2VRNA

The structure of the stress response protein dr1199 from deinococcus radiodurans: a member of the dj-1 superfamily
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
185
structure length
184
Chain Sequence
DLTGKKIAILAADGVEEIELTSPRAAIEAAGGTTELISLEPGEIQSMKGDIEPQEKYRVDHVVSEVQVSDYDGLLLPGGTVNPDKLRLEEGAMKFVRDMYDAGKPIAAIHGPWSLSETGIAQGLKMTSWSSLKRELTLAGAQWVDEECVTDKGVVTSRKPDDLPAFNKKIVEEFAEGDHSSRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the stress response protein DR1199 from Deinococcus radiodurans: a member of the DJ-1 superfamily.
pubmed doi rcsb
source organism Deinococcus radiodurans
molecule tags Hydrolase
molecule keywords PROTEASE I
total genus 64
structure length 184
sequence length 185
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01965 DJ-1_PfpI DJ-1/PfpI family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.880 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vrnA00
1SY7A 4Y1EA 2R1TB 4UCFA 5JZOA 1QVZA 1SOAA 1S1MA 3ER6A 3P9SA 2R1VA 3NOVA 4WXYB 1N57A 4WINA 3N7TA 3CY6A 3TTSA 3TTXA 3PQ5A 4L7QA 4OIFA 3EZGA 4OFWA 1P5FA 1JDBC 4N0MA 1KA9H 4MTCA 4PXYA 1VCNA 4MGHA 3R75A 4BTEA 3VU3A 3OT1B 1OI4A 4P34A 4I2NA 1KEEB 2IUFA 2R1TA 1Q7RA 2ISSD 3BHNA 3RHTA 4RKWA 1JVNA 3D54D 2XF2A 5JZMA 1BXRB 1QVVA 3R76A 4N12A 3TTVA 1P7ZA 2ZUTA 1PV2A 1QVWA 3L7NA 4S0ZA 4UZSA 1OY1A 2VXOA 4AUMA 4ENTA 3TTYA 1I7SB 4OGGA 1U9CA 4ZDIA 1J42A 3UGJA 1CE8B 3UK7A 1GGKA 3B3AA 4L95C 3PQ2A 3PQ6A 3OT1A 4ENRA 4QYTA 1ONSA 1QF7A 4UOQA 4B2YA 4BIMA 3P9QA 4B5KA 4P2GA 4E5VA 4B31A 1VCOA 3EN0A 3WFZA 1R9GA 3EFEA 1VCMA 3ZR4B 3ZJ5A 3EJ6A 4Y1RB 4GE3A 1OX4B 4L8WB 5LIRA 2OR3A 2H2WA 3KKLA 2ABWA 3PQ3A 3TTTA 2RK3A 4QYXA 4Y1FA 4ENWA 1C3OB 1GGFA 5BV2P 3PQ8A 2WJZB 3UJNA 1VHQA 4GUDA 3SOZA 3SF8A 1FYEA 4E08A 1T0BA 1T3TA 4ZDJA 3P9RA 4UOZA 2AD5A 4OJYA 2R1UA 5DFAA 3P9PA 4UNIA 4Y1RA 2ZUWA 1OX5A 1GGEA 3PQ7A 2A9VA 2LXNA 1FY2A 3L18A 2VPIA 5SY6A 4MNTA 2RK4A 4RKYA 4Y1GA 1GGJA 1OX6A 1GPWB 1P7YA 4L8FA 3FSEA 4ENPA 1I7QB 4OGFA 3FIJA 3MIIA 3NONA 2YWJA 2ZUSA 4I4NA 4LGYA 3SF8B 4ENSA 4Y0NA 4L78A 3B36A 3M3PA 2VKTA 2YWCA 4AJ9A 4GE0A 3NVAA 3F71A 5K4AA 4AUEA 1IPHA 1A9XB 5IP5A 1C30B 4XLLA 5SY4A 1P81A 1T36B 3CZAA 1CF9A 2W7TA 4LRUA 5SY9A 3R74A 4ENUA 4I46A 1PDVA 1WL8A 3EWNA 3NOQA 1Q2UA 3UMMA 3CNEA 1PDWA 3PQ4A 1IZZA 1L9XA 4ZGGA 3TQIA 2VRNA 3MGKA 2FEXA 2NV2B 4K2HA 3CZ9A 4P35A 1GPMA 2VDJA 4BFLA 1GGHA 1PE0A 1UCFA 2ZUUA 3BWEA 4ENQA 4ZDKA 5E9AA 2GHRA 1P80A 1OX4A 3NORA 4ADSG 3L3BA 3TTUA 2V4UA 1QWSA 2AB0A 2NV0A 3B38A 1GG9A 3CYFA 2ZUVA 3UOWA 4B40A 2GK3A 2R1VB 3GRAA 4L8YA 4D1YA 1K9VF 3ZJ4A 1CS0B 2RK6A 4P36A 1O1YA 4AUNA 4P5PA 1KWKA 3L4EA 4JQSA 1I1QB 3F5DA 1QDLB 4ENVA 1M6VB 1IZYA 4OQ4A 4HCJA 1KWGA 4R7GA 4B7AA 3TTWA 2YWBA 2YWDA 2D7JA 5SYAA 1KXJA 4AULA 1G2IA 3NOOA
chains in the Genus database with same CATH superfamily
3PXAA 3ZY6A 1N2OA 1QANA 1X9GA 2A35A 4TTAA 2XCIA 4BLVA 1SOAA 1GNQA 1J1UA 3EIOA 2R86A 3D2BA 1JMYA 3E8XA 4IIHA 4XVRA 5IJAA 3CPSA 1MVLA 4LZAA 3PHLA 5BVGA 4P22A 1M6YA 3W3AA 4C2AA 2QL7A 3NJ4A 1XHEA 2JLQA 4KWHA 2CXRA 4YRQA 4A5OA 2NW6A 3I1JA 3VJRA 2QP9X 1TK3A 4DB4A 1WB9A 1IN7A 4O2BF 4TLBA 5KNDD 1AZSC 3IUNA 3L7IA 1ODJA 4OP3A 3GLHB 4IS2A 4E07A 221PA 3AUAA 4GXTA 1U8FO 1GXSA 1FX0B 3C7DB 3OQ6A 4CWAA 1G42A 5BQPA 3LRPA 4EB6A 3WA7A 5DN6D 1RP7A 4IWYA 4CCAA 4CU2A 5JFOA 1FZTA 2HMWA 1J56A 4Y2PA 1C81A 3GOQA 4IHKA 3RAJA 1KH1A 3AFIA 1ST2A 5FR1A 5LZ8A 2COKA 2GH1A 2JRLA 3VPFA 1K2VN 5I7WA 3OFJA 1PR5A 2HCJB 2HU8A 3IUQA 5F5XA 4AMBA 2GARA 1DS6A 1G5QA 1HDGO 4Y1RB 1D2NA 3PUKA 2DUWA 4RPIA 5ALGA 1JFRA 1GEGA 3BSFA 3LY9A 2AOWA 5FUBA 4HNQA 2HDOA 5EY5B 3OX1A 4M4SA 1LRJA 3O47A 1JKIA 1SM4A 2IYVA 3GLHE 4GPBA 4Z9YA 3GFFA 1PW7A 2PNJA 1XVTA 2I55A 3NANA 4DZTA 5BSWA 1X0XA 3C7CB 5EQTA 1E8MA 1ZCZA 1ZMBA 4YBZA 3ZW9A 1Z36A 1KY5A 5CA0F 1OHHA 5HUJA 1XA4A 3RU3A 1NOIA 3TOXA 2NX2A 5GIPE 1Z22A 4KITB 1KGDA 1TOAA 4C0QC 3OOEA 2D6FA 1E2JA 2WWTA 1UPFA 2GB4A 2Y0DA 4JLVA 3WSWA 3OWOA 3G2KA 4IHJA 1N5DA 1RBQA 3D3QA 3D8RA 3NWOA 1SBHA 1ZXBA 4MI1A 2L18A 2ZUSA 2H48A 1K27A 4DMHA 1BC5A 4IX9A 3RU2A 4CGYA 4K9RA 3NH9A 4S2UA 3K5IA 3C70A 4ZMRA 3L77A 4AY2A 2YWXA 1T36B 3WBKA 5KQPA 2QRHA 3SS8A 3L1JA 5CLGA 1AUXA 5G1NA 5D84A 2XDQB 4B48A 2QTHA 5CA1B 4Q24A 3ZWXA 2AUMA 4K9SA 1HURA 1HMPA 1UL1X 4ZC8A 3U1BA 5FOSA 1GG2A 2NT3A 1K92A 2QGFA 1Q0TA 2AL7A 1LI4A 1YS1X 1ONBA 5LYJB 2EW2A 3RNOA 3PF8A 4ALLA 3DYBA 1AHNA 4BJ1A 2A1TS 1PF7E 3VGJA 1UXOA 3E15A 3QFSA 1MMFB 2PE5A 2C9MA 3OJ0A 4Z4HA 2IS4A 4GVXA 3CSSA 1OA0A 3GRKA 3KE8A 3FNRA 4M1SA 3WNVA 5JSQA 3JQPA 4K9QA 1YZYA 3R5JA 4INJA 4WAUA 1MOZA 2M6LA 3L4EA 4N3AA 1EEHA 4BHTA 2EX0A 4WKCA 2YV1A 5GJCA 3S8MA 4M1EA 2PSFA 3ETJA 2EP5A 2YWDA 1IZ9A 2YWBA 3K5HA 5SYAA 3AZOA 4Q6WA 4GMFA 2D54A 3BFJA 2QL9A 2F3SA 4AROA 3BREA 2GJAA 1XZIA 2C5HA 3GH3A 4S12A 1GUAA 4YMSA 2RARA 1QZ3A 1F2VA 4FC6A 1AVTA 4NI5A 2WE7A 3DOHA 2PRZA 2XCQA 5JH7A 3QMVA 2GAOA 5DM70 2ZSAA 2IIQA 1N1EA 2E1PA 1J0XO 2C78A 2QLFA 3OJXA 4BGVA 1W46A 1SAYA 2ERXA 1XNGA 4KIFA 4M8SA 3RD5A 4BKPA 1PBTA 2BYTA 4G1EB 4XZ3A 2Z98A 2I2WA 2V96A 1VXRA 2DBZA 2FZ5A 4D9NA 1T2CA 1SUAA 2HNBA 4GP7A 4HF7A 3M5CA 5ICEA 1NVBA 1RJWA 4M9QA 2JFNA 1F2DA 2WSSD 4RTOA 4EZEA 4XIIA 4Y30A 4F3CA 3Q9NA 4MRMB 3LW8A 1J5XA 3HXOA 4D57A 1AGPA 2JZOA 4EEZA 3H86A 3LHKA 4UVDA 1CIVA 3LZ6A 1Z0SA 1CT9A 1VCOA 2WJJA 5TMDA 1JP7A 1OX4B 2R6ZA 4PZCA 2ERCA 2XQKA 3PXBA 1GFZA 1N7GA 1RLOA 3EEFA 1NI3A 4AF6A 5AVVA 5JMOA 1H5UA 3K05A 3C85A 3KUXA 4X6XA 3WB1A 3GUZA 1QU2A 1A8HA 2FQXA 4OO3A 2BR3A 1V11B 2PZJA 4I1UA 3GBSA 4MRPA 3P5BA 2O2GA 4F86A 3HKBB 5AM0A 3PL5A 1LSSA 3CSUA 3TIGA 4WCFA 1FVFA 5IXYA 3IMKA 4D8YA 3IIJA 3VYWA 3ABOB 4MDHA 2G88A 1PLLA 2XHEA 1P45A 7GPBA 1D2AA 5NULA 2AW3A 1VGVA 1PR6A 3GRYA 3IE0A 4JH0A 5TC4A 4JJ6A 3S2ZA 2QBYB 4FDAA 3NDBB 4BFTA 3AM5A 4F9TA 1YVRA 2FXVA 4JBHA 3W04A 5J5VA 5FWYB 1E79A 2JCGA 1ZNZA 2ZR0A 5WRFA 4HRAA 4IDDA 4UXJA 5CX1A 1H1TA 2O19A 4XIFA 3AEUA 4RD2A 3K8YA 5AW7A 3QVXA 2HU5A 4U9HS 3OFSA 3VHLB 3HTXA 2VLIA 1SKUA 3T99A 2QOEA 1KEZA 1UBHS 2JAWA 2QORA 4FHFA 4DA8A 3CX3A 3NOQA 4RNDB 3TPCA 2CNOA 5IN5A 1FU8A 2ZITA 4R2WA 4J2OA 2EGGA 1YNSA 3WWEA 1F3LA 3IPYA 3WNZA 1QHXA 3LSYA 4G1CA 2ZT8A 1OSNA 1T3GA 1NUAA 3QXXA 2A92A 1I7LA 1OFUA 2DJIA 3UUGA 2QU8A 5E9AA 4B6PA 1QU3A 2OBNA 3FD8A 4QXOA 4DVJA 1OX4A 2GZMA 4EFLA 2E18A 4PFSA 5TT1A 1FFDA 1T43A 1V1MA 2G04A 3KLNA 4BO6A 3EZ2A 5K1ZA 2QROA 4R6XA 1YZQA 5EP3A 3BHMA 1BEUB 1OBOA 4L8YA 5FYDA 1LPMA 4X3CA 2BFBA 1RXYA 3PCXA 5I3ZA 5KJFA 1AK9A 3PEWA 1CJCA 1P5HA 5CFOA 4RDCA 2NSJA 3FWYA 4JLUA 2Q2QA 1FRVA 5E1DA 1YC2A 4BLPA 1FVHA 5IEJA 2BM1A 3ASYA 5JY6A 2WWHA 4DDKA 1PTJA 1GZDA 4IGIA 1SY7A 4ME6A 4Z8YA 2WMDA 2XB4A 4B5LA 3WAGA 4RXTA 1UT8A 4G84A 4UULA 2AFHE 3P9SA 2ZRJA 4BBZA 2ZBQA 1U5CA 2H2HA 1F0KA 3GGSA 2A7XA 3EISA 5AP9A 4TMKA 4HQ0A 3LWBA 1YJCA 3DZ8A 3BXPA 4OBWA 1AKVA 1CBUA 1E0SA 1UMDB 3C5EA 3JAMA 3CQ9A 3JYLA 3PEEA 2C92A 4PCLA 4WD3A 3RUFA 5A0FA 3ZTWA 2RB5A 4E1VA 3GFGA 3FOBA 4G07A 1CDOA 1R0XA 4INPA 4I1PA 1TRKA 3OX2A 4D81A 1I0ZA 3QF4A 4UUMA 1QRDA 3EVZA 3L7YA 4GRIA 4B2IA 1ZJ5A 4C2TA 4F45A 3A27A 4TMZA 4WVLA 1GNRA 3ZI4A 3SZ3A 4MSUA 1DPFA 5BNTA 3ZWDA 3ZH2A 2NU8A 3W3AD 1VIDA 3R09A 2OLJA 5HOEA 2QJRA 5IKEA 3WZLA 5JCOC 5I4BA 3M1AA 3C3DA 4HQRA 4CM4B 2OKCA 3CUTA 4B3GA 121PA 1QV9A 2C2BA 3UEOA 1ZZGA 2BTQB 4DW8A 3FPJA 3Q3EA 5TSDA 2WTBA 4OH1A 1SQ5A 3NXSA 2J85A 4Y6PA 3S40A 3TFQA 2EKBA 2NN3C 3DL4A 3JQGB 4MX8A 5BNZA 4O08A 2RG1A 3EGOA 2QMOA 1C8KA 2VSXA 4CIDA 5I7RA 4WL0A 1BDIA 3TSZA 3JWEA 3RRJA 1XDSA 2X9GA 3G2LA 2B92A 3GLFA 1K66A 3DOCA 4MKGA 1SUWA 1PJ8A 5FNZA 2IE8A 4RW0A 1ZGZA 2AMJA 5E4YA 3CKLA 1X8KA 2ZUWA 3W8RA 1AXGA 2WF7A 1UP7A 4J9VA 4LSZA 1YZVA 1KZ7B 3M6IA 5BVHB 1VJCA 2H4WA 3BUSA 3C1AA 4Y1GA 4DILA 2EHJA 3N75A 5EHZA 1SIUA 1VI6A 4F9FA 3V3TA 4R8RA 3ZVMA 1NXPA 3DE6X 4GRDA 5AW9A 5AHKA 5EWJB 4PIPA 4GKKB 4LOIA 4YT5A 3KOMA 1T8TA 4MS1B 2YFKA 3VX4A 1U2EA 1WPRA 5FTWA 1YU9A 1HQCA 3WBFA 3FDIA 2YQ4A 2YRXA 3LBYA 4PPGA 4EAQA 3N2ZB 3LH5A 2PLFA 4ED9A 3WWOA 5HIJA 1I10A 4HLUC 5TIIA 2HADA 1SPBS 2Z4RA 3H1FA 3DBVO 3D2CA 4BO0A 5AESA 1Q7BA 4DBVO 4P0PB 2F43A 4KEAA 3RYCB 2OILA 3ZD8A 2NVUB 4MPRA 3FMGA 3AR5A 3DE4X 3HUTA 4IDAA 5DT9A 2AFVA 1RWPA 4RA9B 3JAKA 1BD3A 2BV3A 2YHAA 4IIDA 4K8OA 3RJMA 3OH8A 4KXLA 4MGYR 3L04A 1I3CA 4W5JA 5LA6F 2AUNA 3EWIA 4HDNA 4KR3A 4NV3A 4FE4A 1T9KA 2J3JA 2HEGA 2P8SA 2H7XA 5C7LO 4DM4A 2MSCB 2C9OA 3LYHA 3NO4A 3DFIA 2CLOB 5BRNA 4ZKEA 4U7DA 3RF7A 2B2XA 4YAWA 2IYZA 1E63A 3SFZA 3TLGA 2XGMA 3D6MA 1CY4A 5CCXA 4XYGA 2GZRA 1QDLB 2DHQA 2HMVA 2IH4A 4Q4AB 4J6FA 4Z4CA 1I80A 3DLPX 1N2GA 1MX9A 2ODWA 4NCIA 4Q5IA 4QYWA 3U48A 4HX9A 2D8MA 3B9PA 1IU9A 4JBNA 2ZWMA 1VG0B 5EHIA 2Z3WA 2P9QA 4CETA 1DTWA 4H7IA 5B3JA 3UIEA 4U5QA 1C9JA 4JI4B 1JEYB 3LOQA 1FNSA 4JJGA 3HCDA 1FDUA 1XZDA 3COVA 1BEEA 1WTAA 2G71A 3JCZA 1XNHA 1QQ7A 3OCWA 5HFNA 1Y4DE 3C3WA 3LDHA 5J43A 3RV3A 1GTG1 3QFRA 2DPYA 2YR0A 1WBDA 1VBFA 3FMPB 1UPBA 3P2YA 4K5QA 1AKYA 4MRAA 1E7YA 4CL2A 4MKXA 5AI9A 3TEMA 2IYLD 1H23A 2VK8A 1QF9A 4Y9SA 4UTNA 4C04A 5JS2A 4YT2A 2LCQA 3V2GA 4MI6A 2PTGA 4YNBA 5I48A 2W2PA 4MUBA 3BGVA 4KFUA 3EVFA 4TXMA 3JVVA 3ZWVA 4NVRA 4DQXA 3EZNA 2R11A 3BB3A 4WK6A 2X8AA 4O8CA 2PGXA 3DAFA 2NYRA 4L15A 1AMNA 1J1IA 1H6DA 2B0JA 4AJIA 3QVGB 4GNRA 4JOCA 4C01A 5ALXA 3UV6A 4LF9B 3D31A 4Q3LA 4F1JA 4O29A 1CZRA 1HR0B 2ODTX 2GD6A 5GVSA 2P6UA 1UBKS 2W4IA 3EXG2 1IHDA 1Z8FA 4OXQA 4DHWA 3IR5A 3C87A 5HK9A 3I2IA 4BQSA 3KQNA 2DTXA 4BGDA 1KOFA 2X7HA 3HDQA 1CK4A 5LR6A 2OZKA 5FWNA 1ZI9A 4J9UE 3K3PA 4MV1A 1GCAA 1GTVA 1J33A 1PLJA 3ZZTA 3PX3A 3T3IA 1EVZA 3V33A 5BW4A 5C1OA 3VR5A 3DD5A 4QHYA 3VSDA 3C6MA 2YVAA 2AOUB 2UV8A 3FKSA 3UTDA 1US8A 5HQTA 2CCKA 2PX2A 4AMVA 2BGIA 1NVEA 1T0IA 2HRZA 1M74A 3B53X 1IZ7A 1T5HX 5H4HA 3FOZA 3COWA 1SEVA 3QKTA 4BQNA 3MT8A 1MO6A 4JJZA 2PKXA 1XRPA 2PHZA 3C8ZA 3RSHA 1VHJA 3PP8A 3BD6A 3D8TA 3CM0A 4M76B 4MYTA 4BP1A 1DPGA 2DBQA 1WXIA 1H2WA 1XYGA 4G0NA 2ZJ4A 3C3BA 4JVNA 2BR4A 2CVOA 2RH4A 3FHCB 3L49A 4MA4A 4HT3B 5GADl 4WZAE 3VSEA 5MFPA 1PWEA 2JI6A 3OE7A 1TKCA 4LJYA 4B82A 4DUPA 2CHQA 1UC9A 4S35A 3SKVA 3HBJA 1C0LA 1ONNA 1H2XA 5E6SB 1IWPB 4ENUA 4CM1A 3X1JA 1TQ6A 4B0PA 2HCRA 3AIMA 3BD7A 2IHNA 1RHRA 1E64A 5IXJA 4XWTA 3VAZA 4RABA 1E1QD 1RKUA 1FIUA 3VPHA 1JYFA 1R6DA 4OQEA 3I9NA 4MCHA 5BSUA 1J8MF 4Q7JB 4FONA 3NLLA 1PZNA 4YRMA 2CHFA 4Z2AA 2IU4A 4B43A 2BD0A 2VKQA 4ZOQI 3TKAA 4X7MA 3JTEA 2V6GA 5E7MA 5FA6A 5HFAA 2UUAB 1Z3CA 4HEQA 4HMQA 1WMEA 2KHZA 5CBKA 1TAHA 3K09A 5J2UB 1O58A 1GYQA 3NM6B 3GCDA 3GP3A 1Y81A 4IHAA 4WXEA 5DXFA 1EFRD 2COUA 4IXDA 3IMGA 4DBLC 4RFSB 1GU1A 1MAUA 3CVJA 3UMVA 4PC3A 4X97A 3CLKA 2FOLA 3TW8A 3DDZX 4JLWA 4LSMA 3LDUA 4ROSA 2NSYA 1WP4A 3F74A 1W48A 4II3A 3D4PA 3IBFA 4QXMA 3UH1A 3WX0A 2P6OA 3MT9A 4HB0A 1B0PA 5TS3A 4C0WA 5FAKA 5GGXA 4KIUA 3UJBA 4DLVA 3AF6A 5ES4B 3HEAA 1XWWA 1JAYA 2DAPA 1HDYA 1JT9A 4NMLA 4P98A 3WTCA 4D9GA 4MQ6A 1W4ZA 2BWJA 2OYSA 2YW9A 2M1ZA 3CV3A 4HFNA 4JI3B 2C84A 3RUDA 1P9RA 3B52X 4UUOA 1P5JA 1SVWA 1H0RA 2WAAA 3AR2A 5TPZD 1W0JA 3JQRA 2NUPB 3M7IA 1F06A 3H0CA 1QZZA 3QXGA 4ZO6A 3QVGA 3GAZA 4MR7A 5BSVA 4IJ5A 2QM7A 3OQNA 3A1FA 1P75A 3RVPA 5IJ9B 1ECPA 2P77A 1PNTA 3D43A 2RAPA 3U44B 2M2IA 2I4NA 1XKQA 4Z7QB 3U9SA 2XYRA 2YNMC 3S28A 1TLTA 1T2NA 5KDLA 1W5TA 1XD8A 1QH0A 2CVPA 2F48A 1RI3A 1CFJA 3I0ZA 4PZLA 2PL1A 1RYEA 4MQLA 4ARVA 4M38A 3H5IA 3L8DA 1MH1A 4X7RA 3N8DA 3LMKA 1RLIA 2A4MA 2QQEA 4KIJA 3WLEA 1IUKA 1SK9A 3B1FA 1KP2A 4AMGA 5KYNA 4ZHQF 1T29A 1TM1E 2K4MA 3F7OA 1FX1A 2Q3HA 5JECA 1P2GA 3IA7A 1JSXA 1DBSA 1RHKA 3IEIA 1TZKA 3FYUA 4Z9FA 3KV1A 5AVZA 2OCXA 5AD1A 1R0BA 4GUDA 3LKZA 4KYVA 1EVLA 5HM8A 3R6TA 3OM0A 4LJ8A 1SXPA 1L7QA 1ZH6A 4OJQA 4FFWA 5EI5A 3P0EA 5TVGA 4A8JC 1FFXA 3R4CA 3Q8LA 1U8EA 1ZI8A 2AQIA 2I80A 3I9V6 2HU2A 1JLKA 4RAOA 2J9FA 4KR9A 2Q9AA 2IYAA 1UZNA 1WHSA 3HHEA 4AKIA 2I4MA 4IPTA 1G6Q1 1CRWG 3N3BC 4LGCA 3SS9X 4ENPA 4QGSA 4HI0E 3DT6A 3L2OB 3WFIA 4KG7A 4IDCA 1J9ZA 3DT9A 1X7XA 3KVYA 4LXYA 3RS8A 1QIMA 5HOQA 1DBWA 1OC2A 3F6RA 3GZTB 3WDLA 4YA6A 4KP7A 4OXRA 4AXXA 5FWXB 2IYNA 4NHEA 1QYDA 1U2DA 3N74A 4M49A 1K9SA 3K1ZA 1CULC 2X77A 2OG2A 1HTWA 4G5FA 4L2IB 3W90A 3UW1A 4XVUA 1CR4A 4ZYTA 4TWJA 3KQHA 1BA3A 2PQ0A 1X7DA 1XKTA 1VI2A 2QMHA 5B1HA 3DZHA 3DTVA 3JQ6A 1FFEA 1Y80A 2WQZA 3MSXA 1GPMA 1P1CA 3SQNA 1VJTA 5HRAA 1A9SA 3UFBA 1KIFA 1CJVC 5JQWA 2X4GA 4D9KA 3I04M 2JFZA 3WLHA 2XBMA 4XYEA 1NXOA 3QA3E 1SCUA 3HPRA 3KZ1E 3NAMA 4Z7NB 1JG4A 3OIUA 4HADA 5TJHA 4BZXA 1XMPA 3FGPA 1ZIYA 3IVAA 1IH8A 2FQQA 3EA0A 2XITA 5AK5A 1OLUA 2D2EA 4X1OA 4I8XA 4ZQEA 5ARCA 1CVRA 1GEEA 3OZGA 3ZX5A 4EHIA 5JFGA 3G2QA 1CUUA 3AJAA 4BATA 1T9ZA 3IV7A 5D3MB 3W9UA 2BFBB 3HR7A 3ORHA 4NBWA 3WDSA 4WLEA 4BFXA 2KW5A 3GH1A 3V7FA 2Q41A 4LFBB 5EXXA 5ILQA 1E6MA 3TLMA 2AXPA 2VNSA 4UARA 1U2SA 3VR4A 2IC5A 3QM1A 2WABA 1KO8A 4HQKA 2CJYA 1TUGA 3BMOB 2OQ2A 2AEEA 4TTTS 2X8LA 1CNFA 3GRPA 4EY4A 5AIBA 2OVBA 2HWKA 1WXWA 4Y9UA 3ND5A 4HOYA 3C5WP 1W6RA 4I6JA 4MGHA 5EFZA 4YGYA 3H4TA 3JQBA 1FZQA 4RX1A 2WUDA 2NV6A 1UMDA 1HTBA 2ENUA 4QQKA 5CNKA 1BDMA 2HAEA 4KHZA 1ACJA 1Y6JA 5TEWA 1MNQA 3WO1A 3NIDB 5C2JB 1GLGA 4IMIB 4CV1A 2WKQA 1E8NA 3MNFA 1ZK1A 1Q44A 5D6NA 4LNUA 5FHRA 4O4HA 1FTQA 3IAFA 1JKXA 3OE1A 4KW7A 3TX6A 3QF4B 3MWKA 1PVDA 2GZ3A 4WK2B 3IDOA 3REQA 2WJ3A 4PFJA 4KPGA 3GT3A 1VHWA 3TZEA 3K0KA 1QP4A 4TYNA 4NXMB 3LLCA 2QPOA 4BN0A 3EEQA 1CUEA 3U7IA 4G1MB 4AP6A 4E15A 3CVUA 3R7LA 3L8CA 3WKCA 1Z7WA 5IXSA 1R9GA 2W8BA 1X1RA 1OC4A 1M5UA 4L8WB 1R5NA 1WBBA 1DG3A 4X6YA 3A6KA 5HGJA 4IQGA 4PINA 3TB4A 3SLKA 1ZXLA 1VPEA 2XDQA 2SKCA 2XRYA 3OOSA 5CFZA 2YYAA 1ZZEA 5FBLB 2FQWA 2PJUA 1NU6A 1YMVA 4X60A 1LS1A 1UBSB 4DSAA 3K9QO 1G7CA 1C3OA 3D8HA 1BW9B 5LYYA 3ZLVA 4EJSB 1GWNA 4MINA 3IAUA 2BFPA 4HNUA 3W5BA 3WE7A 2HY7A 4YDHB 1C1XA 3WWZA 5A4DA 1T3TA 2FPOA 4LJ9A 5I47A 3GEPA 3QPCA 1FU7A 4OUDA 4TLCA 5G2OA 4U7TB 5MF6A 4BOYA 3IP6A 3OAAA 4TL8A 3IYLW 4ZO7A 3FKQA 3W0LB 4HS4A 1H5NA 1B0UA 2VYNA 1XZKA 3DW3X 3OEYA 1SULA 3CWZA 2JNWA 3W4IA 5INTA 4LEIA 2Q4OA 4N76A 5L9AA 5U1PA 1VMIA 4H27A 8OHMA 1X74A 3ICVA 3PJGA 4P54A 4C5BA 2D0OB 3K72B 2FMXA 1EVQA 4DCOA 2BMWA 4G0UA 2ZIFA 1RWNA 3KPWA 4TUYF 3BWBA 4LOAA 1QIIA 2ZJ3A 2NADA 2ZPTX 3IC5A 1Q0HA 5E7JA 4HATA 5KVAA 8ADHA 4R9VA 2PZKA 1FLNA 2FDXA 4LF7B 1MQAA 1MVOA 1G6HA 4IOKA 2O48X 5B3KA 4RYLA 4M46A 3N6VA 5A7FA 4DTCA 3K0AB 3E58A 5FOXA 1YVDA 1XO1A 3GT7A 3NETA 4G26A 2Y1GA 4O1MA 4X8LA 4WX2B 4QJIA 1XTJA 2ZJ1A 3H2KA 5DK4A 1JHXA 3DCNA 1TFRA 3MAGA 1ZI6A 2BI4A 2QVGA 4G09A 4Q4JA 4KNYA 1MEEA 4H1TA 5IVDA 4IH4A 5FTMA 5DWDA 2QL6A 1E3TA 2GZDA 2O06A 4HB3A 3P45A 3CH6A 4GLLA 3NC4A 2PWYA 1GKUB 3H1BA 1E3EA 4CQMD 1U4NA 1HBJA 1YDWA 1TQ2A 4M86A 2AEFA 2IHUA 4XCVA 5MDHA 4ITVA 2I3DA 3DL0A 4C7VA 2VDOB 2FNAA 3HCCA 3ZBUA 3KCQA 2I33A 3OIVA 4RPKA 1IVYA 2X15A 4IIEA 3ADOA 3ZY3A 4BMPB 3UPTA 1X0VA 1VE9A 2FUNB 3LECA 3THSA 3L1IA 1OYOA 3IX7A 5HIIA 3ZXIA 1Z68A 3ZNQA 5BMOA 3VISA 3PJEA 3GZ4A 2ZRFA 5BQ3A 1OXXK 3DP7A 4ZYXA 4LDRA 2FB9A 3PCTA 4DANA 4YX9A 2X2OA 1T5SA 2SECE 2HGSA 1PQWA 5JLJA 1MG0A 5LP1A 4FSDA 3H9EO 4CN8A 4IWXA 4GGPA 2P7HA 1NKSA 4M1MA 5KINB 1SC6A 2QZSA 3NYIA 2CSXA 4Q1FA 3F3MA 1JZQA 3H5OA 5E9WA 4YONB 8GPBA 4JMLA 1COWA 4DY6A 2ZE6A 1SMKA 4FM9A 1PP4A 4FGUA 4GXQA 1UFKA 1MRNA 2CL5A 1YBVA 3JR7A 2UXBB 3KOWA 2J0VA 3F47A 4DTIA 1NSTA 1HOTA 4RM2A 1P2DA 3HUFA 5FUXA 1I2MA 1H2FA 5TPZA 3VX3A 1YA6A 1CR6A 3IXQA 3WGQA 2DUUA 3WWYA 1E20A 3U49A 3W5JA 1O97D 2UVQA 2X3FA 2XODA 5B7NA 1RPZA 2BF4A 4IIYA 1GUFA 1OU4A 2QY9A 3GJZA 2G63A 1D2MA 3D4NA 3FHJA 3IVGA 3RC1A 2L0XA 1KS9A 2PO5A 4DARA 5A3SA 4E1BA 3DF9A 1XQ1A 4PRKA 1JG3A 5F2OA 1LCIA 1JLLA 3VM6A 4DLPA 4DLTA 4J7XA 3I1IA 5DNEA 4TL7A 3TRFA 2MTBA 4BB6A 1F0PA 4RVHA 4P93A 5J3JA 3L7DA 3TE6A 3T7JA 3MTIA 3FPBA 2E89A 1SRQA 4LQDA 3B6ZA 4LKOA 3RR2A 3UKOA 4CHTA 2XXAA 1LQTA 1VJGA 4RZXA 1DMSA 1ULUA 1Q21A 2FX2A 3HYLA 1U5BB 1YAJA 1VE6A 5JAQA 4OB6A 2ODQA 3CVXA 1Z12A 1JKJA 4IUDS 4B79A 3R2JA 3Q85A 4AECA 4N49A 2I76A 3G0HA 4L85A 4IXNA 2AG1A 3H05A 5DH9A 4DV5B 3FPHA 3KDAA 3PNYA 3DWIA 3NVAA 2CC2A 1N4AA 3VHQA 4F12A 4XDYA 3O95A 1L4LA 2J0SA 4Y2GA 2Y1LA 3DWGA 2W6QA 1HE4A 1E5TA 1ZCAA 4CKCB 2ZYAA 1IXZA 3EG9A 4UQPA 1NWHA 1PR1A 3KHKA 4A2QA 4JSTA 2VAWA 4LV5B 1G6OA 1J0DA 2VUSA 3O8RA 4TMWA 4HQ6A 2OM6A 3JWPA 4BE9A 2ZWOA 1YRYE 3GBVA 3G89A 5JJIA 4XB1A 3F1LA 2JIZA 2P5UA 3LO8A 2C4KA 4BDSA 1PJAA 2H18A 3ROKA 2R7AA 5DNUA 4D45A 3ZDDA 2V9ZA 2EG5A 1H69A 2PKQP 2ZVQX 3B1XA 3EEYA 4R9NA 4DIMA 2VAPA 4DMLA 1IAQA 3HZRA 5DNVA 1EVEA 4TKUA 2AZXA 1A9YA 3N05A 3WQBA 3RQSA 2OBLA 1U5AA 2RK6A 5I4IA 1D1QA 3IUBA 5BOVA 1JKMA 4P36A 3CE9A 2EKZA 3H5NA 3THYA 3NCHA 2UYHA 2M1XA 4YRGA 1TEZA 1U0EA 2BHSA 3TTWA 1GFSA 3C6KA 2J3DA 4HWTA 4JP8A 3ZXXA 2C3MA 5AVQA 2LRHA 1DQRA 2I4RA 3J81A 1WCIA 1IG3A 3R3VA 2VZLA 4MJXA 1LBTA 2VUIB 3N2NA 3W2FA 2PL9A 4CKEA 4NU5A 4DR7B 2LBPA 2F3QA 2PT7A 5AI0A 3VZPA 1FPMA 1NRXA 3RO7A 3IV6A 3SM3A 3SZMA 4IMJB 4YALA 3AR8A 4BQIA 2D4AA 3C41J 5K3EA 4QDUA 3AMVA 2I34A 4RIEA 3H1PA 4GZ6A 1O95C 2CMDA 2IUFA 2ZIZA 3KZVA 3RWBA 3ZGXA 4RORA 1GZUA 2R1TA 4U7FA 5EYPA 4BGIA 3IBYA 5JD4A 4IICA 4KDCA 2WYWA 2ZYGA 5GQSA 1PJ2A 3ONDA 2P11A 4FOTA 4GG1A 4M55A 1FNNA 2NNWB 1CY8A 3IMCA 4S1VA 4Z0TA 1IOVA 3BTUA 3MXTA 3UBMA 2VP5A 3N53A 4JJEA 5ALUA 4M1QA 6AT1A 3MUFA 3PUJA 5K6AC 3M81A 1HZZC 1NG1A 1Z33A 3S2IA 2C2HA 4YMTA 4ENRA 3BWMA 4L5CA 3LW7A 1LWNA 2CB0A 2XTMA 4ZRMA 3EVTA 2IHKA 3QEOA 1YIOA 1J0EA 2I8LA 4KKVA 5L3VA 1FSZA 3Q7IA 5IASA 2X2PA 3DQQA 6Q21A 1DG1G 3H2BA 4KR2A 3ZDQA 1OBCA 3U7GA 2FPKA 4X1YA 4MA0A 3NHYA 4WZBE 3I5AA 2KPOA 1AZLA 1J39A 2GN4A 1Q0QA 3RSOA 1R0ZA 2NQ2C 3RM3A 1M2VB 3WWCA 1E9SA 1FFXB 2VAXA 1NVVR 1S2MA 1UM9A 5AH0A 2R6JA 5AQEA 5FEMA 1GQOA 4ZVTA 3OPYB 4EARA 4KUHA 4MP3A 1T5IA 5B37A 3Q1LA 3H87A 3O73A 3VI4B 2DFLA 1OPXA 4Y2QA 4KWIA 1UK7A 1X8LA 4H7JA 3O9ZA 4DCSA 1RI1A 4H16A 4R81A 2X0RA 3N70A 4LPSA 3OKPA 4HZIA 3WP1B 3HP4A 3KQYA 2XVZA 4C05A 1EINA 3KVOA 3DTVD 1VLHA 4QRDA 3ZWMA 2JA1A 2C7RA 1X2BA 1IMOA 4Z9BA 5CLHA 1DI0A 4Y0NA 1KPHA 2N0SA 1G7TA 3LXUX 4PG7A 4PX2A 1P2VA 1L4NA 2ENWA 5A4KA 2C04A 4B45A 2VRWA 3MFYA 2EFCB 1M2JA 1DTWB 1KBOA 2CZGA 2YNMD 1YZKA 2FKNA 3IO5A 2CFSA 3IEXA 3R3WA 2GZAA 5CW2A 4X24A 1XAJA 2PGNA 5GVRA 3E8SA 4MYRA 1R0KA 4MR9A 3K9CA 1UBCA 3UC5A 3QKIA 2OQVA 5L6MB 3GUYA 1V4VA 3IHLA 2CKDA 4R69A 1CP3A 5T4BA 2QSUA 4U7JA 3KJGA 1CUVA 2AYXA 1X7GA 4I08A 4YPFA 3PXCX 4C43A 5EXEA 1PN3A 1XZ8A 4OHCA 2Y4OA 1IN5A 1T4BA 3TSYA 3PFFA 4K03A 2WSBA 3GJ3A 3IMEA 3INGA 5T4FA 5EIBC 16PKA 3AUKA 3KZOA 4W9RA 4RFVA 3H2GA 5DX0A 4BEBA 3QITA 2AE1A 1MCZA 2ZVPX 4QNMA 2JBAB 3GYGA 4RH3A 3VZCA 2WHQA 4YUXA 4AVYA 2XADA 2QV0A 3USCS 2GPWA 4LHSA 3L9XA 2GCIA 4HGYA 3TZBA 4DUYB 2N47A 1ZK0A 1YJ8A 4CLEA 1NV9A 3CNLA 2CD9A 4XM1A 2DFPA 1L7MA 3PGLA 1UJNA 3W4JA 2XCUA 3TIXB 3K1TA 4P9NA 2XOEA 1PR2A 4EY6A 2NAFA 1F20A 1PV4A 5COBA 5IT9A 4L6IA 1NG9A 3DLAA 3LE8A 2WSIA 3AESB 1KAQA 3EARA 2D0DA 3GA0A 3R7DA 3V7NA 3B7GA 4B3JA 1OYVA 4UAJA 1REQB 1SXIA 4UU7A 5BV1A 3R6WA 3IB6A 2FMKA 1SXJE 4ZAGA 5FIUA 3LP6A 4LKRA 2BSXA 3AY3A 3EX7C 3IOCA 3KOZA 3O2NA 3LC1O 1CUJA 1TL7C 1M6NA 2DU8A 2GF0A 2HF7A 2JGDA 4MO2A 4Y2RA 3UWMA 3MT7A 4QVGA 4EGJA 3UK7A 3RHSA 4L95C 3PFWO 1DKLA 1M2VA 4GH5A 3WWPA 1BMTA 1F4VA 3PPWA 3C1OA 5LDGA 3WGOA 2B8TA 1BROA 3WGLA 3ZJ5A 1C0PA 3I9JA 2RHDA 2X8WA 4O4LB 3IV9A 1TF2A 1L6RA 4X94A 1ADCA 1AF4A 1DXHA 1PFGA 1XGKA 3ADBA 3Q6NA 3ILYA 4B7XA 1C3OB 3NPMA 4I99A 4KOAA 1NBIA 5JZ9A 3O90A 2BMJA 4CJXA 1CS4C 4HH0A 1PZHA 1JJFA 3RH0A 4OMFG 1DMRA 2E3JA 2YOHA 1W4LA 3HBFA 4XYMA 1IN4A 5IBPA 4FZ5A 2B1IA 3DW1X 3GY0A 5C0OE 1WUJS 2VP6A 4QD3A 5L3QB 2GO1A 1JFVA 2JKYA 4UUQA 4ZEMA 4BN5A 1IJKA 2W6ZA 4ALIA 4F7DA 1GU0A 1O96B 1ZL0A 2QTGA 5BY2A 5L3SB 2V1UA 3PD0A 1TZMA 1DEXA 1QKKA 3KJXA 1F4PA 2FKAA 5REQA 4HUTA 3T1YB 1P1RA 1MJGM 3OZAA 4Q15A 1YMUA 2Y1OA 3ZDAA 1VSBA 5J2TB 1ZNXA 2CVQA 5KKCA 3LAWA 4UEKA 4KPUB 1RVV1 3LWDA 5E8RA 4C20A 1EVYA 5K0NA 3WKAA 2ZJFA 4ISBA 3ORQA 4Y6OA 3CZAA 4WIAA 4LWOA 4ZT2A 1JA1A 1WUHS 1Z75A 4IV5A 4PU0A 4FUQA 1P19A 3H83A 1LVUA 1ZM2A 1E9CA 4NFHA 4R0VA 1AH2A 2HWUA 5JLAA 1IZZA 4CG0A 3I6ZA 1MAHA 1JQLB 3U1TA 1CTQA 4DLWA 2BKEA 5B58C 2B1JA 1JEQA 4CFYA 2WNHA 4LF5B 3BWEA 1IB6A 2ZU0C 4M9SA 5ALMA 4QDKA 3U3OA 4A8TA 1A77A 1T4DA 1Z4QA 1OROA 2CXHA 1A95A 2CXQA 3EVDA 3IPXA 2I1VB 5CURA 1OIVA 3GDHA 4F1KA 4R54A 1BVHA 1VKJA 3KL2A 1ULHA 3D4BA 3EIUA 1AK1A 4IJ6A 4F9EA 1XZLA 2KS6A 5F64A 3OQVA 1V7CA 4HSGA 4JR1A 1B0AA 1KYYA 3H5WA 5FI0B 1TJPB 2PUFA 3DHVA 4EM6A 3ER8A 3FYSA 4AIIA 3TOZA 1EVJA 4HCJA 1JXMA 4E5DA 1WEHA 1RWKA 1Y6RA 4PTZA 2JKZA 1J09A 3OM1A 1U8YA 2BFCA 5LQUA 1NZJA 4M8LA 5PGMA 1XRMA 2Q3DA 2P27A 2CVZA 4CTJA 1IBKB 3H9GA 13PKA 4MKZA 1USWA 3LRXA 4Z1MA 1JG1A 2EHDA 3SQMA 2CFTA 3O4VA 4W9MC 5J58A 3EEOA 1QRUA 1JL3A 1KA9H 1WVGA 4EEKA 4URWR 4LY3A 4J7CA 3G1UA 4XE5A 5AW5A 1W47A 4YPVA 3ZZ0A 5KWSA 1ODFA 2C20A 5M3BA 2N1BA 3B85A 2CDNA 2OBYA 1K8QA 1P7VA 2QUIA 1NVDA 2OHXA 3CLTC 4FR5A 4TT8A 1BQEA 2AMLA 2YZ7A 1L4HA 2WJAA 4AURA 4CPDA 2WP8J 1J7KA 2GJ8A 3F5MA 1QVVA 3I8OA 4F06A 1F8YA 4YDQA 3R9XB 1CRZA 5T8KC 5DHFA 4OHKA 4I55A 3PI6A 5G0UA 2W2KA 3A1CA 3UUFA 1Q1BA 1RAHA 3ABRB 3TW4A 2BE7A 1I1NA 4OBXA 2ZB8A 4INOA 5ELXA 2OLEA 2R79A 2XMPA 3AY6A 3D0RA 4FHGA 3C8HA 1DC3A 1YJ5A 3CS3A 4Y9TA 3H4VA 2FWBA 1Q7GA 4LYYA 5FA5A 4OHVA 3BGWA 4IXMA 3RVNA 1ZUHA 3ZR4B 4U2FA 3DJYA 2H00A 4YREA 3KWJA 4A8JB 4KQJA 4IEIA 1DXYA 4YJGA 1ENZA 1U6KA 5DRTA 4QEDA 3SSOA 1KC1A 3T6KA 4YYZA 3ZJVA 1YHNA 3M6WA 3MCVA 3TDMA 4UAGA 1SVMA 3NR2A 4DWVA 1D5CA 5GV8A 1UK6A 1KVSA 5B7PA 5I9IA 1U7ZA 2JI7A 2EW8A 5BR1A 3R3HA 1BE6A 4KN9S 3I4LA 4MI3A 4EKNB 1K68A 3F2IA 1GXSB 3P4YA 4FBMA 1IONA 3H5RA 5SY6A 2DFNA 2OWDA 3SXJA 1XZCA 5EVJA 3RYHA 1W35A 1CX9B 1Q12A 4LMBA 5ALDA 4K86A 3LQFA 1TUBA 4EB6B 5K0ZA 3SN6A 4US2R 5M5BA 5CHEA 3H97A 1FFYA 2YWJA 2DP4E 4I4NA 4KPFC 3MUEA 2C0QA 2F1HA 4HUJA 2BHRA 5K3AA 4RCYA 1G8YA 5IC4A 1G291 3OIYA 1JV2B 4MPPA 4RHCA 1FRFS 1TAQA 1A0OA 1GPH1 3KX2A 2A88A 4UE2A 4YJ3A 3T1NA 5M7EA 2XNKA 4PYMA 4OHFA 3EFOA 4NQZA 4DA0A 3QX8A 3QQ5A 5LP6C 3ZLTA 1I94B 2FEWB 4KZPA 2JCSA 5A3QA 5CBPA 4BMOB 5ELLA 1YDGA 4G56A 3IBTA 1IUNA 1JLRA 2V03A 1I1HA 2JFPA 3AVOA 3R6LA 3LIIA 4BBAA 4YV0A 5JPCA 2JLVA 1G7SA 1I14A 2IPXA 3K7EA 5BW8A 5HF5A 4XDGA 3LCUA 3QVVA 1AKQA 4I5EA 4RQBA 4B6QA 1PR4A 4EFMA 1KQGA 3KKKA 5ICMA 1ACMA 5K6TA 4ZYVA 1Z8NA 2ACEA 3GF4A 2X3UA 1LW7A 2ASEA 3IIKA 5BO5A 3A6GA 2CWWA 4BNYA 3L6UA 1NSFA 4Q3DA 3UT5A 4WFKA 3X1XA 1BWPA 4DEYA 5BOSA 2R1VB 3MWDB 1B43A 1V95A 1VG9B 1FDVA 1B93A 5GM1A 2OCKA 1ZVJA 1FFBA 1TF5A 4Q4CA 5HWSA 3TBFA 2A0XA 2IOHA 3AONB 4QOHA 4F6RA 1U0NA 2X0JA 4F21A 4FW8A 4LXQA 4J0KA 1WCIB 4LJKA 2BFFA 2EYQA 3CUYA 1EUZA 4UU1A 5ERXA 4CKWB 3ADCA 3RYHB 3KLBA 1Y89A 4MQUA 1W25A 3BB4A 1VJ5A 2ATEA 1IBCA 2X41A 5ER9A 5H9VA 5A2GA 2J9FB 1HNXB 3GMDA 1FTGA 4OYHA 2BC9A 2QN2A 5HKKD 5D7NA 1JWBB 4ZZ3A 5ENZA 5HIKA 4DOMA 5J59A 1CZLA 1NUHA 3GJ6A 4BNMA 3BK7A 5C7IO 2I87A 1OI4A 2HPAA 4XJSA 2IGTA 1SA0A 4BMVA 2DRIA 4ZOAA 5HM6A 3Q5DA 1HI9A 3DMPA 3IBGA 3BSSA 4JEHA 5A4FS 4EUNA 4CIBA 3HB9A 4KCGA 2VZ8A 1O9GA 1QLWA 3NFYA 2QVBA 3U17A 1QV6A 2I78A 3I6YA 3KEFA 3JYHA 1TQ4A 1XAIA 3OF3A 2Z9BA 3RIGA 2XAUA 4EA7A 2QT1A 4H4DA 4KVFA 1EZZA 2Q8QA 3DGFC 4FDVA 3H8SA 4XQ0A 4Y6SA 4LFCB 5TQ2A 1J5EB 1XPUA 3SR3A 3KEMA 4J3JA 5K0JA 1EFVB 1WY5A 4JQOA 5K3SA 3I72A 5FBZA 2E4XA 2Z6VA 3O83A 3MB8A 4C4RA 2A0KA 5IZCC 4N4AA 5JNRA 1XDBA 2WFLB 4FYPA 3H13A 4HLDA 1RCUA 1MLDA 4IRXA 5F5LA 1L5GB 3BRQA 4CQJA 1V7PC 2JGMA 3EGDB 3FPFA 1MQSA 3HKBA 5I45A 3PX2A 4I9GA 4PFQA 5HMLA 3BXGA 5IFLA 5JISA 4JBLA 2A14A 1L5NA 1G4UR 2XJ4A 1Z6XA 4ZDJA 4K3UA 5JBQA 4MPDA 4BVEA 4MUHA 4A5SA 3W3ZB 1WXQA 1P2UA 1IYZA 4CL0A 3PYXA 1J8FA 2YNMA 4I50F 3TINA 3A6PC 3RSCA 2AWOA 3OUUA 4IEFB 1OQAA 1OZAA 2VHYA 4E11A 4AKTA 1RPJA 2ATCA 2WIDA 2PFGA 3MJDA 4REQA 2QDKA 4O1IA 4C6TA 4DN6A 2CF5A 4UMVA 3ES9A 3S5UA 3AHCA 3KT0A 2A5JA 1FMFA 1J8VA 1M2HA 2VIIA 3RUCA 1EU1A 1GPBA 2DBYA 2J32A 2XVMA 5EWLB 4FD2A 2GCOA 3NC1C 1WUKS 3GXBA 1CUWA 4QLOA 1CZKA 3KSRA 1ZCFA 2RJ3A 1OTYA 3OSZA 2HB6A 4P3PA 3P2IA 3A6DA 4BFUA 3Q9SA 5FBRB 1MXHA 2VYCA 3NUQA 3AR6A 1KYVA 1QIJA 5E7QA 1LX6A 3E9CA 3SBEA 2B37A 1K5HA 1Q74A 4MV3A 4DA4A 1J99A 1IPEA 3JXEA 5H3CA 2H5JA 3T9BA 1II0A 2CEKA 2IXGA 1TJNA 3VYRB 4DNPA 4U9UA 3OPNA 2PT5A 3FZYA 4CF3A 2V7WA 5EZYF 4BXOB 3S1LA 2H2IA 5KUTA 1EVIA 4HYEA 3CKYA 2H3EA 1DC4A 5I9LA 3T9FA 3VBCA 1WDKA 2AD1A 2XTZA 3LQKA 1IEXA 1JTVA 5AKYA 2PUDA 2V3CC 4UTZA 2YOFA 1LUAA 5EJMA 5DSZA 4PCAA 4YHBA 5D3ZA 1JR4A 1FDWA 3M6MD 3H1TA 4LXTA 4Y67A 1NBEA 1WRBA 2WJWA 2WWYA 4Z0HO 3PEYA 5DYTA 3TLJA 3IBSA 4U2EA 1JDBB 4IS3A 2WA2A 4IGKA 1UDXA 4REQB 2A1UA 3OPQA 1OFGA 1W4AA 5KJCA 4Z4GA 1U7UA 3D7NA 3LTEA 5CPFA 4JAVC 5K6RA 4NPAA 5I3CA 4EA6A 2YFQA 3GQBB 2I6QA 1Y8QB 2SKDA 2YYSA 3GFSA 4JL6A 1OGYA 1C80A 5D8DA 4N8EA 5IJWA 3EC1A 1M3SA 5FTKA 2ETXA 4BRSA 3EQ8A 1JI3A 2MDTA 2RHOA 4WZZA 1VB5A 4A2PA 1K86A 2BH9A 1P61B 2R47A 4I6GA 3RTCA 1M1NA 2WHPA 4JB0A 3OU6A 5I9SA 1MB3A 3WG9A 1U7WA 4J49A 2FWMX 5DJ5A 1H9AA 3EIHA 1G19A 3RRYA 1V6CA 1REQA 4N7JA 4EPYA 1NBMA 3I6QA 4FMPA 3N0VA 2GFHA 2W00A 3UMRA 1KAOA 1DIHA 2QG4A 3KTDA 4TN1A 2XE4A 2I2FA 1KR5A 1YJBA 1BYIA 1D0SA 1HE1C 3OPXA 1ZGBA 3KSUA 3A9RA 3C14C 2GN1A 3OQ1A 2IHBA 4M0FA 3UVEA 4CBVA 2H4ZA 3OLVA 4OHMA 3ZE7A 5LWQA 1DHRA 4MYDA 4JK3A 3OTGA 2HLHA 2PUBA 2GZ2A 4JGGA 5F33A 2JEZA 3O92A 3PQ3A 1RZVA 4MJ3A 4OBEA 4DCUA 2Y27A 4YJHA 4LK3A 1Y8RB 3M49A 4F7WA 2FPUA 3NHMA 1H8ED 1ST3A 1KR2A 4BO4A 3BA6A 4LZJA 4C6TB 1KVTA 3W2HA 3GP5A 2JHAA 5JPDA 1FXWF 1M7GA 2Q6OA 1K8YB 2QU7A 2VJKA 4P81A 4ZODA 3CUKA 5EKDA 3T7AA 4C1BA 4TWIA 1KEPA 3G5TA 4WFJA 1SC9A 4YMGA 1T6YA 2RGDA 3JWGA 4TTSA 3D3WB 4XKJA 2G72A 3QELB 5EXPA 1DEKA 2I3AA 1CUSA 4AM8A 1NULA 2TMDA 4QPNA 3NOXA 4ZOEA 1RXWA 5EWJA 4ZXFA 2YWEA 1QYVA 1YHZA 3NONA 2XXBA 3T5MA 4M7RA 3E9ZA 1EZ4A 4ARCA 5TF4A 4YCLA 2PUWA 3H4MA 3CT4A 2XV1A 1H0HA 3O4FA 5J1SB 3OC6A 5AW3A 2YWHA 1UJ6A 1VM6A 3JRXA 2BKLA 4OJKA 1KKLA 4RU1A 2CW5A 1H1LB 4KRYA 4RE6A 1WDWB 2EGHA 5JXWA 3U7FB 3P20A 2CWDA 5LXTF 3PYLA 1ZJZA 4OKIA 1OPRA 1C3LA 4AD8A 3U7JA 2M6SA 1AA6A 2MU1A 1G8PA 3O3OB 3SU8A 1YVUA 3EASA 4NBKA 2WLTA 2DWUA 1QZUA 1BQ3A 1RT9A 1YFKA 5TVKA 2LPMA 4ZJUA 3G0CA 1N32B 3KB2A 3M5WA 3OFNA 2VCEA 4XIGS 3VR4H 1GNVA 2DWQA 2X6TA 4PYKA 2IX3A 1GRQA 2NU7A 4UVEA 2A1UB 2IUTA 4Z4FA 3N0XA 4ERXA 4ILKA 4PCVA 2VNJA 2OQRA 4M53A 1Q11A 2UKDA 3LZCA 1O1YA 4MIYA 1YF3A 1T0PA 4L22A 3I12A 1X7HA 5KX5B 1EYZA 2YV2A 2D1TA 2PH5A 3W6ZA 3T7SA 2XZOA 3FUTA 1POWA 4TSKA 4PYOA 5JQGA 1WUIS 2E37A 2PKYX 4JB2A 1W93A 1W36B 2FDRA 1KO7A 3SS7X 4TZ0A 4QFBA 2B2CA 1AUVA 1ELOA 3B6MA 2XH8A 3UAGA 2XKJE 4YQYA 3DGEC 3QQPA 3AU8A 2ID4A 3P8ZA 3DXFA 4WXYB 4CV2A 2UVPB 3TI7A 1ZESA 1QNLA 2VT7A 4Q4HB 2OQIA 1XD2B 3E82A 5F9MA 2B4RO 2HQ1A 3PRYA 2E4YA 2HJSA 2XVYA 3K8QA 4KQWA 3G8CA 4Q03A 5JALA 2GN9A 1XEXB 2GVNA 2QX9A 4FCCA 1L8QA 1FW6A 1X70A 3AF2A 1RZ3A 3QEAZ 1PNVA 1J8QA 1UXJA 4CNBA 5JQGF 4B3RB 4ETNA 1RQ2A 4S0ZA 1D0VA 4F93B 3P0IA 4IUYA 2V55B 2WJPA 3E1KA 2VJAA 3R5TA 2Q6VA 4GGMX 2YKGA 2EJCA 3E18A 4PYNA 3UAOA 4RA6A 3AGQA 3IOYA 3LOUA 1V1RB 1OILA 4UOQA 1QF7A 2OBXA 4ZYUA 1LNQA 4N0PA 3GEEA 2I3GA 3GNQA 5DE3A 4CEJB 2YZ2A 1R8JA 2JGLA 2QB5A 2I2BA 4AU1A 4E6EA 1VPDA 3IAS1 4XM0A 3QFHA 1IN6A 2QMQA 3LL4A 2Z5FA 1S4QA 1U6IA 3QKRA 1JR2A 1NA5A 2GHTA 4JEUA 1UMCB 1WWKA 3FRJA 1Q77A 3H2YA 4A3SA 4F84A 1NDUA 3ND7A 2DQYA 1XT6A 4MR9B 3VZBA 2QNBA 2SCUA 4GZLA 2C7PA 1HYHA 1P4JA 1WG8A 5HK8A 1QUFA 1ZONA 2B4AA 5ALNA 4E94A 3UENA 4XGQA 5CLLA 1TVMA 2V74B 4LRSB 1BXGB 5EPUA 1V96A 3HYNA 3SSMA 4A0GA 2OV8A 3FF4A 2ZETA 4HKTA 4FR0A 4Q9HA 2ZBRA 4HLUA 5J63A 5BORA 1OWMA 1KY4A 1DBVO 1V35A 2NG1A 1JHAA 2ZSEA 4TLMB 1XK6A 5FNVF 4AQ7A 2W43A 1TUBB 2CXSA 2FN4A 4TWBA 4Q9JA 2KM1A 3E9YA 3MGBA 1WABA 4WASA 1L7BA 3RG2A 2B4YA 5JT1A 1HMYA 2G0TA 4M0KA 5LKRA 3RAEC 2B36A 3AB8A 4H3SA 5BSRA 4L78A 1U1GA 2OM2A 3Q12A 3DCYA 5H16A 1ZSYA 4QYMA 1F1JA 1S8AA 4F46A 2JFQA 3AWDA 1A2BA 2D0IA 3H6GA 4PPNA 3WL7A 1C9EA 3EQ9A 1BHQ1 4MLPA 3HU2A 3PFHA 5ALLA 1AQJA 4B6GA 3WGVA 3KSDO 5DHSA 1ECJA 1RIIA 1Z5UA 1I6LA 5AKGA 2C7GA 3A31A 2DMRA 2VH1A 4CR8A 4PNEA 2R7MA 2Z8ZA 2NV2B 3IE1A 3CHYA 2OAP1 1D0IA 3R3YA 2VXBA 5GGYA 4DL9A 1HY3A 1EXNA 3ED1A 4RHFA 1AKWA 5FXMA 3SFTA 4A8PA 3NORA 3G2MA 2Q7OE 2Y1FA 5AKLA 3VNSA 1Y7IA 2ZB2A 3AV0B 1R8SA 3HA7A 1W1IA 3MLEA 4HXYA 4TTJA 5HMMA 5JSYA 3NV9A 1GL6A 3RC7A 4Z5XA 1TYAE 3C4QA 3NTRA 4W8OA 1SWWA 5MGBA 2R00A 4IDFA 1H22A 3F8WA 2ECFA 1IY9A 1GQFA 1QLJA 3GG2A 3IURA 5A3RA 5CB8A 4ZJZA 2GS9A 5K8LA 1KO1A 1W5BA 3SPXA 1ZMOA 3R7WA 5TT0A 2QE7A 4FOLA 1K8XB 1LK7A 1NVWQ 5ALYA 3MFQA 2VQFB 2B20A 4CT5A 2NXWA 2PU5A 4CMEA 3I73A 2A58A 1MU0A 2EDCA 4J76A 4EHJA 3DZJA 1OAAA 2Z3VA 1UWLA 4FWBA 3UWPA 4RY8A 1E2MA 4LRWA 4MW5A 1QHEA 1ZUWA 2R66A 4CKWA 1XMOB 4LYEA 1POXA 1FMJA 2CLSA 2QTVB 1TMKA 3CY6A 2O4UX 3DDOA 2G5GX 3CUVA 1A04A 3EAGA 3G13A 3QHQA 3SC6A 4A23A 4YJ2A 2E85A 2OZLB 3E3OA 4FMBB 1NDHA 4N54A 4ZQCB 5HCIA 3R5KA 1PFYA 2AJTA 3C16C 4Q19A 3UQZA 1UBFA 1QP7A 4JWKA 3MTEA 4E1AA 4LECA 5EHNA 4N0QA 2WUGA 1N0VC 2I22A 2IZ6A 4GI5A 1CERA 1TD1A 1GTL1 5B64A 2V7QD 3QWBA 5CDYA 2PBLA 1RQRA 2X0IA 2ZUTA 1J4AA 1MABB 3BFVA 3OUTA 4FHCA 1M66A 4FN4A 1PJRA 2C96A 5KWJA 4OV6B 4AS3A 3B5IA 3UK2A 1NW8A 1KO4A 2N9UA 1KFCB 3QE0A 4F8YA 2Y1XA 1VECA 2WIGA 2E9SA 4UHEA 2DHCA 1Z16A 3GFBA 1F9EA 1W5AA 4JA0A 4QC2A 2FWNA 2X2FA 1GILA 1ICIA 1MAVA 4P33A 5KQMA 4LZNA 2FWJA 3SQXA 4DQDA 2B0CA 2BEWA 1D1SA 9ABPA 3JQ7B 2CK3A 3AEXA 3VU9B 2HJRA 4JLOA 1NRIA 5KTMA 5F23A 3G5AA 5JSZA 2Q49A 3NEAA 3AFNA 1E0KA 2DT5A 4V0OA 1YDFA 3VO1A 5KYVA 5I01A 2AOTA 2JGJA 5CFPA 1A5AB 1NY5A 2GBCA 1GTRA 4MVJF 4OY3A 2D59A 2F17A 4TV9B 3MD9A 4CLRB 3AHEA 1RWBA 4X1IB 2GM3A 1TZBA 4ID3A 5K0EA 2HW8A 3UATA 1FP4B 2J3LA 2QLBA 1BWSA 4RY2A 1PGPA 2VOEA 4OI0A 1G1AA 3KP1A 3SR0A 1U1FA 1MFZA 1XMVA 4BMZA 1YUMA 5HJEA 1AQNA 3ASUA 2Q0SA 1F7VA 3CC8A 3WMFA 4C0XA 4G8JA 3W4KA 4DDVA 1BQ4A 2QP3A 4M98A 3LX4A 3CTPA 1FF9A 1KF0A 4JKYA 5G1PA 4NBLA 1PJZA 1WSAA 2BI8A 3T5BA 3L1HA 2Q5IA 1H2RS 2ZS8A 5E1OA 2ZKLA 3PHIA 1D4OA 4L3WA 5A02A 2IFTA 2ATVA 1N5RA 3GRVA 3G2JA 3P19A 4R1UA 2JHFA 1DB3A 3AKCA 3IPCA 4ZCSA 3MS4A 2QE6A 4A9AA 3NRCA 3OQIB 1J0AA 1CZNA 3EDRA 4GPTA 3IDFA 4IRUB 1CQJA 5TS2A 4MV0A 1JIKA 3Q2OA 1XCOA 1RD4A 3EXHA 3MLBA 5FBWB 3PEUA 2JGDB 1V45E 1JVSA 3M6XA 1S3FA 3EODA 4ZRDA 2WJ4A 4DAEA 4BWYA 3VKGA 1CQXA 3HSKA 2ZYRA 2FPLA 3T9EA 2XWSA 1OBVA 1L7NA 3GLGA 1NX6A 3HCNA 1UKAA 3QVUA 5EIBD 3UM9A 2D1RA 1TA0A 2DBVO 3AKYA 2FN3A 4YGXB 1XPOA 1CHNA 1V43A 2NOAA 4KZKA 3RT1A 4A6EA 1H9CA 2B5VA 3GRAA 4UE6A 1RCFA 3P0RA 4JUDX 4IDBA 5A5GA 1JHRA 4TWRA 1N5OX 1KZ4A 4TYYA 3WIVA 4P5PA 1BCSB 4QVKA 4ZRNA 5LYJF 4L1KA 4KYIB 1XKXA 2YHIA 4DKJA 3WNQA 3WJ7A 2R3SA 4F2WA 2C31A 3QE9Y 1P4HA 1WPQA 4A8HA 4ZAZA 1N7HA 3QEMA 1XMJA 4K9KA 5CA1F 3BIOA 3CN9A 4HQFA 1O6BA 4OU4A 3OY2A 2J45A 4PAMA 1GAWA 2EX4A 2OYRA 3TTXA 4AQDA 4Z86A 4ZA2A 4L74A 1A2KC 1NLFA 3EOZA 1BDHA 2O0MA 3U0BA 1RFLA 4OKNA 1JU4A 2ALJA 2W0MA 2AN3A 3LX5A 2EQAA 5KVSA 2X6QA 2IZ5A 3VTKA 2BLNA 4QGHA 4Y2JA 2DHDA 2FU5C 4EVRA 5KSOA 3BHNA 5BXQC 3FWKA 1B8NA 1N2HA 2H0RA 4YO7A 1BS1A 3SIPA 4IX1A 3NKVA 4K05A 3QVKA 5BMVA 4Y6LA 4UC0A 4D43A 2XMGA 5EAIA 3PR1A 2F43B 5AXCA 2VHQA 3UJ3X 2PRJA 4ZEOA 4FGSA 2RGUA 3LF1A 3EQ6A 4QOSA 3N07A 3GI1A 1JHZA 2G25A 1UWVA 3GUVA 5BSKA 4DLUA 1ZM9A 4S05A 2AS0A 3F5FA 1V3VA 4GD3Q 4GE3A 4W6QA 3ANSA 4AZ0B 3P5SA 4V1CI 5LPNA 3BMOA 3USZA 2HMSA 1NJ1A 1RQGA 3UTCA 4UHJA 4PYRA 2HIHA 2ZTSA 2IHVA 2HGZA 2C5GA 3F6YA 2YHIB 3N2KA 1INLA 1JR3A 3D3JA 3DONA 4I66A 4PGGA 1LV8A 2J5RA 2H1OA 4R8SA 3AIOA 2OHOA 1GSHA 3MWEA 4RK1A 5ALFA 3K0SA 2IOQA 1MGPA 2FW7A 1SKAA 5BSFA 5K05A 4F3RA 1W9HA 1JQ3A 4ITRC 1WOYA 2Z09A 2KMLA 2TSYB 3D64A 1B23P 4MTLA 2EP8A 2KLHA 4FW9A 3V5NA 3ZN2A 4DLLA 1JDUA 4TYWA 3TD2A 3WLFA 5FWDA 5IM4F 4EVQA 1ISHA 1QDUA 4NFYA 2OAQ1 4ENSA 2I62A 4L5IA 2QAGB 2WYIA 4R6WA 1P0CA 3GLHA 3PDHA 4WVFA 3TQCA 4E03A 4FEGA 3B2QA 3I34X 2DQZA 1IM5A 3LC2O 4HNSA 1Z7BA 3EIQA 4I9HA 4DJEC 1E6UA 4OD0A 2FFHA 4WW0A 3T7IA 1RBYA 4P38A 5F2EA 4BNLA 5BUCA 3OO1A 3KB6A 1QM5A 3E5MA 3DQZA 3FJ1A 4JXXA 2IODA 1XQ6A 2AI1A 1U0LA 4HDRB 1Z6TA 1UCFA 3AJ8A 4BO9A 1R5BA 5CYPA 4CMAA 4E0BA 3DE3X 5E0KB 5A5VA 2NZJA 1C3JA 2RAUA 1XMSA 3OVMA 1O4WA 4RD3A 5KYXA 4CDNA 3HDHA 4PGHA 1EFPB 2D7CA 2EEZA 2EWVA 2IOFK 1R6TA 2E4ZA 3WICA 2R6R1 3PLAE 4N6OA 1F5NA 3OLCX 4R9RA 1KETA 3F6CA 4QAQA 3M9XA 4UAVA 3ZGVA 4L8LA 5C1DA 1AHPA 2B94A 1ECGA 2IHZA 3IHKA 3E05A 1PD1A 3JQCA 4HFMA 5TR9A 2DC1A 3L6RA 3AUTA 2OO3A 4XX1A 3ZQJA 2FRVA 3V1KA 2O8FA 2I9PA 4UBKA 2IV7A 1TCCA 5ERYA 4ZK2A 5GZ6A 4PVCA 4QATA 2OGSA 1Q0UA 5LQDA 3QENA 3M4XA 1QH9A 1NJ8A 1BKDR 5CVVA 2HBQA 3WGJA 2QTZA 2R1VA 3VR5H 3EWAA 4L75A 3DEYX 5FHQA 1XTUA 1CIJA 2FSIA 3QUCA 4QECA 3RT7A 2VUHB 2AZMA 1YZLA 4PYLA 2ZS7A 1GAEO 5FR2A 1T1JA 3V48A 3EA4A 2A5DA 3FR7A 2G9UA 2QQFA 3O31A 1RYZA 4JGBA 4BJ3A 6REQB 4NICA 1KJWA 1ESNA 4FX5A 2YVUA 2EIXA 4IP0A 4OAPA 5J9FA 3QJ5A 2W2QA 4JHXA 2IA5A 4O4LA 2NXJA 2O2EA 1P18A 4UW9A 1G2QA 1UEXC 5EUMA 3ID6C 3MRXA 2FSSA 1UBUS 5C35A 2DEUA 1UFVA 1XDGA 1FMCA 3H8VA 1JEAA 1LQ2A 2WVAA 4LHYA 5EFOA 3PC3A 1L5SA 6YASA 1NP3A 3B3AA 3OKAA 2WYUA 5AWFC 3ZOKA 5C8DA 3KKMA 4XSGA 5J40A 1QQ6A 5FDFA 2CUTA 4FLEA 4HGQA 1WBJB 3EEIA 2E7ZA 4PHGA 1DQPA 1XEWX 3GRUA 3NAGA 4LDQA 3GJXC 2XQVA 4V0SA 4BLSA 2HD4A 5BVHA 1ADYA 2QIOA 3HVUA 2BMVA 1OH7A 3GJ8A 3NVKI 2BKAA 2QUZA 3LT4A 4AN4A 3LC7O 3T3DA 1KSJA 1GFWA 3C6YA 3HA5A 5KTOA 2VRCD 4DSUA 1KSFX 3BD8A 4XVQA 4RVDA 3L6BA 2O8FB 1KVQA 4LG1A 1M76A 2J08A 1SGWA 2GTHA 4LRXA 3LGAA 5DOVA 4BB9A 1H8HA 3UHJA 3KEQA 2Y93A 4JITA 1CDDA 4BMDA 4ZEXA 1T4MA 2Z5VA 5HE8A 2P4HX 1YCGA 1ZBQA 1II9A 2G4VA 3BXOA 3IT2A 2PWBA 3F67A 3D6JA 1IJEA 3SC2A 1NVFA 2AE2A 1G8AA 1VYUA 1JT2A 2NYVA 4L6CA 1Z7GA 4RJIA 2OV1A 4DLYA 3BEDA 2AYZA 3M4YA 1O0CA 1D4FA 3GW8A 3ODGA 3EZLA 1E3WA 4P3OA 3QK7A 1RPNA 2YWCA 5D6OA 4JB8A 4PZ9A 3R41A 1E7RA 2GAAA 3OQHA 3VDQA 4HDMA 5KYXB 2QRMA 4A2CA 4CMBA 3R0QA 2FWAA 2DYKA 2IT1A 5ALRA 1TRHA 2WNIA 3D5EA 4JXJA 3LBAA 2ZYUX 4C4AA 4NZNA 4IIUA 2V7VA 3KR9A 4OBBA 1AUPA 3U6KA 3K1YA 3PHBE 5CVEA 1S2DA 1Z0JA 1AMOA 3RYIB 2QR2A 3G3EA 3NPAA 2HPZA 1MDBA 3CCCA 1I4EB 4TMFA 4EO4A 4EFDA 2KQUA 1N1DA 2VJPA 4MULA 1PS9A 5JCZA 3WI7A 2H06A 4AIRA 1AQ6A 3BC1A 4QPDA 1XXLA 4Q7EA 4UUBA 4CU5A 2F3PA 4J07A 3ZV7A 3IEVA 5G0TA 3H17A 2IPAB 2WFLA 1Z2NX 4IXWA 4WESA 3NNNA 3SYRA 4JL8A 2D7DA 2ZYVX 4HEJA 1RWMA 2WZCA 3QIVA 1C0EA 4ZP1A 4NEGA 3UAWA 1I2BA 1EJ0A 1CRQA 1NUQA 1NXTA 3HBMA 3TCKA 3LUAA 4XVCA 3G2IA 1MRSA 5K5EA 3EPRA 1F3OA 1ATZA 2E5FA 2X0NA 3I1FA 2CDCA 5DCUA 4COOA 4RF4A 2C0PA 3HDJA 4FJ2A 1G3IA 4KQHA 3W3AH 2AN5A 2FUG1 2P0EA 1RXCA 4UEOA 4D0SA 1CPYA 4C89A 4P53A 1SBCA 2PAAA 1DKMA 3PEFA 4FILA 2BW0A 2GAIA 4L27A 5DDIP 1UBOS 3AFHA 3HPQA 4MIKA 4WFIA 3TBHA 3TNDA 3V7YA 5BSTA 3U31A 5LOVA 2GKOA 4HL6A 1U31A 5T3UA 5BN5B 1UINA 2HQBA 3BT7A 4MA5A 4FDUA 4Q7KA 2A4KA 1G3UA 3AOEC 2P41A 2I03A 2FP4A 1YL6A 1GAXA 1MR3F 1CZUA 2EL9A 3GVHA 1OFHA 2ISSD 1HSOA 3ZV3A 5DM60 4NX2A 1TCAA 5D85A 4D92A 2Q4EA 4NWIA 4O0MA 2N42A 5M29A 4LZWA 1QHYA 3NH6A 2RI0A 3LDAA 4MRMA 4O33A 5EINA 4NBNA 4P4SA 1ONPA 1I7SB 2R5FA 3DWEX 4C0JA 1NI4B 3JQFA 2GD0A 4BVAA 3V4RA 4HWPA 4MROA 4RTLA 1U6JA 2IEAA 2CUNA 5LP6A 2HTFA 3BXXA 2GPJA 4NULA 2GMWA 1QOPB 1ZRMA 4E21A 3EFEA 4XR4A 4XUGB 3E7WA 2Q1YA 3DBOB 1EM6A 1KQFA 1WNTA 3EY4A 1YBAA 4WESB 1A69A 1Z06A 3H6HA 3ZXYA 4FEEA 4Y2XA 1Q3HA 7ADHA 4PAOA 2R5WA 1E2HA 4NY1A 1XRLA 2QN8A 1NOJA 3TDKA 1FE8A 2V59A 5JH7B 5JSZB 4B3TB 1NQUA 1SHLA 3HJNA 4Y2SA 5IH3A 1N6KA 5KJ1A 2XOXA 4YIHA 4N9WA 1PFQA 2A5GA 3HRKA 1MDFA 3A1SA 4GLFA 1Q20A 4HDMB 5B2ZA 2RGBA 3ETNA 3L0SA 4CQLA 3DMFA 4LXIA 2VDPB 1L7VC 4JR0A 4R9UC 4NJEA 5CVTA 4LVNA 4KN5A 5BN5A 3BILA 2W6IA 1YJXA 3TLEA 2MIIA 5BNFA 2QZPA 3S44A 2FVXA 1MFPA 2K2WA 1V4BA 4D8UA 4GM4A 2YDXA 4A1OA 4EITA 1KRXA 1KSGA 3FOEC 2Q1SA 5CFMA 4DMCA 2B34A 4QWMA 4PONA 1E1KA 1P9LA 1UBMS 2BMAA 4GHWA 5C53B 3JTMA 3OQIA 1N2IA 2IXAA 4WI1A 2DXIA 2QXYA 1H4QA 5C8ZA 4O4LF 3GFQA 3KZMA 3PIRA 2UAGA 3F7NA 1N33B 3LXMA 3RVRA 3REQB 4K1LA 2AI2A 3WZMA 1RW4A 3E1SA 3LA8A 1C41A 2YCBA 3FRHA 1C4OA 1BE8A 1JHVA 1SUPA 3ZIDA 3DMNA 2GAFA 1LDMA 3SDSA 4IGAA 3LFTA 1I33A 1EX6A 1KPGA 3A1NA 3CYFA 4R98A 5IK2A 2AQ8A 3HYRA 3U3MA 1YXMA 3ZNPA 4F5ZA 1TA9A 1XF1A 2FZWA 4WNAB 1JPVA 1B2LA 5D1HA 5FL3A 1NMSA 2J5BA 2OXCA 1CC1S 4B3IA 1VMDA 1QIEA 5DM2A 1MEJA 3F5DA 3UYLA 5B4UA 1EBUA 3PDWA 3LVRE 3SAJA 1TD9A 1EFTA 1J1ZA 5M2QA 2AKEA 4MPJA 4NE7A 3L01A 3UWKA 2O1EA 3I2YX 1EFKA 4LMRA 3S7TA 4V02A 3U5TA 4YJFA 4LMPA 1IY8A 3O3CA 5ER6A 4OXYA 4DR6B 5K01A 1OT5A 2NZXA 4MS3B 4PRZA 1Q0LA 5FPPA 3RFVA 1FP1D 4R31A 4PZEA 1NBAA 3CW9A 3IQIX 4S04A 4QGBA 3EMDA 3OKFA 3S0JA 3M82A 3QSYA 5EKXA 2Q0QA 4LISA 1UF9A 4V24A 1K3FA 2GZHA 5GJWC 5LD2B 1B14A 2IZ1A 2PIDA 5AKEA 4B9AA 2A9JA 4E2ZA 3AIKA 2GF9A 1Q83A 1OB5A 2WU8A 1XLWA 1R4MB 3REGA 1XJCA 2XUOA 3A0UA 2WC1A 2PCLA 3BYZA 4UPVA 3IJRA 2SICE 1NYTA 2QSJA 1WSBA 3EGDA 1T10A 1FLAA 4HH3C 3UGJA 2M32A 3EMKA 1E89A 2XR1A 3QG5A 3WL5A 1PQYA 5C5CA 3BWYA 1O77A 2OCGA 4KE7A 5FRDA 1KDZA 4DUGA 1FLVA 1ZHOA 1JX6A 4MUKA 4AY3A 1LRLA 4HAZA 2YMPA 4LJ5A 4B4KA 2MSWA 2Q46A 1E5LA 1DC5A 4EF5A 3DUWA 3S4YA 3BCRA 2VF7A 2VP3A 4MYUA 4W7IA 3ZDCA 2YBDA 4NJEB 1Z6YA 3QBTA 3CCFA 3KCNA 4BASA 1F4LA 4TYMA 1TTHA 1BWRA 2ZSUA 3KUUA 5ICFA 4NYIQ 1E9FA 3L8ZA 2Y1DA 3URMA 4URXR 4NOJA 3K70D 2NVBA 7REQB 1QG0A 4M0LA 3DZKA 1BGVA 2DULA 3ESBA 5CT4A 1E2EA 3UB4A 3KAKA 3GT4A 1DRUA 2Q3MA 3IOBA 3URKA 5TXGA 5L53A 3Q7SA 2PD4A 2H8GA 3T1VA 1NF9A 4KGXA 4J7AA 1T9CA 1O08A 1J2YA 4C3OB 1CQIA 4G2NA 4TMVA 5DX1A 2EEPA 2OC9A 2ZUCA 2A30A 4KYUA 2GRAA 5DIFA 1WZNA 4JP2A 1EX7A 1LDBA 2MSLA 2BMEA 3SIRA 2I9KA 1GA4A 1R15A 2QAGA 2RHHA 4AJ9A 4BRUA 1PG2A 3FPSA 4RH0A 4ZDWA 2HV8A 2IY8A 1VZ2A 1T9BA 1RLMA 2BKXA 2PBRA 2ZDHA 4A10A 4Q3CA 2BM9A 1DUIA 3CJTA 2WUFA 3WHIA 2EFGA 1Y7HA 4RY0A 2W90A 3F8TA 3A4YA 3H9BA 3U3RA 4B6FA 4NH0A 1U0GA 4P7KA 3T61A 1KYTA 1W1UA 1XD9A 3CZ9A 4JQZA 1BCRA 2X3YA 3TSCA 1P44A 2GJ4A 3K71B 1BMFA 4YPOA 4ZI5A 3U7EB 3H42B 5CUQA 5EUBA 4LHZA 5AVWA 1WCV1 4Q82A 2GOYA 1I5EA 2AEJA 4RVOA 3IULA 1LLUA 3QU4A 1BHO1 2D2VA 5KMGB 2G70A 2JFFA 4FIZA 3D7RA 4AWAA 1UEJA 3EBLA 3JYNA 2PS3A 3O74A 2NU6A 4KSBA 4D1YA 1L5QA 1LJLA 1XTSA 4B34A 3G0IA 1P74A 4X8OA 2R7LA 4F3NA 3LVQE 1W87A 4ENVA 1Z8DA 3OEHD 3W5VA 4LI0A 4AZTA 5FEUA 4ANFA 4JVSB 2HF9A 1U3WA 1DAPA 1G41A 5JPIA 4NV1A 5IHXA 4HY3A 3WVNA 2H59A 1MB4A 2KX7A 1TQ8A 1E1YA 1IQUA 1U3CA 2J07A 2R7KA 4IUBS 2HRBA 1YDEA 3GQVA 3LTNC 1CF4A 3LI2A 5KOHB 4BS9A 4RADA 3CURA 1GVNB 2XLBA 2HRRA 2GASA 3PC2A 2HHHB 2O2XA 1RC8A 4EK9A 4R01A 2JLXA 3OPYI 4JZKA 2ZCJA 2P9JA 3OG9A 3AHHA 4Q9IA 5KNDH 4BNXA 2QN9A 2VHEA 1RSZA 1QCYA 2HDHA 2PAFA 1JU9A 2PYZA 3P9XA 4FVTA 3TKYA 4AY4A 2AKAB 1XRQA 2CBGA 3KLPX 4IMPA 4RJ2A 4K6CA 4CUKA 1L1QA 3P2JA 3IPLA 4OFXA 5KSWB 1GT6A 2WHYA 4NE2A 3WB9A 1YL7A 1E18A 1RI2A 2WU3A 5THXA 2NPOA 1JDJA 1MJGA 1XE3A 3C39A 3DNFA 1AN9A 4GBED 4NEHB 5EHQA 3EG9B 3JX9A 4TRJA 4HRVA 3L5KA 5EIFA 2VSYA 5A9TA 1ZNWA 4ONEA 4I4CA 3B1WA 4YCCA 1O03A 1TJ3A 1WB4A 1E2QA 3A1TA 3NXKA 1M8KA 1XTPA 2IYFA 2QLNA 2RKWA 2QRPA 3AEUB 4HR7A 4O2LA 4RF3A 3ROXA 4KAAA 3UB2A 4C21A 2O8BB 4MOWA 4CKBB 2LIVA 2V9CA 3KEGA 4MUYA 5FAXA 4ZVRA 3UA3A 2VJDA 1EXDA 4B44A 3G17A 3SHQA 1F6DA 2OB2A 4G86A 3ZWQA 3PS9A 3NNDA 3RBZA 3U09A 2DPHA 4ZVNA 1U7PA 1Z08A 3EZYA 1ZU5A 4PPYA 2P65A 5IKXA 2QHXA 3IT1A 2LD4A 1AGNA 4FNGA 1JZSA 1UWKA 5J4VA 4XA8A 3R8FA 1IG0A 4TWAA 4UTOA 1VI5A 3VKUA 1Y1PA 2E0IA 6LDHA 4GWKA 2B8WA 1TU3A 4IG9A 1SN7A 2IXFA 3KQSA 1GPJA 3AEQB 1KEVA 4MGIR 2ZAMA 3B51X 3KQVA 3VZQA 1ITZA 3VR6A 1LLDA 2GM5A 1EUCB 1E7MA 1PS0A 4CLHA 1RRVA 4ZU6X 4O8ZA 1FK8A 1T4GA 4MWTA 4K9MA 1FMLA 2F4VB 4L4SA 4MDEA 3O94A 2R8OA 3GLIB 2EKQA 5A2QA 3DL7A 5HQ3B 3DAOA 5CFNA 1V25A 5CVJA 2J48A 3IKMB 1OLXA 2OZLA 1CJTC 3PGVA 5A4AA 2WYVA 4LPKA 2FFJA 1KAEA 3V97A 1KEWA 2CLKB 2R97A 1G0OA 2HO5A 1N1MA 4ZCPA 4TYQA 3EAQA 1GP2A 4KN8A 1OYWA 4R2JA 1P33A 1K7YA 1R3UA 4EB3A 2IEDA 3HDYA 4D8XA 2QPTA 1XLTC 3A9CA 1NURA 4HXGA 2FUKA 4DV7B 4G4SP 3GJTA 5ARBA 1IEVA 1DCKA 1JQKA 3EC7A 4BLOA 4C0LA 3T4XA 3PHHA 4L5AA 1A98A 3K9LA 2Q7DA 2ZBDA 1E5QA 5HF8A 1RJ9A 1DX4A 4Q48A 2GILA 5F9HA 1KI6A 1GR0A 1V5WA 1PTKA 1VP3A 1H6BA 2YV4A 4KSCA 3T7EA 3NKFA 4ID9A 2Z1MA 2GN0A 5D7BA 1X9HA 2ZUVA 1KNXA 3OQJA 1LLCA 3S99A 3WGUA 2NACA 4Y0AA 2FF7A 1QFXA 4FWIB 3I2FA 3RW9A 1Y63A 2J3KA 4ETWA 3T12A 1Y34E 3TRJA 3LCCA 4G6ZA 3QWAA 3UAZA 1IM8A 4MWEA 3DLCA 1EFAA 1HXHA 2CXOA 4DG8A 5EGNA 1OH8A 3PFNA 4NZZA 5G4KA 2RB4A 1QVRA 4O5OA 4B75A 1KMIY 2B2NA 3AUXA 1P9NA 1O95A 3K15A 3ABZA 4J1NA 4UJ3A 5AHWA 1B26A 1R6XA 1ZVKA 3FUVA 3HKDB 3BIXA 3AYXB 4B83A 1MC4A 3MWGA 4F4UA 4K6OA 1GDHA 4QTUB 3PG5A 1TO6A 4EBBA 2WG2A 4RF2A 3VZDA 2FDCA 3F0TA 1J70A 1SOMA 1EHCA 4HTFA 1IDN1 1G4HA 1OWNA 1T2VA 2FW8A 2B25A 1SUBA 1SVNA 3MIZA 5B3AA 5AUNB 3HACA 3AEZA 5FWXA 3SE0A 5DRYA 3PHGA 4B6RA 3F73A 3HBNA 5I7EA 3TPZA 5BPFA 2W58A 4MUXA 1QGYA 2IVZA 1L7EA 2C2ZA 5AMXA 3BICA 4AZWA 3QE3A 2ZRNA 2JFYA 3QLUC 4O25A 2GHQA 4GNKA 2ONCA 1Q0RA 1QDEA 2X19A 3A1UA 2A6PA 2PKEA 3L7NA 4XEUA 4D9JA 4DIBA 1Y1LA 1ESEA 1H94A 5DULA 1JEEA 1HL3A 2QTNA 5EJEA 2X9LA 1CYEA 1VL5A 4CMGA 5CD9A 3DDWA 3MCTA 4DF3A 4IZOA 1UDRA 3IKTA 1UKVY 3BVPA 3HWSA 2V45A 4N3GA 5E1MA 4MRRA 3IQWA 4JLSA 3VU0A 1T34A 4LHVA 3ZZUA 4OJMX 1KJZA 3AEQA 3J7TA 5KVQA 4UBJA 1JLSA 2J0UB 5D01A 2VBCA 4H7FA 3WJ2A 4RVNA 4F4JA 1VJ1A 1C9DB 2CHVA 3RGGA 4UXIA 3P0JA 1MN6A 3F97A 3PQ8A 1PGNA 1OCEA 4KTTE 3EF1A 3O4RA 5DW0A 2GYVA 4O02B 1K1EA 1NFQA 3L0DA 1EZ1A 1EE2A 4HNRA 1KYZA 1DEAA 1JIXA 2RGNA 1WW8A 2Z30A 3OIWA 3I05A 3Q98A 5LDDC 2AOXA 5HIMA 3WK5A 1V6AA 2Y71A 2XDWA 3AF5A 5DLDA 5LOVF 1QQBA 2N46A 3B89A 4WE3A 4Z7OB 1O94D 1X1QA 3DV0A 3FVVA 2P5SA 5E9QA 4EX7A 3BRWD 4B3FX 1L4KA 2HI0A 4LMAA 3B13B 3OD5A 1X7XB 5C4MA 4JJFA 1U65A 1PU2A 3C1TA 1ZK3A 4JCCA 3OBIA 3H2SA 1XEAA 4QUGA 2X14A 1PR9A 2NTNA 1Z4IA 4FCTA 3QKSB 4J0EA 4DCMA 2BJHA 1K6EA 2A9OA 1A9XB 4QULA 1EH5A 5JEEA 4YRDA 2J6HA 3KL4A 3DHNA 2V8BA 4RY9A 5AKJA 4OHWA 4KLRA 1XQWA 2DQSA 3QWHA 3V4ZA 2IXTA 2CFOA 2EL7A 3PNKA 2XNDA