2VS0A

Structural analysis of homodimeric staphylococcal aureus virulence factor esxa
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
83
structure length
83
Chain Sequence
MIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VIRULENCE FACTOR ESXA
publication title Structure of Staphylococcus Aureus Esxa Suggests a Contribution to Virulence by Action as a Transport Chaperone and/or Adaptor Protein.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Cell invasion
total genus 36
structure length 83
sequence length 83
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF06013 WXG100 Proteins of 100 residues with WXG
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.1060 Mainly Alpha Orthogonal Bundle Helix Hairpins ESAT-6-like 2vs0A00
4I0XA 3O9OA 2AZ0A 3Q4HA 3G80A 3GVMA 2VS0A 3TXSA 2AZ2A 3TXQA 2DE0X 2B9ZA 3HR0A 4LWSB 4ABMA 3FAVB 3FD9A 3OGIB 2KG7B 4LWSA 3GWKC 3FAVA 2KG7A 1WA8B 4I0XB 1WA8A 4GZRB 3ZBHA 3Q4HB 2VRZA
chains in the Genus database with same CATH superfamily
4DR7O 4GKKO 2ZE8A 2JRIA 4UVCA 5A9GA 3H1LH 5IWAO 2HJFC 4WFHA 2Q8VA 4JI7B 1HNXB 2CGNA 2UXXA 3J80N 3OEHG 5B1OA 2KSDA 4ZOLA 4WFGA 2LQTA 2ZXWC 4DR6B 3SJAC 4CH5A 4DV3O 2B1GA 4NXNO 1N34B 2XAHA 4JI2O 4B3SO 4D7TA 4UFZA 4DV6O 4O2BB 4LFAB 4FLTA 3OMAB 1VF5B 3Q4HB 1E79G 1XHXA 4X1YB 3APQA 1AROP 2EIJC 1AP5A 2YEVA 4HYOA 1VF6C 3FKSG 3PN1A 4JV5B 3OTOB 3B8MA 5EC1C 3QF7A 1NR7A 4K35A 5IYZA 1MZEA 5E79Z 4KHPO 4EKWA 5IJ9A 1N4CA 2ZDIC 1Q6UA 1I94O 4PA7A 3D36A 3JD3A 4JYCA 4FMTA 3K0GA 1V55B 1I0HA 3PJSK 5BMVA 3OMNB 2ZXWB 2UUAB 2D2CB 2YSUB 3WB1A 2GSMB 1VQLV 1EZVH 3K79A 1I5YA 4X62B 2P22C 4YIPA 3WFVA 2F95B 5KMGB 4X65B 1M56C 5EK0A 1BT8A 1HWYA 1OJHA 3AEIA 5FNVA 3VQXA 3LSUA 2QKAA 4NTXA 1R3JC 1P49A 2IW5A 4DV2B 2F1MA 1KU9A 2AXTZ 2CAZC 4O4HA 2YXYA 1GH6A 4ZI7A 1OZ0A 4JAVA 2PYLA 1F4NA 1T5EA 1J95A 1Y67A 1XMOB 4IIJB 3P32A 1UJWB 4H44B 3SYQA 3GVMA 4C7UA 1FFXB 1RPRA 2BSKA 3ABUA 3E86A 4I55B 4YJ3A 4I7ZB 1ZSPA 1CXZB 1G8MA 1P84F 4NXMB 1FXKC 2IM9A 1LR1A 1K5SA 4R8CA 2A79B 5JJEB 4Z1MG 3SYOA 3BVOA 4IYHA 2R9RB 2HVKC 1R73A 2E76B 1H2MA 5LMUB 3I55V 4UVAA 3T4ZA 2HHHB 4ZBMA 5LGUA 3ZMZA 1NH2B 1GK9A 4DV0O 1LUVA 3OUSA 3VOUA 4UCTA 1IXBA 3FFQA 2ZM6O 4D6TH 1MNGA 2VWJA 4FM1A 4O2AA 1GRJA 2Y0PA 4UXNA 2WLJA 2Q68A 4R7CA 3RYIB 5CN0A 2BOBC 2P90A 3HKCA 1XDCA 3ZHTA 1L1FA 4PELA 1EM1A 4YY3B 3U11A 1AB3A 2HG5C 2EIMC 2QWRB 4ZHQB 1XNRO 5E1AC 2YUAA 2UU9B 2OT5A 5JWPA 3SJBC 1K4DC 1PKXA 4BWAA 4JAAA 2Z3YA 3BHPA 1TUBB 2IU3A 3OGIB 2N74A 1J5EO 3H9VA 1AP6A 3UM7A 4JI4B 4DK1A 5KHJA 3GWOA 1WNSA 4LF6B 4I0XB 3OMIB 3JATB 2E5LB 1N0JA 4JI6B 3D8CA 4UCRA 4PDVA 4B7KA 4DRXA 1HNZB 1SESA 4FM2A 5J2TB 3SPJA 2F23A 1ORQC 2DE0X 5B1NA 5EYPA 4BW9A 1BSMA 4LWSA 3ETQA 3SPCA 5K1XA 5TISZ 1VMGA 1SQBH 2UXCO 1K34A 5LXTB 3E22B 5JJNB 3O9OA 3CX5F 4CZZA 3SJCC 2YIDA 2JDIG 1AJNA 1E1RG 3G80A 4TUYA 5KHHA 2BTOA 3IAYA 3VQYA 2ZDIA 4JF3A 5GTIZ 5B3SC 4DUZB 4IYIA 1YXBA 4EFEA 2EIMB 5BY1A 5LA6B 3ZIAG 2HVJC 3AG4C 1XEQA 4L87A 1S5LZ 1AJQA 1F51A 1HDJA 2Q69A 4EB6B 1D5NA 2DW4A 1K3EA 2LW7A 3F5WC 4AHCA 2QDOA 5LOVA 5L3DA 1YF2A 1XBLA 3M99B 1XMQO 1IDSA 4X64O 3C3SA 3F5TA 3T1YO 5BR8O 1IBLO 2Q7EA 1IURA 4DR3O 2A0LA 4WFFA 2DYRC 3IC9A 2UXDB 2GV9A 3CC2V 1BQ0A 1OCZC 5LHGA 3TXQA 2UUBB 2Y0IA 4FZ0A 1QBZA 4EEQA 1ZLZA 4OPAA 4LF8O 2FL4A 2JS3A 5EZYB 4B3RO 3CE2A 2Q0AA 1NVPB 2W0XA 3ZRSA 4TT3G 1V54B 3H1JH 1SQVH 2VRZA 2JGDB 4ZKIA 3O65A 2LP7A 1G6UA 5B3SB 1IXMA 4PA9A 3ZRWB 1L8DA 4U3JA 2VQEO 3B2EE 2WLIA 3AG4B 1AI7A 1R1BA 1FXKA 4X66B 1PD3A 5IYCO 5A2QN 4W4LA 2ATKC 4O4JA 3JD0A 3T1CA 2LO1A 2ZNIA 1AI4A 2A06H 4LP8A 4AQYO 4GKJB 4CC5A 4O4IB 4R6ZA 3MAQA 3C3TA 3ZHVA 1FPOA 3M7MX 2JGUA 2PI4A 2B1IA 2DWEC 1SQXH 4H37A 4YXWG 3RYCA 4N21A 1SF9A 1JA8A 3FB7C 2DYRB 3U0ZA 2OYQA 2V7QG 1TGOA 4MTFA 2DN9A 2VQFO 1SS3A 1XI1A 4I50B 2QKSA 4J80A 1KP2A 1GTOA 2XAQA 4LNUA 2EILC 3TXSA 4AI8A 2FYUH 1JOYA 4LF7B 3GB7C 3RN4A 2LFSA 2PI5A 3QO7A 5CA0A 4UV8A 3K57A 4DR7B 1TVKB 2LW1A 3SGIA 1S0VA 2W6JG 1O9GA 3UQ8A 4B3MO 1M90W 4DV5B 2YIBA 1FYJA 3A8TA 5KX5A 4DR1O 3G6BA 3K5NA 1P4RA 1KP3A 5JH7A 1GM9A 4WFEA 4JYBA 1G1XB 4GZRB 4DW1A 2F4VB 1H2NA 2OWOA 1VARA 1YTFD 3WU2Z 5L3BA 4K8ZA 4NXNB 3ZHRA 4XDJA 2P67A 3EXAA 3L74H 4OX9O 4B3SB 1NTKH 2CK3G 2KB1A 4LFCB 3TJTA 3ZHUA 2A9HA 4FFBB 1M5IA 2XAFA 3RBZA 1WB7A 2DJVA 2EILB 3X2QC 3S3WA 4DR5B 4GX5A 3ZMSA 2HKOA 4NYKA 2AW9A 5LYJB 1Q90D 3HKBA 1THZA 2OTLV 4FLVA 2W0FC 4YIOA 1HW7A 1BS3A 2HFEC 2VS0A 5GTHZ 1PL4A 2W6IG 3RYHA 4NKGB 4CS4A 4EFBA 4KL1A 1KC8W 2Q6AA 2QSAA 1FKAO 2ADQB 1JFFA 3TGUH 4QJFB 4F6RA 4YJ2A 2UUCO 1H2SB 4HNAA 3CCRV 3QG5A 2KKWA 5IYZB 5JQGA 4JI0O 3CP1A 4UB8Z 1YDXA 4Q6GA 3JARB 3RYFA 4QPJA 5KAFZ 2YS8A 4LF9O 4OPHA 3ZN0A 4MS2A 5CA1A 1Q3EA 3JYCA 2IH1C 4B3TB 4MSWC 5BXZA 4MVUA 4A5UB 1KQSU 3D3QA 3BY6A 3N2KB 1N33O 2K9PA 3L71H 1R6KA 3FYIB 4JI3B 4O4LA 5LGNA 4J9YB 5H5NA 1BGYH 5CB4A 3DC5A 4XBFA 1BE3H 1SZXA 4TOIA 3E8HA 2XASA 5L3FA 4R50A 3JAMN 2IJJA 5GW7A 1SRYA 4X20B 1P7BA 4P30A 3DSQA 4JYAB 4LF5O 3K0DA 4PA3A 4RO2A 5FPRA 2WSSG 4DO2A 4DR4B 1DF4A 2A3QA 1M57C 2R72A 3CCMV 1RM1B 2CDYA 4MVRA 1HNWB 2PF4E 1Z5WA 1I08A 1WP7A 3KCXA 1V55C 1GAXA 4DR2B 4FFKA 5AG2A 1UPGA 5JVDB 2EIKB 1ZL8A 4X1KA 5KAIZ 1OCRC 1BHAA 5HFMA 3IC7A 1PV0A 2DMXA 1XHZA 1I5XA 4U3FH 3ZHSA 1VQMV 3ZMUA 1M93A 2K1EA 4MT8A 1GKFA 1YI2V 3JSLA 4JI1O 1G4YB 5IYBO 2JJ1G 1URFA 3AG1B 4H13B 2WLLA 4TQFA 2UXBB 4ASUG 1Q82W 1N32B 3ZX6A 4UV9A 2JJ2G 1NR1A 2ZR2A 4K8XA 4W4KA 2JK5C 3E89A 4X1IA 1SA0B 3OFNG 1FJGO 3CRRA 2RNBA 3AK3A 1W0KG 3ICXA 4JI5O 1IBKO 2X0LA 4LH6A 4PJ0Z 1M57B 5L3GA 1ZAUA 4UVBA 4UB6Z 1SERA 2GUZB 2L6LA 1MMMA 5GONA 2DWDC 1EN6A 4IGGA 3ZRVA 3CXCU 1BMFG 5JJJB 1J5EB 3HKCB 1H8HG 3DXRA 3K9AA 1XREA 3HKDA 3RGBA 5KHGA 1OCRB 2RDCA 1VQ7V 5KHIA 2BE3A 2R9AA 1Q86W 3OT7A 3E8FA 3CEIA 4LH7A 5J2UA 3JCUZ 3THOA 3KG2A 4JTCB 5DECA 4WBNB 3SDLA 1SQGA 3N2GB 4JI8O 2JS5A 3FD9A 4QE7A 4I4TA 1NQTA 5H9CA 3T4DA 4BR6A 4WFAV 3JAKA 3AG3B 3BA9A 5LP6C 1PM9A 4JAUA 4X88A 1CP9A 3LSQA 1XQ8A 2MW2B 3EHBB 3L72H 4I5SA 5H6QA 1S5JA 3BFRA 4MVQA 2NLJC 1YIJV 1DTOA 3CRAA 4XDLA 4IHJA 5D5QA 2ZD9A 4FZ1A 2QR4A 4KXRA 5LMNO 3JASB 4TUYB 2XTAA 3KCYA 1BQZA 3RT3C 4GLXA 1FXVA 5ITZB 1KD1W 3EFFK 3BABA 2QGNA 5J9PC 4JI7O 1HNXO 4B08A 2P6JA 2Q67A 1ZX3A 1HR0B 3L75H 4DR3B 4O2BA 2IU0A 3MD0A 2QM8A 1D2DA 2PY5A 4DR6O 3Q4HA 1H2KA 4X1YA 4X9QA 4U7NA 2BCCH 1S76D 4GT1A 3CD6V 4HBNA 1SC5B 2R70A 4MTXA 1N34O 4JYYA 2ZT9B 4PI2A 5DEDA 5HFLA 5LP6B 1M4UA 1Y76B 4LFBO 1IBMB 1OCCC 3CC4V 2CTQA 4YHHB 4LFAO 4BIUA 3KKYA 4JV5O 3OTOO 2ZQMA 1KMIZ 1VEWA 4G28B 4K0KB 1XNQB 1DF5A 2LGWA 2Q7HA 4E4EA 3H1IH 1S5HC 4JGSA 4J11A 4RUFA 5KLVH 2V1DA 3ML0A 2CTWA 4XDKA 1QNMA 2IBZH 2ARHA 3ZHQA 1K4CC 2EX3A 1K7DA 4UCUA 1EFRG 3J7AU 5DN6G 4I9QA 5KMGA 3SR2C 2Q9LA 1KB9F 1NT2B 1NI8A 5D5PA 2UUAO 1ROPA 4DYLA 4JASA 1NS1A 2BTQB 1VF6A 2YDEA 3APOA 3SPIA 1QR9A 5KA6A 1BZKA 3CHXA 4X62O 3UKMA 1KUQA 1ZTEA 1N8RW 3TETA 4X65O 1WN7A 2GTAA 4IIJA 1US6A 1UFIA 2ILMA 3B09A 1PL0A 1MA1A 1V54C 4PA4A 1OCCB 1FFXA 1YHQV 4CH3A 1JJOA 4UCSA 4DV2O 4LF4B 2QWQB 4I55A 3OD4A 1YZBA 1W59A 3HB3B 4MW8A 5CMUA 5EBMC 2Q7GA 5EBWC 3CYOA 5C8YB 3K3WA 1HP8A 2DYSB 4LNUB 1RPOA 4P9OA 1H8EG 1XMOO 4DR1B 3SYPA 4FIPC 1TA8A 3RWRD 1SETA 3F7YC 4J7KA 1YJNV 1K73W 3JAWB 1RSOA 2YIBD 5FL7G 5JCOC 3A2FA 3N27A 2R9IA 4NXMO 4RWUA 1EBOA 1N36B 4OX9B 1YEWA 5IE9A 1JJ2U 5JH7B 5IT9N 2OIEA 4DV1O 5LMUO 2D3OW 2A7WA 3ETGA 2KG7B 3WG7C 2P4VA 3DGEA 2HHHO 4NR1A 3W7UA 3WB0A 2VWKA 4DUYB 4LC1A 1VQ4V 3JD4A 1NJIW 2UXNA 3C90A 3JALB 1E1QG 1Y6XA 5EIBC 2XNDG 2AHYA 1LNQA 3CB2A 3QTCA 3TCUA 4ZHQA 4F6EA 4ICGA 4J10A 3CXHF 3LDEA 1K8AW 2ZIOA 1KBHA 3QO5A 1TUBA 1QVFU 1VIBA 2RCVA 2Q5ZA 3OTFA 4I0XA 3JATA 2AZ0A 4YY3O 1K92A 2X6BA 2HR3A 3OR6C 1QHTA 3RYHB 4QE9A 2DQ0A 1W2BU 1R3LC 2Y48A 4J42A 5J2TA 2UU9O 2Q0OC 2ZINA 5KUKA 3A0BZ 3FB8C 4YJ2B 1XL6A 4JI4O 4FLUA 1U96A 1VF7A 2YXHA 1GN3A 1N0NA 3CWBH 1KKDA 2E5LO 1NTZH 5LXTA 3E22A 4JI6O 3R66A 3WG7B 5IJ0B 4DV7B 5IY5B 2C2AA 3RW0A 2ZR3A 1HNZO 5L3CA 2XUMA 3RYFB 3SPHA 4FPPA 4GUNA 1QR8A 3CCEV 5KA5A 2FKXA 2RQ6A 3FAVA 3UT5B 4J7JA 2P5OA 3ZMTA 4ZIBA 5LA6A 2PZSA 3JSNA 4GKKB 4PDLA 2P06A 3CJHB 3NXSA 5IWAB 3AG2B 4EB6A 1PNMA 2GTSA 1VQOV 3G71V 3CMEV 1Y74B 4DUZO 4Z2WA 1WA8B 4QIWF 4DV3B 3T2MA 4TV8A 1WB8A 1YTFB 1FFTB 3ABLB 2WLHA 1EN4A 3D36C 4JI2B 3ASNC 4HZ3A 3K06A 3OAAG 4BAYA 1IZ3A 4DV6B 3HKEA 1K97A 4ZOLB 1F23A 4DXWA 3G6EV 3K5MA 2HP8A 3R65A 2LFRA 3OE7G 3F7VC 3K5LA 3K04A 4FLYA 3CSXA 3SJQC 2M6YA 3MHHC 1GN2A 1FXHA 3JCZA 4FLZA 1K5QA 3ZRXA 3ABMB 2QM4A 3ZRWA 1IVSA 2UXDO 4KHPB 2H94A 4DV4O 4BW5A 2UUBO 1JX9A 1QLEC 4PHZA 3SYAA 1VQ8V 2JEXA 4B7EA 1EN5A 2YEVB 1I94B 5LL6Y 1ZUQA 1RM1C 4TV9A 3ABKC 3ZCCA 1NU1H 4O4IA 2EBOA 5LHHA 2XT9A 3BA8A 4WF9V 5IJ9B 3T1HO 1VQKV 2EIKC 1PP9H 1NTMH 3H01A 3LDDA 1OCOC 3ASNB 4GKJO 4I50A 3UCSC 5BMVB 1M1KW 2QTOA 2EULA 4P2ZA 3G4SV 1JR9A 3ZEDA 1S3JA 1ENVA 2V4DA 3AG1C 1R6TA 3SPGA 2XOKG 2ZE7A 1SQPH 1BHBA 1TVKA 5FNVB 1H38A 1QLEB 3OM3B 4CH4A 4O4HB 1H2LA 1SQFA 4ZI7B 2B9ZA 2XAGA 4LF7O 1PPJH 3ABKB 4CS2A 5CA3A 5IYDO 4JTAB 2RMKB 4MTOA 1VQNV 5LMNB 2HLDG 4RQEA 4PDMA 4LR3A 5LGTA 4Q20A 1QVGU 4DV5O 2BSKB 3FX7A 1WPXA 3H1HH 4YJ3B 1OCOB 2CTRA 4CH6A 4BIZA 4PDRA 5K1PA 2QA4V 1L0LH 4IHJB 3ZMVA 4DV0B 5C93A 3A0HZ 4FFBA 1AI5A 3HPLC 4PI0A 3QNEA 3JD1A 4UUJC 2ZM6B 2F4VO 1M9NA 1OV9A 4N23A 1K9MW 3BCCH 2IH3C 5LYJA 1VQPV 3QO8A 4X8AA 1OHHG 3S3XA 3AG3C 4LFBB 4LFCO 3VQVA 2QE7G 1JQ0A 1DK1A 2FMLA 4Z1VA 4DR5O 1VQ5V 5L3EA 4GYCB 4H33A 4BIOA 3B4SA 4O2AB 4KP4A 2QJ1A 1XNRB 2YIAA 2YI9A 2CH7A 3A0RA 5B66Z 5KHKA 1Q6IA 3LNNA 1S77D 2WPDG 3I56V 1FD9A 2EZOA 4ABMA 3G67A 2P7TC 1R3KC 3JARA 3K59A 3VQWA 1MZFA 3FYEB 4KFMA 2X6CA 1MABG 2NR5A 1R6NA 2EJ7A 3N2KA 5H2FZ 2HEPA 2JVDA 3K5OA 1COWG 1Q7YW 4P9PA 1B3QA 4X89A 3BEHA 4PD4F 4I9WA 4JTDB 2UXCB 2WA4A 3GWKC 2CTPA 3BAAA 2ZNJA 2CGOA 4X20A 1X59A 4DRXB 1D5AA 4B3TO 3ABTA 1O9HA 2GBOA 5EYPB 1Z2GA 3IGAC 4CC6A 4LWSB 3NR7A 2EIJB 4JI3O 1PNKA 2RJZA 1AI6A 5B1BC 3CS5A 3ZJZA 1Q5OA 2FB5A 3ZS8C 1L0NH 4FLXA 4JZGA 1DLBA 3CRCA 5CBFA 1U97A 4JYAO 5JVDA 1F7YA 2OCCC 3J81N 2OTJV 4L8JA 4FJCC 1XMQB 1Y4MA 4DR4O 1Q8IA 4X64B 3LNMB 1Z5VA 3K58A 4RAIA 3T1YB 5BR8B 1HNWO 2QWOB 3STLC 4LBEC 1IBLB 1XUQA 4DR2O 1QCEA 3I5DA 5CBHA 2EINC 1MSWD 5LOVB 3CPWU 2OIGA 2YICA 3RVYA 3LSSA 4DV1B 4IT5A 1TAEA 1WAZA 5F2VO 4LF8B 1NH2D 1M56B 4B3RB 1RSOB 1V9PA 2N05A 1R3IC 5CBGA 1VP7A 2LGQA 1SA0A 3ZBHA 4TWKA 3DTUB 1JVMA 2BOCC 3AK1A 1XL4A 2VQEB 3CCSV 2UXBO 1N32O 4GCZA 1FAFA 5B1BB 4GX1A 5BZBA 2GUZA 3E83A 1AR4A 2DYSC 4WCEV 1SZTA 3CC7V 2X6AA 2OCHA 2EZPA 4AQYB 2M7WA 2OCCB 1YITV 2WLKA 1EZJA 1TUEB 4OGQB 4U3JB 4CBCA 5LBQA 2QEXV 3TK1A 2WLIB 3ETEA 1FXKB 4GX0A 3L73H 3HR0A 5H6RA 4QPKA 4O4JB 4WBNA 2KQXA 5LHIA 3N2GA 2EINB 2PUSA 3CCUV 1Q81W 2P4KA 2VQFB 4NTYA 2QM7A 2F93B 3ZN1A 2ZKOA 2AHZA 3RYCB 1FS0G 1K33A 3OUFA 4OXSA 4G27B 3IJ4A 3ASOC 1GO3F 3P3NA 4UCOA 1WPBA 4B3MB 4GX2A 5FPOA 1YVWA 1BL8A 1QU7A 3MHSC 2XHBA 4MTGA 1ZWIC 3JASA 1YJWV 5B5EZ 3M8AA 5EC2C 2ITDC 5CA0B 5ITZA 3FAVB 1S72V 3UO3A 4WFBV 1AILA 3L9DA 3OGCC 5KX5B 3UO2A 2Z5UA 4QNHB 1B06A 4UCVA 4RQFA 5FLXN 2NNUA 3MDSA 3OEEG 4TSFG 5B1AC 2PTMA 3P3PA 2N04A 2ITCC 1KECA 1LUWA 1P7GA 2GHYA 2Q73A 2ZE5A 3RYIA 5LP6A 2RN9A 5IY5C 1BCCH 1HR0O 1Y76A 2WWWA 4TV8B 1WLEA 2JIZG 2YXLA 1GMGA 2FTKA 2Y69C 3ASOB 2WAMA 2AGAA 4DV4B 1GN4A 1RFYA 3HKEB 1KKCA 3W7TA 2X7RB 1GM7A 1NVPD 4FK5C 3K08A 3AG2C 3LUTB 2ZCEA 3H1KH 2UUCB 5DM6V 1IBMO 1QQCA 4MVZA 2F43G 3HKBB 4YHHO 2WA3A 2WLNA 4JI0B 1Q6HA 1VQ9V 3W7WA 4LCUC 1GM8A 3W7XA 3SYCA 3T1HB 2Z0AA 2AZ2A 3IFXA 2QTSA 1WJZA 4E2LA 4K0KO 1XNQO 1QLNA 3DC6A 3RFRA 3W7SA 4DW0A 3B8NA 3BPZA 3JD2A 2MK3A 1JFFB 3AK2A 4F6RB 3ABLC 4HNAB 4LF9B 4TV9B 1JPXA 3CCLV 4JZ2A 5B1AB 1YJ9V 2BTQA 4LF6O 1A32A 4K3AA 5JQGB 1AJPA 2GDSA 2JEUA 1N33B 4MVMA 2IJKA 1MG1A 1SKVA 3BRCA 4MW3A 4H0LB 1NZ6A 3L70H 1JMKC 5KUMA 1MOFA 4J9ZB 1AVMA 3B77A 3B40A 2Y69B 3ABMC 5CA1B 1OCZB 2ADPA 4G2KA 4LF5B 3CCQV 1YSCA 3CRMA 1AR5A 5C8YA 4MVSA 2H3OA 4J41A 1I7FA 4J7ZA 4O4LB 1RP3B 3CCVV 3ETDA 2XAJA 3K9SA 5CB4B 1X4TA 4QGPA 5EIBD 3OR7C 4LF4O 2IJIA 4RUEA 2O57A 2WLMA 3D3IA 2ZIMA 3JAWA 2ETNA 3E2EA 1DGSA 2LJ2A 3U10A 3KZIZ 1AR1B 2ODMA 1XOUA 4IL6Z 1F4MA 3QVNA 1NKDA 4TQDA 2IJHA 4HAMA 2KG7A 1H2GA 4MVOA 4PV1B 1VQ6V 1PNLA 5EZYA 4JI1B 3AG7A 4FM0A 3RVZA 1ZL8B 4X1KB 2DQ3A 2JGDA 1N36O 2PYJA 2EJRA 3JALA 2E74B 2YC0A 1FJGB 1B6QA 1KYOF 1JCHA 2DOSA 3CRQA 3STZC 3E8BA 4JPRA 4JI5B 1IBKB 3LDCA 4CS3A 4NVPA 2PGGA 2B5UA 2WLLB 4DUYO 1NBMG 2F66C 2L35A 2Q4PA 4F4LA 4FLWA 3WB2A 2NN4A 1XILA 4KUMA 4X1IB 5EBLC 5JCOA 1CPYA 3P30A 4X66O 3OW2U 5IDJA 2YI8A 2QWNB 3VBBA 2Y4TA 2CH7B 5GONB 2ZE6A 2H8PC 1Y66A 3FB5C 2CUGA 1YCIA 1CEZA 5IJ0A 2G38A 3E8GA 4DK0A 4JI8B 3DXRB 3FB6C 3HKDB 1W0JG 3EVKA 3E35A 4AILC 2E3CA 4NB5A 4PA6A 2CE4A 3UT5A 5J2UB 3CMAV 1IX9A 2Y4UA 4U7OA 2E75B 3CJHA 1MSDA 3X2QB 2QKCA 4DV7O 4D7SA 4NTWA 1Q43A 4I4TB 1B04A 4FVMA 2HJDA 3K03A 3JAKB 1Y74A 2QWPB 1SQQH 1GN6A 1WP8A 3CCJV 1WA8A
chains in the Genus database with same CATH topology
4I0XA 3O9OA 2AZ0A 3Q4HA 3G80A 3GVMA 2VS0A 3TXSA 2AZ2A 3TXQA 2DE0X 2B9ZA 3HR0A 4LWSB 4ABMA 3FAVB 3FD9A 3OGIB 2KG7B 4LWSA 3GWKC 3FAVA 2KG7A 1WA8B 4I0XB 1WA8A 4GZRB 3ZBHA 3Q4HB 2VRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I0X A;  3O9O A;  2AZ0 A;  3Q4H A;  3G80 A;  3GVM A;  2VS0 A;  3TXS A;  2AZ2 A;  3TXQ A;  2DE0 X;  2B9Z A;  3HR0 A;  4LWS B;  4ABM A;  3FAV B;  3FD9 A;  3OGI B;  2KG7 B;  4LWS A;  3GWK C;  3FAV A;  2KG7 A;  1WA8 B;  4I0X B;  1WA8 A;  4GZR B;  3ZBH A;  3Q4H B;  2VRZ A; 
#chains in the Genus database with same CATH topology
 4DR7 O;  4GKK O;  2ZE8 A;  2JRI A;  4UVC A;  5A9G A;  3H1L H;  5IWA O;  2HJF C;  4WFH A;  2Q8V A;  4JI7 B;  1HNX B;  2CGN A;  2UXX A;  3J80 N;  3OEH G;  5B1O A;  2KSD A;  4ZOL A;  4WFG A;  2LQT A;  2ZXW C;  4DR6 B;  3SJA C;  4CH5 A;  4DV3 O;  2B1G A;  4NXN O;  1N34 B;  2XAH A;  4JI2 O;  4B3S O;  4D7T A;  4UFZ A;  4DV6 O;  4O2B B;  4LFA B;  4FLT A;  3OMA B;  1VF5 B;  3Q4H B;  1E79 G;  1XHX A;  4X1Y B;  3APQ A;  1ARO P;  2EIJ C;  1AP5 A;  2YEV A;  4HYO A;  1VF6 C;  3FKS G;  3PN1 A;  4JV5 B;  3OTO B;  3B8M A;  5EC1 C;  3QF7 A;  1NR7 A;  4K35 A;  5IYZ A;  1MZE A;  5E79 Z;  4KHP O;  4EKW A;  5IJ9 A;  1N4C A;  2ZDI C;  1Q6U A;  1I94 O;  4PA7 A;  3D36 A;  3JD3 A;  4JYC A;  4FMT A;  3K0G A;  1V55 B;  1I0H A;  3PJS K;  5BMV A;  3OMN B;  2ZXW B;  2UUA B;  2D2C B;  2YSU B;  3WB1 A;  2GSM B;  1VQL V;  1EZV H;  3K79 A;  1I5Y A;  4X62 B;  2P22 C;  4YIP A;  3WFV A;  2F95 B;  5KMG B;  4X65 B;  1M56 C;  5EK0 A;  1BT8 A;  1HWY A;  1OJH A;  3AEI A;  5FNV A;  3VQX A;  3LSU A;  2QKA A;  4NTX A;  1R3J C;  1P49 A;  2IW5 A;  4DV2 B;  2F1M A;  1KU9 A;  2AXT Z;  2CAZ C;  4O4H A;  2YXY A;  1GH6 A;  4ZI7 A;  1OZ0 A;  4JAV A;  2PYL A;  1F4N A;  1T5E A;  1J95 A;  1Y67 A;  1XMO B;  4IIJ B;  3P32 A;  1UJW B;  4H44 B;  3SYQ A;  3GVM A;  4C7U A;  1FFX B;  1RPR A;  2BSK A;  3ABU A;  3E86 A;  4I55 B;  4YJ3 A;  4I7Z B;  1ZSP A;  1CXZ B;  1G8M A;  1P84 F;  4NXM B;  1FXK C;  2IM9 A;  1LR1 A;  1K5S A;  4R8C A;  2A79 B;  5JJE B;  4Z1M G;  3SYO A;  3BVO A;  4IYH A;  2R9R B;  2HVK C;  1R73 A;  2E76 B;  1H2M A;  5LMU B;  3I55 V;  4UVA A;  3T4Z A;  2HHH B;  4ZBM A;  5LGU A;  3ZMZ A;  1NH2 B;  1GK9 A;  4DV0 O;  1LUV A;  3OUS A;  3VOU A;  4UCT A;  1IXB A;  3FFQ A;  2ZM6 O;  4D6T H;  1MNG A;  2VWJ A;  4FM1 A;  4O2A A;  1GRJ A;  2Y0P A;  4UXN A;  2WLJ A;  2Q68 A;  4R7C A;  3RYI B;  5CN0 A;  2BOB C;  2P90 A;  3HKC A;  1XDC A;  3ZHT A;  1L1F A;  4PEL A;  1EM1 A;  4YY3 B;  3U11 A;  1AB3 A;  2HG5 C;  2EIM C;  2QWR B;  4ZHQ B;  1XNR O;  5E1A C;  2YUA A;  2UU9 B;  2OT5 A;  5JWP A;  3SJB C;  1K4D C;  1PKX A;  4BWA A;  4JAA A;  2Z3Y A;  3BHP A;  1TUB B;  2IU3 A;  3OGI B;  2N74 A;  1J5E O;  3H9V A;  1AP6 A;  3UM7 A;  4JI4 B;  4DK1 A;  5KHJ A;  3GWO A;  1WNS A;  4LF6 B;  4I0X B;  3OMI B;  3JAT B;  2E5L B;  1N0J A;  4JI6 B;  3D8C A;  4UCR A;  4PDV A;  4B7K A;  4DRX A;  1HNZ B;  1SES A;  4FM2 A;  5J2T B;  3SPJ A;  2F23 A;  1ORQ C;  2DE0 X;  5B1N A;  5EYP A;  4BW9 A;  1BSM A;  4LWS A;  3ETQ A;  3SPC A;  5K1X A;  5TIS Z;  1VMG A;  1SQB H;  2UXC O;  1K34 A;  5LXT B;  3E22 B;  5JJN B;  3O9O A;  3CX5 F;  4CZZ A;  3SJC C;  2YID A;  2JDI G;  1AJN A;  1E1R G;  3G80 A;  4TUY A;  5KHH A;  2BTO A;  3IAY A;  3VQY A;  2ZDI A;  4JF3 A;  5GTI Z;  5B3S C;  4DUZ B;  4IYI A;  1YXB A;  4EFE A;  2EIM B;  5BY1 A;  5LA6 B;  3ZIA G;  2HVJ C;  3AG4 C;  1XEQ A;  4L87 A;  1S5L Z;  1AJQ A;  1F51 A;  1HDJ A;  2Q69 A;  4EB6 B;  1D5N A;  2DW4 A;  1K3E A;  2LW7 A;  3F5W C;  4AHC A;  2QDO A;  5LOV A;  5L3D A;  1YF2 A;  1XBL A;  3M99 B;  1XMQ O;  1IDS A;  4X64 O;  3C3S A;  3F5T A;  3T1Y O;  5BR8 O;  1IBL O;  2Q7E A;  1IUR A;  4DR3 O;  2A0L A;  4WFF A;  2DYR C;  3IC9 A;  2UXD B;  2GV9 A;  3CC2 V;  1BQ0 A;  1OCZ C;  5LHG A;  3TXQ A;  2UUB B;  2Y0I A;  4FZ0 A;  1QBZ A;  4EEQ A;  1ZLZ A;  4OPA A;  4LF8 O;  2FL4 A;  2JS3 A;  5EZY B;  4B3R O;  3CE2 A;  2Q0A A;  1NVP B;  2W0X A;  3ZRS A;  4TT3 G;  1V54 B;  3H1J H;  1SQV H;  2VRZ A;  2JGD B;  4ZKI A;  3O65 A;  2LP7 A;  1G6U A;  5B3S B;  1IXM A;  4PA9 A;  3ZRW B;  1L8D A;  4U3J A;  2VQE O;  3B2E E;  2WLI A;  3AG4 B;  1AI7 A;  1R1B A;  1FXK A;  4X66 B;  1PD3 A;  5IYC O;  5A2Q N;  4W4L A;  2ATK C;  4O4J A;  3JD0 A;  3T1C A;  2LO1 A;  2ZNI A;  1AI4 A;  2A06 H;  4LP8 A;  4AQY O;  4GKJ B;  4CC5 A;  4O4I B;  4R6Z A;  3MAQ A;  3C3T A;  3ZHV A;  1FPO A;  3M7M X;  2JGU A;  2PI4 A;  2B1I A;  2DWE C;  1SQX H;  4H37 A;  4YXW G;  3RYC A;  4N21 A;  1SF9 A;  1JA8 A;  3FB7 C;  2DYR B;  3U0Z A;  2OYQ A;  2V7Q G;  1TGO A;  4MTF A;  2DN9 A;  2VQF O;  1SS3 A;  1XI1 A;  4I50 B;  2QKS A;  4J80 A;  1KP2 A;  1GTO A;  2XAQ A;  4LNU A;  2EIL C;  3TXS A;  4AI8 A;  2FYU H;  1JOY A;  4LF7 B;  3GB7 C;  3RN4 A;  2LFS A;  2PI5 A;  3QO7 A;  5CA0 A;  4UV8 A;  3K57 A;  4DR7 B;  1TVK B;  2LW1 A;  3SGI A;  1S0V A;  2W6J G;  1O9G A;  3UQ8 A;  4B3M O;  1M90 W;  4DV5 B;  2YIB A;  1FYJ A;  3A8T A;  5KX5 A;  4DR1 O;  3G6B A;  3K5N A;  1P4R A;  1KP3 A;  5JH7 A;  1GM9 A;  4WFE A;  4JYB A;  1G1X B;  4GZR B;  4DW1 A;  2F4V B;  1H2N A;  2OWO A;  1VAR A;  1YTF D;  3WU2 Z;  5L3B A;  4K8Z A;  4NXN B;  3ZHR A;  4XDJ A;  2P67 A;  3EXA A;  3L74 H;  4OX9 O;  4B3S B;  1NTK H;  2CK3 G;  2KB1 A;  4LFC B;  3TJT A;  3ZHU A;  2A9H A;  4FFB B;  1M5I A;  2XAF A;  3RBZ A;  1WB7 A;  2DJV A;  2EIL B;  3X2Q C;  3S3W A;  4DR5 B;  4GX5 A;  3ZMS A;  2HKO A;  4NYK A;  2AW9 A;  5LYJ B;  1Q90 D;  3HKB A;  1THZ A;  2OTL V;  4FLV A;  2W0F C;  4YIO A;  1HW7 A;  1BS3 A;  2HFE C;  2VS0 A;  5GTH Z;  1PL4 A;  2W6I G;  3RYH A;  4NKG B;  4CS4 A;  4EFB A;  4KL1 A;  1KC8 W;  2Q6A A;  2QSA A;  1FKA O;  2ADQ B;  1JFF A;  3TGU H;  4QJF B;  4F6R A;  4YJ2 A;  2UUC O;  1H2S B;  4HNA A;  3CCR V;  3QG5 A;  2KKW A;  5IYZ B;  5JQG A;  4JI0 O;  3CP1 A;  4UB8 Z;  1YDX A;  4Q6G A;  3JAR B;  3RYF A;  4QPJ A;  5KAF Z;  2YS8 A;  4LF9 O;  4OPH A;  3ZN0 A;  4MS2 A;  5CA1 A;  1Q3E A;  3JYC A;  2IH1 C;  4B3T B;  4MSW C;  5BXZ A;  4MVU A;  4A5U B;  1KQS U;  3D3Q A;  3BY6 A;  3N2K B;  1N33 O;  2K9P A;  3L71 H;  1R6K A;  3FYI B;  4JI3 B;  4O4L A;  5LGN A;  4J9Y B;  5H5N A;  1BGY H;  5CB4 A;  3DC5 A;  4XBF A;  1BE3 H;  1SZX A;  4TOI A;  3E8H A;  2XAS A;  5L3F A;  4R50 A;  3JAM N;  2IJJ A;  5GW7 A;  1SRY A;  4X20 B;  1P7B A;  4P30 A;  3DSQ A;  4JYA B;  4LF5 O;  3K0D A;  4PA3 A;  4RO2 A;  5FPR A;  2WSS G;  4DO2 A;  4DR4 B;  1DF4 A;  2A3Q A;  1M57 C;  2R72 A;  3CCM V;  1RM1 B;  2CDY A;  4MVR A;  1HNW B;  2PF4 E;  1Z5W A;  1I08 A;  1WP7 A;  3KCX A;  1V55 C;  1GAX A;  4DR2 B;  4FFK A;  5AG2 A;  1UPG A;  5JVD B;  2EIK B;  1ZL8 A;  4X1K A;  5KAI Z;  1OCR C;  1BHA A;  5HFM A;  3IC7 A;  1PV0 A;  2DMX A;  1XHZ A;  1I5X A;  4U3F H;  3ZHS A;  1VQM V;  3ZMU A;  1M93 A;  2K1E A;  4MT8 A;  1GKF A;  1YI2 V;  3JSL A;  4JI1 O;  1G4Y B;  5IYB O;  2JJ1 G;  1URF A;  3AG1 B;  4H13 B;  2WLL A;  4TQF A;  2UXB B;  4ASU G;  1Q82 W;  1N32 B;  3ZX6 A;  4UV9 A;  2JJ2 G;  1NR1 A;  2ZR2 A;  4K8X A;  4W4K A;  2JK5 C;  3E89 A;  4X1I A;  1SA0 B;  3OFN G;  1FJG O;  3CRR A;  2RNB A;  3AK3 A;  1W0K G;  3ICX A;  4JI5 O;  1IBK O;  2X0L A;  4LH6 A;  4PJ0 Z;  1M57 B;  5L3G A;  1ZAU A;  4UVB A;  4UB6 Z;  1SER A;  2GUZ B;  2L6L A;  1MMM A;  5GON A;  2DWD C;  1EN6 A;  4IGG A;  3ZRV A;  3CXC U;  1BMF G;  5JJJ B;  1J5E B;  3HKC B;  1H8H G;  3DXR A;  3K9A A;  1XRE A;  3HKD A;  3RGB A;  5KHG A;  1OCR B;  2RDC A;  1VQ7 V;  5KHI A;  2BE3 A;  2R9A A;  1Q86 W;  3OT7 A;  3E8F A;  3CEI A;  4LH7 A;  5J2U A;  3JCU Z;  3THO A;  3KG2 A;  4JTC B;  5DEC A;  4WBN B;  3SDL A;  1SQG A;  3N2G B;  4JI8 O;  2JS5 A;  3FD9 A;  4QE7 A;  4I4T A;  1NQT A;  5H9C A;  3T4D A;  4BR6 A;  4WFA V;  3JAK A;  3AG3 B;  3BA9 A;  5LP6 C;  1PM9 A;  4JAU A;  4X88 A;  1CP9 A;  3LSQ A;  1XQ8 A;  2MW2 B;  3EHB B;  3L72 H;  4I5S A;  5H6Q A;  1S5J A;  3BFR A;  4MVQ A;  2NLJ C;  1YIJ V;  1DTO A;  3CRA A;  4XDL A;  4IHJ A;  5D5Q A;  2ZD9 A;  4FZ1 A;  2QR4 A;  4KXR A;  5LMN O;  3JAS B;  4TUY B;  2XTA A;  3KCY A;  1BQZ A;  3RT3 C;  4GLX A;  1FXV A;  5ITZ B;  1KD1 W;  3EFF K;  3BAB A;  2QGN A;  5J9P C;  4JI7 O;  1HNX O;  4B08 A;  2P6J A;  2Q67 A;  1ZX3 A;  1HR0 B;  3L75 H;  4DR3 B;  4O2B A;  2IU0 A;  3MD0 A;  2QM8 A;  1D2D A;  2PY5 A;  4DR6 O;  3Q4H A;  1H2K A;  4X1Y A;  4X9Q A;  4U7N A;  2BCC H;  1S76 D;  4GT1 A;  3CD6 V;  4HBN A;  1SC5 B;  2R70 A;  4MTX A;  1N34 O;  4JYY A;  2ZT9 B;  4PI2 A;  5DED A;  5HFL A;  5LP6 B;  1M4U A;  1Y76 B;  4LFB O;  1IBM B;  1OCC C;  3CC4 V;  2CTQ A;  4YHH B;  4LFA O;  4BIU A;  3KKY A;  4JV5 O;  3OTO O;  2ZQM A;  1KMI Z;  1VEW A;  4G28 B;  4K0K B;  1XNQ B;  1DF5 A;  2LGW A;  2Q7H A;  4E4E A;  3H1I H;  1S5H C;  4JGS A;  4J11 A;  4RUF A;  5KLV H;  2V1D A;  3ML0 A;  2CTW A;  4XDK A;  1QNM A;  2IBZ H;  2ARH A;  3ZHQ A;  1K4C C;  2EX3 A;  1K7D A;  4UCU A;  1EFR G;  3J7A U;  5DN6 G;  4I9Q A;  5KMG A;  3SR2 C;  2Q9L A;  1KB9 F;  1NT2 B;  1NI8 A;  5D5P A;  2UUA O;  1ROP A;  4DYL A;  4JAS A;  1NS1 A;  2BTQ B;  1VF6 A;  2YDE A;  3APO A;  3SPI A;  1QR9 A;  5KA6 A;  1BZK A;  3CHX A;  4X62 O;  3UKM A;  1KUQ A;  1ZTE A;  1N8R W;  3TET A;  4X65 O;  1WN7 A;  2GTA A;  4IIJ A;  1US6 A;  1UFI A;  2ILM A;  3B09 A;  1PL0 A;  1MA1 A;  1V54 C;  4PA4 A;  1OCC B;  1FFX A;  1YHQ V;  4CH3 A;  1JJO A;  4UCS A;  4DV2 O;  4LF4 B;  2QWQ B;  4I55 A;  3OD4 A;  1YZB A;  1W59 A;  3HB3 B;  4MW8 A;  5CMU A;  5EBM C;  2Q7G A;  5EBW C;  3CYO A;  5C8Y B;  3K3W A;  1HP8 A;  2DYS B;  4LNU B;  1RPO A;  4P9O A;  1H8E G;  1XMO O;  4DR1 B;  3SYP A;  4FIP C;  1TA8 A;  3RWR D;  1SET A;  3F7Y C;  4J7K A;  1YJN V;  1K73 W;  3JAW B;  1RSO A;  2YIB D;  5FL7 G;  5JCO C;  3A2F A;  3N27 A;  2R9I A;  4NXM O;  4RWU A;  1EBO A;  1N36 B;  4OX9 B;  1YEW A;  5IE9 A;  1JJ2 U;  5JH7 B;  5IT9 N;  2OIE A;  4DV1 O;  5LMU O;  2D3O W;  2A7W A;  3ETG A;  2KG7 B;  3WG7 C;  2P4V A;  3DGE A;  2HHH O;  4NR1 A;  3W7U A;  3WB0 A;  2VWK A;  4DUY B;  4LC1 A;  1VQ4 V;  3JD4 A;  1NJI W;  2UXN A;  3C90 A;  3JAL B;  1E1Q G;  1Y6X A;  5EIB C;  2XND G;  2AHY A;  1LNQ A;  3CB2 A;  3QTC A;  3TCU A;  4ZHQ A;  4F6E A;  4ICG A;  4J10 A;  3CXH F;  3LDE A;  1K8A W;  2ZIO A;  1KBH A;  3QO5 A;  1TUB A;  1QVF U;  1VIB A;  2RCV A;  2Q5Z A;  3OTF A;  4I0X A;  3JAT A;  2AZ0 A;  4YY3 O;  1K92 A;  2X6B A;  2HR3 A;  3OR6 C;  1QHT A;  3RYH B;  4QE9 A;  2DQ0 A;  1W2B U;  1R3L C;  2Y48 A;  4J42 A;  5J2T A;  2UU9 O;  2Q0O C;  2ZIN A;  5KUK A;  3A0B Z;  3FB8 C;  4YJ2 B;  1XL6 A;  4JI4 O;  4FLU A;  1U96 A;  1VF7 A;  2YXH A;  1GN3 A;  1N0N A;  3CWB H;  1KKD A;  2E5L O;  1NTZ H;  5LXT A;  3E22 A;  4JI6 O;  3R66 A;  3WG7 B;  5IJ0 B;  4DV7 B;  5IY5 B;  2C2A A;  3RW0 A;  2ZR3 A;  1HNZ O;  5L3C A;  2XUM A;  3RYF B;  3SPH A;  4FPP A;  4GUN A;  1QR8 A;  3CCE V;  5KA5 A;  2FKX A;  2RQ6 A;  3FAV A;  3UT5 B;  4J7J A;  2P5O A;  3ZMT A;  4ZIB A;  5LA6 A;  2PZS A;  3JSN A;  4GKK B;  4PDL A;  2P06 A;  3CJH B;  3NXS A;  5IWA B;  3AG2 B;  4EB6 A;  1PNM A;  2GTS A;  1VQO V;  3G71 V;  3CME V;  1Y74 B;  4DUZ O;  4Z2W A;  1WA8 B;  4QIW F;  4DV3 B;  3T2M A;  4TV8 A;  1WB8 A;  1YTF B;  1FFT B;  3ABL B;  2WLH A;  1EN4 A;  3D36 C;  4JI2 B;  3ASN C;  4HZ3 A;  3K06 A;  3OAA G;  4BAY A;  1IZ3 A;  4DV6 B;  3HKE A;  1K97 A;  4ZOL B;  1F23 A;  4DXW A;  3G6E V;  3K5M A;  2HP8 A;  3R65 A;  2LFR A;  3OE7 G;  3F7V C;  3K5L A;  3K04 A;  4FLY A;  3CSX A;  3SJQ C;  2M6Y A;  3MHH C;  1GN2 A;  1FXH A;  3JCZ A;  4FLZ A;  1K5Q A;  3ZRX A;  3ABM B;  2QM4 A;  3ZRW A;  1IVS A;  2UXD O;  4KHP B;  2H94 A;  4DV4 O;  4BW5 A;  2UUB O;  1JX9 A;  1QLE C;  4PHZ A;  3SYA A;  1VQ8 V;  2JEX A;  4B7E A;  1EN5 A;  2YEV B;  1I94 B;  5LL6 Y;  1ZUQ A;  1RM1 C;  4TV9 A;  3ABK C;  3ZCC A;  1NU1 H;  4O4I A;  2EBO A;  5LHH A;  2XT9 A;  3BA8 A;  4WF9 V;  5IJ9 B;  3T1H O;  1VQK V;  2EIK C;  1PP9 H;  1NTM H;  3H01 A;  3LDD A;  1OCO C;  3ASN B;  4GKJ O;  4I50 A;  3UCS C;  5BMV B;  1M1K W;  2QTO A;  2EUL A;  4P2Z A;  3G4S V;  1JR9 A;  3ZED A;  1S3J A;  1ENV A;  2V4D A;  3AG1 C;  1R6T A;  3SPG A;  2XOK G;  2ZE7 A;  1SQP H;  1BHB A;  1TVK A;  5FNV B;  1H38 A;  1QLE B;  3OM3 B;  4CH4 A;  4O4H B;  1H2L A;  1SQF A;  4ZI7 B;  2B9Z A;  2XAG A;  4LF7 O;  1PPJ H;  3ABK B;  4CS2 A;  5CA3 A;  5IYD O;  4JTA B;  2RMK B;  4MTO A;  1VQN V;  5LMN B;  2HLD G;  4RQE A;  4PDM A;  4LR3 A;  5LGT A;  4Q20 A;  1QVG U;  4DV5 O;  2BSK B;  3FX7 A;  1WPX A;  3H1H H;  4YJ3 B;  1OCO B;  2CTR A;  4CH6 A;  4BIZ A;  4PDR A;  5K1P A;  2QA4 V;  1L0L H;  4IHJ B;  3ZMV A;  4DV0 B;  5C93 A;  3A0H Z;  4FFB A;  1AI5 A;  3HPL C;  4PI0 A;  3QNE A;  3JD1 A;  4UUJ C;  2ZM6 B;  2F4V O;  1M9N A;  1OV9 A;  4N23 A;  1K9M W;  3BCC H;  2IH3 C;  5LYJ A;  1VQP V;  3QO8 A;  4X8A A;  1OHH G;  3S3X A;  3AG3 C;  4LFB B;  4LFC O;  3VQV A;  2QE7 G;  1JQ0 A;  1DK1 A;  2FML A;  4Z1V A;  4DR5 O;  1VQ5 V;  5L3E A;  4GYC B;  4H33 A;  4BIO A;  3B4S A;  4O2A B;  4KP4 A;  2QJ1 A;  1XNR B;  2YIA A;  2YI9 A;  2CH7 A;  3A0R A;  5B66 Z;  5KHK A;  1Q6I A;  3LNN A;  1S77 D;  2WPD G;  3I56 V;  1FD9 A;  2EZO A;  4ABM A;  3G67 A;  2P7T C;  1R3K C;  3JAR A;  3K59 A;  3VQW A;  1MZF A;  3FYE B;  4KFM A;  2X6C A;  1MAB G;  2NR5 A;  1R6N A;  2EJ7 A;  3N2K A;  5H2F Z;  2HEP A;  2JVD A;  3K5O A;  1COW G;  1Q7Y W;  4P9P A;  1B3Q A;  4X89 A;  3BEH A;  4PD4 F;  4I9W A;  4JTD B;  2UXC B;  2WA4 A;  3GWK C;  2CTP A;  3BAA A;  2ZNJ A;  2CGO A;  4X20 A;  1X59 A;  4DRX B;  1D5A A;  4B3T O;  3ABT A;  1O9H A;  2GBO A;  5EYP B;  1Z2G A;  3IGA C;  4CC6 A;  4LWS B;  3NR7 A;  2EIJ B;  4JI3 O;  1PNK A;  2RJZ A;  1AI6 A;  5B1B C;  3CS5 A;  3ZJZ A;  1Q5O A;  2FB5 A;  3ZS8 C;  1L0N H;  4FLX A;  4JZG A;  1DLB A;  3CRC A;  5CBF A;  1U97 A;  4JYA O;  5JVD A;  1F7Y A;  2OCC C;  3J81 N;  2OTJ V;  4L8J A;  4FJC C;  1XMQ B;  1Y4M A;  4DR4 O;  1Q8I A;  4X64 B;  3LNM B;  1Z5V A;  3K58 A;  4RAI A;  3T1Y B;  5BR8 B;  1HNW O;  2QWO B;  3STL C;  4LBE C;  1IBL B;  1XUQ A;  4DR2 O;  1QCE A;  3I5D A;  5CBH A;  2EIN C;  1MSW D;  5LOV B;  3CPW U;  2OIG A;  2YIC A;  3RVY A;  3LSS A;  4DV1 B;  4IT5 A;  1TAE A;  1WAZ A;  5F2V O;  4LF8 B;  1NH2 D;  1M56 B;  4B3R B;  1RSO B;  1V9P A;  2N05 A;  1R3I C;  5CBG A;  1VP7 A;  2LGQ A;  1SA0 A;  3ZBH A;  4TWK A;  3DTU B;  1JVM A;  2BOC C;  3AK1 A;  1XL4 A;  2VQE B;  3CCS V;  2UXB O;  1N32 O;  4GCZ A;  1FAF A;  5B1B B;  4GX1 A;  5BZB A;  2GUZ A;  3E83 A;  1AR4 A;  2DYS C;  4WCE V;  1SZT A;  3CC7 V;  2X6A A;  2OCH A;  2EZP A;  4AQY B;  2M7W A;  2OCC B;  1YIT V;  2WLK A;  1EZJ A;  1TUE B;  4OGQ B;  4U3J B;  4CBC A;  5LBQ A;  2QEX V;  3TK1 A;  2WLI B;  3ETE A;  1FXK B;  4GX0 A;  3L73 H;  3HR0 A;  5H6R A;  4QPK A;  4O4J B;  4WBN A;  2KQX A;  5LHI A;  3N2G A;  2EIN B;  2PUS A;  3CCU V;  1Q81 W;  2P4K A;  2VQF B;  4NTY A;  2QM7 A;  2F93 B;  3ZN1 A;  2ZKO A;  2AHZ A;  3RYC B;  1FS0 G;  1K33 A;  3OUF A;  4OXS A;  4G27 B;  3IJ4 A;  3ASO C;  1GO3 F;  3P3N A;  4UCO A;  1WPB A;  4B3M B;  4GX2 A;  5FPO A;  1YVW A;  1BL8 A;  1QU7 A;  3MHS C;  2XHB A;  4MTG A;  1ZWI C;  3JAS A;  1YJW V;  5B5E Z;  3M8A A;  5EC2 C;  2ITD C;  5CA0 B;  5ITZ A;  3FAV B;  1S72 V;  3UO3 A;  4WFB V;  1AIL A;  3L9D A;  3OGC C;  5KX5 B;  3UO2 A;  2Z5U A;  4QNH B;  1B06 A;  4UCV A;  4RQF A;  5FLX N;  2NNU A;  3MDS A;  3OEE G;  4TSF G;  5B1A C;  2PTM A;  3P3P A;  2N04 A;  2ITC C;  1KEC A;  1LUW A;  1P7G A;  2GHY A;  2Q73 A;  2ZE5 A;  3RYI A;  5LP6 A;  2RN9 A;  5IY5 C;  1BCC H;  1HR0 O;  1Y76 A;  2WWW A;  4TV8 B;  1WLE A;  2JIZ G;  2YXL A;  1GMG A;  2FTK A;  2Y69 C;  3ASO B;  2WAM A;  2AGA A;  4DV4 B;  1GN4 A;  1RFY A;  3HKE B;  1KKC A;  3W7T A;  2X7R B;  1GM7 A;  1NVP D;  4FK5 C;  3K08 A;  3AG2 C;  3LUT B;  2ZCE A;  3H1K H;  2UUC B;  5DM6 V;  1IBM O;  1QQC A;  4MVZ A;  2F43 G;  3HKB B;  4YHH O;  2WA3 A;  2WLN A;  4JI0 B;  1Q6H A;  1VQ9 V;  3W7W A;  4LCU C;  1GM8 A;  3W7X A;  3SYC A;  3T1H B;  2Z0A A;  2AZ2 A;  3IFX A;  2QTS A;  1WJZ A;  4E2L A;  4K0K O;  1XNQ O;  1QLN A;  3DC6 A;  3RFR A;  3W7S A;  4DW0 A;  3B8N A;  3BPZ A;  3JD2 A;  2MK3 A;  1JFF B;  3AK2 A;  4F6R B;  3ABL C;  4HNA B;  4LF9 B;  4TV9 B;  1JPX A;  3CCL V;  4JZ2 A;  5B1A B;  1YJ9 V;  2BTQ A;  4LF6 O;  1A32 A;  4K3A A;  5JQG B;  1AJP A;  2GDS A;  2JEU A;  1N33 B;  4MVM A;  2IJK A;  1MG1 A;  1SKV A;  3BRC A;  4MW3 A;  4H0L B;  1NZ6 A;  3L70 H;  1JMK C;  5KUM A;  1MOF A;  4J9Z B;  1AVM A;  3B77 A;  3B40 A;  2Y69 B;  3ABM C;  5CA1 B;  1OCZ B;  2ADP A;  4G2K A;  4LF5 B;  3CCQ V;  1YSC A;  3CRM A;  1AR5 A;  5C8Y A;  4MVS A;  2H3O A;  4J41 A;  1I7F A;  4J7Z A;  4O4L B;  1RP3 B;  3CCV V;  3ETD A;  2XAJ A;  3K9S A;  5CB4 B;  1X4T A;  4QGP A;  5EIB D;  3OR7 C;  4LF4 O;  2IJI A;  4RUE A;  2O57 A;  2WLM A;  3D3I A;  2ZIM A;  3JAW A;  2ETN A;  3E2E A;  1DGS A;  2LJ2 A;  3U10 A;  3KZI Z;  1AR1 B;  2ODM A;  1XOU A;  4IL6 Z;  1F4M A;  3QVN A;  1NKD A;  4TQD A;  2IJH A;  4HAM A;  2KG7 A;  1H2G A;  4MVO A;  4PV1 B;  1VQ6 V;  1PNL A;  5EZY A;  4JI1 B;  3AG7 A;  4FM0 A;  3RVZ A;  1ZL8 B;  4X1K B;  2DQ3 A;  2JGD A;  1N36 O;  2PYJ A;  2EJR A;  3JAL A;  2E74 B;  2YC0 A;  1FJG B;  1B6Q A;  1KYO F;  1JCH A;  2DOS A;  3CRQ A;  3STZ C;  3E8B A;  4JPR A;  4JI5 B;  1IBK B;  3LDC A;  4CS3 A;  4NVP A;  2PGG A;  2B5U A;  2WLL B;  4DUY O;  1NBM G;  2F66 C;  2L35 A;  2Q4P A;  4F4L A;  4FLW A;  3WB2 A;  2NN4 A;  1XIL A;  4KUM A;  4X1I B;  5EBL C;  5JCO A;  1CPY A;  3P30 A;  4X66 O;  3OW2 U;  5IDJ A;  2YI8 A;  2QWN B;  3VBB A;  2Y4T A;  2CH7 B;  5GON B;  2ZE6 A;  2H8P C;  1Y66 A;  3FB5 C;  2CUG A;  1YCI A;  1CEZ A;  5IJ0 A;  2G38 A;  3E8G A;  4DK0 A;  4JI8 B;  3DXR B;  3FB6 C;  3HKD B;  1W0J G;  3EVK A;  3E35 A;  4AIL C;  2E3C A;  4NB5 A;  4PA6 A;  2CE4 A;  3UT5 A;  5J2U B;  3CMA V;  1IX9 A;  2Y4U A;  4U7O A;  2E75 B;  3CJH A;  1MSD A;  3X2Q B;  2QKC A;  4DV7 O;  4D7S A;  4NTW A;  1Q43 A;  4I4T B;  1B04 A;  4FVM A;  2HJD A;  3K03 A;  3JAK B;  1Y74 A;  2QWP B;  1SQQ H;  1GN6 A;  1WP8 A;  3CCJ V;  1WA8 A; 
#chains in the Genus database with same CATH homology
 4I0X A;  3O9O A;  2AZ0 A;  3Q4H A;  3G80 A;  3GVM A;  2VS0 A;  3TXS A;  2AZ2 A;  3TXQ A;  2DE0 X;  2B9Z A;  3HR0 A;  4LWS B;  4ABM A;  3FAV B;  3FD9 A;  3OGI B;  2KG7 B;  4LWS A;  3GWK C;  3FAV A;  2KG7 A;  1WA8 B;  4I0X B;  1WA8 A;  4GZR B;  3ZBH A;  3Q4H B;  2VRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...