A;  3KYC B;  2XF6 A;  3LA2 A;  3OY9 A;  2P6S A;  3RPQ A;  1KU9 A;  2MC4 A;  2VKE A;  2B9S A;  2ICW G;  3Q9S A;  3IH2 A;  4EM1 A;  3WTT C;  4ZTF A;  2QYO A;  2YUS A;  3QOD A;  4JBA A;  1W1W E;  5E1Z B;  4Y33 A;  1U3E M;  1WJC A;  2YX4 A;  1QZY A;  2L5Q A;  2ZXI A;  3GTQ J;  2WAD A;  1SD4 A;  4WWC A;  1FSH A;  1WVR A;  3FDY A;  2DMP A;  3K6G A;  1DGR M;  2XF5 A;  3SYT A;  4XLA A;  4AVZ A;  1IRX A;  1D5V A;  2PJR B;  1BOA A;  4YEL A;  3CCR I;  1ZG1 A;  3S1Q J;  1YOV B;  2IA2 A;  4BU2 A;  3ZMV A;  1TW3 A;  3CO6 C;  2RAE A;  2VL8 A;  2Z9O A;  5DM6 F;  2KZV A;  3P9I A;  3LWF A;  4D1Q A;  2RNG A;  4LG0 B;  2NNY A;  4C30 A;  2L0K A;  1D1A A;  4XKC A;  1OCT C;  1XGN A;  1ZYR F;  2MBF A;  2XGX A;  4LJZ F;  4U0W A;  3GTJ J;  1RR7 A;  3K70 D;  2WWY A;  3FXR A;  2VPL A;  4AYB A;  2LD5 A;  1ZAR A;  4ESF A;  2O9L A;  2HOE A;  3HIF A;  4WK8 F;  2Z2S B;  3D1N I;  1ZRF A;  1R4M B;  5GAH J;  2IGO A;  2X6X A;  5GP9 A;  3AFH A;  2E5Z A;  4P9U A;  1R9T J;  4MFE A;  3OYM A;  4PSW A;  1TL8 A;  3N97 A;  4F7Z A;  3VOD A;  2WV1 A;  1A5J A;  4HEA 2;  4UUV A;  3H1C A;  2ZSH B;  4HNT A;  4CCK A;  3C7J A;  4HNU A;  2FBH A;  3FMR A;  3BR2 A;  1YJ9 I;  3K4N A;  2OQG A;  1YG2 A;  4V19 K;  2CQX A;  2P5K A;  1TNT A;  1I50 J;  2VIX A;  2F5E A;  1Z1D A;  2EZI A;  4KIS A;  3CP2 A;  2FXA A;  2R4G A;  4G6T B;  5DS9 A;  2VQG A;  2EB7 A;  4P1W A;  2OTJ I;  1W5S A;  1IN7 A;  3E6D A;  5FRN A;  3BCB A;  3A4C A;  1X1C A;  4RB1 A;  3CC2 I;  4AD9 A;  4AIH A;  1HOM A;  4LD5 A;  3I5U A;  2R3S A;  3ECO A;  4BQO A;  1ZRD A;  1D3Y A;  2YPR A;  3H92 A;  3UKG A;  3BZ6 A;  6PAX A;  3BG6 A;  2XAU A;  4M3F A;  1IC8 A;  3OMY A;  3H9G A;  1O3S A;  1P4X A;  3S2H J;  1MMG A;  2MGQ A;  3PQK A;  2QM3 A;  1Y1W J;  5FLX Z;  1J59 A;  2EH3 A;  3HC7 A;  3OYI A;  2E19 A;  1GT0 C;  4DYR A;  5JLX A;  3PNY A;  3PL8 A;  1BIB A;  1ZEL A;  2K9N A;  3KP4 A;  2Q2E A;  4A12 A;  4BKX A;  4BXU A;  1BR4 A;  5ICF A;  1YI2 I;  1QPI A;  3HM5 A;  2HXI A;  1MMA A;  2J5P A;  3C2H A;  3ZGK A;  2EIJ H;  3HGG A;  2O5R A;  1ETW A;  3CF2 A;  4M9S A;  1ON1 A;  1W5T A;  2BW3 B;  2CW8 A;  2EJR A;  1MMN A;  3KET A;  2MLG A;  1TWG J;  1OCC H;  2F2E A;  2QQ8 A;  4ETS A;  4CYD A;  3ABM H;  4I0B A;  4IJA A;  1VQP I;  2QQB A;  1BJA A;  2DW4 A;  3VSK A;  2LDU A;  2N8G A;  1JUM A;  1RUO A;  1V5F A;  2QQA A;  3BTI A;  1TT0 A;  5C4J J;  1RNL A;  5GTH C;  1Z0X A;  2XSJ C;  1ULY A;  3D0S A;  4HF0 A;  4M73 A;  2BVL A;  1LFP A;  1ETO A;  4HZF A;  3CES A;  3GFI A;  2IT0 A;  2HGC A;  3AL0 B;  5IT9 K;  3MD2 A;  1W7P A;  2DOE A;  3GYH X;  1U78 A;  3ECH A;  4JX6 A;  2XIG A;  5D4S A;  2Z99 A;  1H89 C;  3TO6 A;  5L3B A;  1HCR A;  3L09 A;  2DYS H;  5HNH A;  5KK1 A;  3C18 A;  3L2V A;  3CF5 F;  3WHC A;  3TKY A;  3NAU A;  3MQ0 A;  4XON A;  3E0J B;  2CJJ A;  4BJ6 C;  2M8G X;  1RIO H;  4EJW A;  1ONV A;  4U0Y A;  1GXQ A;  5LHG A;  3J80 Z;  4XM3 A;  2JVG A;  3E6B A;  3WTU C;  3LNQ A;  1MSF C;  4GCV A;  3F8C A;  4F91 B;  4MHG A;  3LSM A;  2CV0 A;  4UVC A;  1RKT A;  2LMD A;  3WU2 C;  1OCR H;  3TDU C;  1QU3 A;  2IJL A;  3DV8 A;  5GTI C;  4HF2 A;  2VQH A;  1K78 B;  2PI0 A;  1J09 A;  2R7O A;  1TQI A;  2E7X A;  3Q0V A;  2IGM A;  1SVM A;  2ZO4 A;  4I09 A;  4PCQ A;  2FNP A;  3F8M A;  1FMV A;  3GZ6 A;  3DU5 A;  3CZ6 A;  2OBP A;  1V3F A;  2MG4 A;  5EYR A;  2JVH A;  3BDD A;  4HV5 A;  4IHW A;  4TV7 A;  1OR7 A;  1HBX G;  1BJZ A;  1ZH5 A;  5KAI C;  3I3L A;  1X1A A;  2D5V A;  3QWL A;  2W4S A;  2ZJP F;  3S3N A;  3QYE A;  4OOI A;  4FX0 A;  4NBQ A;  1U0J A;  3DEW A;  3I59 A;  3EDP A;  2R7V A;  2JA5 J;  3BQY A;  1VQ9 I;  3E1S A;  1MBH A;  1T0F A;  1OFC X;  2NVY J;  3K4B A;  2CQN A;  2DDA A;  1B6A A;  1HC8 A;  1WPK A;  3DEE A;  4U7D A;  5CVU A;  2FML A;  3BR0 A;  2HQN A;  1MMD A;  2VPR A;  4EJU A;  4IQJ A;  1MNM C;  3KYD B;  4PJ0 C;  3OYJ A;  3FHN A;  1FY7 A;  5D6E A;  1J2X A;  2EIN H;  1FIP A;  1BBY A;  1R4N B;  1AA7 A;  4XL9 A;  1R1T A;  1P4W A;  4NQW B;  3HSR A;  2FMY A;  3K2Z A;  3CP8 A;  4LB6 B;  2F48 A;  3I53 A;  1UG0 A;  4RB0 A;  1RZ4 A;  4KMU X;  3KP7 A;  3HRM A;  4UHT A;  2BY2 A;  1HLV A;  2NVX J;  3K1N A;  5F0F A;  1SEU A;  1QNT A;  3WTY C;  2GA2 A;  5D4R A;  4G7H F;  4CIC A;  2B7E A;  2M4G A;  2O03 A;  2Y30 A;  4OU0 A;  2WC2 A;  3DTI A;  3QPL A;  1BOB A;  3HOX J;  5BS6 A;  5E3O A;  1SFE A;  5FLV A;  3E7L A;  2L54 A;  3GEZ A;  1W0U A;  2K9S A;  2XAJ A;  2DT6 A;  2A68 F;  5L3C A;  3IAS 2;  1KQ0 A;  2E36 A;  2CO5 A;  1YHQ I;  5GAE J;  2LBF A;  3KX2 A;  4RMN A;  2A6E F;  1WH7 A;  1O57 A;  3CTA A;  3REO A;  4GGG A;  2XC7 A;  2EFO A;  4IHV A;  4O6J A;  2HI3 A;  1UFM A;  2DDB A;  1X3U A;  4PSX A;  2CGP A;  2ETH A;  2ELH A;  2QBY B;  1J7K A;  4ZH4 F;  2CQQ A;  3DTE A;  2NOG A;  1W36 C;  1K7A A;  4KYW A;  2DFE A;  3AG4 H;  3S1M J;  1O7L A;  2M0C A;  2XHK A;  2I10 A;  4HLY A;  4MEY F;  1ZRE A;  2BVM A;  2FOW A;  4ASN A;  3R0J A;  5B1A H;  1EV7 A;  5HLI A;  4DGW B;  2XB5 A;  3KLO A;  4EMS A;  2BEO A;  1KA8 A;  1X3W B;  5JFR A;  2RGV A;  1DQU A;  4RBO A;  4A3L J;  1YE9 A;  1Z7U A;  3G6E I;  3O3K A;  3Q0U A;  1FX7 A;  3IH3 A;  2RRE A;  4Y4R A;  3M3Y J;  2ZJ2 A;  1W5C C;  4HQM A;  5J8F A;  1KU3 A;  5H20 A;  1UMQ A;  1B72 A;  1T95 A;  2HVR A;  4ZYG A;  4I6Z A;  1DDN A;  5F27 A;  3U21 A;  2DFF A;  4WX9 A;  3V7C A;  5EJC A;  4L0Y B;  1RUN A;  1R6R A;  4M3G A;  4EV0 A;  4LIT A;  4QWQ A;  2M1B A;  4O5V A;  2EBI A;  2EWN A;  1W4M A;  1Z05 A;  3MKZ A;  2F5C A;  4PK4 A;  4HF1 A;  4IX7 A;  1TZL A;  2JUG A;  3L2C A;  5E3M A;  5DTD A;  3OOP A;  1ZAO A;  3MKW B;  2VC0 A;  2G7H A;  2XVC A;  3HRU A;  1FYM A;  3HSE A;  1XGO A;  4LB5 A;  2HOT A;  2EV6 A;  2HKO A;  1QRY A;  2VN2 A;  2STT A;  3QQA A;  4A3B J;  1A35 A;  2E1N A;  2CUJ A;  2ID6 A;  4KN7 X;  4BY1 J;  2ELK A;  1K6Y A;  1SMY F;  2JZY A;  3WG9 A;  2DA4 A;  3BG3 A;  2M0M A;  3S93 A;  1WH5 A;  5DCM A;  5EZH A;  2P8T A;  2R7Z J;  1OKR A;  2HEO A;  5HOD A;  2IA1 A;  3R61 A;  2V4J C;  1VFC A;  3PFY A;  3H0G J;  2GLO A;  3HSF A;  3KZI C;  1JI8 A;  1XDU A;  2DMN A;  1G3S A;  3U9G A;  4U0V A;  1WWX A;  2R7D A;  2IGN A;  3TMO A;  3GXO A;  3SZP A;  4L9T A;  3M8E A;  1T38 A;  2VT2 A;  1KQ8 A;  3IC7 A;  1V54 H;  2FX0 A;  2W82 A;  3KIO A;  2X1D A;  1MW7 A;  2L7Z A;  3CCY A;  1T6S A;  3EQL F;  2K02 A;  2HDW A;  2VKV A;  1LEA A;  1RC9 A;  5FD5 A;  4IZZ A;  1AOY A;  2H1L A;  2XAG A;  3H3U A;  3I54 A;  4IRG A;  2LRD A;  2PEX A;  2XKO A;  3LMM A;  3PSI A;  1R36 A;  4YRV A;  1F4K A;  1UCR A;  2EA2 A;  3TO9 A;  1Z6T A;  3CCV I;  2FRH A;  1LE8 B;  4F93 B;  4NB5 A;  3TOB A;  3MZ8 A;  2W24 A;  1VQO I;  3EUH C;  4S05 A;  1RKW A;  4NDL A;  1I3Q J;  2HVQ A;  3FBI B;  1X1D A;  2HYJ A;  3QYF A;  3LAP A;  1WZ2 A;  2WY8 Q;  1AHD P;  2GOM A;  2KIQ A;  2Y48 A;  1D8K A;  4AC0 A;  1HF0 A;  1TWH J;  2R7T A;  3HRT A;  5C4X J;  4BXX J;  2GIZ A;  1XCB A;  5J1U A;  2LLK A;  4WXH A;  3BLY A;  4MQV A;  2P5L C;  2B0L A;  4R79 A;  2E7W A;  4UB6 C;  1UHW A;  3WGG A;  2PJR A;  4N9H A;  4RLF A;  1H0M A;  3KE2 A;  4X6A J;  5HLH A;  5IT3 A;  2W85 A;  3FXO A;  5EF6 A;  3OYB A;  3BG9 A;  2XPV A;  3LSK A;  4LG0 A;  1W0T A;  1D8J A;  1QGP A;  5M3F J;  1UAA A;  3MKY B;  3OV8 A;  1JHH A;  2ZKZ A;  1J0R A;  2PMH A;  3ISP A;  1G59 A;  2FU4 A;  1I3A A;  1H9G A;  3JRF A;  1MJA A;  5B66 C;  1K4T A;  1G4D A;  5ED4 A;  2R93 J;  2HZT A;  2L02 A;  5LGT A;  4MEX F;  4HW0 A;  4A0Z A;  4A3M J;  2RC4 A;  1LUJ B;  3L2Q A;  4OIQ F;  2CUE A;  2KIM A;  4RAY A;  5ICG A;  1LQ1 A;  1YRN B;  2E2I J;  1NK3 P;  3RQ4 A;  2XGD A;  3MWM A;  1AKH A;  4ENN A;  1XCV A;  3HBL A;  1BC8 C;  1D0Z A;  3ABL H;  1HW5 A;  3RKX A;  3C3W A;  4ZYE A;  1G3Y A;  3F23 A;  3FBN B;  3DFG A;  4BUP A;  2L2O A;  4RS8 A;  2BY0 A;  1A36 A;  4LK1 F;  2ECB A;  4MIM A;  3OS1 A;  2VOO A;  4CO8 A;  5HVQ C;  4KUM A;  4N4O B;  3ELK A;  3SDB A;  2QGU A;  2X1C A;  4RA2 A;  3HL2 A;  1IUY A;  1XGS A;  5EEA A;  1B8I B;  2Y0M A;  4UV9 A;  2MW8 A;  4PUS A;  1N75 A;  2P6T A;  1WFX A;  4QTR A;  5EDN A;  4LLL A;  3W6V A;  2QUF A;  9ANT A;  3H9Q A;  1D0Y A;  1SFO J;  1NG7 A;  3SFZ A;  1UHS A;  2LH9 A;  3ZRG A;  5FFZ A;  4PJL A;  2KIF A;  2W48 A;  2F4O B;  3L9F A;  4RB3 C;  1K61 A;  3HOZ J;  3PNT A;  5LGU A;  4XQF A;  2DTZ A;  1CF7 B;  2PLY A;  1ON2 A;  3ZMS A;  2EZK A;  1V5G A;  4CA0 A;  4JX4 A;  2RNJ A;  1K79 A;  1OYY A;  1FP1 D;  2DA6 A;  4IRI A;  1HKS A;  1YYV A;  3TP0 A;  1MH4 A;  3SQN A;  2BW3 A;  3RZO J;  4C3I J;  4FQG A;  3H35 A;  5J1R A;  2HZD A;  1HA8 A;  3F6O A;  3LQR A;  5FB2 A;  4UVB A;  1Z67 A;  1LB2 A;  3PIP F;  2K27 A;  2I8D A;  1IW7 F;  1RPW A;  2ESH A;  3ZCO A;  3FXJ A;  3DEU A;  3J81 Z;  3M8J A;  1GUU A;  2STW A;  4L9J A;  2DYR H;  4HX4 A;  1IV8 A;  3KFW X;  3QPS A;  2GOX B;  3E6M A;  2AXT C;  5C3E J;  1ODD A;  4Y7N J;  5JHF A;  3G3Z A;  3B02 A;  2EV5 A;  3N05 A;  4HST A;  2E34 A;  3D5R C;  3LFK A;  2NVT J;  5L3E A;  4F52 A;  4CSW A;  3FHZ A;  5HLG A;  1ZGJ A;  2L9V A;  3OYG A;  4E7K A;  1FTT A;  3O6B B;  1JUP A;  3HKZ N;  1OYW A;  3JRG A;  3FM5 A;  2W57 A;  3MZY A;  1LFU P;  2DFI A;  3IWF A;  2QEN A;  5D8K B;  1MGT A;  4OMZ A;  4B44 A;  4UUS B;  2DK8 A;  1WQ2 A;  2VQC A;  1REP C;  1DU0 A;  1QQI A;  2VQL A;  1ZKG A;  3R6S A;  4IEJ A;  5E18 F;  5E79 C;  4YFK F;  1X1B A;  3NAR A;  3OOU A;  5E3N A;  2Y2Z A;  5CKT A;  2IS2 A;  4F92 B;  2DO7 A;  1MBG A;  2XGE A;  3KP3 A;  1P9Q C;  2CMP A;  2L7M P;  1IO2 A;  5FKL A;  3MVP A;  3GTL J;  1LJ9 A;  1XMK A;  4WCG A;  1K78 A;  1Y6I A;  1OPC A;  4AIK A;  1C0W A;  1SVL A;  2LF8 A;  3L1P A;  4QSH A;  4N4N B;  4G8X A;  3ZMZ A;  1VND A;  5EZG A;  3I9V 2;  2I5U A;  2FEZ A;  3DPL C;  1VQK I;  4RGR A;  3G1L A;  5AON A;  3VDX A;  4ZYD A;  2NS0 A;  1E3O C;  4IHY A;  1ZTR A;  4KIC A;  5FLM J;  1VF9 A;  4E7I A;  2WAF A;  3CMM A;  3M7G A;  2K5C A;  4KIB A;  4RAZ A;  5IOY A;  4JYK A;  1MDM B;  4GO1 A;  2DA2 A;  3GLL A;  1DGW Y;  1BW6 A;  5ERI A;  3CME I;  2AXL A;  5DCF A;  1YO5 C;  2VAS A;  1FPQ A;  3CUQ C;  4E70 A;  2LKS A;  2DT7 B;  3T1B A;  2ZCW A;  3G2B A;  2G9W A;  3HKZ A;  1LFB A;  2VT3 A;  3V8L A;  5K5O A;  3BR6 A;  4RB2 C;  5TRD A;  1O4X A;  2O61 A;  5EGO B;  3LSP A;  5IPA A;  2IS6 A;  2ZNZ A;  3FZV A;  1UZC A;  3OYL A;  4P96 A;  2L01 A;  4C2T A;  1QZZ A;  2CW7 A;  3GW2 A;  4KT5 C;  1Z91 A;  2GXG A;  2NYX A;  2GM4 A;  5M3M J;  4II2 A;  5DUI A;  3HJE A;  1OJL A;  2EFQ A;  1BI2 A;  3I4P A;  4HRI A;  2K9L A;  4Y3O A;  4LG3 A;  1PP7 U;  2QZ8 A;  3BR3 A;  3L2W A;  4HBL A;  2L9S A;  2LTP A;  3BZC A;  4IXA A;  1NTC A;  3TGN A;  3K10 A;  3W3C A;  2V1D A;  5LEJ A;  4G7O F;  2VJ5 A;  4BDY A;  3BOQ A;  4BQA A;  3CCU I;  4FHT A;  5J40 A;  3K0L A;  3GUD A;  4D9J A;  3HDD A;  4L5I A;  4M9Z A;  4S0H B;  1Y56 A;  2ECC A;  3RKW A;  4NQW A;  1BW5 A;  1XGM A;  3ZOB A;  2QSG X;  4EGY A;  3FWE A;  1UJ8 A;  4FX4 A;  1V5E A;  1VQ5 I;  2HXO A;  2R7R A;  1U6G A;  2P81 A;  1X2M A;  5D5V B;  3GFL A;  4IKF A;  1B59 A;  2PFB A;  4IPA A;  2PX9 A;  3J7A O;  4ENK A;  3ROU A;  1GLN A;  3E3V A;  2NS7 A;  2GQQ A;  3IV5 A;  2LNB A;  1XN7 A;  3C1D A;  2HTS A;  3F6V A;  1W36 D;  3K69 A;  5DYM A;  4KIG A;  3ESW B;  2UUZ A;  2M2E A;  1A31 A;  4NC8 A;  2Q8K A;  1VQ4 I;  2CUF A;  1U5T C;  4YFN F;  2EFP A;  2F4M B;  3HXL A;  3KP6 A;  1J75 A;  4I2O A;  5K7H A;  2NVQ J;  1E2X A;  1WHU A;  3W2A A;  4A2U A;  4A69 C;  2A61 A;  2JRT A;  4IL6 C;  2LFB A;  2P0W A;  2BY3 A;  2MD5 A;  3GME A;  2QBY A;  1FLI A;  3C2B A;  4CCO A;  2VI6 A;  3I0T A;  5HDN A;  1E0E A;  2EIL H;  2Y69 H;  3E97 A;  1ZG3 A;  5FFX A;  3K4L A;  3KZZ A;  1BM9 A;  2QCO A;  5E8G A;  1JGS A;  3CO7 C;  5F64 A;  2KJB A;  1PUE E;  1A6I A;  2LF7 A;  3OIP A;  4BJ5 C;  3MKL A;  3S17 J;  2KRH A;  5J8C A;  1MBE A;  2OV7 A;  4PFO A;  4XLN F;  1ZHF A;  4M3B A;  1JT6 A;  4AVP A;  2EIM H;  2JPB A;  1BI3 A;  4UXN A;  5KCM A;  4A3I J;  3V8J A;  4EM2 A;  3F9K A;  2V1U A;  2LG4 A;  2JJ7 A;  1CQT A;  2XPU A;  3HUG B;  1G8X A;  3W2W A;  3DLA A;  1P6R A;  2AQF A;  3KP2 A;  4HQE A;  1R49 A;  1KGS A;  4E6K G;  1RES A;  2M30 A;  2OF7 A;  1XX5 A;  5JLW A;  3LSR A;  4IF4 A;  4BL0 B;  1LKX A;  2D1V A;  1KYW A;  1YW8 A;  1FNN A;  2X0L A;  3CCJ I;  4NHJ A;  3BTC A;  2JA6 J;  4XR6 A;  1NG6 A;  3TO7 A;  1QZE A;  1SVO A;  2V6E A;  4HNV A;  2GXA A;  2Z5U A;  4Q5S F;  4E7S A;  4Z2Y A;  3P9K A;  3OS0 A;  3AG1 H;  2VXZ A;  3LSH A;  5F08 A;  1WJ5 A;  4J01 A;  2OTL I;  4DQ2 A;  3CCQ I;  1FOW A;  2WBM A;  3I71 A;  2P4W A;  1Z7L A;  3BJ6 A;  5CQG A;  1JHF A;  3CJR B;  4BY7 J;  4NC7 A;  2A3S A;  1GV5 A;  1VI0 A;  2DLL A;  3F8N A;  5LHI A;  2KLO A;  1H8A C;  1IG7 A;  5CYV A;  2E71 A;  3F3X A;  1G6N A;  3CDI A;  4I98 B;  2Y0S A;  1P4A A;  3VSL A;  1P92 A;  1TLH B;  1UST A;  1Z3X A;  3QPT A;  2PMZ A;  1JT0 A;  4A0X A;  2CYY A;  5LFA A;  4M71 A; 
#chains in the Genus database with same CATH homology
 4QPQ A;  3EUK L;  2IS1 A;  3A1Y A;  4BXF A;  1D1C A;  2M0M A;  1MND A;  4XMY A;  3S93 A;  1X4O A;  4DOZ A;  2LOO A;  3FKJ A;  2R7Q A;  1KON A;  3S32 A;  3AL0 C;  5CPR B;  2ZSI B;  2V4J C;  3PFY A;  1JI8 A;  4XOR A;  3EPZ A;  3LSI A;  2IGN A;  3TMO A;  3L2R A;  4OAY A;  4XKV A;  3VYU B;  2WY7 Q;  5FRM A;  3OR2 C;  4ZC3 A;  1VZ0 A;  4II3 A;  2W82 A;  2X1D A;  4F55 A;  1MW7 A;  4AU7 A;  4ZTJ A;  4P5O A;  3UNG C;  2R7X A;  4XNF A;  3OYE A;  2HDW A;  1S9H A;  3EUA A;  2X85 A;  5HOO A;  4C9Y A;  4IZZ A;  3SEQ A;  3QOE A;  2V9K A;  3HOS A;  2RQQ A;  4OWR B;  2LRD A;  1PJR A;  3LMM A;  1ERD A;  3PSI A;  4YRV A;  2ELJ A;  3RCO A;  4F93 B;  1QHH D;  1MNE A;  2XDV A;  4XKB A;  4BAC A;  4XLF A;  3EUH C;  2F5V A;  4BE0 A;  2CUZ A;  2VB6 A;  4RM3 A;  4ZDL A;  4ZDO A;  2HVQ A;  3FBI B;  1X1D A;  2VJ4 A;  3DKX A;  3QYF A;  3RPU D;  2WB1 A;  2WY8 Q;  4DIQ A;  2GOM A;  4KT6 A;  2R7T A;  4DJA A;  2X1E A;  4MLO A;  1UEL B;  3ZQQ A;  3ZR8 X;  2KMU A;  3BLY A;  4PJM A;  3K4K A;  4R79 A;  2XF6 A;  3OY9 A;  2MC4 A;  4ZTF A;  2PJR A;  4RLF A;  2LY2 A;  3SEZ A;  3SZG A;  3QOD A;  2VXD A;  3HPH A;  3OYB A;  1OR7 C;  4Y33 A;  3LSK A;  2R7S A;  1WJC A;  4BQN A;  1YX3 A;  4BE1 A;  1UAA A;  3MKY B;  3CJQ B;  5KHD A;  2L5Q A;  3QYB A;  2VKD A;  2ZXI A;  2WAD A;  1G59 A;  2VLA A;  1WJF A;  3FDY A;  3K6G A;  4NNJ A;  1DGR M;  2XF5 A;  3SYT A;  4XLA A;  4AVZ A;  2KP6 A;  1IRX A;  3S3O A;  5LFA A;  2PJR B;  1T0F C;  4YEL A;  4BU2 A;  3L2Q A;  1EA3 A;  2VL8 A;  4CUG A;  2JSP A;  2KZV A;  4X0G A;  3K4J A;  4XOP A;  2RNG A;  4D1Q A;  4C30 A;  4XKC A;  1D1A A;  1QHG A;  3RQ4 A;  3K70 D;  2AQE A;  2L9N A;  2X51 A;  2VPL A;  4AYB A;  3H0D A;  2E1M B;  2Z2S B;  1D0Z A;  4F3Q A;  2IGO A;  2X6X A;  3V42 A;  2CS3 A;  3FBN B;  3AFH A;  2E5Z A;  4BUP A;  4RLQ A;  2L2O A;  3OYM A;  4PSW A;  3OS1 A;  3HG9 A;  5HVQ C;  3SDB A;  4N4O B;  4HEA 2;  2X1C A;  2ZSH B;  4HNT A;  4CCK A;  3KYL A;  4HNU A;  3HL2 A;  2HPI A;  2QKM B;  3K4N A;  4ZYA A;  4PUS A;  1N75 A;  2BOL A;  1WFX A;  2VIX A;  4DBQ A;  2E60 A;  4KIS A;  3CP2 A;  4BEH A;  3DU6 A;  2R4G A;  4G6T B;  1N77 A;  1X4P A;  3H9Q A;  2OUM A;  2UWM A;  2CH0 A;  2VQG A;  4P1W A;  2R7U A;  1D0Y A;  2V26 A;  4BS9 A;  1NG7 A;  2W00 A;  1BR1 A;  2LH9 A;  3ZRG A;  4PJL A;  5FRN A;  3BCB A;  3A4C A;  1X1C A;  1SFK A;  3PNT A;  2W1O A;  4XQF A;  5TGT A;  4BQO A;  4CA0 A;  1V5G A;  2KRC A;  3BG6 A;  3K70 C;  1WJD A;  2XAU A;  3ZXS A;  3OMY A;  2BW3 A;  3H9G A;  4B48 A;  4E7Z A;  3L2U A;  3H35 A;  4BEH B;  4XKW A;  2HZD A;  4PJJ A;  1HA8 A;  4ANJ A;  1MMG A;  2K9M A;  3HC7 A;  3OYI A;  2I8D A;  3PNY A;  3ZCO A;  3PL8 A;  3M8J A;  1ZEL A;  2KHM A;  1BR4 A;  3AKZ A;  2GOX B;  1MMA A;  3C2H A;  5JHF A;  3ZGK A;  5FRO A;  4BQQ A;  2O5R A;  2DOA A;  3N05 A;  3CF2 A;  4HST A;  4DBR A;  2BW3 B;  2DJI A;  2CW8 A;  3D5R C;  1MMN A;  4PJN A;  4F52 A;  4CSW A;  3D5S C;  3VYS B;  3OYG A;  3C2G A;  3ONQ A;  4E7K A;  2VJI A;  2VKH A;  3BG7 A;  3VYT B;  4HPQ A;  3VSK A;  4FET A;  2Q2E B;  3OL3 A;  1V5F A;  1SAU A;  4B44 A;  4EAT A;  4E4H A;  1TT0 A;  2VQC A;  3OWT A;  2VQL A;  3PNV A;  4BGD A;  2XSJ C;  2BVL A;  2VJJ A;  1X1B A;  1LFP A;  2LRE A;  3OOU A;  3CES A;  4KIT B;  2IS2 A;  5CKT A;  3AL0 B;  4F92 B;  3OR1 C;  1P9Q C;  2CMP A;  3NWS A;  3MD2 A;  2KL4 A;  4QPO A;  1WJB A;  1Y6I A;  4N4N B;  3I9V 2;  3DPU A;  3DPL C;  3VDX A;  4CCL A;  5HNH A;  3H5N A;  3OYH A;  3L2V A;  4XN0 A;  1WJA A;  4XON A;  3E0J B;  3OYA A;  4BJ6 C;  4E7I A;  2WAF A;  3CMM A;  3H5A A;  2K5C A;  4RM2 A;  1LVK A;  4XM3 A;  2JVG A;  4XN3 A;  1LDK B;  3MMY B;  4IQ4 A;  1DGW Y;  3HOT A;  3VWB A;  1N78 A;  3K4M A;  4F91 B;  2HU9 A;  5KNL A;  2A5W A;  4BJT A;  2VAS A;  3LSM A;  2CV0 A;  1Z3Y A;  2HPM A;  3TBI A;  1QU3 A;  3OS2 A;  2DCE A;  2DT7 B;  3IAM 2;  3G2B A;  2VQH A;  1J09 A;  2R7O A;  2CV2 A;  2IGK A;  3HKZ A;  4KJZ A;  2LY1 A;  2V1N A;  3DKY A;  2IGM A;  3DWL E;  2HNH A;  2IXS A;  1D1B A;  2IS6 A;  3DPT A;  1FMV A;  2A6T A;  4B47 A;  4FAS D;  3DU5 A;  3LSG A;  3OYL A;  3CZ6 A;  4BE2 A;  4C2T A;  2CW7 A;  3DQV C;  2JVH A;  4II2 A;  4C2U A;  3H9J A;  5HNF A;  3I3L A;  3OYF A;  1X1A A;  4YEJ A;  4HRI A;  2MD0 A;  2K9L A;  4ITV A;  4Y3O A;  4ZDP A;  4LG3 A;  2W4S A;  3S3N A;  1X19 A;  3QYE A;  3L2W A;  2M3A A;  3GBG A;  2L9S A;  3LL7 A;  1U0J A;  3S8P A;  2FUG 2;  2M4K A;  2M7B A;  4E7L A;  2R7V A;  4CCM A;  5LD2 C;  3K10 A;  3W3C A;  2VJ5 A;  1FMW A;  4BDY A;  1PYV A;  2XF7 A;  3E1S A;  2KPM A;  4JQF A;  4D9J A;  3NWT A;  2KDO A;  1Y56 A;  3OL4 A;  5CQE A;  3HPG A;  4LIU A;  3K4B A;  3UR3 C;  2K3P A;  1V5E A;  3D5L A;  3A2K A;  2R7R A;  2WA0 A;  3DEE A;  2R7W A;  4XLC A;  1MMD A;  2MAB A;  3TL4 X;  4IQJ A;  4IKF A;  3DTK A;  3OYJ A;  3FHN A;  4E7J A;  1GLN A;  3M1C A;  3LFU A;  4HSR A;  3OYD A;  1AA7 A;  4XL9 A;  3PJR A;  1W36 D;  4NQW B;  2UUZ A;  4NC8 A;  1DP3 A;  5HLT A;  3CP8 A;  2F6C A;  3OYN A;  3J7A Y;  4H4K C;  1UG0 A;  2WAE A;  2WAQ A;  3IP4 B;  3HXL A;  3W2A A;  3VYR B;  4B3X A;  2P0W A;  2HVS A;  2E1M C;  2M4G A;  3S3M A;  4CCO A;  2LC2 A;  1E0E A;  2E5N A;  3DTI A;  1BOB A;  3K4L A;  3PSF A;  2CFO A;  3OYC A;  3W2V A;  2DT6 A;  3OIP A;  4BJ5 C;  3IAS 2;  4NUB A;  2KRH A;  2LBF A;  3KX2 A;  3OYK A;  4RMN A;  2OV7 A;  4PFO A;  4OAZ A;  2XC7 A;  4XOT A;  2OC6 A;  3K4C A;  1BR2 A;  4PSX A;  4CCN A;  2JA2 A;  5KCM A;  3DTE A;  4XLE A;  3RTR A;  2HQA A;  4LIV A;  1W36 C;  3F9K A;  2LG4 A;  2Z1D A;  4CCJ A;  3RSN A;  3HUG B;  1G8X A;  1D0X A;  1OLT A;  3W2W A;  3DLA A;  2AQF A;  2BVM A;  3KEY A;  2UV1 A;  4E6K G;  4DGW B;  2NOJ B;  2LBF B;  2ZFU A;  4ZJZ A;  2QKL B;  1DQU A;  4BL0 B;  1LKX A;  2V7F A;  1YE9 A;  2CV1 A;  4CH7 A;  2RRE A;  4XR6 A;  3PUB A;  4Y4R A;  2MYS A;  1NG6 A;  2Q1Z B;  4CZC A;  2V6E A;  2X6W A;  4E7H A;  4E7S A;  1T95 A;  2HVR A;  4PFP A;  2M7A A;  2Z16 A;  3OS0 A;  2VXZ A;  3LSH A;  3U21 A;  1WJ5 A;  4J01 A;  4HG2 A;  4GRI A;  2F4I A;  2WBM A;  4XLH A;  1Z7L A;  5CQG A;  4J00 A;  1R6R A;  3CJR B;  4LIT A;  4NC7 A;  1WJE A;  3OIQ A;  2DXI A;  3MKZ A;  3H5R A;  4PK4 A;  4IX7 A;  1TZL A;  2JUG A;  3BCA A;  2KLO A;  2W7N A;  3MKW B;  1YX5 A;  2X6Y A;  2L7K A;  4BDZ A;  3IUO A;  2IS4 A;  2MFZ A;  2Y0S A;  3BC8 A;  3VSL A;  1Z21 A;  1Z3X A;  2LYC A;  4B43 A;  2CUJ A;  2ZXH A;  2PMZ A;  2KQR A;  4U7B A;  4U87 A;  4JOM A;  1K6Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...