2VR3A

Structural and biochemical characterization of fibrinogen binding to clfa from staphylocccus aureus
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
316
structure length
308
Chain Sequence
TDITNQLTNVTVGIDSGTTVYPHQAGYVKLNYGFSVPNSAVKGDTFKITVPKELNLNGVTSTAKVPPIMAVLANGVIDSDGNVIYTFTDYVNTKCDVKATLTMPAYIDPENVKKTGNVTLATGIGSTTANKTVLVDYEKYGKFYNLSIKGTIDQIDKTNNTYRQTIYVNPSGDNVIAPVLTGNLKPNTDSNALIDQQNTSIKVYKVDNAADLSESYFVNPEDVTNSVNITFPNPNQYKVEFPDDQITTPYIVVVNGHIDPNSKGDLALRSTLYGYNSNIIWRSMSWDNEVAFNNGSGSGDGIDCPVVP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Structural Model of the Staphylococcus Aureus Clfa-Fibrinogen Interaction Opens New Avenues for the Design of Anti-Staphylococcal Therapeutics.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell adhesion
molecule keywords CLUMPING FACTOR A
total genus 56
structure length 308
sequence length 316
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-03-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10425 SdrG_C_C C-terminus of bacterial fibrinogen-binding adhesin
A PF17961 Big_8 Bacterial Ig domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1280 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vr3A01
2.60.40.1290 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2vr3A02
5CFAA 2F68X 4MBRA 4LEEA 1N67A 2Z1PA 2F6AA 2YLHA 3IRPX 1R17A 4B60A 4F1ZA 2Y7LA 5CF3A 4F24A 2VR3A 3IRZA 4JDZA 4JE0A 4Q6KA 3IS1X 2Y7OA 2RALA 4B5ZA 4BBWA 3AU0A 3IS0X 2Y7MA 3V10A 4FJ6A 1R19A 4LE8A 3ASWA 4F20A 4LEBA 3AT0A 4F27A 5IHWA 4RMBA 2Y7NA 4MBOA 4JDZB
chains in the Genus database with same CATH superfamily
2C7UA 1PCSA 2VL4A 5F7NC 4FA7B 4C47A 4D9QE 1T1ZB 1BECA 2YC1A 5F9DC 4AC4A 3QDAA 2ARWA 4PHZA 2A6DA 5AVWB 2XVBA 4EDWH 2EDQA 3HLAB 4ZW5A 3GXDA 3FB7A 4FQPA 4UB0H 4KQ3H 5IJVB 1CURA 1P4BL 2KUTA 3VW3L 4XNBA 3BUPA 5F0LB 1E4XH 2XETA 3DHUA 1JMZA 2V7HA 4DGYL 3MRLB 2W07B 1MSPA 3WN6A 4C56B 7TAAA 4EVNA 1FIGH 1YY9D 2H2SC 4J2XA 1OOAA 2DH3A 2C7FA 1E90A 1MCWM 3DMMA 3ESMA 2ZKXA 4OZFB 1AOZA 3X3FH 1U8OB 1S5IL 3MNWB 4XO4A 5FXCH 1OSZB 4P46A 4XCEA 5J9PB 4JO2H 5C7ZA 3MTXA 1PG7H 2BHFA 1AR2A 4WTZG 3QJXA 2GCYB 4PBWD 5EBMB 3VXOB 4LOFA 3KLAB 2PTUA 4DVRL 3BFOA 5F21B 4EI5A 2FR4A 2OMWB 4R4FH 4DKAA 3QUXA 4ZS7H 2ZE0A 4HALA 3IK2A 4TRPL 3C60D 4I9WD 4HXBH 3T4AB 5CU5A 2YGPA 5C07B 1XR8B 4UAHA 2H2PD 2ZWKA 2W0LA 5CJ5A 2DLFH 4RESB 3VFVB 1K8IB 4JQIL 4JRYD 3HVNA 4NWTH 1ASQA 3RLSA 3ASOB 3IMUA 4NQCB 2CXKA 3ECBB 4UIKL 1C5DB 4WGWB 1N5YH 3ZDXE 5FGBC 1A21A 2D0HA 2I24N 4MVBD 1CUOA 3EOYG 2KLSA 3X13B 4ETYA 2A9AA 4FQJH 2XA8H 3U6RB 1WV7T 3SGKA 3WNJA 4OCXH 2JK5A 2OSYA 5AYUH 1R75A 4A67A 5J11C 5MP6L 4N20A 5B39G 3BT2L 2WLZA 2YSSA 5KS9B 3MO1A 1PKQA 1T0NB 2DIBA 4KNSA 4G8EB 3RX7A 3WFCL 2V5YA 1IAIH 4J39A 3T5WA 2YEQA 4P3DA 1Z9LA 3KLSA 1CE6B 1OOWA 3GSNA 1D9KA 2UZYA 3P4OA 5K33A 1XF2A 3QUXC 1JGEB 5EF2A 5K39B 2ENSA 2PWGA 4HIJB 4ZO9A 5GRYA 4P2QE 2QSVA 4YHML 4PLJC 5J11B 2ZUSA 3MZTA 4J4PD 2FBOJ 5MENA 1PIGA 1MXDA 3FBQA 2ICES 3IBOA 2PP7A 1XCQB 1ND0A 1QG3A 4KKRA 1J18A 4KO5A 2Q8BH 3ARGA 2UZXA 2CO1A 3GLEA 4QJ4B 3B4NA 1AI1H 4Y1TA 3GTVA 1FVEB 1NTDA 3RUGF 2A0LC 4RMUA 2O30A 1MN4A 4ERSH 3DK2A 1CBVL 5AAMA 1KLGA 3OBAA 1DUYA 2P5WD 2BZDA 4X5WB 5ACMA 1KCKA 1NWOA 3D7PA 4PJEE 5INCB 3AM8C 4W1TA 4Z95L 2UZIL 5HYEA 3RWHB 4XHJC 5IJBC 3EO1B 4L37A 2HB0A 5AW8B 3ZSTA 1PEZA 2EZ0C 1PNDA 4M5YH 4P0DA 5I76B 1NBYA 4L3CB 1N3NA 1QFWL 3QXTA 1BA9A 3NCYP 2ITEA 2DBLH 2FDBP 2VDLL 5SWSA 3VE0B 1LDPH 2YARA 1JWMA 3LKOB 5L7XL 2HLFD 3LB6D 4AW7A 1WSST 1DL7H 3QZOA 4JO4H 2UXVA 4OKVA 3RX9A 4HJEA 3I6KB 4ZX3A 4X99B 4M6NH 1U2HA 4Q89A 2MMXA 2EDWA 5BRZD 2CDFB 2XZCH 3KWWA 2JKLA 3NIDB 4BHUA 4LSVH 4F8NA 1P7QB 2FO8A 3UG3A 3X17A 1EVTC 2EDHA 2EDRA 2JB5H 2NRDA 5E00B 4D0DA 3U2JA 2XV6B 3PFUA 4R7XA 3KYNB 3CSBA 1GGBH 5JPMC 4YBQD 4IBZA 5MI0B 1ZPUA 1U8NB 1TQTA 2IBBA 4KDTA 5ANME 3V9CA 3BPOC 3L5WB 3GDCA 3KE0A 3WEXB 1ODAA 2DD8L 4EOWH 2F53A 2HFFA 5F1NA 5LWYL 2Z1PA 3CIAA 4E9YA 2VZ3A 2MOVA 4ZS6C 3B6SB 1NBCA 2R39A 3Q9QA 2CLRB 3FOMA 4DETA 3BVDB 4GW1B 4NQEB 4IKNA 4FYSA 3UEZA 1M7XA 1U9KA 1UM5L 2GKIA 2W8CA 2JB6B 4PWFA 4PCYA 5DRXB 3PL6B 3W82A 1YN6B 2H5UA 2XZAH 4PJIF 4WO4C 5ETUB 5IY5B 3ZYIA 2IAMC 4QXGH 1NPUA 1RU9L 3MJ9L 3VG0H 1WQVT 1SBSL 4IDLA 5F6IC 2YKLL 2NY1D 3FUEA 4JFQB 1QR4A 5CILH 3W9DA 3T0WA 3GC3A 5E8NA 2BC4B 2E7MA 3NRQA 2OL3L 1O7SA 1R5IA 1W16A 3IJYA 2FHCA 2QR0B 3VTAA 2CU9A 3MLXL 3BAKA 4OJAA 4JE0A 5E5RB 1JRHL 5D7LD 5F88B 1BVKA 1WJ3A 2BIOA 5CKGA 1ED3B 2BIPA 5SWQA 5F9OH 4G80B 3T6VA 1NCIA 2ZXQA 2BSSA 5HHMD 4OM1H 2DQJH 5C0IA 1A7PL 4MD5B 1G7JB 4BSWB 1H3PL 4IOSA 5DMGC 3LH2H 1KCSH 1L3NA 4NN6C 1CK0H 4KOBA 2P5ED 3IU3A 4MB3A 1KBGH 2ZAGA 4PJEF 2BOCA 5CJQH 3SY0A 1TZ8A 4P2RD 3S3SA 4MD4B 3ZTJG 4FG6C 2QV4A 3Q2LA 3NT0A 1XIWB 4RQQA 5D70L 3TA3A 4L8SA 3QUMH 3W37A 4IRJC 1DQVA 1MI5B 2JFCA 3KDMA 5FAAA 3S48A 1FFPA 4JRYE 1GGCH 3J07A 4OFPA 4D9RE 1W8EA 2XBTA 4ZXBA 3BH8A 5K9OA 3PQYE 2RFXA 5F7LB 4YZFE 4JPKH 5F1OB 2ZCHH 1Q0XH 4Y2NA 4CRPA 5A2IH 2WANA 3VXQB 4XGZB 4HGKC 5CN2A 4Y9CA 2E7LA 1BQHG 5MENB 4KV5E 5HHQB 3UG4A 1VA9A 2BHYA 1G9HA 1ND0B 2VDPH 5FV2A 2GABA 5C6PB 3P3UA 2Y4SA 5EMYA 2DBJA 2WXNA 4Y88A 5H37A 5FHBL 1RZQA 4G6FB 3IDYB 3SDCB 1SLWA 2BM3A 2R29A 1JZGA 4AK2A 3D0VA 3VRJB 1CFTB 3ZIMA 5E5MA 3QEHB 5I73C 1ZGLP 2PCFB 3HZVA 4QI3A 5F9JA 3GMLB 3WUZA 4KXZI 5KVGL 3A6CL 4W70A 1DBML 5CMAB 2WTRB 3QO1A 2V2TB 4JLRA 1ZA6A 2ERJC 2QADD 2AMGA 4ALAL 4LSUL 3TF4A 1WAAA 4HFWB 4X7EC 1Q9OA 4MJJA 3OR7A 4Y2DA 5ABAA 4ZG1A 4AG4H 4LCVA 2FX8H 4HISA 4D2NA 1MIMH 3DX4A 4O2EA 2I9TB 3L1FA 1QASA 5GS0C 5MI0C 3DRTA 5TJWK 1AXTL 4GS7B 2NTSP 3MXVL 1U58A 2V9RA 4OJCA 2DLTA 4RSYA 4Y2OB 2MJWA 1QTYT 2DM2A 4OZHE 5E94B 3LN5A 2B5IB 2WP3T 1DE4A 5HHOA 4RMQA 5JYLA 4PJIB 1XL6A 2X4NA 4EXKA 1MW3A 1Z5HA 5CAYB 3F7VB 2P28B 1UJ3C 1SNRA 1GC1L 2QKSA 4G1EA 3Q8AA 1GZPA 2VL5B 1HESA 4KRPD 5EU3B 3VNYA 2XZQH 4OD3L 3VFMA 4N2AA 4KK5C 3D3VE 1OAXH 1BVNP 4NQXB 3AGVA 2AV7B 3FH7A 5E2TL 4UV7L 5J0BA 4N90D 4Z3JA 4KQ3L 3DOSB 3HBGA 1I7RB 3GKWH 2ARJQ 3MCLH 1KACB 1L0QA 4MDIA 1ZVHA 2MQGA 5E2WH 4AENA 4PIBA 4U49A 4NUJA 2Q6WB 4P2QD 4BIKA 1ZANL 4BRVA 3QDMD 4J8RA 4YWGH 3POHA 4U6XA 1KIPA 2AGJH 2COQA 5E99H 4N2BA 5C6TH 3RU8L 3OKNB 1Q9WB 4P2RB 5B1AB 4Z7NB 4G9DB 3TCXA 3P9MB 3D0LA 3VFUA 4ZTPH 4DP5X 3AMKA 2Z91A 1FWXA 2AEQL 5DJZA 1D5XB 3S88H 1E4JA 2Q7YB 2GBAA 2BNRD 3O0RH 4WW2C 2QL1A 2R69L 5JQ6L 3AS3A 4HS8L 2BZ7A 4DEUA 2R1XA 3V6OA 2C8NA 3QG6B 1CZ8L 3B2PA 5FYJH 5FUCC 4G82A 2CA4A 3IF1B 5MHSE 3IU3B 4PJBE 1UZ8B 4ADJA 1KJVA 1KN4L 2CJUL 4M7KH 4O2FA 4LNRA 1JF5A 3IGAA 3DX7B 5IZ7A 1YY9C 1JTTA 5ALBH 2DQUL 3TBSB 1A6ZB 1HIML 1KNOB 2BVEA 3V6ZA 1A6AA 2JB5L 3MTRA 4Z6AT 3QRGH 4Q6IC 3MRGB 2APSA 3WO3B 3ARDC 2D7TL 3KYAA 3PNWA 4C56E 4DH2A 1IBBA 3A6BL 1QWHA 1YJDC 4OM0H 4A6YL 5F93C 1VHPA 2MCMA 3MPCA 3CXHJ 4QT5B 3ZE1F 4HW6A 2I07A 3DJ9A 4J3UA 1E4HA 2VN6A 4J3BA 4ZZKA 5JXEA 2ZKMX 4GT0A 2JCCE 4PRNB 1ZD6A 4Y4FB 4TNWF 3JVFC 3UTSB 4LQFL 4I5BB 4FQIL 2PXYC 4IRJD 4JFEE 1ET5A 3E38A 3LPFA 3MRFA 1FYTA 3DK0A 2BINA 4LCIL 1S7XA 4K3EH 4QHLB 1A5FH 1FCCA 1JVOA 2BIHA 2OMXB 3SE9L 3BPNC 4P06A 3ARDB 4AQEA 4YGAB 1BJ8A 5F6HI 2YBGA 3ZTCC 3MBWA 2FEDD 1KYOJ 3ZR5A 5E95B 5CZVL 5E5MB 3O4LD 3W0WB 3FU9A 1VESA 2I85A 3CBJB 4NENA 5I9QB 2XV2A 1L6ZA 5IQ7L 2A5UA 3MXWL 4Y5VB 3QUZD 1NOFA 5KVFL 1OSPH 4H1LH 4IMLA 4PJAE 2X4RB 2OSLA 4F37F 4NUMA 2WN2A 2ZUQB 3T3MF 2E9GA 4F57L 1HCFX 2C1OA 3H3KA 2X9ZA 3W2DH 3MROA 1IB5A 2IALB 3KZ8A 3MJGX 1LD9A 4GKOA 3SPGA 2H0EA 3MCYA 3RVVD 3TYGL 4HUWB 5FB8B 4I87A 1GA2A 1LDPL 5D7KE 2KC0A 3CSFA 4DVBB 3X14A 4LRIA 2PWDA 4MDJB 2WLIA 2QEJA 4P5RA 5SWZD 4ADIA 1TPXC 1V3JA 4HD5A 5GS2H 2HPTA 3GBLA 4QTHB 3NYKA 2VWEE 3HLAA 3UYRH 5FO8B 4AITA 4KTDH 4IKLA 1W0VB 1RKRA 1U8MB 3CCHA 2UZIH 3D34A 3GBDA 2VDQL 4OLWL 5J3HC 2H8PA 1A6VH 1E6JH 3D12B 2I7OA 1D3CA 4B9GA 3BLPX 2WBJA 3K4ZA 2XN0A 4DPBX 4D3CL 1C12A 3BH4A 1KULA 3LRHA 1ZA3A 3N40P 5D72H 2PW1B 3ILPA 1ZVNA 3MRBA 5JORA 12E8L 2BNQE 1BQUA 5I71B 5JOFB 4FLQA 4KBPA 2AJYH 4YEFA 1B9KA 4HJUA 1NSNH 4HZ1A 4N26A 5IG7B 1UWXK 3UAAA 4LCWD 5E2JA 5CZRA 5AD0B 2VC2H 2VLJE 3O4LB 4DT2A 4PGJA 5BOJA 2CMRH 1KFAL 1BM3L 3OAWA 3QUZA 1M2VA 2DLEA 1SXZA 3M88A 2ADJA 1ERNA 1M6OA 1LNUA 2HLFC 4BGDA 1SBSH 4ODXB 1OAJA 1J9SA 1QUNB 2QQLH 5KOVC 1JHTB 2AI0H 1DJSA 5EEYA 4OJEH 3SE8H 5FPIA 3MNVA 1U42A 1DJZA 3EO9L 1EPFA 4JKPH 2EABA 2P7TB 2XCMC 1HL4A 4JRYB 1C5DA 4MFHA 4NQTA 1KELH 2QPUA 3LIUA 1OP4A 3S5LB 4JFVA 5J6GB 3MV9D 1A8ZA 3QUYA 3K6SA 1TYEB 3NZSA 1HZLA 1QTSA 1NGXB 1X7QA 2OTPA 1FI8C 2VDLB 3SDAD 1QPPA 1OCWL 2Y1VA 3VXUD 4H8WL 4JPVL 2K78A 4NC0B 2ZUUA 3D08A 2NNAA 3MRIB 1UKTA 2Z92A 4U3SA 5T3ZL 3SDXB 2BERA 1U91B 1K9TA 3C2SA 3FNKA 2YPKB 2EVHA 1PCXA 3P4OB 1QSZA 2CCLA 4K8RL 5K39A 4DAGH 5DC4B 4BKTC 2X70B 1JS4A 2ITCA 3SYOA 1YEWA 2C7UB 4P59L 4PP2A 5AYTA 5EOCL 2J5WA 4JY4A 5AVZB 1GIGH 4WTZA 1X6LA 4OIFA 3UYPB 2O93L 1IZJA 5D55A 3VMOA 4D0CA 1B4JH 1XGQB 4OLUH 3E80A 2WD0A 3WS3A 4ABVA 2B1AL 1WFUA 2XZCL 5LBGA 1BFTA 1CTNA 1KCVL 1PZ3A 2WTOA 4WIQA 4FXGB 4HGWA 1A4KB 4K3JH 2XJKA 3OPZH 4QRQB 1KJ2B 2EE2A 4L3AA 1CFVL 1QKZH 5DZOA 4HEPA 2PXYD 1MH5B 3GZQA 2CR0A 2J73A 2G60L 3IFNH 4PJ8A 4P2YA 4O51B 1EHLH 1AYRA 3KNBA 4OZGB 3BZ4B 2G5BA 1F13A 3C6SB 4R2GD 2IAMB 3IETB 3MROB 1XV8A 3AXLA 3Q43A 2OAAA 1H15A 2OV0A 3CSYB 1OGAA 4AM0Q 5BNXD 2EH7L 5IQ9B 3TEUA 2XA8L 3B7SA 5EU4B 3V7AG 2AXFA 2Y6TE 4JM4L 4YDLB 2FNBA 2A6KA 2MFNA 5BVJA 2ZIDA 4TUJA 4BKLB 1DANT 3AM8A 3BZ5A 2XSKA 4B9CA 5I8OL 4X6FB 3F65A 4YBHA 3L45A 4G71B 1DUZB 1HILB 5FO8A 1T03H 1U8HA 2W9DH 1U8NA 4UF7C 4LEXL 1HCZA 4XCFL 1FNEA 1I7UB 4FP8H 3WEXA 1EXUB 2Y69B 4JRWA 2UWEF 4FG0A 4YHIB 3WJJA 4IBWA 2QQLL 4N2FA 1F8TH 3I9IA 4ZXBD 1J12A 4L8DA 1R5VA 1U4FA 5EEZA 4GAFB 2XWEA 2FX8L 2OMYB 3MQIA 3QJQB 2N7BA 1D5BA 2ICWB 5F8QC 1AR1B 3AY4A 3DROA 4HUMB 1VACB 2VDNB 1H3PH 5IB3A 2YAOA 4D7PA 4NGHL 1ASPA 1AGEB 1G6RA 4UANA 5IBUG 3T2NL 3VFOA 5T1LD 1R5WA 3T04D 4Z7VA 2VZOA 2X28A 3TV8A 3ARPA 1IFGA 4N1CA 5KAQF 4L3EA 2JELL 4P2QB 2IO5A 3HPJA 3QQNA 2VZ1A 5IEKA 2IGLA 1WA2X 3QRLA 1MOEA 3RAJL 4YL4A 4IMKC 4CMMA 2XVGA 5L4IA 5KYWB 1A2YA 2JI2A 2XWXA 4PREA 3G6JE 4BUHA 2XZQL 4OD3H 1IC4H 5C8JA 5T3ZH 2HX9A 4KKQA 4U1NB 1I8IB 4KWUA 1YMMB 4XBGB 3B9KD 1IARB 1WG3A 2UZXB 4Q6YA 4UT9H 1VGKA 1FSKC 5MEND 4N0YL 1XH3B 1INQA 1K6QL 3US0A 1AKPA 3FB6B 1J0YA 1XGTB 2XTJB 2Y2TA 3TYFA 5IVXF 4Q14A 4CC0A 3L3OA 4JAMA 4HLZG 3S35L 4GMTL 2FTAA 3EF4A 1K4DB 1OHZA 4MD4A 4JN2A 5D7EA 3RX8A 4YSUA 5DS2A 4GAGH 1MQKH 1VRSA 3G6DL 5GRJH 3RWHA 4A66A 1JHKH 2B1OA 4HJSA 5J13C 2DEYX 1YEIH 3LRGA 5F3FA 5ACZA 4XNQA 2V3EA 5IMKB 3QC5X 3QNYB 1E30A 1HINH 2EDYA 4X8XA 1EEQA 3N50A 3NP4A 4ANXA 1S5IH 2L4OA 2Z4QB 4UTBL 1WS8A 4KUZL 1CN4A 5HHNA 1U6AH 2NX5D 4LKXA 3ZTNL 2QBWA 2N59A 3S3PA 2WVSA 3IKCA 2F1AA 4UILH 4PP2B 1E5AA 1KEMH 5HHQA 5FUZH 3A6BH 3QIWC 1KDIA 4GRLB 2WO4A 3N1MC 4ZMWA 2XVKA 4PJ5A 4X9HA 3OKKA 1F4WL 1K8DB 3WXVL 3Q0HA 1C7SA 1A6WH 1JPEA 5L88H 1ZMYA 2NW2A 2WWNA 3SDYL 4HIXL 2Q2EB 4UV4H 4NZDA 4YL9A 3H0TB 1QLFA 3KW8A 4PH8A 3E6FA 1AC0A 1LWRA 5ANMA 2NSQA 4R26H 3WE1A 1CFMA 1URLA 2J5LC 3WO4C 1L5GA 4PRBB 2BS71 4UDUA 1T03L 3VGFA 2DM3A 3Q05A 3DX9B 3RB7A 1TVBB 1CS6A 5DJDB 1QSEA 3T1FB 3ZDZE 3B9EA 5L2JA 1GH7A 1YMHA 5E2TH 3I6SA 4JE4B 2HRLA 1DN0A 2WGXA 2AJVL 3L17A 1JOIA 4MMYB 4WI5A 5DDHA 4L8SC 1TNMA 1NJ9B 5CJQL 4Y2OA 4UTBA 1PZDA 2WLHA 5H94A 2UY7A 4GP5B 1ED3A 3WKNA 2N1KA 5IB2B 2VXSH 3CZFA 4RMBA 2VLKB 5JPNA 3VNZA 4FTVD 3V7AE 3CJJA 1NPNA 1DUZA 3EYSH 2O26U 4R2GC 2VDNH 4EIUA 4H0IA 1UADC 1IEAB 1DQQA 1ZCRA 3KG5A 2AITA 3ZTEA 1AGCB 4LPYA 1AZNA 3SO5A 2AABH 3GPSA 4NQXA 4IK7A 3TEXA 1A3LH 1HT6A 5LCVH 5KSBB 4L8DB 4DAGL 4J1UA 4FZ8H 1G7HB 3ABZA 2EECA 4F57H 2OMYA 4GAAA 4Y4KB 1NM9A 1U8LA 5E4EC 3TNMB 3AVEA 4TTDD 2K45A 5JW3L 3TIEA 1A22B 2W5PA 2GHZA 3FTZA 2C3GA 2JKNA 4QXUL 4TNWK 1FH5L 5I1CL 4HKZB 3CPUA 4Q6IB 3W56A 2IDSA 2PO6B 1VFAB 1RZGA 3M8OH 3KM2A 5DI8B 2WJ7A 3OB0H 1MXGA 5EUKB 4KVCL 4AZ8B 3IMWA 4QXTA 4F7CB 1AY1L 4ZT1A 4X4ZA 2R56H 5I8EB 5E8DH 1AXIB 1FE8H 2EDNA 1YEJL 2P8MA 3G5VB 5KYYB 2XZZA 1SVBA 1N18A 4KUZH 1H3GA 3QG6A 3WFEL 5EZJB 4PJ9A 2V5TA 4AH2A 1P2CA 3ORJA 3C5JB 3MFFA 5L9DL 4G8IB 2P80D 2AEPH 2OMUB 4IGBB 2BVQB 1KCWA 1B88A 4G42B 2FWLB 2XG4A 2EP6A 4OLYH 3DVNB 4XE5B 3VFSA 3CFBA 4X9BA 4AY0A 4MNHA 4GUPA 3ZSSA 4KTEH 1ETZA 4PJCB 5FWQA 1P9MA 3CK0L 1JGUH 4NKDB 3VD3A 3B1UA 4HFWA 1BHGA 1KGWA 5LBSL 2P49B 2LABA 4GO8A 1MRCL 5I16B 2AI0L 1BVZA 2AJXL 5EU7C 4TVPD 4KZEL 3MRNA 2WYTA 3D25A 3RUGB 2ZOTA 3U7YL 3H8NA 4JFFE 4GPVA 4JY6A 1A4CA 4YDKH 5KSAA 1U3YA 5FGRA 3TBTB 4TXVB 2FNWA 5KOMC 3UBXI 4DW2L 3QSKB 3FU7A 4S1QL 4TTDC 3D0AA 3TT3H 1LYQA 1A7NH 2FD6L 5D7LB 4MMXA 4XNMA 2X4NB 1QFPA 1Q9LB 3IWUA 3IAQA 2DQGH 4LSRL 1KB3A 1Q9KB 1NFIA 2A74C 1JERA 4U0RB 4IQHA 3KPQA 1AQKH 3CAFA 4JO1L 4BWUA 2NTFB 3GTNA 5EBLA 4P5TC 3MLPA 3ME0A 5EUOE 5HHVH 2J8UB 1EANA 4KHTH 4KC3B 3DGDA 2PPCA 3K5SA 4TUOA 1LEGB 1BEYL 4LSQH 5GRUH 1CDHA 3AB0B 3O4OB 4RBPH 1EJ8A 1FJ1A 4HH8A 3STBA 5GGRB 3S8WA 2FX9L 1WWBX 5DJYA 3FQTB 3HC2A 5HY9A 5I5MA 3QORD 5ID1A 3BP6A 3UPCA 2FJFA 1OLZA 3QI9D 2XN1A 3DX8A 3V52L 1ZHLB 3S37L 3TN0A 4IKJA 3TO4B 1QSVA 5JHLL 5DJDA 5KVMC 3QZWB 1GGIH 3VFPA 3HC0A 3B5TA 5T1KD 4LHJB 5E08L 4QRAA 1YMHB 2JKWA 5FKPA 2G60H 3TVMC 4KKBC 3VXMA 4Q58C 4WDIB 2FZ3B 4CC1A 5EBWB 4MMYA 2GIXA 4ZO7A 2CK0H 4G6JH 1JV5B 4H88L 4X6CA 4HWBH 3DO7B 3GXFA 1SJMA 1SEQL 4PJFF 3L3IA 1KCVH 1OP3K 4AYBA 4JO2L 5D96C 1W9XA 3WOVA 3HVDA 1MCFA 1H6TA 2DWXA 1CL7L 4MS8C 4NZUH 4P2OA 3B83A 3X13A 1G43A 4XP5L 4PJEB 4PJHB 3IAGC 2VLJB 3QZLA 2APBA 2VZSA 1D5ZB 4WUUA 5I24A 3BW9A 2XX1A 5A6LA 1U8CA 4F9PA 1EBAA 3V6FB 2R4RH 4POZC 3HJEA 4YZWA 4RMWA 3CX2A 2GVYA 2BMKB 3R8QA 1YC7A 4ZUTB 4XR8C 1A3RH 2Z35B 2EH7H 4AT6A 1EHAA 4BFOA 4KFZC 1TJIL 1NDGB 3BCFA 1CQKA 3CFJA 3EYFA 3ZPDA 1CE6A 5KVFE 1W72L 3NK3A 4FI7A 1WUZA 1F4WH 4DPAX 5KSUA 3MUHL 1DVFD 5D1XD 3TJPA 1BPVA 4JG0H 1U33A 2H6PA 4UQ3B 4D0BA 4ALAC 3RWGB 5DEFB 5DHVA 2BW5A 2A6IB 4GMSH 1OK0A 3MX0A 4GEJA 4LF3A 2GK0B 5FK9A 4ZUVA 2X10A 4KRNA 4KO7A 2E8ZA 2YAHA 4XVTH 1IAOA 3VWKA 4YSSA 4IOFC 1QVOB 3O3BA 1PYWA 3F85A 4WJ5A 1WA1X 2VLRA 5T33H 4XN1A 3GHBL 3I75A 1I1AC 2Q1EA 1XCWA 1CE1L 1ZTMA 4NKMA 2M2DA 1OY3B 1YJDH 3NEEA 4G8IA 3EUDA 1IC7H 1YMMD 2FECL 3NFNA 4P57A 2FUQA 4Z0BH 4YAQA 2ZWYA 4AUUA 1PG7X 1NANH 1D9KD 4W9LC 5J5EA 4Y5YB 4KOCA 1K5NB 3OJDA 3EBIA 4RFNC 1ETZB 3CDFA 3NCCB 4HA1A 3UTQA 8FABA 4AVIA 1YAIA 3MJ7B 3AADB 3BYTA 4I18B 1BIHA 4Y16C 2GTWA 3IDMA 3LV3A 2WINA 1J10A 3LKOA 2W38A 4YIQA 1FGVL 3HEIB 5TE7H 3AY2A 1JGVL 5CLTA 3HG1B 4A37A 3KAAA 2VXQA 5K93A 3AWEA 3HAEH 4P5KB 2DI9A 4N8VG 5T5FA 3SB3A 2XFXB 3ETTA 4LVHC 1REIA 3EYVA 1NC2D 5DSCB 5I0YA 4FZ8L 3N5AA 1ML0A 4XMPL 2Z31B 4HWZA 3H85A 5HDOA 3ZMRA 3C09B 2LHAA 4RFNB 2V33A 3MLUL 4XNMB 1LMIA 2Y3AA 1L9NA 3V8CA 3ZDYE 3UC2A 4TULH 5HHPA 1ILSA 5A6IA 2EXYD 3JWDC 4KGJA 3LMJL 4CSTA 4LL9A 3N9GL 4BFIB 4CBZA 3A4DA 2JI1A 3SZ6A 1AO7E 5B3JF 3T09A 1FO0H 5C3LD 4YBLB 1KCUL 2O6CA 2EEAA 4ESKA 2AVGA 5GXBB 1BAWA 3E7JA 4HWNA 2XYBA 3CZLA 4WUUD 3LHPL 3SDYH 2EADA 4GW4B 3C6SA 4HBCH 3ZDZF 2Y0SA 1DVSA 1TCMA 4WJKB 5FKAA 1DO5A 2ADJB 3C9NA 3NG5A 5D96B 3X1FA 2WHVA 2CHXA 4XNAA 3LRSB 3M7FB 3AG3B 4JL2A 4MCZB 4KHXH 4IHOA 4B9ZA 3DLQR 1WO2A 5F88A 2OMNA 2CO2A 3QQ9C 5C0CD 5EEWA 1RIVL 4R7LA 4RWHA 1R3LA 2K6ZA 1O7VA 1RP9A 5CP3A 4MSWA 2GQHA 1U8HB 2HX8A 4R0LC 4PU2A 1OAYH 1XGPB 4FQIH 2IWKA 2K6WA 3RHWF 3PGDA 1WIUA 1QX1A 2X4UB 1FSKB 3ABLB 2BWDA 3NCYS 4Z3TA 5CR8A 2VDMB 3TONA 1DLFH 2QGBA 1WBYB 4JFZL 4MJ2A 4KO9A 2XTJC 1Q90A 5L2KA 4EKJA 1XZ0B 3OAUL 4RQQB 4W9FC 3HMWL 5T1LA 1B0GB 3HHSB 3KD4A 1QFHA 4OFYA 4Y9GA 3KDMB 3U2IA 1TSRA 2OP4L 2QPFA 2YPLE 1ES0A 2BWIA 4C55A 3QVAA 5DXWA 4WU7B 3VI3B 3HG5A 4KX7A 4F9LA 1INEH 5TDOA 1MY5A 4RGMB 3MCG1 2FL5B 5AUMB 3PUCA 2CGRL 3D07A 3HKFA 3ZKXB 2WSPA 1ZHBA 3QYMA 4WI8A 4P9MH 4PTTB 3WN5A 2H6PB 3CLEH 3L1EA 5FGCB 1HQRB 1MELA 1NANI 4MCYA 1MLBA 4E0RA 4CMHC 1BLNB 2AFNA 5KANI 2IXQB 3F5WB 5F7AA 3AS0A 6FABL 2C1PA 1FV1A 5IV2A 3T65A 3NJIA 3HR5B 3OMIB 2H45A 5IB5B 3QR1A 5D2LF 1SGKA 1WDAA 3NCFB 1YQVH 2VERN 1JZ4A 4ACPA 1BD2B 3U83A 1U95B 4YE4L 1PBYA 4JDZA 4ZTPL 3Q6GH 4OBRA 5T3XL 1CFTA 3SGEH 3QA3A 4AJ0A 2ADFL 4RFEB 1BBJB 2WQAA 1IIKA 4JM4H 5AG8A 3V4PH 5E8PA 2R9HC 3L4TA 2PR4H 4AJWA 2OMVB 1PZ2A 2GI7A 4LEBA 3RGHA 3SN6N 5IHHA 2G5BB 1C5CH 4JM2F 4V1DE 4MBOA 3VWJC 1FAIH 4HV8A 5IVNA 3AREC 4ZMZA 2W65B 3NBNA 5D72L 2JKJA 3AABA 4XP5H 1PTZA 4JQIA 4A6YA 2AJYL 4NUQA 2OJEB 5I15H 3VXPB 3V6BR 3K46A 2DW5A 2CO7A 3IDUA 4X7SH 2CIIA 1X5IA 1BXVA 4GT7A 3NSDA 3QFJD 5A16B 4NZFA 3VXNA 5D4IA 3NN8A 5GPRA 1EERB 1S46A 1LO0L 1CWVA 4ONFL 3IDXH 4JFPB 3UIZA 3BI9X 3L1OL 5KVEL 1OF2A 4GRWE 4JKNA 2D9CA 3CK0H 1UEMA 2ZZUT 1H3TA 5LCVA 2ZKWA 1HOCA 1IEHA 3ZQXA 3DJRA 4ELMA 4G72B 4N8CH 3SJVB 5E1AA 1WZ1H 3D39D 3UAJD 2ZICA 4XPFH 4N6RA 1U41A 3RPKA 5I6KA 4OD1L 1F41A 5DMJB 4KHTL 1YN7A 2R1YB 5EBMA 5FYLL 3VXOA 2OSXA 4BGLA 2BIMA 1I9JL 2JCCA 1TVBA 3CZNA 3RBSA 4KI5E 4K7PY 1DBAL 5D1ZA 2BOBA 4U1JB 3BWAB 4ZO8A 1JXKA 3H9YA 4G9DA 4BD4A 4KXZH 3VQ1C 3P30H 4W81A 4JCWA 3CC5A 4Y2LA 5CN1A 3RVUD 2X1OA 5IQ7H 2V6HA 4APQA 2WYHA 3ESUF 5KANG 3VFVA 3LKSA 4UBDC 2XNAA 4M5SA 1Q0XL 3QXUA 5D1QD 4B97A 3SBWC 4JM2B 5EDXA 3SKJH 3ARSA 3ZE1E 1I3VA 4K5PA 4AYFB 4XBPB 2DYPD 3V5DB 4KTYA 1KLUB 1MLCA 3ULUL 3EDKA 4LLMA 3PV7A 1DQQB 1IEAA 5AOKA 1SN0A 3QPXH 2PW2B 5EIIB 4PJBA 2VZUA 5HYJB 2J1ZA 4OQTA 1ORQA 1BMZA 4N2HA 5CIPB 2Q7AA 4D8OA 2J43A 3LQMA 3ZL4H 4K9EL 3CTTA 1TJHL 4PHXA 1MFNA 1M7DA 1UWFA 3IJ8A 5DUMH 5ACZB 3QGVA 5DJ6A 1LM8V 1HYSC 3V4LA 1G87A 3OLDA 1EHKB 3UTPD 1DEEA 2F9BT 2RTTA 4FXTA 3R1GL 4R83A 1CC3A 3H42H 4HCRA 4KY2A 1FGNL 4KK9C 3R19A 2UXFA 3QYCA 4ZYKA 5FCSH 3IYLW 1H8NA 3NZHH 3EJPA 3ZTJH 4LP8A 4YHLH 3WTUA 2MQCA 1M7IB 3GMOA 4YDVB 1HQRA 1I8LC 3LZOA 1BZDA 4MTMA 3F12A 4WW2B 1ZLSL 5DO2D 2EH8H 4YNYB 2OTUA 5D1ZD 3HRPA 3CUPA 4UT6H 3L9BA 4OFQA 2C4FU 3UBXB 1CT8B 3B9DA 1TVHA 1QI3A 2CCWA 4JZNB 4QCIA 3OKKB 4DF9A 2IPTH 2X3CA 1DQML 4RVBA 3AFLA 1P4LA 3GBNL 3ULVC 5ITFB 4EUPH 4P2RE 4Z7NE 3KVPA 1TQVA 4HOMA 4MHHI 4NM4H 3D3VA 3DYMA 2X4OB 5KTEH 3WLWD 5I66A 4PYHA 4DCQB 4NENB 2GT9A 4YHMH 2LR4A 5BO1L 4P4KA 3NA9L 3UEQA 2R29H 3IJEA 4H20L 1OB1B 1W0WB 2DQHH 5IK3A 3WMSA 2JI3A 1LO3L 3DX9A 5CCJA 4X7FC 4ZOCA 4JGJA 2FSDA 2JIXA 5CUSH 5IREA 3BFQG 3GS4A 4NQQA 1G0XA 1HSBB 1KDJA 2WIMA 3HC4H 1VEPA 2Q7NA 4R5VA 3ISWA 2EIZA 4I48A 4DPCX 2J6EA 4HUVB 1UM6L 2DOCA 5DJ2B 1FN4B 1E8WA 2MTAA 3D33A 2Q76B 5JIHA 4DOHB 3U79A 1ZJBA 3BHBB 4XO9A 1DVFC 5CEZD 4XXCA 1G1CA 2E59A 1GZHC 5JIDA 5A16A 3IE9A 1NDMB 1OGTB 5K59E 1M2OA 3L2LA 3TBWA 3PP4L 4X5PA 3O2DH 1NH6A 3TV3L 3OGCA 4ZK8A 4TUKH 3U6XA 2NW3B 4H1LG 1YYMH 2FH6A 3L5IA 4KRPB 3IDGA 4KK8D 5CSGA 4P4RB 4JFTA 1H0DA 5DMKA 2WXGA 3ETSA 2DQ6A 1I1FA 5I17A 2C9AA 1KB5H 4NNYA 2J8UA 4HHAB 3KPRB 4PRHA 3RVXC 5EZIH 3SKMB 3KGUA 4DKEL 1ZSHA 4P59H 4L1SA 4LLWA 3SGKC 1CLYL 2WQSA 3MDJA 3NACH 1QP1A 5EU6D 3MACL 2VO5A 1T5WA 2DMCA 5E1AB 2PW1A 3ILPB 5JORB 1RERA 3OLEA 3A4AA 4HCIA 4PAZA 4A2HA 3KWUA 1QA9B 4YUEL 1A1NA 4ZOEA 1TQUA 3VQLA 3K71B 3CXHK 2MH4A 1KGJA 2C4FT 3FTSA 4U6TA 4M1CD 2B1AH 1RURL 1TETH 3S2CA 2VN3A 5C1MB 4F8OA 3LQAH 4Z3IA 2AERT 2I32A 3C6EA 3P73A 4WLCA 5CIPH 3SGJC 4XMUA 3W0WE 1NICA 1HINL 2WVVB 3Q1SL 4TNEA 4WUKL 5LG1A 5C09B 3VFGH 1MCRA 4FEMA 4CJ0A 4DGVL 1J9TA 5T8IA 3VI3F 4AVKA 3DO7A 3SCMD 5KYNA 4P04A 5TDPB 3C8KA 4QAWA 4PRDB 1NKRA 3JTTA 4O02A 4GG6E 3FFCB 1IKOP 3ABGA 1IC0A 3CX5J 1V3LA 1XMEB 2JKSA 3QCUL 3VXSE 2ZXDA 3A5VA 2LE9A 4LHUB 2OYLA 1CB4A 4WU5A 5ALCL 4FFYA 2WAQA 4I89A 5MEOB 3H2QA 3BX7C 3PJSA 1OM3H 1W0YT 3HE7B 5DVPA 3M17A 2KZKA 3L4WA 5C71A 2I9LA 1E0OB 1U8CB 3T4AC 3CFBB 3ZIYA 3RTQB 5A3ID 4H8PA 4YDNA 4WI9A 5FA4B 4MKMA 4X5XB 3KPSD 3TIDA 3VXTA 2YUWA 4FFYH 3DO3A 5HI3D 4KHXL 4PWKA 1N59B 3ZHLA 4DK3A 4K71B 4MCMA 4ZYKB 1AHMA 1QHQA 4A2DA 5C0FB 5JIKA 3CN2A 4XCYA 1JSYA 1YNLH 3SQOL 4YHOH 1BFVL 4BZYA 3T8VA 3WU1A 1I8KB 1UWXH 2AZAA 5DHVB 4MKTA 4X9YA 2E6PA 3FSWA 4WHTA 1NCWH 1FG2A 1XIWD 5K59F 3PDGA 3VSTA 1SUJA 3LDBB 1IRAY 4ZTEA 3G6AB 2V2XB 2I60H 4IYKA 4G1MA 2GBUA 1XGQA 1VKXB 1NEUA 4G3YH 2YEZB 5JPMA 4M62H 4WTWA 3JQOB 4GKZA 4L05A 4XNUL 1WEJH 4ZJ9A 1C8QA 3IN2A 4S2SB 3FF7A 3II1A 3UTTE 1NBZB 3KS0H 1UJTA 3DVIA 1XGYH 3P69A 4FJYA 3WNMA 4ELKA 5A1AA 3JZYA 4E41D 2CA3A 1T22A 3AUWB 3KJ4C 2FHFA 2B9AA 2Y06H 4IM8A 3HZVB 3QIBA 4XC1L 3ULVL 3MGTB 2XIDA 3D05A 4HEMA 2JJTA 4KROD 4HWBL 1VFOA 2ZF9A 5DYOA 4P2OC 4UQIM 4U1MB 2ZWLT 2WXFA 3MI6A 3MJ7A 1Q9OB 1BVOA 1Q0EA 1G9MH 4PJDB 1J87A 5AW4B 2ZAIA 5BO0D 1V27A 2HKFL 2DM7A 5FWRA 2HJLB 2ED9A 3S0PA 3MYJB 4W9JC 4TSAL 1CR9H 1CDCA 1CJYA 4WHYH 2AEWA 1I3GL 3QCTL 5EU4A 1J0KA 1E67A 5EBWA 4KI5C 4ANWA 4OH2A 1I7TB 2R0WL 2UYLA 4MCNA 1THCA 4AGMA 5I1IL 5L6YH 2EE0A 5JQIB 4X6CB 3RHWK 1IKFL 1RK1B 1T7ZA 5E9NA 3HNTL 2EKSB 1CICD 3VFRB 4FADA 4CGUB 5F1SA 4GO6B 3N1QC 3QRFM 3M8OL 4MXWL 1HDMB 5IJVA 2FJGA 2X1QA 3PWPE 2VM4A 4HEME 3L95A 1NLDL 4MD0A 1G6RH 1T0MB 2Y1ZA 3VYOA 5J4MA 2J4WH 3DX0A 3VFGL 4JKKA 2M8XA 1GGBL 3QJFB 4Y4HB 3SKMA 5I0XA 2YXVA 1N7ML 3WFEH 2HTKC 3RDTA 1FNLA 5JHDB 2VXQL 2O6FA 3UCQA 3O6FA 4FLSA 3VCLB 3QAZC 3GXUB 3CSPA 5EU6E 5IROC 1QI4A 3P3TA 3CVCA 3FCTA 4CVXB 1LO4L 1LGVA 3O3AB 1TYRA 2DQFB 3WGVB 5KSUB 3RGVA 4L4TE 1Z9MA 5IT2L 4KPHL 5MEQA 3PWNB 3CFKB 4H8WH 4KKCC 4AW4A 4XOBA 1JGLH 1WIPA 1BW8A 3QIUC 3MNMA 1U8IA 3PF2A 4CN4A 5HDBF 4WWID 4AXWB 4KKLC 4UTAA 5C0GA 1VGEL 4JL1A 5FLUA 1YEEH 3MUGA 3KXFA 4OD2B 1IQWH 3T3PF 4XXDB 4YC2B 4XAKE 5TDNA 1B2WL 3STZB 1PKQE 5GRZA 4XPGH 4MSWB 5F6IB 2IANA 1MWAH 2VKWA 3FSAA 4FZEH 3MREB 3FB6A 1RAMA 4QOKE 5IEHA 1S7VB 3GRWH 5E5UB 4HUXA 4OI9A 1JYVA 3VAEA 1QOKA 3U7AA 4JHBA 1X4ZA 3KLAA 4Y9FA 4ZI8A 1NUFA 3MNZB 4QRRA 1C8PA 1UD6A 3OAZH 3VA2C 2F74A 2YK1H 1NOAA 3E0GA 1N5AA 4RGNE 4R8WH 4U1HA 4P23B 3REVB 1A6AB 2FBRA 3QAQA 4GQZA 8FABB 1TZGL 3S88L 2BH0A 2GSGB 1GAFH 3RWJA 4W9HC 4X5XA 4EN3A 1N59A 2Z4QA 5F89B 3BT0A 4JRXB 2FYYA 1XGYL 1E6OH 4ZUSB 3JVGA 2JSFA 3NCWA 3D18B 3I3BA 3GSOB 3IFNL 3U48A 3PWLB 1OL0A 5E6IA 3GUTA 1TQWA 3ARRA 3HG2A 3K6OA 3P2DA 4PRNA 4YE0A 3O9WC 4NN5B 4PWHA 2IPKA 5CSZA 5D7SH 4E42A 1FG2B 3FSZA 4B41A 1CI3M 5F1KC 1P5UA 4CU8A 3WENA 3TLRA 4XP1L 5KS9A 3WKPA 3OHMB 4UBDD 3IMBA 5KZCD 1SLXA 2GJPA 1UASA 4XH2B 3WNNA 3QEQD 3ZE1B 3K81A 1A4JB 5EA0H 35C8L 5IKCA 1IUZA 1KJ3L 3VSUA 3QDJB 1N6UA 1DUYB 3PREA 1F4AA 1QLFB 2BP8A 1FGNH 4OZIE 4GXVH 1IE5A 4OQ1A 4I2XB 1YEHL 4ZOAA 1I3RB 3II3A 3L4UA 1T2QH 2FWOA 3CHSA 2QZ5A 2ZKYA 3IS1X 1EO8H 2OI9C 4OZIA 1Y18A 3C60C 4TQHA 2VSKB 4EI5B 5ICXB 5LWYH 5L9DH 3RDTD 5E1IA 4ZO6A 3EFOA 3LNGA 3WNPA 5KSAC 1RULH 3PWVA 2W9EH 4UUJB 4YLQT 5I6XB 1J86A 4K9EC 1AKJB 1X5HA 1N6QH 4XPTL 4NWUL 3WL9A 1RZKL 4LBAA 1MFDH 2XZAL 1FZMA 5I8KL 4G9FB 3SDXF 1M3IA 1G9NL 3C6LC 4M7LH 4HCRL 2GEQA 4V2BA 5BZDA 4BDVB 5JLZB 5L8LB 5ISZB 1PGRB 1KEGH 3WG7B 2R69A 1U8KA 1WAEA 5G4MA 2F54A 2OP4H 1OK8A 1W0VA 1F4YL 3IJSA 4L37B 3WUWG 3JYCA 4EKXA 4YK4C 1T0MA 1H6FA 1MF2L 3APMA 4HP5A 3WV0A 1W6WA 3EXLA 5C0EB 1KXQE 5GGRY 1E27A 4P9ML 2VQ1B 3AGWA 2CLRA 5E2UH 4GS7C 1R4XA 4OSUH 2A73B 4LCCC 1CQYA 1NBVL 1S8DB 4UQBA 5LGJB 1CICC 1F97A 5ETUA 2VLRD 5ADPH 5J1SC 3VD2A 3V0VB 3I9PA 4N87A 4DQOL 5K69A 4AGLA 4Z76A 4NC1E 4U1IA 1CK0L 5T5FH 1RK0A 3HG1D 4LCYA 5IJKA 4PP1C 4Q6IA 4WCYH 2X44D 3FO2A 1EIBA 1DFXA 15C8H 4PTTA 3WN5B 3GSVB 3PWNA 2XTSA 4U05A 1N68A 2R2EB 4MCYB 4F37K 3GEWB 3N6YA 1RZ7L 4LAQL 3VRIB 2YAFA 4Q9CA 3UTTD 1J5HA 3KXFB 4OD2A 3QXAA 4HK3J 5LNGA 1I7ZA 3DOIA 3QQDA 2D73A 5H8DA 4F15B 4F2ME 4TTGA 2ZX5A 2P8MB 1FVDB 3G5VA 5E23A 5C09E 1GXEA 1A9EB 3M6DA 1HYSD 3VXRB 1E43A 5IOPB 2LAAA 4ODSH 2WB1A 1TO5A 4UNUA 4L4TA 2ADGA 4EDXB 3BN9D 3VH8B 1AIZA 2QQNL 2W88A 2DIJA 4L29A 1VADA 4K7FB 2F8XC 2VITB 1DBJL 1CXEA 2DH2A 3SDDC 5E4EB 5EU6A 1T83C 2A9CA 4OJYA 4NJAH 5AL0A 4PCKA 1QSFA 2NR6C 4PTUB 4Z3FA 4H5SA 4W4OA 4PG2A 1HXMB 1IM9D 2HT4D 1HNYA 4OV6F 1KT2A 1URIA 4HV8B 5E4OA 3OKDB 2YPKA 2G5RA 1N0LB 3LRMA 1AGBB 3WLBB 4Z9KB 4MD5A 4S1SL 1JCKA 5BS0A 4QHNA 4XHJD 2HT2D 5FECA 2MWCA 3RRQA 5EFIA 4E42B 3BH9A 2OTUB 1I4FA 5EORH 2VDPB 5D93B 4U6VL 3VXNB 1ZGLA 4L3ED 2O6DA 4WI4A 2P80A 3ROLB 2BCKB 1B6DA 4ZQKA 3T1WA 2H1PH 1MIML 2F54E 2NZIA 3APNA 3H56A 4FQ2L 1MJ7L 4JQXA 3SDCD 3GPEA 4TVSa 3CDZA 4B9YA 1INDH 4M8QA 4NI3A 3O2DA 4X6CF 1LWHA 6CGTA 4X6CE 1UB6B 4LCIH 2DYSB 1OP5H 4KPHH 4ZAKC 4HGWB 1W72B 2QLVB 3CVDA 3N3EA 1FJ1B 2R0ZL 1N9PA 5EF1A 4BYHA 1CGTA 1JVKA 3CQQA 5E4IA 4F27A 1GKEA 3GHBH 4LMQI 4ERSL 5ID0A 3CHRA 2A83A 4AL8C 1A7NL 2FD6H 1E4XL 1XGZA 1XD0A 2R1YA 3TN0B 2W9LA 1OP9A 5ILTL 2CNZA 2B15A 2PYED 3HC0B 4LCCA 4M7JH 4MNGE 1FPTL 1QNZL 1ETA1 4HSCX 4M5YL 2IADB 1N4XH 4LCUB 3VXMB 1RHFA 1TJMA 4KX8A 2HRPL 5E70A 3MLRL 1DQTA 5IB1B 1INEL 3WJLC 3N04A 4MJIA 2UX7A 4PJ5E 3ZRSA 3EJZD 1TXKA 3UO8B 2AJSH 2E6QA 5BW7C 2RGSA 4NPKA 4PJIA 4RAVB 1U8KB 5DURB 1EHXA 3OGCB 5JR1L 5I6MA 2R1WB 2AVFA 1UG9A 2ZJSH 3GMLA 3IM1A 1Z2KA 3ISYA 3D30A 4G5AA 1DBBH 3FPYA 3DMMC 1TEGA 4BRJA 4N0CC 4QXVA 1M53A 3SYPA 3RL1B 3ZGIA 3ATBA 3P3SA 4QRUA 4MMZA 3BVWA 1JPSL 2GBTA 3AT8A 2BSEA 5D8JL 1B2YA 3WN5C 4UQCA 3KYOA 4PB9H 1F3RB 5HGDA 4M03A 3GXMA 3CFQA 1BX2B 4GYBA 1UACH 4W4NA 2TSBA 4FQJL 4U6XB 4RBPK 3G5YA 3OAZK 4OJFL 3R0NA 2X4PA 2PP8A 5MEPA 5E94A 2F58H 2NY1B 5HHOB 4HH9B 1B0RB 5EULV 2E9JA 4HLZH 4OY9A 2WLLB 5DJXB 3TU6A 2CBMA 1MVUB 1NL0L 4A55A 1HHJB 1CU4L 3MBED 4N85A 1OQOA 1IAOB 3VWKB 2WTPA 5DZVA 3E3QC 5LUMA 3OKOA 3ES6A 5AKTA 3AG2B 1BJ1H 2XY1A 4ZX6A 3VD4A 1EFQA 1M57B 3DOSA 1SY6H 1S9XB 2C9RA 3HAEG 1P5UC 4W9GC 1MCNA 1BQKA 4GBXD 5D1QC 2ITDB 5GGVL 4N86A 1S9WB 4JHWH 2UVEA 2AXJA 2SEBB 4KQ4H 4WO4D 1IGYA 2L04A 4FLRA 3SDAA 3ZMNA 1MCQA 4JGMA 4MWFB 3EGDB 3MJWA 1J1XL 5A6MA 4NO0A 1JUFB 1RZPA 4QOKB 1AQKL 5DR5L 4JRLA 1YECL 4I9XA 1CGSL 1PS3A 1SXAA 4WI0A 2E7CA 3GSXB 3TBCA 3GRWL 2V2TA 4PFEA 2Z0BA 3T77B 2FAUA 2R27A 3DX6B 2WLKA 1B0WA 3HC3H 1ZLWH 2NY2C 4NNPH 4N0RA 4AGOA 4DUVA 2VJ8A 2XWDA 3K72A 3CHPA 3C60A 3DSNB 3GYRA 1CE1H 4QHKI 3T2LA 4D7BA 3D85A 3D06A 3FB8B 1WBXB 3OXSB 4PS7A 1I8KA 1HFUA 4GG6F 2XWBB 4Y4KD 1KUMA 2VT0A 9PCYA 3MJ6A 2K9UA 4JG9A 4HK0A 2BSDA 1RUAH 2O1AA 3GO1L 3L9YA 4I5BA 4Z7VF 1E4KC 1SF3A 3MCLL 2MNJB 4LNRB 1A0QL 3G6AA 2YUVA 1L9MA 4ONHA 2EIBA 3NZ8B 3LAFA 4JN1L 2DZEA 5G5DA 1H8OA 1VKXA 2XRAL 4FQXC 4Y89A 4YDIH 1JMXA 4NFDA 4WV1A 3VFMB 1TZIB 4R8WL 5FO7A 1CFSA 2AEOA 4A2FA 2FO1A 1AO7A 3MRGA 4N3UA 2YIHA 3BD5A 2FB4L 1KBPA 2PWEA 3CN3A 3K4DA 1LO5A 4HWEL 4LGSB 5DC0A 4CILA 1UT1A 2F61A 1T5WB 5E8DL 2DMBA 3ARBC 2ZSWB 3FZUD 3F84A 4PBXA 3T0EA 1UWGH 5IFHL 2HKAA 5FUZL 4YDJA 1NLDH 4HPYH 4K3JL 4M7LT 4HG4J 1BBDH 2XC8A 4H13C 3LS4L 1AE6H 4UYQA 5BQ7A 1CXIA 3ECVA 4CN1A 1CBJA 4RWYL 3HUJF 4P2RA 1OW0A 3D87B 4D9QD 2B0SH 4MAUH 3UABA 5IB1A 3FQUB 3WFBH 5AFAA 3OG4B 3US9A 1NJ9A 2IAND 2VR6A 1DJYA 4LIQH 2APTA 3P0YL 4NQDD 4WWKB 1T1YA 2ALAA 1LVEA 3QHFH 2EKSA 1S9KC 1SQMA 4M29A 4ZUWA 2NNXA 3S36H 4NYLB 2WBWB 4M9PA 1BM3H 1G5AA 2Y07H 5IM7A 3MBEA 1IFHH 3CMOH 1TJXA 4GSRA 1QHOA 4QTFA 1GSMA 4ZSOB 4C4KO 4MMZB 3S5ZA 4AQ1C 1GRWA 5D2LE 5L2KB 1ZS8A 4JDVB 2X05A 1Z0NA 4UQDA 3HUJB 4AWJC 4RAUA 2NY5L 2AQPA 4HUNB 4PRIB 5SV3A 2DWDB 2VDOH 5D2NB 5F96H 3OSKA 3TIDB 2DQTH 5B4MC 5D71L 2D03L 4YN3A 4CNIB 2R8SH 1BFOB 5C0CE 2IVFC 4FQ2H 1KBGL 2V7NB 3CFEB 4OZHF 2R29L 4H20H 2AJ3B 2DTMH 3PWJB 3ULSA 4JS7A 3PP3K 2VAAB 1ZANH 4Y5XB 5DI8A 4O02L 1B3IA 5G2NA 3RWDB 1CGSH 4Z77B 2AGJL 4ZMPA 2IQAA 2Q20A 1F2XK 4HUCA 3UBHA 3N55A 2GW5A 4AYDC 1DQJA 4WEBL 3ARGD 3NRPA 3UYOD 3O9WB 4NN5C 1EFXD 2V8MA 3CFNA 5LJYH 2ISDA 4GG6A 3GUFA 2OR9H 1L4IA 2R0LH 4M8RA 3C5JA 3MFFB 3NQIA 1A9BA 2VSDA 1SXNA 3BXNB 1BPLB 1FL3A 1BIIA 2ZOLA 3IGUA 4IGBA 4JKLA 4NP4H 1F2QA 4OJDH 4QXWA 4TVPH 5D7SL 3W0WA 4CA4A 3EGDA 3DNKA 4Q8BA 2W0FB 4I88A 3UZEC 1WK0A 1UFUA 5FX3A 4WI0B 1Y6NR 3DBXA 2RQEA 1NBYB 1XSJA 4YSTA 4ELMF 5T3ZE 1XDTT 3ERXA 1FHNA 1UURA 3R4DA 4WI2A 4EO5A 5C0DB 1Z32X 3QIBD 5F7KC 2I5YH 3QZNA 2OI9B 3TZVD 5AZ2H 3MV7D 4DP2X 3BGMA 1SXCA 1I8LA 1P4IH 5DRWB 2H7WA 3OZLA 5AVXB 1LK2A 3OF6A 4ZDHB 4Q7DA 1Z5LB 4H25A 1GY1A 2WKOA 5A2AA 1J0ZA 1HL9A 1UGKA 5DK0B 1NA8A 1G7LB 1DBMH 1S7QB 3U4KA 4UTBH 1KIUB 2V2WB 1DQDL 4BFKA 3QH3A 5J8OA 4LDOB 4ALAH 3Q8EA 3EFFB 1MCJA 4XB8A 3LQAL 5J3HD 5CGBA 4GAYA 1BBDL 5IVZB 1H5BB 1PSKH 4HXBL 3HN5A 4ODHL 4HSAC 4NOBA 1T6BX 2V17H 4FQHA 4Z5RA 4BQ9A 9CGTA 4UILL 2YAEA 3OGOE 2BRRH 3P0VL 2NTFA 2YLKA 4TSCH 4FFZL 1OF2B 5KYXB 1BF5A 2HJFA 2YN3A 1B4TA 4MXVE 4LOVA 4AYID 1LEGA 3QHFL 1NUDA 1ZHNA 2G75A 4PYGA 2CKNA 1NEZA 2CO6B 1N8OE 2NY3B 3UZVA 4AV5A 2OK0H 3QHZL 4JEGB 1EJOL 5EN2A 3DX8B 4NUGL 3WHE0 1SYVA 4M6OH 5I1HL 2O5XH 3QZWA 3SGDH 3V4UH 3RGVB 4ES8A 5L4MA 1TOXA 1ZY9A 4OAWB 2N0MA 2B8OT 3CE1A 4N2CA 1JIBA 1U2CA 2OXHB 4LFHG 2UZPA 1HWWA 1P5VA 3WL9B 1SM3L 4B7LA 3Q06A 2Y7MA 1E4WL 1JI1A 4HOWA 4W6WB 2QMJA 3Q5TA 4LL1A 4FQLH 1XSKA 5FO2A 3FJTA 2VABB 5C0BD 4DGUA 1N4XL 2HFGL 2HT3D 3MRJA 3E1ZA 3DDGA 1QUPA 3UTPE 1UTDA 1MLCB 3LZFL 3ARWA 1L7IL 1VPOL 5CEXA 4Q9RH 2JKRM 2VGLM 2WLJA 4AGNA 1FFNA 2X2JA 4AE1A 4PJ8B 4DIXA 1U8QB 1MVYA 5DJ0B 1ORQB 5IP4A 4AGPA 3AROA 4NCC1 2DJ4A 3MNZA 4QRRB 4RGOH 4PGCB 4L8SB 2ZX9A 3LEXA 5DFVD 1ECZA 1PX3A 3ZZLA 1JNLH 4HS8H 3CDGB 2ICWA 5IMLA 3EHBC 5F2FA 2AXFB 1A1MA 3DIDA 2WB7A 3OZ9H 1OF0A 3WHE1 4F8PA 1CF8L 1PU0A 3HMXH 4JFYB 1NFDB 1Q4NX 2X9WA 3K6DA 5B22A 2PN5A 5LAXB 2YPLB 3LXCA 2EJ1A 3APDA 1KFGA 1KN4H 2Y3NA 5EHFA 2B3RA 2G2RA 4QEGA 3LEYL 5L0QC 2QQKH 3VI4A 5DEFA 3QEGH 1PQZA 1GMIA 2I27N 2NDGA 1MCSA 2RQ8A 4WW2A 5AB2A 2EIDA 1G4MA 1PZ5A 3ILEA 5TE6H 1D5IH 3SDDD 4BA0A 2B08A 4EI0A 1HZKA 5GZNC 4NNXA 1CT8A 3NESA 5CZKA 4MJ5B 1QKZL 4RMRA 2EDLA 4Y4FC 4JZNA 4PRIE 2YMXL 2DKUA 2PWFA 1E9PA 1FFQA 3H42L 4R7DB 2JJWA 2HUEA 4MYWB 2BJML 1WGOA 5CD3A 1WFMA 5DEZA 4YHLL 1Y0LA 5TE4L 4ZZFA 2YPLD 2YEVB 4ZFOB 2ODIA 5L8JB 4IKIA 4C4UA 2WUCH 1J48A 3P0YH 4UAOB 4G7VL 3NFSL 5BRPA 4CMMB 3ETBF 3MOBH 1FVCB 3MV9A 4NBZB 4YSQA 4QRPB 3JWNC 4PUBH 3QWRA 3W39A 2BNQA 4O2EB 2I9TA 4DNLA 3K74B 2GK2A 5C70A 5IVXE 2Y07L 5DJ2A 3FU3A 5AEAA 2VLLA 2QKIB 5M94B 1ZDSA 4NQSA 2A6KB 1EK3A 3HMWH 4H8VA 2WXJA 3JV4A 4J27A 4I18C 2OK0L 1E8YA 3LN5B 1CD8A 4OZHA 3L3OB 3JWDH 3WIHH 3FO1A 2WBJC 3C75A 4U7SA 3KVQA 2BRQA 1RZIB 1P7KB 2BCKA 4HK3N 4W4OC 3FONB 5CS7A 3IJSB 3JV5A 5FYKL 4E9XA 1LO3H 4XN9A 5IVOA 3VU1A 3MRLA 1YNKL 3DRQB 4LSPH 4WZ9A 5EUOF 2AJVH 3S4SB 4Q52A 2R23A 4BK4A 1N70A 1OSYA 1N8ZB 3K4AA 2X4TB 2QGEA 1JFHA 2XT1B 4LLWB 2KL6A 3WAJA 1A65A 5B38G 5JQ6H 1KPUA 3K3QA 4GRWB 2EO1A 5I1JH 1AQDB 1BDYA 3UPRB 3L5XL 2O6EA 3NRFA 4Q0XH 1TUPA 5DWUH 3F05A 1BEXA 4OCRH 2AEQH 4JHZA 4LCWE 5ID0B 2DRUA 5ENWB 4MJID 3UJTH 2H0FA 3OPUA 3CZJA 3K2KA 4XOCA 1EUUA 1EO7A 1CBVH 4GINA 4Z7WB 5JDSA 1UH2A 4LNVA 1FZJB 5ADOL 3N9GH 3BMWA 5FW6A 3RA7L 4HJ0C 5HVFB 2B1HH 12E8H 4PJ8C 1K8IA 1XQ4A 3BIAX 5C9KA 1S7SA 4JFEB 4ZFQA 4BV1A 1FC1A 1HH6B 3N0PB 4LMQE 3UACA 2V9TA 1HIMH 1YYLH 1GPOH 3FFCA 3L9RB 1VGKB 3LOWA 4KDTC 1NCOA 2MCG1 5SV4A 3T9WA 3LHPH 5IOPA 4YHYB 1IBGH 1FYTE 4UT6L 2VLME 4DVRH 3KJ6H 3MLZH 4FC3E 1T89C 1USQA 3H2PA 4KJQC 4NI6A 5BMFL 1F58H 3B3IB 3H55A 5IHZB 4X7SL 5KSBA 4XI5D 3G5WA 5F9WB 4N0UB 5H2BA 4DJMA 4LEXH 3MRCB 4JPIB 1AR1C 2CJTA 5PCYA 3B9KC 3UJIL 5ESAA 5KAQG 4NM4L 3RPIA 2Z8SA 4FL4B 2DQEH 2G0KA 2NLJA 4XBMA 5HDBB 5DGRA 2YPLA 5E0FA 4CVUA 3X3GH 3BRFA 5MEPB 4TNFA 4TL5A 1IVTA 3SYQA 2NY4D 2EVFA 3FH5A 4N68A 5AZEL 1RHHB 2BVPA 2F15A 1RZGB 4PBVC 5JOPE 2XN9B 2DQTL 5TF0A 3L6FB 1HHKA 1JF1A 1OPOA 3L8QA 2WUCL 3LNFA 4JREB 3G3LA 1RU9H 3MRKA 3HHMA 3T65B 2APWA 5GJTH 4ONGL 2IH8A 4DP6X 4F1SA 4PJ5B 1I9JH 1AXTH 1QBML 1UZ6E 3L3DB 3FYEB 3U0PB 3VXME 1E9PB 2OMXA 1U8LB 3NCEB 3FRPA 5E6YA 3FUNA 2XV0A 4LBEA 1KLFA 1U3HD 3A67H 4RNRB 2DPKA 1WHOA 3JTSA 4MQXC 1F4XH 1E2WA 3MBWB 4R7NB 2XIBA 4O5LL 3H0TA 4BH7B 3IU4H 3GO1H 4HU8A 3RE0A 4LVEA 1HE7A 1KN2L 3PNRB 3FN0L 1KF9B 3HBQA 3MLRH 3EJRA 5G4NA 5E8PB 5IFJA 2XXGA 2BSTA 1OXYA 3FUHA 2F54D 4KV5F 4QR7A 4WEUD 2MCPL 4YDIL 4Z7QF 1FVCA 5LGYA 3HAEA 3SKOB 4AZ8A 1DJXA 3T0BA 3AW5A 3KVDD 3Q5OA 5I16A 2BNQB 4DP0X 5L4FA 1RUPH 3THMH 3KR3L 1YHPA 3ZL2A 4U4IA 3GLAA 3CVBA 4DQAA 1RCYA 1R6VA 1GCYA 3MGOA 3TBTA 2VDKL 3E8UH 2FJHA 4P5TB 2CHZA 1FG9C 1XBDA 4L9LA 1BQLH 3QIWB 5EUOB 4MBRA 4JK0D 2AXHA 4HDIA 1GS6X 2YQBA 4XP6H 1MFCH 5D7IF 4Z7IA 2YRBA 3QIBC 4WWKD 3KPQB 1BG9A 1ZE3H 1ZAGA 4OGYH 3NTCH 1M1XA 5A2FA 1XBRA 4B9KC 4YSPA 4XT1C 4B3EA 4G83A 1UVQB 3S3JA 5HGBA 1AQMA 1RH8A 3D2UD 4GQ9H 3UADA 3FFOA 4H88H 2KQMA 3NIFF 1HOCB 4M02A 4ODHH 1VEMA 4G43B 3VH8G 3RQ3A 1LQSR 1TTBA 3O6FB 5DGQA 1SMOA 4IOSD 5ECJE 1DQMH 4MMXC 2FATH 3VJ6A 4BZ1L 3I84A 1BM7A 1JI2A 5DHVH 1KJ3H 5I0WA 3RDJA 4L1BA 1FO0L 1JK9B 2O72A 2AKRB 2V3DA 1VFAA 1P1ZB 4MX7B 2QVKA 1L0XA 1Y7VA 4PCSA 2FZ3A 3I50L 2Z8WC 4HXAH 3ASWA 4NCC2 5C08B 3MUGB 4K3HA 4Y19D 3A0OA 5F96L 3S36X 2PPFA 2YWYA 5DR5H 4Z7QB 4OUOA 3SBRA 3L3IB 2EIJB 4RRPM 4BFJA 4YHOL 3REWB 3R0MA 5AAWC 4X4YA 3LXAA 4AH2B 4WO0A 3O6MH 1H3VA 5CGYC 2VN5A 5J6GA 3LZQA 3ZK0A 43C9A 1UM4H 1XEDA 5DVOA 3BEVA 4N9GB 1E28A 2FJFB 1JGDA 5HYJA 4A7QA 4I1PA 3QJTB 4BZ2L 5J12C 1X7QB 1A5FL 5JPNC 5I1HH 1JXFA 2FK9A 3T2PA 3GHPA 3MRCA 3O2WH 4JPIA 4W6XB 4E9LA 4D94A 2WXLA 4AT6B 4H2AA 5TK2A 5HYIA 4N5EC 3F7KA 5A2KH 3MUY1 1PLAA 3PQYA 4PLKD 2F68X 4Z0XA 4BCZA 4RGOL 4PGZA 2P5EA 3CDYA 1ZT4A 4KJPC 1F4XL 2YQGA 1OLLA 3NCJL 2VISB 4KROC 2ICCA 4DPRA 1ZHKA 5FLVA 4OB5H 2R2HA 3L7FA 3EW3B 2YA1A 2EXWC 2BIIA 2JE8A 3GJFH 4P9HH 4CSZA 3NACL 2C9SA 3VGDA 5AW3B 3LZFH 3O6LL 1M05B 4LF3B 1UA3A 1TKWA 3BP7A 2DL2A 2EUWA 4ETQB 2V37A 2VLJA 2E9BA 3T3ME 4W93A 4X8JA 1Q9LA 3ULVD 4FD0A 4IOIA 3GSNL 2EDMA 5E4AA 1MNUH 4K7PH 5I18L 4FCHA 3P4NA 4HPYL 2PP9A 1LMKA 1RMFH 4JR9L 2ZCHL 2ZNXA 3GB7A 2C9PA 5CHNA 4EIGB 1G7PA 5HHOD 5TQ2L 4HKBA 1JHLL 1K5NA 3BP6B 1A1OA 1W0WA 3CFCL 5GRWA 1Y18B 4N2MA 4DKTA 4AVHA 2ZD0A 1JJUA 4U31A 3SY6A 4L5FE 4BZ1A 2ZKHH 1AGFB 1ITCA 3TBBA 3CLFL 3EFOB 1IKNC 5D2NE 3F7YA 2CJUH 3BGMB 4KNTA 4M7KL 1JDAA 3K6IA 1I1AA 2D2OA 3NCXA 5DHXB 3LD8C 3N41B 5IQNA 2CLVA 3PL6D 3QUXD 5F7WC 1FZMB 2JQMA 1WWWX 1ZKAA 3BQVA 2VLMD 3TH3T 3FU0A 4OLXL 3AT9A 5EUOA 3UZEA 1W6LA 2YC1B 2I26N 1T5KA 5HDRA 1E3ZA 4N25A 2HXAA 3B2UC 3SOBH 1HILA 1J9RA 3L5HA 4I7ZC 2P8LA 4F2EA 5J1AA 3WYRA 5IM7B 3JWOC 2ATPA 3RWEA 3R06B 3FN9A 2IH1A 1T0PB 2H32A 3FQNA 1AMXA 3FQXA 3W5MA 2NMSA 4EEEA 2JELH 3EDDA 3T6ZA 5JIPA 1S8DA 2SODB 4KH2A 3ZVVA 1P7QD 1ICTA 3B2XA 5LGJA 2DWDA 4AENB 4PS3A 7PCYA 2AQ3A 2VDNL 5EN2B 3MV9E 1MHPH 4NKQB 2ENPA 5IFAL 4E5XB 1FORH 1QRNE 1EMTL 1LDSA 2FH8A 3OQRA 1YYML 4HYTB 3HZYA 4AEIL 1EGJA 1IL1A 5GQBA 1MJJA 3LRSA 3A4FA 2DDQH 2NY0C 5DT1H 4ZMTA 2OXHA 1DJIA 2PO6C 3V5HA 4M61B 4EQ3A 1LO2H 1T20A 3OZ9L 3KGTA 3FF8A 1UA6L 3ZE2F 5GS1B 4O02B 1KBWA 3TT1L 3WHXB 1XH3A 5DZPA 3VX0A 1JPTL 3ECWA 1CIUA 5T5FL 3EDFA 5ESVB 2EC9T 2NXYC 4IDJH 3M1BB 1CLOL 1X3DA 2VMDA 4GSDH 2GJ6B 2WZAA 5AVSB 4S0SD 1PAZA 2WM0A 4YX2H 2ICWI 2J1YA 5DJCB 2PTTB 4HIEA 4ZS6D 4XX1G 4NZ8A 3T6WA 3ZTNH 2X3AA 1UA7A 4MNQE 5FKAB 3QPXL 2XJLA 2NDFA 3HE6B 3QRBA 5AOMA 1A1MB 1MNUL 3PDOA 4K7PL 5I18H 1XR8A 2APVA 1ZDQA 4JQIH 4W9ZA 4RH4A 2GTWB 2IGTA 3IDMB 4OCSL 4FMKA 4P3DB 1SN5A 5JHMA 4XMLH 2UZYB 3GTTA 2ARJB 5KVGH 3MC0A 4PBDA 5FCUL 2J6EH 4P5KA 3QFDA 4W9DC 4M93C 1QMUA 4L0ZA 4ZXBC 2YD4A 4F15C 2G4GA 1BWMA 1J5IA 4KZ0A 1F86A 1HL8A 3B2MA 3UTSA 1IKNA 3EFFA 1FV1B 5IV2B 1XCTA 4K71C 4UQ2A 1MNNA 1JFQH 5BOPA 1ZGLB 3GMQA 3MV8B 5HDLA 4J3OC 3ARFC 3NJLA 2HKHL 3BCDA 4IRZL 3B3BA 4ZQKB 3H2WA 3QE5A 1RZKH 1NUGA 2GG1A 4XC3L 3VD9A 2A77L 1NAML 4I0CC 1ZOXA 1X5MA 3HZKA 5KYXA 5DMGD 1Q0YL 4FDWA 5HJGA 3CPLB 2YO3A 4MA8L 2GSIB 4PW4A 1KXQA 3VGHA 2FIKA 2G3NA 1MRDH 3SPCA 1OW0C 3KH4A 1QLRA 4OM1L 4JKPL 3HBZA 4JHAL 3QZBA 4HIJA 1JBJA 5HHOE 2A83B 3Q01A 3ZZSA 1LO0H 1UCTA 2MIZA 4KAQH 3ARFB 4XWOD 4FXLA 4S1DC 3VGEA 3FN0H 3NCMA 4XPHH 2W59A 3HJ0A 1TTAA 4WNJA 1OAKH 2RACA 3C9NB 2IV8A 2P5PA 2XWJA 1INDL 2LLGA 3GF8A 4Y8DC 4A6YB 4RFOH 5IROD 4AMKL 3KWWB 5FM5O 1NGQH 5DDHB 4CU6A 3MLVH 1Z5YD 3TBYB 1DJGA 1WP6A 5LCVL 1JZ5A 4I77L 3RIFK 5CCKL 3D4GA 1S9VA 3U6XS 1LTXA 3S37H 1R3LB 4C4KT 1BAFH 1PPIA 3ZQWA 3EYOA 1EAOA 3OC5A 1FNSL 4RGNC 1DFBL 3R06A 4PRHD 5K5YA 1TTRA 1ZSDA 2O61A 3EGXB 3MLUH 5CM1A 1S6NA 1XR9A 2X2IA 3K5RA 2P52A 3PAUA 5DHEA 1KSRA 4ZUUB 3N91A 3T6XA 2GAZB 3MN8A 3CDGA 4JGNA 3ARFD 3T4YB 2WSDA 3MRPA 2YJQA 4P3CL 1GMEA 4UTAL 1OKEA 2FT8A 3GI8H 1W91A 1OD7A 1L6PA 1U3JA 2CKBH 3FBKA 4KRPC 3EF7A 5DD6A 1HQ4B 2OCCB 4HCGA 2D3NA 3D5OF 2ZYRA 4KJYB 2VB5A 1PZ5B 3L5WA 4ZTOH 4UNVA 3OJVC 2R15A 2EC8A 3C6LA 4XVJL 4F7CA 3LKSB 3NTCL 1FFTB 1LP9B 1ZVYA 2ADFH 4NRYA 3VVWA 4F3FA 5I8CA 2WXQA 3MBXL 1UM5H 1XHHA 2OMTA 3VWJA 2PXYA 4AOFA 4BQCA 1JL8A 2JLLA 2AK4B 4OLVL 4PJ9B 5DQJA 4P5MA 2DLFL 3DI3B 3QNXB 4YBQC 2C9VA 3QUYB 4QRRE 1WZMA 2ZNWA 4N8VB 4XMXA 1YN7B 5HVHB 3EDJA 5HD8D 2N3JA 4PVMA 4KXBA 3MLYH 5LG6A 1FNAA 4X98A 1BBJA 3KLDA 1NCCL 3KWVA 2BOBB 4U1JA 5AVVB 5HI4C 1KEGL 4PP1D 4KMTH 4L48A 1HL5A 2VSCA 3K91A 4XC3H 3SBWA 1DLFL 4YHNA 1OARH 1OALA 3QR0A 32C2B 3BKYH 1L7TL 2B77A 2BSSB 3CFTA 1OSEA 3FT1A 5DQ9A 3WMPA 5LNDA 3IU4L 4YHKL 5DD1H 5JLZA 1YPZA 1QBLH 3FU5A 3N1PC 3DX2A 1PEWA 4JANB 5D2LA 3CSTA 5E6IB 3U2SA 4E9SA 3GUTB 3O6ML 3GMMA 3HKZA 1ZJAA 5CP7B 2OTWA 1G1OA 1P5UB 4ABWA 1AIFB 5CWSA 3PWPB 1T4KA 4MRCA 5DK2B 4QHUB 1GGCL 1WVZA 5C3TA 3WMQA 5T1DH 1CGYA 1G1YA 1MWAA 2GTZA 2VXSL 2P24B 1AO7D 3JTSB 1JZ2A 2I60L 2X4TA 2NSXA 1UUSA 5E7FA 1BJMA 2UWEB 2B20A 3F04A 1J7VR 3B7UX 3D69A 2DDQL 4I3RH 3S98A 3TH4T 5K9JL 2C3XA 2BVUA 2ZP8A 3V55A 2XLLA 3RDTC 3T0EB 2L7EA 3STLB 3MV7B 4C83B 3F12B 4N0YH 2DQIL 1TZHB 2C4XA 5AW6B 4A7SA 3N1GC 5J89A 3DXAE 3CHQA 3HAEB 3SKOA 1NUNB 3TPKA 4BZ2A 2EZ0D 5H35B 3Q3GB 2ZWNA 4AIOA 1JZ7A 1IM9A 5EA0L 1K4CB 5TD4A 3CC5B 4EE2A 2HTLD 1P84K 1FNGB 2ESVB 3HMXL 3QZPA 1V10A 4R6UA 4TUJB 3QUHA 3OV6A 3QPQC 1E2VA 1J05A 1RZJC 3ZMEA 4F93B 4WWKA 2E46A 1L9QA 2EXWD 1KFAH 1YUKB 1M9WA 3DSFL 3WD5L 5H4ZA 1IGTB 2HG5B 2PCFA 1YEFH 3UTZB 5BS0E 3SE6A 3IXTB 3NJKA 1CU4H 5CFAA 2IBGA 1FNEB 5ISZE 1NC4B 2OMBA 2EEBA 1KB5B 1QYGH 1T2XA 1JWSA 2F7IA 2W91A 4LDCA 1MREH 3O0LA 3DV4A 2VUKA 3HNVH 3QDJE 3PFQA 3CLFH 1I7RA 3B2DC 5HGAB 5AOIA 4E9WA 4IOFD 3KPPB 3HN3A 4UQ9A 2G9KA 3ZLQC 2B59B 3FTGB 4FXKA 4WFFD 2JVUA 3WEOA 5ALCH 1RK0B 4N24A 5FOBA 5TE4H 3OLGA 1D2OA 1R5WB 5B7FA 4Z7AA 2FLRT 2XX0A 3RWGA 2NW3A 1MF2H 3NIFB 1Q0YH 2N1TE 3L6FA 4R26L 2FWUA 2XACC 4LZKA 3RWDA 1PZCA 1C5BH 4ZUVB 1WTLA 2X88A 2Y2WA 2Z93B 1PYWB 2MSPA 1SOKA 3KBPA 3QNZA 5FGBA 3PL6C 4NUGH 4K8RH 2OZ4A 1XTMA 1SJEA 1WZAA 4PRDA 4F33A 5BCAA 3REWA 2CK2A 5FYKE 3NIFE 1XFPA 4BE5A 1XT5A 2BY1A 1KLFB 2IMNA 2GSMB 2VM3A 4XCNB 4GH7B 1OTSC 5EO9B 3UDWC 3K71A 1E28B 5HYSA 1VADB 4K7FA 3DDFA 1JV2A 3Q5YA 3GRBA 4JN1H 1G0YR 1GZHA 4G11A 4OF3A 5JIIA 1JPTH 4PJXA 1G9NC 1SYSB 2DM4A 4IU2A 4RETB 3QUXB 2J44A 4G5ZH 2HUHA 4WFHE 3CZEA 1T1XB 2O5NA 3GK8H 4FJZA 4BINA 1JZFA 2QDWA 5F7MC 1T3FB 3QK0A 1GW0A 4HS6B 3GGWA 4MNQB 2X6BA 2EIKB 2YS4A 5I6OA 2J21A 3MGOB 3N41F 3E6HB 1KGCD 3S35H 4OZGF 5MEOA 4ETQA 4ISVA 1JE6A 3I6LD 4IDJL 4G7YH 1RP8A 5LHDA 4X8JB 2DWSA 4MASA 3RIAK 1GHFL 2J1KA 2MPAH 4YO0A 2VC2L 5E9AA 2DYRB 3RA7H 2HLAA 1AVAA 5I8OH 4NPJA 2XPYA 1NMBH 4WVRA 1GYVA 1WBZB 5E9DD 4YVNA 3LSOB 3ML9A 3MR9B 2ZUWA 3K0YA 5F3HB 1XL4A 3E6FB 4DOHE 3MV7E 1AFVL 1K5WA 4FQ1L 4HKBB 1KTLB 4XCFH 1MEXH 3CD4A 4E5XG 4MQXD 3HNSH 3MGTA 3BPNB 3ZE2B 2WY3B 4N8PA 4G8GE 5J7CC 1B0IA 2GCYA 5IW3A 3VDCA 4PMEA 4Z23A 4PY8I 2VXUL 4NO0D 3VG9C 5AWNL 3L1OH 3L9EA 2OMZA 1WFOA 3F58L 3ARVA 3F7YB 5AW9B 4JQVC 1IM3B 3FB5B 4ZMYA 1RSYA 4LCUA 4Y5VC 5FB8A 1NCNA 5AYUL 3BUBA 4XPHL 1UWYA 2VERA 2VLKA 1EZUA 1X9UA 4NAMA 4C54A 4IBSA 3BGFC 1PDKA 1TQCC 2HG5A 2Z64C 3OX8B 4LLAA 2LW3A 4LRIC 5FGCE 5AVQB 5T1KB 5CEXB 1UXMA 2ATPB 4FFYL 3IFPB 3WY2A 1MY7A 4XPAL 4M7JL 5FC9A 1OTTD 5T33L 4J3OG 2XU9A 4PGCA 2BY3A 5DUJA 3VW3H 4HHGA 4JFXA 1MHEA 3DPBA 3NP3A 2CKBA 3MZGB 1XXFC 1O0VA 1S5HB 2Y5TA 4LPWA 1B4JL 5HYJD 3BEWA 4MAYB 2B59A 4WU7A 5CBAA 3EXJA 3H7BB 1ZT7A 2P5EB 5E00A 3GSWA 3LN9A 3T8MA 3TEWA 1F6AB 3K1DA 3GSNH 4FA6A 3LQZA 1AS6A 5D5MF 3FT4A 4MA7H 5I1KH 4XVUC 3WJMA 1TR7A 3QXDA 1SLVA 4YUEH 2RHEA 4PVLA 1VEOA 5E8OB 2RAMA 1AZRA 2W95A 4O2CB 1CFVH 5GIRB 2Q8AH 3NFPA 4GNKB 2APFA 2ZOKA 4RX4D 3SGEI 3WGUB 1A3LL 5C2UB 4QNPF 3QDME 5CZXD 2CPCA 5D1ZI 1XAKA 4ZMVA 1R24B 5AL8A 3TWCH 3BZFA 2V2XA 3MNVB 4OCSH 1MCPH 4PRPD 1U6AL 3KYMA 4XN8A 5E51A 3RFRA 1NPJA 1GGIL 2YEZA 4NUPA 4FYTA 3AS1A 5CJOH 5C7XH 1DBKL 3H1ZA 4F9LC 3TO2A 1RUQL 2EYSB 1HU8A 3KWTA 3TTSA 2E76C 3S3DB 2BRRL 5B39A 5MEQB 3J7HA 4XZUA 1MZYA 2E7BA 5A7BA 2VW6A 3DVGB 3HNTH 4HKXB 1X5JA 2E5EA 2F8IA 4AGQA 3EH2A 2GITA 5FFGA 2HJLA 2F53E 1DJWA 2VW7A 1UUNA 3MBXH 4GAJH 2AQ1A 3ARGC 3BE1L 4KO6A 4WHDA 1I7TA 4B9PA 1SOXA 2CLVB 2KZ1B 3C6LD 3NA9H 3ALWA 4GY4A 3TH2T 4URTB 5BV7H 2ZCZA 3QI9A 3V4VB 1TQBB 2MKWA 2CDGA 2OQJA 2D03H 1XSOA 2R8SL 1BFVH 3T0EE 3V5KA 3Q2VA 5HYQA 4X6DB 2F74B 1IX2A 5HYSG 2NUTB 1MI5A 5I1AB 4UT9A 4P23A 5F7HA 5JXED 4BUQA 5DEJA 3VYPA 3VUAA 3AXIA 3CPLA 2NXZC 4TYUA 4GW1A 4NQEA 5C0NC 1A4KA 4I77H 1A7OH 1V05A 1IZKA 1T7VA 2ZXCA 4U3HA 5DRXA 1I75A 2E0PA 1HXKA 5B1KA 3L5JA 4PJFE 2PPDA 3QUMB 5CEZL 2AV1A 3BP4A 3WIHL 3D39B 1WAAE 3KGSA 4DWHA 1T1WB 3O3AA 3WFHB 2DQGL 4LSRH 5EC1A 5SX4I 2A7BA 3LH8A 5BQ7B 4Z3HA 3UYPA 4KXDA 2H3KA 2Y7LA 3ULUH 3QPKA 3ARBB 4WFEE 1SDDB 4GI8A 4FTVB 2B3IA 5GRJL 3GKWL 2Z7UA 5B8CA 1Q8MA 3D52A 3QCVL 1XTLA 2NXZB 4HKJB 4MAZA 1KWGA 5ILTH 5D1XE 4ZMXA 1BD2E 3TCLA 4K9EH 1BEYH 2X4SB 4LSQL 5GRUL 2BNUB 2MCPH 4QYAA 3ZL1A 4L4VB 3E1F1 2F8OA 2V9UA 1QEWA 4OGAD 5T1KA 1UWGL 5IFHH 2IOOA 4I2XA 4Q4IA 4RX4A 3L54A 3MBEB 4XAKD 4RZKA 4F7MA 1X44A 5CINL 1MCEA 2WTRA 1YVLA 4Y4HC 1FF5A 4ZNEE 2N56A 5GISL 3E8UL 4K94C 5JR1H 4MZIA 1J0IA 1XIWA 3ZDWA 3TWCL 4YFEA 4XPBL 5B4MD 3GINA 2K1MA 1F11A 4GRMB 1VACA 5IB3B 3US1A 4HC1L 3N43B 4W9IC 4P5SA 3CH1B 4BKLA 3PGFL 3Q2WA 1HWHB 2VDPL 3ILQD 4MMZC 3ZYZA 1ZGLM 4JGUA 3KBHE 2QSTA 3TVMB 4PJHE 3VSQA 1C9SA 2AJZA 4M00A 1CXLA 2YD8A 2F5BL 5C0CB 1CCZA 2N01B 3S34L 3NFPB 4QWWC 1GZPB 2VL5A 5EU3A 4M8VA 2IDUA 1A2YB 1FLTX 3LKQA 4NFCA 3CUPB 4UMGA 1DQKA 1IFRA 2D3LA 5J1TC 2CMRL 1G7QA 2ED8A 4XVOA 1ZLUK 5C8JB 4ZFZA 3BZFB 5C0AB 1ZS2A 3AY4C 1OQXA 3ZDXB 5B7MA 4N8UA 5CFHA 1OZTG 3LDBC 5DJAA 1AS8A 4NN6B 2D7NA 1AZBA 1U3HA 3QW9A 4LSUH 2ZSVB 1EUTA 3L3GA 4S1SH 1LP9F 2A74A 3QUKA 2ESVD 2K3HA 2E6JA 1KY6A 3G5XB 4G8FB 3SQBB 3X11A 3SKNA 4ZAKD 3EO9H 4U1IB 2FQGA 1BIIB 2ZOLB 1YYCA 2LOEA 2C3VA 4YAQB 3CZGA 5FO9B 2TRHA 2X09A 4W9EC 1MCOH 1Z6JT 2FWOB 1BQHB 3RZCB</