2VQSA

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
197
structure length
182
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERPLKYLQELHELHEDWLIHPQSCKVLVLDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 67
structure length 182
sequence length 197
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vqsA00
4CEIA 1ZD8A 1E2LA 3NXSA 2ZR7A 3C16C 4FXPA 1EX6A 2FSFA 2ZR0A 1W36B 1UPTA 4X8MA 1BKDR 1ZM9A 2CHGA 4I4LA 3BB3A 1JJ7A 2A5FA 1W36D 1G3QA 2O5VA 5LDDC 2YINC 4TMVA 2OILA 4OI4A 1JR3A 2ZREA 3K0AB 2QRNA 2XSZA 3T15A 1G64A 3EARA 5EZ5A 4C0HA 4TMKA 4PQYA 2JLUA 4B34A 3ETLA 1YJ5A 5J4LA 3SNHA 2QAJA 4WZ6A 3MWKA 1ANKA 2QGNA 2GILA 1A2BA 1Z0JA 5KU1A 3ZIAA 3B2EA 4KBGA 1VCIA 3HYRA 1XNJA 3TVDA 1XU4A 3AM1A 2WJYA 4O25A 2BWJA 2Q3HA 1JR3E 3PEUA 2ZETA 4PHHA 4XD7D 2O0HA 2C98A 1FP6A 2C95A 4LJ9A 4S2EA 3BWDD 3PV0A 2OCPA 2XGJA 4IFEA 1YKSA 1D6JA 1E0AA 2EYQA 3OIUA 4MKIA 1E1QA 4C2UA 3B7GA 2ZYTX 2F1RA 4RVCA 1GOTA 3DKVA 4UJ3A 4C0JA 2RGCA 3TUJC 4D82A 2R6CA 4QM7A 4B6FA 1EWRA 3K70B 2DB3A 3U3JA 1YZGA 2EU8A 3OF5A 2WKRA 3K70D 1QHHB 2IXGA 4ITRC 1WBDA 3JZAA 1MH1A 3W34A 2ZI3A 2XNDD 4KU4A 2YNMA 2VP0A 2GA8A 2VHTA 2ZJOA 1Q1ZA 1Q3TA 2QI9C 2ZRDA 4A0RA 1P5ZB 2G1KA 1DAEA 3RLFA 3O47A 2GCOA 4DT1B 1COWA 3OEED 2OBNA 2GWHA 1KDPA 1OB5A 4C9BA 2O8EB 3LVQE 1HE8B 1ZAKA 4AKHA 4DSNA 2FPMA 2C03A 1JECA 4MKHA 4P4TA 5EE9A 1DARA 3RANA 4PAQA 1N5IA 4M1TA 3RHFA 2A5DA 2HT1A 1UM8A 2DFLA 2G0TA 4LV5B 3NBZC 3T61A 3TK1A 4O0MA 1J7KA 4B74A 5KTYA 1XDBA 2IHBA 3LLUA 3QKSB 1E9BA 3CRRA 5H68A 3T5DA 2YJTD 2WKPA 2FMXA 2XJ9A 3N5CA 2IHYA 3VX4A 2C77A 1LTQA 1S1MA 1ZCBA 2O8CB 5HCIA 2WM9B 4Q7MB 1E94E 1TQ2A 2YWEA 4C0LA 1NRJB 4FINA 4M53A 2NGRA 3I8SA 1IQPA 3SDZA 1P9RA 1XD8A 5F9HA 2JLRA 3OHMA 4DSOA 3GLIA 3ZLJA 2W6JA 5KDLA 1NVVR 2F43B 4PC2A 5G3ZA 4WAUA 4JKIA 3QOFA 2CCKA 4Q66C 1K6MA 2QG6A 1Z6GA 3GLGA 5M04A 3CX8A 4C0QC 2GEUA 2NPFA 2GJ8A 3AP3A 3A1UA 2ONJA 2BKUA 2G6BA 2ZTSA 5EE3A 2NQ2C 4HAWA 2VHQA 2BKEA 5JI2E 1NN1A 1W5SA 5TY0A 1NIPA 1KI1A 2YOFA 3CLVA 4FMCB 2FFBA 2EWWA 1UAAA 1SXJE 1JR6A 3A58B 4TL8A 3DM5A 3FWYA 3NVAA 1P2SA 3PEVA 1E2PA 4EFNA 3GLFB 4XIGS 3T1TA 2F1IA 3U4QA 3GLGE 2GAOA 3RRMA 4CEHB 1YQTA 3GFTA 2ZRNA 3QG5A 1YR7A 2JLVA 4JMPA 1KDRA 2EYUA 2WWIA 3LH5A 4MRNA 5FFMA 2BV3A 3GJXC 3KB1A 2AWNA 4IVPA 4L5BA 5EP1A 1L7VC 5BYKA 5CK5A 2D2EA 3W5IA 2JA1A 3RSOA 5C1BA 1II0A 3ZGXA 1G17A 1ZM4A 1WP9A 1Q1BA 3EWAA 1G7TA 2IEYA 2AK3A 4BFTA 4B33A 1UBFA 1A5TA 2WICA 3N70A 1Z6XA 3D6TB 5SZIA 2QNRA 3VKGA 1ZUHA 1CS4C 1DG1G 4NYIQ 4BGDA 2OEPA 4BEBA 4PQFA 5B30A 1W1WA 2BCGY 1UKEA 3GQBA 3NDPA 1G8FA 4LHZA 4LWZA 4A0FA 3RS4A 5DI9A 1E9DA 1E1RD 1UEJA 3AP2A 1P60A 1OHHA 5H8WA 3K0SA 4B3CA 3L2OB 2CL6X 3LA6A 1CKEA 1ZU5A 3F0TA 5DH9A 3VR3A 5JZVA 4KODA 1AKYA 4KCGA 5DN6D 3KJEA 4DLYA 2D62A 4IDPA 2BBOA 4G5GA 1E99A 4FMCF 3RRNA 1NSTA 1ZC4A 4Q4HA 2MMCA 3B5JA 2ORWA 4M1MA 4TMWA 3DEFA 1OXSC 4Q1EA 3I32A 3EX7C 4WBSA 2FDCA 4GSYA 4IEEA 2ANCA 4CT5A 2GF9A 2YWGA 3ECCA 1R5BA 3AF3A 1HH4A 4OHYA 1U8AA 1FTSA 3Q72A 1LVGA 4TWZA 2LKCA 5CIWA 4DCNA 2X77A 3CRMA 1EFCA 1TUEA 1LY1A 2X19A 2ZAMA 1I2DA 4CVNA 1XP8A 3P27A 2EQBA 2XB2A 1CR4A 1R0XA 3SEAA 3NHBA 4AKEA 2ZRLA 4Z8XA 2WAXA 4DLSA 1DO0A 1QZXA 1II8A 1ODFA 4TMTA 2JAQA 2N42A 4B3FX 4KXFB 4A2PA 1Z6YA 3RDPA 3NC0C 3ASYA 3W6OA 1KGDA 4LYAA 2N46A 3M1IA 1KK1A 1U90A 1IN7A 2BM0A 3FKSA 1US8A 1IY1A 1U9IA 3TW8B 1BMFD 4EJSA 1BOFA 1OW3B 1Z6AA 2A5JA 1HQCA 3K0EA 5DE3A 3TAHA 4DKXA 1K5DA 4D0LB 4PANA 4KI0A 4B32A 2BC9A 3IPYA 3PR1A 4JL5A 3NHAA 1EFRA 3SFVA 4NCNA 3TJZA 2QT1A 1IXSB 2BHRA 4PR0A 1LNZA 2IYTA 1F2UA 2W0MA 1T3HA 1HTWA 2XXAB 4AIIA 1CLUA 4FMDB 4GDFA 2EFCB 5EXTA 5HTKA 2JDID 5AJZA 4NTZA 2O8BA 3OIWA 1E0KA 1E2NA 3QBVA 1LF0A 5FBLB 3IGFA 4LBZA 3WY9A 5GADl 2P2LA 2QUZA 3LFUA 1OYWA 5GJVC 2AKYA 2BMEA 3DKPA 1Q1EA 3IIJA 4I1UA 1BYIA 1KIMA 2QGZA 2R62A 2W00A 3CX7A 1RRFA 4RZ3A 3U7FB 4C0BA 4PZYA 1U9IC 3EASA 3K0AA 4XWOA 4XSGA 1S1CA 2R6FA 1E9FA 2PEYA 2QE7D 3K53A 4EJSC 2ZI6A 2MSEB 5BYJA 1GUAA 4JLDA 5B2ZA 3SQXA 1LS1A 4G3XA 4TN1A 2ODWA 2QT0A 2VF7A 4BPBA 1TU4A 3KUDA 1TF7A 3QUSA 4MDEA 2OZEA 1F48A 2W83A 2WWGA 4XTCS 4NZYA 1T9HA 4TL7A 4JT4A 4XD7A 3T1QA 4NH0A 4U7DA 1W5TA 1W4CA 4MGKR 2GXSA 2WIBA 4Q03A 3KKQA 3QF7A 1SVIA 2PBRA 2IS6A 5K8TA 1CR1A 1ZBDA 1R5OA 2Z4SA 3CRQA 2W2VA 3GEEA 2KSQA 2BBTA 3GJ7A 2PJRA 1OFUX 1VCNA 2Q9BA 1QG2A 3FMOB 1NG9A 1ZC3A 1W36C 4JLAA 4M1SA 2H18A 2ZJ2A 1EFUA 2GEDA 2NZ8A 4B71A 4AD8A 5H1YA 1Z0KA 3LBIA 4U02A 5KSPA 1RKBA 3VR4A 2V7QD 1KOFA 4M9ZA 1DVRA 1R6BX 2XNDA 4GMXA 3UMSA 2QPTA 3BFXA 3TLXA 2VEDA 5JFGA 1IBRA 3K9NA 4FMDF 3OEEA 4H1UA 3X1DA 4B47A 3QI2A 2ZU6A 2C04A 4TT3D 4DT1A 3Q9LA 2FFQA 3A4MA 1KO5A 5GVRA 1GSIA 2FSGA 1R4AA 2ZSEA 4V0MA 5DYIA 1N3BA 2AFIE 1PUJA 1CRQA 5FPYA 1YRBA 4IDNA 2JLQA 1FUUA 3GFPA 4OQNA 3GJ3A 3WYAA 1GL6A 5AJXA 3QKSA 2ZSAA 3VHLB 3SZRA 2ZANA 3PEYA 1ONBA 2O8CA 3U5ZB 3THXB 1U8ZA 1W4AA 2VSFA 5JHGB 3JVUA 3CB4A 3DVLA 4K46A 4RZ2A 4XOIA 3SI7A 1VKJA 1VCMA 3I8XA 3HJNA 3K70C 2VSXA 2FEOA 3BB4A 4HSEA 3HU2A 5KPDA 2FE4A 2F43A 3NTUA 4K81B 4G01B 4LC0A 5KDDA 1OFIA 1OH8A 1E4YA 3SYNA 2HF8A 1OIVA 1Q1QA 3CNNA 4P32A 3HPRA 1CP2A 1E79D 1JPNA 1QRAA 3PXGA 4AYXA 4HAVA 5KOYA 2IS4A 2A78A 1NLFA 4DB2A 1GNQA 4PHTA 1SKYB 4FD2A 1Z8FA 2B7BA 4PTLA 3ZS8A 5C4GB 1AQYA 4JVMA 2IYVA 1G3IA 4HLCA 1FPMA 1KK0A 5J4KA 1GWNA 1AIPA 1CRPA 3U3KA 3PQCA 3SJAA 5J4YA 5KO2A 3MJHA 4NL4H 5LPNA 3I4LA 4OK3A 4GOXA 4PO9A 3CF0A 4PPNA 1U0HC 3KXLA 1YZUA 3HU1A 4Q4AB 2ZSDA 3GLFA 3RABA 3WYGA 1FTNA 1TF5A 1YR9A 2YOGA 4CEHA 5TVKA 1N0VC 1AQUA 3TSZA 3PG5A 1KMHB 3F8TA 2D06A 4XSHA 1TQ4A 1K8RA 3WMFA 4F38A 5L3QB 1P2UA 2HJVA 3UG6A 3QXCA 2IXEA 1WA5A 1ZJ6A 4NBSA 4LJAA 3SHFA 2YV5A 1UKZA 1DG3A 4EKDA 2ZQ5A 3U2QA 4FCVA 3NDBB 2I3BA 4URVR 4WOPA 1G7SA 4ERNA 2J46A 3N2EA 2F9MA 3UG7A 2B8WA 1Q22A 2ZU0C 1N2CE 4Q5IA 4MRVA 2NO7A 3VMFA 4DLTA 2DBYA 3V00A 3SU8A 4A4DA 1F5NA 1JB1A 1ZM7A 721PA 4D0NA 3HR8A 2BEKA 1E1RA 1N5KA 4LSGA 1Z0FA 3BGWA 2VO1A 3EG5A 4TTQA 4IDQA 2HEIA 2AWOA 1V43A 4QC2A 4KYUA 3AF1A 3FHOA 2J41A 1R0YA 2PMKA 1S9DA 2DWQA 4B76A 4LUCA 2PX3A 2VP4A 5DN6A 2WSSD 3DO6A 3IHWA 1KK2A 2AL7A 4DSUA 4DEXA 3Q7QA 1SXJB 1W4BA 1NVUQ 2GJ9A 3KKNA 4Q9LA 4ZDKA 1SXJD 1HE1C 3CBQA 5CLQA 1MO5A 1ETUA 3NC1C 1AZSC 3B9QA 1XBTA 2WV9A 3MUFA 4JLBA 4TTPA 1N6NA 2H1LA 3RWOA 2J0SA 3ADBA 4LHVA 4QHYA 4MRSA 4RZUA 4WIAA 3C7KA 2ZS7A 5FOTA 2PH1A 1CU1A 3JVVA 4L9WA 3AUXA 3WRYC 3AUYA 2IC5A 2GVZC 5CLLA 1BS1A 1XTSA 1XPRA 1M74A 3KZ1E 1G21E 4KFSA 1OF1A 4F4IA 2JLXA 4JYCA 3TR0A 1M7HA 4M8NE 4WXPA 2WOOA 1OYYA 2P65A 2VTKA 3WXMA 1D9XA 3HPQA 5E95A 1XEWY 2IYZA 1FW6A 1P9NA 4D0GA 2CLSA 2QENA 2AD5A 3ZH9B 2Z83A 2JJ1D 1D2EA 2GJSA 3GJ8A 4NCJA 1BMFA 1Y63A 3KB2A 4ZIRB 4JJKA 1OSNA 2FFHA 3PENA 2VIIA 4OHWA 1KSGA 3OESA 4JBWA 1FFHA 1YVDA 3CUEF 1G7CA 1R0ZA 3AQ4A 5EP3A 2A9KA 1XJCA 4MKGA 3GD7A 1Z5ZA 3BJIC 4I99A 2GJKA 4P3YA 3OIYA 4JVSB 2CDNA 3GMTA 4PO8A 4NYMR 2JLYA 2DCUA 2H17A 1NJFA 1YZLA 2JDIA 2QRZA 3CONA 2WIAA 3OZXA 3VAAA 4F91B 2VPPA 2XXAA 1XFAA 4EFMA 1Z07A 2J0QA 1C1YA 1CBUA 3TGPA 1M8PA 2F3TA 3CNOA 3DMDA 2OE2A 3FFBA 4OYHA 3WYFA 3NBYC 2AXPA 2BJVA 1RRPA 1GL9B 3REFA 1XEFA 1OXTA 2FWRA 1F60A 1G6OA 2PLFA 4V0LA 2C5LA 4LZZA 4XTRA 4D25A 1FOEB 2VBCA 3AKDA 5G40A 3OEHD 4NPHA 3VQTA 2ZITA 2QP3A 5KYKA 1QVRA 1XD9A 2JJ2D 2HCBA 2QMUA 1GRQA 1KJZA 4F93B 2QE7A 2TMKA 4B48A 1I4DD 1QF9A 1T8TA 1Y3AA 2VA8A 3BRWD 4LPKA 3T1OA 3GPLA 4LBYA 4HB3A 3PUZA 3GLHE 2ZRAA 4GL2A 2ZSFA 1N6HA 4QL3A 3FHTA 2REBA 4UNQA 2OESA 3W3ZB 1XXHB 3VX3A 1KI3A 2YC2C 3UWKA 3VKHA 1QHNA 1W46A 1XJ0A 3QXXA 2B6HA 1J90A 3C8UA 3KJHA 1D2MA 1KYIA 2GK6A 3NWJA 3EPKA 1T3LA 3IIKA 1SHZA 2SHKA 3AGQA 4HZIA 4Q9IA 5LD2B 3A36A 4GPTA 3ZDQA 2ZS9A 3KKPA 2R44A 1CJMA 3D7MA 2PCJA 3K1JA 4NKRA 3L82B 5AUOB 1UADA 4MYHA 3LXRA 2V7QA 1JBKA 5J47A 3ICEA 1XD2B 1E4VA 3ND9A 5EXXA 4BZPA 2WHXA 1CF4A 1KO8A 1XZPA 4KAXA 4HLQB 5G53C 3EPJA 2RCNA 3B1XA 3MG9A 4TT3A 2OFXA 1I4LD 4X8HA 1VYVA 4QXAA 5TB5A 5DIFA 2J87A 1TEXA 5L3RA 2ZRGA 4NHOA 5IK2D 3ZVRA 4TYWA 4DHEA 2Y8EA 4QKQA 1GRNA 221PA 2VF8A 1AA9A 4B3BA 2JIZD 3EW9A 1E9RA 5CM9C 4DSTA 5BN3A 3QEOA 1R10A 2P6NA 5GJBA 1OXVA 2CVFA 3K9LA 1G8HA 1UBEA 5CK4A 1JI0A 4KBFA 4EDHA 3L0SA 1GL7A 2GF0A 4WA7A 4Q00A 1CXZA 2GKSA 3THXA 3TSWA 2IS2A 1QHSA 4L4UA 2CXXA 3LLMA 4YMSA 4WW0A 3SJZA 2P5SA 3AVOA 2VSOA 2CEAA 1E79A 3QPVA 2UZIR 4IDHA 2ZJ8A 3NH6A 5LBIA 2GETA 1AN0A 1EFTA 3QXSA 3I61A 4BFVA 3LXXA 4XVQA 2OFWA 5DYGA 4CZ2A 4KO8A 4EFLA 4JJZA 3R20A 5J4HA 3A8TA 4PPFA 4BFWA 2R6GA 4Q7LA 4GBMA 5KSZA 1E2IA 1KI7A 2PEZA 3LY5A 1OH5A 1IY2A 4OI1A 4LJ7A 4LX0A 3ZS9A 2IYLD 3MWJA 5UKDA 1PUIA 2C2HA 5FPHA 4OHVA 3KX2A 2CE7A 1RFLA 4R2IA 5FTKA 2ODNA 4TYQA 4ZKEA 2VRWA 4DC9A 4Q4AA 3SC3A 2BEJA 2CNWD 3E70C 5SZJA 4DLWA 1SKYE 5FH9A 4CGZA 3ZQ6A 1E9AA 1KMHA 4AKIA 2XOKD 5LB2A 5L3QA 3S1AB 3H0KA 3TUIC 1GKIA 4MDFA 4D80A 4KJZA 4TL9A 4R98A 4D6PA 3KTAB 1ZNZA 4R7ZA 3RWMB 1B23P 4ARZB 1CJTC 4Q7JB 4PFSA 4QGAA 3VR2A 3EWSA 1E2JA 4RKEA 3REGA 3QY0A 2J1LA 3HR7A 4CRWB 3QF4B 2CK3D 4GOKA 5JEEA 2FN4A 1T5LA 1IN4A 2OLKA 1RRCA 5FL3A 4JBYA 1ZIPA 1ZM3A 1VIAA 1XB2A 3AF0A 3ZQJA 2H92A 2QTFA 4YDSA 4B2PA 1TTTA 1T4GA 4JBXA 4M1KA 2QAGB 1YZQA 4XVRA 4BFUA 5A4JA 1FQKA 2ZEJA 2WSSA 2ZRMA 3TBKA 3IUYA 1PZNA 1X3SA 2N1BA 4LHWA 2IBMA 3AVPA 4AK9A 2IF2A 4URUR 2H5EA 1SXJA 1RYHA 2V54A 3TQFA 3Q3JB 4Q1BA 1VCOA 4II7A 4WVFA 2RB4A 3SQWA 2Z43A 1IAQA 4NYJR 3ZVNA 3KUCA 5DNYB 3C41J 1TADA 1Q12A 1PVOA 4GFDA 4YDHB 3I73A 4YONB 2ODBA 3KQNA 4RD6A 1RRGA 4A82A 1XRJA 3LD9A 1FX0B 1X8KA 4JKYA 1T91A 1J70A 2BVNA 1UDWA 2P0EA 2VLIA 1VECA 4QGHA 3RAPR 1RYFA 1VPLA 4TLAA 3SYLA 2RGBA 4US2R 1NI3A 1BH2A 2G88A 1ZU4A 4O2LA 3MGCA 4YC7A 2QMEA 3EIHA 4RFVA 3G82C 2VHUA 3L8YA 5JJIA 2F55A 1KI6B 3CPJB 1P3JA 3ZZ0A 2IYXA 3UK6A 4R9UC 1S3GA 1RC8A 3BFKA 2JJ1A 1QHXA 5SZKB 1SKQA 4DWJA 4RJLA 2ZYUX 1OB2A 3AGPA 5BQ5A 3BS4A 1SXJC 2GXUA 5HR5A 5HPYB 1PLKA 4ZIRA 1E32A 1Z0DA 3DMNA 4LBWA 4QGFA 1G8YA 1W2GA 4LJYA 4C2TA 2MMGA 3QBTA 3CWQA 3FYHA 1YZTA 2ZROA 1VTKA 3PUVA 4HATA 5G41A 2QM7A 1SZPA 5JCZA 2CJWB 4RD2A 1XTKA 1E0JA 2QBYB 1U81A 1G8GA 2P3SA 5CB6A 1ZYUA 5JWOA 2O0JA 3B6EA 3K9GA 5FTMA 1VHLA 2QMOA 1EG7A 4OJKA 4Q1AA 4URWR 4PQRA 1Z63A 1NVWQ 1MRSA 4HLDA 4IVQA 1NMZA 3OEHA 3PUWA 3QG1A 3T34A 4JLKA 4BLSA 3LWNA 4RD1A 4GT1A 2CL0X 2X1VA 2E1RA 4ZKDA 3W8NA 3VNVA 2JJ2A 3FE2A 4PAMA 4PX9A 5HZKA 5JBQA 1ZUNB 5C46F 3CM0A 4QG7A 3SR0A 3QJYA 4DDTA 4NONA 4PZZA 2VP2A 2ECKA 1KJWA 2B21A 5DHFA 1GKUB 1XZQA 5FBVB 2EW1A 3THYB 1F3OA 1AGRA 1NMXA 2RGXA 1TQDA 2DHRA 3PITA 1NVVQ 1J8YF 5TXGA 3R7WB 3G0HA 4V0OA 1NKSA 4RCYA 1E2KA 3AVQA 3B82A 1VG8A 4Q01A 3W9YA 4W5HA 3WRXC 3C14C 1E0SA 2MSCB 3LBNA 5GJWC 1XTRA 4D2IA 3V4FA 1RE0A 5A0FA 4DCSA 1GM5A 2W2TA 1UDXA 2RGEA 1JEDA 1IN8A 1KI2A 1NNEA 3P32A 1A82A 1IY0A 1N25A 4LDJA 4DLZA 3B78A 1U0LA 1U8YA 4OL0A 3TMKA 2QZ4A 2J3EA 4I81A 2EFGA 3NKVA 1VYTA 3WBJA 1KSJA 2WWYA 2WZQA 3WMEA 1EESA 2ZRJA 4W5WA 1XXHE 3FB4A 3SOPA 4TYNA 3MAAC 3OFND 2CMKA 4IKEA 4IFBA 2ZRBA 2ZRIA 3AVXA 1Q57A 3D3QA 2ZUBA 3EZ6A 4LYJA 3I72A 1DELA 3LAWA 1LS6A 3FOZA 2FGKA 3DHWC 1NLZA 4MGZR 4Q02A 5IK2A 4CYMA 1UFQA 1IJEA 1VG9B 2QMHA 4G1UC 3AVYA 1EXMA 3PJRA 5BWMA 5ELXA 2JIZA 1GAJA 3VNUA 4ZV4A 1E9EA 2FPKA 1Q3HA 5HCNA 3TKLA 1ZUIA 2GESA 4BUJA 1N6KA 2CCJA 2D7CA 1KSHA 4E03A 3DOEA 4HEJA 2VP6A 1BYUA 2J0VA 3I1FA 5JEDA 3EXAA 1BO6A 2IUTA 2J7KA 3GLHB 1A1VA 2RHDA 1OFTA 1OT3A 1WE2A 4QJ3A 5LD2C 1L4UA 2XJ4A 2CLCX 3OIVA 1VMAA 5JJKA 2EFEB 4Q1DA 4EPXA 2XTMA 1RPZA 4DLRA 2HUPA 4TZ0A 1OKKD 3CRW1 2VYFA 2OUKA 3UATA 3LQRA 4HDOB 4D4JA 1G3UA 3B8HA 5G3YA 4YXWD 3R9IA 1GKYA 1NY6A 2BIFA 2D3WA 3B1ZA 5FTNA 2IK8A 1F6BA 2X2EA 2AXNA 4DEYA 4LV6A 1QHIA 3BFVA 4A2WA 2J0UB 3Q85A 2ZE5A 1ZP6A 4JSYA 5EP4A 4BZXA 4EPWA 1TU3A 1KO7A 1DAKA 4ESVA 3B1VA 5FOWA 4CIDA 1JALA 2VH5R 4E22A 2KE5A 3I92A 3KQUA 2O52A 4HYYA 1OIWA 4QHTA 2PZEA 1E9SA 1WQ1R 2I1QA 5E7JA 4LI0A 2FG5A 2ZJYA 4GOJA 1JXOA 4W7SA 4N1AA 4BEJA 1OH6A 1XMSA 2CNWA 2DY1A 3ND8A 3UIEA 4DCVA 2WWWA 3LRPA 5J4VA 5JLJA 1MOZA 1IXRC 1R8QA 2YWFA 4IVRA 3IPXA 1TNDA 2QQ0A 1KI8A 2QSZA 2WPDD 3MWLA 2XOKA 821PA 4RY2A 1LB1B 1OXXK 5FR2A 4IHQA 2IF0A 4XWAA 4A6PA 1KHTA 3E1SA 3S1AA 3JZMA 4V0KA 1QHHA 2DWPA 2ZI9A 3TW4A 3KTAA 4L15A 3U3MA 4ARZA 3OAAD 2CBZA 3HP1A 3X1WA 1XMJA 4YMUA 1VDZA 3UWOA 3IKJA 2CK3A 2O8EA 4B43A 4KVGA 4HB0A 3AB3A 1A2KC 4N3NA 3QF4A 1Q0UA 2B8TA 3U60B 3CWZA 1OV4A 4XH9B 2GZHA 4BASA 4B3XA 2KBEA 2AKAB 5CJ2A 4DB4A 1S9HA 4LGMA 4DVGA 1N6IA 4FI3C 3QXJA 2RGNA 2QAGA 2ZUDA 4R71A 2RKOA 4DZZA 2E9SA 3EPHA 5D3QA 1G4UR 3MWYW 2FX3A 2WAYA 3LDAA 4NCIA 1XTIA 1KK3A 5JRZA 5CIQA 3B9PA 1P75A 1DAMA 1G3MA 4L9SA 3SFZA 4HB2A 5P21A 4A0HA 2ATVA 2FNAA 5L3SB 2WWFA 1UJ2A 4GNKA 2CE2X 1RZ3A 3C15C 3QKUA 1X1SA 4IOJA 2Q3MA 1QHGA 1DAIA 3C5CA 2FSHA 3DL0A 3UPUA 2H16A 2GAAA 4MUBA 2WJHA 1FX0A 2JLSA 3H2YA 4YMWA 2JLZA 3M6AA 3E2IA 1AK2A 3UKDA 2BBSA 4DUGD 3P20A 2FZ4A 3T5GA 4BLTA 2BBWA 5HE8A 4LJ8A 3W6NA 4M21A 5L3VA 2NOAA 1EX7A 4C7OB 3CIOA 3GJ4A 4J0QA 3IQWA 2RMKA 3EZFA 121PA 3RS2A 1H65A 2RGNC 2QAGC 2IX3A 3DM9B 2ZRHA 4OHXA 3RS0A 4S35A 4D4LA 2F6RA 2QP4A 2C99A 4URZR 1UKYA 3EIEA 2EVWX 3IO5A 5E7IA 1GZSA 1AM4D 4AURA 3RRYA 1NN0A 1XF9A 2GVDC 3FGNA 3TE6A 4Q4LA 2YHSA 3GFOA 1XPUA 1HURA 4B3DA 4NU0A 4UXIA 2HYDA 4M1WA 2Z5FA 4IW3B 3K09A 1F2TB 5FUWA 2NO0A 1H8HD 1KY2A 4JS0A 1X1RA 2Q0HA 2OCBA 3VU9B 4H1VA 4IOLA 4Z1MD 4HLUC 2XTZA 4TLBA 3U44B 4BFSA 4O3MA 1U94A 2V4ZA 5EXSA 5J5CA 3WHLA 2CJWA 5JSZB 1Z2CA 1SVWA 2QBYA 1N6RA 2BMFA 5FPSA 5CDFA 4RD3A 4JLVA 4TLEA 3RC3A 1IJFA 4CF7A 1HYQA 1WXQA 2UKDA 1TMKA 1KZGB 2O0KA 3LQQA 5AUQA 4AG6A 4QNRA 4BFXA 4PSVA 1JXMA 3QXHA 1FZQA 2A30A 3CPEA 1M1YE 1WRBA 4ON9A 5AK0A 3KXIA 1PLLA 2OM2A 3H86A 3M0EA 4UKDA 4U00A 1EK0A 4URXR 4M9SA 1L2TA 3WP0A 1LF5A 2ZJBA 1CIPA 4F4JA 4AY2A 1XEWX 5J40A 4UNSA 4NCKA 5CDFE 3BK7A 3PUYA 1CTQA 2ERXA 2PZGA 2W6ID 2YWHA 2OG2A 3AP1A 2J45A 1G18A 2JCSA 3K09C 2R6AA 3THYA 3R7WA 1Z0AA 4LJ4A 2D7DA 3KL4A 2Q6TA 5CJPA 2JATA 4YQFA 1G7RA 4Z51A 1IOZA 1W44A 4ZCLA 2LKDA 5CYOA 3MSXA 1D5CA 5L8VA 4FWTA 4X8LA 1CJVC 2C96A 1FNNA 1NL3A 4L8GA 1W0KD 3U3RA 4KYIB 3V4RA 2K5UA 5E7MA 4B2LA 1CJUC 4US1R 3EAQA 2WJJA 4F4CA 1XWIA 5DI3B 3WBKA 2Z6VA 4K8OA 1XMVA 3KKMA 5SZHB 3DZDA 4Q1CA 2GXAA 3OFNA 4JZKA 2I4IA 5HE9A 1ELOA 3CW2A 1VG0B 3RS7A 1S8FA 1CR0A 3RC8A 1DAFA 1XX6A 4LYHA 2F9LA 3AH8A 2V3CC 1ZCAA 4GZMA 4BECA 4EPVA 2P6UA 1M6NA 3V9PA 4KLNA 3Q5DA 2ONKA 4RCZA 4W5JA 3BOSA 1P9WA 1TPZA 1JJVA 4JVLA 1SHKA 1NP6A 3PCRB 5DSZA 4UQOA 3RNLA 2KI5A 3KFXA 2BOVA 4PC3A 2GNOA 2WKQA 4GZLA 3QKRB 4PHFA 1NG1A 2ZRFA 4MRRA 1HUQA 2FOLA 2IT1A 3KQHA 3RSLA 2OCAA 4NE2A 1NKTA 3TVTA 4DRZA 2P6RA 5K8IA 2HXYA 3GLHA 1NLYA 3PUXA 2GHIA 4GRAA 1G20E 1UKVY 2JASA 4A92A 1OKKA 2PLRA 4JSTA 3QQ5A 5A5GA 4IJMA 5GVSA 4LRWA 4EPRA 4EAQA 4YXWA 3CPHA 1HT1E 3NBXX 4LYFA 4R2HA 2AR7A 4N0DA 5FI0B 4ZCMA 3W3AA 4MA4A 4M2LA 3Q7PA 3KQKA 2GCPA 3R9WA 4QHSA 2PT5A 4G5SA 3RVBA 2JGNA 4QBHA 2PJZA 1KNXA 1T0HB 2XNSA 4XVUA 1IXZA 1KO1A 2J0UA 2VP5A 4A15A 2IWHA 3WMGA 4AWXA 1T5IA 3N2IA 4UXHA 4RD0A 3IBGA 5JJLA 3SJCA 5KHOC 2ZJZA 2WVJA 4HI0E 2ZRKA 4MYCA 1R7RA 1KAGA 3L0PA 5IF9A 4HDCA 5K8LA 2NIPA 5D3MB 1A7JA 1P72A 2I1VB 3K0FB 2O8DB 4P4SB 2C8VA 3IDQA 3MMPA 421PA 2WPDA 1P6XA 1P4SA 1ESNA 1UBCA 4MGIR 1JEEA 4JIMA 3VR1A 2LCFA 3B13B 4LBVA 3SS8A 1RIFA 4P0TA 2R2AA 2WWHA 2EFHB 2XEXA 4CEIB 4A36A 621PA 1EFHA 4RZXA 1GDDA 2IW3A 3O8RA 4HZUB 3OAAA 3OE7D 4IRUB 4ZDIA 2HLDD 2FA9A 2AX4A 1KY3A 3X2SA 3BORA 1MABB 1II9A 3QPUA 2ORIA 4PAOA 4QGGA 4JL8A 2JJ8A 3H4MA 4QBFA 4BZQA 1P2VA 4TYYA 1G1MA 1O3YA 2ZVQX 1PLJA 1TUIA 2IYSA 1KAOA 3W6PA 1J2JA 3NBFA 3R8FA 2RGAA 3I5YA 4HUQB 4ZPXA 3CX6A 2GTPA 2RHMA 3ZD7A 4AYWA 1IONA 2H57A 3THWB 4JLNA 5AJVB 1C9KA 4NYMQ 4RKFA 5JHHB 1DPFA 1JAIA 3P4XA 4BRUA 5EE1A 4C0KA 4FWIB 2V1UA 1QG4A 1OLOA 1SVLA 4CT4B 1SVOA 5TDHA 1TEVA 4MYUA 5KDOA 2QROA 5KNDA 4WZAE 5FBQB 2AK2A 4AKGA 4HB4A 5L3SA 4Q47A 2O8BB 3BH6A 2ASEA 3EZ2A 2ZE8A 4LOAA 4V03A 1Z0IA 1MO6A 1E2FA 1YR8A 2LWIA 4DLXA 1VG1A 4HAUA 5F9FA 4A8JB 4DUGA 1E9CA 2L0XA 3AV0B 4JLOA 2ZRCA 4M22A 1AS2A 4MITA 2Q9AA 3CF6R 2F3RA 2ZYWX 3ONWA 3QENA 4Q19A 1YR6A 3P4YA 4PC1A 5AUNB 3BE4A 3A6PC 2EWVA 2ZR9A 3GJ5A 3KDSE 2YC4C 3BH7A 1D8TA 5TV2A 4C7OA 2JLWA 2Z0MA 3PIRA 1I4TD 3GCGA 5GJCA 2QQEA 4N0EA 4I1SA 2A5YB 8OHMA 5FPKA 2C9CA 2V8OA 5AWFC 4AG5A 2WJGA 4MKFA 5CYPA 4A6XA 4PPQA 3PVSA 1E2DA 4JLJA 2XTNA 1FMLA 5FUYA 5EJEA 5DO9A 3MFYA 3ZJYA 2R9VA 1G41A 2KB0A 3QKTA 4D4KA 2BDTA 2CLDX 3UANA 3H84A 4Y0VA 3VFDA 1H8HA 2R8RA 3KKOA 5DISB 1HT2E 1M2OB 2D74A 2NO9A 3W5JA 3AKYA 4DIEA 3ADCA 4PXAA 5IRCD 1F2TA 2ZPTX 3F3YA 4Z54A 2ZXUA 2DPXA 4Z1MA 1IN6A 4B35A 2IYQA 2NG1A 4TZ6A 1MT0A 3VU9A 1E3MA 2OCYC 1T3SA 3U44A 3HYTA 4KFUA 4ASUD 2MSDB 4HUTA 5JSZA 1MKYA 4BRWA 4KVAA 5EZ6B 1A4RA 3LW7A 4LY6A 3B1WA 2BM1A 1G16A 4IOKA 4NYIR 5FOVA 2NTYC 3BERA 4KITB 1WBBA 4B75A 1XCMA 4Q18A 1KJYA 4BLOA 1R8SA 3IEVA 4OI2A 4TSFD 3TIFA 1G9XA 3FTQA 4FCWA 4EIWA 3P1JA 1N0UA 1Z83A 1GITA 1GNRA 4MQBA 3E5HA 2W2XA 4LHXA 4Q4JB 2ERYA 2W6IA 2GZDA 3HWSA 2GBLA 4TQAA 3U6BA 4URYR 5ANRB 2OT3B 4C4PA 2IYYA 3QVVA 1R0WA 3TQCA 1KKLA 1VHTA 3WP1B 1G5RA 1YRAA 1Q20A 1ZM2A 4LCBA 2DFTA 2F1HA 1JQLB 4OQFA 3MD0A 3T12A 1FQJA 1XMIA 2D4HA 4B6EA 2OSBA 5TMPA 2VQSA 4QJ5A 1W0KA 4Q9KA 3Q5EA 1DBSA 1ZD1A 6Q21A 5FTJA 4D81A 5FI1B 1X8JA 2AFHE 4OQXA 1YZNA 4U5XA 4UXJA 4MYTA 2WSMA 3IO3A 3LNCA 1Z6TA 2IS1A 5DI3A 1OE0A 4OBEA 1FP7A 1WB9A 1NSFA 3GLIE 3P26A 3VR5A 1OH7A 1S96A 4QNMA 2FSIA 3CR8A 5HKKD 3A1TA 2ZRPA 2GBLC 2G83A 2ZAOA 1TAGA 1J8MF 3NEYA 2YVUA 4E09A 5C2JB 2HXSA 1Z06A 4YMTA 2HT6A 3CO5A 3AVTA 4OK6A 4KLZA 4NP6A 3IEUA 2W58A 3IQXA 4PPGA 1KTVA 1NN3A 1S4QA 4E07A 1T8UA 3C5HA 1P73A 3MCAA 2E87A 4A0GA 2J5XA 3QKRA 3KJIA 3EC2A 4B3GA 4MGYR 4QBGB 1RVDA 1OIXA 4G5OA 2C9YA 3SE0A 1DE0A 2BCJQ 5F3WB 5FOXA 4QRHA 4DDUA 3AF4A 2XZOA 2F1JA 3QVUA 3FMFA 5FOUA 3DPUA 3EIQA 1N6OA 2CCGA 3CNLA 3T06B 2D2FA 2FGJA 4NCHA 4BLPA 4LHYA 4OK5A 1ESMA 3TNFA 2FPLA 4ACBA 4P4UA 4QFMA 1TQ6A 2GDJA 4DJTA 3A37A 1OJLA 5KSOA 1SULA 4Q9HA 1OXUA 4EQ6B 1AS0A 4NYJQ 3R9XA 2H7VA 5FL7D 1MR3F 3NH9A 2FZLA 2XX3A 4FMBB 5FR1A 1XXHA 4C30A 3U6KA 5HZHA 4OQMA 1LV7A 4P31A 5IHPA 4C3ZA 2ZJ5A 2Z4RA 4H9GA 2RGDA 5D3MA 2CVHA 2O8DA 2XAUA 3K0FA 4P4SA 2ZI4A 2A5GA 4CW7A 2V9PA 1WCV1 2OXRA 3F5FA 3KQLA 4JLMA 1DADA 1MRNA 1MV5A 4NMMA 3CH4B 1G5PA 1XD2A 4G0NA 3W8RA 2Q21A 4ILEA 3OE7A 2PL3A 3I3SR 5JRJA 1S3SA 1SVSA 2XZPA 1E69A 2JEOA 2PX0A 4WZBE 2HLDA 1W2HA 4M4SA 1JNYA 3VHXA 4HZUA 2GEVA 2DWOA 2FFAA 3WNDA 5EUQB 2DR3A 1P61B 3FFAA 5EP2A 3TUZC 2J7PD 4KSBA 1E96A 4TLDA 1MABA 1G5TA 4GP7A 2IWRA 2WTUA 2V6JA 2QTHA 3KXKA 4EUNA 3H1TA 1W0JD 5EQTA 5C4MA 4RFSB 2GJAA 2GK7A 3FMPB 3W90A 2BMJA 2ORVA 3DOFA 4BLRA 3KJGA 4RSGA 3A1VA 1KI4A 2NPIA 4DXAA 4HUQA 1GILA 1G4AE 3L8ZA 3L43A 1J99A 4ZDWA 2REXB 1T0JB 4NDZA 3THWA 2OAP1 1ZNXA 3A1WA 3NG1A 4HDQB 4ZDJA 1L4YA 1UF9A 4LPSA 5FUXA 3L0IB 5JS7A 4D26A 2ZI7A 3FVQA 1Z22A 2WJVA 1C4OA 2FF7A 1GNPA 1S2MA 1SVMA 1E6CA 4Y0AA 1TL7C 3TRFA 4EPYA 4F92B 2WMOB 1DAHA 5EE5B 2QY9A 1H8ED 3IHLA 4US0R 4Q21A 5KUTA 4LK2A 5E3HA 4CEJB 2X8AA 1IM2A 3U7HB 1WMSA 2V6IA 3X1XA 4DCTA 2IYRA 1UEIA 4A8JA 4PSKA 1ZIOA 2IEZA 2FJUA 2ZS8A 1NN5A 4UJ5A 1XTJA 2A2ZA 4TQUS 4OHZA 1ZNYA 4MUAA 1G6HA 1M34E 2HDNB 2CHQA 4ABYA 4BWYA 2YYZA 1EGAA 3RS3A 1L8QA 3AEZA 3VR6A 5F98A 4ESHA 4HAYA 1T6NA 3TH5A 3A4LA 1BIFA 2FU5C 4IDOA 1ZVQA 3QE0A 1XJQA 4M1YA 4IOMA 1S0UA 5JI3E 5KPJA 3BBPA 1RJ9B 3GJ0A 2IXFA 1U98A 3B60A 2PMDA 1OPXA 1HY3A 4GMDA 1NMYA 3SHWA 1Z29A 3IBYA 5JWRA 4XWKA 5AJWA 4O2RA 2QPAA 3RYTC 1NBMD 1E2QA 2HF9A 4IXMA 4KSCA 5BN4A 4KHZA 3R8CA 1XTQA 1KDTA 2V55B 4RD4A 4ASUA 2VL7A 1XCPA 2DYKA 3EA0A 4A8JC 2G77B 1HEIA 2HCJB 2NMVA 2VHCA 1U2RA 1AS3A 3UXMA 3U7GA 1MO4A 4LJ6A 4UNNA 2QL6A 3SBDA 1ZW6A 2NZJA 1PV4A 5FPTA 2O8FB 4TSFA 3SN6A 2WJIA 3HU3A 3AVVA 2VP9A 3BD9A 3ZD6A 1KSFX 2G3YA 1YZKA 3D31A 3FHCB 5F2EA 5KSYA 3D8BA 3B1YA 3O8BA 4C0SA 4OKSA 2ZUCA 1FNMA 4M9XA 1XEXB 2R6DA 2WBLC 3BH0A 2OBMA 3A1SA 3QEJA 4Q4JA 4BE7B 2OO7A 5AUPB 2WMNB 4DLUA 3LX8A 1OFHA 1Z08A 2ZE7A 1DAGA 3J81k 4DDWA 3PEWA 2ZI5A 1KO4A 2WOJA 2PT7A 2PZFA 5EUMA 5K8UA 4HLUA 5CM8B 2FH5B 2CL7X 4LV8B 3EPLA 4QBIA 4V0ME 3QNUA 3U61B 2F7SA 1E2GA 5B58C 2X2FA 4DIDA 2ZE6A 2G0NA 2A3RA 4EPTA 1CR2A 2XITA 4IXNA 4JT2A 5CITA 1G8PA 1TF2A 4QOSA 1JR3D 1E2EA 3UMFA 1KI6A 2XSZD 3T1VA 4TMXA 1YU9A 1FMJA 1W49A 1V5WA 4A9AA 1Q44A 1JPJA 1VIYA 1W4RA 4TMZA 3EZ7A 4QJ4A 1KKMA 3DDCA 2OLJA 2RAPA 1NF3A 3LBHA 1P7CA 4ACAA 3LX5A 3ZIAD 4X8OA 5HKKA 1P2TA 3O8CA 1CJKC 3AVUA 2P67A 3IIMA 2Q3FA 1D2NA 1NIJA 2PCLA 4IEIA 5TARA 2HYIC 4AI6A 3L0OA 1D9ZA 1E1QD 2A7QA 3O8DA 1GP2A 4PC7A 1ZRHA 2J9RA 1ZMXA 2C9OA 5JWHA 5H70A 2QEQA 4ZCIA 2AHOA 1X8LA 5C18A 1NJGA 2G9NA 1X6VA 4JYBA 2BMDA 5IDVA 5CB8A 2IYUA 5FBWB 2GCOB 2C78A 3GLFE 4AC9A 1KDOA 1W48A 1K5GA 4TLCA 4FN5A 2DFKB 2IA5A 2UVQA 2V1XA 1COWD 2GCNA 4Q9JA 2FV8A 1WDTA 2KBFA 3G5UA 1N5JA 4Q48A 1HA3A 1U0JA 2ZJAA 1G291 4POAA 4OQLA 4ZO4A 3TAUA 4KV9A 2J59A 4ZI3A 1IN5A 1UBGA 1X86B 1ZNWA 1I2MA 3AKEA 3UMRA 4BFYA 1W47A 3ICQB 2XB4A 4DLVA 5B64A 4TQ9A 3EC1A 4BLQA 3FDIA 4PHGA 1GVNB 3IILA 3RRZA 3NEJA 2OFOA 5FL7A 3ADDA 5BW8A 3GP8A 2B7CA 2GXQA 2VHJA 4UNPA 4EQ6A 3GLIB 1R2QA 1N0WA 1N5LA 1CULC 2NO6A 5JCPA 1NVXQ 2OV2A 5FUVA 2FEMA 2W6JD 3CH5A 3WNCA 5B57C 4AYTA 4A1FA 3GLGB 4P33A 2ODEA 4I1OA 4M0LA 2OHFA 3TR5A 4B44A 2YZ2A 4LC1A 1KZ7B 1N6PA 1KMQA 4TYPA 2REOA 4YMVA 5AJYA 1R5NA 2AD1A 1E2HA 2HJGA 4Q7KA 4E5UA 1LFDB 4OJQA 1G3RA 3X1ZA 1GIAA 2RGGA 1DOAA 1ZINA 4Q1FA 3X1YA 1ZD9A 3EZ9A 1MO3A 2OAQ1 4JVNA 2QTVB 2P5TB 1N6LA 1AGPA 1VYUA 2NO1A 2ZSBA 1M7GA 4JL6A 1JAHA 2XZLA 5FBRB 5KNCA 1Z3IX 2J7PA 2R65A 4G5RA 4GI7A 2QN6A 3U4QB 3GEHA 3M4YA 3ASZA 3A4NA 3K0CA 2DFNA 1NY5A 4ZI2A 3I5XA 2QORA 1W0JA 1PJRA 2W0SA 1XCGB 3ZZUA 2OBLA 4MRPA 4W9MC 2ZIAA 3MJRA 5AR1A 3CF2A 3ZVLA 4RFSA 3QSYA 2ATXA 1GG2A 4PZLA 3VKWA 1QHYA 2WWXA 5BXQC 3ZVMA 1U99A 4GP6A 4PC6A 4DBLC 1CEEA 1QBKC 4I1VA 2KJQA 1HV8A 1SGWA 2GRJA 2IUUA 5DLQC 4PSAA 3ZZTA 5JMTA 4HAXA 1AKEA 1QDEA 5DHAA 1GTVA 1AZTA 3ADKA 2QU8A 3Q8XB 1G19A 4MH0R 4TTRA 2IL1A 1H8EA 2YOHA 4BFZA 3SBEA 3AKCA 3MRSA 3LVRE 3GJ6A 3CRVA 1O87A 4M1OA 2QA5A 4Z8YA 2CHVA 3MLEA 1EWQA 3CR7A 1OHHD 1E98A 3K0CC 3LO5A 4CEJA 2ANBA 2B92A 1Q21A 3AF2A 4YLGA 1JQJC 2IYWA 3FKQA 3CZQA 4DCUA 1AJEA 5EXPA 4KFTA 1IHUA 2UZ3A 1SQ5A 2OXCA 4B2IA 4XJXA 4OI0A 3KFVA 3BB1A 1Z28A 4Q4HB 2ZM5A 3CZPA 1DS6A 3GEIA 4QM6A 3HDTA 3QPWA 2H8KA 3PFIA 2KWIA 1DEKA 3U3OA 3T35A 2IUSA 1DTSA 3QIAA 1KNQA 2ZYVX 521PA 4A2QA 5FTLA 4G5QA 1P62B 4WXRA 4B73A 3FPAA 2RH5A 3DZ8A 2QSYA 1GFIA 1RW4A 4V0NA 4HAZA 4JLPA 1RJ9A 1WF3A 4D4MA 1HQYE 1II8B 5EE0A 3U7EB 1Z2AA 2Q9CA 4L16A 1NBMA 4PO1A 1W7AA 3B85A 3AVWA 3LV8A 2G1JA 3BXZA 2ZVPX 3BAFA 5FOSA 5KNBA 1QVAA 1LW7A 4F7WA 3FMIA 1B0UA 1FUKA 3K8YA 3RS5A 5JECA 4M9QA 4LJ5A 4FCTA 2GZAA 4BQSA 3C4JA 1TX4B 4UNRA 5IT5A 3WNBA 1US8B 2YKGA 5JS8A 5LB4A 3EA5A 3FKSD 1KI9A 2QPOA 2EFDB 3SJBA 4EJSB 3LW8A 1SVKA 1YHNA 1NBME 4C0AC 4CDGA 1M7BA 4KFRA 5DGXA 4DDVA 1YE8A 2AN9A 1Z47A 2O8FA 1XPOA 3WHKA 2QM8A 4TL6A 1DO2A 2BJWA 3CKLA 5BN5A 3K9HA 2QP9X 3BC1A 3NIBA 5E4FA 3TSOA 3SYKA 3VTKA 1F2UB 4V02A 1GRRA 1FL9A 1E2MA 1EFRD 4FIDA 3THOA 2HV8A 1XEXA 3ZYCA 4FW9A 3BIFA 3I62A
chains in the Genus database with same CATH superfamily
1TFUA 1ZD8A 1E2LA 2ZR7A 3C16C 3RVPA 3WVNA 5FAXA 1XCLA 4MQMA 1YJAA 3I9MA 3DWGA 4W7IA 4UEOA 3IQFA 1CQIB 2FZWA 3E3OA 3ONDA 1ZGHA 1RABA 3BB3A 3TWOA 1G3QA 2O5VA 2YVLA 4ZTUB 1XTUA 3G2PA 4EP1A 2W98A 2ZREA 1QX3A 2RGYA 1YHZA 3TN7A 5CA1A 3K0AB 1PQ4A 4RM2A 3K94A 1PTJA 1Z13A 1L1EA 1PV2A 3K35A 3QVGB 4TMKA 4RULA 3ZU3A 4PQYA 4KYVA 2OZKA 2A9QA 2I4RA 3ETLA 2K6GA 4GH5A 2O57A 4LSZA 2SKEA 4RVHA 4ZZ0A 5J4LA 4ND3A 4WERA 5BMVA 1ZOPA 4IYJA 3CRNA 3KPWA 4WZ6A 1WQ4A 3MWKA 3U56A 3DWFA 4QUIA 1PGQA 1HDRA 5KEIA 3AHFA 1FDVA 3LP6A 5P8WA 4IVNA 1V9LA 1S2LA 3UCFA 4UU1A 1YMVA 1JB9A 2JAXA 2PMEA 2C7VA 2Q3HA 3R5KA 2CXHA 2C2BA 2OOSA 3RIGA 2WHPA 4WBXC 2JVJA 2GO7A 1FP6A 1CY6A 1IOWA 3BSFA 4N12A 2X6RA 2XGJA 2VZ8A 2QVCA 1SY7A 3F6EX 1D6JA 3A11A 3LL4A 3R6GA 2GAFA 2EYQA 3N39C 4IFEA 4RSRA 3TCNA 4D3FA 4ALLA 4EYGA 4FR2A 1GOTA 4PLTA 4ZZ1A 1QTRA 2DB3A 1I0LA 2R6CA 1PI3A 4LZOA 2V5AA 4YMIA 4UEWA 1YZGA 2OD2A 3OF5A 1EK1A 4J03A 1VLQA 5AKZA 3UHFA 2BGLA 2Z8YA 3HCDA 3THSA 4B6OA 4BKRA 4WBNB 4GC9A 2RHJA 3PICA 5LA6A 3ZWQA 3MINB 5CDGA 5LP6B 1LJLA 3JZAA 5LQUA 2XA9A 4KU4A 4R1UA 4GWGA 2Q5QA 2ZJOA 3NXKA 2QI9C 2IITA 5F9HA 4A0RA 1UXOA 5M29A 2GCOA 3VBCA 4XD2A 4C9BA 4U7FA 5IFLA 4QYMA 1HE8B 1ZAKA 1GTL1 2Y1OA 2C03A 1GGFA 1ZGZA 1NQTA 3LQ1A 4MKHA 3D4OA 5GMOA 3RANA 2FRDC 4M1TA 2H06A 2VT2A 4UDNA 3VDMA 2JJQA 2FY8A 4DV5B 5BW6B 3AJRA 1X7ZA 1Q95A 2XBLA 1HDXA 3T61A 3WXBA 3NQ41 1J7KA 5ELLA 3ER9A 2IHBA 2X8JB 3QKSB 1E9BA 1O7JA 4MWDA 1ZWKA 4FYYA 4MB0A 2HNKA 3DFUA 4NABA 3ANNA 1HNNA 3JQRA 3AZOA 4H4CA 1T0PA 4RMHA 5D1NA 3A9TA 3CVYA 2XJ9A 3N5CA 2IHYA 4JX8A 4HFNA 1TW3A 4Q7MB 2YWEA 2KW5A 2CF5A 1E7SA 2NGRA 2QQGA 1EDOA 4DCMA 2J9YB 1TKRA 3OZIA 2J67A 3E81A 1NMSA 4H4DA 3KQPA 3FMVA 3SDZA 3OHMA 4I08A 2ZSHA 2Y99A 2NX2A 4FNGA 4XB2A 2O5EA 3LIIA 3N8GA 4PC2A 5G3ZA 1T10A 3TNYA 2WLTA 1PD1A 1SU8A 3EEIA 3IVMA 4WAUA 3T5CA 4B8ZA 4CWAA 4YV1A 5B2EA 5FUMA 1PJ2A 4MP6A 1YF3A 4Q66C 3GVHA 4AZ0B 4K9LA 5ALJA 4ZXPA 3MBIA 2Q3BA 1B3RA 2WQZA 1RWWA 2YNMC 3GLGA 4DV1B 3CX8A 2DUUA 2WWTA 2AN1A 2GJ8A 2HMYB 2ZPAA 3IJEB 1R9GA 2NPFA 4YUYA 2FZKA 1P2FA 3MZ0A 1TO1E 1PFUA 2ONJA 5HK9A 3WTCA 5EE3A 3GAZA 1YO6A 3NC4A 1FBNA 4HAWA 4ME6A 4U6QA 3ETHA 4LWPA 2BKEA 1W2WB 1NN1A 3SZGA 3F1KA 3G2IA 2PY6A 4FMCB 1B26A 4UAJA 2EWWA 1UAAA 2FXVA 5IT9A 4YCJA 1XEAA 1PNOA 3PVCA 1FFWA 3QE2A 3EGDA 3FFWA 5CPBA 3JQDA 4ONEA 1Y7PA 3EFBA 4K05A 4XIGS 2JGFA 4UUQA 2EGHA 2GAOA 1ECGA 2HOQA 2O2JA 2ZQYA 4W4TA 1TCVA 3OE1A 4XWGA 5FJIA 4AB1A 4ARIA 4Y3UA 3T3MB 2O2EA 2ZRNA 2C9DA 1P1KA 4JEMA 4L4RA 1ZK0A 2CFOA 3N6XA 2EYUA 2WWIA 2KLBA 3MD9A 4MRNA 5DT9A 3KSUA 3OCZA 3KQQA 5FFMA 3F98A 1M5UA 2E85A 1X14A 2Q1UA 3TE7A 2RJOA 2Q3JA 3U40A 1YCGA 1C0KA 1P18A 2D2EA 3W5HA 3O92A 3G8BA 3ZGXA 4OSOA 3FAKA 3L7AA 4OLBA 1Q1BA 1I51A 1VMEA 4YH1A 2WSIA 3WB9A 5B4VA 4X64B 4CL3A 4ZHSA 1I5RA 1O54A 4JXZA 2H48A 1DO8A 1FX1A 1KIFA 5E9QA 3T5PA 4OMUA 3N2GB 3IIEA 4R31A 4YDRA 2TMGA 3DE4X 2CJYA 4BEBA 1Z88A 2G7MC 3PU6A 4CCSA 1UKEA 4LHZA 1SJ9A 4A0FA 3WJ7A 4RW0A 2J5RA 3MHTA 4YROA 1P60A 4H35A 1OHHA 4MQ5A 2I2XB 5DM1A 3UHAA 5IXYA 3TSAA 1BMDA 1X7DA 4MOWA 4MUNA 4AP5A 2W8BB 1EJ0A 1VKOA 2VNKA 3K1TA 2Z9DA 5JIBA 2ZK7A 1V45E 3N76A 3BT7A 1EK5A 3EQ8A 4QPNA 4UMDA 1G5IA 5J2TF 5AW8A 1AKYA 4F12A 4C14A 5JW6A 1LKZA 4WZBA 5CTJA 2QG4A 1XYVA 2D62A 4IDPA 1MN6A 4XASA 3F67A 3WGNA 4AJ4A 1I13A 2PJDA 4DSAA 1SC1A 3R77A 4TMWA 1OBVA 3DEFA 4D3YA 1VRCA 1E6UA 4ID9A 3S2FA 1P77A 2DTXA 3GNLA 4HRYA 2P7HA 1SURA 4WBSA 4GSYA 1BDHA 1OU0A 5KYNA 2ANCA 4CT5A 4B3MB 4KZPA 1RRVA 4DR3B 4OHYA 4TWZA 3P45A 4UU0A 1TJNA 2AJCA 3EJWA 2LKCA 3LYHA 4KEAA 5AI4A 5DF1A 4EX6A 2X77A 2BFDA 2DBRA 3GLTA 1HKUA 3D8HA 5DMXA 3KOWA 2EW2A 5DW3A 3A3NA 3C3DA 4IKOA 1EE9A 1ORVA 1X7XA 1XP8A 2RJ3A 2VAMA 2VK1A 3A6KA 1PJZA 1R0XA 3K2BA 4ZAWA 3Q3CA 4CMIB 2H29A 4QECA 5CXQA 1H85A 5EZQA 1RAAA 5L7YA 1ODFA 4R84A 5BSVA 3KEQA 3OM8A 5TEVA 4HH4A 4RIIA 4B3FX 3KIPA 4UZFA 1FIUA 2BEWB 1Z6YA 2W48A 4MUYA 3ASYA 2BFEB 1KGDA 2I8LA 3BMNA 1EUDB 2N46A 5CT8A 5I4BA 1H23A 1U90A 3UCEA 3ZJVA 2Y6VA 2QV7A 2BUBA 1BXZA 3G3EA 4CMBA 5EFZA 1C4WA 3K1YA 4G9GA 3BF7A 5DP2A 4J0EA 1IUNA 1N3IA 1QIMA 1I4OA 3WAJA 5EESA 4XM1A 2HL6A 4EJSA 3O94A 2A5JA 3UN1A 5MF6A 2FUG6 3B5EA 5DE3A 1DB3A 1T9DA 1ZVMA 1BE6A 1K5DA 4D0LB 2K4MA 5BQOA 3VAYA 3LQ4A 5FT9A 4IILA 3PR1A 5BUSA 2D0DA 2VHZA 2JFFA 2QYSA 1EFRA 3NHAA 5H7XA 3TSCA 5CLFA 2QT1A 5EQJB 1HT3A 3FRIA 1V11A 1RI4A 1OZAA 2DJ5A 1G6KA 2YN4A 4Z0PA 1A8PA 1Q6ZA 2BF4A 1HTWA 4PVDA 1PHRA 1GZ3A 5TX7A 4ZI7F 4FMDB 4GDFA 1XZCA 5EXTA 1GGKA 2B3DA 2GEKA 2JDID 4OHCA 3OIWA 2PZLA 4MWSA 1J25A 1SBTA 1F51E 4LBZA 2HA6A 4FYIA 1N2OA 3FTCA 3LFUA 3RWBA 1EHIA 4DRXA 1OYWA 3BM5A 5ABPA 1LDGA 2F62A 1NASA 2BMEA 2QVGA 4YFYA 3S55A 2VPIA 4JIGA 2W9XA 1CDOA 3IIJA 1BYIA 3HCPA 4RAOA 1EFVB 1XN1A 2R62A 4WESB 3WWPA 5J1TB 2PRZA 2GRAA 3M4NA 4RNCA 4RZ3A 3ZNNA 4PZ0A 3QFFA 4ABTA 1U9IC 4HPJB 4R9RA 2FQQA 2CZGA 1S1CA 3K53A 2QE7D 3JR3A 5CDTA 2MSEB 5BYJA 1GUAA 2GERA 1CP3A 2XYPA 4B82A 1LS1A 3SQXA 4MW0A 4GG1A 3JYQA 3GRYA 4TN1A 5F2KA 3SSNA 3A4VA 5D3ZA 5C1IA 4B2YA 5AW2A 3VZSA 4BPBA 1OYVA 4AL4A 1ONPA 2VAXA 2FLWA 2PS9A 3IEXA 3OZFA 4XTCS 1J23A 3S81A 1T9HA 4TL7A 4JT4A 2PX6A 2GGSA 3N2NA 1W4CA 3IMCA 2BUAA 4MGKR 1M1NA 4YIHA 1NVMB 3QF7A 1ZLYA 2X86A 2HMWA 2PBRA 4RELA 4CNQA 5FNVB 3UK1A 1OFUA 1ZJYA 5IG2A 1CR1A 3MF4A 3OLXA 4JHXA 2OV8A 4C7KA 5C8YF 5KYTA 2QRVB 3W0LB 2QY6A 4DR7B 4K3VA 4PIPA 4B3RB 4ZAGA 1NG9A 3KWMA 1JFVA 3RV4A 5L4SA 2H18A 2WABA 3GUYA 2GEDA 1HDCA 1PD0A 2NZ8A 3AESB 2I34A 3KCQA 4OB6A 3CV3A 3NTQA 2DPHA 4U02A 5KSPA 1ZRSA 2CW5A 3TXYA 3JASB 3W9UA 3C3KA 2ZULA 2OK8A 2PK3A 4JXXA 1ZRNA 2FSSA 3BXGA 4HN2A 4WN3A 2RGRA 2Q0XA 3MYRA 4RKWA 1TECE 1Y8RA 4H1UA 3TX2A 2FJPA 2ZU6A 3Q9LA 2V4MA 1BWQA 2X76A 3A4MA 1PJ8A 3EMKA 3N05A 2BI7A 2FSVC 3HCFA 3HKEB 1GSIA 4HVTA 4PGAA 1ZXLA 3EVTA 3O7WA 1U0EA 3U81A 4RF5A 2WP8J 3URMA 5DYIA 4BUCA 2HJRA 1L5FA 1NBAA 3IAXA 3KHUA 4D5EA 2JLQA 3DCJA 3GFPA 4OQNA 3WYAA 4BXOA 1AG9A 2ZSAA 1RYMA 4MLZA 5JTTA 3CLRC 4BQFA 1VI5A 3NBAA 3PEYA 1ONBA 3SGLA 4B0OA 1XI2A 5KOIA 3U5ZB 4JDUA 2BONA 1MB4A 1LDMA 1W4AA 4N6OA 1UC4B 3AFMA 4S1PA 4H77A 4YRFA 5JHGB 3GEBA 4MW7A 5IDQA 3CB4A 4XOIA 3IKMB 1VCMA 4HP8A 1X8XA 3HJNA 3K70C 3RFTA 5DKFA 3BB4A 1WHTA 4ZHQB 1BDMA 3TOVA 3HU2A 5DCUA 3AIIA 4R1SA 1EVKA 2WWRA 4UBMA 5LXTF 4EG3A 4EA9A 1OFIA 1Y5LA 3CNNA 5EKSA 3A6JA 4P32A 4J07A 4AYXA 1L7AA 2A78A 4DB2A 3HXLA 4PHTA 4Z9YA 1SKYB 4E51A 2QRGA 3PYMA 3ZS8A 4EY3A 3GDHA 3FCSB 3LYLA 4ICIA 5C4GB 2FZGA 2W4IA 3O4VA 6REQA 4WD3A 5K6TA 2AV6A 1KMNA 3H11B 3A05A 1D09A 4HLCA 4HWSA 1BW9A 1PJ3A 2A92A 4BKUA 3HHPA 5J4KA 1GWNA 3RD5A 3P7MA 4YQYA 3PQCA 3L8GA 3SJAA 5J4YA 4NL4H 2R6HA 5HQ3A 2C1XA 3UJ6A 3X1JA 3A1FA 3TG8A 2BFNA 1KYYA 3R0QA 4Y2VA 2WQ6A 2P8JA 3JD3A 3LZ6A 4YT4A 4Q4AB 3HYNA 2ZSDA 5ED4A 3R7SA 3RABA 2XRFA 1OZGA 3BTVA 5EVJA 4D79A 4YO7A 4JASB 3DDNA 3HXMA 1R50A 2XE6A 2XMZA 4EY4A 2A35A 3F8TA 4J6FA 5L3QB 4F38A 2JVIA 3VKVA 4BVEA 1P2UA 4DA6A 1FDUA 3B5IA 2WB4A 3M70A 1WA5A 3LDGA 3SHFA 4ZODA 1DG3A 4L28A 4EKDA 2ZQ5A 4FHGA 4DLNA 4FCVA 1EUYA 2I3BA 2ZIXB 5DX8A 2Q5JA 1W88A 2BDEA 3S68A 3INTA 1R1DA 1BDJA 3A2KA 1QZTA 2J46A 1JVNA 2OQRA 1N2CE 2XVXA 3DE0X 1SUSA 2UVDA 3ISTA 3PXAA 4MRVA 4Q5IA 3B70A 3VMFA 1WB4A 2WC1A 2Q0QA 3CUVA 1E4OA 1F5NA 3LPAA 1ZM7A 3NV9A 5T3UA 4X97A 5E1DA 1IUPA 2YHAA 4LSGA 4MQFA 1ESCA 4HXFB 1MGPA 4CQLB 4TTQA 2AWOA 4DCOA 3D8TA 4NF2A 1J5EB 4JU8A 3AF1A 4V1CA 2WE7A 1T0IA 1R0YA 2PMKA 4Z0HO 4BVAA 1S9DA 1DTWA 3NEPX 3OIDA 1Z25A 3A4YA 4WK6A 3GFRA 2BW0A 4PV7A 4BGUA 1MC1A 3L7NA 2C31A 2PGAA 4QSHA 3DVAA 5A4IS 4ENWA 4CQMD 2V7EA 2XF8A 2OBFA 5LZ9A 4QXRA 4Z4EA 2EBFX 2J3DA 3PEFA 1W4BA 5ALZA 3D1JA 3ZN2A 1Z5UA 4EG7A 4D9FA 5EWMB 4X3OA 2AVNA 1MO5A 1ETUA 4EW6A 3EYWA 2AFRA 5DXJA 3B9QA 3HB4X 1V8PA 2WV9A 4RK1A 4TTPA 4KXUA 3SF0A 5JS6A 1C9JA 3FNIA 5BNZA 4W8OA 1OREA 2X15A 2J0SA 4LHVA 1VLJA 3RW9A 3HWWA 4MRSA 5EIXA 1YZVA 3OUZA 4WIAA 2LPMA 5T4FA 1CJCA 2FWJA 2ZS7A 4S05A 2PH1A 1CU1A 2WVHA 3MQ4A 2NZ2A 3ND6A 4KI7A 4ZT3A 2PS3A 2VF4X 1YIOA 4RE6A 5CLLA 3UA4A 1BS1A 1Y98A 2RC5A 3FYUB 3KLPX 3RF6A 5AW7A 1DIRA 1OF1A 1RMYA 1XZBA 2XNJA 4JYCA 1GZDA 3PWKA 4AQ7A 4CLRA 4CM4A 1FDSA 4D6XA 3V8PA 2R1VB 5B1IA 3U1BA 4JUIA 2VTKA 2P65A 3WXMA 1D9XA 1PGJA 2QNIA 4XGQA 5TNXA 1ZL2A 3L0ZA 4ZAYA 5AKHA 2IYZA 3EZXA 4GGOA 3MCTA 2W2KA 3F4BA 2JJ1D 2HK7A 4C78A 2EG9A 1XLTA 2WIJA 5BOSA 4ZIRB 1SOVA 2CV1A 1LLFA 1PT8A 4EW3A 3G0BA 1FB5A 3HDJA 4NULA 1FFHA 1T6XA 2AA3A 4TV9A 4AF6A 3Q3HA 5ITZA 3NEAA 1KFBB 2IELA 2QRKA 4L0CA 2Z8XA 2Q9UA 2VPZA 4W5NA 1GD1O 2AG0A 4LYDA 1J2UA 5LC1A 1BXRB 1XJCA 5L6LB 2VNJA 3S7ZA 1DC3A 3AXTA 2YJ3A 3CLUC 1E3TA 2GUGA 3PWSA 4B6QA 5ICEA 4JYZA 4JVSB 2BSQA 1RKVA 1SUDA 2CDNA 1QQ6A 3MMNA 2H1VA 2P5UA 1T9KA 1YE3A 3WMRA 3CEHA 4BTVA 2BGKA 3VAAA 4X85A 1YZLA 2JDIA 4FNAA 4F91B 3L0YA 1UINA 1JHYA 4W9NC 5BQFA 1XFAA 3MMSA 1CBUA 5K3FB 3X43A 4DE5A 3EIFA 1M8PA 4F72A 2PXHA 1YBHA 3DMDA 2O4UX 3N0TA 2IPMA 1FDTA 1BMQA 1ENYA 1P4JA 3VDQA 4AM8A 1ONOA 4ZZ3A 1XEFA 2FWRA 4UOZA 1F60A 1I3LA 2GEJA 4V0LA 2FPPB 3V7NA 4Z9BA 4AS2A 4D25A 1FOEB 2VBCA 3OZSA 4LOJA 5G40A 3OEHD 2CL5A 4YREA 5CXUA 2Q5EA 3VQTA 1TQHA 3UUWA 4D44A 1BU5A 2QAIA 1XD9A 1MPXA 1QYIA 2FR8C 1FRQA 2JJ2D 2PPVA 3E7XA 3IMKA 1ZDMA 1IK6A 2D8MA 2QE7A 2TMKA 3KNZA 4BGIA 5KTSA 1UFKA 5LUAA 4B6GA 1S8AA 1TZCA 1I4DD 3I6QA 4NQRA 1OUMA 2P6PA 3KP1A 1F12A 1M75A 4YUAA 3DZJA 2IQ5A 4LPKA 3RTDA 3T1OA 3ZE8A 1Y7TA 3A6GA 2QD4A 3L7DA 5H80A 1U1DA 2BP7A 3BUSA 4GL2A 2YQZA 4OO3A 3OFJA 1VA5A 1R8JA 1RIIA 2CBXA 2O48X 4HADA 5B37A 3W3ZB 2IH5A 3VX3A 2YV3A 5FD8A 2YC2C 3UWKA 3VM6A 2Q3DA 1Q84A 1PO7A 1W46A 5CHYA 3B3AA 3PE6A 2RBKA 1V16A 2B78A 2B6HA 3QXXA 1NURA 1Z62A 3R3ZA 5THXA 5DDIP 2HLNA 3EPKA 3IIKA 1VGVA 1ADBA 3GO4A 4PG8A 5LD2B 4GPTA 2ZS9A 4LI3X 2R44A 4RWZA 4P58A 1P0MA 2X3YA 4Z7QB 4NKRA 5BNWA 3UVEA 3L82B 4MYHA 4NRDA 1VJTA 4ED9A 5J47A 3TPCA 1TLFA 1Y3DE 3DPIA 3K2IA 3K73O 1Y5NA 5BSRA 2PGXA 2DSTA 3BMCA 3KWFA 2MYPA 4L9RA 2RCNA 3GBSA 4NNPA 1B8UA 1MAUA 1SOAA 1YGPA 3EVNA 3A06A 3O2JA 4C03A 4EHAA 3T9AA 1I4LD 3GHHA 4DMMA 5KWVA 2O54A 3CU5A 4RPLA 1CY4A 1JS1X 3FSEA 5TB5A 1Y5RA 3CSUA 2ZRGA 4XQEA 3NHLA 3ZQKA 3ANLA 4EJMA 3C6YA 5JVDF 2RHOA 2ZBDA 3MJCA 4WFQA 4J7AA 1GRNA 2VF8A 4A0SA 2YRFA 2DTEA 2L82A 4OFBA 4I2NA 2PE5A 4BO1A 2EX4A 2Y0BA 3GUVA 4RY0A 1NQOA 3BF8A 3RVLA 5GIOE 3DMYA 2O3JA 2QJFA 5FIUA 4EKIA 1U1CA 2P6NA 5GJBA 4QPZA 3K9LA 5CT4A 1T25A 1G8HA 1UBEA 4YJKA 5HZMA 4EDHA 2Q6KA 2C4WA 3OMXA 4UTXA 3W5UA 2UUAB 1TA9A 2GF0A 3LL7A 3R3YA 5EMNA 5CH8A 5G1PA 3BEOA 4V1CI 1NVDA 4CT0A 1CXZA 1GUZA 1Y81A 4JQZA 4NFYA 2IS2A 4MVJF 1YGYA 2UYOA 2F8MA 4L4UA 1X7YB 3PA6A 2ZB7A 3ZQ4A 5JR3A 3HGMA 2A0UA 1QIFA 4NWIA 4I5FA 4QQRA 3ZIDA 4MI6A 1FSPA 2CEAA 3VNSA 3OU6A 1A9YA 5I9IA 5IUJC 4F96A 3KD2A 5DN9A 1GHTA 2VXYA 5LBIA 3IAHA 2RHHA 1X2BA 1HYEA 5CXSA 5BV2P 2UVPB 5CFOA 5IJ0B 1S3IA 1U4NA 1M2NA 1PFYA 1ZKMA 3R20A 1MOPA 4ZJYA 2A33A 3Q88A 3EBLA 1P81A 3S2YA 2A0FA 3KOXA 2YRWA 4PR3A 3O0DA 4AY6A 3LUAA 4OI1A 3VISA 4LZPA 3TLBA 4CTKA 5K0CA 1WKCA 4HEA1 3DYVA 3G5MA 1U0BB 5FPHA 1RYEA 4MIOA 3ZJTA 1AN9A 4XARA 5F7ZA 3CFYA 2WIDA 4R2IA 3EISA 1Z36A 5JYCA 1USGA 1X1AA 3BILA 3CF4A 3MSCA 1QCCA 2CNWD 2JPDA 3E70C 4LS3A 2ZXFA 1KYXA 4CGZA 3Q40A 1MXHA 5EMHA 1KMHA 3KQWA 3MAGA 2XOKD 4OY3A 3H0KA 4CM9D 1ZZGA 3WKAA 3INRA 4D80A 3N2LA 3DJFA 4YCCA 1A4UA 3FR8A 3TTWA 2BFAA 4B8YA 1FJXA 4R98A 2H2AA 2YJNA 2D1RA 3KTAB 4L5CA 4EGSA 5IT0A 4QYIA 4Q7JB 3RVNA 1DQNA 3I2HA 2I9PA 1AKTA 2X7HA 8AT1A 1UWVA 1KH1A 4KNVA 2GKGA 3IT3A 4GZ3A 2H4XA 1KBZA 3DBRA 3EPPA 2HRBA 3GMSA 2BM9A 3GP3A 4FEGA 4WT7A 3SQOA 2CK3D 2VRBA 4GXQA 3ZHUA 4GMGA 4Q24A 3TL2A 2FN4A 5JEEA 3FFTA 1ZOIA 2FW7A 2XADA 4UM9D 3PCXA 4GF5A 2QLMA 1RM4A 2NU8B 1WUKS 2PT6A 4HRXA 3OY7A 1ZM3A 3E27A 4KMMA 2H92A 4W82A 1TZKA 2HK6A 5KNBH 4P5DA 1TTTA 4E5PA 4B46A 2F59A 2VJAA 4QPPA 2F4VB 1R0KA 1DLIA 5ALVA 3TBKA 2H63A 2JLBA 4M9CA 2JARA 4FE7A 1UQTA 2GD0A 5KREA 4CQMA 3QK7A 4TWBA 4DQVA 2IBMA 4AK9A 5DHSA 2G82A 2W37A 2IF2A 4TS3A 4BNVA 2QQ5A 4URUR 5A5DA 3KG2A 1DEHA 2V54A 4Q1BA 1M1UA 4II7A 4UE3S 4WVFA 1EM6A 3SJ7A 3SWWA 4BVGA 3ZVNA 1L7BA 4WNCA 5DNYB 4MO9A 3V8EA 4BMOB 5KOJA 2DFPA 1WNFA 3L4JA 2ODBA 4RVNA 3UWSA 2BI4A 3QVKA 3LD9A 4KGDA 1CCWA 1FX0B 1X8KA 3B3QA 5EQDA 1UUFA 1AMUA 3ZHRA 2X42A 3RAPR 4XKJA 1VECA 1RWPA 2GQ0A 2GARA 2ETVA 3F6PA 1KYVA 7ADHA 1OR8A 1NI3A 2IHVA 1H4TA 3C5HA 4K3UA 3VH4A 3AOGA 1VMIA 5C34B 5IYZA 3LWDA 3BJEA 4NHEA 2QMEA 3KJFA 4J9VA 3EIHA 4CLDA 3L8YA 3GGGA 4I1IA 1HTTA 1YDEA 2FEXA 3CPJB 4MICA 3MWGA 4BQRA 1ZMOA 4RU1A 2UUCB 2CNDA 3ETDA 4R9UC 3UK6A 5F64A 4J94A 3QFCA 1S3GA 4K7JA 4ZA2A 3QI7A 1CEXA 2JJ1A 1QHXA 1ADJA 5HIJA 4BLWA 1ES9A 5JZSA 2DBQA 1H22A 2YQ4A 4QAQA 2G40A 2ZYUX 1V48A 2N3ZA 4RQUA 5AK6A 1A8IA 2R8EA 4GBGA 1SXJC 3LGXA 5FO1A 3T3DA 2XQFA 4EY8A 2DHDA 1KDZA 1YCFA 2VZ0A 1DBIA 1E32A 1BCRA 3UWPA 4OXNA 1BN6A 3R76A 3LY9A 3DMNA 4KR2A 5ALIA 3G6WA 4GLFA 5D5HA 2EZTA 1EPUA 4LJYA 4PINA 3EYAA 4QRIA 3UH0A 3ZGVA 2MMGA 4EHNA 1IZ9A 1UFRA 1QH8A 1FRZA 3FYHA 3H5IA 3NDRA 5SY4A 3R7AA 4BO3A 5KYUB 2PJUA 4DA8A 1N0IA 3T9CA 1XTKA 1E0JA 2EBHX 3DUFB 3GUHA 3PHBE 4IUYA 1U81A 4PZEA 4WY8A 5ILQA 1ZYUA 2M1ZA 1K3TA 3QUTA 5AVRA 2H2WA 2RGWA 4E4YA 3DEZA 1OYOA 1BWSA 2B2NA 2QMOA 2EEPA 4ZZ2A 4OJKA 1PKXA 2D2XA 4Q1AA 4URWR 1CUUA 4TVKA 3JX9A 3VSBA 1Z63A 1DFHA 4LE2A 3OEHA 5EINA 1CUBA 3QG1A 4ZKDA 4TV8A 3UMVA 1ENOA 3PHIA 3JWIA 1XVTA 7REQB 2K87A 2JJ2A 1CUAA 3KOUA 3MW8A 3NATA 4PAMA 2HPHA 1WNTA 2B5WA 5DM0A 5HGJA 3RBXA 5G02A 1XRLA 4X24A 1U8XX 3ZXXA 3P2IA 4BTLA 2X6QA 1Y42X 4HVCA 4CU5A 2R7LA 3F9IA 2VP2A 1QQAA 1KJWA 2B21A 2V6BA 1Z18A 3F8WA 3NCHA 2G09A 4WACA 1U0GA 2FAXA 1ZL0A 4HJRA 2C4UA 3DXFA 3PGA1 4FDTA 4IR7A 2RGXA 1J8YF 1SH7A 3J7TA 2N9UA 1ZR4A 1CZLA 4V0OA 1UZAA 2J9FA 4FDUA 3A6EA 4RCYA 3FPBA 1JSZA 5CUQA 3B82A 4Q01A 3W1EA 1U3FA 5CLJA 2CXOA 4QAJA 5FFNA 5F4BA 1RHRA 3V4FA 1S7GA 2G25A 4XIFA 5J5VA 1AMNA 4ZAVA 3I34X 3U7JA 3VH2A 2H08A 4YRSA 3UOAB 4OEHA 4DCGA 1RJEA 4R9VA 2XWQA 4U5QA 3AUJB 3I4CA 4ESOA 1SIUA 2JIMA 3P32A 4D41A 1A82A 4UMFA 4LDJA 4C6TA 3A6FA 3C39A 3HS3A 4DLZA 4IZOA 4KMOA 4LZJA 1KL7A 3B78A 1DIBA 4MX8A 2CV0A 1Z35A 1SCUA 4ETNA 1U8YA 1SBHA 4NAVA 3JYPA 1YHYA 2H6EA 3MGAA 4D45A 4J8PA 2PUDA 1TYEB 3ELUA 1MJGM 4OFWA 3JWPA 2ZRJA 4W5WA 2OGSA 4Y30A 1CV2A 1XXHE 2AS0A 5DBIA 2RE8A 2PYIA 4F6CA 4QRDA 3TVYA 3G2HA 1Y1LA 3EDYA 3WWDA 2C5HA 3Q15C 4BVHA 5C8YB 1R4NA 2D0OB 3I72A 1LS6A 4LZAA 1YAJA 1VSQA 5K3CA 3U3XA 4J76A 4KOEC 3UMBA 1JQKA 1MOQA 4LQLA 4CYMA 4F3RA 3N59A 4L0MA 3BHJA 4G0UA 3AVYA 4KO1S 4M0KA 3PJRA 5BWMA 1WU7A 1CYDA 4JBGA 3VKUA 1C9MA 5TF4A 3EIXA 1QIEA 5HCNA 3R4VA 4N5DA 4ISBA 1JG7A 3Q0TA 3BICA 3B20A 2ZQZA 3DOIA 3KVOA 3PQ6A 4HEJA 2VP6A 4N6NA 4TXLA 1BYUA 3T3HA 4EARA 5JEDA 4PNEA 1DBVO 3G0OA 1PCXA 3L8MA 3GT3A 1JHUA 5EIHA 3VTZA 1HG0A 2J7KA 4DA0A 5C37A 1FDOA 2JCXA 1OT3A 3RYHB 1PGOA 1G1AA 2J3MA 3VXKA 3ZLBA 4QJ3A 5CBPA 1L4UA 4LVNA 1RQRA 3QEMB 2RK3A 4QLBA 5C0OE 4DQLA 2EFEB 2PMWB 4LE1A 1RC1A 1P5JA 1VSTA 2ICAA 4Q1DA 3ZCUA 5JC8A 3AUUA 2NV6A 4P8RA 2P9JA 3S3TA 3DEJA 4YRGA 4LMAA 2QXYA 2RBEA 1RPZA 5B1SA 4PYMA 3DYBA 2WTBA 4NOKA 3V8RA 4ARAA 3B1JA 4KE6A 3UATA 4K1XA 4HDOB 4MSUA 3P94A 3QMPA 3M3PA 2I2AA 5G3YA 2QW0X 4O1HA 4ZOBA 2O7QA 1F6BA 2FPSA 3LDHA 1PEAA 4DEYA 4E5KA 3BFVA 1QZ3A 4ZVSA 3Q85A 2FSVA 2ZE5A 2AX3A 1ZP6A 2BFFB 3NUZA 4JSYA 4R3NA 3W5VA 3FJYA 1GPWB 1TU3A 4KAJA 1KO7A 1OX6A 4E2YA 4QE3A 5E4TA 4I5DA 3ECSA 1YVEI 2P9FA 3B1VA 5LQCA 4ESVA 3I92A 2CXNA 3ESBA 3WLQA 1OIWA 1GV0A 2NACA 2HA2A 2ZJ3A 3PB3A 5JMPA 2GAJA 1RHQA 1E9SA 5JZ9A 5KINB 1GZHB 1C30B 3ABOB 3O9ZA 2ROQA 1XKLA 1JXOA 4GOJA 3SCZA 3BA1A 2VSNA 3O8OB 4JC0A 1AQNA 1OH6A 2CNWA 4G2TA 4DCVA 1C50A 1VPEA 1MOZA 1E3WB 1R8QA 4HGZA 4WNAA 3FHLA 3L8FA 4G67A 1KI8A 5CCEA 2XOKA 4XQCA 4YJ3A 1UP6A 2X0JA 3ZDRA 4CM9A 4MV7A 1OA0A 5FR2A 4IHQA 4OF4A 3DOUA 1AUVA 4YJDA 1LD3A 2K2QB 4HXGA 3ZUGA 2HTFA 1VB5A 1KHTA 3FDFA 3FXAA 2AFIA 3E2MA 2QX7A 3JZMA 3NOVA 4LXYA 4V0KA 3ERCA 8MHTA 1D2RA 1ZHHA 3MGKA 2DWPA 4MI9A 4DJ5X 3GG2A 3ZNQA 5LP1A 2IEDA 5LQNA 4XQ9A 5BSKA 5A05A 5ICFA 3F6BX 1VJRA 1XMJA 2AOXA 2YZNA 3UWOA 3CZMA 2YQ5A 2CK3A 2QT9A 1NWCA 3BQNB 2O8EA 1VGRA 1LZLA 4TTTS 1JIVA 1RADA 3AB3A 2QTTA 4EBBA 1Q0UA 1RLTA 3HG7A 2I22A 3CWZA 4R8MA 5DX1A 3TPFA 4C29A 3BEDA 4MJLA 2WJWA 1ZXXA 1U02A 4N40A 4WADA 4L5AA 2QVZX 1QZZA 3BE8A 4BASA 3AC0A 5BR8B 1JHAA 4G4JA 2EZUA 3D64A 2AKAB 1VIDA 1XRRA 4MWTA 4DVGA 4DB4A 4FI3C 1CE8A 1P7VA 3F74A 3G2KA 3NOXA 1RQLA 4N47A 2B69A 2VUIB 5GM1A 3IAEA 3DFZA 1V71A 3CW9A 3MCAA 2GN8A 1U9CA 3DPSA 3MPUA 3OJLA 5K8CA 5HJ2A 2VWGA 3MWYW 2FX3A 2WAYA 3P0RA 4NCIA 1XTIA 1KK3A 2PH3A 3GUCA 5AKEA 3ZCQA 4IHKA 1TVMA 4U7PB 1G3MA 3JWEA 4A0HA 2ATVA 2HM7A 3OQMA 1AV6A 4LTNA 2D1FA 4QICA 2PSHA 2CE2X 3C4QA 5B55A 1H6BA 2YHUA 3C15C 1X1SA 3GK3A 3T8YA 5KNDD 4QDTA 5FADA 2XPCA 1KEEA 1QHGA 3FKJA 3C5CA 1TVKA 2H16A 1GN8A 1Z8NA 4UDXX 3ETJA 1PVVA 2JLSA 2DXIA 5CFMA 1PR6A 4G8DA 4E2XA 3M6AA 2GM9A 2J4CA 5K6AC 2Q28A 3JR7A 6GPBA 5JAZA 3GN1A 2IXAA 3UKDA 4DUGD 4BLTA 1JYFA 2BBWA 2CJFA 2XTJA 1ZEJA 4JNKA 4LJ8A 3W7BA 4DNQA 3PLRA 5B1DA 1JIXA 3U4AA 1EDEA 4X1YB 4NBNA 3IQWA 1WUTA 4PFQA 1RWNA 2PZBA 4E94A 3GD5A 1GGVA 1OLSB 2QAGC 3L1IA 1KAQA 1PR5A 5IPFA 3G0GA 3CISA 4CKEA 2IX3A 1WKBA 1WIWA 3HNOA 4II3A 1PL0A 1RP7A 2PHZA 4WY2A 3EIEA 4GECA 4MVJG 5IM4F 2EVWX 2PWYA 3IO5A 4YALA 3VO8A 2VPWA 2Q8NA 4O4IF 2C7BA 2VJMB 4AURA 1LPOA 3B8EA 3JQAD 3IHKA 4QIHA 2P78A 3ESYA 4Q4LA 3VR6H 1LRJA 3RU7A 2FQ1A 2JH3A 1LI5A 4NU0A 3PDHA 1PFGA 4AP9A 4YT2A 1SELA 4QPCA 1QVWA 3WS7A 4PWZA 4JBLA 1AXGA 2FX2A 1R64A 3KCNA 3TW0A 1SQGA 1MRZA 5FQNA 5KQSA 4YAWA 3T7DA 3G1WA 4L02A 2FX5A 3HKBB 3VYVA 1Q1NA 4BFSA 1T4CA 1U94A 2FHSA 2V4ZA 3WHLA 1BQEA 1RR6A 1X42A 2CJWA 2XNCA 2IU3A 1Z2CA 1SVWA 2DSNA 1N6RA 2BMFA 3IPLA 3RC3A 3L77A 3WAGA 4DV7B 3T9FA 1X19A 2BFPA 2VF2A 5AUQA 4Z2AA 1A7AA 1JHZA 2R4TA 3ILXA 1QGUB 3OI7A 4AG6A 1L9KA 2GD2A 2SICE 5JNWA 2H0RA 3MB5A 4PSVA 1IOLA 1JXMA 4XCQA 1M1YE 1NR5A 1YQGA 1WRBA 5B36A 2OM2A 4UKDA 2OORA 2MYNA 4M9SA 2E4YA 1L2TA 1ZUNA 4F4JA 1BVHA 1G21A 4ZYVA 4LF7B 4XGNA 2QTNA 2DKOA 5CA1F 5FWAA 1OPRA 4YA6A 2CVQA 1CTQA 3ZW7A 1MFPA 2AFHB 2PZGA 4HH1A 2YWHA 2OG2A 3AP1A 3NKFA 1FUEA 4H3KB 1KFCB 1G18A 2NU9A 4GX1A 4EO7A 2JCSA 4J2OA 4WNYA