2VQSA

Structural studies of nucleoside analog and feedback inhibitor binding to drosophila melanogaster multisubstrate deoxyribonucleoside kinase
Total Genus 67
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
67
sequence length
197
structure length
182
Chain Sequence
TKYAEGTQPFTVLIEGNIGSGKTTYLNHFEKYKNDICLLTEPVEKWRNVNGVNLLELMYKDPKKWAMPFQSYVTLTMLQSHTAPTNKKLKIMERSIFSARYCFVENMRRNGSLEQGMYNTLEEWYKFIEESIHVQADLIIYLRTSPEVAYERPLKYLQELHELHEDWLIHPQSCKVLVLDAD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DEOXYNUCLEOSIDE KINASE
publication title Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transferase
total genus 67
structure length 182
sequence length 197
chains with identical sequence B, C, D
ec nomenclature ec 2.7.1.145: Deoxynucleoside kinase.
pdb deposition date 2008-03-18
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2vqsA00
4TYNA 2GF9A 2HEIA 2ZXUA 1MR3F 1W49A 4A36A 1G8PA 3K0SA 4JL8A 2EWWA 5EJEA 5IK2D 1H8EA 1HE1C 3OZXA 1G8FA 1KY3A 1R7RA 2VSOA 1PUIA 1FOEB 4Q7LA 1OFUX 5HCIA 1MABA 4ASUA 4B34A 3KZ1E 5AR1A 3RS7A 1Z3IX 5FTLA 1X86B 3FHOA 1W1WA 4US2R 4QBIA 2F9MA 2WWWA 5FBLB 4QM7A 4PQYA 2V55B 2PT7A 1OKKD 3AP3A 3K0CA 4A1FA 4L15A 4EPWA 2JJ2D 4LV8B 4GMXA 3AP1A 1TF2A 2GEDA 3QE0A 3V9PA 4HZIA 1D6JA 4OQMA 1U8AA 4EPVA 1FW6A 3K0EA 2FOLA 1Z6GA 2GRJA 3THWB 2W6JA 2XOKD 4QBFA 4CT4B 2GAAA 3REFA 2REOA 3PUXA 5DI3B 4DLTA 2RGNC 4JLPA 1CF4A 4IXMA 3C8UA 2J45A 3TRFA 2GJAA 3THXA 4DVGA 1Q1BA 1XD2B 3VNUA 4L9WA 3QJYA 4ZIRB 4KITB 4DIDA 2Z4SA 1S3SA 3HYTA 3K70B 2D7DA 1QRAA 5J47A 3VHLB 5TMPA 2PJRA 3JZAA 4URVR 5E7MA 4B47A 2X2FA 2B8WA 4Q19A 4XIGS 1G5RA 5E4FA 4L8GA 121PA 2IEYA 2Q3HA 2GJ8A 1D8TA 1P2VA 1TQ2A 2ORIA 4XWAA 4C2TA 3OAAA 1KO4A 1LFDB 3AGQA 2O8EB 5KO2A 2XX3A 4M22A 3Q3JB 1DAHA 4Z54A 1OFHA 1P7CA 3DOFA 5F3WB 4ZI2A 3LO5A 4TQ9A 2H8KA 2W58A 1Z0IA 1ZBDA 2XJ9A 4IVPA 4AD8A 2FE4A 4W9MC 2YINC 2V4ZA 1ZNZA 1RVDA 2P3SA 5KDDA 5EP2A 3WBJA 3LVQE 3UANA 2ZETA 3I4LA 1F2UB 4UNQA 4BEBA 1YZUA 2JIZD 3Q7PA 4I99A 4TT3A 2WBLC 5FL3A 2ZAOA 5AUOB 2BKEA 3T1OA 2Z43A 1E3MA 3SJZA 5JWHA 3ADBA 4RZ3A 1P3JA 1LV7A 1K6MA 3B1ZA 2VSXA 4DBLC 1T4GA 1Z06A 3ZH9B 2BWJA 2ERYA 2AN9A 2ZRBA 3NHBA 4PC1A 3FVQA 4URUR 4B75A 1AA9A 3O8BA 5AJWA 1OYYA 2VBCA 3TMKA 4ZCIA 4CEIA 2BBTA 521PA 1SKYB 4PHFA 1Y63A 2J1LA 3THWA 4NYMR 3VU9B 4G5QA 3CWZA 1JR6A 4G5OA 5DGXA 1VECA 1CKEA 1UKVY 4A15A 1Q57A 2W0SA 4DLUA 3RLFA 1QHSA 4QHYA 1BKDR 4LI0A 4B6FA 1P2SA 4XD7D 4TTQA 1BMFA 1XD2A 2C95A 4XTCS 1PVOA 5E95A 1KJWA 3B85A 4QXAA 2EQBA 4OHZA 4Q9KA 4GOJA 4F4IA 1D9XA 1YZGA 3AVQA 1W0KA 2A5YB 3JVVA 1BOFA 4V02A 2V8OA 4Q00A 1Z47A 3KL4A 3QKUA 1Z83A 2BM0A 4BLPA 1HE8B 1DO2A 3NBFA 3U3OA 4O3MA 3THYB 4EJSB 5CDFE 1FPMA 3B7GA 2IS2A 1II0A 1GOTA 3IO5A 5DI9A 1U8ZA 3KFVA 4MYHA 5J40A 4AI6A 1TU4A 4FINA 2V9PA 3K0FB 1P5ZB 1E2KA 1YZLA 2C9OA 1S0UA 2P0EA 4M4SA 4NTZA 5J4VA 2QAGC 3LQQA 3AKCA 2OFOA 3KDSE 1WQ1R 1BO6A 3H0KA 1VG1A 3TAUA 3QKSB 3KJGA 4Q9IA 4C0BA 5CLQA 1Z6XA 2PT5A 3NBXX 1W5TA 3BGWA 5FPTA 1VIAA 1UADA 4FD2A 4GL2A 3GJ8A 4LWZA 4Q01A 3GD7A 1N25A 3NWJA 1SXJB 1OF1A 4KI0A 4OQLA 4PPNA 1FTSA 3RSOA 4D25A 1NBME 1EFCA 2JAQA 3HR8A 5DYIA 3BBPA 4B3DA 1DAGA 4ZKEA 3SU8A 4DEYA 4HUTA 5JS8A 1G20E 1CR1A 1M34E 3KTAB 1JEDA 3D7MA 3PXGA 1VG9B 1X1SA 4Q21A 4MRRA 1ZM7A 2B6HA 2NO6A 4O2RA 2BEJA 2P6RA 1WCV1 2W2XA 3VU9A 1Z0AA 3O8CA 2DBYA 4ESHA 4MRVA 2ZROA 4US1R 4C4PA 3FB4A 3AVYA 4LCBA 2GVDC 2QENA 2J0SA 1YHNA 2XJ4A 2JLWA 1Q1ZA 2AX4A 2YOHA 4KLNA 5KPJA 2WTUA 2FGKA 2I3BA 2CBZA 3KFXA 2ZJYA 2V6JA 5AJZA 2CK3D 2GZAA 2QTFA 4TL7A 3K0CC 2ZI3A 3MJHA 2BDTA 4GZLA 3PIRA 4QNMA 1XZPA 4JLNA 5JWRA 4FCTA 1AKEA 1Q3TA 2XNDA 8OHMA 3U4QB 2B21A 3DO6A 5HPYB 5LPNA 5FR2A 2ZJ2A 4A8JB 1Z63A 2WJHA 4YXWD 2ZR0A 4PPQA 4EJSA 1YR8A 1N0VC 4LJYA 5FTKA 3RWMB 4DDTA 3CPHA 4PSAA 1OHHA 3K0FA 5EP1A 1UBFA 1YR9A 3T1QA 3UXMA 2MSCB 3UG6A 4QKQA 3FYHA 4NCNA 4TN1A 3RWOA 3BIFA 4A6PA 2GXQA 3FE2A 4ZDJA 2OBLA 3M6AA 3S1AB 4DXAA 2VHUA 4PO9A 1LW7A 4KHZA 3QKSA 1NG1A 1Z6YA 3BD9A 1NVVQ 3TR5A 4OI4A 4NP6A 1KO8A 2NTYC 2AD5A 3NC1C 4Q4JB 3RS2A 1SHKA 2IS1A 1WDTA 1SVOA 1OH7A 3MWJA 1CJMA 4LV5B 4S35A 2Q0HA 2Z5FA 3EZ9A 3TH5A 4C2UA 3TJZA 4MKGA 2GCOB 1R8SA 1G3RA 4EFMA 3KTAA 3EARA 2ZYWX 1UBEA 4B3XA 1QG4A 2QE7A 2XITA 3O47A 1CR2A 2C77A 3QF7A 5L8VA 3U6KA 5JECA 3P1JA 5HZHA 4MGYR 3ZIAD 3WMGA 2QT1A 5KDOA 3CRMA 2KBFA 5EXSA 1Y3AA 4GPTA 1CBUA 2B7CA 3U7GA 2OO7A 3GLIB 1F6BA 1ZIOA 3QG5A 3UKDA 1E94E 4GI7A 4LBWA 4AKIA 2D3WA 4QHTA 4AYXA 1NJGA 2IXGA 3PEUA 3QEOA 1GNRA 1N5KA 1W5SA 4KCGA 1H8HD 1TEVA 1N5IA 2ZE5A 4P31A 1HY3A 4AKHA 4WZBE 4DCVA 1IQPA 4A92A 2OZEA 1AZSC 1R8QA 3LFUA 3U4QA 1UM8A 4RD6A 1WB9A 2A78A 4HLUC 3EZ7A 4GOXA 3P26A 5F9FA 2J59A 5EXXA 4A8JA 3SQXA 1LVGA 1SHZA 1XRJA 2FN4A 2IYTA 2EYQA 1OIVA 1OIWA 2DFNA 2R6DA 1NMYA 2QMUA 1QHHA 4NYIQ 3AVOA 5DHAA 1NY6A 2P6NA 1SZPA 2GZHA 4HDQB 4WZ6A 3QKRB 3DHWC 2QZ4A 3GLGA 4IVQA 1RW4A 3KKMA 2VRWA 5IHPA 4JLJA 2VHCA 3REGA 5F2EA 1JBKA 1JJ7A 3UMFA 4B3CA 5C4MA 5F9HA 2RGGA 1KDTA 3FKSD 4LZZA 5D3MA 2YYZA 1HQCA 4Q02A 1R5OA 1U94A 1I2DA 3FOZA 1K5DA 2ZRNA 4GBMA 3L8ZA 1XWIA 2MSDB 3QENA 1KSHA 1D2NA 4Q4JA 2DPXA 5A5GA 4I1VA 2REBA 2ODEA 3U3RA 1OXVA 3KXIA 2JDIA 1VG0B 3P20A 2ECKA 2CE7A 5A4JA 1AS2A 4G3XA 1NLZA 2YNMA 4IDHA 1S96A 1P72A 2OCPA 1FMJA 2R6AA 2WICA 3T5DA 4LRWA 4YC7A 3HPQA 2PZGA 1N2CE 4M53A 1IBRA 2VH5R 1JXOA 3L2OB 1NIPA 2RGCA 2C04A 4RKEA 4DUGA 2VP6A 2EYUA 1P62B 4PC6A 1N6OA 1W2GA 1YE8A 2KWIA 2GBLA 1UFQA 4GT1A 4IHQA 1PJRA 4NDZA 4A9AA 4MYCA 5GJWC 1P2TA 4DJTA 2CLSA 3GJ4A 3AF2A 4XVRA 1N6KA 4FN5A 3B1YA 4FMDF 2ZUBA 4TYPA 2AHOA 4QGAA 4P4SA 5M04A 1ZRHA 2F1IA 2VLIA 2QTVB 3HYRA 1TF7A 3WY9A 4YDSA 2VO1A 4M1WA 1XZQA 2VP0A 3U3KA 5EUMA 3DL0A 1KI7A 1E0AA 3H86A 1P2UA 2PLFA 2BIFA 2GNOA 3LRPA 1QZXA 5KPDA 3PCRB 2FX3A 2GXSA 3CR8A 3KQUA 3VKWA 2OV2A 5KNBA 1N6RA 1HURA 2QNRA 3MRSA 3SR0A 3CX6A 3PV0A 3BWDD 2LCFA 2DFKB 3VKHA 3BB4A 1JNYA 2ZANA 3RRMA 2FSGA 3QKRA 4JSYA 5JBQA 1HQYE 4FMCF 2Q21A 1AK2A 2O52A 4G01B 3OFND 2QUZA 3WP1B 1FUKA 4N0EA 4TMKA 2HLDD 1Q1QA 4I4LA 4HSEA 4W5WA 1MT0A 2FFAA 3GLHB 4A0GA 5HKKD 1JR3D 3LW8A 4KXFB 3RSLA 3G5UA 4LJ8A 1E1QA 4TSFD 1FZQA 2ZE8A 3ADCA 4B32A 3NVAA 3KUDA 1V43A 1SQ5A 4AYWA 2DWOA 1SVMA 1PUJA 1NRJB 3HU1A 3SJBA 4D4MA 3BK7A 1CRQA 5H1YA 2JLXA 4OHVA 1CULC 2PZFA 4O2LA 5B64A 1GTVA 2IYYA 1E9DA 4OHWA 5EZ5A 5SZKB 3PUVA 2XZOA 2GCPA 2GF0A 1KSJA 1E9AA 2Z6VA 3CWQA 2CLDX 2ZI6A 1QF9A 4Q03A 1P73A 4TMVA 3SI7A 2QBYA 1XMVA 3UATA 2SHKA 4WXPA 4CEJB 3BOSA 3T1VA 5KSYA 3U7FB 1ELOA 2R62A 2V7QA 1FP6A 1LS6A 3AF3A 3E1SA 4A82A 4ZDIA 3SC3A 1GG2A 5KTYA 1TF5A 2Y8EA 5E7JA 5GVSA 2O5VA 1UEIA 2A5JA 5BW8A 2GETA 3KQLA 2EFDB 2VP9A 4LC0A 1NVVR 2ZRMA 1UF9A 2C78A 3SS8A 2ERXA 1KZGB 2JCSA 3KB1A 4B44A 5JRZA 5G41A 1NMXA 3FFAA 1E2DA 1NVXQ 3OEEA 4KFRA 4QGFA 4IFBA 3EPHA 2XXAA 3I62A 1GVNB 3IBYA 1A1VA 4PPFA 3UK6A 1YR6A 4JBXA 1X6VA 4KV9A 3OF5A 2ZYUX 4FW9A 2PEYA 2CCGA 1XCMA 1M7GA 1AS3A 1EXMA 2GILA 1HYQA 1E2FA 1D5CA 1XFAA 3BORA 2J87A 4P33A 4N3NA 3VR6A 4BFXA 3AV0B 4G0NA 4D4JA 5KYKA 3OHMA 5EE5B 2NOAA 1ZYUA 1OXTA 2BBSA 4OJQA 3VX3A 4CYMA 4OYHA 2FNAA 1KAGA 3NEJA 4IFEA 3CUEF 2Z0MA 4IJMA 1QVRA 3NXSA 1S3GA 3RHFA 5JCPA 3EASA 3Q8XB 2O8CB 2X2EA 4Q9HA 2J7PD 1NKSA 4B76A 1T0HB 2ZSFA 3UMSA 3L0OA 2J46A 3VHXA 4LBYA 4NYIR 1IONA 2VF8A 4QOSA 2XSZD 4MUBA 3Q5DA 1GNPA 3LX5A 3HP1A 2IT1A 5JHGB 2QP3A 5GJCA 2OLJA 1J2JA 5JHHB 4NCIA 4G5RA 4H1VA 1E9EA 2IBMA 2ZRPA 1DG1G 1YU9A 3BFVA 3AKDA 2R6FA 3K1JA 3TVTA 4BZPA 1XPOA 5FUVA 1OYWA 1KAOA 5JWOA 5JI2E 4WOPA 1M7HA 1Z22A 5HR5A 4JLKA 1E2QA 4BLQA 2ZUDA 4JT4A 1W0JD 4ERNA 1OKKA 821PA 4YLGA 2QROA 2P6UA 1JB1A 2VHQA 1VMAA 5AUNB 2DYKA 5KOYA 1WXQA 3EIEA 3WMFA 1FNMA 1KI6B 2WPDD 3R8CA 4NONA 2ZYVX 3A1TA 1U98A 3CRQA 3CH5A 2ZSBA 4TMWA 4AC9A 4EAQA 5K8IA 4K81B 3TQFA 3I61A 4PZYA 1ZW6A 1IN5A 1RJ9B 4JL5A 4PR0A 4C0LA 2OBNA 3CM0A 4V03A 1ZD8A 4RZUA 1OH6A 3GLGE 2CE2X 2HYIC 3SEAA 3W5JA 1IN7A 5IDVA 4B6EA 1O87A 3B1VA 3CIOA 2GWHA 1U90A 4ARZA 3T35A 1II9A 4POAA 3Q72A 4PTLA 5TV2A 4AKEA 3AF4A 1ZU5A 1W4BA 1C9KA 3ETLA 4MRSA 4CGZA 3SFZA 5JJLA 4WW0A 1XXHB 1BYIA 2D62A 3FMFA 2W6IA 1Q1EA 3W5IA 1E98A 2O8CA 3E5HA 5SZHB 1RRCA 4MKHA 3GLFA 2DCUA 2IA5A 1NVWQ 1S2MA 5G3ZA 3VR4A 3TVDA 4BASA 5DHFA 2FMXA 2ANBA 3CF2A 1XTJA 2H1LA 3MWKA 4XVQA 3QBTA 5CIQA 1CJTC 3LY5A 3NIBA 4LHZA 2YWFA 3D31A 1G5PA 1U9IC 1ZUIA 3TSZA 2J41A 3KJIA 1XJ0A 5CM9C 3U61B 2V1XA 2C98A 1FFHA 4Y0VA 1J90A 2ZU6A 1T3SA 4V0MA 2VP5A 1N6HA 1SULA 1DAMA 3GJXC 3F5FA 4A0RA 2ZE7A 1ZCBA 5FTNA 3WRXC 2AK3A 3IDQA 4ZI3A 1KSFX 2PBRA 2KSQA 1IHUA 1ZNYA 3FTQA 5HE9A 1OXSC 3U44B 3IIKA 1G8YA 1JPJA 2H18A 4Q7KA 5LD2C 4DWJA 2CMKA 3U2QA 1RYFA 2ZRGA 3ASYA 4KVGA 4BE7B 1ANKA 1E9FA 2AKAB 3IIJA 1W4AA 1OB2A 1LTQA 4PZLA 3MJRA 1G7SA 1D9ZA 1S1MA 3SBEA 1BS1A 2C96A 2GVZC 5KNCA 1RFLA 3I8XA 4Q4AA 4XD7A 1E2HA 3H1TA 3CRW1 2OLKA 5JI3E 4KO8A 1AIPA 1FTNA 2ZPTX 3PEYA 4ZPXA 3I32A 4A2PA 1P9RA 2NPIA 1RE0A 1JAHA 1NBMD 4EFNA 2CLCX 2WZQA 4QJ4A 3RNLA 3WNBA 4HUQB 1J70A 2OBMA 4XH9B 1UKZA 5EP4A 1VYUA 1J8MF 3U60B 1GWNA 4LYHA 2FU5C 4Q5IA 3T06B 3EX7C 4BPBA 1RKBA 2NMVA 2XGJA 1CR0A 2R6CA 1JEEA 3B78A 1DAEA 3DVLA 4YMVA 4CEHB 2ZJOA 4Q1BA 2CXXA 4W5JA 5BN5A 4Q1FA 5LDDC 1KGDA 3GEHA 1YZKA 5GADl 5EXTA 2C8VA 4EPYA 4PAMA 1G7CA 4OK5A 3FMIA 3V00A 1DAIA 4KSBA 4U02A 2RCNA 3RANA 2CHQA 5JJKA 3A1UA 4JIMA 3L0IB 2DR3A 3QXSA 3K9GA 4JJZA 4NHOA 3B8HA 3MGCA 3EG5A 3OIYA 4QGHA 3A37A 4B3GA 4NKRA 2Q3MA 4FIDA 3PFIA 2O8DB 3X1DA 2YV5A 3HDTA 3WRYC 4PXAA 5CJPA 1YZTA 4ZV4A 3U44A 4BWYA 5AK0A 2G0TA 2ATVA 2FEMA 1Z08A 4WBSA 3L0PA 2LKCA 1MO5A 4XSGA 4CDGA 3QSYA 1QHIA 2X8AA 3KXKA 2IYLD 3VQTA 3LXXA 2GAOA 4IW3B 1T0JB 2EFEB 2VA8A 4JVNA 1GL6A 4HEJA 2ZYTX 3WHKA 3TLXA 3IQXA 3QKTA 5KSOA 3KQNA 1T9HA 1W48A 4E09A 4DDWA 1KI2A 1H8ED 2IUTA 4C7OB 1R0ZA 2D7CA 3RAPR 3PJRA 1XJQA 3U7EB 2F1JA 2J9RA 2E87A 2IK8A 4ASUD 1GRQA 5DI3A 4A0FA 1CS4C 3KUCA 1TUEA 1N6NA 2QRNA 3QPWA 5FOTA 3ZS9A 3I5YA 5KU1A 2JA1A 1ZNXA 3VMFA 3MMPA 4TYYA 2BEKA 2G0NA 4ZIRA 2L0XA 1NY5A 1R5BA 2FA9A 3B1XA 2V3CC 1CU1A 2XZPA 4YXWA 2WAYA 1X3SA 2WWYA 1GNQA 4JL6A 1XX6A 3KXLA 3TBKA 2GA8A 3CF6R 3ZQJA 4CEHA 4R9UC 4R71A 2ZM5A 3NG1A 4AG5A 4AY2A 2CHVA 3B82A 3W6OA 3LBIA 4R2IA 1EWRA 4KJZA 1E79D 3X1YA 3FGNA 5BN4A 2HF9A 4NPHA 2O8EA 2O0HA 1YQTA 1FP7A 4Q9JA 5L3SB 3SHFA 1GL9B 1U0LA 1PV4A 2RGEA 3VR5A 3GFPA 2WWIA 1OPXA 1ZM2A 1N5JA 2YHSA 3VKGA 1ONBA 2KE5A 4HYYA 5CYPA 1XEFA 1F2UA 2FWRA 5JSZB 5AWFC 3BAFA 4HDOB 5FUXA 1NIJA 2ZS8A 2AR7A 5F98A 3KX2A 4UKDA 4H1UA 4TWZA 1NLFA 1WMSA 1TPZA 4UQOA 4D6PA 3RS5A 3PITA 1XEXB 3LBNA 1N3BA 1E2MA 2ZRHA 2AXNA 3BFKA 3EA0A 1A4RA 5FPHA 1A7JA 4JVSB 2E1RA 2QRZA 2WWGA 3Q85A 3MAAC 2XAUA 1IM2A 4KYUA 2QMHA 4Q4HB 2D2FA 2EFCB 5CJ2A 4BFTA 5DIFA 3VR3A 1NN0A 2A30A 4CZ2A 1U0JA 3HR7A 1EG7A 1E9SA 3MWLA 3R7WB 4C7OA 1XF9A 4OQXA 4URWR 3WNDA 5KHOC 1A2KC 2A5GA 4PSVA 4JBYA 4LJ9A 4IOJA 3SHWA 3W8RA 2OFXA 2QM8A 4TT3D 2OILA 1E0KA 3VTKA 1GRRA 3X1XA 5JEEA 2NZJA 2NO7A 1ZMXA 2ZR7A 4DDVA 1R5NA 1GRNA 2FDCA 2RH5A 621PA 1ZD1A 1KY2A 3LNCA 4GNKA 4DLXA 3AVXA 2GJKA 4HAWA 4AURA 4G5SA 1R2QA 1G7TA 4F91B 1G3UA 2REXB 2W00A 2DY1A 4NL4H 4F4JA 1G5TA 3ECCA 1Q0UA 2D2EA 3TKLA 2EWVA 2QM7A 1CTQA 2WAXA 1CIPA 3AB3A 5KSPA 3THYA 4C0SA 3GLFE 1KKLA 3KKOA 5DN6D 5JEDA 5LB4A 4LOAA 1G291 3W3AA 4DCUA 2GDJA 3WNCA 1M1YE 2JJ1D 1VIYA 1ZAKA 2Q9BA 4X8OA 4AYTA 2J7KA 5L3SA 4LJAA 1CR4A 2QU8A 1UJ2A 2BBOA 1UAAA 1COWA 2N1BA 4LGMA 4PHGA 3T5GA 3BE4A 2P65A 3PENA 3CRVA 2ZRKA 1US8B 2CJWB 1NKTA 4NZYA 5JSZA 2ZJBA 2QPOA 5J4KA 4RD4A 5JLJA 1XTQA 1YKSA 3LX8A 3CPEA 1W0KD 4GP7A 3IILA 4A6XA 1UKEA 4QG7A 3ZD6A 2D06A 4V0ME 3WYFA 3A1VA 1ZM4A 1SXJA 4M2LA 2ZI5A 5C1BA 2OHFA 3AUYA 3QQ5A 2X19A 3NH9A 4DSUA 2B92A 2PCLA 4L9SA 3GMTA 2WKRA 5FI0B 3NTUA 1AJEA 4UJ3A 5CM8B 1KK3A 4TMZA 4Q4HA 1U2RA 4BLTA 1LF0A 2A5DA 4V0KA 5EE9A 3AM1A 2HDNB 3T12A 3KQKA 1Q20A 1OFIA 2PX0A 2HJVA 3GFOA 1PZNA 3HJNA 3OIVA 1V5WA 4ZKDA 2PEZA 2OUKA 5DE3A 2IYVA 3WBKA 1OFTA 3T1TA 2IYSA 1UDXA 2RMKA 1DADA 3OE7D 3I73A 1KO1A 3QUSA 4WA7A 5FH9A 1LY1A 3DKVA 1T3LA 1Q22A 2R6GA 2QGNA 4Z8XA 3B6EA 3HU3A 4AWXA 1Z07A 4C9BA 2A9KA 1W44A 1TQDA 2OXRA 3PUWA 5JRJA 1JJVA 2KBEA 1W2HA 1AKYA 1MRNA 3ND9A 4GSYA 4ZCLA 4DLVA 3CRRA 2O8FB 2FSFA 4K8OA 4HATA 4PC2A 1KSGA 1XEWX 4GDFA 4D4KA 4TL8A 1EESA 5JS7A 2ZI9A 3U3MA 3I5XA 1E2EA 5UKDA 1WE2A 4BGDA 4EQ6B 2HLDA 1E2PA 5HKKA 5HZKA 1EFRA 4EKDA 1JR3A 1AGPA 3LD9A 3KJEA 5IT5A 4XVUA 4HLCA 1US8A 5FTMA 1F5NA 1G41A 1NLYA 3S1AA 2X77A 1M74A 3PG5A 3DM9B 4DSTA 1I2MA 3CZPA 4LHYA 2AXPA 4RVCA 1FQKA 3ZGXA 1Z0KA 4JLVA 4FWIB 2GKSA 5B2ZA 1T91A 2FZLA 1E2JA 1E69A 3NEYA 1GAJA 4RKFA 1RIFA 1TAGA 2KI5A 2UZ3A 3L82B 3QY0A 4QHSA 3UIEA 4A2QA 1G21E 3AVUA 2LWIA 1D2EA 2GCOA 1MRSA 2XTZA 3DDCA 1DAKA 4U5XA 3ZVNA 1U0HC 4WAUA 2YOFA 1G17A 2ZRFA 4Z51A 3LXRA 4LJ6A 1O3YA 3NBZC 4D0GA 2DFTA 4DIEA 2Q3FA 4OQNA 2V1UA 4I1SA 4NCHA 2BBWA 4QL3A 1GFIA 5HCNA 1JQJC 3Q5EA 3BH6A 1KK0A 3K9HA 3TW8B 3VR1A 3R9XA 3GLIA 3NDBB 1Z0FA 1IY0A 2CCJA 3BH7A 1KJYA 2P5SA 2WWHA 1UBCA 3K09A 4UXHA 4ZDWA 2EU8A 4LYAA 3B13B 1F2TB 3WMEA 3HWSA 4V0OA 4DLZA 5BWMA 4AKGA 4OI1A 5C18A 2RGXA 1IY2A 1KTVA 2CNWA 1M6NA 4RSGA 2OEPA 3MWYW 3TSWA 4JLBA 2F1RA 2RHDA 1Z0JA 3K0AB 2VPPA 2QE7D 2WMNB 3QXXA 2FPKA 2VL7A 3O8RA 2QL6A 2QT0A 3MFYA 4JSTA 4H9GA 4XJXA 2GJ9A 2ZS9A 1TUIA 3BXZA 3CKLA 3A6PC 2ZJ8A 1M8PA 1WF3A 3GJ5A 1KMHB 3IBGA 3ZZTA 1ZCAA 1K5GA 1KZ7B 4EQ6A 3DKPA 3L0SA 3QF4B 3CF0A 3TUIC 1EFHA 3WHLA 2WJVA 3SJCA 4WZAE 3FMOB 2B7BA 3CO5A 4B33A 4YQFA 2WJGA 4RD3A 1NG9A 3A58B 1DO0A 1WP9A 3D8BA 4Q47A 4Z1MD 2C9CA 2QGZA 1NN5A 4I81A 4OL0A 1KK2A 3MD0A 4MUAA 3ZD7A 1Z2CA 1ZUHA 1Z29A 4LBZA 4EJSC 1XDBA 1ZUNB 1CLUA 2D74A 2J7PA 5KNDA 4TZ6A 5FTJA 4PQRA 2IX3A 3E70C 2WWXA 3PQCA 1MV5A 4HZUB 4Q1DA 4R98A 4LHWA 4B74A 4KFTA 4URZR 1K8RA 2IS6A 2XSZA 2O0JA 4C0AC 1XTIA 1SKQA 1AGRA 2R8RA 4HAUA 3TNFA 1WRBA 4HLQB 1G19A 3QXJA 1Z6AA 4MYUA 2FF7A 5G3YA 1JALA 3IO3A 2KJQA 5FOVA 2ZSDA 3JZMA 2GZDA 5AJYA 1SKYE 4WIAA 5H70A 3TE6A 2AL7A 1HUQA 3ZQ6A 3ZZ0A 4GZMA 3D6TB 1BYUA 4Q7MB 1ZD9A 3RYTC 2A5FA 2IYQA 5EE3A 5B57C 1T8TA 1W4CA 2Q6TA 2AK2A 2ZU0C 3VNVA 1E9CA 4N1AA 4QNRA 3TSOA 3K0AA 2CL6X 1G6OA 1ETUA 1S9DA 2Q9CA 4HAXA 3AEZA 3BC1A 5FR1A 2F6RA 2IWHA 3RRZA 3W34A 3TK1A 4IVRA 3ZVLA 1N0WA 2IW3A 5FL7D 2WOOA 1XMSA 1KMHA 2EVWX 4DUGD 4FCVA 3LDAA 1LB1B 1QDEA 1A82A 1E1RD 1ZNWA 2AKYA 5KUTA 3FFBA 4M8NE 1GDDA 3I3SR 4HB3A 4DSOA 2G3YA 2G77B 4Z8YA 3VAAA 1GITA 4Q48A 4UNPA 4B2IA 5FOWA 1L4YA 2RGNA 3IUYA 1YJ5A 3UWOA 3IEVA 2VEDA 2JGNA 2ZREA 3GLHA 1XMJA 3C41J 1XD8A 2RAPA 5FI1B 1C4OA 1QHGA 4F92B 4Q1EA 4EDHA 3K9LA 4EUNA 4A8JC 1JPNA 1W4RA 4TL6A 1EFUA 421PA 1QHXA 5LBIA 2B8TA 4QC2A 4TMXA 4GOKA 4G1UC 4NCJA 4HZUA 1MO3A 5HTKA 4PAOA 3ZJYA 1SXJE 4M9QA 1XJCA 3IKJA 4PC7A 4D80A 1QHYA 3AVWA 1A2BA 2BCJQ 3OESA 4NYJQ 1SVLA 1CP2A 3EWAA 3GQBA 2FJUA 1W47A 1XNJA 2QORA 3P32A 3QPUA 4B43A 2GXUA 4DCNA 2VIIA 4BLOA 2I1VB 2WWFA 2ZIAA 5IK2A 1G18A 1TMKA 3WXMA 2ZR9A 4CEJA 2G1KA 3N70A 2W0MA 4BFSA 3KKNA 2JASA 4ITRC 2QAGB 2DFLA 3AH8A 2QMEA 1FQJA 2OSBA 1E1QD 1TL7C 2HCBA 3SJAA 5L3QB 2BJWA 1Z5ZA 1PLJA 4TL9A 1ZINA 3N2EA 4PO8A 2ASEA 4LPKA 5C46F 1HH4A 1BH2A 3DZ8A 1G3QA 2YWGA 2OCAA 5CLLA 2Z83A 5KDLA 2N46A 2PX3A 3M1IA 3SDZA 3THOA 2ZE6A 1DARA 3PR1A 4KFSA 4YMSA 2JJ2A 2NO9A 3SQWA 3KJHA 4PSKA 3DZDA 2IYZA 3EC1A 4Y0AA 4IEEA 4MYTA 2GBLC 1NP6A 1NNEA 2HF8A 2AFHE 3R9IA 1MO6A 5B58C 4HAYA 4FMDB 2WSMA 4OK3A 1X8LA 2X1VA 1FUUA 3ZYCA 2FGJA 1ZVQA 2GJSA 2XOKA 2V7QD 2ATXA 2AFIE 3X2SA 4CF7A 1HA3A 2DB3A 3B5JA 2LKDA 4E07A 4Q1AA 2MMGA 2YVUA 4PX9A 2J0VA 4BZXA 1F3OA 1VDZA 3LW7A 2BMDA 5CB6A 2QPTA 3AKEA 3FHTA 4LX0A 2E9SA 1CRPA 2IXFA 4BZQA 3EZFA 5CK5A 5EQTA 3FKQA 4ABYA 2WKQA 4EPRA 3H4MA 1QG2A 3BB3A 4LPSA 3KQHA 1B0UA 4OKSA 4FMCB 2DWPA 4TQUS 5GJVC 3QG1A 1J99A 1E96A 5TY0A 4OI0A 3W6PA 4KLZA 3I92A 4DCTA 1LS1A 1TU3A 4E5UA 4HI0E 4IDQA 1TQ6A 2FFHA 2H92A 5CITA 4ZCMA 2UVQA 3CNLA 1GM5A 1VTKA 4FXPA 4P32A 4ZDKA 2NO0A 1T5LA 4ON9A 5J4LA 5L3QA 3AP2A 2JIZA 1HV8A 2F55A 1I4LD 3GLIE 3LWNA 4A4DA 1G16A 2QSZA 3EIQA 4S2EA 2ODNA 4JMPA 5FPSA 4YMUA 1CEEA 3CX7A 2HCJB 3F3YA 1NVUQ 1PLLA 3H2YA 5FFMA 1KIMA 4FI3C 4FMBB 3BRWD 2PLRA 1AZTA 2IS4A 2ODBA 3PVSA 3GEEA 1VG8A 3PEVA 2CVHA 2R2AA 1GKUB 1KI6A 1U81A 4NH0A 4DLSA 1TNDA 1UBGA 3OIUA 4GRAA 6Q21A 2ORWA 2QQEA 2ZRAA 2WSSD 1N5LA 2A3RA 1XP8A 3LBHA 3Q7QA 1L4UA 1ZC3A 4HLDA 2OESA 1KI1A 4DB2A 1RJ9A 4HAZA 4ACBA 3ADDA 1OLOA 1XCPA 3TR0A 2MSEB 4LYFA 4LV6A 1EWQA 3C5CA 4M1SA 4QRHA 3C15C 2NIPA 3DEFA 2ZQ5A 1R10A 3WYGA 5BN3A 2RKOA 1ESMA 2NQ2C 2BJVA 4E22A 2AWOA 3A1WA 2UKDA 4JZKA 1IY1A 3FDIA 1NMZA 3NH6A 3QVUA 5E3HA 2J3EA 2W83A 2JLQA 5TB5A 3W90A 1UDWA 2KB0A 1E0JA 3A8TA 3AF0A 2WJIA 1IN6A 1DVRA 4JLAA 1UPTA 1ZC4A 1CXZA 1HT2E 2VP2A 3QXCA 1XXHA 4CEIB 3CONA 3MSXA 221PA 1IXZA 1E79A 1M2OB 4WVFA 4N0DA 3OEHD 3SE0A 1KI3A 3PUZA 1TQ4A 5L3VA 4C0HA 3R9WA 3RS0A 2DWQA 3HPRA 4EFLA 4EPTA 2RGAA 3SBDA 4V0NA 3AQ4A 3Q9LA 1E99A 4PC3A 3QOFA 1RRPA 1OV4A 2I1QA 2XNSA 4BUJA 3L43A 3CLVA 4CRWB 3R8FA 1DEKA 4TQAA 1XD9A 4Q66C 1ZP6A 1NN1A 4XSHA 1OW3B 4TLAA 2CEAA 1GILA 4KYIB 4OI2A 5GJBA 1QVAA 3TUZC 1VYTA 1YR7A 2CL0X 2WIAA 4G5GA 3L8YA 1NN3A 1XTRA 4Q9LA 2WJJA 1UEJA 4F38A 2W6ID 4JBWA 1HTWA 1X1RA 1OXXK 2C2HA 1L8QA 3EWSA 3B2EA 1EFTA 3K8YA 1G7RA 2QAJA 4I1UA 4L16A 1FL9A 4BECA 4M1YA 4EIWA 3QXHA 1H65A 2WVJA 3VR2A 5FPKA 3LV8A 2ZUCA 2NO1A 3CBQA 2EW1A 3LQRA 3QIAA 2VHTA 4NU0A 2ZSEA 4QBHA 3C5HA 4Q1CA 4NYJR 1P4SA 3SYNA 4LY6A 4QBGB 3AGPA 4DKXA 3ICEA 5SZIA 1SVWA 4A0HA 1ZM3A 4RD1A 2BVNA 2GTPA 2QQ0A 3FHCB 4LK2A 4FCWA 1E2IA 2R65A 3TW4A 1HEIA 2CK3A 3RC3A 4BFYA 5H68A 1U8YA 1G4AE 4TMTA 2OM2A 2ZI4A 1EGAA 3GLHE 3ZZUA 1RRGA 4HUQA 1TEXA 3RABA 3AVPA 4BEJA 1XPRA 4NMMA 1LNZA 3CNNA 4HDCA 5EP3A 5LB2A 2QI9C 1XEWY 1RYHA 4HLUA 4AIIA 4JLMA 1D2MA 1JXMA 3LVRE 3NKVA 1KYIA 5DN6A 1E2GA 1Z28A 2HUPA 2F7SA 4LHVA 2IYUA 4MITA 2YC4C 1KMQA 1XPUA 2JJ1A 4DDUA 2ZRDA 4V0LA 4TYWA 5BQ5A 5IF9A 2JLRA 2XB4A 3QI2A 1FNNA 1S4QA 2QPAA 5HE8A 3F8TA 4B2PA 2W6JD 3E2IA 4OHXA 1KOFA 4RFSB 4DB4A 2J0UB 4DHEA 3EA5A 5H8WA 1OB5A 1XBTA 2BKUA 1NSTA 4BFUA 4YDHB 1DBSA 4US0R 3VX4A 1T5IA 2Q9AA 2BMJA 3U7HB 1OJLA 2GEVA 2WV9A 3DMNA 3EXAA 4OJKA 4TLCA 2ANCA 4IOMA 3RRYA 2NPFA 4MDEA 2IYXA 3UMRA 5FUYA 3AKYA 3C16C 2O8DA 4JKIA 3LH5A 3B9PA 2IYWA 5CYOA 5D3QA 2N42A 2EFGA 3LAWA 1W36D 3SOPA 2J5XA 3OAAD 4ILEA 3N2IA 3ZIAA 2GK7A 2V6IA 4XTRA 3LA6A 1AN0A 5C4GB 4QFMA 2QP9X 1JAIA 1GL7A 3C14C 4GP6A 4AK9A 2OCYC 3HU2A 2WHXA 2VP4A 2K5UA 2NG1A 3OE7A 4JVMA 4RCZA 5BYKA 2ORVA 4UJ5A 1BIFA 1H8HA 4F7WA 5C2JB 3A4MA 3J81k 3BS4A 2OXCA 2EFHB 2HT1A 5FUWA 2Z4RA 5EE1A 3GCGA 1EX7A 1AS0A 4CIDA 4GMDA 3W8NA 1E0SA 5DSZA 3OIWA 1R6BX 3IPXA 4IXNA 4II7A 2PMKA 5JZVA 3EPJA 2HXSA 1IN8A 1DPFA 3ZS8A 2ODWA 4LJ4A 3W6NA 4F93B 4YMWA 2VYFA 3WYAA 1GZSA 1RRFA 4M1OA 4DT1B 2RGDA 4TLEA 1KDOA 1XCGB 1GP2A 2G9NA 3NC0C 1T6NA 4JJKA 2OAP1 3K9NA 2PL3A 4RFSA 3X1ZA 2J0UA 1E9RA 1S1CA 3FKSA 1YZQA 3EZ6A 4LYJA 3W9YA 2PJZA 2JLVA 3SYLA 1IN4A 1BMFD 1E4VA 2R9VA 2NZ8A 4M9XA 2H7VA 1RZ3A 4UXIA 3K70D 3C4JA 1FX0B 3H84A 2IL1A 1N0UA 1QHHB 1AQYA 4B71A 1CJUC 2GK6A 2H57A 4W5HA 4B48A 5JMTA 2D4HA 1MKYA 1N6IA 1XEXA 3EW9A 4ACAA 3I1FA 2WMOB 4IOLA 1W36C 4QGGA 3GLGB 1DS6A 3EC2A 3BB1A 2BV3A 2YKGA 1NJFA 1ZJ6A 2XTNA 2ZAMA 5EUQB 2XTMA 5IRCD 3IEUA 3ONWA 1RC8A 3G82C 4HAVA 2JATA 5D3MB 3R20A 2FV8A 4IRUB 3R7WA 2VSFA 1J7KA 2JJ8A 3A1SA 4KU4A 2QSYA 4QM6A 2O0KA 1LF5A 1T3HA 1S9HA 3RS3A 5CB8A 5JCZA 1EX6A 4P0TA 3BH0A 5B30A 2FSHA 2PZEA 3U3JA 1P75A 5A0FA 4PO1A 2ZS7A 3ZVRA 2BCGY 4W7SA 5ELXA 1DELA 5FBVB 3GJ7A 4B35A 3EZ2A 4KODA 4MKFA 2MMCA 2ONJA 5TVKA 2PCJA 1E32A 4PAQA 5GVRA 4JLDA 3UWKA 3ZVMA 4DT1A 1XXHE 1EK0A 3O8DA 3IQWA 2GXAA 2BM1A 2A7QA 2XB2A 1VHLA 1IXSB 4P4SB 3A4NA 4KFUA 1X8KA 3K53A 3AVTA 1VKJA 2CCKA 1ZIPA 3OFNA 1OE0A 4LUCA 4NCKA 2G88A 1II8B 3RVBA 3EPLA 4MDFA 4QJ5A 2UZIR 4PHTA 2OG2A 4TTPA 4Z1MA 4PZZA 1DAFA 3IHWA 5FBRB 4DC9A 3LLMA 5JJIA 1A5TA 2XEXA 4TSFA 2YWEA 3K70C 4M21A 4RY2A 4YONB 2QMOA 2CJWA 3D3QA 1R0WA 2WKPA 3JVUA 1KDPA 4MRPA 1FX0A 3SZRA 1G8HA 2FZ4A 4LC1A 1GUAA 2GHIA 2AWNA 2BMEA 2F1HA 2XNDD 2ZJAA 2ZVQX 4OHYA 4EPXA 4HB0A 2VHJA 5J4HA 2BMFA 1E2NA 3PUYA 1VCOA 4PFSA 4UXJA 2JLYA 4PQFA 1MO4A 4M9SA 3V4FA 4UNRA 1Z6TA 3B9QA 3DPUA 1KO7A 4FWTA 2FPLA 2CDNA 1XMIA 2VTKA 1KNXA 3GEIA 4URXR 1OHHD 3AF1A 4PANA 4XOIA 4OQFA 4D4LA 1G1MA 1XU4A 1COWD 1G3IA 2P2LA 2ZRIA 2FG5A 1Q3HA 3MG9A 3B1WA 3MCAA 4JKYA 5SZJA 5DH9A 5TDHA 2QP4A 2R44A 1B23P 2FSIA 1MH1A 4O25A 2P5TB 2TMKA 1G9XA 5DLQC 4XWKA 3I72A 4OBEA 2IXEA 2NGRA 2DHRA 1NI3A 3SN6A 1IAQA 4MGKR 1VPLA 2A2ZA 2HYDA 1SXJD 4C0KA 2VQSA 1ESNA 4HB2A 1VYVA 1GKYA 2H5EA 2ZTSA 4TLBA 2OE2A 3PEWA 5DO9A 2YZ2A 5FL7A 2WJYA 3BERA 2W2TA 5FBQB 2BOVA 3ICQB 1MOZA 2GEUA 5LD2B 1E1RA 2ONKA 4Q18A 2QTHA 4Q7JB 5FBWB 2QBYB 2O8FA 4B2LA 5AJXA 1IXRC 1PLKA 2HT6A 2ZJ5A 2XZLA 1G3MA 3DMDA 3RS4A 3X1WA 2H16A 1OSNA 3LLUA 4KSCA 1QBKC 4BLRA 4X8LA 1II8A 1G8GA 1VCMA 2BC9A 2C5LA 4LBVA 4RD0A 4F4CA 1Q12A 1Q21A 4JYCA 4BRUA 2IUUA 4NE2A 3B60A 2ZVPX 3IGFA 2IUSA 1N6LA 4U00A 4A2WA 4DZZA 4D0LB 4DRZA 2ZI7A 4BLSA 4JLOA 4IKEA 5J5CA 3TGPA 3RC8A 2QA5A 4TYQA 4DCSA 1VHTA 4M1TA 5DISB 1TTTA 2VF7A 3A36A 2ZSAA 4MH0R 4MRNA 4JT2A 5BXQC 3TQCA 2XXAB 1NF3A 1DE0A 2G6BA 1HT1E 2WM9B 4I1OA 2IHYA 2WIBA 3I8SA 2PH1A 1GSIA 3ZLJA 5AUQA 5CK4A 1WBBA 2ZRJA 4B3FX 3U6BA 4P4TA 3TUJC 1E9BA 1OT3A 3MUFA 5KSZA 2I4IA 1P60A 4JS0A 3N5CA 1Q44A 4LSGA 1P9WA 4JVLA 1OXUA 4L5BA 1R0XA 2ZITA 1XB2A 3T34A 1UKYA 2RGBA 2IYRA 1EFRD 4JYBA 4R7ZA 3NDPA 2OCBA 4LJ7A 1KI9A 4D82A 3IHLA 5EZ6B 1IJEA 1W46A 3VFDA 2IC5A 3A4LA 1U9IA 3QNUA 2HJGA 2JLSA 5ANRB 4B3BA 2F3RA 1E2LA 3TAHA 5TARA 4KAXA 4M1MA 5K8TA 2YC2C 3M4YA 4D2IA 3EAQA 1SVSA 2F9LA 4LDJA 3TIFA 2J0QA 1E6CA 1SXJC 1W0JA 2CVFA 3ADKA 4P4UA 4CVNA 1F2TA 4PHHA 1KKMA 2H17A 4YMTA 1J8YF 5TXGA 2F3TA 3UPUA 5DNYB 4RZ2A 2JDID 3T15A 1QHNA 3CX8A 3GFTA 3CNOA 5K8UA 2WPDA 2GESA 1KNQA 2BHRA 4UNNA 1U99A 3NHAA 3QBVA 3CR7A 1WBDA 5AUPB 3QPVA 2O8BB 4KBFA 1TADA 1GKIA 1F60A 2C99A 1DTSA 3GJ0A 5FOSA 5L3RA 4D81A 1Z0DA 1S8FA 2GCNA 3F0TA 2OT3B 3QF4A 2QN6A 3UG7A 5G53C 3FMPB 5FOUA 2PMDA 4RZXA 4DLWA 5G40A 4IDPA 1N6PA 2WOJA 2FH5B 3C7KA 4U7DA 3KB2A 1VCNA 4C0JA 1DG3A 4PPGA 3W3ZB 4TZ0A 1R4AA 2CNWD 4IDNA 5P21A 3FWYA 2CL7X 4C3ZA 1G6HA 3SNHA 2IHBA 2RB4A 4B73A 1SVKA 2YWHA 4BFVA 1Z2AA 3U5ZB 3ND8A 1NL3A 1F48A 5BYJA 3G0HA 1OH8A 4M0LA 4Q4LA 3EPKA 4K46A 1YRBA 3ZDQA 2V54A 2ZJZA 4RD2A 2JLUA 1VCIA 4E03A 3M0EA 3KKPA 4OK6A 1P61B 3P4XA 2FFQA 4HB4A 1IOZA 1OIXA 1CJKC 3CB4A 4ARZB 2F43B 3ASZA 1KJZA 2RHMA 2ZRLA 4O0MA 4R2HA 1I4DD 1YZNA 1I4TD 3QVVA 2IWRA 4M9ZA 1L2TA 1R0YA 1XTKA 2YJTD 5FOXA 1KI4A 3DOEA 4X8MA 4DEXA 2C9YA 2QY9A 3KKQA 4D26A 2HXYA 2C03A 4ZO4A 1WA5A 2G1JA 1XTSA 5CDFA 721PA 5J4YA 1M7BA 3BJIC 4MGIR 3GLFB 1TX4B 3BFXA 4P3YA 3P27A 4RFVA 3SYKA 3CW2A 3MLEA 1T8UA 4L4UA 4NYMQ 1IJFA 2WSSA 4D0NA 3CZQA 2O8BA 1ODFA 1NSFA 5AJVB 5K8LA 3GJ3A 4WXRA 2YOGA 1DOAA 1KHTA 3QEJA 4IDOA 2FPMA 3EIHA 4KVAA 4MA4A 4BFZA 1FMLA 2OFWA 1ZU4A 3IPYA 1G4UR 3FPAA 3K09C 4DSNA 1MABB 1KI8A 1C1YA 3P4YA 4IOKA 2AD1A 2IF2A 3WP0A 4LJ5A 1NBMA 4LHXA 3GP8A 2CHGA 5E7IA 1JR3E 4X8HA 1W7AA 1YVDA 1AM4D 4CW7A 2QG6A 4QJ3A 1ZM9A 3GJ6A 5FPYA 4MKIA 2IF0A 3SFVA 4MQBA 3AUXA 4DLYA 4C0QC 4MGZR 3OEHA 5EE0A 1JQLB 3OEED 3T61A 4XWOA 4BRWA 5JFGA 1L7VC 5EXPA 1SVIA 4AG6A 3CH4B 1OH5A 1YRAA 4TTRA 4RCYA 4UNSA 2ZRCA 4Q4AB 3CPJB 4BQSA 3V4RA 2JEOA 1AQUA 1KDRA 1G64A 2F43A 3AVVA 4M1KA 4GFDA 1X8JA 1JECA 2FEOA 3RRNA 4NBSA 2JLZA 1P9NA 2FFBA 3IIMA 3THXB 3GPLA 2P67A 2QAGA 5DYGA 4CT5A 3DM5A 4TLDA 3NBYC 1RPZA 2QEQA 2HV8A 4RJLA 2ZEJA 1Z8FA 4ESVA 5CIWA 4J0QA 1SGWA 4URYR 4C30A 4BFWA 1E4YA 1KO5A 2OAQ1 2IEZA 4IEIA 1JI0A 2W2VA 4KBGA 3RDPA 4DLRA 1W36B 1CJVC 1P6XA 1KK1A 2G83A 1GIAA
chains in the Genus database with same CATH superfamily
3HN2A 3S27A 4BU0A 2GF9A 1RYBA 2CF5A 2YDXA 2YW9A 3N7TA 2HEIA 3HNPA 1N7GA 1PCXA 4IDCA 5CP8A 2KX7A 2B30A 1W49A 2EKBA 1ECFA 3AUJB 4OBBA 1G6KA 3SEFA 4MPJA 3V8RA 4PS0A 5F52A 2I7CA 3K0SA 5MHTA 2H1CA 1H5UA 4IZIA 1H8EA 2PSDA 5T4EA 4EA9A 2VSOA 5SV2A 1OFUX 1XYGA 1MABA 4K6GA 1QR6A 3P9PA 1SCDA 3VR0A 4RQAA 5AM4A 3KZ1E 2OGZA 1QTQA 4E94A 3FYUB 3GFVA 1DEAA 4JOCA 1ISHA 4QGSA 2VTBA 3TEMA 4US2R 4QBIA 3IAS6 4ZOLB 2GH1A 3MAGA 1UOQA 1XQVA 5KNLA 2V7UA 4PQYA 4XA8A 2CKMA 2EKLA 4ZAXA 1GPYA 2RH4A 2PT7A 3K0CA 4OSOA 1B2LA 1H4QA 3EGCA 4I08A 2ZRQA 3N2YA 4L74A 4EAAA 2WVAA 1C7FA 2HPVA 3PQFA 4J7AA 2IU4A 4WLUA 5TQJA 4C4XA 3AB7A 5IC5A 2ZVDA 4ZT2A 3WJAA 1W581 5ALOA 1GU7A 1FP4B 5NLLA 4DXHA 1D6JA 3V42A 2TSYB 4O3FA 2ID8A 1Z6GA 1GFZA 3OF3A 5C3UA 3OUUA 2XOKD 5IS2A 2P91A 1Y3HA 2J6IA 4RVDA 3Q12A 2QRVB 1OR8A 3IR5A 5DI3B 1I7NA 1CF4A 4MLDA 1OBVA 5BRNA 2X7HA 3LCCA 1GNLA 1GT6A 1MEJA 2OZLB 4Y7DA 4DVGA 3FLAA 2F8LA 3RIXA 2UV8A 4Y8VA 3VNUA 4W8OA 3PI7A 1KE2A 3DCJA 3M9XA 4DIDA 1S3SA 4DRYA 3HYTA 2CUNA 1UIRA 5J47A 4X1YA 1N8NA 2C2MA 3VHLB 1QZTA 3NJ4A 5TMPA 2PJRA 5HYVA 1IDN1 2EARA 1A9RA 4QECA 4URVR 2X2FA 4Q19A 4XIGS 3R7FA 5KJ6A 5E4FA 2Q45A 4L8GA 121PA 1NVFA 2IEYA 1W34A 2Q3HA 4DWVA 1USVA 3AUTA 4FNOA 1D8TA 4RETA 2YWDA 1P2VA 1TQ2A 2I7VA 2ORIA 2P3LA 3EY9A 3OEWA 5DNDA 2H5IA 1KDZA 5AQ1A 4NXNB 4Y6SA 3ZE9A 5KO2A 5GZ3A 2XX3A 5M34A 1R9GA 4WZAB 1P33A 3C3WA 3Q3JB 1DAHA 1UMDB 4Z54A 2YJ3A 2JVJA 4TQ9A 3H3XA 1WSDA 3L7YA 1SCJA 1Z0IA 1ZBDA 2B4KA 2XJ9A 3HBNA 4X1IB 3W05A 5J2UF 4V1CA 5KDDA 1XA4A 3OMXA 3I8OA 4WHMA 3UANA 4A3SA 3MF4A 1HNZB 3I4LA 2HRZA 4JJGA 3FSEA 3PBKA 1I7DA 3MINA 3OUZA 2WM8A 2X76A 4BEBA 2DLNA 3G88A 3WGMA 4I99A 1PSWA 3BTUA 4PG5A 4TT3A 4C2BA 5AUOB 5L7WA 1G21A 2VUUA 4UTOA 5EJEA 2GHRA 2R8EA 4BNLA 2XGGA 1LV7A 1XAIA 5BVHB 2VNAA 1E7YA 2BZ0A 2VSXA 1T4GA 1ORWA 1LJLA 3E9QA 3M9WA 3ZH9B 3J80A 5ECYA 2QLMA 3K94A 2VZ0A 3BXFA 3MZ0A 3D43A 4PC1A 4CKEA 4ETNA 4YT2A 5D7NA 3KYDA 3UH1A 1ZO8A 3P0EA 3RREA 4CEIA 3OOJA 3MUNA 2JFBA 4XR9A 4WY8A 1SKYB 1TK2A 1SUAA 521PA 5IVDA 1B6SA 1ENPA 2J1LA 4M7OA 1AVTA 3QTLA 1UC5B 2I22A 2V96A 1KVTA 2QZZA 2VEOA 1K1EA 1U2SA 1WABA 2YJ4A 1SH7A 1UMBB 1CKEA 1VECA 1M0TA 2A88A 1Q57A 2W0SA 1T29A 2YY5A 4JJEA 4RIIA 4Q9AA 4Y2UA 3R8XA 5AKHA 3V8EA 4B6FA 4D3ZA 1C30A 1HTTA 3MJSA 4I7EA 4XD7D 4FBLA 4FXOA 5K6TA 2QLJA 1S8AA 4BNTA 1DJMA 3GCDA 5JMPA 1NT4A 3QYFA 1VJ1A 4W82A 3V7WA 9MHTA 4RHUA 1W0KA 1B00A 4HS9A 4V02A 1CDDA 4B4WA 1D1PA 3HBJA 1RJGA 3H13A 3KL4A 5J1SB 1B6RA 1Z83A 1MC5A 3KEOA 3FCAA 1HE8B 1DO2A 4DYHA 3NW9A 3IEMA 3L1HA 1QPGA 4BVFA 4EJSB 1WSAA 5DI9A 2ZB3A 2R7LA 1QQ5A 5BV0A 2DPGA 5J2UB 3KS9A 4DYDA 3WDLA 1KOJA 2Q6VA 3KJQA 3OOHA 3UOWA 4W5TA 2V9PA 3D6JA 3ZVKA 1JFRA 3GDOA 3S70A 1YZLA 2C9OA 4DBLE 5J4VA 4DTIA 3LQQA 4RXUA 4EGQA 2OFOA 1RC0A 1V47A 1SIUA 4UUPA 2BFOA 1VG1A 4ABTA 4H3KB 1V8ZA 1U0BB 3CX4A 3LUBA 4Q9IA 4CCSA 3NBXX 5BNTA 3QYAA 5HILA 3U17A 2W8BA 3T7JA 3GJ8A 3LYAA 4JEHA 1ZH8A 2ZSIA 1OF1A 1ZOOA 4PPNA 3I04A 3NP9A 1FTSA 1NKVA 3RSOA 1NBME 3IVMA 3JVDA 5FBZA 3HYCA 3LLVA 5DYIA 1DAGA 4M8SA 3DF7A 2YRXA 1Z6PA 1IU9A 3U49A 4D25A 3L46A 1TM7E 3PWZA 1G20E 3UGTA 3GA5A 1JSZA 2Z09A 1VE1A 4CG2A 4YJHB 4Z49A 4AG3A 2OBBA 5ENVA 3VR2D 4XX1A 4B7XA 4KR3A 1ABBA 1I6MA 3DZBA 3E58A 4TLLB 3IQFA 3VM6A 3N2KA 1GZ4A 1LK0A 4ZVSA 3VU9A 2LE0A 1Z0AA 3K2EA 2R6R1 4HXGA 5KVCA 1XZDA 4D3SA 1K98A 4JYAB 1XAGA 1O96B 3OJWA 2JFHA 1L1EA 4NBUA 4L4YA 4WN9A 5BVGA 3FB4A 3IR6A 4BJ6A 3BSSA 3N3AC 2GVDC 2H1VA 5CW1A 2XJ4A 3EODA 3A05A 2W71A 1Q1ZA 2AX4A 2RSLA 3ANXA 4OB6A 5GONB 5LIPA 2I3BA 5JZMA 3IP7A 4MW6A 5A06A 1QGZA 3ADPA 3K0CC 3MJCA 4GLOA 4MV7A 1VCHA 3I6YA 2BDTA 3MJHA 3PIRA 4QNMA 1V37A 1XZPA 3HCRA 2B2XA 1KC1A 1H0SA 4JLNA 3PHHA 4KO1S 1M72A 3D7SA 4CM9D 4MQLA 5JDIC 1CY7A 2XNDA 8OHMA 3BXOA 2B21A 2RHLA 2NXJA 3R7BA 4D9IA 1PD1A 1V5GA 1D2GA 2H1FA 2QGFA 2D2IA 2AFHB 1FDIA 5F33A 2A5LA 5JG7A 5K2MA 1Z63A 1GPLA 1WY7A 4ZCRA 2ZR0A 4PPQA 1T6XA 5KWVA 3HYSA 1T2VA 4QRDA 4LJYA 3V1UA 1N77A 4PSAA 2QRHA 1O58A 2H7YA 1MHTA 1L4LA 5DM60 2XDQA 4HVTA 4CL8A 4PBTA 2VPZA 4G9BA 1T1EA 2BLLA 2FLWA 2GPNA 4FX2A 3T1QA 3UXMA 4Q3DA 1ZJWA 3DULA 4B8WA 3KT6A 4Z2YA 2NUAA 2J9GA 3KDAA 4A6PA 4ZDJA 2OBLA 4PWZA 5A4DA 4LIPD 1L3BA 3LTNC 3ZTYA 4O2AA 3BD9A 3SZUA 5L6MB 1LX7A 4GVLA 4R3NA 3ANTA 4NP6A 4GYKA 4B83A 4LNAA 2QTTA 3FJ1A 1SHKA 1WDTA 3GLSA 4HRAA 1ZFNA 2H2GA 2NWQA 4LV5B 4O4JA 4R2JA 4J3FA 5EJGA 4DANA 3EZ9A 5B3JC 1ID1A 3HBFA 2GCOB 3EXFB 4PE5B 4EFMA 3R76A 3IBTA 3DS8A 3EARA 4Q93A 4Y1FA 1RLOA 2QE7A 3AT1A 4D7AA 3QF7A 1HMYA 4FJ1A 3T94A 4KQKA 4ZK6A 5LQCA 1Y6RA 3GDGA 3SE7A 4KDRA 2O5RA 4R9SA 2PV0A 3NTLA 4MGYR 4JJ8A 1VRVA 2O2XA 2QJFA 3OY7A 4QPJC 4KGVA 5JZOA 4YRTA 2GMWA 4GPTA 4ALMA 4CKZA 3RAEC 1B6GA 1W76A 3RUEA 2B7CA 4BNWA 3U7GA 3O31A 3UKDA 1ZIOA 2FLVA 3PYMA 1E94E 1NPTO 4OUDA 2Y1WA 3HRKA 4QHTA 2GLTA 2A1UB 2IXGA 3PEUA 1AOXA 4XM0A 1LBIA 1UAGA 5IYZA 1N5IA 1J8QA 1NJSA 4RLQA 2RHOA 4WZBE 5M7EA 4AKHA 3F67A 3G2JA 2OYRA 4X1OA 5HF8A 2VPTA 4UTVA 1RWKA 5BYAA 1CY6A 4YRLA 3QFHA 5U9CA 4MR9B 1QK5A 2XKAA 3SYTA 1R8QA 3F2VA 3LFUA 4YO8A 1MAHA 5BSWA 2Z4TA 3OJFA 2WY2D 1ZGJA 4TWBA 3MPUA 1QGED 3P26A 5F9FA 4DV4B 1ZPDA 5DXAA 1E4EB 2IYTA 2PUEA 1XDGA 1OIVA 2DFNA 2EYQA 2O3RA 2R6DA 2MSWA 1G98A 4WV3A 4NYIQ 4XASA 3KU4A 3ZCUA 2NTEA 3ZHZA 3A70A 5DHRA 2VWGA 3EIWA 2Y99A 4FC7A 1X39A 4HDQB 4WZ6A 3QUBA 3DHWC 4CG3A 2QZ4A 2X5NA 2HI0A 1TA9A 1N2EA 3I5MA 4I9HA 1JQBA 2VRWA 3NGXA 4HWSA 4H1WA 3VC7A 1XAJA 4E7PA 1AQ6A 2Z57A 3WK9A 1JBKA 1JJ7A 4BO5A 5C4MA 1JJIA 1XPJA 1MQSA 1WV0A 3IT3A 2Q3DA 1HO3A 2RGGA 2X8JB 3FKSD 3QFFA 3UYLA 4QGBA 4UDNA 3VOTA 3IDSA 4BTEA 2H51A 1I2DA 4MVYA 1P2DA 1RZUA 1XWIA 1BXKA 3VDRA 4BGVA 4LFBB 3TFWA 3ZZNA 1S6YA 3EDCA 4OAQA 1GGEA 2QZSA 4O0LA 4Q4JA 1P4HA 2AOUA 4I1VA 2ODEA 5B3AA 3RSCA 3U3RA 5A5GA 5DNUA 3F74A 3KXIA 4RA6A 4LF9B 3IP8A 2EGGA 3N28A 2YZGA 5A4JA 1MX1A 3GLKA 4G3XA 1CD5A 1ULUA 2DBVO 4P7FA 1T8PA 3C4VA 4AZ0A 2A0UA 3N1UA 4EO7A 3LT2A 2CMGA 2OCPA 4YP9A 3RC9A 5TNXA 1FMJA 5SY9A 4ZEMA 5I4IA 1AGYA 4J16C 2O3UA 2V5VA 2VK8A 1IBRA 4I4CA 4C1NA 1Z2DA 3BDAA 2Q8NA 3RHZA 5I7HA 5BWLA 3U6KA 2C04A 1RC1A 1XRSB 1YWGO 1P62B 2VP6A 2W4IA 3R3WA 3NC4A 2GBLA 1UFQA 4RF5A 4DJTA 4W9NA 1VGQA 1TPYA 3GJ4A 1DIAA 3DMTC 3B5IA 2XTAA 1GPBA 4FN5A 4HH0A 2E6KA 4ERXA 1YB5A 2KYRA 4ALLA 1USWA 4H1HA 1YMUA 4D5GA 3T7IA 1Z5GA 1UOEA 2VLIA 1ZMRA 4BKQA 3WY9A 1HYGA 2GR9A 2LIVA 5AHKA 2VP0A 4CN8A 3OICA 1ZJJA 2ID7A 5BSUA 2XUHA 3DBOB 4QTXA 2C9BA 3DL0A 4EHIA 5AVRA 2XBMA 1P80A 1P2UA 3AINA 1XTVA 1IBMB 2PLFA 1XRRA 4EF6A 3LRPA 3DEIA 3KPJA 4NESA 3PCRB 2VJOA 1KIAA 2XXBA 4W1SA 5JFOA 3KQUA 3U19A 2HX1A 4LOJA 5BSHA 5F21A 1THGA 3MRSA 1UJCA 2NSDA 2QNRA 2UVDA 4AJPA 3N0VA 4K9LA 1QHFA 2PVPA 3BB4A 1JDSA 3DBHB 1JNYA 2ZANA 1W5EA 1JJFA 2VJKA 3G0DA 1TW2A 3LT1A 4ER7A 2Z6AA 5A0VA 1KZ4A 1RXYA 1X1AA 2K2WA 4NEQA 1S3FA 3I2HA 1D4FA 2C7VA 2FXIA 4HWRA 2O7NA 1CETA 1D0IA 4IIDA 4R7GA 2UU9B 2IY8A 2PFSA 4NFYA 3NHZA 1WCXA 5JO9A 3WP1B 3RFXA 4N0EA 5EJ5A 2VKTA 3JVIA 4I4LA 4QTUB 2QAIA 5E38A 1E5QA 2C4NA 2V59A 2Q5EA 3LW8A 4HDNA 1U3CA 4HH1A 4IWYA 1E1QA 4TSFD 1FP1D 4HQKA 4B84A 1FZQA 1XDZA 5JRDS 4B32A 4I55A 2GK3A 1ZSVA 2A4MA 3OCYA 2DWOA 8ATCA 2VBGA 1JL3A 1WSBA 3IMFA 2QL7A 1XQYA 2PBLA 1EK6A 5JTTA 1JKFA 3JRXA 1OWPA 3HU1A 5K03A 3SJBA 3BK7A 4N7JA 4MQ5A 2NAFA 4J1SA 2JLXA 4OHVA 5SYNA 2PZFA 4O2LA 3WSVA 4F72A 1GTVA 3GCWA 4N48A 1X19A 1E9DA 1LV8A 3D4NA 3R44A 3OFJA 4MV8A 3W06A 5AW1A 1IQUA 4MPDA 2JFYA 2VR1A 4CGYA 1SBHA 1CFJA 3IL2A 1KSJA 5JQGB 4MS4B 3V9AA 3L6OO 1KTIA 4MUNA 5U4QA 4TMVA 1Z18A 2QBYA 2W6CX 2CWWA 1B6TA 3UATA 4CL2A 4CEJB 3T1VA 4J4TA 2VDWB 3X1KA 2P6PA 1LS6A 4A82A 4ZYXA 2IZ7A 1DC4A 1BFKA 1JDPA 2FJPA 3HB9A 1HRDA 1ZRNA 3ZU5A 4EQZA 3K4QA 5E7JA 3Q98A 1M10A 2O5VA 1UEIA 3C39A 5BW8A 3ET4A 4EBBA 5EKUA 1AQJA 3JQGB 2EFDB 3F3MA 5DM4A 5LQUA 1KZ6A 4J0KA 1GPDG 1KZGB 5CDSA 2CY0A 4FJ0A 5I7VA 1DWQA 1GN9A 3DBRB 4LJRA 4TV8A 1UT6A 3M2TA 1FDUA 1E2DA 1BGXT 1L7OA 3OEEA 1P81A 4ID3A 4KFRA 3FA2A 1GGVA 4IFBA 4R8VA 4AW9A 1GVNB 2TYSB 4U2EA 3AFGA 1A1VA 1XFDA 3HKEB 3PI6A 1T8WA 4MW9A 4V2IA 1YR6A 3UK6A 1DP4A 5AD1A 3V80A 4JB0A 1Q0SA 4KV9A 3WK4A 2G63A 2ZYUX 1Y9JA 3B3GA 1NYLA 4EW2A 4XPIA 1EG2A 2D1TA 2D0OB 1EXMA 1UEXC 4J9UE 5DTRA 3T3HA 3E9RA 1E2FA 3WSTA 1D5CA 5KU7A 4BFXA 5CH3A 4N3NA 3AV0B 2O1WA 3PQ6A 2Z6QA 5A7GA 1M2GA 3QX7A 5EE5B 4PWYA 1DWUA 4OGGA 1FQOA 2NOAA 1ZYUA 1OXTA 2XQGA 1IG3A 4MPTA 3I2KA 4NZ9A 3LDFA 1VPEA 2Q99A 2PD4A 2FNAA 2DKNA 1MC4A 1I0IA 3A6HA 3ISVA 4J0EA 5EIAA 4E15A 1TTPB 2XA1A 2Z0MA 3CUEF 2MDTA 2H29A 3KELA 4GPEA 1PTJA 1S3GA 4JI2B 3JQBC 2OHGA 3JQCA 3C6KA 1MB9A 1XQ9A 2CYBA 1HE4A 2X2EA 3OE1A 3WLKX 1NTRA 3RROA 4B76A 1P2GA 1T0HB 2D1FA 2MYPA 3FPLA 3L0OA 4MAMA 2QRJA 4QU8A 3UMSA 5FORA 3VHXA 3OPYA 3LX5A 2J4DA 2I2FA 3A4TA 3HN6A 2IT1A 2GZSA 3WKAA 1YS7A 2OLJA 5JHHB 3TXYA 5CB4A 1XVAA 4G0ZA 1FYDA 3TDMA 2HMYB 1ZI9A 2Q50A 3BFVA 1YU9A 4YS6A 4BZPA 1L7RA 3TVTA 4YUZA 3QX3A 5FUVA 5IAGA 3L1KA 3TRHA 3HY6A 4B6GA 1WLYA 4FFBA 1ADJA 3VUFA 2BGWA 4BLQA 3PEEA 1BQEA 1W0JD 4JT4A 1SEVA 3LT4A 1Z36A 1C50A 3ENKA 4ZHQB 4L8LA 4B46A 4JI7B 4FBMA 1KJ9A 1TEHA 1R27A 2P6UA 2VHQA 4PNPA 5BUQA 5AVQA 4KLAA 3NQ41 4XCQA 4PXSA 4UMDA 5JCJD 5H82A 1WXQA 3EIEA 3LDHA 1FNMA 2BFWA 2PTGA 3IE2A 1K3UB 1LUAA 3W4IA 4ZO6A 1PI3A 3HJTA 3ZNPA 3CRQA 4LEIA 3CZCA 4GHWA 4TMWA 4LOLA 4BKUA 1JT2A 3GRVA 3QKWA 1UZUA 1YXMA 1DLIA 3ILVA 1KY4A 1L7NA 2WD8A 3NTOA 5FADA 2ZUTA 5EAIA 1WUTA 1XELA 4MSUA 1RYYA 3NTRA 3GLGE 4WNYA 4R8SA 4R8RA 5TMDA 3N5KA 3SEAA 2LVBA 4RQBA 2FP3A 1OU0A 5SYAA 1Y81A 2OA0A 3ZKWB 3CQ9A 3L07A 3R6LA 4ZQBA 5I7UA 1LEHA 2GWHA 1U90A 4NOJA 4ARZA 4EH1A 4POAA 5LQMA 3LUPA 3Q72A 3FNFA 4YCMA 2A7XA 2Y0EA 4AKEA 3BSWA 3PU6A 5AVVA 4YR7A 3O2SB 4MICA 1Y1RA 1W4BA 4II2A 4ZI5A 3TPCA 3LWBA 4QXOA 4MRSA 4CGZA 2BFMA 4PG7A 5JJLA 3ZZ1A 1BWQA 4IRXA 4OM7A 4X64B 1KP9A 2AUNA 4U2DA 5REQA 1PHPA 1U7PA 2NUTB 4P82A 2R8ZA 2FDRA 2O8CA 1P0CA 3E5HA 1W85A 3H8WA 3SX4A 3GLFA 1NOJA 4YDQA 1BAPA 3QUAA 2R6HA 1TZ2A 1NVWQ 1S2MA 2P9EA 3A2MA 3I58A 4IM7A 2O8VA 5G3ZA 5DHFA 3TVDA 3VR4A 4DA8A 1M1YA 2ZBEA 3ZEIA 2YWXA 3SEZA 3MWKA 2H4YA 4LG1A 4BQPA 1JEJA 1KZ1A 3D5QA 3QBTA 4OO3A 5BQPA 5BORA 4LRYA 4XEUA 2HH9A 3MWDA 2DWUA 4NR0A 4D3XA 1P1KA 1RQ7A 3DQQA 1OGJA 3SM3A 1E3TA 1SO8A 1ZD2P 4CMEC 3BIJA 2FUKA 4I3HA 4MVJD 2V1XA 2WTNA 1CW2B 3OQIA 1UDRA 3QE4A 2P9FA 3R24A 5G0WA 4OQZA 1K6JA 5E0KB 1SULA 5DCUA 3F5FA 4A0RA 4PCUA 5FTNA 3GFRA 5BR7A 2HCRA 3AJ8A 1ICEA 4ZI3A 3O82A 3LOUA 2KSQA 4RESA 3P8ZA 3ZGNA 3FTQA 5HE9A 3IURA 4JKOA 4NATA 4MB6A 1KKUA 3JZDA 4O1IA 5EJIA 3UAOA 3F4LA 4RMJA 3U2QA 4BL5A 3VI3B 4CMIA 4CTKA 3SXUA 3I9JA 1VKZA 3Q7IA 3FUXA 2AKAB 1BXRB 5T4HA 2C58A 2PGAA 3CISA 3MJRA 2LNDA 3G8YA 4PZLA 4UE2A 4YP6A 4O4LF 1KF0A 4X65B 1K7CA 1YI0A 1GXSB 1RWMA 4M1QA 3N86A 4ALNA 1U0TA 1ZGBA 2LW7A 3OZUA 4OMFG 5J23A 3OQOA 1HSZA 4XD7A 5T8KC 5IABA 4ZCTA 4MJLA 2M1ZA 4FHEA 3OCJA 2Q5OA 4PQEA 4ER5A 2Z8YM 3ETGA 1Z73A 1OY1A 1KEKA 1QCYA 4Z4FA 1MBZA 1P9RA 4OQDA 2YIJA 1RE0A 3EJ6A 3KQSA 1NBMD 1QGAA 4PZAA 1EFPB 4C5BA 2PNFA 4RF2A 4TKZA 4QJBA 5DPMA 3WNBA 4BQRA 4QO8A 1J70A 2E3JA 3REQB 1QIIA 3RT1A 1J8MF 5ALZA 1FFEA 4U2FA 4QDJA 1XNQB 4KQ9A 4QYIB 3R23A 1DRKA 3QLUA 3O3MB 1CR0A 4HN9A 4BIIA 1JEEA 1JWLA 1SG0A 2P5UA 2YV3A 3DVLA 1FVXA 4CLRB 5G4LA 3V3TA 1P6QA 4Q1BA 4W5JA 4ZZ0A 5BN5A 2O19A 2H4WA 4Q1FA 1AKUA 3GEHA 3ER9A 1K66A 3DOIA 4NZZA 4A6EA 5IM4F 5GADl 1EUYA 1SC4A 1TO1E 3UMGA 2FQWA 1V7CA 2YX1A 5LZ5A 3HV2A 1DQYA 3GAZA 1RFGE 2BY4A 2GD6A 3CZAA 3E23A 1I2CA 3GEGA 3IMGA 3V00A 1DAIA 3HP7A 2AMVA 3IKVA 3UOGA 3QMPA 4CL0A 1MNAA 2R2GA 3EXEB 4N65A 3RANA 3EYWA 2I3ZA 3A1UA 3R0VA 3Q15C 1I51A 4AECA 5DX0A 5JAOA 4PLFA 1KPGA 2DR3A 1GPJA 2ZIEA 3Q8KA 3JR7A 4X61A 4CTNA 2NTNA 3AEKA 2JG3A 3K9GA 1MIHA 4NHOA 5AJUA 2FFJA 3CZRA 5AW5A 4IG9A 1A8IA 4WLFA 3EG5A 4WACA 2EX0A 5F76A 3THRA 4NKRA 2J0EA 1FYEA 4JP2A 3WO1A 3ZLVA 3DQPA 3PA6A 3D3KA 4B17A 4LI3X 4CTOA 4NFSA 5CJPA 1ZN7A 4LVCA 4PGFA 2B8NA 5AK0A 1LPOA 2G0TA 1ZK3A 4C4OA 4J0JA 1PK7A 1FNBA 2B36A 2LKCA 2Z56A 1MO5A 3SF8A 2QVGA 1F20A 2CD9A 1JA9A 3CLHA 2W6NA 3IX7A 3MS4A 4IGKA 1GUDA 3KXKA 2IYLD 3OZSA 5GOTA 3CVUA 1PEKE 3A6FA 2KS6A 4GIBA 5ALDA 2OKGA 2ZYTX 3TLXA 1W0CA 3QKTA 4P6VF 4FNMA 5DHSA 4JBNA 1CE8A 3CTPA 3NONA 2OM6A 1EK1A 4J49A 1QG6A 4PHCA 3A1DA 2B99A 3PJRA 4BCDA 3A7EA 5C8YB 1X94A 2IK8A 3T5CA 1GRQA 1CS4C 3KUCA 1GTL1 3B89A 2RGWA 1PQ4A 5EJMA 4CM1A 5H3LA 1G9SA 1ADFA 1SIOA 2BHSA 4TYYA 2G0NA 2B0JA 4EB6A 1T25A 1NY5A 1R5BA 3E3AA 4MP6A 4J3NA 3VDNB 1RI4A 4FKMA 3ZYCA 1CU1A 1DFIA 2XZPA 3FVWA 1BX0A 2WAYA 2WWYA 1PJAA 4A10A 3BKWA 3QA9A 2BN4A 1VKRA 3KXLA 5IJAA 3EXIA 3CF6R 9ABPA 5IANA 2ZM5A 3LDUA 3OP4A 3CS3A 2I6UA 1IZ0A 4CV2A 3X1JA 4IUBS 4RSHA 3W6OA 1L5GB 1PGJA 1QGUA 2V7VA 3BMXA 5E1MA 1CP3A 1E79D 1T5DX 2BFBB 3EOBI 3FGNA 4IG4A 5K3FA 5BN4A 5JYEA 3T1YB 4ROTA 2H5JA 1NR1A 2O0HA 2QUHA 2FKNA 2PNJA 1ZK0A 2QJRA 1U0LA 1PV4A 1GDTA 1I7PA 2GN6A 4HGRA 4BNNA 2QB5A 1X2BA 1FUIA 1EM8A 3ESRA 3I12A 4JI4B 2WWIA 1T2DA 3VKGA 2YHSA 1TZJA 5JXGA 2KE5A 2Q41A 4OJMX 5KX5F 2BGLA 4HDOB 3FPJA 3MBOA 1NBAA 1NIJA 2ZS8A 1VLZA 2AR7A 2JFQA 2F3UA 3KX2A 3MTBA 3NAMA 5E9JA 1NVEA 2P2YA 5BUSA 1PTKA 1TPZA 4W6QA 1NE7A 2BFFA 2D1SA 3COVA 2NU8A 1H3EA 1XEXB 4F5DA 2RHRA 4CG0A 1VE7A 1W5AA 4G8CA 3TWOA 5CFPA 3EA0A 4AP6A 3N8HA 4QTYA 5FPHA 5EQJB 1VP3A 4PY2A 5CDYA 1A7JA 5HJ7A 1BCSA 1TRKA 4GH5A 1M0WA 4EYGA 3Q85A 3MAAC 2XAUA 1IM2A 3IIEA 4KYUA 1M1XB 1HBJA 2Z95A 3BFJA 1J2YA 4Q4HB 2H4JA 5CDUA 3VR3A 3DE0X 4MXDA 3DFMA 1M6WA 3BF7A 1EJ2A 4DJAA 4LF4B 4QD3A 1T0IA 3R7WB 4DV0B 3GBVA 3IDZA 4JGBA 4MROA 1SQ0A 4URWR 5SYMA 1IQRA 2A35A 3CLKA 3WNDA 4F2DA 4YJDA 1Z6QA 3PHCA 4Q9DA 2WD9A 1WXIA 5COBA 1Q0LA 4PYLA 4XUCA 4CLEA 5LP1A 4FUTA 4F2HA 4RXMA 3CYFA 4HMQA 3NHKA 3SDSA 3BQMB 5JEEA 2NZJA 3E5NA 1ILWA 1VHWA 3IS3A 4MHSA 4ZT5A 5IFLA 2DH5A 3LNCA 4GNKA 4DLXA 4HAWA 2WTAA 3O83A 5E4JA 1G7TA 2W00A 3EPPA 1VI6A 3PNPA 4EKYA 1C9YA 4JBLA 5EMHA 1LLQA 1S89A 1E63A 4JI8B 3ECCA 4HF7A 3TKLA 2D2EA 5HRCA 2R48A 1NXQA 4AMZA 2WAXA 1VE5A 2EHJA 1UPBA 1XDSA 4GAEA 2AYYA 2EIHA 4EEKA 5LB4A 1J0CA 4JFRA 5AKGA 3PHJA 1G291 1P9OA 5EFOA 4DCUA 5HKBA 1G9TA 1NATA 4X8OA 2JJ1D 1Y5NA 3T4EA 3RFUA 4COKA 1JHQA 3PXCX 5L3SA 4LJAA 1CR4A 1VPTA 2CXOA 1M67A 1UJ2A 3ZU6A 5KQRA 1UBLS 1P74A 4WFKA 3T5GA 4QASA 1FMCA 3WHPA 5F2NA 3CRVA 4ARCA 1E8NA 1BVRA 3QITA 2CJWB 1RQNA 3G9QA 5LCXA 1NXSA 2R6JA 3P7MA 2GUWA 2OQRA 3G9UA 5BOVA 5WRFA 4DAEA 5JSZA 5KKCA 5FYDA 2W6ZA 5ICCA 3LX8A 4A6XA 2C31A 1SD1A 1UKEA 4FSDA 2D06A 1HWYA 4V0ME 1ZR4A 4JXJA 4HDSB 2OHFA 2CLIB 4DMKA 4H16A 2E4WA 4G23A 2PCLA 4LSZA 4KVFA 4XZ3A 1H2BA 4M55A 5CYPA 3ZW8A 1D03A 3NTUA 4R81A 2PL1A 5CG2A 5CM8B 1KK3A 2BEWB 4TMZA 2WE8A 3FDZA 3ZWWA 5EE9A 4BLTA 2O54A 3NXKA 2YZMA 3PX7A 2HDNB 2W5UA 3HEAA 3KQMA 1Q20A 5E6RB 1N2OA 3KQKA 2HJVA 1PZNA 1ZDMA 1CS0A 3KJZA 3NTXA 1Q0QA 5I45A 4XYBA 3GZNA 1KYZA 3DZCA 4RHXA 1KAQA 1AZLA 2ODPA 1USUA 2L17A 2PEZA 4RK6A 4IVNA 5DE3A 4NY1A 3VPDA 4PONA 3T1TA 2QXYA 2WA2A 1T36B 3NR2A 1DADA 2JD2A 5JNLA 2WWVD 1UBRS 3A25A 3AG5A 3GX1A 2AXEA 4B4UA 1JBQA 1I7LA 1DMRA 2FZVA 2QGNA 1N78A 3HU3A 4AWXA 2FMFA 2RFLA 4MMZB 1BHSA 1Z07A 3QYPA 2A9KA 4OQEA 4C9BA 1TQDA 2LTAA 4G1VA 4BMPB 4QUDA 1FDWA 3IMEA 4GSYA 2PTHA 3TJRA 4IO1A 1E77A 2LDBA 3S81A 2FPPB 3UYKA 3HQ4O 3MOGA 4K8OA 4F21A 2A33A 1G0OA 1DHRA 3PXBA 1KSGA 4ZJUA 4IDBA 1GFSA 4D4KA 3I5XA 4MWDA 2TMYA 1GDHA 4YT5A 3ZCTA 3H2ZA 2O1EA 1R8JA 4EMBA 2DGDA 1VLVA 4XB2A 3TKYA 4RHYA 4YJ3F 2XOXA 4EKDA 1PDOA 3KJEA 3NKLA 5HOEA 5IT5A 1LWNA 5T5QA 1NLYA 1G41A 3S1AA 3WBFA 3A1CA 4H7FA 1Y4UA 5CVUA 3PQDA 2QJWA 4K9SA 1UC8A 2W2QA 3K31A 1KP3A 1DBQA 1RBYA 1USIA 1V11B 2AXPA 2P9JA 3CZPA 5JLAA 2V0GA 1YNSA 1Z0KA 3CR3C 1YS9A 2JIPA 3LUCA 3OPNA 2WI8A 2AOWA 1ECBA 2EC5A 1WU7A 1GTG1 1YHYA 3G9ZA 1XLVA 2BMWA 3L82B 4DA6A 1Z26A 5CM2Z 1D2EA 1MRSA 3N8KA 4X6YA 1MO2A 3GP3A 1U0HC 1ONNA 1QIKA 3ASUA 2FK7A 2W6MA 3MMNA 2ZRFA 3AFHA 1FMTA 3LXRA 4CCAA 4GWGA 1O3YA 3DW3X 4YAIA 5CDHA 5KNBH 1J22A 2Y9MB 4KDEA 4AO6A 4YH1A 4I9FA 4DJEC 4ENSA 4K6CA 2OHXA 3AL2A 2Q3EA 2BBWA 1Q0TA 2YVLA 1SOWA 1AGXA 1SKAA 3CFYA 2QYSA 3MK31 5FNZA 3GLIA 3UK7A 1IUNA 4KDFA 4KMMA 3OLXA 4FFPA 3HO6A 4N9QA 4U7PB 4OUKX 5FX2A 4RADA 2CCJA 4Q3EA 1KJYA 2WWHA 4WNIA 1UBCA 4RTMA 4LY9A 1FS6A 3BWCA 1UM9B 1JVNA 1OCEA 4K28A 1F2TB 1AMUA 4V0OA 4NJEA 2XMBA 1JB9A 1OFGA 1P5RA 3WMXA 3HVKA 3E15A 4HNAB 5C18A 1FE8A 1MVNA 1FFDA 4TKLA 2CNWA 3S2FA 1Q6ZA 4H77A 3OIDA 2IZ1A 4Q3OA 2ZBVA 4JHLA 4RSGA 3OWOA 3ABZA 4JLBA 1XZIA 1XDDA 5MDHA 1N2SA 3ZJ4A 4QEKA 3UY4A 2OV4A 2D0PB 3E1GA 4ZALA 1C7ZA 2OK7A 2Z1NA 4MUXA 4WDRA 1SUEA 1WB6A 2GN0A 4JSTA 4RANA 2W4MA 5AHXA 5I9BA 1QP0A 4DJDC 3V48A 1RRKA 4FGJA 1KMHB 1NUSA 2DR0A 3ZWXA 3ZZTA 4JWKA 2FW8A 4D4HA 1K5GA 2FN8A 3PC6A 4YEDA 4PX2A 4KTVE 2XVZA 1B8OA 1JFLA 4QXQA 3CT4A 4N18A 3FMOB 3CO5A 3DFFA 3ICOA 3P71T 4MVWA 3JWJA 3WGJA 1E7MA 1G2QA 3IXMA 2DY0A 5H80A 3RCBA 1CNEA 1DO0A 1TYBE 5JVDB 4ZTBA 3T5MA 5CA1A 4MS3A 2ON6A 2DPMA 2QGZA 3KK0A 1UBNA 3QU4A 1XHFA 1PDVA 2FCAA 3C3YA 4D1YA 1QIEA 4PSDA 4X6UA 3CVXA 3OJ0A 2ZIXA 5LP6F 1ADGA 3ZD7A 4LECA 2ZOSA 4LBZA 3PCTA 1ZUNB 2D74A 1CY1A 3DC2A 1KAEA 5LZ2A 4QUGA 5FTJA 3SHTA 1JEOA 4PGGA 3UEOA 6YASA 2WNSA 3E70C 2WWXA 3PHIA 3PQCA 3EUFA 3QI7A 1F8UA 1ZMOA 2BTQB 2C9MA 4H2DA 3KR2A 2O0JA 4CF6A 1XTIA 4F4DA 1T5BA 1K6XA 1P45A 4X7MA 4I4TB 1VJTA 2ZLBA 2JBAA 1SCNE 1GVHA 3EIUA 4MYUA 1IHDA 3DR3A 4KXNA 3IO3A 4JP8A 4QOIA 1H2XA 4QYMA 4EKNB 5DKFA 3UJPA 3L8EA 1NI4A 2E4ZA 2PZAA 3J81A 4PLHA 5KTRA 3GUCA 3CCBA 3RKSA 5EIWA 2UVPA 1OT5A 2XMCA 5AFSA 3CG0A 2FMTA 1I9GA 3S40A 4L7QA 3ZZ0A 4GZMA 5GY7A 2ZBFA 4BB6A 3LQ1A 3FVRA 2QTVA 1B76A 3RYTC 4OB8A 4DE5A 3H5AA 3CNHA 4M0KA 3OP1A 2XE4A 3QVWA 4U7FA 2AJ8A 4RZSA 2ZU0C 4RZQA 4L0DA 4ZOLF 1BW9A 1UZAA 4LMAA 1GAQA 5DULA 3TSOA 5TR9A 2CL6X 1XXLA 2JGAA 1Y89A 1J00A 4HAXA 2I29A 4L76A 4MUYA 4QLOA 3W34A 2J9XB 3TK1A 4Z0HO 2XODA 3ROFA 1D2CA 1U2DC 4KPFC 1U80A 1W59A 1EX9A 5EPOA 4CIVA 3NWOA 4BV3A 3KYCA 1NP3A 2GPWA 1BDMA 1QDEA 2DOKA 5B6JA 1WCWA 2B2NA 1LPBB 2E5WA 1WX1A 3A28A 3OFSA 4YRCA 4ICIA 2EJCA 3FFBA 1GDDA 4DDKA 3OCXA 1I2BA 2G77B 4WMLA 2PH7A 4PYNA 2FSVC 4L0CA 3TOCA 1OBHA 4Q48A 3VAAA 1M2WA 3OWXA 3TLAA 2BHNA 2H6EA 2JGMA 5DTJA 4B2IA 4XLLA 4LQLA 1CEXA 4GYYA 1FJ2A 2HDHA