2VQHA

Crystal structure of porb from corynebacterium glutamicum (crystal form ii)
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
76
structure length
76
Chain Sequence
b'LSPQYNWVACGILEGGLKAAGVLEEGQYNRELAEAIAAKGEGFWTTQFPQIGDWNEDQAAALADRAQTCGLVKADT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Putative Alpha-Helical Porin from Corynebacterium Glutamicum.
pubmed doi rcsb
molecule keywords PUTATIVE UNCHARACTERIZED PROTEIN CGL0972
source organism Corynebacterium glutamicum
molecule tags Membrane protein
total genus 28
structure length 76
sequence length 76
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF11565 PorB Alpha helical Porin B
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1280 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2vqhA00
2VQLA 2VQGA 2VQHA
chains in the Genus database with same CATH superfamily
3TDZC 3FWEA 3ZQIA 1IN4A 2LKXA 1RNLA 5B1AH 4L0YB 4I76A 5EZGA 3VSLA 3S3OA 3E1SA 4YRVA 3GTMJ 3GF2A 2EWNA 1X1BA 3KP4A 3GX4X 3L1PA 3J7AO 3IH3A 5ILUA 5TJJA 1LDKB 3PFYA 4O3MA 2XAJA 2WA0A 5FB2A 1Q1VA 2VN2A 2IS1A 2XVCA 1B8IB 2HQRA 2CSOA 2MH2A 1J09A 5E1WA 2Y48A 2ISYA 1G3YA 1W0UA 2EILH 3P9KA 4A3FJ 2MC3A 1SFEA 3KP6A 3ERMA 5HS9A 2R7UA 3A4CA 1REPC 1D0XA 4KJZA 4B09A 3HG9A 1VQMI 2K9NA 2H94A 4IVNA 1BJAA 4XRMA 1V54H 3G1MA 4BDZA 1ZELA 1A36A 2DCEA 2YX4A 1T2KA 2MYSA 1XGSA 1BW5A 4ZC3A 5F0FA 1N25A 2Y0SN 1TWCJ 4CDGA 1ZH5A 2EV0A 1TBXA 2UUZA 1EH7A 1R1VA 3ZQ7A 3UKGA 1W4MA 2STWA 1OMIA 4XLHA 2VE8A 4P5OA 4CZZA 5M3FJ 5GPAA 2IA1A 4A3MJ 3WTTC 4BYYA 2EFNA 3KEYA 4ESJA 3S17J 5D6EA 4QWQA 2W85A 2E60A 4KMUX 3LNQA 5HNFA 1XDSA 3DPUA 3SFIA 1TWAJ 3DEUA 3IV5A 1KU3A 3RQIA 4IO9F 2CQKA 3RKQA 2GA1A 3CMEI 1B9MA 1CF7B 3G73A 3LL7A 1UJ8A 4RAFA 4UVAA 3MAJA 5LD2C 3C2BA 1PP8F 1F5TA 5AIPA 3BC8A 4AYBA 2KRCA 5TGTA 4NC6A 1W5CC 3M1EA 3N97A 4GCVA 1OCOH 1RKWA 5GAEJ 5EZHA 4IRIA 3PIPF 2DI3A 2FBHA 2ZSHB 4RGUA 2LF7A 2JTVA 3HYIA 5FGMA 5K7FA 2L2OA 1Z0XA 3J80K 5J6XA 4LB6B 1Y56A 4BS9A 3A0BC 4OIRF 4DIQA 1MDMA 3OYDA 2ETHA 4XKBA 1OYWA 1Q1HA 1R36A 2EB7A 5DEQA 4A3EJ 1Z7LA 3BR5A 2HYJA 3KLOA 4Y15A 5F64A 3H9JA 4C2UA 3WTUC 1VNDA 2DLLA 4G7HF 5JLXA 2HEOA 1OCCH 4J00A 3EUAA 1GUUA 1MJAA 2GXBA 5ED4A 2L02A 3GZNB 1UG2A 2ZJ2A 4W97A 1U0JA 2M3AA 2Z9OA 5K5OA 4AVZA 1T6SA 2GBYA 2LBFB 1V5FA 5DD4A 2R5YB 3JAMK 2VC1A 5FKOA 3ZMVA 2HFHA 3TW6A 3HM5A 4F3QA 3B6AA 1GLNA 3G3ZA 3MD2A 2CG4A 2E5NA 1ZHFA 3SZTA 2VKDA 3BG6A 4QIWN 1VQNI 3GZ5A 1U5TB 2DMUA 3CUQB 2Z5UA 3HTSB 1G2HA 2COBA 1R58A 4AM3A 1X4OA 4PSWA 1Y39A 3ZGKA 3T1BA 2ZJQF 2M45A 5HODA 2DTRA 3LMMA 2BGCA 2WAQN 4RB2C 1OKRA 2V79A 3OL3A 2BVLA 3VYSB 4FX0A 3X2QH 1ZK8A 2PI0A 2Z3YA 5BMZA 2RN7A 2AS5F 1U9OA 4KIGA 1W1WE 1WJFA 2HZDA 2DK5A 4KNYA 3TKYA 3JRIA 3TO7A 4HG2A 3WODF 4EJTA 1UG0A 1H89C 4LIUA 2PFBA 5C3EJ 3BZ6A 5HDKA 1IN6A 3PQKA 3LAJA 2WC2A 1SFOJ 1WJAA 4CZCA 5K5QA 3FXKA 3NRVA 3RDIA 1RUNA 2NYXA 2M2EA 1EA3A 2A05A 4Y3OA 5E18F 3KZIC 1AKHA 1G8XA 1ETOA 4I7HA 5HS8A 1JGGA 2CV2A 4KISA 2DQLA 3Q9SA 2VT3A 4OAZA 1IRGA 3ML6A 2TRTA 2XC7A 1B4AA 3FZVA 2X48A 2F4OB 2E1MB 3RPUA 1MMDA 3B02A 1ETQA 4BE2A 4A3JJ 4G7ZF 2O3FA 1I1SA 2MABA 3BR6A 2VASA 4EM1A 5ICCA 5IYBJ 2BXZA 1XPXA 3F3XA 5FRNA 4B43A 3DTEA 1KA8A 2CW0F 2X6XA 4MQVA 1K6YA 3TL4X 4D7NA 4N4NB 4A69C 2XRLA 4M73A 3GTLJ 3UNGC 2HOTA 1MBHA 3E5UA 4BQNA 2RDPA 3BTCA 2TDXA 1N78A 2JQ7A 1BW6A 1R1UA 4IRHA 5L3FA 3MWMA 5LGTA 1IGNA 3SFZA 1WI3A 2K3PA 3QYBA 4DBQA 3D5LA 1WH5A 2VBWA 1ZARA 3C2HA 4U7BA 4PSXA 4UVCA 4ZYHA 5E1ZB 1ON1A 1U8RA 2LR8A 3HIFA 1H0MA 4HF2A 3RPQA 3BJOA 4OIOF 2BBYA 2RKHA 3DXJF 3E6MA 2L3DA 2D2WA 3E6BA 1G3TA 3AG3H 2NS7A 2M9HA 2DPUA 4KDPA 4MLOA 3WTWC 1C0WA 3HC7A 1H8AC 5BPIA 2CW8A 3DFGA 3W2VA 2GLOA 4LD5A 3MZ8A 1OR7C 2QSFX 4OU0A 1ZN2A 4M3EA 4OOIA 3ERED 1B1BA 2V7FA 3L2QA 1TLHB 2DJIA 4OIPF 5H6QA 5DCFA 3BPXA 1Y8QB 4AD9A 1RC9A 4UXNA 5ILVA 1ZGAA 1R71A 2LG4A 3ABUA 1D1CA 3LQRA 1O7FA 5GP9A 2KQRA 4DJAA 2R7WA 3MZHA 1X2MA 5C4XJ 4G9YA 1CQTA 3DU6A 2Z99A 4MTEA 5B5EC 1FX7A 3R6SA 1HW1A 2XAFA 3GTQJ 5EYRA 4D7MA 2Y0MA 1TWHJ 3CQZJ 2W00A 1BBYA 4HQEA 1CGPA 1HW5A 3D1NI 3K4JA 5KAFC 5CVUA 1S7EA 2FUG2 4JX4A 4V19K 3QAHA 5GTIC 2WAFA 2DMPA 1WFXA 2CWEA 5H6RA 2KHMA 1VQ6I 4UV9A 1ETXA 3CC4I 3AL0B 2VIXA 3ECHA 3PUFA 1YLFA 1RRJA 3M4OJ 5J1YA 5E8GA 3RJPA 4BJ5C 2WBMA 3J81K 1BL0A 4CYDA 2RGVA 5GTHC 3KE2A 1S29A 2W4SA 3HUGA 5J4YA 5EG0B 2XRNA 1PJRA 3EETA 4AC0A 5HLHA 3JSPA 2VOPA 1FEXA 2ZNYA 4DZJA 2Y9ZA 1IXRC 2LY9A 2KMUA 2XKPA 2X51A 4ZZDA 1FOXA 2FMLA 2L5QA 2V1NA 3LQQA 1HKTA 3H5AA 3AG4H 4UUSA 2LSOA 3JRHA 3F8FA 2OCCH 2E1NA 1V5GA 1BC8C 1XG1A 1FBUA 2XF6A 4EEFG 2FD5A 5JI6A 2K85A 2JSCA 1JHFA 4JQFA 2CH0A 1BOAA 2NOGA 1PDNC 4E7ZA 4Q5SF 1YX3A 4ESBA 3HGGA 2QEXI 4EGZA 1R22A 3DBLB 1QHGA 2WY8Q 2OTJI 1DQUA 5EEGA 4HZFA 4PFPA 5LBQA 5FLVA 3OS0A 1X1AA 2JSPA 1BI3A 3BTJA 5C44J 1ZGJA 5FKKA 2X1DA 5DTDA 1HKSA 4I2OA 1F43A 1HLVA 5E8IA 4MIMA 4FE4A 3AG1H 2IEKA 2NAZA 2ECBA 2ZKZA 1WKMA 4NDLA 1LQ1A 2Y2ZA 2EH3A 2GA2A 3L00A 2R92J 2ZMEA 3DLAA 1X19A 2PMHA 4MFDA 4E7SA 3LAPA 2XPWA 1WZ2A 5C4JJ 1IF1A 1OJLA 4EM2A 1HQCA 5J8CA 3OYEA 1MMGA 5IP6A 1SMTA 3CO7C 3F0CA 4I02A 4BQQA 5JVGF 1VTNC 4ZTJA 4ZJZA 2ZC2A 2QQBA 4PK4A 3O6BB 4HF0A 1FOYA 2ZBKA 3KEOA 1DU0A 2X6YA 2VJ5A 4EQQA 4UNOA 3M8EA 2QYOA 1HSJA 5JHUA 3LSIA 1LFBA 5IPAA 3WG9A 4DYRA 4FISA 2R93J 4XICA 3CCRI 4L5IA 3WGGA 3KETA 2HOEA 3G71I 2WV0A 2V9KA 3A1YA 2O5RA 2QENA 3D0SA 3ONQA 2DAOA 2IGNA 1J0RA 4XORA 3DEEA 3HL2A 3K4KA 2X6OA 3CDHA 1BOBA 1ON2A 1OYIA 3L2CA 1QU3A 2X0LA 1UMQA 4BY7J 3RTRA 3HJEA 2KZVA 2FEZA 1A35A 3HRSA 4G6TB 2ZO4A 4XK4A 4WWCA 4MNUA 2NRAC 3I59B 4KICA 2YPRA 5F08A 1U6GA 2MLKA 3EUHC 1G6NA 3HSRA 1UCRA 1XMKA 2O7OA 1IXSB 4E7JA 3OYCA 4E7IA 2QF7A 1TT0A 3CF2A 3LSTA 5CVIA 4E4HA 3QRFF 2JWTA 5ICGA 4AIHA 1T0FA 4A3KJ 1P4WA 2DA3A 2WB1A 2E7WA 1S5LC 1JGSA 2L01A 1B8IA 2ZB9A 3V7CA 3DQVC 1YIJI 3PNVA 4LITA 4HYEA 5DDGA 2XGEA 4OAYA 1USTA 2RNGA 1ZLJA 2KKOA 3OIPA 3BZKA 5IT9Z 1DPUA 2G7HA 4XLEA 1FIAA 3KX2A 4D1QA 2DU9A 4MGRA 4F52A 1FLIA 4NQWB 1BIBA 4RBOA 3JRDA 2HPMA 2JVHA 1J59A 3RSNA 4BAYA 4XQFA 1KYWA 1P6RA 4XOPA 2YU9J 3GLXA 4KN4X 2X6WA 3FIWA 1QQIA 3G1OA 1O7LA 2V1UA 2PMZA 3QYEA 3H5NA 5E3NA 2QKMB 5F0HA 3K0LA 4FTHA 4XLFA 5H20A 3QYFA 4ABZA 3IRRA 1DPRA 3PM1A 1IRZA 2GAUA 3WHCA 1K4SA 2LC2A 5DM7F 2O0YA 3H36A 5M3MJ 1POGA 1EH6A 2DPDA 1XX5A 4XKVA 2JJ7A 5CVRA 2JRMA 1MH3A 1VQ7I 2XV4S 4XRSA 5LLQA 2FNAA 5FJ8J 2X1EA 4LG0B 2M4KA 3KP3A 1A31A 2K3FA 1XCVA 4IHSA 5D5XB 4HV6A 3LSHA 3LFKA 1YS6A 1FSHA 4I01A 3BOQA 3JSOA 1ZLKA 4IJAA 4NNJA 2F48A 1JJ8C 2PX9A 2KJCA 3OYMA 4YIRX 1CF7A 4LLNA 4AIJA 3CCMI 2XGXA 1E3HA 4IHVA 1Y1WJ 3LOCA 2HQ5A 4E7LA 4HA8A 2Z1DA 3VOEA 3T5XA 5J1RA 3F8CA 1FSEA 2G0EA 3C3WA 4A6DA 2RREA 2O8KA 1VI0A 3RPUD 3WE3A 3TDUC 2E2HJ 4IX7A 1SD6A 1QGPA 4BEHA 2ME6A 4RS8A 4MFEA 1WCMJ 4M72A 3NWTA 3NWSA 4A2UA 1MNDA 2F4IA 2CUJA 3W2WA 4XOTA 3K2ZA 2EK5A 3CTAA 1WRJA 3R0JA 2ESNA 4Z2YA 4CCNA 1IRFA 2A5YB 2R5ZB 1SANA 1LE8B 2H6BA 2EJRA 3E0JB 3W6VA 1I50J 3VSKA 1ONVA 3CD6I 1AU7A 1SD5A 5ICEA 1RIOH 1K78B 2AXLA 3K10A 4PZJA 3UR3C 4F91B 4IZZA 4BXXJ 2JPCA 4UUVA 4GRIA 4I09A 3BR1A 2M87A 4XLAA 2L4AA 1TNTA 1OCZH 3WU0A 3MFKA 2WADA 2DA2A 3DWLE 1MMSA 3C18A 4PJ0C 2R5YA 1YOVB 2K9QA 2OJED 3OIOA 4HSRA 1W5TA 2XGCA 1W7PB 4L5JA 2MBFA 2BHZA 5K5RA 6PAXA 3M7GA 1J9IA 3ZMSA 5JLWA 4IHTA 1FP2A 3MKWB 1AHDP 1U5TA 2KDOA 2YSRA 2HTJA 3FM3A 4HNUA 3RI4A 2VODA 4HLXA 3AAFA 2IS4A 3OR2C 3AKZA 3KYLA 4XSZF 3BWGA 3LA3A 3S1RJ 1R1TA 2DQRA 3K9TA 2FRHA 1XMAA 1WJBA 1HW2A 3QP6A 3S16J 3FISA 1PYVA 1MBJA 4YG2F 3H3UA 3V8KA 1TTYA 2GWRA 1E0EA 1FBSA 3T0YA 4GYGA 4LB5A 4ZDLA 4EM0B 4A12A 1HDPA 1VQ4I 1Y1VJ 1HKQA 3BG5A 2LD5A 2DT7B 1LB2A 1LNWA 2EINH 2JPBA 3CC2I 2NVQJ 1XS9A 2ZCWA 1R5GA 4KT5C 3RYPA 1S3JA 2IGKA 2F4MB 4XNFA 5A2QZ 1YIOA 1MJ9A 2OQRA 3PSIA 1QPIA 3ABLH 3B6CA 3FXJA 3E5XA 3RIRA 1Y6IA 2DDBA 5H2FC 1YJWI 2CV0A 1ZG3A 2K4JA 3HGYA 3HKZA 2A69F 4RA2A 4RB1A 2DDAA 5GPCA 2DXIA 4CGZA 3FBIB 4ESFA 2L7KA 3L2WA 1IRXA 3QOPA 1VQ8I 1FWZA 3TBIA 2HR3A 1OISA 5F27A 3HB9A 1ENHA 1DUXC 2QGUA 2ZSIB 2EZLA 3ISPA 3ROUA 2DBBA 2JA6J 1LEBA 3VWBA 2Q0OA 3D5SC 4I0AA 3SHFA 5E3MA 1TWFJ 2VJ4A 2VJJA 1X1DA 2XUBA 3MZYA 2P7CB 3TO9A 3F8MA 2CW7A 2A6HF 4IL6C 2HYGD 2E1OA 4IXAA 4X1EA 3W2AA 4IKFA 3PNYA 4PDKA 2KP6A 1WWXA 2VJIA 4E70A 2FMYA 1UHMA 1HCRA 3BCAA 2UXNA 3U1DA 2L7ZA 2JN6A 1MBFA 3M8FA 4UVBA 3V4GA 4BH9A 2XHKA 4B3AA 3GTJJ 3QPLA 1TT5B 3KFWX 4QTRA 3WHBA 2I8DA 4ZYAA 1JTXA 1A6QA 3BG7A 1Z21A 1MZBA 4CSWA 4F93B 3GWZA 3ESWB 1Z7UA 2R7OA 4ZTFA 3FDYA 2DFIA 1P4AA 3IKVA 3VYRB 4YFXF 4WX9A 3HDDA 2LRDA 4M74A 3I0TA 4A3IJ 2EPFA 1XN7A 2QUFA 1XMXA 3QOEA 1XC5A 4L9TA 2DODA 3IAM2 2GOXB 1K4TA 2QLZA 2OBPA 3A0HC 4MEYF 4LK0F 1RR8C 2OA4A 3FKIJ 4IQ4A 2JMWA 1TC3C 2K27A 1KQ9A 2MW8A 2ZFUA 4P55A 1KONA 4YIFA 1X1CA 3PJRA 4DGWB 3Q0VA 2DMNA 2J5OA 1GHCA 3LWFA 3BJ6A 4KUMA 3CJNA 2UZKA 4PGHA 3CESA 2NS0A 1APLC 3MKLA 4YEJA 2VKVA 3HHHA 2VT2A 2IS6A 2ZXJA 1LPQA 4D9JA 1LUJB 3W6KB 4FT8A 2KPMA 2VUMJ 2HKOA 3I55I 3WTYC 2LP0A 1IDYA 3OYNA 2DA4A 1L3LA 3M3YJ 1BI2A 2MH9A 1SD4A 3MVPA 3IL2A 4GFBA 2YX7A 2QSHX 2DA1A 1MMNA 1TWGJ 4XLPF 1FP1D 1YITI 4ENMA 4XBFA 3ZOBA 1BR2A 2VQHA 5EG0A 2AQFA 4Q47A 2HVSA 2X1CA 1KZHA 3DBHB 2N8GA 1TP4A 5HLGA 4I0BA 3OYJA 1EH8A 2COMA 1E3OC 4KITB 4GDFA 4S0HB 1TW2A 1YE9A 1XD7A 3E6DA 4CCMA 2M1BA 1MJBA 5KK1A 1XCBA 2FBIA 1TZLA 2X4HA 5CVJA 3GTPJ 3DEWA 1A04A 2GXAA 1MKMA 2LFBA 4Y4RA 2XF5A 3Q0UA 1VFCA 2YR2A 5LRSA 1NG6A 4F55A 5HS7A 3I71A 4KMFA 2LKPA 3K4BA 3LA2A 4HLYA 2O03A 1S7OA 3J7ZI 5D4RA 2KRHA 1J7KA 1VQ9I 2L9NA 2OUMA 2VC0A 2EBIA 2H8RA 1Z1DA 3BLYA 3VB2A 5LEJA 2OZ6A 3G4SI 3HOXJ 2JRTA 3KEQA 4P1WA 2NVXJ 2W25A 1WJ5A 3MQ0A 5KVRA 3SZGA 1NK3P 3DTKA 4L5EA 5B3SH 3JTGA 4RGRA 1YYVA 4I98B 3ZQLA 1JKOC 1FC3A 4ETSA 4G94A 1BR1A 4U0WA 2EFWA 3K70D 4F7ZA 2M7BA 1PVEA 1X3WB 3FF5A 2BVMA 1JKPC 2L9SA 3ZXSA 5JFRA 1EF4A 4Y33A 4BJ6C 1NG7A 1SFXA 2MLGA 2RAEA 2ID3A 5DV5A 3SEQA 4CUGA 5BPDA 5HLTA 2NS8A 2L4MA 2VL8A 4BDYA 4EJVA 1XSXA 4P96A 2HYFA 1FT9A 4DYQA 3F6OA 3FXLA 2PJRB 2ZMEC 5IOYA 2X85A 4BNCA 3L2UA 5J8FA 5IY5H 2A07F 2R7TA 1O4XA 4H4KC 3SZPA 2IW5A 4HX8A 4ZYEA 1O3TA 1DGRM 1LFUP 4NB5A 4OMZA 2IAIA 3LSGA 3I59A 1L0OC 4DQ2A 4RGXA 3ZMZA 2EIKH 3GO5A 4KFCA 1D5YA 2LY1A 1RKTA 4QPQA 3TOAA 4DOZA 5M5XJ 4U0YA 5BS6A 1IV8A 3COAC 1FYMA 2CRGA 2WWYA 5IOZA 4FHTA 1NTCA 3H0DA 2JA5J 3HOUJ 1YW7A 5F1RA 2HOSA 1IC8A 2H6CA 1R6RA 1U9NA 2KIFA 4JOMA 4RDUA 1OPCA 3VFZA 3E6CC 4RAZA 3NEUA 1FBQA 2JT1A 3GYHX 2HVQA 5F1JA 3OV8A 4ASNA 4NQWA 1ERDA 2K40A 2R7FA 4MO7A 2P5KA 3Q9VA 1O3QA 4BHBA 2A68F 1P92A 3V8JA 2Z33A 1H9TA 3RZOJ 2R7XA 1T08B 4NC7A 2ZNZA 4KA4A 1LEAA 2V9PA 3PIOF 5E3OA 1JI8A 1SC7A 5FFZA 2AQEA 5E20A 2DA7A 3DBRB 4C3IJ 3K1MA 4C3HJ 3K4MA 1OLTA 3S1NJ 4XMYA 5IT3A 2DA5A 3K4NA 4O6JA 1FJLA 1T0FC 3BJAA 4GO1A 3RCOA 4MEXF 2DMTA 2RC4A 1YTYA 1WSUA 1BI1A 4G8XA 5HDGA 1X3ZB 2VB6A 4P9UA 5DM6F 4LG0A 3ABKH 3E3VA 2IS2A 1LFPA 3L2RA 4LLLA 4E7KA 3FXMA 3REOA 4AUXA 4IOCF 2DMQA 5IT9K 1B72B 3FK6A 2HWVA 3O3KA 1QVUA 1XSDA 5F04A 4XRSG 1P4XA 2DT5A 1TQIA 1QZYA 4NBQA 4XSXF 4Y17A 2NNNA 4IEJA 3DKWA 3CMMA 1SAXA 4RLQA 3W6JB 3A03A 1ZAOA 2PN6A 3ZN1A 4HPQA 4Z6YA 4HDUA 2PBIA 4RMNA 4BHPA 4EV0A 1WJCA 2LH9A 2Y0SA 3S93A 3HOZJ 3BQYA 4LLGF 1Z67A 4MTDA 2BHYA 2ZXHA 3VPRA 1R23A 2HPIA 1ORKA 5L3BA 1T98A 2FX0A 1K79A 4D0PA 1HSTA 3NAUA 3K70C 2FXAA 2O8XA 3ZRGA 4HX4A 4M6VA 1N75A 3Q0WA 1W36D 3FK7A 3GFMA 2QSGX 1Y0UA 3DU5A 3H5RA 3PQJA 1U78A 2YUSA 3HEFA 1T38A 2R5ZA 1LE8A 1LDJA 2RQPA 2M0MA 1O57A 4OMYA 4OWRB 1W5SA 2VQLA 3HXLA 1VQ5I 1VQKI 3BDDA 2QBYB 1K78A 1TNSA 2JVGA 2VONA 1YX5A 1IO2A 3S14J 3WU2C 4HW0A 3U1KA 1S7AA 4XLNF 2P8TA 2OD5A 3WTXC 1G59A 1A6IA 2ISZA 2A3SA 3BG3A 4AYBN 1BIAA 4UV8A 2VPLA 1IXCA 1NK2P 2R7QA 1RPWA 3P7NA 1MGTA 5DD8A 4QLCU 1W7PA 2XSJC 1B6AA 2OF7A 3CJRB 1SFKA 3I58A 3OIQA 5FKMA 4BL0B 4PJNA 2O6GE 1D1BA 4M3GA 4RB3C 1MIJA 3H9QA 4XR6A 1WJDA 1MBEA 1F36A 4CCLA 3HRUA 4IOAF 2CV1A 4C2MJ 4XIDA 3IP4B 2XGDA 1J2XA 3O8GA 5FLXZ 4L0ZB 2E34A 3CDIA 3S2WA 1I6XA 1OR7A 2DK8A 2FJ1A 1OCRH 2LYCA 3HSEA 4Y7NJ 4F92B 3DP7A 5EEHA 3GFIA 1UHSA 2QQ8A 3I5UA 4KT6A 1QZZA 4NUBA 5FO5A 2R7VA 1LKXA 3R61A 4CO8A 1YS7A 1J75A 3D5RC 1QO0D 2XAUA 3BT9A 3ZMTA 1MBKA 2KLOA 2IRFG 1K6OA 1RUOA 5K7HA 3WU1B 1X1PA 1VQOI 2FOWA 3GTOJ 3PO3J 2PMUA 3PNTA 2XAHA 1KU9A 1SVOA 2W7NA 3TP0A 1IW7F 4PCQA 5LGNA 1FMVA 2UXXA 2O9LA 4XM3A 2K4BA 1XGNA 4MHGA 2IXSA 4M9XA 5IP9J 2K9SA 3VODA 2JA8J 3G6EI 1U5TC 4DYCA 1DGWY 3CUQC 2WTEA 2ELKA 3IWFA 3CCSI 1IN5A 1Z05A 3ASOH 4FCYA 2GZWA 1ZG1A 3U21A 5L3GA 3F72A 2WV1A 2HZTA 3NQOA 2A5WA 3L7WA 3P9IA 2Q2EA 3A02A 2QA4I 3TGNA 3CMYA 4ZDPA 4U88A 2H8WA 3F22A 3CCVI 3I56I 3C7JA 4XKCA 2M8EA 4LOCA 2CQQA 2O61A 1X58A 3FHZA 1RR7A 1YJNI 2HU9A 2D1VA 2R7ZJ 1S9HA 3HHGA 2Y9YA 4GGGA 4DW6A 3OY9A 2JA7J 3CP2A 1UB9A 5GAGJ 4R8HA 5JHFA 3K1PA 1IV6A 2B9SA 3ELKA 2ACJA 3CC7I 3F23A 3CCJI 2IT0A 1I1GA 2BV6A 3PO2J 1FPQA 4RAYA 4RGSA 2RNJA 4E7HA 5FD6A 1HF0A 3S1QJ 1U3EM 4FE7A 2E1MC 5A2QK 5FRMA 1FNNA 1RI7A 3CP8A 2P0WA 4LFUA 4YFNF 2E1CA 3OOPA 1ZGWA 1VQLI 1TQMA 3ECOA 3M9AA 4A3CJ 1YW9A 5J1UA 2R7DA 4QPOA 4CYCB 2PEXA 2KRFA 3ZQFA 1QBJA 1ETKA 2MGQA 4AVPA 3S3NA 1W36C 1U2WA 5TISC 4YFKF 1ULYA 1FY7A 1E3PA 2BXYA 4BY1J 2R7RA 3HSFA 1GVJA 2OQGA 2CYYA 3HOSA 1LDDA 3F9KA 2H27A 3BY6A 1S72I 3CJQB 3CCQI 4X6AJ 2EIJH 2HDDA 1YRNB 1J5YA 1H9GA 1V3FA 1Z9CA 3H35A 1TL8A 4M3DA 4L18B 2UV1A 3DCFA 1P9QC 1XGOA 5L3EA 4JBAA 2I10A 2CUZA 1R49A 1OQYA 3I9V2 1FZPB 1R5ID 2MSYA 3HPGA 3BTIA 3LA7A 1TW3A 4U87A 4HOBA 5F6FA 2OV7A 1ETYA 2V6EA 3QU6A 1GXPA 4JX6A 4OIQF 4EMSA 2MD0A 4L9JA 5M5YJ 3RKXA 2EV6A 2PLYA 3OYGA 3WE2A 5LHGA 2CQ7A 4J19A 1BM9A 3OOUA 2FU4A 3QPSA 4N9IA 2F5CA 3KYDB 4RLFA 4AWXB 3C1DA 3PL8A 1Z3XA 3QQAA 3RKWA 2VBXA 3EUHA 4FETA 1GDTA 3K4CA 5EEAA 2GXGA 4D5CA 3TMOA 4B4CA 3H3ZA 2IGOA 5LRRA 4WXCA 2HQAA 3F8NA 4KIFA 2OTLI 5HVQC 4BU2A 4CHUA 1Y0NA 1BJZA 2HDWA 2CGPA 4H0EA 2BY0A 3KYCB 3MKZA 4CCKA 1IG7A 3OS2A 4AIDA 3IH2A 1I6HJ 1E17A 2LDUA 2GM4A 3MCZA 5LHIA 4ZZLA 3G1LA 1EV7A 1RETA 3SEZA 4RAGA 2L0KA 4HX7A 4ENKA 3AL0C 2HGCA 1VZ0A 3S2HJ 2VI6A 2ID6A 4PJLA 3TEDA 3IC7A 3LFUA 1ZREA 1DP3A 1STZA 1X2NA 3O2PE 2A6TA 5KCMA 3E5QA 1MD0A 2K02A 3K2AA 4LK1F 5L3CA 4X0GA 5KNLA 4CXFA 1BN5A 2Y75A 1KQ8A 1ZG5A 2Q2EB 3FXRA 5D8KB 4E6KG 4A6EA 2OCEA 2R7SA 3ABMH 2VQCA 3R0AA 4BACA 2EZKA 3T8TA 3O8HA 3MKYB 3CLQA 4NHJA 4B44A 3GZ6A 3IWZA 1NHAA 4KIBA 2Y30A 4IRGA 1EJ9A 3AFHA 3I54A 5BNGA 3GFJA 3BROA 2CU7A 3R4KA 4M71A 4A0ZA 2V6CA 2GIVA 5KAIC 3BR2A 5EDNA 3ZPLA 2KJBA 4CA0A 2R4GA 1JUMA 2XPVA 2HVRA 1RESA 2W48A 2AXTC 1E2XA 1ZYRF 3V7SA 2DOFA 1YHQI 2M30A 1YQAA 5ILSA 5K1YA 1GV5A 1WJEA 2E5ZA 3I4NJ 3IAS2 2JUCA 4A5NA 2E7XA 1F9NA 1QPMA 2VKEA 3HRMA 4PGGA 5CPRB 3I53A 1LVAA 2CQXA 2P6SA 4LMYA 2EA2A 3CO6C 1JUSA 3FMQA 2PJRA 1IN8A 2HXIA 2DOEA 4D5FA 1D8JA 2ZFWA 5DCMB 3SJMA 5KHDA 3DF8A 2BYVE 1Z3YA 3TP3A 4BHCA 2KIUA 4HQMA 4LGWA 4CCOA 5M5WJ 1JKQC 1G3SA 3S32A 4XLCA 2ELHA 4N0BA 4BUPA 2DTZA 2HTSA 4B8XA 1T33A 3Q3SA 2QVOA 3EDPA 2B0LA 5BOXA 2BW3B 2DW4A 4KN7X 1LVKA 4WXHA 2VE9A 3HOYJ 3OSGA 2E36A 4KYWA 2CMPA 2FQ3A 2QZ8A 4HV5A 1HA8A 3MN2A 5J3LA 4EJWA 3LSPA 1MSFC 3A01B 2NNYA 2P6TA 1QA6A 1FTZA 3I4PA 2MFZA 2C6YA 3P9CA 3OYIA 5BQTA 9ANTA 1GT0C 3ASNH 4XKWA 1ZRFA 2BE5F 1BC7C 2EA4A 1ODDA 3HOTA 4V2FA 4M3FA 5D6FA 3IHUA 1W7PD 5CKTA 2CFOA 3TW7A 2STTA 4ZH4F 1JT6A 3S2DJ 3QPTA 1UELB 4ENJA 2D5VA 1T39A 2VBYA 4XRFA 2EFPA 3WTVC 3F6VA 2XSDC 3BP8A 3V7RA 1JTYA 2ZJPF 4HSTA 4RM2A 2W82A 3CCYA 3FM5A 4XL9A 3QPHA 3G2BA 4BBRJ 1T95A 1KQ0A 3RYRA 1D1AA 2WB1N 2G9WA 3JCUC 4CCJA 5LGUA 3DKXA 1X3UA 3CF5F 3MMYB 1R4NB 1DP7P 1JKRC 1UZCA 1OCTC 3LSRA 3CMAI 1P2FA 1S6LA 2CQNA 2VBZA 1PUFA 3PFIA 1I5ZA 4WXDA 1B72A 3JRCA 1FYLA 4WK8F 3HTUA 2V9VA 3RZDJ 2E35A 1AWCA 1HDDC 2BOLA 2QKLB 1U8BA 1VQPI 2PMZN 4G6DA 4ANJA 3FKJA 5HNHA 2KFDA 2DFEA 1MBGA 1YO5C 2MC4A 2XROA 2OPTA 3I64A 3ZN0A 3H1CA 3E7LA 4A3BJ 2F5EA 1XDUA 4ZDOA 5JVTA 4AU7A 3GW2A 1IDZA 2W84A 2EFOA 4DZPA 4EJUA 4U7DA 2P5LC 5D8LB 2H09A 2ELJA 2LOOA 3OSFA 2VXZA 3BTLA 3E97A 1V4RA 2DO7A 3FBNB 4BKXA 2VKHA 3FXUA 1MNEA 2DFFA 2EFQA 2XPUA 1KGSA 1OYYA 1SEUA 2MD5A 1YJ9I 4HNVA 3C2GA 4GXOA 1V5EA 3VEPA 4BXFA 3M8JA 1MW7A 2ZXWH 3T8RA 3CJTB 1SVLA 3DPTA 1Y8RB 5J40A 2Y69H 4O5VA 2XB0X 1A5JA 5DUKA 2QBYA 1QVTA 3BR3A 1MH4A 2XIGA 3HPHA 4OINF 2F2EA 2MG4A 3SQNA 2OAZA 1ETVA 2CS3A 3SYTA 3BPVA 2M7AA 2G7UA 2IA2A 5GADJ 4A3GJ 4G7OF 4I6ZA 2M34A 2L7MP 1HOMA 2P4WA 4A0YA 2RQQA 1USSA 3JRAA 4J01A 3QU3A 3S1MJ 2KT0A 2VQGA 1GVDA 2FF4A 3S15J 4UHTA 4A5MA 4LJZF 1I39A 1K83J 2NVUB 2W24A 3KLNA 3J80Z 2R0QC 4HAMA 5ERIA 2K9MA 3BR0A 4HEA2 2CUEA 2FOKA 2LVSA 3OWTA 4BQOA 2ZXIA 1T8IA 1ZRDA 3GTGJ 4S05A 1JT0A 3V42A 1X4PA 2D1HA 3CCLI 3OYBA 1SVMA 1ETWA 2BY1A 3DKYA 3LSJA 1OFCX 4UB8C 3JREA 2JA2A 1KU2A 4HF1A 3J7AY 5CJ9A 2W57A 4II2A 4PJJA 4ZYGA 2NOJB 2XASA 3J7YJ 3VYUB 4HRIA 4UB6C 3K69A 1D8KA 1WVRA 2OC6A 1ZR2A 3ABTA 2CJJA 3ZCOA 3OYAA 1VF9A 4IPAA 3JAMZ 2V26A 4M9ZA 3ULQB 1FIPA 4XN0A 3ZMDA 4Q48A 3GBGA 2IA0A 2JUGA 3A2KA 2V1XA 1GV2A 2IGMA 4C2TA 2L9RA 1FMWA 3GTKJ 2KDZA 4ENNA 3RKYA 4XN3A 1MDMB 2F5VA 5FLXK 3K7AJ 3HBLA 2ICWG 3TOBA 4XONA 2VOOA 2M0CA 4BE1A 2QM3A 2ME0A 2LTPA 3GMEA 3VYTB 1ZQ3P 3K1NA 3OS1A 2F6CA 1ACIA 4B1RA 4M3BA 1QRYA 3S3MA 5B1BH 2J5PA 3OL4A 2XAGA 5FD5A 1Z6RA 4EJOA 2CUFA 2HOAA 3P5JA 4G12A 5E3LA 1D0ZA 3TO6A 4IHYA 3JR9A 3M07A 5CQEA 4P9FA 1YI2I 4EATA 1RZ4A 1WHUA 3L9FA 1K61A 4BXUA 2BY2A 2KIMA 1DDNA 3GXOA 3KCCA 2HXOA 4C9YA 1PUFB 1O3SA 2QCOA 5IYDJ 2RV8A 4ITVA 4QSHA 2DN0A 1IZ1A 3KP5A 3QODA 3GUDA 3R60A 3OYHA 3IRQA 4M6YA 2L54A 5D5UB 4EGYA 3FMSA 3HOWJ 3DTIA 3OYFA 2ESHA 1AA7A 3EPZA 2P81A 3K4LA 3QP5A 5DYMA 2JK3A 1R00A 4WCGA 2HNHA 3HKZN 2M4GA 5L3DA 5DUIA 3CZ6A 3FX3A 2FA5A 3GEZA 4CYCA 4HNTA 1TQPA 2W1OA 1M1EB 1I3AA 1JXSA 1NH3A 3H9GA 2KZGA 1F4KA 4R1HA 1XGMA 4YELA 2H1KA 3PSFA 2DOAA 5CLSA 3BQZA 3ZMUA 2K86A 4JP0A 1S8NA 1JUPA 2OZUA 3OR1C 5LEKA 1D3YA 1BI0A 2Q1ZB 2V4JC 3ZQGA 1YRNA 3AG2H 1YW8A 2LK2A 3SXYA 1K7AA 2XB5A 1AKHB 4L9NA 2FBKA 2L7FP 2R3SA 1FOWA 1XSVA 1R4MB 5EGOA 1YFHA 5CVVA 3EUKL 4BEHB 3JRFA 2PQ8A 5CYVA 5AONA 2LF8A 2CO5A 1D5VA 2RVCA 4WF2A 3JRGA 4IF4A 3DLLF 1FTTA 2DA6A 4Y13A 2HQNA 5FKNA 1PUEE 2LLKA 4A93J 5IYCJ 2HS5A 3IKTA 3OYKA 4CICA 3KZZA 2K7LA 3NARA 2P7VB 2FNPA 4I99C 3ZQQA 5D4SA 5HDNA 2IJLA 3N4MA 1MMAA 2EV5A 4MQ9F 1B9NA 2BY3A 4DBRA 1OCPA 4EVIA 2EZIA 3VDXA 2NVYJ 5LFAA 3WTSC 4BGDA 2AHQA 5E1XA 5GAHJ 3OMYA 1IUYA 2KIQA 3H0GJ 3CCUI 1G4DA 2L9VA 3FMRA 2A61A 3ZQCA 1DU6A 2E71A 1O3RA 3S8PA 2D45A 4IHWA 3EYIA 3L09A 2X9DA 1IAWA 4UUTA 1HBXG 2UWMA 4G6QA 4HBLA 4A0XA 3F21A 2GQQA 1KU7A 3I3LA 1B59A 3DPLC 3N05A 3KP7A 1QNTA 4PFOA 3SDGA 3WGHA 4FX4A 5F0CA 2BEOA 1UHWA 3ZQHA 3KZYA 5HOOA 2F5FA 2XF7A 4C3JJ 1UFMA 1WGXA 3CCEI 2MA3A 1ZRCA 3TQNA 3J81Z 2E2JJ 4BE0A 2HDCA 4C30A 2M8GX 2FQ4A 3Q5FA 2CFXA 1WH7A 2EZHA 5FLMJ 5HLIA 3FHNA 3WTZA 3K6GA 2NVTJ 2GIZA 4A3LJ 3GFLA 1KYZA 1IUFA 1GXQA 1HC8A 5ICFA 3EQLF 1PP7U 5DS9A 4M6XA 5IP7J 3MEXA 2M5WA 4IHXA 4Y52J 4IQJA 2WAQA 4L9VA 3LSMA 2LMDA 1LJ9A 2DYSH 4JX5A 4JYKA 1XTAA 2XDVA 5D5VB 3CLOA 1SFUA 5E79C 4BJTA 2VLAA 1ZKGA 3DV8A 3OYLA 4HDVA 2ZJRF 5E17F 1FYKA 1G3WA 4S04A 2FE3A 4II3A 1JE8A 1WQ2A 1WPKA 3W3CA 1QHHD 2IBDA 2NXNB 1FOKA 4RB0A 3CDLA 2VXDA 1MNMC 3HOVJ 2PJPA 3B73A 4B48A 1R7JA 3FXQA 3H92A 4B47A 4W1UA 2Y31A 2QQAA 5EJCA 3WG7H 1H88C 3IUOA 2A6EF 2WAEA 2LREA 3HUGB 4N4OB 3KIOA 4M9SA 2LKSA 3U9GA 4AIKA 2V1DA 5DCMA 2EIMH 2Z2SB 3HRTA 4GYIA 1N77A 2XKOA 2P5VA 3PUBA 4PUSA 2E2IJ 2FSWA 3U2RA 3GCMA 2ECCA 4Q4ZF 1HXDA 5AIQA 3JRBA 1SMYF 3KPHA 2KL4A 4UUSB 2HI3A 1F1ZA 2BW3A 1EKEA 4V2GA 1QZEA 2H1LA 1Z6TA 3L2VA 3BG9A 3ZP5A 2WY7Q 3WGIA 1D0YA 1UAAA 1R5HA 4CH7A 1ITYA 3IH4A 5D5WB 2TCTA 1BR4A 2Q8KA 1XB4A 1SD7A 3A01A 3RQ4A 2F5DA 4B3XA 2QQ9A 1P7IA 3QWLA 1T56A 2LY2A 3V8LA 3CUOA 5LHHA 4NC8A 4PJMA 1Z77A 3I4MJ 5J4VA 1R9TJ 5EGOB 2BZTA 1JHHA 1V55H 2DYRH 2DJNA 2OU2A 3ZR8X 5EF6A 1IN7A 3BCBA 3BZCA 1W0TA 2VPRA 1AOYA 1Z91A 3F8BA 4R79A 1ZR4A 1IJWC 1SAUA 1YG2A 2ZMEB 2IPQX 2Z16A 3GLLA 4TV7A 5FFXA 1I27A 5J47A 1BA5A 2B63J 5CQGA 2JZYA 2XAQA 4N9HA 2IP2A 2GOMA 4BBSJ 3SDBA 5FROA 3M1CA 1JJ6C 2E19A 2YS9A 2YU3A 2KISA 2EQRA 2AO9A 5B66C 1WI9A 3GVAA 1MSEC 3KP2A 5K7ZA 2LBFA 3H3VK 3EYYA 5TRDA 4BQAA 4JK1X 4FASD 4ON0A 2ADUA 4UY8I 2HKXA 1I3QJ 2IVMA 2K9LA 4LG3A 4K2EA 2B7EA 5JR3A 4U0VA 4YIIA 3JW4A 4FQGA 3FXOA 3HZJA 2K5CA 5FKLA 3JTHA 1P7JA 3LSKA 2QWWA 4LIVA 1ZTRA 4RM3A 3CUQA 2DT6A 2I5UA 2LNBA 2PG4A 4A3DJ 4DNCA 4ZYDA 2DFHA
chains in the Genus database with same CATH topology
4NC7A 2WB1A 1JI8A 3VSLA 3S3OA 2AQEA 3DQVC 3E1SA 4YRVA 3PNVA 4LITA 4OAYA 2RNGA 3OIPA 1X1BA 3K4MA 1OLTA 4XMYA 4XLEA 3KX2A 4D1QA 4F52A 3K4NA 1T0FC 4NQWB 2HPMA 2JVHA 3RCOA 3RSNA 4XQFA 1LDKB 2BOLA 2QKLB 4XOPA 3PFYA 2WA0A 2X6WA 4ANJA 3FKJA 2VB6A 5HNHA 2IS1A 2PMZA 2MC4A 3QYEA 2IS2A 1LFPA 3L2RA 3H5NA 1J09A 2QKMB 4E7KA 4XLFA 4ZDOA 3QYFA 4AU7A 2LC2A 2ELJA 2LOOA 2R7UA 2VXZA 3A4CA 1D0XA 4KJZA 4XKVA 3HG9A 3FBNB 3CMMA 2VKHA 4BDZA 1MNEA 4RLQA 1ZELA 2X1EA 2DCEA 4HPQA 2M4KA 2MYSA 3C2GA 4ZC3A 1V5EA 4RMNA 4BXFA 3LSHA 3M8JA 1MW7A 1WJCA 3DPTA 2LH9A 2Y0SA 3S93A 2UUZA 4NNJA 2ZXHA 2HPIA 3HPHA 4XLHA 4P5OA 4BEHA 3OYMA 2CS3A 3SYTA 2M7AA 3K70C 3KEYA 3ZRGA 4E7LA 1N75A 2Z1DA 1W36D 2E60A 3DU5A 3H5RA 5HNFA 2RQQA 3DPUA 2RREA 4J01A 3RPUD 2M0MA 4IX7A 4OWRB 2VQLA 3HXLA 2VQGA 2JVGA 1YX5A 3NWTA 2K9MA 3LL7A 3NWSA 4HEA2 1MNDA 2F4IA 2CUJA 3OWTA 4XOTA 3W2WA 1G59A 5LD2C 4BQOA 2ZXIA 2VPLA 2R7QA 3BC8A 4AYBA 2KRCA 5TGTA 4CCNA 3V42A 1X4PA 2XSJC 3CJRB 1SFKA 3OIQA 4BL0B 3E0JB 4PJNA 3OYBA 2ZSHB 1D1BA 3VSKA 3DKYA 3H9QA 4XR6A 1WJDA 2JA2A 3J7AY 4PJJA 4II2A 4CCLA 2NOJB 3K10A 3UR3C 4F91B 4IZZA 2CV1A 2L2OA 3IP4B 4HRIA 3VYUB 1Y56A 4GRIA 4BS9A 2OC6A 4DIQA 3OYDA 4XLAA 4XKBA 3ZCOA 3OYAA 2WADA 3DWLE 1Z7LA 2LYCA 2V26A 3H9JA 4F92B 4C2UA 4HSRA 4XN0A 4KT6A 4NUBA 2R7VA 4J00A 3GBGA 1LKXA 3EUAA 2JUGA 3A2KA 2IGMA 4C2TA 1FMWA 3D5RC 2XAUA 3MKWB 2KLOA 1U0JA 2M3AA 2KDOA 4XN3A 4AVZA 4HNUA 2F5VA 3PNTA 2LBFB 2W7NA 4XONA 1V5FA 2IS4A 3OR2C 3AKZA 4BE1A 3KYLA 3VYTB 1FMVA 4XM3A 3OS1A 4F3QA 2F6CA 2IXSA 1GLNA 3MD2A 1WJBA 3S3MA 2E5NA 1DGWY 3OL4A 1PYVA 2VKDA 3BG6A 3U21A 1E0EA 1D0ZA 2A5WA 1X4OA 4ZDLA 5CQEA 4PSWA 3ZGKA 4EATA 3LMMA 2DT7B 3VYSB 3OL3A 2BVLA 4ZDPA 4C9YA 4ITVA 3OYHA 4XKCA 3QODA 1WJFA 2HZDA 2IGKA 4XNFA 3DTIA 4HG2A 3OYFA 1AA7A 3EPZA 3PSIA 3K4LA 2HU9A 1UG0A 2HNHA 1S9HA 2M4GA 1Y6IA 4LIUA 3OY9A 3CZ6A 2CV0A 3CP2A 3HKZA 1WJAA 4CZCA 5JHFA 2DXIA 4HNTA 3FBIB 2W1OA 1EA3A 2L7KA 4Y3OA 1IRXA 3L2WA 3H9GA 1G8XA 3TBIA 2CV2A 4E7HA 4KISA 2E1MC 4YELA 4OAZA 5FRMA 3CP8A 2P0WA 3PSFA 2ZSIB 2XC7A 2DOAA 2E1MB 4BE2A 1MMDA 3VWBA 3D5SC 2MABA 2VASA 2VJ4A 3OR1C 2Q1ZB 2V4JC 2VJJA 1X1DA 4QPOA 5FRNA 2CW7A 3S3NA 4B43A 1W36C 3DTEA 2X6XA 1K6YA 3TL4X 4N4NB 3W2AA 4IKFA 3PNYA 2KP6A 2R7RA 2VJIA 3EUKL 4BEHB 3HOSA 3UNGC 3BCAA 3F9KA 4BQNA 3CJQB 1N78A 3H35A 2UV1A 1P9QC 2I8DA 4ZYAA 3BG7A 4F93B 1Z21A 4CSWA 2K3PA 3QYBA 4DBQA 3OYKA 2CUZA 3D5LA 2R7OA 4ZTFA 3C2HA 3FDYA 4U7BA 4PSXA 3VYRB 3ZQQA 3I9V2 3HPGA 1MMAA 2LRDA 4DBRA 4U87A 3VDXA 2OV7A 5LFAA 2V6EA 4BGDA 3QOEA 2MD0A 3IAM2 3OMYA 2GOXB 3OYGA 3OOUA 4MLOA 4IQ4A 3HC7A 2ZFUA 4RLFA 1KONA 2CW8A 3W2VA 1X1CA 1Z3XA 3PL8A 3S8PA 4DGWB 3PJRA 1OR7C 4FETA 3CESA 3K4CA 2V7FA 4YEJA 3L2QA 2DJIA 2UWMA 3TMOA 2IS6A 2IGOA 4D9JA 3I3LA 2HQAA 3DPLC 3N05A 4PFOA 4BU2A 5HVQC 2HDWA 2KPMA 2LG4A 1D1CA 2KQRA 3OYNA 4DJAA 2R7WA 5HOOA 2XF7A 4CCKA 3MKZA 3OS2A 3DU6A 4BE0A 4C30A 1MMNA 2W00A 3FHNA 3K6GA 1BR2A 2VQHA 2HVSA 2AQFA 3K4JA 2X1CA 2FUG2 3SEZA 2WAFA 3AL0C 3OYJA 1VZ0A 1WFXA 2KHMA 4IQJA 2WAQA 4KITB 3LSMA 4PJLA 1YE9A 4CCMA 3LFUA 3AL0B 2VIXA 1DP3A 5KCMA 2A6TA 2XDVA 4BJ5C 2WBMA 4X0GA 1TZLA 5KNLA 4BJTA 2W4SA 2VLAA 3OYLA 1PJRA 4II3A 4Y4RA 2Q2EB 2XF5A 3W3CA 4E6KG 1QHHD 2R7SA 2VQCA 4BACA 2KMUA 2VXDA 2X51A 3MKYB 1NG6A 4F55A 4B44A 2L5QA 2V1NA 4B48A 3K4BA 3H5AA 3AFHA 4B47A 2KRHA 1V5GA 3IUOA 2WAEA 2L9NA 2OUMA 2XF6A 2LREA 3HUGB 4N4OB 4CA0A 2R4GA 4JQFA 2CH0A 2HVRA 3BLYA 4E7ZA 2Z2SB 1YX3A 1N77A 4P1WA 2WY8Q 1QHGA 1WJ5A 1DQUA 3PUBA 1WJEA 4PUSA 3SZGA 2E5ZA 3DTKA 4PFPA 3IAS2 3OS0A 1X1AA 2JSPA 2KL4A 5CPRB 2BW3A 2X1DA 1BR1A 3K70D 2PJRA 3L2VA 2M7BA 5KHDA 2WY7Q 1D0YA 1UAAA 4CH7A 1Z3YA 4CCOA 1BR4A 2BVMA 3DLAA 2L9SA 1X19A 3RQ4A 4B3XA 3S32A 2LY2A 4XLCA 3ZXSA 4BUPA 4Y33A 4BJ6C 4E7SA 1NG7A 4NC8A 4PJMA 3SEQA 4CUGA 5HLTA 2BW3B 1LVKA 2VL8A 4BDYA 3OYEA 3ZR8X 1MMGA 2CMPA 3BCBA 1HA8A 4BQQA 4ZTJA 4R79A 2PJRB 4ZJZA 4PK4A 2X85A 3L2UA 2X6YA 2VJ5A 1SAUA 2R7TA 4H4KC 2Z16A 3LSIA 1DGRM 2MFZA 3LSGA 5CQGA 3OYIA 2GOMA 2V9KA 3A1YA 4XKWA 3SDBA 2O5RA 3M1CA 5FROA 3ONQA 2IGNA 4XORA 2LY1A 3DEEA 4QPQA 3K4KA 4DOZA 3HOTA 3HL2A 1BOBA 5CKTA 2CFOA 2LBFA 1QU3A 3H0DA 1UELB 3RTRA 4FASD 1R6RA 4JOMA 2KZVA 2K9LA 4G6TB 4LG3A 3EUHC 2HVQA 2K5CA 4HSTA 4RM2A 2W82A 3LSKA 4XL9A 4E7JA 4E7IA 3OYCA 1ERDA 4LIVA 4RM3A 3G2BA 1TT0A 1T95A 3CF2A 2DT6A 4E4HA 1D1AA 4CCJA 3DKXA 2R7XA 3MMYB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VQL A;  2VQG A;  2VQH A; 
#chains in the Genus database with same CATH topology
 3TDZ C;  3FWE A;  3ZQI A;  1IN4 A;  2LKX A;  1RNL A;  5B1A H;  4L0Y B;  4I76 A;  5EZG A;  3VSL A;  3S3O A;  3E1S A;  4YRV A;  3GTM J;  3GF2 A;  2EWN A;  1X1B A;  3KP4 A;  3GX4 X;  3L1P A;  3J7A O;  3IH3 A;  5ILU A;  5TJJ A;  1LDK B;  3PFY A;  4O3M A;  2XAJ A;  2WA0 A;  5FB2 A;  1Q1V A;  2VN2 A;  2IS1 A;  2XVC A;  1B8I B;  2HQR A;  2CSO A;  2MH2 A;  1J09 A;  5E1W A;  2Y48 A;  2ISY A;  1G3Y A;  1W0U A;  2EIL H;  3P9K A;  4A3F J;  2MC3 A;  1SFE A;  3KP6 A;  3ERM A;  5HS9 A;  2R7U A;  3A4C A;  1REP C;  1D0X A;  4KJZ A;  4B09 A;  3HG9 A;  1VQM I;  2K9N A;  2H94 A;  4IVN A;  1BJA A;  4XRM A;  1V54 H;  3G1M A;  4BDZ A;  1ZEL A;  1A36 A;  2DCE A;  2YX4 A;  1T2K A;  2MYS A;  1XGS A;  1BW5 A;  4ZC3 A;  5F0F A;  1N25 A;  2Y0S N;  1TWC J;  4CDG A;  1ZH5 A;  2EV0 A;  1TBX A;  2UUZ A;  1EH7 A;  1R1V A;  3ZQ7 A;  3UKG A;  1W4M A;  2STW A;  1OMI A;  4XLH A;  2VE8 A;  4P5O A;  4CZZ A;  5M3F J;  5GPA A;  2IA1 A;  4A3M J;  3WTT C;  4BYY A;  2EFN A;  3KEY A;  4ESJ A;  3S17 J;  5D6E A;  4QWQ A;  2W85 A;  2E60 A;  4KMU X;  3LNQ A;  5HNF A;  1XDS A;  3DPU A;  3SFI A;  1TWA J;  3DEU A;  3IV5 A;  1KU3 A;  3RQI A;  4IO9 F;  2CQK A;  3RKQ A;  2GA1 A;  3CME I;  1B9M A;  1CF7 B;  3G73 A;  3LL7 A;  1UJ8 A;  4RAF A;  4UVA A;  3MAJ A;  5LD2 C;  3C2B A;  1PP8 F;  1F5T A;  5AIP A;  3BC8 A;  4AYB A;  2KRC A;  5TGT A;  4NC6 A;  1W5C C;  3M1E A;  3N97 A;  4GCV A;  1OCO H;  1RKW A;  5GAE J;  5EZH A;  4IRI A;  3PIP F;  2DI3 A;  2FBH A;  2ZSH B;  4RGU A;  2LF7 A;  2JTV A;  3HYI A;  5FGM A;  5K7F A;  2L2O A;  1Z0X A;  3J80 K;  5J6X A;  4LB6 B;  1Y56 A;  4BS9 A;  3A0B C;  4OIR F;  4DIQ A;  1MDM A;  3OYD A;  2ETH A;  4XKB A;  1OYW A;  1Q1H A;  1R36 A;  2EB7 A;  5DEQ A;  4A3E J;  1Z7L A;  3BR5 A;  2HYJ A;  3KLO A;  4Y15 A;  5F64 A;  3H9J A;  4C2U A;  3WTU C;  1VND A;  2DLL A;  4G7H F;  5JLX A;  2HEO A;  1OCC H;  4J00 A;  3EUA A;  1GUU A;  1MJA A;  2GXB A;  5ED4 A;  2L02 A;  3GZN B;  1UG2 A;  2ZJ2 A;  4W97 A;  1U0J A;  2M3A A;  2Z9O A;  5K5O A;  4AVZ A;  1T6S A;  2GBY A;  2LBF B;  1V5F A;  5DD4 A;  2R5Y B;  3JAM K;  2VC1 A;  5FKO A;  3ZMV A;  2HFH A;  3TW6 A;  3HM5 A;  4F3Q A;  3B6A A;  1GLN A;  3G3Z A;  3MD2 A;  2CG4 A;  2E5N A;  1ZHF A;  3SZT A;  2VKD A;  3BG6 A;  4QIW N;  1VQN I;  3GZ5 A;  1U5T B;  2DMU A;  3CUQ B;  2Z5U A;  3HTS B;  1G2H A;  2COB A;  1R58 A;  4AM3 A;  1X4O A;  4PSW A;  1Y39 A;  3ZGK A;  3T1B A;  2ZJQ F;  2M45 A;  5HOD A;  2DTR A;  3LMM A;  2BGC A;  2WAQ N;  4RB2 C;  1OKR A;  2V79 A;  3OL3 A;  2BVL A;  3VYS B;  4FX0 A;  3X2Q H;  1ZK8 A;  2PI0 A;  2Z3Y A;  5BMZ A;  2RN7 A;  2AS5 F;  1U9O A;  4KIG A;  1W1W E;  1WJF A;  2HZD A;  2DK5 A;  4KNY A;  3TKY A;  3JRI A;  3TO7 A;  4HG2 A;  3WOD F;  4EJT A;  1UG0 A;  1H89 C;  4LIU A;  2PFB A;  5C3E J;  3BZ6 A;  5HDK A;  1IN6 A;  3PQK A;  3LAJ A;  2WC2 A;  1SFO J;  1WJA A;  4CZC A;  5K5Q A;  3FXK A;  3NRV A;  3RDI A;  1RUN A;  2NYX A;  2M2E A;  1EA3 A;  2A05 A;  4Y3O A;  5E18 F;  3KZI C;  1AKH A;  1G8X A;  1ETO A;  4I7H A;  5HS8 A;  1JGG A;  2CV2 A;  4KIS A;  2DQL A;  3Q9S A;  2VT3 A;  4OAZ A;  1IRG A;  3ML6 A;  2TRT A;  2XC7 A;  1B4A A;  3FZV A;  2X48 A;  2F4O B;  2E1M B;  3RPU A;  1MMD A;  3B02 A;  1ETQ A;  4BE2 A;  4A3J J;  4G7Z F;  2O3F A;  1I1S A;  2MAB A;  3BR6 A;  2VAS A;  4EM1 A;  5ICC A;  5IYB J;  2BXZ A;  1XPX A;  3F3X A;  5FRN A;  4B43 A;  3DTE A;  1KA8 A;  2CW0 F;  2X6X A;  4MQV A;  1K6Y A;  3TL4 X;  4D7N A;  4N4N B;  4A69 C;  2XRL A;  4M73 A;  3GTL J;  3UNG C;  2HOT A;  1MBH A;  3E5U A;  4BQN A;  2RDP A;  3BTC A;  2TDX A;  1N78 A;  2JQ7 A;  1BW6 A;  1R1U A;  4IRH A;  5L3F A;  3MWM A;  5LGT A;  1IGN A;  3SFZ A;  1WI3 A;  2K3P A;  3QYB A;  4DBQ A;  3D5L A;  1WH5 A;  2VBW A;  1ZAR A;  3C2H A;  4U7B A;  4PSX A;  4UVC A;  4ZYH A;  5E1Z B;  1ON1 A;  1U8R A;  2LR8 A;  3HIF A;  1H0M A;  4HF2 A;  3RPQ A;  3BJO A;  4OIO F;  2BBY A;  2RKH A;  3DXJ F;  3E6M A;  2L3D A;  2D2W A;  3E6B A;  1G3T A;  3AG3 H;  2NS7 A;  2M9H A;  2DPU A;  4KDP A;  4MLO A;  3WTW C;  1C0W A;  3HC7 A;  1H8A C;  5BPI A;  2CW8 A;  3DFG A;  3W2V A;  2GLO A;  4LD5 A;  3MZ8 A;  1OR7 C;  2QSF X;  4OU0 A;  1ZN2 A;  4M3E A;  4OOI A;  3ERE D;  1B1B A;  2V7F A;  3L2Q A;  1TLH B;  2DJI A;  4OIP F;  5H6Q A;  5DCF A;  3BPX A;  1Y8Q B;  4AD9 A;  1RC9 A;  4UXN A;  5ILV A;  1ZGA A;  1R71 A;  2LG4 A;  3ABU A;  1D1C A;  3LQR A;  1O7F A;  5GP9 A;  2KQR A;  4DJA A;  2R7W A;  3MZH A;  1X2M A;  5C4X J;  4G9Y A;  1CQT A;  3DU6 A;  2Z99 A;  4MTE A;  5B5E C;  1FX7 A;  3R6S A;  1HW1 A;  2XAF A;  3GTQ J;  5EYR A;  4D7M A;  2Y0M A;  1TWH J;  3CQZ J;  2W00 A;  1BBY A;  4HQE A;  1CGP A;  1HW5 A;  3D1N I;  3K4J A;  5KAF C;  5CVU A;  1S7E A;  2FUG 2;  4JX4 A;  4V19 K;  3QAH A;  5GTI C;  2WAF A;  2DMP A;  1WFX A;  2CWE A;  5H6R A;  2KHM A;  1VQ6 I;  4UV9 A;  1ETX A;  3CC4 I;  3AL0 B;  2VIX A;  3ECH A;  3PUF A;  1YLF A;  1RRJ A;  3M4O J;  5J1Y A;  5E8G A;  3RJP A;  4BJ5 C;  2WBM A;  3J81 K;  1BL0 A;  4CYD A;  2RGV A;  5GTH C;  3KE2 A;  1S29 A;  2W4S A;  3HUG A;  5J4Y A;  5EG0 B;  2XRN A;  1PJR A;  3EET A;  4AC0 A;  5HLH A;  3JSP A;  2VOP A;  1FEX A;  2ZNY A;  4DZJ A;  2Y9Z A;  1IXR C;  2LY9 A;  2KMU A;  2XKP A;  2X51 A;  4ZZD A;  1FOX A;  2FML A;  2L5Q A;  2V1N A;  3LQQ A;  1HKT A;  3H5A A;  3AG4 H;  4UUS A;  2LSO A;  3JRH A;  3F8F A;  2OCC H;  2E1N A;  1V5G A;  1BC8 C;  1XG1 A;  1FBU A;  2XF6 A;  4EEF G;  2FD5 A;  5JI6 A;  2K85 A;  2JSC A;  1JHF A;  4JQF A;  2CH0 A;  1BOA A;  2NOG A;  1PDN C;  4E7Z A;  4Q5S F;  1YX3 A;  4ESB A;  3HGG A;  2QEX I;  4EGZ A;  1R22 A;  3DBL B;  1QHG A;  2WY8 Q;  2OTJ I;  1DQU A;  5EEG A;  4HZF A;  4PFP A;  5LBQ A;  5FLV A;  3OS0 A;  1X1A A;  2JSP A;  1BI3 A;  3BTJ A;  5C44 J;  1ZGJ A;  5FKK A;  2X1D A;  5DTD A;  1HKS A;  4I2O A;  1F43 A;  1HLV A;  5E8I A;  4MIM A;  4FE4 A;  3AG1 H;  2IEK A;  2NAZ A;  2ECB A;  2ZKZ A;  1WKM A;  4NDL A;  1LQ1 A;  2Y2Z A;  2EH3 A;  2GA2 A;  3L00 A;  2R92 J;  2ZME A;  3DLA A;  1X19 A;  2PMH A;  4MFD A;  4E7S A;  3LAP A;  2XPW A;  1WZ2 A;  5C4J J;  1IF1 A;  1OJL A;  4EM2 A;  1HQC A;  5J8C A;  3OYE A;  1MMG A;  5IP6 A;  1SMT A;  3CO7 C;  3F0C A;  4I02 A;  4BQQ A;  5JVG F;  1VTN C;  4ZTJ A;  4ZJZ A;  2ZC2 A;  2QQB A;  4PK4 A;  3O6B B;  4HF0 A;  1FOY A;  2ZBK A;  3KEO A;  1DU0 A;  2X6Y A;  2VJ5 A;  4EQQ A;  4UNO A;  3M8E A;  2QYO A;  1HSJ A;  5JHU A;  3LSI A;  1LFB A;  5IPA A;  3WG9 A;  4DYR A;  4FIS A;  2R93 J;  4XIC A;  3CCR I;  4L5I A;  3WGG A;  3KET A;  2HOE A;  3G71 I;  2WV0 A;  2V9K A;  3A1Y A;  2O5R A;  2QEN A;  3D0S A;  3ONQ A;  2DAO A;  2IGN A;  1J0R A;  4XOR A;  3DEE A;  3HL2 A;  3K4K A;  2X6O A;  3CDH A;  1BOB A;  1ON2 A;  1OYI A;  3L2C A;  1QU3 A;  2X0L A;  1UMQ A;  4BY7 J;  3RTR A;  3HJE A;  2KZV A;  2FEZ A;  1A35 A;  3HRS A;  4G6T B;  2ZO4 A;  4XK4 A;  4WWC A;  4MNU A;  2NRA C;  3I59 B;  4KIC A;  2YPR A;  5F08 A;  1U6G A;  2MLK A;  3EUH C;  1G6N A;  3HSR A;  1UCR A;  1XMK A;  2O7O A;  1IXS B;  4E7J A;  3OYC A;  4E7I A;  2QF7 A;  1TT0 A;  3CF2 A;  3LST A;  5CVI A;  4E4H A;  3QRF F;  2JWT A;  5ICG A;  4AIH A;  1T0F A;  4A3K J;  1P4W A;  2DA3 A;  2WB1 A;  2E7W A;  1S5L C;  1JGS A;  2L01 A;  1B8I A;  2ZB9 A;  3V7C A;  3DQV C;  1YIJ I;  3PNV A;  4LIT A;  4HYE A;  5DDG A;  2XGE A;  4OAY A;  1UST A;  2RNG A;  1ZLJ A;  2KKO A;  3OIP A;  3BZK A;  5IT9 Z;  1DPU A;  2G7H A;  4XLE A;  1FIA A;  3KX2 A;  4D1Q A;  2DU9 A;  4MGR A;  4F52 A;  1FLI A;  4NQW B;  1BIB A;  4RBO A;  3JRD A;  2HPM A;  2JVH A;  1J59 A;  3RSN A;  4BAY A;  4XQF A;  1KYW A;  1P6R A;  4XOP A;  2YU9 J;  3GLX A;  4KN4 X;  2X6W A;  3FIW A;  1QQI A;  3G1O A;  1O7L A;  2V1U A;  2PMZ A;  3QYE A;  3H5N A;  5E3N A;  2QKM B;  5F0H A;  3K0L A;  4FTH A;  4XLF A;  5H20 A;  3QYF A;  4ABZ A;  3IRR A;  1DPR A;  3PM1 A;  1IRZ A;  2GAU A;  3WHC A;  1K4S A;  2LC2 A;  5DM7 F;  2O0Y A;  3H36 A;  5M3M J;  1POG A;  1EH6 A;  2DPD A;  1XX5 A;  4XKV A;  2JJ7 A;  5CVR A;  2JRM A;  1MH3 A;  1VQ7 I;  2XV4 S;  4XRS A;  5LLQ A;  2FNA A;  5FJ8 J;  2X1E A;  4LG0 B;  2M4K A;  3KP3 A;  1A31 A;  2K3F A;  1XCV A;  4IHS A;  5D5X B;  4HV6 A;  3LSH A;  3LFK A;  1YS6 A;  1FSH A;  4I01 A;  3BOQ A;  3JSO A;  1ZLK A;  4IJA A;  4NNJ A;  2F48 A;  1JJ8 C;  2PX9 A;  2KJC A;  3OYM A;  4YIR X;  1CF7 A;  4LLN A;  4AIJ A;  3CCM I;  2XGX A;  1E3H A;  4IHV A;  1Y1W J;  3LOC A;  2HQ5 A;  4E7L A;  4HA8 A;  2Z1D A;  3VOE A;  3T5X A;  5J1R A;  3F8C A;  1FSE A;  2G0E A;  3C3W A;  4A6D A;  2RRE A;  2O8K A;  1VI0 A;  3RPU D;  3WE3 A;  3TDU C;  2E2H J;  4IX7 A;  1SD6 A;  1QGP A;  4BEH A;  2ME6 A;  4RS8 A;  4MFE A;  1WCM J;  4M72 A;  3NWT A;  3NWS A;  4A2U A;  1MND A;  2F4I A;  2CUJ A;  3W2W A;  4XOT A;  3K2Z A;  2EK5 A;  3CTA A;  1WRJ A;  3R0J A;  2ESN A;  4Z2Y A;  4CCN A;  1IRF A;  2A5Y B;  2R5Z B;  1SAN A;  1LE8 B;  2H6B A;  2EJR A;  3E0J B;  3W6V A;  1I50 J;  3VSK A;  1ONV A;  3CD6 I;  1AU7 A;  1SD5 A;  5ICE A;  1RIO H;  1K78 B;  2AXL A;  3K10 A;  4PZJ A;  3UR3 C;  4F91 B;  4IZZ A;  4BXX J;  2JPC A;  4UUV A;  4GRI A;  4I09 A;  3BR1 A;  2M87 A;  4XLA A;  2L4A A;  1TNT A;  1OCZ H;  3WU0 A;  3MFK A;  2WAD A;  2DA2 A;  3DWL E;  1MMS A;  3C18 A;  4PJ0 C;  2R5Y A;  1YOV B;  2K9Q A;  2OJE D;  3OIO A;  4HSR A;  1W5T A;  2XGC A;  1W7P B;  4L5J A;  2MBF A;  2BHZ A;  5K5R A;  6PAX A;  3M7G A;  1J9I A;  3ZMS A;  5JLW A;  4IHT A;  1FP2 A;  3MKW B;  1AHD P;  1U5T A;  2KDO A;  2YSR A;  2HTJ A;  3FM3 A;  4HNU A;  3RI4 A;  2VOD A;  4HLX A;  3AAF A;  2IS4 A;  3OR2 C;  3AKZ A;  3KYL A;  4XSZ F;  3BWG A;  3LA3 A;  3S1R J;  1R1T A;  2DQR A;  3K9T A;  2FRH A;  1XMA A;  1WJB A;  1HW2 A;  3QP6 A;  3S16 J;  3FIS A;  1PYV A;  1MBJ A;  4YG2 F;  3H3U A;  3V8K A;  1TTY A;  2GWR A;  1E0E A;  1FBS A;  3T0Y A;  4GYG A;  4LB5 A;  4ZDL A;  4EM0 B;  4A12 A;  1HDP A;  1VQ4 I;  1Y1V J;  1HKQ A;  3BG5 A;  2LD5 A;  2DT7 B;  1LB2 A;  1LNW A;  2EIN H;  2JPB A;  3CC2 I;  2NVQ J;  1XS9 A;  2ZCW A;  1R5G A;  4KT5 C;  3RYP A;  1S3J A;  2IGK A;  2F4M B;  4XNF A;  5A2Q Z;  1YIO A;  1MJ9 A;  2OQR A;  3PSI A;  1QPI A;  3ABL H;  3B6C A;  3FXJ A;  3E5X A;  3RIR A;  1Y6I A;  2DDB A;  5H2F C;  1YJW I;  2CV0 A;  1ZG3 A;  2K4J A;  3HGY A;  3HKZ A;  2A69 F;  4RA2 A;  4RB1 A;  2DDA A;  5GPC A;  2DXI A;  4CGZ A;  3FBI B;  4ESF A;  2L7K A;  3L2W A;  1IRX A;  3QOP A;  1VQ8 I;  1FWZ A;  3TBI A;  2HR3 A;  1OIS A;  5F27 A;  3HB9 A;  1ENH A;  1DUX C;  2QGU A;  2ZSI B;  2EZL A;  3ISP A;  3ROU A;  2DBB A;  2JA6 J;  1LEB A;  3VWB A;  2Q0O A;  3D5S C;  4I0A A;  3SHF A;  5E3M A;  1TWF J;  2VJ4 A;  2VJJ A;  1X1D A;  2XUB A;  3MZY A;  2P7C B;  3TO9 A;  3F8M A;  2CW7 A;  2A6H F;  4IL6 C;  2HYG D;  2E1O A;  4IXA A;  4X1E A;  3W2A A;  4IKF A;  3PNY A;  4PDK A;  2KP6 A;  1WWX A;  2VJI A;  4E70 A;  2FMY A;  1UHM A;  1HCR A;  3BCA A;  2UXN A;  3U1D A;  2L7Z A;  2JN6 A;  1MBF A;  3M8F A;  4UVB A;  3V4G A;  4BH9 A;  2XHK A;  4B3A A;  3GTJ J;  3QPL A;  1TT5 B;  3KFW X;  4QTR A;  3WHB A;  2I8D A;  4ZYA A;  1JTX A;  1A6Q A;  3BG7 A;  1Z21 A;  1MZB A;  4CSW A;  4F93 B;  3GWZ A;  3ESW B;  1Z7U A;  2R7O A;  4ZTF A;  3FDY A;  2DFI A;  1P4A A;  3IKV A;  3VYR B;  4YFX F;  4WX9 A;  3HDD A;  2LRD A;  4M74 A;  3I0T A;  4A3I J;  2EPF A;  1XN7 A;  2QUF A;  1XMX A;  3QOE A;  1XC5 A;  4L9T A;  2DOD A;  3IAM 2;  2GOX B;  1K4T A;  2QLZ A;  2OBP A;  3A0H C;  4MEY F;  4LK0 F;  1RR8 C;  2OA4 A;  3FKI J;  4IQ4 A;  2JMW A;  1TC3 C;  2K27 A;  1KQ9 A;  2MW8 A;  2ZFU A;  4P55 A;  1KON A;  4YIF A;  1X1C A;  3PJR A;  4DGW B;  3Q0V A;  2DMN A;  2J5O A;  1GHC A;  3LWF A;  3BJ6 A;  4KUM A;  3CJN A;  2UZK A;  4PGH A;  3CES A;  2NS0 A;  1APL C;  3MKL A;  4YEJ A;  2VKV A;  3HHH A;  2VT2 A;  2IS6 A;  2ZXJ A;  1LPQ A;  4D9J A;  1LUJ B;  3W6K B;  4FT8 A;  2KPM A;  2VUM J;  2HKO A;  3I55 I;  3WTY C;  2LP0 A;  1IDY A;  3OYN A;  2DA4 A;  1L3L A;  3M3Y J;  1BI2 A;  2MH9 A;  1SD4 A;  3MVP A;  3IL2 A;  4GFB A;  2YX7 A;  2QSH X;  2DA1 A;  1MMN A;  1TWG J;  4XLP F;  1FP1 D;  1YIT I;  4ENM A;  4XBF A;  3ZOB A;  1BR2 A;  2VQH A;  5EG0 A;  2AQF A;  4Q47 A;  2HVS A;  2X1C A;  1KZH A;  3DBH B;  2N8G A;  1TP4 A;  5HLG A;  4I0B A;  3OYJ A;  1EH8 A;  2COM A;  1E3O C;  4KIT B;  4GDF A;  4S0H B;  1TW2 A;  1YE9 A;  1XD7 A;  3E6D A;  4CCM A;  2M1B A;  1MJB A;  5KK1 A;  1XCB A;  2FBI A;  1TZL A;  2X4H A;  5CVJ A;  3GTP J;  3DEW A;  1A04 A;  2GXA A;  1MKM A;  2LFB A;  4Y4R A;  2XF5 A;  3Q0U A;  1VFC A;  2YR2 A;  5LRS A;  1NG6 A;  4F55 A;  5HS7 A;  3I71 A;  4KMF A;  2LKP A;  3K4B A;  3LA2 A;  4HLY A;  2O03 A;  1S7O A;  3J7Z I;  5D4R A;  2KRH A;  1J7K A;  1VQ9 I;  2L9N A;  2OUM A;  2VC0 A;  2EBI A;  2H8R A;  1Z1D A;  3BLY A;  3VB2 A;  5LEJ A;  2OZ6 A;  3G4S I;  3HOX J;  2JRT A;  3KEQ A;  4P1W A;  2NVX J;  2W25 A;  1WJ5 A;  3MQ0 A;  5KVR A;  3SZG A;  1NK3 P;  3DTK A;  4L5E A;  5B3S H;  3JTG A;  4RGR A;  1YYV A;  4I98 B;  3ZQL A;  1JKO C;  1FC3 A;  4ETS A;  4G94 A;  1BR1 A;  4U0W A;  2EFW A;  3K70 D;  4F7Z A;  2M7B A;  1PVE A;  1X3W B;  3FF5 A;  2BVM A;  1JKP C;  2L9S A;  3ZXS A;  5JFR A;  1EF4 A;  4Y33 A;  4BJ6 C;  1NG7 A;  1SFX A;  2MLG A;  2RAE A;  2ID3 A;  5DV5 A;  3SEQ A;  4CUG A;  5BPD A;  5HLT A;  2NS8 A;  2L4M A;  2VL8 A;  4BDY A;  4EJV A;  1XSX A;  4P96 A;  2HYF A;  1FT9 A;  4DYQ A;  3F6O A;  3FXL A;  2PJR B;  2ZME C;  5IOY A;  2X85 A;  4BNC A;  3L2U A;  5J8F A;  5IY5 H;  2A07 F;  2R7T A;  1O4X A;  4H4K C;  3SZP A;  2IW5 A;  4HX8 A;  4ZYE A;  1O3T A;  1DGR M;  1LFU P;  4NB5 A;  4OMZ A;  2IAI A;  3LSG A;  3I59 A;  1L0O C;  4DQ2 A;  4RGX A;  3ZMZ A;  2EIK H;  3GO5 A;  4KFC A;  1D5Y A;  2LY1 A;  1RKT A;  4QPQ A;  3TOA A;  4DOZ A;  5M5X J;  4U0Y A;  5BS6 A;  1IV8 A;  3COA C;  1FYM A;  2CRG A;  2WWY A;  5IOZ A;  4FHT A;  1NTC A;  3H0D A;  2JA5 J;  3HOU J;  1YW7 A;  5F1R A;  2HOS A;  1IC8 A;  2H6C A;  1R6R A;  1U9N A;  2KIF A;  4JOM A;  4RDU A;  1OPC A;  3VFZ A;  3E6C C;  4RAZ A;  3NEU A;  1FBQ A;  2JT1 A;  3GYH X;  2HVQ A;  5F1J A;  3OV8 A;  4ASN A;  4NQW A;  1ERD A;  2K40 A;  2R7F A;  4MO7 A;  2P5K A;  3Q9V A;  1O3Q A;  4BHB A;  2A68 F;  1P92 A;  3V8J A;  2Z33 A;  1H9T A;  3RZO J;  2R7X A;  1T08 B;  4NC7 A;  2ZNZ A;  4KA4 A;  1LEA A;  2V9P A;  3PIO F;  5E3O A;  1JI8 A;  1SC7 A;  5FFZ A;  2AQE A;  5E20 A;  2DA7 A;  3DBR B;  4C3I J;  3K1M A;  4C3H J;  3K4M A;  1OLT A;  3S1N J;  4XMY A;  5IT3 A;  2DA5 A;  3K4N A;  4O6J A;  1FJL A;  1T0F C;  3BJA A;  4GO1 A;  3RCO A;  4MEX F;  2DMT A;  2RC4 A;  1YTY A;  1WSU A;  1BI1 A;  4G8X A;  5HDG A;  1X3Z B;  2VB6 A;  4P9U A;  5DM6 F;  4LG0 A;  3ABK H;  3E3V A;  2IS2 A;  1LFP A;  3L2R A;  4LLL A;  4E7K A;  3FXM A;  3REO A;  4AUX A;  4IOC F;  2DMQ A;  5IT9 K;  1B72 B;  3FK6 A;  2HWV A;  3O3K A;  1QVU A;  1XSD A;  5F04 A;  4XRS G;  1P4X A;  2DT5 A;  1TQI A;  1QZY A;  4NBQ A;  4XSX F;  4Y17 A;  2NNN A;  4IEJ A;  3DKW A;  3CMM A;  1SAX A;  4RLQ A;  3W6J B;  3A03 A;  1ZAO A;  2PN6 A;  3ZN1 A;  4HPQ A;  4Z6Y A;  4HDU A;  2PBI A;  4RMN A;  4BHP A;  4EV0 A;  1WJC A;  2LH9 A;  2Y0S A;  3S93 A;  3HOZ J;  3BQY A;  4LLG F;  1Z67 A;  4MTD A;  2BHY A;  2ZXH A;  3VPR A;  1R23 A;  2HPI A;  1ORK A;  5L3B A;  1T98 A;  2FX0 A;  1K79 A;  4D0P A;  1HST A;  3NAU A;  3K70 C;  2FXA A;  2O8X A;  3ZRG A;  4HX4 A;  4M6V A;  1N75 A;  3Q0W A;  1W36 D;  3FK7 A;  3GFM A;  2QSG X;  1Y0U A;  3DU5 A;  3H5R A;  3PQJ A;  1U78 A;  2YUS A;  3HEF A;  1T38 A;  2R5Z A;  1LE8 A;  1LDJ A;  2RQP A;  2M0M A;  1O57 A;  4OMY A;  4OWR B;  1W5S A;  2VQL A;  3HXL A;  1VQ5 I;  1VQK I;  3BDD A;  2QBY B;  1K78 A;  1TNS A;  2JVG A;  2VON A;  1YX5 A;  1IO2 A;  3S14 J;  3WU2 C;  4HW0 A;  3U1K A;  1S7A A;  4XLN F;  2P8T A;  2OD5 A;  3WTX C;  1G59 A;  1A6I A;  2ISZ A;  2A3S A;  3BG3 A;  4AYB N;  1BIA A;  4UV8 A;  2VPL A;  1IXC A;  1NK2 P;  2R7Q A;  1RPW A;  3P7N A;  1MGT A;  5DD8 A;  4QLC U;  1W7P A;  2XSJ C;  1B6A A;  2OF7 A;  3CJR B;  1SFK A;  3I58 A;  3OIQ A;  5FKM A;  4BL0 B;  4PJN A;  2O6G E;  1D1B A;  4M3G A;  4RB3 C;  1MIJ A;  3H9Q A;  4XR6 A;  1WJD A;  1MBE A;  1F36 A;  4CCL A;  3HRU A;  4IOA F;  2CV1 A;  4C2M J;  4XID A;  3IP4 B;  2XGD A;  1J2X A;  3O8G A;  5FLX Z;  4L0Z B;  2E34 A;  3CDI A;  3S2W A;  1I6X A;  1OR7 A;  2DK8 A;  2FJ1 A;  1OCR H;  2LYC A;  3HSE A;  4Y7N J;  4F92 B;  3DP7 A;  5EEH A;  3GFI A;  1UHS A;  2QQ8 A;  3I5U A;  4KT6 A;  1QZZ A;  4NUB A;  5FO5 A;  2R7V A;  1LKX A;  3R61 A;  4CO8 A;  1YS7 A;  1J75 A;  3D5R C;  1QO0 D;  2XAU A;  3BT9 A;  3ZMT A;  1MBK A;  2KLO A;  2IRF G;  1K6O A;  1RUO A;  5K7H A;  3WU1 B;  1X1P A;  1VQO I;  2FOW A;  3GTO J;  3PO3 J;  2PMU A;  3PNT A;  2XAH A;  1KU9 A;  1SVO A;  2W7N A;  3TP0 A;  1IW7 F;  4PCQ A;  5LGN A;  1FMV A;  2UXX A;  2O9L A;  4XM3 A;  2K4B A;  1XGN A;  4MHG A;  2IXS A;  4M9X A;  5IP9 J;  2K9S A;  3VOD A;  2JA8 J;  3G6E I;  1U5T C;  4DYC A;  1DGW Y;  3CUQ C;  2WTE A;  2ELK A;  3IWF A;  3CCS I;  1IN5 A;  1Z05 A;  3ASO H;  4FCY A;  2GZW A;  1ZG1 A;  3U21 A;  5L3G A;  3F72 A;  2WV1 A;  2HZT A;  3NQO A;  2A5W A;  3L7W A;  3P9I A;  2Q2E A;  3A02 A;  2QA4 I;  3TGN A;  3CMY A;  4ZDP A;  4U88 A;  2H8W A;  3F22 A;  3CCV I;  3I56 I;  3C7J A;  4XKC A;  2M8E A;  4LOC A;  2CQQ A;  2O61 A;  1X58 A;  3FHZ A;  1RR7 A;  1YJN I;  2HU9 A;  2D1V A;  2R7Z J;  1S9H A;  3HHG A;  2Y9Y A;  4GGG A;  4DW6 A;  3OY9 A;  2JA7 J;  3CP2 A;  1UB9 A;  5GAG J;  4R8H A;  5JHF A;  3K1P A;  1IV6 A;  2B9S A;  3ELK A;  2ACJ A;  3CC7 I;  3F23 A;  3CCJ I;  2IT0 A;  1I1G A;  2BV6 A;  3PO2 J;  1FPQ A;  4RAY A;  4RGS A;  2RNJ A;  4E7H A;  5FD6 A;  1HF0 A;  3S1Q J;  1U3E M;  4FE7 A;  2E1M C;  5A2Q K;  5FRM A;  1FNN A;  1RI7 A;  3CP8 A;  2P0W A;  4LFU A;  4YFN F;  2E1C A;  3OOP A;  1ZGW A;  1VQL I;  1TQM A;  3ECO A;  3M9A A;  4A3C J;  1YW9 A;  5J1U A;  2R7D A;  4QPO A;  4CYC B;  2PEX A;  2KRF A;  3ZQF A;  1QBJ A;  1ETK A;  2MGQ A;  4AVP A;  3S3N A;  1W36 C;  1U2W A;  5TIS C;  4YFK F;  1ULY A;  1FY7 A;  1E3P A;  2BXY A;  4BY1 J;  2R7R A;  3HSF A;  1GVJ A;  2OQG A;  2CYY A;  3HOS A;  1LDD A;  3F9K A;  2H27 A;  3BY6 A;  1S72 I;  3CJQ B;  3CCQ I;  4X6A J;  2EIJ H;  2HDD A;  1YRN B;  1J5Y A;  1H9G A;  1V3F A;  1Z9C A;  3H35 A;  1TL8 A;  4M3D A;  4L18 B;  2UV1 A;  3DCF A;  1P9Q C;  1XGO A;  5L3E A;  4JBA A;  2I10 A;  2CUZ A;  1R49 A;  1OQY A;  3I9V 2;  1FZP B;  1R5I D;  2MSY A;  3HPG A;  3BTI A;  3LA7 A;  1TW3 A;  4U87 A;  4HOB A;  5F6F A;  2OV7 A;  1ETY A;  2V6E A;  3QU6 A;  1GXP A;  4JX6 A;  4OIQ F;  4EMS A;  2MD0 A;  4L9J A;  5M5Y J;  3RKX A;  2EV6 A;  2PLY A;  3OYG A;  3WE2 A;  5LHG A;  2CQ7 A;  4J19 A;  1BM9 A;  3OOU A;  2FU4 A;  3QPS A;  4N9I A;  2F5C A;  3KYD B;  4RLF A;  4AWX B;  3C1D A;  3PL8 A;  1Z3X A;  3QQA A;  3RKW A;  2VBX A;  3EUH A;  4FET A;  1GDT A;  3K4C A;  5EEA A;  2GXG A;  4D5C A;  3TMO A;  4B4C A;  3H3Z A;  2IGO A;  5LRR A;  4WXC A;  2HQA A;  3F8N A;  4KIF A;  2OTL I;  5HVQ C;  4BU2 A;  4CHU A;  1Y0N A;  1BJZ A;  2HDW A;  2CGP A;  4H0E A;  2BY0 A;  3KYC B;  3MKZ A;  4CCK A;  1IG7 A;  3OS2 A;  4AID A;  3IH2 A;  1I6H J;  1E17 A;  2LDU A;  2GM4 A;  3MCZ A;  5LHI A;  4ZZL A;  3G1L A;  1EV7 A;  1RET A;  3SEZ A;  4RAG A;  2L0K A;  4HX7 A;  4ENK A;  3AL0 C;  2HGC A;  1VZ0 A;  3S2H J;  2VI6 A;  2ID6 A;  4PJL A;  3TED A;  3IC7 A;  3LFU A;  1ZRE A;  1DP3 A;  1STZ A;  1X2N A;  3O2P E;  2A6T A;  5KCM A;  3E5Q A;  1MD0 A;  2K02 A;  3K2A A;  4LK1 F;  5L3C A;  4X0G A;  5KNL A;  4CXF A;  1BN5 A;  2Y75 A;  1KQ8 A;  1ZG5 A;  2Q2E B;  3FXR A;  5D8K B;  4E6K G;  4A6E A;  2OCE A;  2R7S A;  3ABM H;  2VQC A;  3R0A A;  4BAC A;  2EZK A;  3T8T A;  3O8H A;  3MKY B;  3CLQ A;  4NHJ A;  4B44 A;  3GZ6 A;  3IWZ A;  1NHA A;  4KIB A;  2Y30 A;  4IRG A;  1EJ9 A;  3AFH A;  3I54 A;  5BNG A;  3GFJ A;  3BRO A;  2CU7 A;  3R4K A;  4M71 A;  4A0Z A;  2V6C A;  2GIV A;  5KAI C;  3BR2 A;  5EDN A;  3ZPL A;  2KJB A;  4CA0 A;  2R4G A;  1JUM A;  2XPV A;  2HVR A;  1RES A;  2W48 A;  2AXT C;  1E2X A;  1ZYR F;  3V7S A;  2DOF A;  1YHQ I;  2M30 A;  1YQA A;  5ILS A;  5K1Y A;  1GV5 A;  1WJE A;  2E5Z A;  3I4N J;  3IAS 2;  2JUC A;  4A5N A;  2E7X A;  1F9N A;  1QPM A;  2VKE A;  3HRM A;  4PGG A;  5CPR B;  3I53 A;  1LVA A;  2CQX A;  2P6S A;  4LMY A;  2EA2 A;  3CO6 C;  1JUS A;  3FMQ A;  2PJR A;  1IN8 A;  2HXI A;  2DOE A;  4D5F A;  1D8J A;  2ZFW A;  5DCM B;  3SJM A;  5KHD A;  3DF8 A;  2BYV E;  1Z3Y A;  3TP3 A;  4BHC A;  2KIU A;  4HQM A;  4LGW A;  4CCO A;  5M5W J;  1JKQ C;  1G3S A;  3S32 A;  4XLC A;  2ELH A;  4N0B A;  4BUP A;  2DTZ A;  2HTS A;  4B8X A;  1T33 A;  3Q3S A;  2QVO A;  3EDP A;  2B0L A;  5BOX A;  2BW3 B;  2DW4 A;  4KN7 X;  1LVK A;  4WXH A;  2VE9 A;  3HOY J;  3OSG A;  2E36 A;  4KYW A;  2CMP A;  2FQ3 A;  2QZ8 A;  4HV5 A;  1HA8 A;  3MN2 A;  5J3L A;  4EJW A;  3LSP A;  1MSF C;  3A01 B;  2NNY A;  2P6T A;  1QA6 A;  1FTZ A;  3I4P A;  2MFZ A;  2C6Y A;  3P9C A;  3OYI A;  5BQT A;  9ANT A;  1GT0 C;  3ASN H;  4XKW A;  1ZRF A;  2BE5 F;  1BC7 C;  2EA4 A;  1ODD A;  3HOT A;  4V2F A;  4M3F A;  5D6F A;  3IHU A;  1W7P D;  5CKT A;  2CFO A;  3TW7 A;  2STT A;  4ZH4 F;  1JT6 A;  3S2D J;  3QPT A;  1UEL B;  4ENJ A;  2D5V A;  1T39 A;  2VBY A;  4XRF A;  2EFP A;  3WTV C;  3F6V A;  2XSD C;  3BP8 A;  3V7R A;  1JTY A;  2ZJP F;  4HST A;  4RM2 A;  2W82 A;  3CCY A;  3FM5 A;  4XL9 A;  3QPH A;  3G2B A;  4BBR J;  1T95 A;  1KQ0 A;  3RYR A;  1D1A A;  2WB1 N;  2G9W A;  3JCU C;  4CCJ A;  5LGU A;  3DKX A;  1X3U A;  3CF5 F;  3MMY B;  1R4N B;  1DP7 P;  1JKR C;  1UZC A;  1OCT C;  3LSR A;  3CMA I;  1P2F A;  1S6L A;  2CQN A;  2VBZ A;  1PUF A;  3PFI A;  1I5Z A;  4WXD A;  1B72 A;  3JRC A;  1FYL A;  4WK8 F;  3HTU A;  2V9V A;  3RZD J;  2E35 A;  1AWC A;  1HDD C;  2BOL A;  2QKL B;  1U8B A;  1VQP I;  2PMZ N;  4G6D A;  4ANJ A;  3FKJ A;  5HNH A;  2KFD A;  2DFE A;  1MBG A;  1YO5 C;  2MC4 A;  2XRO A;  2OPT A;  3I64 A;  3ZN0 A;  3H1C A;  3E7L A;  4A3B J;  2F5E A;  1XDU A;  4ZDO A;  5JVT A;  4AU7 A;  3GW2 A;  1IDZ A;  2W84 A;  2EFO A;  4DZP A;  4EJU A;  4U7D A;  2P5L C;  5D8L B;  2H09 A;  2ELJ A;  2LOO A;  3OSF A;  2VXZ A;  3BTL A;  3E97 A;  1V4R A;  2DO7 A;  3FBN B;  4BKX A;  2VKH A;  3FXU A;  1MNE A;  2DFF A;  2EFQ A;  2XPU A;  1KGS A;  1OYY A;  1SEU A;  2MD5 A;  1YJ9 I;  4HNV A;  3C2G A;  4GXO A;  1V5E A;  3VEP A;  4BXF A;  3M8J A;  1MW7 A;  2ZXW H;  3T8R A;  3CJT B;  1SVL A;  3DPT A;  1Y8R B;  5J40 A;  2Y69 H;  4O5V A;  2XB0 X;  1A5J A;  5DUK A;  2QBY A;  1QVT A;  3BR3 A;  1MH4 A;  2XIG A;  3HPH A;  4OIN F;  2F2E A;  2MG4 A;  3SQN A;  2OAZ A;  1ETV A;  2CS3 A;  3SYT A;  3BPV A;  2M7A A;  2G7U A;  2IA2 A;  5GAD J;  4A3G J;  4G7O F;  4I6Z A;  2M34 A;  2L7M P;  1HOM A;  2P4W A;  4A0Y A;  2RQQ A;  1USS A;  3JRA A;  4J01 A;  3QU3 A;  3S1M J;  2KT0 A;  2VQG A;  1GVD A;  2FF4 A;  3S15 J;  4UHT A;  4A5M A;  4LJZ F;  1I39 A;  1K83 J;  2NVU B;  2W24 A;  3KLN A;  3J80 Z;  2R0Q C;  4HAM A;  5ERI A;  2K9M A;  3BR0 A;  4HEA 2;  2CUE A;  2FOK A;  2LVS A;  3OWT A;  4BQO A;  2ZXI A;  1T8I A;  1ZRD A;  3GTG J;  4S05 A;  1JT0 A;  3V42 A;  1X4P A;  2D1H A;  3CCL I;  3OYB A;  1SVM A;  1ETW A;  2BY1 A;  3DKY A;  3LSJ A;  1OFC X;  4UB8 C;  3JRE A;  2JA2 A;  1KU2 A;  4HF1 A;  3J7A Y;  5CJ9 A;  2W57 A;  4II2 A;  4PJJ A;  4ZYG A;  2NOJ B;  2XAS A;  3J7Y J;  3VYU B;  4HRI A;  4UB6 C;  3K69 A;  1D8K A;  1WVR A;  2OC6 A;  1ZR2 A;  3ABT A;  2CJJ A;  3ZCO A;  3OYA A;  1VF9 A;  4IPA A;  3JAM Z;  2V26 A;  4M9Z A;  3ULQ B;  1FIP A;  4XN0 A;  3ZMD A;  4Q48 A;  3GBG A;  2IA0 A;  2JUG A;  3A2K A;  2V1X A;  1GV2 A;  2IGM A;  4C2T A;  2L9R A;  1FMW A;  3GTK J;  2KDZ A;  4ENN A;  3RKY A;  4XN3 A;  1MDM B;  2F5V A;  5FLX K;  3K7A J;  3HBL A;  2ICW G;  3TOB A;  4XON A;  2VOO A;  2M0C A;  4BE1 A;  2QM3 A;  2ME0 A;  2LTP A;  3GME A;  3VYT B;  1ZQ3 P;  3K1N A;  3OS1 A;  2F6C A;  1ACI A;  4B1R A;  4M3B A;  1QRY A;  3S3M A;  5B1B H;  2J5P A;  3OL4 A;  2XAG A;  5FD5 A;  1Z6R A;  4EJO A;  2CUF A;  2HOA A;  3P5J A;  4G12 A;  5E3L A;  1D0Z A;  3TO6 A;  4IHY A;  3JR9 A;  3M07 A;  5CQE A;  4P9F A;  1YI2 I;  4EAT A;  1RZ4 A;  1WHU A;  3L9F A;  1K61 A;  4BXU A;  2BY2 A;  2KIM A;  1DDN A;  3GXO A;  3KCC A;  2HXO A;  4C9Y A;  1PUF B;  1O3S A;  2QCO A;  5IYD J;  2RV8 A;  4ITV A;  4QSH A;  2DN0 A;  1IZ1 A;  3KP5 A;  3QOD A;  3GUD A;  3R60 A;  3OYH A;  3IRQ A;  4M6Y A;  2L54 A;  5D5U B;  4EGY A;  3FMS A;  3HOW J;  3DTI A;  3OYF A;  2ESH A;  1AA7 A;  3EPZ A;  2P81 A;  3K4L A;  3QP5 A;  5DYM A;  2JK3 A;  1R00 A;  4WCG A;  2HNH A;  3HKZ N;  2M4G A;  5L3D A;  5DUI A;  3CZ6 A;  3FX3 A;  2FA5 A;  3GEZ A;  4CYC A;  4HNT A;  1TQP A;  2W1O A;  1M1E B;  1I3A A;  1JXS A;  1NH3 A;  3H9G A;  2KZG A;  1F4K A;  4R1H A;  1XGM A;  4YEL A;  2H1K A;  3PSF A;  2DOA A;  5CLS A;  3BQZ A;  3ZMU A;  2K86 A;  4JP0 A;  1S8N A;  1JUP A;  2OZU A;  3OR1 C;  5LEK A;  1D3Y A;  1BI0 A;  2Q1Z B;  2V4J C;  3ZQG A;  1YRN A;  3AG2 H;  1YW8 A;  2LK2 A;  3SXY A;  1K7A A;  2XB5 A;  1AKH B;  4L9N A;  2FBK A;  2L7F P;  2R3S A;  1FOW A;  1XSV A;  1R4M B;  5EGO A;  1YFH A;  5CVV A;  3EUK L;  4BEH B;  3JRF A;  2PQ8 A;  5CYV A;  5AON A;  2LF8 A;  2CO5 A;  1D5V A;  2RVC A;  4WF2 A;  3JRG A;  4IF4 A;  3DLL F;  1FTT A;  2DA6 A;  4Y13 A;  2HQN A;  5FKN A;  1PUE E;  2LLK A;  4A93 J;  5IYC J;  2HS5 A;  3IKT A;  3OYK A;  4CIC A;  3KZZ A;  2K7L A;  3NAR A;  2P7V B;  2FNP A;  4I99 C;  3ZQQ A;  5D4S A;  5HDN A;  2IJL A;  3N4M A;  1MMA A;  2EV5 A;  4MQ9 F;  1B9N A;  2BY3 A;  4DBR A;  1OCP A;  4EVI A;  2EZI A;  3VDX A;  2NVY J;  5LFA A;  3WTS C;  4BGD A;  2AHQ A;  5E1X A;  5GAH J;  3OMY A;  1IUY A;  2KIQ A;  3H0G J;  3CCU I;  1G4D A;  2L9V A;  3FMR A;  2A61 A;  3ZQC A;  1DU6 A;  2E71 A;  1O3R A;  3S8P A;  2D45 A;  4IHW A;  3EYI A;  3L09 A;  2X9D A;  1IAW A;  4UUT A;  1HBX G;  2UWM A;  4G6Q A;  4HBL A;  4A0X A;  3F21 A;  2GQQ A;  1KU7 A;  3I3L A;  1B59 A;  3DPL C;  3N05 A;  3KP7 A;  1QNT A;  4PFO A;  3SDG A;  3WGH A;  4FX4 A;  5F0C A;  2BEO A;  1UHW A;  3ZQH A;  3KZY A;  5HOO A;  2F5F A;  2XF7 A;  4C3J J;  1UFM A;  1WGX A;  3CCE I;  2MA3 A;  1ZRC A;  3TQN A;  3J81 Z;  2E2J J;  4BE0 A;  2HDC A;  4C30 A;  2M8G X;  2FQ4 A;  3Q5F A;  2CFX A;  1WH7 A;  2EZH A;  5FLM J;  5HLI A;  3FHN A;  3WTZ A;  3K6G A;  2NVT J;  2GIZ A;  4A3L J;  3GFL A;  1KYZ A;  1IUF A;  1GXQ A;  1HC8 A;  5ICF A;  3EQL F;  1PP7 U;  5DS9 A;  4M6X A;  5IP7 J;  3MEX A;  2M5W A;  4IHX A;  4Y52 J;  4IQJ A;  2WAQ A;  4L9V A;  3LSM A;  2LMD A;  1LJ9 A;  2DYS H;  4JX5 A;  4JYK A;  1XTA A;  2XDV A;  5D5V B;  3CLO A;  1SFU A;  5E79 C;  4BJT A;  2VLA A;  1ZKG A;  3DV8 A;  3OYL A;  4HDV A;  2ZJR F;  5E17 F;  1FYK A;  1G3W A;  4S04 A;  2FE3 A;  4II3 A;  1JE8 A;  1WQ2 A;  1WPK A;  3W3C A;  1QHH D;  2IBD A;  2NXN B;  1FOK A;  4RB0 A;  3CDL A;  2VXD A;  1MNM C;  3HOV J;  2PJP A;  3B73 A;  4B48 A;  1R7J A;  3FXQ A;  3H92 A;  4B47 A;  4W1U A;  2Y31 A;  2QQA A;  5EJC A;  3WG7 H;  1H88 C;  3IUO A;  2A6E F;  2WAE A;  2LRE A;  3HUG B;  4N4O B;  3KIO A;  4M9S A;  2LKS A;  3U9G A;  4AIK A;  2V1D A;  5DCM A;  2EIM H;  2Z2S B;  3HRT A;  4GYI A;  1N77 A;  2XKO A;  2P5V A;  3PUB A;  4PUS A;  2E2I J;  2FSW A;  3U2R A;  3GCM A;  2ECC A;  4Q4Z F;  1HXD A;  5AIQ A;  3JRB A;  1SMY F;  3KPH A;  2KL4 A;  4UUS B;  2HI3 A;  1F1Z A;  2BW3 A;  1EKE A;  4V2G A;  1QZE A;  2H1L A;  1Z6T A;  3L2V A;  3BG9 A;  3ZP5 A;  2WY7 Q;  3WGI A;  1D0Y A;  1UAA A;  1R5H A;  4CH7 A;  1ITY A;  3IH4 A;  5D5W B;  2TCT A;  1BR4 A;  2Q8K A;  1XB4 A;  1SD7 A;  3A01 A;  3RQ4 A;  2F5D A;  4B3X A;  2QQ9 A;  1P7I A;  3QWL A;  1T56 A;  2LY2 A;  3V8L A;  3CUO A;  5LHH A;  4NC8 A;  4PJM A;  1Z77 A;  3I4M J;  5J4V A;  1R9T J;  5EGO B;  2BZT A;  1JHH A;  1V55 H;  2DYR H;  2DJN A;  2OU2 A;  3ZR8 X;  5EF6 A;  1IN7 A;  3BCB A;  3BZC A;  1W0T A;  2VPR A;  1AOY A;  1Z91 A;  3F8B A;  4R79 A;  1ZR4 A;  1IJW C;  1SAU A;  1YG2 A;  2ZME B;  2IPQ X;  2Z16 A;  3GLL A;  4TV7 A;  5FFX A;  1I27 A;  5J47 A;  1BA5 A;  2B63 J;  5CQG A;  2JZY A;  2XAQ A;  4N9H A;  2IP2 A;  2GOM A;  4BBS J;  3SDB A;  5FRO A;  3M1C A;  1JJ6 C;  2E19 A;  2YS9 A;  2YU3 A;  2KIS A;  2EQR A;  2AO9 A;  5B66 C;  1WI9 A;  3GVA A;  1MSE C;  3KP2 A;  5K7Z A;  2LBF A;  3H3V K;  3EYY A;  5TRD A;  4BQA A;  4JK1 X;  4FAS D;  4ON0 A;  2ADU A;  4UY8 I;  2HKX A;  1I3Q J;  2IVM A;  2K9L A;  4LG3 A;  4K2E A;  2B7E A;  5JR3 A;  4U0V A;  4YII A;  3JW4 A;  4FQG A;  3FXO A;  3HZJ A;  2K5C A;  5FKL A;  3JTH A;  1P7J A;  3LSK A;  2QWW A;  4LIV A;  1ZTR A;  4RM3 A;  3CUQ A;  2DT6 A;  2I5U A;  2LNB A;  2PG4 A;  4A3D J;  4DNC A;  4ZYD A;  2DFH A; 
#chains in the Genus database with same CATH homology
 4NC7 A;  2WB1 A;  1JI8 A;  3VSL A;  3S3O A;  2AQE A;  3DQV C;  3E1S A;  4YRV A;  3PNV A;  4LIT A;  4OAY A;  2RNG A;  3OIP A;  1X1B A;  3K4M A;  1OLT A;  4XMY A;  4XLE A;  3KX2 A;  4D1Q A;  4F52 A;  3K4N A;  1T0F C;  4NQW B;  2HPM A;  2JVH A;  3RCO A;  3RSN A;  4XQF A;  1LDK B;  2BOL A;  2QKL B;  4XOP A;  3PFY A;  2WA0 A;  2X6W A;  4ANJ A;  3FKJ A;  2VB6 A;  5HNH A;  2IS1 A;  2PMZ A;  2MC4 A;  3QYE A;  2IS2 A;  1LFP A;  3L2R A;  3H5N A;  1J09 A;  2QKM B;  4E7K A;  4XLF A;  4ZDO A;  3QYF A;  4AU7 A;  2LC2 A;  2ELJ A;  2LOO A;  2R7U A;  2VXZ A;  3A4C A;  1D0X A;  4KJZ A;  4XKV A;  3HG9 A;  3FBN B;  3CMM A;  2VKH A;  4BDZ A;  1MNE A;  4RLQ A;  1ZEL A;  2X1E A;  2DCE A;  4HPQ A;  2M4K A;  2MYS A;  3C2G A;  4ZC3 A;  1V5E A;  4RMN A;  4BXF A;  3LSH A;  3M8J A;  1MW7 A;  1WJC A;  3DPT A;  2LH9 A;  2Y0S A;  3S93 A;  2UUZ A;  4NNJ A;  2ZXH A;  2HPI A;  3HPH A;  4XLH A;  4P5O A;  4BEH A;  3OYM A;  2CS3 A;  3SYT A;  2M7A A;  3K70 C;  3KEY A;  3ZRG A;  4E7L A;  1N75 A;  2Z1D A;  1W36 D;  2E60 A;  3DU5 A;  3H5R A;  5HNF A;  2RQQ A;  3DPU A;  2RRE A;  4J01 A;  3RPU D;  2M0M A;  4IX7 A;  4OWR B;  2VQL A;  3HXL A;  2VQG A;  2JVG A;  1YX5 A;  3NWT A;  2K9M A;  3LL7 A;  3NWS A;  4HEA 2;  1MND A;  2F4I A;  2CUJ A;  3OWT A;  4XOT A;  3W2W A;  1G59 A;  5LD2 C;  4BQO A;  2ZXI A;  2VPL A;  2R7Q A;  3BC8 A;  4AYB A;  2KRC A;  5TGT A;  4CCN A;  3V42 A;  1X4P A;  2XSJ C;  3CJR B;  1SFK A;  3OIQ A;  4BL0 B;  3E0J B;  4PJN A;  3OYB A;  2ZSH B;  1D1B A;  3VSK A;  3DKY A;  3H9Q A;  4XR6 A;  1WJD A;  2JA2 A;  3J7A Y;  4PJJ A;  4II2 A;  4CCL A;  2NOJ B;  3K10 A;  3UR3 C;  4F91 B;  4IZZ A;  2CV1 A;  2L2O A;  3IP4 B;  4HRI A;  3VYU B;  1Y56 A;  4GRI A;  4BS9 A;  2OC6 A;  4DIQ A;  3OYD A;  4XLA A;  4XKB A;  3ZCO A;  3OYA A;  2WAD A;  3DWL E;  1Z7L A;  2LYC A;  2V26 A;  3H9J A;  4F92 B;  4C2U A;  4HSR A;  4XN0 A;  4KT6 A;  4NUB A;  2R7V A;  4J00 A;  3GBG A;  1LKX A;  3EUA A;  2JUG A;  3A2K A;  2IGM A;  4C2T A;  1FMW A;  3D5R C;  2XAU A;  3MKW B;  2KLO A;  1U0J A;  2M3A A;  2KDO A;  4XN3 A;  4AVZ A;  4HNU A;  2F5V A;  3PNT A;  2LBF B;  2W7N A;  4XON A;  1V5F A;  2IS4 A;  3OR2 C;  3AKZ A;  4BE1 A;  3KYL A;  3VYT B;  1FMV A;  4XM3 A;  3OS1 A;  4F3Q A;  2F6C A;  2IXS A;  1GLN A;  3MD2 A;  1WJB A;  3S3M A;  2E5N A;  1DGW Y;  3OL4 A;  1PYV A;  2VKD A;  3BG6 A;  3U21 A;  1E0E A;  1D0Z A;  2A5W A;  1X4O A;  4ZDL A;  5CQE A;  4PSW A;  3ZGK A;  4EAT A;  3LMM A;  2DT7 B;  3VYS B;  3OL3 A;  2BVL A;  4ZDP A;  4C9Y A;  4ITV A;  3OYH A;  4XKC A;  3QOD A;  1WJF A;  2HZD A;  2IGK A;  4XNF A;  3DTI A;  4HG2 A;  3OYF A;  1AA7 A;  3EPZ A;  3PSI A;  3K4L A;  2HU9 A;  1UG0 A;  2HNH A;  1S9H A;  2M4G A;  1Y6I A;  4LIU A;  3OY9 A;  3CZ6 A;  2CV0 A;  3CP2 A;  3HKZ A;  1WJA A;  4CZC A;  5JHF A;  2DXI A;  4HNT A;  3FBI B;  2W1O A;  1EA3 A;  2L7K A;  4Y3O A;  1IRX A;  3L2W A;  3H9G A;  1G8X A;  3TBI A;  2CV2 A;  4E7H A;  4KIS A;  2E1M C;  4YEL A;  4OAZ A;  5FRM A;  3CP8 A;  2P0W A;  3PSF A;  2ZSI B;  2XC7 A;  2DOA A;  2E1M B;  4BE2 A;  1MMD A;  3VWB A;  3D5S C;  2MAB A;  2VAS A;  2VJ4 A;  3OR1 C;  2Q1Z B;  2V4J C;  2VJJ A;  1X1D A;  4QPO A;  5FRN A;  2CW7 A;  3S3N A;  4B43 A;  1W36 C;  3DTE A;  2X6X A;  1K6Y A;  3TL4 X;  4N4N B;  3W2A A;  4IKF A;  3PNY A;  2KP6 A;  2R7R A;  2VJI A;  3EUK L;  4BEH B;  3HOS A;  3UNG C;  3BCA A;  3F9K A;  4BQN A;  3CJQ B;  1N78 A;  3H35 A;  2UV1 A;  1P9Q C;  2I8D A;  4ZYA A;  3BG7 A;  4F93 B;  1Z21 A;  4CSW A;  2K3P A;  3QYB A;  4DBQ A;  3OYK A;  2CUZ A;  3D5L A;  2R7O A;  4ZTF A;  3C2H A;  3FDY A;  4U7B A;  4PSX A;  3VYR B;  3ZQQ A;  3I9V 2;  3HPG A;  1MMA A;  2LRD A;  4DBR A;  4U87 A;  3VDX A;  2OV7 A;  5LFA A;  2V6E A;  4BGD A;  3QOE A;  2MD0 A;  3IAM 2;  3OMY A;  2GOX B;  3OYG A;  3OOU A;  4MLO A;  4IQ4 A;  3HC7 A;  2ZFU A;  4RLF A;  1KON A;  2CW8 A;  3W2V A;  1X1C A;  1Z3X A;  3PL8 A;  3S8P A;  4DGW B;  3PJR A;  1OR7 C;  4FET A;  3CES A;  3K4C A;  2V7F A;  4YEJ A;  3L2Q A;  2DJI A;  2UWM A;  3TMO A;  2IS6 A;  2IGO A;  4D9J A;  3I3L A;  2HQA A;  3DPL C;  3N05 A;  4PFO A;  4BU2 A;  5HVQ C;  2HDW A;  2KPM A;  2LG4 A;  1D1C A;  2KQR A;  3OYN A;  4DJA A;  2R7W A;  5HOO A;  2XF7 A;  4CCK A;  3MKZ A;  3OS2 A;  3DU6 A;  4BE0 A;  4C30 A;  1MMN A;  2W00 A;  3FHN A;  3K6G A;  1BR2 A;  2VQH A;  2HVS A;  2AQF A;  3K4J A;  2X1C A;  2FUG 2;  3SEZ A;  2WAF A;  3AL0 C;  3OYJ A;  1VZ0 A;  1WFX A;  2KHM A;  4IQJ A;  2WAQ A;  4KIT B;  3LSM A;  4PJL A;  1YE9 A;  4CCM A;  3LFU A;  3AL0 B;  2VIX A;  1DP3 A;  5KCM A;  2A6T A;  2XDV A;  4BJ5 C;  2WBM A;  4X0G A;  1TZL A;  5KNL A;  4BJT A;  2W4S A;  2VLA A;  3OYL A;  1PJR A;  4II3 A;  4Y4R A;  2Q2E B;  2XF5 A;  3W3C A;  4E6K G;  1QHH D;  2R7S A;  2VQC A;  4BAC A;  2KMU A;  2VXD A;  2X51 A;  3MKY B;  1NG6 A;  4F55 A;  4B44 A;  2L5Q A;  2V1N A;  4B48 A;  3K4B A;  3H5A A;  3AFH A;  4B47 A;  2KRH A;  1V5G A;  3IUO A;  2WAE A;  2L9N A;  2OUM A;  2XF6 A;  2LRE A;  3HUG B;  4N4O B;  4CA0 A;  2R4G A;  4JQF A;  2CH0 A;  2HVR A;  3BLY A;  4E7Z A;  2Z2S B;  1YX3 A;  1N77 A;  4P1W A;  2WY8 Q;  1QHG A;  1WJ5 A;  1DQU A;  3PUB A;  1WJE A;  4PUS A;  3SZG A;  2E5Z A;  3DTK A;  4PFP A;  3IAS 2;  3OS0 A;  1X1A A;  2JSP A;  2KL4 A;  5CPR B;  2BW3 A;  2X1D A;  1BR1 A;  3K70 D;  2PJR A;  3L2V A;  2M7B A;  5KHD A;  2WY7 Q;  1D0Y A;  1UAA A;  4CH7 A;  1Z3Y A;  4CCO A;  1BR4 A;  2BVM A;  3DLA A;  2L9S A;  1X19 A;  3RQ4 A;  4B3X A;  3S32 A;  2LY2 A;  4XLC A;  3ZXS A;  4BUP A;  4Y33 A;  4BJ6 C;  4E7S A;  1NG7 A;  4NC8 A;  4PJM A;  3SEQ A;  4CUG A;  5HLT A;  2BW3 B;  1LVK A;  2VL8 A;  4BDY A;  3OYE A;  3ZR8 X;  1MMG A;  2CMP A;  3BCB A;  1HA8 A;  4BQQ A;  4ZTJ A;  4R79 A;  2PJR B;  4ZJZ A;  4PK4 A;  2X85 A;  3L2U A;  2X6Y A;  2VJ5 A;  1SAU A;  2R7T A;  4H4K C;  2Z16 A;  3LSI A;  1DGR M;  2MFZ A;  3LSG A;  5CQG A;  3OYI A;  2GOM A;  2V9K A;  3A1Y A;  4XKW A;  3SDB A;  2O5R A;  3M1C A;  5FRO A;  3ONQ A;  2IGN A;  4XOR A;  2LY1 A;  3DEE A;  4QPQ A;  3K4K A;  4DOZ A;  3HOT A;  3HL2 A;  1BOB A;  5CKT A;  2CFO A;  2LBF A;  1QU3 A;  3H0D A;  1UEL B;  3RTR A;  4FAS D;  1R6R A;  4JOM A;  2KZV A;  2K9L A;  4G6T B;  4LG3 A;  3EUH C;  2HVQ A;  2K5C A;  4HST A;  4RM2 A;  2W82 A;  3LSK A;  4XL9 A;  4E7J A;  4E7I A;  3OYC A;  1ERD A;  4LIV A;  4RM3 A;  3G2B A;  1TT0 A;  1T95 A;  3CF2 A;  2DT6 A;  4E4H A;  1D1A A;  4CCJ A;  3DKX A;  2R7X A;  3MMY B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...