2VR3A

Structural and biochemical characterization of fibrinogen binding to clfa from staphylocccus aureus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
316
structure length
308
Chain Sequence
b'TDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAVLANGVIDSDGNVIYTFTDYVNTKCDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPEDVTNSVNITFPNPNQYKVEFPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDCPVVP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CLUMPING FACTOR A
publication title A Structural Model of the Staphylococcus Aureus Clfa-Fibrinogen Interaction Opens New Avenues for the Design of Anti-Staphylococcal Therapeutics.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
total genus 56
structure length 308
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vr3A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vr3A02
1R17A 3IS1X 3V10A 5CFAA 4JE0A 4BBWA 2F6AA 4B5ZA 4B60A 3IRZA 4Q6KA 3IS0X 2RALA 3ASWA 1R19A 4F1ZA 4F20A 2Y7NA 4LE8A 1N67A 2F68X 4F27A 4LEEA 2Y7MA 4F24A 4RMBA 3IRPX 4LEBA 5CF3A 2VR3A 2Z1PA 4JDZA 4MBRA 3AT0A 4JDZB 2YLHA 4MBOA 2Y7OA 3AU0A 2Y7LA 4FJ6A 5IHWA
chains in the Genus database with same CATH superfamily
5FB8A 5D5MB 5DI8A 1REIA 3RGVB 3RG1C 1U8QA 4IBZA 5TQ2L 2DY2A 1UWFA 3TV3H 3CLFL 4F1ZA 4GKNB 3H55A 4YC2C 3QEHB 4U1IA 3INUL 5GISL 3T77A 4L4VB 2F58H 3QYCA 1TQBC 5IMMB 2EE3A 4LEBA 4ZUWA 3OMNB 3B37A 5J6HB 4XNMB 2XWJA 5T1DL 3FRUA 1HHIB 3TO4C 1C7SA 5KSAA 5G4MA 3NGBC 4WHDA 3UTTE 4J2XA 5A16B 1CFSB 3E1F1 4RLDA 3RYMA 4GQQA 1OIOA 5C7XL 1W0WA 4PJ7F 3UO1L 1HINH 1ZXKA 3GC3A 4JKPL 2J4WL 4AEHL 2N7AA 3W0WD 3T8VA 1NPJA 2H8PB 4HEPA 3ZQXA 3S36L 5E6IC 5I66B 2PWGA 3EOYG 3QG7H 4G6JL 4MA1B 4AMXA 4GQRA 4E5XG 5EC2B 5C0AD 5EF1A 3WTXA 4LSVL 2G3XA 2E0PA 3ARFA 3EO0B 3MX0B 4ZUUA 1U8PA 1MAJA 3HVDA 1F00I 2OMWB 5B1KA 2V8MA 5FK9B 2WXHA 3B1TA 5F21B 1YY9C 3QO1B 3ROLB 2EE0A 2FJHB 3BAYA 3FT3A 5G4NA 2ZUSA 4JANA 2EXWD 2VLRB 4MA8H 3TTSA 3CNKA 4LPWA 2PWFA 3VXSE 3HLAA 1O6VA 3Q5YA 4JM2F 1UUNA 3EDEA 4EUPB 2AZUA 1OAXL 2VN4A 2V2TB 1ODAA 5GS1C 5IJKA 1FBIL 3MROB 1F4YL 2Y3AA 3CG8A 4Z3TA 5D6CB 2JLPA 5D7JD 3VDAA 3LB6D 3QJUB 3JWDC 4X9GA 1OGAE 4DCQA 2BVPB 4H20H 3RWDA 3H4FA 3BZDA 4FFYA 5HDWA 1FVCA 4NN7C 4KMTL 2X4RA 3UCQA 1QFWL 1T2XA 4HXAL 3CZGA 4IRJA 2FO8A 3D9AH 3GSUA 1I8MB 1VADB 4QY8B 4QXTA 4L2LA 4Y4HB 4G1MB 1FZMA 2XTJE 3L8QA 2V2WA 1AAJA 4HKXA 3IFOB 1R5IA 3G9AB 3L5WA 1AC0A 1XR8B 5AKVA 3OMIB 4FHBD 2EVJA 3KS0J 1FIGL 3VXQB 1UZ6F 4OTXH 1PIGA 3AU0A 2A9MH 4KZDL 3KLKA 5E8PA 4W9LC 3FO0H 4F7CA 3AVEA 3L3OA 4G8GB 5GS0L 1IU1A 2GK0A 4YHML 1CI5A 4O2EA 4N85A 5IW3A 2XWEA 2ADGB 5K39B 4B9ZA 2R83A 5FAAA 3LJ3A 4B9FA 3SE3C 3H0TA 3B2UD 5TE4H 2DBLH 1PFOA 2DQDL 3ASWA 4OCRH 4ZMNA 4EE2A 5C09B 1LO0H 4Y9BA 5C07B 4ZMYA 1CXIA 1SEBA 2CRMA 2KMWA 4LF3B 1JZ6A 3U4KA 1DQIA 3T8MA 4EZKA 5C7ZA 3QHZH 2VQ1B 2VOTA 3FHQA 4WI8A 4Y16A 2M2DA 5DHVH 2PCXA 4G5ZH 4WU7B 1IAKB 5ADOH 1Q0XL 4KTDH 3F5WB 1RSYA 4QJ5B 1NJ9A 3U0WL 4EDXA 3QDHA 4Y4KD 3EGDB 3K4AA 1MJ8H 2E9WA 5IB4A 3BH9A 4BA0A 3BVTA 3V52L 1RJZB 1N8OE 5BOPA 1MCCA 3IRZA 4Z0XA 3BH4A 4NGHL 4YE0A 4M9OA 3G6AA 4XPAH 2XIDA 1Z5LB 3GBNL 4OD3H 4P5TA 3SPHA 2XN9D 1CT8B 1GR7A 1F4WH 4RGMC 3N85H 3MR9A 4B41A 1JZ3A 1INQB 1NFDE 3KPOA 3G6DH 4NQTA 2R1XB 3S96B 3ZSTA 3PS6A 2EACA 1AANA 2GJPA 4U1GB 2YXMA 4U7MA 4Q6YA 1MQKL 4Y5XB 5F0LB 1KJ3L 3D0VA 4PJXB 2HJLA 1FL3B 5HBBA 3RB5A 4R2GD 1GYAA 2BP5M 3JZYA 4BHUA 5IV2B 3BD4A 1ZANH 4ODHH 5D71H 3ZKSD 3WN5C 3EHBB 1CYWA 3FCBA 2G0LA 3UG3A 5IG7A 5GRUH 1F6FB 2P5ED 4YWGL 3BWSA 4CW1A 3V0DA 3T2PA 1UEMA 4ELMA 5HDRA 3QG6B 2Z1PA 4X6BA 2FEDD 4HJIA 3O11B 4HJJL 1ES0A 5AKSA 4YHKL 4DP4X 5ACLA 4L9LA 3U7YL 3P9LA 4JFWA 1ZJBA 1XSJA 4J4PC 2LW3A 2QMJA 4LHJB 1HH9A 2ZWLT 4RFEB 2IGLA 4S0SD 3WY3A 2V6HA 4G42A 4WSKA 2CBPA 2R15A 2WYZA 1KT2A 2OZNA 3D2UD 1N26A 1TT6A 4UNTA 1NOAA 4I89A 1QFUL 3KXFA 5DMKA 5MEPA 3R8QA 3VI4B 4ETQA 1EEQA 2OZ4H 2VR3A 5FFLA 1HK6A 4Q56A 4A2LA 1WZKA 3O3AA 2DLIA 3A24A 4XBGA 4Y5XC 2R0KL 4P57A 4WI5A 5I6PA 3TWYA 5INDB 1XD1A 2QPUA 4GW4A 2XKUA 3K91A 3ZDXE 2IOMA 4HOWA 1I8UA 4UTAL 4O02B 4S10A 2APXA 3BZEA 1KCVH 1CVRA 3KGRA 3CDGA 3HC4H 1JHTB 4U6HB 4IBLT 3IF1B 2XC8A 1ZT7A 4F8NA 2ZXCA 1TO4A 4HV8B 4XX5A 1XBRA 3NIGB 3RIFF 3U83A 4LCWB 2FO4A 2HRPL 5CLXA 2ZP8A 3WEXA 4Z7UF 1NGWA 2JKXA 3PHQA 3RDTD 3WE6A 5IQNA 1MJUH 4YX2H 5LCVH 5DC2A 1C5BL 2R9HC 1MW2A 4MJJA 2JLLA 2W65A 1BQKA 2IVFC 3RUGF 1WCBB 1YC7A 4DQOH 3TF4A 1R5WB 3QXAB 4M5YL 3H9HB 1JF6A 1IC1A 4X8JA 4MNHA 3WU1A 3CFIC 1NCBH 5E9DE 5J06A 2J44A 1TZGL 3ARGD 1XCQA 3D1MC 2JQAA 3LVTA 1A6VL 3D08A 4YO0A 5HI4D 1LO4H 2OJEA 3DUSA 3PUCA 4MZRA 4LSUH 2WVVA 1KJ2H 4RX4A 5TDPB 2CM6A 1YHPA 2YSTA 2BSCA 1RJCA 3EJQA 4FTDA 5GGTA 3RVWD 1KY6A 3VG9B 1JPSH 2DKUA 2ZG1A 4L4TD 4KTGA 1EJFA 2BFVL 2J2ZA 1UXLA 1AXIB 2R8SH 2FR4A 3WIHA 3P9MB 5HJBA 5HHOA 2IALA 3QXWA 4MMYB 2EE2A 4NQQA 3B43A 3CPLB 3LKQB 3B4NA 1T4WA 5JW5B 3MRDB 4F7PB 3VD2A 1BJ8A 2F5AH 3TPKA 5E7FA 4DVBA 1QA9B 3ZHFA 2X70A 5I17B 5IMOB 4IBUA 2GCYB 3QWQB 2I60L 2IAAC 4PRIA 3P3SA 3T2LA 5D1ZA 4HU8A 3BFOA 2WUCL 5CSBA 3FU0A 3BDXA 1J8SA 2QL1A 3J7HA 3VWKD 2SODB 3CVCA 3TNNA 3ARPA 1DQTA 2WBXA 1H8NA 1LJMA 1UH3A 3BGMB 1OTSD 2Q20A 4WENB 3U30C 4ETYA 3LS5H 5IUCA 2AGJL 2BSRA 1EDQA 4JFEA 3IAGC 5C9KA 2CU9A 5AZEL 4NAJA 1G6RL 3LIZA 4HG4K 2P8MA 3UTSA 1Q1JL 5D7JC 2UWEE 3LB6C 4XMUA 3E7JA 1FFNB 3MLSH 5E2WL 5EIIA 1IM3A 1MLCA 2G5BA 3GRWA 3MV7B 2XG4B 1EXHA 2RR3A 3ATFA 1HWGB 4GUCA 3CFCL 4X4ZA 1RURL 4R7NB 4TQ8A 4X98A 2XN9B 4PB9H 5J1AB 2BWQA 1FDLL 4GRWF 5E00B 1G43A 3CVIH 5DJ8B 2A6IB 2OK0H 1BFOA 4FABL 4H88L 1PG7H 2EYSB 1QYGH 2WIMA 4X4XA 2MPVA 1QSEA 2O5YL 5DD6B 4XPHL 4G5AA 4MNGB 4R2GB 1NLBH 4PRNB 1JNLH 1NMCB 2E27H 1JZ2A 3PAYA 3U9PL 2OSLB 1ERNA 2VDNH 2HKAA 3WFEL 3U0TB 1SJVA 3CVHA 1IM9D 2HJKA 3IMVA 4KI5F 3DRTA 3I3BA 3VD4A 5I18H 4OZIE 3KNBA 1ZLUH 2FCBA 1ZA3A 3B2UC 5IESL 4GG6E 2P5EB 3NIFB 4BSVB 1KCUH 3CSGA 1U8CB 5GZOD 5L88L 2BP8B 4OLXH 1G7PA 4M1DL 1RQ5A 2YOCA 1NC2D 4PREA 4KH9A 2P43B 1N59B 4OZHE 4XZUB 4NZRH 5F1NB 4LO9A 3MO1B 4U1JA 1JOIA 5EEUA 3PJSA 3N50A 4J6RL 2DIAA 2F54A 4MLSA 3DC0A 4JX0A 1X3DA 1LD9A 2CHWA 4HS8H 1JDAA 1I3GL 4Y4KC 2CDGB 4LBAA 3TT1H 3MUGB 3QR1A 2ITCA 3SDAB 1NGQL 4NENA 3D2UB 1JJUA 1LNUA 1IBYA 2JKRM 3M46A 3O6FD 1MJ7L 1HH6B 1FG2B 5DRZA 5E99L 1R5VA 2H4EA 1LGVA 2Q9OA 3HS9A 4X8CA 2JKJA 2V5TA 3VMOA 4TUUA 4IJTA 1ML0A 5DU7A 1N6UA 4HIJB 3VVWA 3D87B 2W94A 3FQRB 3GO1H 1D5BB 2XVGA 5EA0L 4IRZA 2GIXA 5GGRY 3FMGL 5EU6B 1RUML 3ARQA 5HGAB 1YY8A 4GOSA 3QZWA 2Y1VA 4XNDA 5L2KB 2ZKYA 1HIMH 1J8HB 3GWJA 4K7PL 1RZ8B 2XV6B 2NNAB 5KSBA 1FE8L 5C0JB 1A3LH 4BKLB 2X0UA 5GGQH 4BFIA 3AUVA 1KB5L 3BDYH 5FKAA 3MUUA 4I85A 5D1XB 1FNHA 3K4DA 4HEME 3HMWL 1CIUA 3RBSA 3AQYA 2C3GA 3H9SB 1V3KA 2DD8L 2YAOA 1C1EH 1M1SA 4FQXD 4BE6A 1A6ZB 4HMEA 2ZKXA 2ZYRA 2PR9A 2YN5A 3QNXB 4UQ9A 2NQ3A 1BYPA 1P9MC 2IANE 3SDXB 1G7QB 1WWAX 3GMPA 1A7PH 1D7CA 1GMIA 1T20B 4P4KA 1I1CA 1NSNH 1I9RL 4KQ4H 4C59B 4X6DA 4ELMF 2A83B 3REVB 4BWUA 2PO6D 1JVLA 1PTZA 2K3HA 4NIKB 1T7ZA 2YLHA 4Q14A 3ZZLA 1XGYL 3ARGB 2VR7A 5IFJB 5JOEA 4KNSA 2WIIA 4ES8A 1PLAA 4H1LH 4L29A 5H94B 3AY4C 2NUTB 4PRHD 2F7QA 2XV3A 2P8LB 1FZKB 1LEIA 3KLHC 2I5YH 3CZKA 3HG2A 4NUPA 4PRPD 2DQFA 3MJ8A 4LHUA 4F37F 1G7JA 3PE9A 3ZVVA 3GSOB 3ZSSA 1SJHA 3A5VA 1BFVL 4IIQC 1FVEA 5GGVL 4XNZC 5IOPB 3PY9A 1BF5A 2NQCA 2BVTA 2YWYA 1ZRUA 4DPBX 3FB8B 4Z3HA 5HGHB 4NKDB 1BOGB 2KL6A 4HG4J 2ZCKL 2ZNXA 3VXRA 4JJ5A 2EJ1A 5E5RB 3AQZA 3ZE0E 1KPRB 4BQ8A 4WFGE 4WFFE 3F6LA 3WJJC 5T3ZE 5JW4R 2Y23A 3MN8A 3RDTC 3ULVD 2V4LA 3CFBA 3T4YB 3JVGC 2DQTL 3H56A 4KTYA 4X8GA 3NFNA 4PJAB 2OL3L 2YD7A 4OFQA 4NNYB 1PSKL 3O45B 5F7LB 3OLEA 3LN9A 4OBSA 2B9BA 4OD2A 2NY1B 4WW2B 4ODVH 3OC8A 3L9RA 3P69A 1S3KH 3WN6A 1VKXB 1MOEA 3U6RA 1FI8C 2O1AA 4UQEA 4Y19B 3RX7A 1KBBA 3X13A 5EN2B 2ZG3A 2AJSH 4QAMB 4I5BA 3RZCD 1XGPB 4PV9A 4UQ3B 2QPSA 1BLNA 3BFWA 3L5JA 4L37A 2XVBA 4I2XA 5DFVD 5GQBA 4HK3J 5HI4C 4XN1A 5DJYA 3K72B 4MAZA 1NC4D 4KY1H 4Y2DB 1EZSA 3ZE1E 4ATTA 3FB7B 5BQDA 4GRLD 3ULUF 5J6GA 2G60L 1UD5A 3OD3A 3UDWA 5EZPA 5I73C 3RVWC 4GQPH 3WS3B 4XP6H 3OSVA 3AROA 5I1HH 5LWYL 3VQ1C 1NICA 1H19A 2CHDA 3BKYH 5CGMA 1D5MA 3W39A 1DSFL 3FT0A 3ZN6A 4X6CA 2QSQA 1FO0L 1OXYA 2OYPA 4X5XA 5BV7B 4GUQA 3QNYA 1DQVA 4G70B 1XWVA 3X3FL 4Z7NE 1M4KA 4QEGA 5HHME 5J6SA 4YGVB 4UAOC 1XB6A 3RWFA 4A6YH 5CFAA 3BP5B 3X14A 1FNSH 3BUPA 3PG2A 3WHE1 1J5OH 1SZNA 1YNLL 2BP0A 4JFSA 2VO8A 3MTRA 4KVPA 1BAFL 2ARJA 3ABZA 2ZZUT 3WMQA 3ILPA 3HZMB 3AS0A 1DCEA 4XWGH 3NA9L 1SHSA 4IBWA 5HD8D 3KCPB 4YLCA 3PL6D 4WO4A 3VWKC 4UI2A 3U0PA 1AE6L 5J8OA 3IMWA 1R24B 1WBXA 3CFTA 4UB0H 3VFTA 2B4CH 2E7DA 2PCFA 1E9QB 2IBZX 1WA2X 3CE1A 5JORB 3HC3L 4OCSL 1F90L 3ES6A 3VRJB 4V2CB 3ET9F 3KLLA 4IKKA 3I75B 3WD5L 2Q2EB 1KYDA 3ISRA 4OD1L 5LG1A 5SWSE 2Y72A 4N8VA 4OUUA 3CMOL 1YYML 2HUEA 4TUJB 2CCWA 2WANA 3G08B 3KYMA 1TSHA 4KROC 3D69A 5D96B 3GS4A 1NDMB 5D8JH 1OP5H 1PQZA 2XZAL 5EU3A 4TPRH 1A7NH 3L6FB 3F58L 4U1HB 2YAPA 3OKYA 1T1WB 2NY0C 4R84A 4YQXH 4AVJA 2P5WA 4N2EA 1GZQA 4Z23A 3CTTA 3LSOB 4WTZG 1RAMA 2A6DA 2AK1H 2AJ3A 3QI9A 4NT6B 5FYJU 3S34L 3VFMB 5JA9A 4NP4L 1G7HB 5KYXA 3R7QA 1UQSA 4CBPA 1GIGH 5FDWA 3II2A 4NRXB 2X7LB 3APDA 4LL4A 2XZQH 4DSYA 5EORL 1MW1A 4XXDA 1FFRA 1LWHA 3QXDB 4R4BB 3UTSE 2F7RA 3IDXH 5GZOC 2X4QA 1K5WA 2CGZA 3IFPA 1LO2L 4CSPA 2DJMA 1EMTH 4M5ZL 2BW4A 1S5IL 3RNQB 3QCVH 1KCSH 2DW5A 1PX4A 2EILB 4KKLD 5A6LA 3LH9A 4ZUTA 2BVOB 4JFDD 4FQLH 4LKXB 6FABL 1G9NL 1LK3H 1A8ZA 3H9YA 43C9B 5EEXA 5KBLA 1ZPLA 4HDIB 2XUWA 1VCBC 3FQ4A 3FUKA 1KCBA 3N3EA 3ZL4H 4PJFB 1C5CL 2ORBH 3MRRA 2N1KA 2YA0A 3O9WA 3FOLB 4HK0B 4I3RH 5D7IB 5E4IA 3VXMA 2PO6B 4HFUH 2FWOA 3VYOA 2HKFH 3U9UA 4Z7VB 3O6FC 3BXNA 2WXMA 3OWEA 3I50H 3TM6A 3PWNA 1GC1C 1V5JA 4KAQH 2YD2A 4XBPB 4F2FA 1CURA 2VDRL 4EOWH 4N2LA 1ET8A 1P7QA 1QEXA 2GAZB 2MQCA 4PRHB 5IROD 5I1DA 2CAKA 5CLWA 1OGPA 4G6MH 2CMRL 5CMAA 2PXYD 3V7AE 5CSZA 2ZQKA 4XN7A 4PRPB 2VDQH 4JDEA 3B2MA 2YPLE 4A7UA 3NA4A 4KJPC 4KUZH 4LEXL 3SJVD 4G7VL 1KN2H 1Z3RA 4NUQA 3SGJA 1JTPA 3GSNL 3MACH 3VSVA 4ZMOA 3HE6D 2IPKA 5GPRA 2H1LM 2UXFA 3QRFM 2OTWA 2WXIA 2QR0A 4MJIA 2QV4A 5GS0D 5I30L 1F8TH 1VFOA 3WDHA 1E4XH 1H3UA 5IFHL 3TA3A 1IGTA 3FW6A 4FQXC 4D0DA 5KSBF 3M1BB 1M7DA 5I8OL 1PZSA 4CKVX 3QFJD 3GJEA 5FEBA 1RU9L 4M6ML 4QRRE 3ZT6A 3HBQA 2C3HA 5CILL 3OV6A 2XA8L 3QAZB 1MREL 2LR4A 2IH8A 4NHCL 1QX1A 1WEJH 2YA1A 5IEKA 5EEZA 4A04A 1MCPL 3DECA 1FZOA 3WJLC 2GIMA 5F3HA 3AMKA 3AC0A 3D33A 2EUZA 1NC4B 3ATDA 3MODL 3MV9B 5D1QD 1E30A 3AT9A 2X0VA 3DVGB 2ZE0A 4GPVA 4IEFB 3T08A 4XVJH 4IYKA 4X6DF 4U6VL 1PYWA 3UJJL 5JHLA 4FQCH 4S0TD 2ED9A 3EJZD 3GZQA 1M7XA 4FJ6A 4ZFOA 2L7JA 4CMHB 3GTTA 4I3SH 5HYJD 3V6OA 5T3XE 2RQEA 3BKCL 4DPCX 2AHIA 5DK0B 2VDOH 4YVNA 1QQDA 2DJSA 2GSGB 1UM5H 4TUKH 1UC6A 3BH8B 2FD6H 2Y36H 2R2EA 3O3DB 4M93C 3FZUD 5DO2D 3ZE2F 2XNAA 1UOLA 5ABDE 4BA8A 2HFTA 5CCHE 4I0PD 4LLYB 1KTKE 4GNKB 2I7SA 3ULVC 3EYVA 5EU7C 3AT0A 4ZQKA 2VXTH 4N2HA 2GYSA 5ERWA 4MGXA 5FXCH 4E41E 3BRGC 1J05B 3ESNA 3QA3A 5JW3H 1E8ZA 1SF5A 3KPLB 4IBTA 4QOKB 5D9SB 3LEVH 1CYGA 3VCLA 2ENYA 1EHNA 3ZTDC 4K8RL 2OMUA 3LRGA 3P4OB 4A39A 4DUVA 1MFDH 3NABL 4W4OA 1H3GA 3MLZL 3V6BR 4I7ZC 5IW6A 3R0NA 4JRXB 4L8DA 3RZCC 2I25N 3NCMA 4TULL 5DFVC 4JG5A 4XCCH 1GYWA 5HPMA 1J0KA 3BLPX 3C60B 4GRLC 2AXGA 2DYPA 3OKMB 3HI6H 1IQDA 4ICXA 3D85A 3MLXL 4E5XB 4XO9A 4JG1H 3EFDH 1MFCL 3CHQA 4ZO6A 4MDJB 1QLFB 4EF3A 4OCNC 3EG9B 5DC9B 5F7NC 1JFHA 3UTPD 2OYLA 4CMHC 2O61A 2PETA 2EIEA 4QRPE 4AH2B 1QFOA 4JHWH 2ATKB 1Y1UA 1BM3H 2ZUYA 3RIKA 4NM4H 5L6YL 2GI7A 5CINL 5E2VL 3SOBH 1TOXA 5E8OB 3G6JB 1QSZA 4PTUB 1E67A 2KZKA 1RZ7H 3BPNC 3ZDZF 5M94B 4NFCA 5CJQH 1TNNA 4WUKH 3H53A 5IQ7L 1Q8MA 1AO7D 3QRGL 4X6CF 4PPTA 2PYFA 3RI5F 3T3PE 3U9WA 3RY4A 1A47A 2WWNA 3EDJA 3PL6C 4UT7L 3ZMRA 5HYQB 1IKFL 3QIWB 3GDBA 1AGBB 1RMFL 4I0KA 3WKQA 3WXWH 1GRWA 5JHAA 3JV6A 2QQKL 5LBSL 5TPWH 2P42B 3QDMD 3X11A 2B08A 2VWEE 3B7RL 4C54A 3CFQA 3V8OA 3FRPG 4YJZL 1D5IL 1RFDH 3LPWA 1WWBX 4HIXH 2R7EA 5GGSB 5IHZA 3FB6B 5T3ZL 4ZS6C 4E9QA 1MFEH 2XACC 3O2DA 4OZGB 3RFZC 2A38A 5F8QC 5TQ0H 1SY6A 5F1OB 3N43F 1R3IL 3D34A 1WAEA 5ISZD 5CN3A 3DTXB 1QRNA 5BMFL 4CSSA 1MHHB 4B60A 2ED7A 3QZPA 3DVNB 2NQDA 4BZ2L 1EJOL 4XCYA 3HG1B 5ADPL 2OJZH 4A63A 4J8RB 1RERA 1Q9OA 5MEND 1SJMA 3OJDA 1NCGA 5FGBA 1NFAA 3MRNA 3QORB 4CVWA 1MAMH 4UBDD 1MXGA 1JGIA 3D25B 2Z91B 3KPQA 3HS8A 1GZHA 2HA1A 3SJVB 1HXMB 1PZ5A 2FWUA 1RZFH 3DIFB 2BLFA 1YPZE 3HNSL 3FT4A 2UZYB 3IJEA 4HISA 5KJ4A 1H15A 2X40A 5D7LE 1E5UI 1Q72L 1OAZH 2ATPA 3S37H 5AFAA 5I1AB 1NGZB 1QNIA 4LE8A 3TO2B 1M7IA 4XRCA 1N0XH 3MRQA 5TFSL 1WD8A 4UIKH 1UURA 1UKSA 3MU3A 4BFOA 5EBMB 4G9FD 2H26B 4LSRL 2N3JA 3GMRA 3R8BB 5EWIL 3F00A 3K6FA 1E4HA 1K4DB 4M1GL 1P4BH 4Q0XH 3TIEB 2HVJA 3WSQL 4PJEB 3BT2H 2V3FA 4XN8A 2J1WA 4CDGC 1U2YA 4HOZA 3MA9H 1QAWA 2VXQL 1T04B 4JRYE 2BOBA 5B4MD 1E4WH 5DJAB 1PIFA 1VJSA 3TO4A 3S48A 3WEBA 1NKOA 1E4KC 2EDWA 2J8UE 1T22B 1T0OA 4XXCC 4JY6B 5C0CA 2V17L 3IYLW 5D1QB 4P49A 3B83A 2PXYC 2ZX6A 4A2MA 4MMXB 1HEHC 1OCOB 3NJXA 5E6IA 3W9EB 1DL7H 2OMNA 1UTDA 3Q2NA 4YUEH 4GBXD 3X1FA 3MLYL 3HE6C 4LHQB 4OF3A 3FJTA 1TQSA 3JWOH 5KYWA 2H6OA 4L3ED 5E4OA 4F2MA 5CZKA 1OGSA 5GS0C 5J4MA 3VFOA 2MH4A 1J1OL 3IEAA 4RCAA 2QQLH 1JHKL 4Y1SA 5IVXB 4WUUE 5DXWA 5GS2D 2EVHA 2GUOB 4RMQA 3SKOA 2ZUQC 1A3RH 2VN5A 3FK3A 5C6PB 2GJZB 2Y07L 3RGVA 3BO8B 2DYRB 5CGBA 5AW9B 5B1AB 3EYQD 3B34A 2FZ3B 2R4SL 3IN0A 4FZEH 4K5MA 5GJTL 4DP8X 3WKML 5LAXA 2CR0A 1MWAH 3FTSA 3LXAA 3RJOA 4FFTA 3FUDA 1U30A 4L4VA 3WBDA 4M8RA 5IMMA 4OGXH 1DTUA 4PJDE 5J6HA 4XNMA 4FQIL 4MZIA 5DUBB 3VXSD 1HHIA 2VZSA 1M42A 2IEPA 4G8EA 3E6FA 4LDEB 1IGMH 5D1QC 5E08H 4JO8A 4AIZB 1OM9A 1QFWM 5E1IA 1SBSL 5CZVL 3T04D 1CZ8L 4K23L 2CJTA 5TDOB 3IGAB 3ZHKA 3EJZC 1IV8A 1NEZA 1KTLA 4X7SL 5I66A 5FWQA 2X0WA 3U4EB 4JDTL 4OFKA 2IIJA 5EC2A 1CYXA 2YAFA 3BT0A 3V4PH 5AYUL 1DVZA 4A7TA 3MX0A 4GXUN 2OMWA 4PCSA 1NUFA 3ROLA 4FG2A 4QHMB 2FJHA 1Y0LB 2ZOLA 2BX5A 5FYKE 2VLRA 2E7LC 4A37A 1KB9K 1ASOA 1O6TA 4WZ9A 3FZUC 4PJIB 2OMTB 4TQEL 5DO2C 5JR1H 3L9YA 3OQ3B 4MXVF 4I0PC 4LSSL 1UJ3C 3T1FB 3TEWA 2VZVA 1QUNA 2JQMA 3WLWD 3FN0H 1CGSH 3VGAB 2Z34A 2FH8A 1KTJA 4KRLB 3IJYB 3PP3K 3RA7H 3UGUA 3O4LA 4FHKA 5EDSA 4NNXA 5D6CA 5DD1H 4YHYB 2W9EH 4NDMB 3PWJA 4WW1A 2RA1A 3KG5A 4JZNA 3LPPA 4XVTH 4UV7H 4U0QB 2ZD0A 1VB9A 1JL8A 4FTVA 4EZMA 3V7AG 5AUMB 5K9QI 5KZCD 2CBTA 1UB6B 5IVOA 2VLKE 4LDLB 3GNMH 4JMNA 4OM1L 5FW8A 3OB0K 1I8MA 1VADA 4QY8A 1GJUA 1ZSHA 4MNQD 3VYNA 1BBDL 3UAFA 5ISZB 4G1MA 2YKLH 3G3LA 3GMLA 3BISA 1KN4H 4HCRA 4XO4A 2WB1A 1CGWA 5BCAA 4PGCA 5IBTL 2P8PB 1IIKA 3IFOA 4NNPH 4NKOA 4U7KA 5LNEA 4LFHG 1FL6B 1MFAL 3EYUL 3NIDB 4ZODA 4DEUA 1KEML 2B8OT 3S7GA 3WY1A 2CO7A 1JG9A 5B8CB 1IIIA 4AUYA 2PCPB 1FGVL 4G8GA 3DDFA 2ZPKH 2CK0L 3F7QA 2ADGA 4OLZH 3OXSB 5BZZA 3U46B 5J89A 2H32H 4ABVA 4A68A 2KLSA 3CH1B 3H9ZA 2NPLX 3POCA 4XTRD 4OGQC 2WTRA 4X4KA 3VDBA 4QLWA 5C09A 1EHKB 4ISVB 3CBJB 2PP7A 4LF3A 4Q74A 5T3XL 3KPSD 2D31B 1UGNA 2D2OA 4GI9A 2CDFB 1KDJA 2PLTA 4IK7A 4N0FB 3BQUD 4KHXH 2WGNB 4G82A 5DEFB 4G8IB 1UYWL 5EB9A 3CZSA 5T5FA 3S4SA 1PZUB 1RJZA 5HI5D 4EDWL 1SYVB 1KYAA 4JKWA 1G6RB 4M56A 1CT8A 2FX7H 2D7NA 5AKTA 3BRFA 1INQA 3MPCA 1MEXH 3F7YB 1IAIH 1G7IA 2R1XA 3S96A 3UH8A 3P3TA 3UZVB 3GXTA 1IC5H 2IPTH 2E3VA 4Y5XA 5HGDB 1SDYA 2ZNWA 1XDTT 4PJXA 4G59C 1FL3A 1DVFC 2HWZL 4OCYH 5FUCE 4JREB 5B8CC 4Z3IA 2KH2B 1IKOP 4UBDC 1NCDL 2R29L 2EQDA 1PJ9A 3NTCH 3MAWA 1CXFA 3US9A 1HS6A 5E5MB 2EDNA 4ZMWA 4PN6A 3TV3L 2LTQB 2COQA 4PGEB 2E47A 4J6IA 1DCLA 3QG6A 5EH1A 1UCTA 4LP4A 3UTTB 2WNGA 3D51A 1RPUA 4O51B 4Z77B 4HUVB 2F58L 3O11A 5C70A 2R4RL 4JGUA 3Q6GL 4JHZA 4DKDC 5IB2B 3KL0A 3H3BC 4GQZA 1ND0B 3HI5H 4IIZA 2HPTA 1F13A 3U2SA 1PAZA 4HBCL 5GRVL 4DK3A 4Z78B 2ZX7A 2DLGA 2D3LA 2W9LA 5IVZB 1EIBA 1KFAL 1MHPH 4PS7A 2ERJB 1MHCA 2YUWA 2VJ8A 1T0NA 3NRQA 4J12A 1FL5A 2BS9A 5IWLA 4LAJH 5JQ6H 2AEWA 4FXTA 3ARZA 5IKCB 5AB0A 3GZOA 5F6HI 4L0PB 4NQXB 3S6CA 5DD5L 3VXSB 2Q86A 1UCBH 1KB9J 1NAMH 4FLRA 1JAEA 3EJTA 4ZSOB 1EHAA 3DTUB 4NFBA 4O02A 4TSCL 3DO3A 2YZ1A 2HXAA 4Y2OA 3TBBA 4JO1H 1JHTA 1R46A 4XNAA 1FORL 5J12C 3W0WA 3IF1A 3QUHA 4EI5D 1VGEH 3HCVA 1SUJA 4JHUA 4Z7QB 1OGAB 4GBXC 1D2OA 3WDIA 3KYNA 1TTUA 3C6LB 4DK5A 1RSFA 2QMKA 2X6UA 1IEHA 4PJ8D 2HFGL 1F6LL 2BSBA 3I84A 4N86A 2EXSA 5DUML 4UILL 2WXGA 4FADA 5B3SB 2EABA 2OMVA 4GJTB 5H4YA 4QRQB 1KB5B 1EO8L 2RIKA 2WLIA 2YRZA 3WNPA 1ECYA 3D0AA 3DJ9A 4XCNB 2JKWA 2WHVA 4ZAKB 1G84A 4XX1E 2XTJB 1BD2D 2VZUA 3K71A 2IG2L 4WV1B 2O6CA 3SCMD 1WCBA 2V3EA 1AG6A 1CD0A 1HCVA 4IU3A 3QYNA 2C8NA 3H9HA 1P5VA 3EYQC 1CVSC 5HHNA 5TF1L 2NX5D 3TBTB 4JPSA 4DGIH 4B5EA 2KPWA 3BOVA 4EVNA 3QCTL 2L7EA 5D7JA 3RL2A 3C8KA 2QSCL 1BM7A 2XCMC 5K9QG 3C2AL 1F1AA 3JSSA 4HIQA 4HPOH 3ESUF 4OFYD 5DFTA 3I6LD 2BOCB 4LZKA 5TDPA 3VACA 5LGHL 1VFMA 1RIVH 1BIIB 1KTRL 4M5TA 4X50A 3ZYOA 2GY7B 2NCMA 3JYCA 2ZSWB 2P47B 2NW3B 4BFNA 1RZJC 1I9JL 3FHAA 3QZOA 2XPGB 5TE4L 4BZ1L 5F7DA 3P9MA 4MMZB 3LKRB 1XFPA 3QXTA 5BO1H 5BRZE 4MMYA 2AMUA 3CPLA 4OFPA 3UO8B 2VSKB 3W1ZA 4M7LL 1P1ZA 2VN6A 3UC0H 4D9QD 1HHGB 1DVUA 4KRPD 1QA9A 5I17A 1M3IA 5B1CA 2XTLA 1FNAA 2CKBL 4M1CC 4GKZB 3T1WA 5HDQL 1BWWA 5BVJB 5KOMC 2JSFA 1NFDB 1S7XA 4F9LA 3GFUA 3EBGA 4WV1C 5C3LD 5CWSB 3ZTNL 4D7BA 3WLWC 3BGMA 3JV5A 4K9EL 3DO7B 1OAUH 2PPEA 2OW7A 4M29A 2V5YA 2ZXDA 2WUBH 4OKDA 2W0FA 4NJAL 1BXXA 1CB4A 3MOBH 1FN4B 2R0WH 1D5ZA 2OL3B 3BQUB 2QQQA 1NBYB 1FFNA 2Y06L 3FTYA 2BOLA 4FS0A 4Y4KA 4IQHA 1W72H 3MV7A 1TU2B 4IS6B 1AJ7H 4CA4A 4YOKA 1EUTA 1J5CA 2MNJB 2AKRB 5GSRA 3NP4A 1BQHG 1I8KB 2PR4L 4R7NA 4FFYH 4O2FB 2XN9A 5J1AA 5K1JA 1PLGH 1URLA 4M6AA 4M8QB 1WSST 5E00A 1Z9PA 1S9KC 2VLJE 5DJ8A 1ASQA 2A6IA 2AJUL 2X2HA 4PU2A 2IDUA 1VCAA 3UCRA 1F11A 3MHZA 5FYLH 1CFVL 1JXGA 1IBBA 2K6ZA 5DD6A 3D12B 3GI8H 3TTYA 3NPSB 3QXUA 4UDUB 2NXYB 4MNGA 4JN1H 4LLQA 2CZNA 4PRNA 1MRCH 2W60B 4ORGB 2GEQA 2LVEA 1HNYA 2OSLA 3PLYA 3HBGA 4D9RD 4Z7AA 1UT9A 2ADFL 1UFGA 1P5UB 2CIIA 4EN3D 4MSWB 2Y9RT 1HL4A 1I1YB 3ARDB 2JKLA 3AGVA 1LDPL 4I9WE 2P5EA 4XTRC 4G43B 4BSVA 1A22B 1U8CA 2FSEB 2BP8A 5F0JB 4R9HA 4HJGB 1N59A 2FL5B 4GG8B 4XZUA 2VO5A 3WJMB 2OZ4L 3ZDXB 1L7IL 4Z1PA 5DZVA 2VXSL 1P9MA 3SE6A 3P77A 1DUYA 4LLMA 2DI8A 1U93B 1E6JL 2EH7L 5FYKL 4KBPA 2D3VA 2VL5B 3MUGA 3V7MA 3SDAA 4K8RD 2LQRA 3FQWB 3D2UA 3HKFA 2AAAA 3PXHA 3MRGB 1KCVL 4WK2B 2Q8AH 3HC4L 5SX5K 1TZ8A 3PGFH 1HH6A 2BDNH 2L0DA 5I1CH 3FH8A 2J55A 1TJGH 2ALAA 3CN0A 3MOAH 4K2UH 1G0DA 4GLRH 3SPGA 2IAND 1L9SA 4O4YH 3GD1C 2CRZA 3FQRA 1D5BA 3ZDYE 1CGYA 4I48B 1CXHA 4GKSA 5HGAA 4HLZG 1XH1A 3LRKA 4IIQA 1ZLWH 3FT2B 1A8JH 2ODHA 2NNAA 3LRMA 4KXZH 5E9DB 3ARRA 2ZOWA 4MYWB 4F5CE 1HQ4B 2GJ6D 3M8OH 4IOIB 2XQBL 3QUZC 3MJGX 3HPJA 4YFLF 5D1XA 1D7FA 4PJXF 4Y1AE 4JFPB 5DR5H 3AM8C 3V0GA 3W9DB 4Q6IB 3D0LB 4XMKL 3ZR5A 4F58L 4NSKA 1A6ZA 4GMTH 3WJJA 1DE4B 3D4YA 1SOXA 3QNXA 1E2WA 3FUIA 1DLHA 4NQUA 1LO4L 3QE5A 4LSUL 5LQBL 5AOKA 4NO2B 4OQTA 1G7QA 3FT1A 3N40F 4OFDA 4I18C 4IJ3B 3BPLB 4GQ9H 4RIRB 3FU7B 2YGNA 4Z95L 4YSUA 5I0XA 2NNXA 1JPSL 5GRXG 3DBSA 2A83A 25C8H 3MFFA 3REVA 3P3RA 4A2EA 3C6SB 4OBRA 3MLUH 2DI9A 2XVKA 3ARGA 4LKCA 3I9AA 4WFGD 4KK6D 4WFFD 2BSEA 5GRVK 1L0YA 3BUQA 4WY7L 3OGOE 1EERB 1MI5E 3FT9A 5H94A 2ATAA 4X6CB 2N7BA 4KO6A 5CJ5A 4TL4A 3B9KC 3P0VL 1S7QB 4R4ND 5DYOB 3HRZB 3F7LA 2DIJA 3LVEA 4W6XB 1BGXH 2EDKA 2WZAA 5AG8A 4Z8FH 4UIMA 5D2LE 3HZ3A 4HWEL 3WIFB 3EOAB 2O5XL 3GSOA 1CDGA 1KIUB 2VKWA 3QUYC 3IMUA 4L4TA 3IMSA 4IMKC 3RILA 4HOXA 3WO3B 5FM4A 4JO4L 3VI4F 5IOPA 2H0FA 1KENL 4EI5C 5HGHA 4M62H 4NKDA 2UWEB 4NXKA 2IC2A 3T2NH 5I75C 5I9QC 2X2IA 4QF1A 1U41A 4K73A 4QRFA 4UU9A 2H41A 1S4IA 1GGIH 5E0FA 1PVHA 3S5LG 4CSZA 4BQ9A 2NY2D 1FF5A 1KPRA 2ZXQA 1LK2B 4PJ8C 3ZTJG 3GSNB 1XHHA 4XPFL 5HHXL 1NUNB 1WFOA 3ZRSA 2GQHA 3DBXB 2RTTA 3A4DA 3MLSL 1CUOA 3FSAA 3T4YA 1IARB 4RNRB 4BFJA 1H3PH 4DUWA 2E9GA 3VWKA 4PJAA 4JFFD 2EZ0D 4ZZFA 1U8KA 2CALA 3BPLC 3O45A 1XF5A 3SCMC 3NIGF 4AV5A 5HHMD 3VD1A 3J8F7 4HU2A 4Z76A 3ULUH 5EN2A 3VM7A 3RU8H 5I6LA 1XGPA 3ETBF 4UQ3A 5DEJA 4NC0B 3DSFH 2MPAH 3FBKA 5A3ID 3K72A 1EFQA 4AEIL 4OZIB 2R2BA 4PFEA 3KPRE 3OQRA 1ZK5A 3DROB 4GG6B 2C7UA 4HZLA 3MLVH 2QGEA 1WBYB 5AAWC 4G7YL 4NRZB 3WS3A 1RKRA 4HKJB 4JO3L 3S3DB 5I15L 4PVLA 1JUFA 3ISWA 5G55A 4DKEL 3QGVA 2UXGA 3N44B 1RUKH 2E86A 5BS0E 2LLLA 5I18L 3LPOA 4OZHB 1YMHB 4LOVA 5GGTH 5JOPD 4Y2LA 5GHWL 3UBXG 2RH0A 1TLKA 4XCFL 1ETJA 4YGVA 4X6FB 5E2UH 3BP5A 5ACMA 3VRLF 2CH8A 3ISYA 2B5IB 5IM7B 3BN3B 3WIHH 2GITA 5SWSD 4KRPC 2OFQA 7PCYA 1O5PA 1ZJAA 3SPIA 3HZMA 1KXTA 1IAMA 1DBBH 3CVDA 4HIIA 4AKOA 4EN3B 2VDPH 4NKIH 3KCPA 1ZS2A 2WY3B 4HPHA 1V7NL 3L1OL 1TJHL 1CBVL 5I82A 2JI1A 3GMOA 3UZEC 1R24A 5GZOA 4W9EC 4NQDD 1O7DE 3MREB 4MJHA 5EUOE 4PWKA 3DJZA 1NC2A 3HHMA 4M3JA 4DFIA 3BWUF 3OJ2C 4DO5A 1HTYA 4LNVA 4IHBA 1I7UA 5JORA 5B3JF 2PMZA 4BH7B 1PLCA 5DZJA 2GC4C 1HDMB 3MZGB 3GT6A 1TCRB 3NSXA 1E5BA 1Z5HA 3UAJD 3BIKA 4F8QA 3I75A 4WHYG 15C8L 2JIXD 2H0EA 3OKLA 3TEXA 5C0ND 4IRSC 1HZHH 4TUJA 3G08A 4FL4B 4XI5C 5I1JL 3O6FA 5EO0B 5CP7B 1NDMA 2IXQB 3ARYA 3SGKA 1LE9A 5IB1A 2YPVL 3ASNB 2VERA 4HUXB 2E75C 8FABB 3HZYA 5A2FA 4PBXA 3L6FA 1EJ8A 4LQ1A 1A6TA 5D6DC 3QVAA 2IANB 1L3NA 3VXOB 5CJBA 2X9ZA 5EFIA 1Q0EA 4BWTA 4M6OH 4N6QA 1FSKB 1C1EL 1BZ8A 3AWEA 2DQJH 2J72A 1U92B 5DHYB 4LBEB 3LSOA 1IL1B 4H8HA 4RDQF 4AQ8C 2YD1A 2DQUH 4YZFF 4NT6A 5EU4B 4WK0B 3AAZB 1QO3A 4Q9QH 4XX1G 5GXBB 2P1YA 3LRHA 4LSDA 1M1XB 4L1LA 4B9KC 3HBZA 3EO1B 4NRXA 4UT6L 2X7LA 4M43H 4QXGH 2OTUB 4X7EC 4XVSL 1J9RA 3N42B 4KQ4L 5IJBC 4GAJH 4TVSa 4BDVB 3FRPB 3CVHH 1QATA 5C0BE 4X5PA 4ONFL 4Y7MA 4DT2A 3Q05A 4HOMA 1EWHA 1NMBL 2K7QA 3NQKA 3CJJA 1BJ1H 5KN5B 2UY6B 4FQXA 4AM0B 3T0EC 3QJHA 5L4FA 3E8VA 3LHAA 2YPLD 3RNQA 2YA2A 4GRMB 2X53A 1UENA 1NCWH 1OSZB 3DYMA 2WNWA 5I76B 4LKXA 2NNCA 1K8DA 4QR7A 3C2SA 4JUTA 3NIFF 1T1YA 2C9PA 4PGBB 1RULL 4PW9A 3D39D 4HK0A 2AJYH 4LCVA 3FOLA 4FL4C 5D7IA 2C9XA 3VD9A 4M48H 4OJDH 2PO6A 3GINA 4XZ4A 2A4EA 4Z7VA 3IBOA 4AZ8B 2XICA 3DGDA 4PG9B 2WQWA 1B0GB 1UWGH 2R1YB 3ZE0B 5L7XH 1CO1A 4XBPA 4RRPG 1DANT 4TLUA 5DEZA 1N3NB 1ETZB 3JV4B 2CO1A 2GAZA 4PRHA 4XPTL 4TUOB 2WM0A 4MDRA 1MF2L 4TLKA 1RCYA 4TSAH 3QBTB 3UXFA 3QDJD 1OB1A 3BP7B 2PTUA 1OV8A 3DX6A 4PRPA 5EF2A 4RFOH 1A1OA 4JKLA 3Q1SH 1FH2A 1KEGL 4JQVC 3ZKXC 4YZWA 1BW8A 2MHAB 2CDEB 4Y5VC 1U8OB 4EI6B 2UXVA 2NMSA 1EXUA 4P4RB 3VI3E 2WAHA 1KULA 1CN4A 4ZFQA 4X9HA 2F53E 2XQYG 3D18B 5C2BH 3F84A 3UIZA 1WD9A 2QKIC 1A3ZA 3ZE1B 5TE6L 2NY2B 1MRDL 1XGRB 4Z3GA 2UUDH 5KW9L 1QHOA 4BXSV 1LM8V 4HKBB 4ZI8A 2ZG2A 3V2AR 5IT2L 3DX3A 3G7TA 3V4UL 3A21A 3M1BA 3RKDC 4KY1L 2M1KA 4GAGL 4NC1E 1PF3A 2WKGA 5T3XD 2BRRL 3MXVH 1Q0YH 2VC2H 3S5ZA 1E50A 5FCUH 4Z7NB 3SE4C 4XP6L 4P9HH 1MCFA 2V7NA 4LVHC 1U42A 5HHMB 3U1QA 1OP3H 3VO0A 4OLVL 1AGDA 3TBWB 3GBML 3LS4H 3SSGA 1S7VB 1EFXD 2I07A 2AQPA 3RWJB 3RZCA 1X7QA 1PZBA 2BXZA 2IOIA 1N10A 2VT0A 4IKLA 2ICWI 4XMLL 4K3EL 1NC4A 3HG4A 4O2CB 3FF8A 3FU8A 4GRLA 3FQXB 4BK8A 1ZHLB 2FUQA 1YNKH 1TR7A 3DVGA 1VFBB 4IEFA 4E41D 5IEHA 3MLRL 1FV1A 1KLGA 1FFPB 2F18A 3IB4A 5F6IB 3JTSB 3TYGH 1QBLH 4W6YB 2O5ZL 2VDLH 4CNIB 1XGTB 1UWXH 2BZDA 1IGIL 4PJ9B 3L5HA 5DK0A 3O81A 3IU3A 1E28B 1I1AD 4V1DD 4C57C 1Q9KB 1Z1WA 2WCSA 3NK3A 4QD2E 2VIRB 2VJ0A 3O3DA 4C4UA 5SWSB 2DH2A 4CGUB 4F24A 2NR6A 2YD0A 2X2UA 1B88A 3IDMA 4WTWA 4AGNA 4BQ6A 4LLYA 1JP5A 3C5XA 5L8JB 5T33L 3U7WH 1Y6NR 3APNA 4QRPD 3PL6A 4U3SA 1N6QH 2EEAA 2EZ0C 2BNQE 1UKTA 2XZCL 1DQDH 3EAKA 3FQUB 4LGRB 4QOKA 3BSZA 4QUOA 4Y5YB 3WTYA 2WSPA 5DSCA 4FFZL 5JXED 4G7SB 3P4OA 4NQED 4F8TA 2WSDA 2WLZA 1M71A 4O00A 3DX4A 4TPRL 3SE8L 2JELL 5LXVA 1N64H 3QUMB 3ZOAA 1PL3A 2MNUA 5A3IC 4PJAF 4YQXL 1T1XA 3O2VH 4WTXA 4KJYA 3RFZA 1NBQA 5E8EB 4AC4A 5AW4B 3L17A 3CV5A 3GKWL 2CO4A 4E5XA 1X5HA 3U1SH 5C0EB 3HZKB 4P06A 5G5DA 4POZD 4MDJA 1D7BA 4IDJL 4JGJA 3WG7B 4AGQA 4HJUA 2BNRD 3K6OA 2ZCLH 3C08H 4AG4L 3MRFB 2W07A 2XZQL 4LL9A 4CN6A 1BHGA 1FYTE 1FNGB 1JXDA 1WZ1H 1E27B 3KD4A 3FQNB 2JJSC 1HAWA 3N91A 3NJFA 4ODWB 1AHWC 3PHOA 5ENWA 4L8SB 2VZTA 5HHPB 4MVBD 3G6JA 2BK8A 4ZFZA 4PTUA 2RHEA 2HSIA 2IPUG 2WCGA 4QIRA 3RWGB 5BO0D 1EMTL 3TT3L 4JO2H 5GJSL 1ZLUK 1YEJL 3QCVL 4IM8A 1KCSL 5EZIH 5F6HJ 2RCSL 3WYRA 3E3QC 2ENSA 1OE1A 3Q2CA 1F58L 1TFHA 2WOYA 2X88A 4I77L 1B2WL 4GEJA 4K07A 1VDGA 3L2LA 3LXBA 3C5JB 1AGBA 2E46A 1IE5A 2X12A 1B4JL 2HKFL 4Y5YC 4CL7A 3I50L 3DXAE 1TQWA 1A25A 1FFOB 2YPLB 1JZ7A 1G9ML 2KT6A 4LSTH 2YEQA 2DQCL 5GGSA 4TNFA 4ZOAA 5KSAD 3UAJC 3FB6A 3VNZA 3WFBH 3PDOB 5CBEA 5CO1A 3EYOB 2ZX8A 5C0NC 2AF2A 1ZT1B 3AU1B 1BXUA 3CFNA 5K59E 3DTXA 1KN2L 3HNTH 2ZUUA 3BSGA 3SIKA 3QQDB 3A6BH 4PJGE 1A7QL 3BVVA 1DO5A 3DTDA 3DVNA 4WWKB 4Q6KA 3WAJA 3HG1A 1E4KA 3V0VA 4XXCA 4YDVA 5IQMA 4J8RA 1INEH 5IROA 3BKMH 2Q5BA 2PXYA 3ZHNA 3Q8EA 4I4WA 3P40A 4QRRB 5CBAB 4DP6X 3D25A 3OF6D 4UT9L 3SJVA 3HB3B 1HXMA 1P4IL 4FZ8L 5CXPA 2HZHA 3DIFA 2WQ8A 4NPYA 4Z3FA 4RGND 1OANA 5JLZB 1FJ1B 3HE6A 3OZ9H 2YK1H 3QNZA 4M7LT 2UZYA 2DS4A 3U82B 1JBJA 3BGFB 4RESB 4FYQA 5CEZL 3U4AA 1NGZA 3W2DL 1NCOA 2DL2A 3TO2A 4D0BB 3BYYA 3ABGA 4WWOA 3HUJA 1N6VA 3S35H 3CN1A 5EBWA 5EBMA 5ESQA 4K3JH 4K94L 1NCJA 1HFUA 3QFJA 4OF5A 4U6XB 5I71B 1F45A 5IJCC 4MD4A 3WFDL 1NGPH 4FFWD 3TIEA 1YEDB 1QABA 4XOAA 1P4LB 3MGAA 4GS7B 5IMLB 4XVUD 5CGYC 3VAEA 4DTGH 4KOCA 5CJXC 3FULA 4I3SL 1A7BA 1T04A 2FUTA 4KI5D 1EFXB 2O93L 4AX3A 4Y7OC 4H8PA 2AK4D 1CL7H 3LEXB 3LN5B 2BVYA 2V37A 1T22A 4ZXBD 2XBTA 5ICZA 4LOFA 2YRLA 5D1QA 4R26L 2FD6L 4JHAH 1YEEL 2YUZA 4MMXA 5DJ0B 4PWEA 4S1RH 4E41B 4PJFF 3F7KA 4R8WL 4TQHA 5D7IF 5ITBH 4Z7VF 2XQYK 1QLRB 1ZLVH 3W9EA 2XETA 3GSVB 3KWWB 3FQYA 5HYJA 2ESVD 1MFBL 3P4NB 1DVSA 4JZJC 4R7XA 2XKNB 5EU5A 3O4OC 1LTXA 3VXTA 4DP5X 2FBJL 2E7LA 4L8BA 3RLSA 1F97A 1AXTH 3WFCH 1F41A 1L4IA 3G5ZA 3P02A 1P7HL 3GSXB 4Q4IA 4LESA 5J5EA 2GUOA 4I0PA 2VQUA 1UJ3A 3WTWA 3IGKA 1UZGA 2GJZA 2F0CA 4QRPB 1KBVA 3OR7B 3HI6L 4XNYH 2XBZA 1A3QA 4B9CA 5CSGA 2Z3FA 1EGJL 5AVRB 1ADQL 3INOA 2BCMA 1ZHBA 1CFBA 4GSQA 5MI0C 4QRAA 3LQAL 2HFFB 4PJCE 3ZR6A 5FYKD 4DN4H 1ID5I 1ONQB 2H0PA 2WVSA 4UQ2B 3ULVF 2HLEB 3FSWA 2AI0L 4UNIA 3QPXH 4AJVA 1A14L 4KV5E 1SFHA 3OM3B 5AW0B 3LRLA 4F1SA 3T3PB 1DJWA 2GVYA 3APCA 1PG7X 5JPNC 4AIZA 1J5DA 5F9DC 3CSYB 2QV2A 4AC2A 2HX7A 1GGUA 3GPEA 1KIRB 3L1FA 4ALAH 3AG2B 2JK5B 2NT0A 4U7SA 3IGAA 5T1MB 5IZ7A 5L9DL 2CBOA 3VFVA 4JRWA 3HR6A 4FQJH 2WINA 1XF1A 4U05A 5AB9A 1D5XB 4H40A 4FNLH 1O0VA 1YO4A 4UTAA 2QFPA 5FHBH 1A7RL 4U33A 1CDYA 5JMRA 1I1AC 1ZY9A 2VLKD 1BF2A 2XXCB 3BE1L 4QHPA 2EECA 2X4NB 4TQIA 4PJIA 2OMTA 3NJJA 2KC0A 4AXWB 2OAAA 1QSFE 3NJLA 4HIXL 3RVTD 3O6LH 4IBVA 1AO7A 4GP4B 3T1FA 4DZ8B 3VXUE 4ENED 1G7MA 4LQFL 1ZHKA 1MY7A 1WICA 4TS6A 4UTCA 3L5IA 4XMPH 4YR6A 3V55A 3UERA 5D4JA 1IBFA 5AYQA 4PS4H 3IJYA 1U8HA 2KUTA 3MGOB 4L5FE 3OWRA 3KXFD 3QDMA 1UB5B 1YN7B 4HSCX 5F70A 5JXEC 2APFA 2L8AA 4J8QA 5FV1L 4NDMA 4CDHA 1FFTB 2JCCA 5IW1A 1T03H 5AUMA 3D06A 3R0MA 4NQCD 3IDNB 5GSVB 3Q2LA 1MAML 1YPZB 2G4GA 4N5UA 1OP5K 2YXWA 3OHXB 2HVBA 5D7LB 1MH5A 1ZVSB 5ISZA 2PPAA 5B7FA 3BP4B 3QEUB 4HPYH 4GXVH 1R3JB 4JL2A 2XWXA 1AGEB 1X5IA 2P8PA 3I2CL 4QYOA 5FM5M 4QHLB 1RV6X 4AKQA 1HOCB 1TVBB 3QQNA 2IPUK 4OIIL 1DVYA 1U36A 2R0ZL 3PPEA 4OKVB 4WI0B 1A9VA 1FL6A 2QHRL 3FUHA 5MENA 2G5RA 1XIWD 3K8MA 1F4XL 5B8CA 5FV2A 1QPKA 2VXVH 2PCPA 3IRCA 4MVBC 4R0LB 4URTB 1G4MA 1NL0H 3T6ZA 3E8UL 5D2NE 3B2DC 1ICTA 1EO5A 2VM9A 1T6WA 3AG3B 2DICA 5LXGH 2WNKA 3U46A 3X12A 4N6RB 4YE4L 3BW9B 3L4WA 4AUUA 2BSTB 1MCOL 1S78D 3CH1A 3KM2A 2ZJSH 2VDKL 3MLWL 2HJFB 3NFPB 4JRYB 4M6NL 4S2SB 5I19H 1X5MA 4ISVA 5DHVB 5FFOA 2J8UB 4XCEB 3FFCD 3EOBB 3CC1A 2CKBB 3G6JF 1OP9A 4G8FB 2CDFA 2KPNA 5E2JA 2B1HH 1X7TA 4HCGA 1JGEA 5DVOA 5LGJB 3TXAA 5DEFA 1BQHB 3OTTA 3KGTA 2FX8L 1ZGLB 1JZJA 2Z7WA 2AW2A 3STBA 3KDPB 4KKNA 2YGVA 3CAFA 5KSAC 1IGJB 2F15A 1JI2A 1SYVA 4OF0A 1G6RA 4U1NA 4UTBL 4XN2A 5CS7A 5CGTA 3OHXC 4EIZC 5FM5O 1T4KA 4ENEC 3QHFH 4AITA 3ILQD 4BUGA 3DLQR 3UOAB 4KRNA 4X5WB 4LLVA 4B9GA 4M61B 3O2DH 5HGDA 4WUUB 3GM0A 2CJ3A 3FAWA 3WTVA 2EO9A 3JWNH 2WGXA 3ARFC 3MJ7A 4PIRF 1G7LB 2YRBA 3SDDB 1J0JA 1DQML 4EJ1C 2P80A 4IKNA 4G7QB 2QQLL 4J3XA 4JFQB 1OQOA 4F7EA 1QTPA 5D1ZD 3WL9B 3CFUA 3G5VB 3MBEB 1ZKAA 2MCPH 1BEYH 2BWDA 1OQXA 4JPKH 4GBXA 4RGNC 1QG3A 3PGCA 4MAUL 4PJDB 4UINH 1KB3A 3S3SA 4PGEA 2GK2A 5A43C 5ELIA 4DGVL 2EINB 4N87A 4L3EA 1MWAL 5BJTB 4UQIM 1HVXA 3IFNL 3QQ3A 4XPBL 3VD0A 4O51A 2PPCA 4Z77A 4HUVA 4UOW1 4FDWA 4J28A 2QLYA 3RKPA 1ND0A 3GUTA 2EADA 2H2PD 5MHSE 1E6OH 5EZOH 1GCFA 3TZVB 4Z78A 4R83A 1IM3D 4K9EC 4UM9D 5IVZA 3L3IB 2W5PA 2AJXL 2WZ6A 4ODTL 2OMBA 3BZ5A 1JNJA 3ALWA 4MHHI 3CU7A 4JCWA 1SDDA 4WNJA 1MELA 1U6AL 2G2RB 4QCIB 4YSTA 4OGYH 2O6EA 3BI9X 1JRHH 3GSWB 4XVUC 3HUJF 3D4ZA 5DK3A 3QIBD 3CFEB 4GXUM 4KI5C 4NQXA 3VMNA 4TVUA 4G11A 3VXSA 3AS1A 3CK0H 4AGMA 1OGTB 1PX8A 1QSED 1DLFH 1UT2A 3S0PA 5ACZB 4ZXBC 4L05A 4R4FL 4H8UA 1WIUA 1H9VA 3Q8BA 5FYJH 2AANA 4PJEF 1IC7H 2P52A 3HFML 3MBWB 3M1CA 5JR1L 1IC4L 1RIUH 2GTWB 5CIPH 3L3OC 1RK1B 5D55A 2QDWA 3NQIA 1JYNA 4QDGA 5I6KA 4BEIA 3OJVC 4JJOA 3C6LA 1BVLA 4AK2A 5C6TL 4XC3L 1UACH 1Q94B 2HRGA 2LVCA 3EUDA 4NZDA 4LNRB 5IGXH 2VLKB 5ICXA 4MQXD 4U1KB 1XGZA 3FCGA 4QRQA 1KB5A 1U33A 2H1PL 2WKOA 2E56A 4PY7A 4Y16C 3PPSA 1ILUA 4FOMA 4YL9A 3DGGB 4U2YA 4XCNA 2NLJA 4LB8A 1GW0A 4WV1A 5C0IB 2OI9B 3NFSH 1XCTA 3LHPH 2FNBA 4YH6A 2J21A 1P1VA 2VITB 5HDOA 4B7IA 3F62A 3IJ8A 1MPAL 4QTIH 1ZGLM 3O0RH 3J07A 1KN4L 4P5TC 3MUJA 4FXLA 1KXHA 1JSYA 5JIQA 3ZX1A 5IVXF 4XNXL 4PYGA 5IHUL 2NNRA 4JDZB 2BOCA 5E8DH 3P30H 2BIQA 2H6PB 3VX1A 1UM6H 3JWDH 2Z92B 2QPDB 1RPKA 1UWEH 2HLAB 4RZCB 4OAWB 3IGFA 2B0SH 4PBVC 4J3SA 5FHAH 3P11L 4QHNA 4DP0X 3BPOC 2NW3A 4DESA 4P2OB 2W95A 3H6JA 3KVPA 3MRMB 4YGAB 3S5LB 3U4BL 1O6SA 5I8KH 2CXGA 1AI1H 2B59B 1GTFA 1Y6MR 1NIFA 5D7SL 4MB3A 2IH9A 3A6OA 3HAEH 1LWJA 4HFWA 1KJMB 1OWWA 2EEFA 1XIWB 1HHGA 5IBUG 2X89D 1CD8A 3O3EB 4M7JH 4HWBL 1FYHB 3GZPA 5AAMA 4CVZB 4GKZA 3I74A 1E9PA 2PW2B 1NFDA 3ME0A 3RVTC 1AD0B 3K6DA 3QAQA 4NM8H 1N12A 5AWNL 4JG9A 4NQVA 4OQ1A 2WLLB 1D6VL 1QRKA 4XP5H 1URZA 1QLEH 2QELA 3SQOL 4X7TB 2FX7L 2L04A 3IWVA 2JH2A 4KUCD 3V6ZB 3PJLA 1FN4A 1HYRC 1K6QH 2OL3A 3BQUA 4PJIF 3IPEA 3EJPA 3ZU8A 3N1MC 4GI6A 1TU2A 4GY4A 4Y0GA 3T6QC 4OGAD 1J1PH 4BCYA 2XKSA 4I9WD 2AV7A 4LHUD 4LLWB 4HUNB 4ZMLA 2HH0H 1CGUA 1I8KA 3ETTA 4O2FA 3RURA 4KNQA 2G2NA 4AV4A 4EQ3A 3LKNB 2ICEB 2XWDA 4X2UA 3GB7B 4PSPA 1Z7JA 1F3JB 1MUJB 2JCCF 5D4HA 5T8IA 2YGQA 1RZPA 3HC2A 4UDUA 5I5RA 4HCRH 1B3JA 4NN6C 4TNWK 1XIWC 4DZBB 1FO0A 1YJDC 2UXTA 2BWIA 4ORGA 1MCKA 3T2OA 5F7KC 4H0HB 3RTQB 2H3XC 3HI5L 3IETB 4HH9B 4JPWH 3F64A 1SOKA 3CSTA 1P5UA 1F1DA 2X4PB 3DOSA 2ICWJ 4H0IA 1U8JB 3FQTB 1I1YA 3ARDA 1N4XH 1S78C 4FXKB 3HZVA 3ULUC 4G43A 1FRGH 4ONOA 4ZOEA 4BK5C 2FSEA 1XL4A 3NIDF 5BQ7A 4N5ED 3E9TA 4HJGA 2FL5A 4GG8A 3WJMA 5IFAL 3I6GB 4UUJB 5C0DA 1LEKB 4MBOA 4ESKA 3FC8A 1R34A 1EVUA 1AQKH 5JQIB 4QKTA 3H3PH 4ZUSA 1M6OB 2B14A 4ZDHB 3JZ7A 5BZWB 3LEYL 4MHHG 4NCDA 2VL5A 1IVLA 2WXLA 4PJ6A 3ZPDA 3MYJB 1AR1B 4J3OG 4LIQH 3MXWH 2ETWA 4OM0H 5CUSH 3W37A 4FF9A 2TSAA 1A4JB 5T5FH 3WNLA 4U3CA 5I2IB 2ZOKB 3ILQC 1VGEL 3CXDL 1JGLH 2ICEC 3HS0B 3QIBB 1D3CA 5T1KD 1WBZB 4L5FL 3LKSB 1DVXA 1RJLB 6CGTA 5M95B 1T7VA 3II1A 3WXVL 1S7UB 4GLRI 4HX1B 2I9LB 3IDYB 4N22A 4Z3EA 3T4AC 3MNDA 4KVNH 4CN1A 1JK8B 3OSKA 3FO1B 4ADIA 2AXFB 3FU9A 5AVUB 5D1ZC 4EI5A 2F68X 4ZW7A 4WJ5B 1MI5D 1FH5L 4KXZI 3K2KA 5D4QA 3OR6B 4JFPA 3RB7A 3W9DA 1RH8A 5L4MA 4W9HC 4X7CC 3D0LA 4PJ8A 2VLME 4DGIL 4BHUI 3OLGA 4OSUH 4ZG1A 2B2XL 2FGZA 3VRIB 3WENA 5L2JA 3TS8A 1MNUL 1Z32X 2C9UA 4LOEA 4A66A 4NO2A 3R7RA 5FUZL 4N90D 2F74B 4N2CA 1S9YB 4N28A 3EXJA 5DD0L 3RNKB 5BRZB 4RIRA 2X42A 3SCMA 3DX0A 4NEHB 6TAAA 4C4KT 4P5RA 4R96A 3X1EA 1IGYB 4FKHA 4FP8L 4B53A 1CLYL 4F15C 3DVFA 2W0KA 3V6FA 1YYLH 3NH7L 1NBVL 4L1TA 4RWYH 1GYCA 5HYEA 4OFYA 1S7QA 3VVVA 4RBPK 5AAWA 2ZXAA 4MKMA 1ITBB 1A6WH 3NDYE 2EDEA 4GAFB 1JWSB 4U49A 1ZGLP 1QVOA 3ERXA 3NCCB 1U0QA 4L1BA 4XN9A 3RWEB 2F54E 4KPHH 1DEEB 1WRFA 1YNTA 3VFWB 2YAQA 3TEZA 2AXJA 4K4KA 1FP5A 1BV8A 2UWEA 4O02H 1RJYB 1LE5B 2FGWH 4PBWD 1LEGA 4DKFL 3L45A 4H0GA 3CZFA 1M53A 4MXQD 1LK2A 2K3TA 2R2HB 3MOBL 2W1NA 3GSNA 4FLOA 2R0WL 4KK9C 1D6EA 2JJVA 2V2XB 4MQXC 3RVUD 3DBXA 1JF1B 1BFSA 1WGOA 4Q2ZB 4RNRA 4BKTC 4BSWA 1W72L 5CEZD 1RLWA 2CR6A 4FNRA 2AMGA 2VLJB 2XX0A 4KHTH 4YHIB 1OCCB 4ZS7L 5C0RH 3NJMA 1JIBA 1PLGL 2QGDA 2OW6A 5B3NA 5TH2B 1WGVA 3O41B 4LASH 1E7VA 2WKOF 2WV3A 4CU6A 2JXMB 2YWZA 1PMYA 2W91A 3HC0B 5CD5D 1E8WA 5J56B 1JPFB 4FNPA 3ZUCA 4F8PA 2D7MA 2BY2A 3LRSA 5DVKA 1PY9A 4PS8A 3BLKA 3DROA 1QBBA 3EYFB 5DYFA 1NLDL 2YQ3A 3V0WL 1WBYA 2EC8A 2QGCA 2EIMB 4YDKH 5AVYB 1AMYA 5CD3A 4CC0A 4C56E 2Y1AA 3GK8L 4H7VA 5DK2A 4EBQH 5KJ7E 2XFXB 1F0LA 3GSQA 3IFLL 5JUEL 4OZHA 4L1SA 4H4NA 5KBMA 3WE1A 5KYUB 2BIIA 3LTVA 5D6DA 1KGXA 2UVEA 4A7SA 4BSJA 3QIUB 1ZWIB 5KTEL 4X6DE 2KKQA 2CJUH 3ZHLA 1N5AB 1R1CA 2GBAA 1JCKA 5IM7A 1EAPB 4AQ8A 1DANU 5DMGD 1B9ZA 1JXKA 5DC4B 4U6YB 2AC0A 3S37X 1TJIL 1A6UH 4QRBA 5J3HC 1OB0A 2B3IA 2DQHH 4EN3A 3SDCB 5KVFH 5C6WH 2Y5TB 4D9LL 2DDQL 2MCG1 1J0YA 1IRAY 1G5AA 2OBGA 1DR9A 3ZE2E 1DP0A 2CLVB 1XXFC 3ZDYB 3K1DA 5JW4N 5L8LB 2BDNL 5I1CL 2XQ0A 1CFMA 2F5BH 4RRPM 3TCTA 3ZYZA 3BAIA 3PP4H 4JFVA 1RZGB 2YAHA 3WNKA 1HDMA 3NSYA 1TCRA 5L8KB 4RGOL 1OAYL 1NFDF 2O6DA 3FO2B 4XO3A 4OGAC 1QBMH 2Z4TA 4QRTB 2B1AL 4HEMA 4TMPA 1NAKH 4Y1AB 5BZXA 5C0BD 2C9QA 2APWA 1S7WB 2IBBA 2CSPA 1IGCH 1ZTXL 3SKJL 1J5OL 3EO9L 3JT0A 3LZOA 3M8OL 4FG6D 5ALBH 2PYEE 2FB4L 4HUXA 3X3GH 3B6SA 8FABA 3V5DB 2UZIL 5DEGB 4KGJA 43CAB 4BUHA 3ZL2A 2B39A 2IANA 5DFAA 3C09C 4AQAB 3WY4A 5F9JB 1U92A 5DHYA 4LBEA 1IL1A 4KK8C 4Y4FD 4BH8B 1GL4B 3DX8B 4LCCC 4JQVA 2DM2A 5EU4A 5KSUB 1AKJB 3AAZA 2YEVB 4Y5VA 3UIYA 3EOTH 5JQHC 4HS3A 2GJ6A 4PWIA 3EO1A 4OCXH 3Q48A 4XAWH 4GQ9L 2OR9H 2RACA 4HUKB 2R23B 4W9IC 1MI5B 3BJ91 3RPBA 4R97B 5ILTL 2C4FT 4BDVA 2QKIA 2DEWX 4AYID 1HSAB 4YNYB 2OTPA 5T1LD 4XBEH 4N5EC 1UA6H 2ZCHL 4BK4A 2UY6A 4AM0A 4HC1L 5CN2A 1OL0A 5D2LB 4H25B 1DFBH 4LDCA 1XSOA 3FONA 5IQ9B 5IHBA 3R06B 2WLKA 1OSZA 1N7MH 3BEWB 3OKNB 1SEQL 4MWFB 5AW3B 1JK9A 5LBSA 1TTRA 5E6UB 5EZLA 1I7ZB 5F9WC 5AW7B 4HW6A 1VIWA 5EBLB 1S9VA 1UT1A 1K2DB 2VMEA 4LU5L 4AZ8A 3ZDXF 4PG9A 1B0GA 2R1YA 4E9TA 1XGUB 3ALPA 1N3NA 3T0AA 3JV4A 3NT0A 4UNVA 2XJLA 4TUOA 4IMLB 4LPTA 5ETUB 3ESMA 4G6KH 3TEYA 4DW2L 4LXFA 1RUAL 2WXRA 2FT7A 3EBIA 4R90H 3ULSB 1M05B 1CDBA 1ROCA 5F89A 1RVFH 2VQ4A 3BP7A 2IAMD 3P2TA 1CBJA 1MRFH 3GXDA 1AGFA 2Q2LA 2YHGA 5K33A 1HXYB 1YQVL 4BZ2A 5I1EH 2E6QA 2CDEA 1A6AB 4AYEC 1H3PL 1U8OA 4EI6A 2MIZA 2VKXA 1RUPH 4NO0B 1CXKA 4HZ1A 4WIQA 4YIQB 4WO4C 3D18A 1JMZA 4E68A 1KBGH 4R7VA 3JYBA 4BFKA 2HAZA 4Y2NA 5E95B 4BWWA 5DURD 3KPRB 1XGRA 2N0MA 4HKBA 3BAEL 2EKJA 1MCSA 4BGDA 2FLRT 4W81A 2CWRA 4NYLB 4WGVB 2OMXB 5BS0B 1W8EA 3TJPA 3UJIH 1JFQH 2A99A 1PS3A 1KGJA 2ICWB 4ELKB 3US0A 3MOQA 2VABB 4YXLH 3TBWA 4URKA 3MBXH 4OQTH 3UEQA 1RUKL 1G9MC 3OPUA 4U1SB 1P0SE 4TN9A 2Z7YA 2GSIB 1BBJB 2A9NL 1XGQB 2Z35B 1TQCC 1DBML 4JFZL 3F12A 4O2CA 3FN3A 3Q06A 4JKMA 3FQXA 5IF0A 1ZHLA 2VXQA 1E7UA 4RMBA 1FGNL 5CM1A 3L3KB 1NGXA 1NKRA 1L7TH 1RZIB 2O72A 1NCHA 3N0PB 1FFPA 2XWBB 3QI9C 4XVOA 4ZX5A 5EUOB 3WNNA 1O9WA 3JTSA 5JPMB 2XN0A 5DUPL 1EDHA 3AWFA 3VD7A 3N41B 4TF4A 5CU5A 4ZFGL 5E1QA 1XGTA 3U48A 4H26A 4FFVD 4Q9CA 1AHWA 4D3CH 1A0QH 4OR1A 2AEQL 1RIHH 2A9CA 4WSGA 3GLDA 3TYFB 4OV6F 2VIRA 4MXQC 5SWSA 2Z7UA 3RAJH 4TXVB 4AIEA 4PB0H 5I6XB 4G7RB 3AABA 2A9AA 2OSWA 3RVUC 5I6MA 1DEDA 2X3BA 3SGEH 1FAIH 3THMH 3QO0B 1Z2KA 2R0LL 3VGGA 2N4IA 5CNHA 3DRQB 3BUYB 4K7PY 3AMLA 1YEKL 2UWEF 1ZMYA 1U3HB 1MFNA 5FW7A 2DQIH 3FQUA 4NI6A 2AV1B 3D8MA 2FT8A 3EGXB 4ODXB 3FF7A 4Y5YA 2P46B 2AITA 1S7SB 3PWLB 1RK0B 1BX2B 3ESVF 1T83A 1AYRA 3KJ6L 4HIHB 4JY5H 1CR9H 4K94C 4P3CH 3NCYP 1F4HA 2KQNA 2RMNA 4GB9A 4KZEL 3L3JB 3IGUA 1F2QA 1SM3H 4XODA 1Q90A 3QUXB 1AS6A 5FA3B 3UAJA 1P84K 4H8WL 3D52A 4OB5H 4OJFH 2PF6A 2ZWZA 2JIXA 5E8EA 2VMDA 4Z9KB 1USQA 2FT6A 5C0EA 2C1OB 3D3VE 3HZKA 5C0BB 1U3NA 3DX7B 5CHNB 5EIIG 2FEEL 2UVFA 4HIEB 3W3BA 1I7RA 3OGCB 4HXBL 5DJCB 4DGYL 4X9IA 1U8NB 5JPMC 4UDTB 1G6VK 3SGJC 4DEPC 4JG0H 2KDYA 1PCXA 4MD5B 2OMZB 5E9AA 1FNGA 3QHTC 2QPFA 5ITFB 3FQNA 2A6JB 4AGLA 2FX9H 2WW8A 5J13B 4NHUB 1IFHL 4GG6F 5BV7H 1XBDA 2GFBB 3I3EA 4L48A 4W1TA 4HGWA 4J3UA 3RWGA 2AS5M 5DMGC 1YEHL 4MS8D 3VDCA 5TGBA 2DMKA 4G9DB 4H5SB 2HMID 2Q10A 4OZHF 2CQVA 3DSNA 1JNNL 1MDTA 3PFUA 5EOTB 4YSCA 3RGVD 1TKWB 1QR1B 1OW0C 5DT1L 3QP3A 3OAUH 3X17A 1KZYA 1TYEB 5F7EL 1XD0A 3MNVB 5T1LB 1JGDA 1UXSA 5C3IA 1S9WB 2M83A 1ZDQA 1VEOA 1FVDB 5F1IB 4MXVE 2J1ZA 1FFOA 2YPLA 2EH8L 1DQQB 2W8CA 3PNWB 2YFNA 3VG0H 2CJSA 12E8L 1CLOH 4OGZA 5AZ2H 3Q3GB 4ALAC 2ZUVA 3PDOA 2D7TH 2DM7A 3WAKA 4KMLB 3VI3B 4RFOL 3EYOA 3F05A 5DRXA 5HHQB 1ZT1A 2DQEL 2F53B 3D39A 4PUBH 3UADA 3AU1A 5CJXA 1KCLA 2X9XA 5C0DB 4OLUL 4RAUB 2APVA 4MX7A 3KLDA 3G5XA 4CU8A 1MHEB 3O2WL 2W92A 4FG6C 1PNCA 4WLCA 1OCWH 4ZD3L 3V6OC 3RL1A 3BJLA 1AFVL 4MJ6B 2R56L 4XP1H 4WEBH 3KVQA 5HHVL 1OZTG 1PPIA 1WDAA 2IGFL 5ANHA 4Q52A 4QNPE 4Y4FC 5FYKU 5CBAA 4G6FB 7TAAA 3VFPA 2EIKB 2JB5L 5E7BA 5A7BA 3A4EA 4KY2A 4OCLC 2KYIA 5JLZA 1AZRA 4P5MB 1HI6B 2VH5H 4TM9A 1FJ1A 2N56A 1AZCA 2VR9A 4JZJA 4NFDA 3TBYB 3FCTB 4W9ZA 1XF4B 3QZWG 4O9HH 1I1RA 1NMAL 2OJ1A 1QBAA 3NCYS 1N8ZA 1W8NA 1TETL 4RAHA 1YEFL 5DURB 5TK4A 4D0BA 2FATH 4PGDB 2OP4H 5E1AB 4BE5A 2VDKB 3O6ML 2FQGA 2P7TB 4PTTB 2CLZB 2L4OA 5ICYA 5J11C 4W4OC 2XRAH 4U6XA 1YEGH 2DQ6A 1EV2E 2FDBP 2AQ3A 3MRIB 3QS3A 4OCWH 1P4LA 4Y4HD 5DVLA 1T5XB 3DUHA 3BVUA 1ET5A 2IFFH 3REWA 1H0DB 4NLHA 5I8EB 3VFRB 4ZTOL 1KBKA 2Q0ZX 1HHKB 1EFXA 1FFQA 2Z8VC 4P8QA 5BVPL 3FQ1A 4Z0BH 4ZUVB 3SO5A 4DFHA 2BSSB 2MCAA 3V95A 2YPKB 5EC1A 5JIPA 3UYPA 4J7RA 1Q9LB 4NC1C 5DJ0A 1IBGH 1CL7I 1HL5A 4E41A 2FJUB 4GW5B 2IAMC 3DIVA 2BFGA 2BNQB 3QB7C 2CGYA 4PJBE 1MJJB 3JUYA 3UABA 1MCHA 3EZ8A 3L95B 4YFDB 3ZE0F 1TIUA 3KWWA 3KHQA 1U4EA 1OO2A 1KLFB 5DA4A 1SYSA 3P4NA 3R1GH 1A7OH 5JXAL 2XKNA 3KJ4C 1ASPA 2KBGA 1C16B 1X9QA 3O3UN 5C07D 1R19A 4PRDB 2R29A 3C6EA 3ENEA 4DIXA 3MRPA 1XAUA 5JYMA 3JWNE 2QGBA 4XN4A 4AMWA 1P84J 3NAAH 3QEGH 1JN6B 3GSXA 4FERA 5EEVA 2FLMA 4XC1L 4P48A 1Z9SB 4N2NA 4S1QH 3KH3A 5HY9B 3K4ZA 3EGSB 4OZFA 4XNUL 3WO4C 4ZYKA 1MWAB 2AVGA 4QRPA 3OR7A 1BZ9B 3FH7A 4ABUA 4YSPA 1JPGA 1MFMA 3GTNA 1FYTB 2DQGL 2QVIA 5GS3A 1QI3A 2ICCA 3B9DA 3ULVH 1JYWA 3ZE1F 3QJZA 5FOBB 2NOYA 4NWUH 4O5LL 2A6KB 1U21A 4NQEA 3LZPA 2HTKD 2OX5A 1CK0H 4XMWA 4U4IA 1HCFX 3BLBA 4UQ2A 5F96H 5E4EB 1W0VB 1EEZB 5F7FA 1N5YH 1I9IH 1KY7A 1XTLA 1LQBC 4RQQB 2OYMA 2B7DT 3LQZA 4PRAA 5FGBC 4Z7NF 1WWWX 4MCYA 3CSYA 1JPTH 1P7KA 1WPCA 1KIRA 1I31A 2DIBA 2WPGA 3DIDA 3V4PB 2JK5A 4RAVA 3EHBD 2PTTB 4NO3B 1GZHC 2YEZA 2BNRA 4HVBA 3DXAB 1EA9C 2VR5A 3F7RA 3EDDA 3IDIA 3FU6A 1D5XA 4O58L 1JGVL 2GTZB 2HP4A 4FFVC 3TURA 2BH0A 2Z4QB 1J86A 5CR1A 1I4FA 3U25A 2ADYA 2X4NA 4AIOA 4G6AD 4AXWA 5I1GH 5FYJE 1SVZA 1LO3L 1ACXA 4X0KB 4UQBA 4DZ8A 3F6JA 4F57H 1GCYA 3ZQ9A 4PJGB 4Y88A 5C0CE 2Y7QB 3LZFH 3SZ6A 4NC2B 3RJQB 3TN0B 3NBNA 4B5ZA 3MGOA 4X6EB 5KYYB 3FB5B 5DWUH 3LMJH 1U91B 5DHXB 2HKHH 1T3FA 3RVXD 5I26A 3KYKH 3OAWA 1INEL 3BSZH 4S1DC 3PAZA 4YDIH 2V7HA 1KELH 2CHXA 3VGBA 1AZVA 3IU4H 4K3DH 5E4EC 4YSAA 3QW9A 2PCYA 5GSVA 1HILB 3TVMB 1AH1A 1YPZA 2G9HB 4HETA 1A9EA 1U8MB 3OHXA 4ORZC 2WXNA 4JN2B 5TQ2H 5JW4Q 4YK4B 3QEUA 3CLFH 1IT9L 3GBEA 1X5ZA 5FGCE 3P54A 5GISH 3INUH 5AOLA 2EEDA 1AGEA 3MA7B 5IBUB 4QHLA 2DRUA 1NH6A 1HOCA 1NDGB 1TVBA 1H3VA 1KACB 4N8VG 4WI0A 1FNFA 5E03A 4PRBB 3K80A 1JZIA 3GMMB 3QC6X 5T1DH 5I8CA 3R18A 4LCWD 5CKAA 1DJIA 4JLRB 2HLFD 2H32B 4BZ1A 1T0PB 4GUOA 3CWGA 4JRFA 5C7XH 4HALA 3OF6A 4JKPH 2X4TB 4AEHH 2J4WH 5I1KL 4MS8C 4N6RA 1ZT4B 3BW9A 2HMIC 2Z64C 4NBXB 1TVDA 3LH8A 4XP4L 5F9OL 3S36H 2HJFA 3U7AA 5FOJA 3RGVC 1A1MB 4ZSOE 4G6JH 2Q7YB 1JWMB 1M3JA 2J8UA 1AZNA 4NRYB 3EOBA 1IAOA 2CKBA 1FUNA 2JJUA 3TA4D 3WUZA 4DTGL 4G8FA 3GSRB 3MYZA 2VAJA 5FS5A 1CDJA 2F9BT 4MDIB 3OKKB 4MCZB 3TCXA 3SHSA 5LGJA 1H5BB 1NBCA 1U8LB 2HCZX 4X4MA 4Z7QE 1OF0A 1UVQB 4HHAB 1Q9WA 2ED8A 4ZO7A 4YHOL 3GXIA 2CPUA 3FL7A 4NQSB 2YQGA 5I74B 1IGJA 1OAXH 1BREA 3F3HA 1EHXA 3IS1X 1RHFA 5AZUA 3X1NA 4BZYA 4EXKA 4WHTB 4YK4C 3PWVB 4U1MA 3CHOA 2AQQA 1GJWA 4X5WA 3DO4A 1F4YH 3WFHB 4AOFA 4N9GA 1MLBB 5GGRB 4Z7IA 2VRKA 4LLDB 2GG1A 3FTXA 2UX7A 2AK4A 2YR3A 5AKRA 4MA1C 4R5VA 3AB0B 4DF9A 1T6BX 4XGZA 4ZXBA 3O8XB 3FPXA 4KMTH 2WJ7A 3VW3L 1QFWH 2XG5B 4HXAH 3U6XS 4FAAB 1JXJA 5E1GA 4HAGA 5GGUB 4IKIA 4JFQA 4KZCA 3WL9A 3SQBB 1ESOA 2C26A 4FTVE 4HA1A 4PJCB 3NRFA 2ESVA 1TITA 1EX0A 2WLNA 3DGCR 4XNYL 4PJDA 3M17A 4FRWA 3BVNB 3TH2T 5SWQB 4NLAA 2X41A 4WNQB 1DBJL 1PBYA 1FIGH 4QLRA 3WHXB 4PV1C 4WJG3 4ABQA 1P69B 5C0GB 1OD7A 4M4RB 1J88A 3NJIA 4KZDH 5GS0H 3QPXL 2C34A 5IHHA 1SDAB 3QRBA 1AQDA 3MV7D 1DDHB 1J9SA 1CICD 3I6KB 1BZ7B 1ANUA 1PD0A 2OZ4A 1B6UA 1TPXB 1LVEA 4F33A 2AABL 2G2RA 4OLYL 4QCIA 1NIEA 2AEIT 4Y4HC 3GSWA 1RXLA 3HE7D 2J1XA 1JVKA 1NAMB 4PEEA 1J5IA 3ABLB 4PJ5E 5SWZB 1X44A 2PABA 2CHZA 2NY3D 4FNLL 3NSJA 1QSFB 4WKXA 5FHBL 1Q0XH 1JRHI 1IVTA 3U0WH 2DLFL 3VXUB 1OY3B 4LK4A 4ZBJA 3V52H 2B16A 4B9PA 5MEOB 4Z7UB 1M2VB 4NGHH 3TH3T 3VYPA 2GTWA 2WLHA 1RK1A 3OX8B 1NIAA 5MERA 4TLSA 5AW1B 1KMGA 2J6EL 5DD3L 4JFOB 3UEZA 2EAEA 3EF4A 1BQUA 4PP1D 1MQKH 1TUPA 3Q2WA 4FC3E 4LNRA 1AZUA 4YHPA 2VLKA 3CHRA 2EDYA 4U1KA 1R3HB 2XWZA 4JBSA 4QXUH 4OFIA 2NY7L 3PCYA 2B15A 2VM4A 1FHGA 2FLBT 5C0IA 2BP3A 5FB8B 1WV7T 3SDAD 2VITA 3VE0B 3DJSA 3ARUA 4YBQD 4G71B 4K5NA 3PF2A 2K8MA 4WWID 3UTZB 2VQTA 3NZSA 4XNBA 3IRPX 4HLJA 2HTKC 5K93A 3T77B 5FA4A 4HJJH 4YHKH 5D2NB 3C87A 3U7YH 5MP6L 4JDZA 3DWTA 4U1GC 4MBRA 4ZUWB 5LBVA 4OJCA 3PV7A 3SYOA 2MTAA 2XWJB 4ZMVA 5J0BA 3DOIA 1IUZA 3FRUB 4N3UA 3QZLA 4NQCA 2Z92A 4WI2A 5EU6D 1L9MA 4XHQA 4OAWA 5F44A 1RHHB 1JMXA 3RX9A 5L2KD 2NY6B 4P2OA 3WNIA 1J8HD 2ARJQ 3CUPB 1QFUH 3MRMA 3S5LA 1G1CA 3EHBC 3KW8A 3VD5A 2B59A 1CLZL