2VSMB

Nipah virus attachment glycoprotein in complex with human cell surface receptor ephrinb2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
137
Chain Sequence
b'IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMAGGLUTININ-NEURAMINIDASE
publication title Structural Basis of Nipah and Hendra Virus Attachment to Their Cell-Surface Receptor Ephrin-B2
pubmed doi rcsb
source organism Nipah virus
molecule tags Hydrolase
total genus 27
structure length 137
sequence length 140
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vsmB00
4N4YB 1WS8A 2FNWA 3IN0A 2FWLB 2HRHA 2XYBA 3AW5A 1I53A 1JZFA 2ZONA 4NERA 1BXUA 1NZRA 1A8ZA 1ET7A 2GC7C 2IWEA 3BQVA 5B7EA 2HLEB 2XU9A 2DYSB 2FQEA 1M56B 3PAZA 3S3CB 3OMAB 2GC4C 1AZUA 2PPDA 2FJSA 4DP0X 2EIMB 3GDCA 4KO7A 3SBPA 3CVBA 5B3SB 2VW7A 3JT2A 4DP9X 2JXMA 1BQRA 3CDZB 4KNSA 1JZGA 3NSYA 1OOWA 2CALA 1DYZA 1E30A 1J9SA 2B3IA 1GS7A 1SF3A 2CAKA 3AG2B 3FSZA 3SBRA 1WA0X 1NIFA 1V55B 2HX9A 1ET8A 1NPJA 4DP8X 4G7RB 1N68A 2XX1A 1CYWA 4BWTA 3UABA 2W8CA 1PAZA 4PCYA 1ASQA 1CUOA 4HALA 3QJUB 4G72B 2W88A 1WS7A 2QT6A 3PXLA 3FQ1A 1OF0A 3UADA 1OV8A 4DP1X 2DV6A 3X1EA 4YSEA 3PPSA 1ZIBA 3FT0A 2PP9A 1ILSA 3OQRA 1ZDSA 3PLYA 1AQ8A 1BQKA 1JVOA 1PZBA 2HX8A 2OJ1A 2FQFA 1OCRB 4E9SA 2XVBA 3ABMB 3DTUB 2EIKB 4GP5B 4HCFA 1PZAA 1IBZA 1HAWA 2AVFA 4KO9A 2BP8A 4EF3A 5I5IA 2R7EB 4W1TA 5I6KA 3FYIB 2CBPA 2EILB 4P5RA 1KCBA 2FT8A 1ADWA 4QKTA 1XMEB 1EZLA 4PAZA 3EHBB 1QNIA 4WKXA 1A4BA 3WIAA 1KYAA 1OE3A 3FU9A 5AKRA 1VLXA 4KOBA 1QLEB 4YSDA 6PAZA 4FA7B 1W6WA 2OV0A 1JERA 2FTAA 3TBCA 4A2EA 1TKWA 4KO6A 2PP8A 3CDZA 3WG7B 3UGEA 4CSZA 4YSCA 1SNRA 4YSUA 4QLWA 1L9OA 1GW0A 5B1BB 1AZBA 4Q8BA 4FAAB 2JKWA 1T5KA 3ABGA 3NJGA 3NSFA 3V9EA 1A3ZA 5B7FA 4BWWA 4YSSA 1A4CA 1M9WA 3QQXA 4NAJA 3QJQB 1V54B 2XWZA 2A3TA 1CURA 2NRDA 1ASOA 1AANA 4GP8B 4RH4A 3KW8A 3TBBA 3L45A 1NPNA 1AOZA 4P5SA 2BP8B 3IE9A 4AKQA 2X88A 1AG6A 3WI9A 5I6MA 2UXGA 4CSPA 2HXAA 4KNTA 5I6PA 2ZXWB 2YQBA 4A2DA 1J5DA 3UACA 2PCYA 5PAZA 2FQGA 5ANHA 1EHKB 3T6VA 4YVNA 3RYMA 2XXFA 2OCCB 2BW5A 4JHVA 3HEIB 1JXDA 1GYCA 1BXAA 4YVUA 3NP4A 4DPAX 3AG4B 2YAHA 2GBAA 3IN2A 2BO0A 3NJJA 3NSDA 3CVDA 3NT0A 4JKNA 2GI0A 4N8UA 4E9TA 2WO2B 2Y1AA 1ZDQA 1IUZA 2VW4A 1DZ0A 3FU8A 3N2JA 1BQ5A 2QPDB 1L9RA 1RCYA 1NIAA 5D4JA 2CCWA 2R7EA 3FPXA 4KO5A 1WA2X 3U25A 1AS7A 4HAKA 4MFHA 3D12B 3G5WA 1AZCA 4KOCA 2IWKA 2YAPA 1SHWA 2YARA 2I7OA 4M4RB 5B1JA 2PPAA 4YSRA 2BP0A 3CZUB 1A65A 2HZHA 4JHUA 3FPYA 2PPFA 5B1JC 2PPEA 4YSTA 1OCCB 2VSKB 4TXVB 2IH8A 3CG8A 4YSQA 2J56A 1X9RA 3CVCA 2UXTA 2IH9A 3UAEA 1AACA 1NICA 3NJMA 3FSVA 4HHGA 3T6XA 5I5MA 2I85A 2VW6A 5A7EA 1F56A 4DP7X 5F7BA 2XLLA 1B3IA 3EH4B 4GP4B 3H4FA 1PZCA 2QDVA 4AI7A 1BEXA 1L9SA 1GS6X 3AY2A 3OMIB 4A67A 4G71B 4AX3A 2UX6A 3AG1B 1NINA 2ZOOA 3PAUA 5I28A 1AAJA 3X2QB 5LDUA 3WNIA 1PF3A 1SFDA 1KBWA 1MG3C 5F7AA 5D4IA 3QJTB 7PCYA 3GXUB 3H4HA 3X1FA 3FSAA 3EH5B 2XV0A 2AZUA 3GYRA 1RKRA 1ZPUA 1A4AA 3NJIA 1J5CA 4HCIA 1IC0A 2TSBA 1GY1A 3OMNB 1AG0A 3NJKA 3EF4A 2BP0B 2PLTA 2PPCA 1SF5A 4KNUA 1L9PA 3NSCA 1PMYA 2IDQA 1E65A 4F2EA 1SJMA 4UANA 4F2FA 1HAUA 1JVLA 2VSMB 3ZIYA 2YAOA 1ET5A 3PAVA 1GS8A 1ZV2A 1X9UA 4BXSV 5D4HA 2XX0A 4E9VA 3S3DB 2B08A 4DP6X 2ZWNA 1OCZB 4UAHA 3V9CA 1JZJA 3S8GB 2AANA 3MBWB 1AS8A 2X87A 4DP2X 3ERXA 4WTQA 1FA4A 1ZIAA 4ZK8A 1JOIA 1KCWA 4G70B 2VMJA 2XUWA 1URIA 2FQDA 1L9QA 1ID2A 2YXWA 4A68A 4G7SB 4AKOA 1BXVA 3BVDB 4BDVB 5I6OA 3X1GA 3SQRA 3ZBMA 2IDTA 2J57A 1PNDA 1QHQA 5AZUA 1KGYE 3N55A 4X4KA 2BZ7A 4E9YA 3FU7A 1JZIA 4AZUA 5I26A 4DPCX 4HIPA 4YSPA 4BWUA 2YXVA 3SBQA 2XV2A 4E9RA 2E86A 1OE1A 1PLAA 2HX7A 4K9JA 5EHFA 3HB3B 1GR7A 2J5WA 3OM3B 1M57B 2HRGA 2EIJB 3FQYA 4A66A 4ENZA 3TA4D 2XXGA 2GB2A 2H47C 1E5YA 1BYPA 1CYXA 3QJSB 1AZNA 1J9TA 3PCYA 1FWXA 3ASOB 4YL4A 2WO3B 3S3BB 1CC3A 2BHFA 5B7MA 1GY2A 1V10A 4A2GA 1BYOA 1SDDA 2CJ3A 1GSKA 2XV3A 1SFHA 4Q89A 1J9QA 3DIVA 4UF7C 5I6LA 3X1BA 2H5UA 1R1CA 1IBYA 4BXVA 5B1KA 2MTAA 2WSDA 3AZUA 3H56A 3EH3B 2GIMA 2AFNA 1NIEA 4HZ1A 4YSAA 2UX7A 1NTDA 1YLBB 2N0MA 2YAFA 4HHWA 2QDWA 2BW4A 1UATA 4E9XA 4W9ZA 1JZEA 1RZPA 3FU7B 1W8EA 2IDFA 2YAQA 2IWFA 3S8FB 3QJRB 4DPBX 3C75A 4HCGA 2VN3A 5B1AB 4BK5C 2YAMA 3FYEB 1MZYA 8PAZA 2I7SA 2CUAA 3IBOA 3FQ2A 1KDJA 1AIZA 1RZQA 3IEAA 5TK2A 3T71A 3T6ZA 1AR1B 2VM3A 2FT6A 4BDVA 1PLCA 1WA1X 3WKQA 4DP5X 2IAAC 3ABKB 5E9NA 4GY4A 1AS6A 2IDSA 3NYKA 1OCOB 1ASPA 3FSWA 1KV7A 1NWOA 1PY0A 1SDDB 4GYBA 2DYRB 3AG3B 3UAAA 1OE2A 2P80D 3OD3A 9PCYA 1NDTA 1JZHA 1ETJA 2H3XC 1TU2A 2J55A 1MDAA 2IDUA 3KW7A 2YAEA 2VM4A 2BWDA 1XB6A 3NJHA 4GXFA 2UXFA 2AZAA 3WNJA 3TASA 1PCSA 1BAWA 1TEGA 3NJNA 2Q5BA 2DY2A 1NWPA 2MRYA 2RACA 2TSAA 4A2HA 2P80A 4E9WA 1KDIA 1L9TA 3NJLA 1JXGA 1N70A 2FT7A 5I5JA 5IY5B 4E9QA 1IKOP 2GHZA 3DKHA 1AZRA 4L0PB 1MG2C 2GSMB 4DP4X 2DWSA 2BWIA 1WAEA 1FFTB 1MZZA 2EINB 4M3HA 3WKPA 2PP7A 3QJVB 2Y69B 4NB7A 2QPEB 1PNCA 3ZDWA 5AFAA 1XB8A 1XB3A 5I6NA 1E67A 2BZCA 3MX0B 3TU6A 5PCYA 3ASNB 3NJFA 2LLNA 3T6WA 3X1NA 7PAZA 5FC9A 1KBVA 3FS9A 2UXVA 1ILUA 2Q9OA 3ZX1A 4YSOA 2PCFA 1NIBA 1E5ZA 1NIDA 3T9WA 4F7KA 6PCYA 1W6LA 1J9RA 4A2FA 3NP3A 5TK4A 4AKPA 1HFUA 3QPKA 2JFCA 2DWTA 3ABLB 1JXFA 1TEFA 4G7QB 1PLBA 3JTBA 1SHXA
chains in the Genus database with same CATH superfamily
2EDRA 4BZ2L 1JPST 5FA3B 1Q0XL 4XAWL 3IETA 2HRHA 3MLSL 1FBIL 2WWKO 1CICD 4QTFA 1JZFA 5IKCB 4HKJA 5C2UB 3FQRA 5FYKE 4PM1A 1AKJB 1OOAA 2M1KA 1TYRA 1LYQA 3GSQB 5F7MC 5KANG 1MWAL 3T77A 5E2VL 1FSKB 1I1RA 2PPDA 1R17A 4JM4H 4PH8A 3WSQH 5F9WB 4WSGA 1NEUA 3L08A 2HKHL 1MFVA 2ADJA 1DLFH 2FH8A 2VW7A 2I27N 3JT2A 3ZZQA 1GGIL 3B2UD 3EHBD 1XMWA 4IRJB 2D8KA 4TUOA 4XC3L 5CEXB 3R7QA 5G4OA 4Y5YC 3OKMA 1IEBA 2H3NA 1K8DB 1U4EA 4FFWC 4ZFQA 2QTVA 4PJEE 4PJ6A 5D7LD 1FPTL 4GKZB 4DWHA 5J6HB 2MHAB 1I1AD 4PJ5D 3ZMNA 1LXMA 1FFRA 1XL6A 3QQ9D 3VDAA 4B50A 1Y18B 3FUNA 2YD4A 3ESMA 3GHEH 2NZ9D 5L4IA 2EYSA 4OJEH 3DJ9A 1JRHI 5DHDA 4AWJC 3P73B 1AQDA 4F7PA 2XT1B 4BA0A 1OP4A 3CQFA 1GCYA 1U95A 2Z3FA 3BKJL 4N5UA 4P3DB 1IFHL 5LKNA 1J0JA 4QTHA 2HWZH 2GCYA 1N12A 3SE8L 3PP3H 1T20A 4OZIB 4DGVH 4JW3A 4UM8A 5D2LE 1IAMA 5KN5B 1QRND 3K81A 4GO9A 4R8WL 5KOMC 1L3NA 4R0LC 5AAMA 2D2CC 4HJJL 4H26A 1PY4A 3EO9H 4NOFA 2BIIA 5IF0A 5GJTL 3QFJE 2OSXA 3ARED 1YJDC 3IS1X 3QIUC 3VH8G 5CD3A 3QB7C 1C5CH 4OZGE 3FO2B 2WLJA 1P4BH 4JQIL 3B7UX 3GRWL 4YR6B 2JLPA 3L9BA 4JM2A 1QBLL 1SDAB 4Y5YB 3NZ8A 2F7QA 3DBSA 3OKDA 3SDYH 3SODB 4R5VA 2EDDA 5EU6A 3TBYA 4N86A 2RB8A 1N64H 1UA6H 2EZ0C 2JB5L 1MCIA 1KTCA 2F5BH 3NA9H 4PU2A 1HKFA 1E4WH 2ILLA 3ZDZB 3GPSA 5HHOE 4J3XA 2GTQA 1XMEB 3SN6N 5HHQB 3JBG7 4R7NB 3QJHA 4ZXBC 5EO0A 2WSPA 3BHBA 5AKRA 5BZXA 2W9DH 1AQKL 1RJZA 3GDBA 3ZL2A 4ABUA 5IW3A 1AH1A 3OZLA 1XL4A 4QYAA 5F7EL 1BIIA 4NN6C 1QSFB 1JGUH 1GL4B 1INDH 4WFHD 3KEDA 4N22A 3WE1A 5IREA 4R0LB 1X9LA 4U1SA 4QHPA 4N2EA 2JELH 4HZLA 4QLWA 3QIUB 5EF2A 3KVPA 3O6FB 1CQYA 3B43A 4EI6B 5KG9A 4HAGA 3II2A 1CDCA 4P2CG 3ULVL 1MFCH 4AYDC 1UOKA 2H1LM 3QJQB 3DOHA 2ZKWA 2VDKH 1TTFA 4HIQA 1D5RA 4PGCB 1DSWA 3HLAB 1DQTA 2Z9TA 2P45B 3SGJC 1QA9B 1TZHA 1JZ5A 5JHLA 3KWWA 5IR1A 5I8KL 3GBNL 4HUCA 5E24E 2F19L 3IE9A 3DPBA 2XC8A 4PJCB 2VITA 1YMMD 2OJZH 4BHUA 1YJDH 3TO2B 4G8FB 5ETUB 1OTTC 1MQKH 3BZFB 4P23B 4Z7QE 5C6TL 3VGBA 4ZXBB 3GTTA 3INOA 5PAZA 1ITCA 4LDCA 1A7PL 2DMHA 1D9KA 2W80C 4JFZL 4LCWA 4HFWB 1KB5L 3KPNA 2XNAB 3MRFB 3EJCA 2NCEA 5GS3A 4WVRA 2F18A 3WUWB 3HZYA 2WOYA 2X42A 3QNZB 1FO0L 2HRLA 3K2MC 1UWFA 1WE5A 2Q7AA 4A6YH 3S36H 1LNUA 5GZOD 6CGTA 3RWFB 5JPMC 2WOBA 3Q48A 1OKEA 3KS0H 1ZJBA 3MZGB 1RFDH 3FU8A 3UJJL 1G94A 3BUYA 1KYOJ 4KPHH 3W1ZA 4LKCA 5IOPA 4TNWK 3MREA 2BMKB 2HN7B 1U8NB 3TA3B 1OK0A 3U25A 4WHYG 1E40A 3BQUD 3IDMA 2N1KA 4WTZG 4L3AA 2UZXB 1OLLA 3HPLB 2NY2C 1XF5B 2X4UA 3GINA 5DZAA 2HZHA 4IOFC 4O9HL 4PRDA 4MAZA 4QXWA 1A9VA 1YPZF 2IPTH 2P46B 2GT9B 2YOAA 4HH8A 1BYNA 2A4CA 4QNPE 2J56A 1X9RA 4P48A 2ZPKH 1NGYA 1T1ZA 4L4TB 2CSPA 3V10A 3QXAA 2YSTA 4JRXA 1WJ3A 5HGHA 5ILTL 5EIIA 1VCAA 5A2AA 3T6XA 2O5XL 4NO0A 2I85A 3QAQA 1L3WA 4XP6H 5CP7A 5LNEA 4LDEB 4QTIH 5DRWB 4Q58C 3F6IA 2VE6B 2VT0A 2FD6H 2CGZA 2I07A 1L9SA 4Z9KB 4HKBB 1CT8B 1S9VB 2BS9A 3HNVH 3QZWA 4P2QB 1NM9A 3AG1B 4GXVH 5I18L 1H3GA 3V6BR 5F6IC 3P3SA 2DF3A 3ARXA 5IVZB 2WXFA 4NKMB 3CLEL 1UCBL 2Z34A 3WO4B 1CGYA 1CI5A 1IBFA 5E0QA 2JKTM 2FO8A 1D2PA 5FEBA 1W0WA 4L4VD 7PCYA 3GXUB 4X8JA 2OX5B 3L2NA 3FZUC 2HFEA 4HZAA 3IDGA 2H6OA 4R3SA 4ILDA 4HJUA 5JW4Q 5MEPA 1IAKA 1L4IA 1P2CA 4GS7C 1G0DA 3MJ9A 3HFMH 4LVEA 4QOKD 1AGBB 1SQ2N 4G6JH 1WK0A 2NY2B 2COQA 1NKOA 1BFTA 2D31B 4HX1A 4MDJB 4F3FA 4LASL 1YEHH 1U58A 2D2OA 3DV6A 2C7UB 4LSUH 3RFZC 5EIVA 4O02H 4ZUTA 2IDQA 1B88A 5KJ4A 1FL3B 2HJFB 5IM7B 5GS0D 2ENJA 2IBZY 3CZFB 3PAVA 1P7QA 3L54A 4G1MB 4AZ8A 3REVA 3Q05A 4YNYA 2FBJH 3JQOB 3D30A 3V9CA 1Q9LA 4YK4C 4NXKA 5FDWA 3G6JF 1IQWH 1VZGA 3FO1A 5F6IB 2XWCA 4GEJA 4X7DC 4BUHA 1T83C 4HDIA 3WXWH 2KDGA 1VERA 2TAAA 1JI2A 1HIML 5ENWB 5L2KD 4LVOC 4NHCL 1MJJB 3E6FA 5EZOH 4LCVA 4GW1B 3WFEL 4J4PC 4HUWB 1E6OH 2EXWC 2YXWA 1CS6A 3TNNA 3V0IA 1H5BC 1I31A 2QQKH 3CU7A 3PWJB 4XB7A 3WIIL 1ZMYA 4OIIL 4CL7A 3U4AA 2DQCH 1ZLVH 3VGDA 3IAGC 1RZIB 3C2SA 3O2DL 4OGAC 4CN6A 4PGZA 1ZOXA 3F7YA 1KIRB 4F1ZA 3RFZB 3TN0A 1EXUB 1IC4L 1WAPA 2KDYA 3UCRA 4LXFA 4NHUA 4HIPA 3DI2B 3W9EB 5T1DH 3SBQA 4BFOA 3JV4B 3CH1B 5E7BA 5IBUG 2D7PA 3BMWA 3ROOA 3T1FA 4F33B 2A9AA 3QA3B 5IHZB 3MYJB 3H0TA 1FNAA 4DESA 4M7LL 4MA1C 3DYOA 4Y4HC 3Q7JA 1AMXA 2HYMA 2BNQB 4RDBA 4PV1C 1OP9A 4YE4L 4IGBB 4MB3A 3V79C 4YK4B 2X0UA 4GAYB 3AUVA 2GY5A 2G2RB 5L9DL 3D85D 4R7LA 3EOBB 3L4ZA 3P30H 4Z7VA 2G3MA 4G8EA 1DQVA 2ARJQ 4FKKA 1DQKA 1V10A 4LVOB 2Y1YA 5H37H 1P1VA 2XN9B 3UYOD 4I88A 2ZJSL 3GSUB 4RRPM 1AC6A 2R0LH 3RBSA 4CBZA 2OL3L 3H85A 4OM0H 4U3XA 1UXMA 5F3FA 4PJ9B 4XN7A 2WXKA 2ZUTA 3UJIL 4WWOA 2X4RA 3BUIA 3X1BA 2PUQT 2Y7NA 3WL9A 1V7MH 2FO1A 4XPGH 7FABH 5K93A 4Q4EA 1F3JB 5SV4A 2XZQH 4G8AC 3H3BC 2XI9A 1NIEA 3ETTA 1MUJA 2GFBB 3P0VH 4EDXB 3ULUL 2ZD0A 1R5VB 2QDWA 5DZVA 1UOLA 1XO8A 2IV8A 2OW7A 4GSDH 4E9XA 4YFEA 5EUOA 5GSVB 2X89A 3HI5L 2D9QB 3VRLF 3FTGA 1CDIA 1VFAA 5KVDL 3ET9F 1A22B 1RK1A 2QEJA 1TETL 2HTLC 4JFEB 3K6IA 3S8FB 3QJRB 1X6LA 3KPPA 2CM6A 3C75A 4KTYA 4MA1B 2YD0A 2R27A 1AFVH 5DURD 1CGSL 5F8RC 3L17A 1RK7A 3VWKA 4TN9A 3OKKA 3C6LC 2QVTA 2O5YH 1A47A 4NIKB 3P3YA 2NXYB 5I1GH 1QLRA 3G6DL 4LU5H 3QNYB 5CJXA 1MY7A 1UWXH 2X7LA 3EBGA 5MENB 4H40A 1R5WA 3DMMC 1KV7A 3UXFA 3MGOB 2WXLA 1CIDA 1NCCH 1QMUA 3QUYA 2GQHA 4YBHA 2NY1D 4OM1L 4JS7A 5AZ2L 1YNLL 4O5LL 4AMWA 2BFGA 2VDLB 5CKGA 4KZ0A 1EIBA 1LEKA 2GTWA 4N0FA 1ETJA 4Y8AA 5DJDB 5TDNA 3KPSB 3T4AA 2Y1ZA 5DJAB 5HJBA 4CC4A 5D70H 1H8SA 1MDAA 1HL9A 2IDUA 3E1ZA 5ADPH 1YNKH 1FFPA 4J3OF 1IC5L 2UY7A 4YDIL 2EIEA 2Z35B 3QCVL 1DO5A 3W9DB 3IGFA 5HYJE 2ZKXA 3L13A 4X9FA 4NPJA 4JMNA 5BO1L 4G6KH 4GG6E 3D2TA 2MCPH 2ICEA 3QUXD 3RIAF 1DBKH 3DO7B 3NJLA 1I7RA 4U7KA 4XPAL 3NUKA 1QD0A 1ACZA 2V7HB 2W0FB 5IBTH 1PG7H 5DU7A 4N2FA 4ONFH 3UJTH 1BM3L 3K0WA 3EJPA 3RWDA 2XTJE 3T3MB 1E9QA 2F58H 4JHWH 4Y9FA 2NYYD 2WWMC 1CU4L 5KUMA 1UH2A 2VUOA 5JR1H 2Y69B 5I1KL 3VD3A 1LDSA 2O5ZL 1JWMA 4L9DA 4K5OA 1EFXA 3DMMB 1EA9C 4XH2B 3T3PB 5BV7L 3OX8B 3QHFL 3DK0A 5PCYA 1EVUA 4ES9A 3VDCA 4BHUI 3D39B 4GG8B 4KKAC 4U1MB 1EK3A 3DYPA 4AJWA 4GH7B 2Q76A 4R90H 3PABA 1T6WA 3I9GH 2EDWA 3KLQA 3GLEA 3NP3A 3EH1A 3IJ8A 4UB0L 4PV8B 1D6VH 2W60A 3DRTB 1P6FA 3UG5A 4JPIA 2AXWA 4MYWB 5ICUA 5I1AA 2WINA 3BD5A 5ACMA 5M94B 1PFOA 1LP9F 3ZKND 4OB5L 2FNWA 3FRPA 3VNZA 4AEIH 2HFTA 2QQNL 4NPYA 1AE6L 3BVNA 2CD0A 1JUFB 3ATAA 5CJQH 4PRIE 5L8JB 5TQ2H 5LUMA 5DUJA 4N3TA 3RTQB 1IGCH 2Z7ZA 3BJ91 3BQVA 2HLAB 4FQIH 4OF0A 4QPEA 5IG7B 5AD0B 3MC0A 4TUKL 3DARA 2ATPA 4PTUB 1RERA 1PZSA 5GRXG 2NNRA 4KK8C 1FIGL 3ZMEA 2V5RA 3F58H 4XC1L 2FBRA 3GDCA 3EADA 5B3SB 5E8OA 2CHDA 3C60C 1WHPA 3CSYB 1FNSL 4KNSA 3EJQA 2FX8H 5E8PA 1VACB 5FKPB 1HZHL 4X7TB 4XPBL 4AL8L 5GJSL 2C3GA 2HAZA 2K9UA 3GEWB 4G8IA 1E30A 2X40A 4YMPA 3LZFL 4DKAA 1N19A 1T21B 4X4ME 1AXIB 2Q8AL 3N91A 2AK1H 4HUUA 2F6AA 2X6AA 1WA0X 4PJ7E 1MCCA 5JORA 3FONA 5JDSA 5D7IA 2PCFB 1UENA 5EOCH 1OANA 3NK4A 1A1MA 2WXGA 1A6AA 5C08D 3LZLA 2AMGA 3OZ9L 3S4SG 4HS6A 2X4PA 4CADA 5JIQA 3KPRB 2V2TA 4ADGA 4PCYA 2ZXGA 3T0ED 2BC4B 1BQHA 5J13C 1WPCA 1F4HA 5F70A 2PYED 5T1LA 2XBTA 3JV5A 3QDJA 1ZSHA 1TQSA 4D8PA 4E41E 3FXIC 4O4YL 4HIHB 1TSHA 2AEQL 5HVWA 4QO1B 3PGFH 2DV6A 1NSNL 4PJ8A 1XTMA 4WI9A 2IBZX 4WGVB 5BJTA 4GLRH 1NCUA 1WVZA 4ZYKA 5ACLA 3BT0A 4HEPG 5HSFA 1JVOA 5K1JA 4QRPB 1U3NA 3C60B 4PJHB 5D8JL 3V4PA 3Q8CA 4Z7WE 2FYYA 1A7NH 4MNGA 5HHXH 2Y7QA 3FRUB 1BBDH 1T89A 2WQWA 4A7GA 1EZVY 4WFGE 5C0IA 4ZQTA 5DMGD 2QQLH 5AOIA 3IU4H 4KJQD 12E8H 1AXSB 2AKRB 2QVFB 5IQ7H 3SDCC 1X44A 1HS6A 5KSAA 4GKSA 1KCBA 4PG9A 2VDNB 5A2FA 1TT6A 3WS6A 3BAIA 4OKVA 5GZNA 1A4BA 2QKIB 4XI5D 5LCVL 1TXKA 2EVJA 1CFTB 3MV8B 1KV3A 6PAZA 1W6WA 3DGGB 5DRNA 1DSFL 2ZCKL 4IIQA 5CEYA 3P77A 4X5PA 4A39A 1GZHC 3ASWA 3IFPA 4TSCH 4RWYH 4OLZL 3CZLA 1DVFD 3VXUB 2FJFB 1MN4A 4FQXA 1X5ZA 3HG5A 4JHBA 4XBPA 1KTBA 2A0LD 4PJIA 5IMKA 2QV2A 3ETBF 2VDNH 1RURH 1EZSA 3L7EB 2AGJH 5INCB 35C8H 4BQBA 1EAJA 4YFDB 4BWWA 4OD3L 5J3HD 3QQXA 4WU5A 4F7TA 2EDQA 3SY0A 2ITCB 3TV3H 2C3XA 1A0QH 1AO7B 3V0AC 5HDLA 5ESVB 4GW5A 2R1WA 1AANA 2J1KA 3FBKA 5EZLA 2ESVB 3BUDA 1ERNA 4EBQH 5E8EB 5LB1A 3QI9A 2G2PA 1XXDC 1QACA 2BY2A 2LU4A 1HVXA 4J3BA 5EF1A 4OFIA 2IEPA 2VXUH 3K74B 3ZZ1A 4RDQF 5H94B 1BOGB 3SKNA 4N0UA 25C8L 2XXFA 4YGVA 1ZEAH 1NKGA 3NP4A 4IRZL 4UTAH 4XXWC 2VLME 3B9VA 3LSOB 1KLUB 3EO1B 2YUVA 4HBCL 5DFAA 3NESA 2CKBL 4JDTH 1W0YT 3ATBA 4W6YB 1ZS8A 2K78A 4R96B 5C9JA 3A6BH 4Y4KA 5IBLD 5IUCA 2Y2YA 2VR7A 4P46C 3F7RA 5EUOF 2Z91B 4XB8A 1S5HA 1DQDH 4QRSB 4HWBH 2WBXA 4N2GA 4O51B 3CFDA 5F9JB 3ZO9A 3IDIB 1CZ8H 3D12B 4YXKL 4IBLT 3X3GL 4PVMA 5AOKA 3FF7A 5E7FA 4JFDB 5TF0A 4PJAA 3NIGF 4KV5E 2VLJB 1YEIH 1RUML 3VI3F 4OD1H 5DO2D 3CDGA 3Q5OA 1HHGB 4QHKI 1KJ3L 4HUVA 3JZYA 5DLML 3GLDA 4WHTA 4PWJA 1XF4B 2G30A 4NQQA 4B9FA 4I0PD 4ZUVB 5LGKA 2FCBA 3HZ3A 5FYLD 5FGBC 2YUZA 3ENEA 1MHEB 2V5YA 1AQMA 4NQEB 4DN4L 5FLVA 2VLLA 4KKCC 4NQDB 4UILH 1GYVA 5CBAB 3VTMA 1NINA 3LN4A 3MXWH 3Q1SL 4S2SB 5DUPL 3TEWA 3H6JA 3GKWL 3GMLA 3BRFA 3WO3B 2HT3C 1AAJA 4N90D 5C70A 5F89B 4FNSA 4P46B 1K4DA 3MRDA 4LEBA 1G0XA 1E8WA 1N10A 3HA0A 5AAWC 3GSOA 1SPDA 4LT7A 1RUKL 4RNRB 2EUVA 3QQ3A 3FSAA 1ULVA 4U1HA 2Y6TE 5JPNC 3WIFB 4HPOH 1F8TH 1IAII 4W68A 4R7DA 5SWSD 5BPPA 4OZIE 4UI2A 5F7WC 3TJHD 1H3UA 1YEKL 1MW3A 2MPAH 3MV7D 4TLSA 5IHUH 3K6SB 3ZIYA 2YAOA 5DCCA 2WLHA 2ATAA 1A6UH 5D4HA 1KIPB 3BP7B 4X5XA 4XCNA 1U3HD 1A64A 3FUDA 1J48A 2Z4TA 2Q6WA 1BZDA 2WLLA 1NCWH 3AGVA 2VXQH 4X0KA 4PJDF 5EZJB 4KKLD 5DZ9A 3BUQA 4OH2A 1O5DT 5IB1B 3VH8B 1FNEA 2R9HD 2ODHA 4ONOA 1FA4A 1UGNA 4HF5H 2G0KA 3QYNA 4ABQA 4AM0B 5GS2H 2VM9A 1X5YA 2VC2B 2VMJA 1OK8A 2F5AL 1JJUA 4LBEA 4JO4H 2AK4A 3ZDZE 3H9SB 4DCQA 3EXJA 1WZAA 2DZEA 2C3HA 2WLZA 3BVDB 3VM5A 1WFJA 2ZKYA 1SZNA 4LCCA 5EULV 5AVSB 4J3OG 4K5LA 5JPNB 1MXGA 4HH9B 1K6QL 5IROA 3EGDB 1PY9A 4ZUUA 4DGYH 3PHOB 5AZUA 2AQRA 5JO5B 5H35A 3IGAB 5A2LH 3QWOB 1XH3A 3CFJB 3DV4A 2B2XH 3ZPDA 1C5BH 1QSFE 1PKQA 3UYPB 2ITEA 2GITB 3O3AA 5FYJL 5FV2A 4E42B 5C0BB 3CV5A 5TE6L 1QATA 2WYIA 3V6FA 2Y36L 2XV2A 3ZSTA 3ARTA 2QPFA 4U1NA 3D25A 4YDKL 3HTLX 1JYXA 4HXBL 4U3HA 2BNRA 2W0LA 1QFWH 3SCMD 1ZK5A 3WFCH 1CYXA 3QJSB 3L4UA 4QJ5B 4XO5A 5E2JA 4ZZKA 3HG2A 4KQ4L 1N2RA 2W9LA 3NPSB 2OTWA 2XG4A 2HPTA 4PREA 3ZO0A 5F3HB 4WWKC 4X6CE 2XV3A 3LVTA 4WEEA 2VIRB 2DS4A 4PJCE 3ULVD 1OWRM 4ORGB 2YWYA 4POZD 4BH7B 2DRUA 2PWEA 1J8HA 2QL1A 3P4NA 4WIQA 43CAB 4B60A 1P4LB 4AMKH 3X12B 1M53A 4B9IA 1F18A 3EBHA 5GGUA 3S5ZA 5E23A 1BFOB 5EZIH 4TV3A 1DBMH 1OT1A 3FTWA 4PPTA 1BG9A 2PTTA 2WWKT 4WJ5A 3PL6D 2N7BA 1ZS2A 5HHPB 5AVTB 1DBAH 5I5RA 2WIIB 3H3PH 4IEFA 4MNHB 5G5DB 1EZVX 4APQC 1AGCB 4WJG3 2E7LA 4LCYB 3LPWA 4Z77B 4MNQA 3BYYA 3O6LH 1DUZA 4XVJH 2IG2L 1KENH 3G6AA 1JZDC 2R69L 1XIWA 5DJ6B 2CXGA 2F53B 2GSGB 4H8WL 2GJZB 2NY5C 3T6ZA 5EIIG 3V8CA 1JV5B 4CUCA 4KGLA 5KJRH 1S7SB 5E6IC 1U0QA 2R8SH 1NCBH 2F54A 2VM3A 3AFLA 1H6UA 5GPRA 4NZUH 3EUUA 1TVBA 4LCUA 3TESA 3QZWG 4WWKB 3EG9B 3MHZA 4CMMA 1EBPA 3MRBB 3FN3A 1MWAA 4HMEA 4D9QD 1SJEB 1E42A 4L4TE 1BGXH 1MELA 2GYSA 3BN9C 4UM9D 2YMXL 1EXHA 1GKEA 2C26A 3VWJA 4TNEA 2WNXA 1JK9B 2VLRD 3EJUA 4B6ZA 3VFGH 3R1GH 4LIQE 4MA3B 2G60L 2AS5M 3EYVA 3CX5J 1Z9OA 4ANWA 1FHGA 1CFQA 1OEZW 2AZAA 4P2QE 4AVJA 3AT8A 4PW9A 1OAUH 1NBVL 2Q5BA 3AXIA 3HAEA 4HGKC 4WUKH 1OB1B 5DZLA 1DVQA 3Q44A 3SYOA 4APQB 1ZVYA 1HOEA 1CK0H 2EDHA 4LRNH 4EN3A 1QW9A 3L3OC 1IKOP 4L0PB 3L2MA 3BLBA 3MLYH 3MRQA 2A83B 2DWSA 4JO2H 1UA3A 5E6IB 5DSCB 1MZZA 4AW4A 1RH8A 3KGTA 3HE7B 5D1XD 2HKFL 2YR3A 4XNMB 1KGUA 5DF0A 4UT9A 1CMOA 1I85A 3OJVC 5AFAA 3RVUD 1FV1A 5EWIL 5I6NA 4HIIB 1RIHH 4IDJH 7PAZA 1UWEL 2BERA 2P28B 1F5WA 1MKFA 1B6DA 4YSOA 5ICXA 3WN5B 1VIWA 3IKCB 2CR0A 4QY8A 5DHVA 4F7KA 5CP3H 1W6LA 5LGYA 4AUUA 5ABZA 4L29A 3O6ML 4WO4B 4JX0A 1NKRA 5TK4A 3CDFA 3UTTD 5J6GA 1UKTA 1AR2A 1IC7L 3GJFK 3GMMA 3CBKB 3OG4B 2HUHA 3VFVB 5IW1B 5L88L 1KC5L 4JY4A 1QRKA 2EC9T 2OMTA 3B6SB 3BGMB 3OPZH 4G7QB 3CQPA 3IJEA 4Y2DC 1TTGA 3EBAA 3I6KA 1IVTA 2J43A 4OU3A 2VDQB 4NERA 5ISZD 2E9WA 5BZWA 3FU6A 1U8QB 4JFFB 4IBVA 3RB5A 1IFGA 1NCJA 3I02A 2IGFL 3K6NA 4UDTA 4DK3A 1FE8H 2GBVA 4WFED 5DMKB 2DEYX 1KPUB 4E9LA 3OXSA 4KX9A 4XNYH 2OJEA 4F7CA 3NABH 4JM4L 3WSQL 4MTMA 5F1NB 3TZVC 1E4XH 2FEEI 3ILPA 2ADGB 1DLFL 1R19A 3HCVB 3POHA 2FO4A 2AABH 3HI1B 3DX7A 2CBOA 2F8OA 2A6IA 1Y6NR 3KXFD 4YS4A 4DO5A 4I9XA 3CHOA 2CM5A 4UU9A 1NGZA 1UH3A 5K9QI 1QX1A 4TSAH 2XFXA 4JZJB 4TRPL 1FYHB 1GS7A 4RDQG 5F3BA 1D6EA 3MU3A 5LAXA 4B9GA 3GHEL 4MJIB 2WSKA 2WBJA 3LV3B 3R4RA 1EPFA 1MW1A 5K69A 1Y1DA 3ARGD 4BWTA 4Y2DB 3K0YA 3PP4H 3UABA 3D05A 5IBUB 1MXDA 4DT2A 3QDMB 5AB0A 5DK0A 4FL4B 1ASQA 2GJJA 5AVZB 2QBWA 2GSIB 3C8DA 5CSGA 3SO5A 3UTQB 3LRLA 4L4JA 3UTSB 2HWZL 4Y1AB 1DBBH 1RZKH 1XHHA 2XN9E 4B27A 4DGVL 3G04B 1VESA 5C09B 5DDHB 1LO5B 4IHOB 3EO9L 4F8PA 4N1HB 3R06B 1X6NA 4AEHH 2V9QA 3HC4H 4UT6H 2IANB 3TZVB 1DDTA 1C5CL 4MMZC 4RAVB 2BVTA 2OJ1A 1P4BL 3QZLA 2R2HB 4HOMA 1U3YA 5KOVC 1II4E 3NFNB 5MERB 3U0PA 5I8CB 1A6WH 1JPFB 3O4LA 4OAWB 4PJBA 4E9SA 4LO9A 1UD5A 2O6DA 2XVBA 3HNTH 3UG3A 2EIBA 3GC3A 1F3DJ 4W9GC 1ZVSA 4ZW3A 1HAWA 3CZEA 5CR1A 3BWAB 4GRLC 2QVMA 1N64L 1UA6L 2JLLA 1FNFA 4JFEE 3SQOL 1A6ZB 1AD9B 2F5BL 1HXYA 1ANUA 1CL7H 4GW4A 3OBAA 3ULUD 5E0FA 4L8SC 2YZ1A 5AYUH 2CHXA 3FO9B 5IWLC 3N3EA 4HJ0C 4A7QA 5AZEH 4ODSH 2J73A 3QH3B 3JV6B 4BUGA 2W9DL 4NYLA 1BFVH 4R6UA 5TGBB 4L8BA 1R9FA 1WZ1H 4N2MA 5MENE 3IBEA 2CK0H 3IPFA 3NGBC 1INDL 4CSZA 4X6EA 2VRQA 1QWHA 4L0YA 3DBXB 4D9RD 2JELL 5KVGE 3PAYA 3D0VA 3MMEA 3QEGH 4KKQA 5DJZA 4ZJ9A 2DMGA 4X83A 1WGVA 4Y16C 4MMZB 5EO1B 5ICZA 3AM8A 3CLWA 3IT8D 2MQGA 4FLQA 3B2DC 1CN4A 3N9GH 2R1XA 2YK1H 1OQXA 3KPSE 3N1QC 3EAKA 4LKXA 3VXTA 4DZBB 4PCKA 5EU5B 1MFCL 5ALCH 5E08H 3TTSA 3QWRD 3HFFA 4FJZA 3G5XA 4N8CH 3MYZA 3ZLQC 5DZOA 5HYFA 5DEFB 5KW9H 5JQ6H 5DI8B 4OGZA 4RH4A 1AOZA 1FAKT 4HJ1A 1IGTB 2X12A 4P4KB 1A3LH 5DFVD 3MOAL 3MFFA 5CZKA 5KYXA 5F96H 2UZPA 3OB0H 2OJZL 2YQBA 4HSCX 1MFUA 1YJDL 2UUDH 3K5RA 3KL3A 1J5DA 3NCYP 4RGNC 4L8SB 5CR8A 2Q8BH 2WJ7A 4XBGB 3T3ME 1ES0A 1MVUA 4WENB 1WCQA 3LPGA 2XPGB 4HKXA 4DVRL 2YC1B 2Y3AA 3QG7H 3L4XA 4LSTH 5DK3A 1JDAA 3CXHJ 1ZHNB 2EKSB 3CHSA 4KRNA 3T3PE 2DQGH 3VU1A 5ITBL 1AOHA 4H1LB 1Z1WA 3D39E 2PXYD 2X6CA 3FRPG 5T1KA 2AJXH 3S36L 4A6YL 3DXAB 1MW2A 3WY3A 4I7ZC 2JJTA 1J5OH 1L9RA 4XE5B 2F15A 4KPHL 2VH5H 4NM4H 2HFFA 1N4XH 1OGTA 2MEJB 3D08A 4XZUA 4KOCA 3QEQA 1RZ8B 2WVTA 1UOVA 2WJ5A 3PQYD 4WTWA 1QTPA 2ITDB 4C56D 3PXJA 4KK9D 4H1LH 3Q2LA 2IH9A 3VFPB 2ZPKL 4H0IA 1OTSD 4FNPA 5FB8A 2B14A 4QRTA 1LM8V 1CLCA 2K3HA 2OPCA 3O2DA 4UQ2A 2CO2A 4XVTH 1QQDB 5CGYD 4PSRA 5EU3B 4XP6L 2DI9A 5HYSG 1SY6H 4GRWF 4PQXA 4QTIL 5KYWB 4ELKB 2FD6L 3KJ6H 3HNVL 1ZHKB 3WNIA 1EANA 5L2JB 1IM3D 4FP8H 4KQ3H 5BS0B 3NRFA 3EYUL 4G42B 1N8ZB 3KPMB 3WHE0 3ZKXB 1JD9A 4K3EH 5EBMB 2AZUA 2OZNA 1ZPUA 1DQJA 2O4EA 3HFML 2CH8A 2QGBA 1R3KA 5CKAA 4G6JL 4MCYB 5JYLA 2TSBA 2VRAA 2VDMB 1GY1A 1MRFH 4A38A 4FMKA 1OF2B 5DZNA 1YEHL 2JCCF 1QO3B 3LRGA 3PUCA 4LSUL 3IDNA 3S4SB 1E65A 1WLHA 1RLWA 4MBOA 4O02L 3VVWA 3W0WD 1RUAH 5K9KB 4NO2B 3T6QC 4L18A 1XR8B 4FYQA 3AAZA 4K94L 2IH3B 2VKWA 2OI9C 3QPQC 4YO0A 3VXQA 1EERB 3QZOA 1XZWA 4PWKA 5J89A 1OCZB 2W9EH 4PJHE 4QRPE 1AD0B 2VDOH 3QC6X 3UP1A 1DJYA 3F04A 3RUGA 4RX4D 2A74C 4AXWA 2VDMH 1IQWL 1E50A 2GJ6D 1FJ1A 5D2LA 1TG8A 4M4RA 3WXWL 4BFIB 1CGXA 3L9EA 4P06A 1OTUC 5IB4A 3MACH 4IK6A 5HTSA 3W11C 1ZA6B 5F88B 4LPTA 2V8MA 3QFJA 4RAUB 5EZOL 4HU8A 1CG9B 1IARB 5DTFB 2OULB 1BVKA 2IOMA 1PL3A 1E6OL 3L3DA 4JQVA 4Y1SA 3DVNA 1F11A 1RP9A 1GZPA 2WYHA 1GGCL 3GS4A 1BZ7A 1K4CA 2DQCL 4QHKJ 3GRBA 5IW6B 3L1FA 4JANA 4LCIH 3MV8E 4M61B 5E9DB 2QTEA 1SEBA 1WHOA 4U2YA 2CJUH 2BVPA 1GRWA 1JGDB 5D9SB 3BUBA 2YBRA 2DD8H 3VXUE 4A2LA 4K9JA 4MAUL 5HHOA 3LKPA 1G7HB 1AGDB 2OI9B 2VTFA 3OM3B 4AQAB 1KCVL 4X4ZA 2NW2A 3FQYA 5AWNL 1SLVA 2KQNA 1JE6A 2H47C 2Q2EB 5F7DA 4I3RL 3RHWK 4GMSH 5TH2B 2BDNH 4YQXL 5FECB 2A74B 3ULVF 3GSVA 3LS4L 4YL4A 2JI3A 3TX4A 3E0GA 1AO7E 3ATFA 5FWQA 3P30L 4A7VA 3ARYA 4XMLL 2BY1A 2G5BB 3U6XS 3ULSB 2ESVE 4A2GA 4QYOB 3WEXA 2IGLA 4JY6B 1SDDA 3ARDB 3ZY7A 5CZXD 2DLIA 5D5MF 5JHAA 1NAMB 1RI8A 2R0LL 4IOIA 4Q89A 1Z0MA 4OM0L 5E8NB 5I6LA 1MJ8L 1CDJA 1DQML 2GTZA 2EEXA 1FAIH 3FB7B 1BJ1J 1T5WB 1V7ML 43C9B 4HULB 7FABL 2XZCL 2VUYA 2PO6D 3HKFA 4PGBB 3U2IA 4HMDA 4GSDL 2WO4A 3EGXB 4HMCA 3G6JB 3PWLB 4FNLH 4C56A 4HGWA 5ERWA 4PJBF 1DFBH 3B7YA 3P0GB 1COBA 1P1ZA 4ZPTA 3WJMA 2RQEA 1U8OB 4QRUA 3LQAC 4BK5C 5BXFB 1MZYA 4PJFF 3L81A 2IQ9H 1FVDB 3JVFC 3MRLA 3GNMH 4NX0A 1BLNB 2P8MB 4YHPB 4JFDE 2O5YL 3FQUA 2WW8A 1JI1A 2RFXB 1YEEH 3FQRB 2AC0A 2BK8A 1A8JH 3B5HA 4FQ2H 2VLJE 3NYKA 4ZMQA 4S0SD 5GRUH 1PY0A 3L7FB 3B34A 1VEPA 5F7FA 2OYLA 3LQZA 4KVPA 2BSDA 3KM2A 4XP9H 4PGEA 1HZKA 1NCCL 3MBXH 2WP3O 3AQYA 1T0OA 3C8HA 2IADB 3IRZA 4NKDA 4ICWA 2WXRA 1OL0A 3US9A 2Z8SA 4MWFB 4P5MA 1UWGH 4NQEE 3VD1A 2LW3A 5D70L 3N43B 4NQDE 4GXFA 2DJMA 4Y19D 2J88H 1EFQA 1YNKL 5DYFA 4XVUC 5DJYA 5IVXF 2P7TB 4U4BA 4FN0A 5HJGA 3MRJB 4HEMA 1FDLH 4G6KL 2MCPL 3BPCB 4BSWB 2M8XA 2AI0H 1DBKL 2OBGA 1TIUA 3C5ZD 1RZGA 3VGAB 1CE6B 5IBTL 1PG7L 4ONFL 3UJTL 1HYSC 5CAYB 2PCPA 1ZLVK 1RJYB 3QUHA 1IT9H 3QIBD 4R2GC 4JHWL 4PRHD 3B5GA 2ICWA 1J11A 4TF4A 3G5YA 1N5AB 2E7MA 4RRPA 3VSVA 1C1EH 3SKUD 4AY0A 1QKZH 4ZUSB 5JR1L 5LGJA 4UINH 4YIQA 4ZX5A 2A4ZA 2IFGA 4GI9A 4H26B 3HE6D 3TH4T 3RZWA 4EI5A 2FJHA 3EOAB 2V4LA 4PV9B 5AW2B 4DGIH 5CD3B 2ZP9A 4J3OC 1ZT4A 4JKPH 3JWOL 2R2BA 3UBXA 2DIEA 2C5DC 4MAYA 5SX4I 1E5ZA 3LQAH 4EKXA 4JM2B 5D2NA 4A2FA 4R90L 2NSXA 3I9GL 4MZRA 3KYOA 4HJTA 4M29A 4XCEA 3TBYB 1D6VL 5MEOA 3U1PA 3T2LA 2F0CA 3C9NA 3MRRA 1FVEA 3UZEA 3Q8FA 1CWVA 3P0YH 5DT1L 2LFGA 3ZYOA 1ZTXH 3OSVA 3SYPA 3QUMB 4HWZB 3D4ZA 2WD0A 5HGDA 5DFTA 2CO6A 1MCEA 1FL6A 5J8OA 1BQLL 5F97E 5TQ2L 3MNMA 1UOWA 3H9SE 5DQJB 1IGCL 5LNDA 1CDHA 4FQIL 2DIAA 4PN6A 4JR9L 3BHBB 1MFEH 4PWHA 1WUNT 3NRQA 4I3SH 4R2GB 1BIIB 4H0HB 4MSWA 4ZMZA 1PDKA 3SZ6A 3QDHA 3ZU8A 1BQRA 1MCPH 4OZHA 5E99H 4BELD 5FOBA 2J8UF 2CALA 2FX8L 1HQRB 2CLVA 1YNTA 4H4NA 1KXVC 4X7SL 3D7PA 4G9FA 5DRZB 3ZL4H 1T0MB 1T1XA 4NRYA 1J9SA 1FZOA 1OAXH 1I75A 2DWDB 5LHDA 3TF7C 4LL1A 2X6MA 3E7JA 3MBED 5D7KE 4F57H 1NIFA 2AK1L 2DQ6A 2DB8A 2YD3A 2P5PA 1PJ9A 2K3TA 3PHAA 2V17H 3FUHA 4YDJB 1J8KA 3CSPA 4KDVA 5EOCL 3B2UC 3EHBC 4BYHA 5HVFB 1ZT7A 4LMQE 2GUYA 2X3CA 2YFOA 4BA8A 5FYJD 2J8HA 2FEJA 1A3QA 3U79A 5IV2B 1CUOA 3I6LD 4HALA 1I1AC 1E7UA 1SEQL 4C55A 2KL6A 3QQ9C 3ULAB 2ED6A 4XWOD 3F5WB 1R3IL 4BK4A 2NZ9C 4M8QA 5CFHA 1I3RB 3D87B 3E8UH 4XHJD 4UQCA 4LLDB 5IMMA 3VFOA 3PGFL 3NZSA 4UUJA 3V6ZA 3HR5A 5JA9A 3EYQD 2HX8A 2H41A 4L5FH 1HWWA 2EABA 2BPBA 1CICB 1A7NL 2PWGA 3K8KA 4UOZA 1JHTA 1G7JA 5HHXL 3ULUF 4NQSA 1BBDL 1ECZA 1S7RB 4LKCB 5IB3A 3MV11 1LP9B 2BIHA 3BH8B 3G7TA 1JHLL 2XY2A 2VDRB 3AREC 3ESPA 3MREB 5I19H 1NGWA 1M7DB 5GGQH 1KB9K 3IDMB 2CIKA 4PAZA 3EHBB 5IMLA 2GVYA 1OPOA 4OBSA 3THMH 3TPUA 1DJZA 2F53E 4QRAA 4HA1A 4ISVB 1YYCA 1KFGA 4PRDB 1S7WA 5FM4A 5DD6A 4FOMA 5D7LB 2OV0A 1I1AB 2FTAA 4TLKA 1TCRB 1TKWA 1T1ZB 2FL5A 1GTNA 1MF2L 5LO7A 3QXAB 4BZYA 3HAEG 2ZWZA 3S34H 5IQ9A 4TSCL 4GINA 5HDBE 3N44F 4RWYL 1JTTA 4R7VA 3IWVA 5AW7B 3NIDF 4F8NA 2JKWA 3WCYA 5BW7C 1E9OB 2I07B 1U9KA 2ZYSA 4RIRA 1RURL 3QZWB 2XWRA 4HC1L 2AAVA 2AGJL 3UBHA 35C8L 2WAHA 4X8GA 5B39A 2VSDA 4FDWA 4PD4J 5AW9B 4W9IC 3TV3L 1QR4A 1A0QL 2QADD 3ZYIA 3W39A 1W0WB 2VLKA 3TBBA 4GIPD 4X8JB 5FYKL 3AREB 3EGSB 4YPJA 2BVYA 1IAKB 2Q3ZA 1P2CB 1KGJA 5ECJE 5FW8A 5IESH 1TVHA 3O45A 2L7EA 5JHDA 5CSBA 4A2DA 4DUVA 3UACA 4FADA 1UTDA 4P2AA 1S8DB 3U2JA 3BN3B 1YAIA 2V3EA 1GYCA 1OALA 1TNNA 5C07D 2BLFA 3SKMB 5ADOH 1ZEAL 3TBSB 4HV8A 3HG1A 4UTAL 3Q3GA 2WHVA 3NJJA 4GG6A 3NSDA 3QCTH 4IRSA 4JGMA 3FC8A 2BOCA 1QSED 4JDTL 4PWIA 3WYRA 1C16B 3N2JA 5CD5D 1FGVH 4HAFA 2XDHA 4BFEA 2R29H 2YLHA 3I6GB 5EN3A 1XR9A 3F7PC 3FO1B 5EF3A 3WNMA 2EIZA 2XTLA 3EJYD 4GT0A 4HDIB 4ANVA 3LQMA 4AG4H 1O9ZA 3VAEA 1LK3H 3U83A 5GZOC 5L8LB 2LGNA 3WJLC 4XZ4A 4NQCA 3Q9PA 1HHKB 3WTYA 1CYGA 4JFFE 1RZJC 4OD1L 3ZE1B 1O7SA 4Z7UF 3MBEA 4EUPB 1D5MA 2EO7A 3JXAA 4NQUA 1ZSDA 4H2AA 5L6YH 2WMPA 2ZYRA 3BQUC 1JFHA 1MNUH 1F56A 3F7YB 4FTVD 4KDTA 4PI0A 1Z5HA 3QJFA 1NOLA 3TN0B 4ELDA 4FQCH 3GSNH 1UT9A 5C0RL 4MMYB 1FZMB 5LBSA 1CF1A 4UILL 1Q1JH 3VTAA 4M5TA 1JZ4A 1XCQA 2R0WL 4PRIA 3SDDD 5HHVL 1I7UA 5LDUA 4ZTEA 5H2BA 2X53A 3FOMB 3OB8A 4OJCA 2P3YA 3GJFA 3VFUA 3GIVA 1WT5C 4E68A 3EH5B 4MJIE 1Q9WA 4JRWA 4Z7VB 1MVFA 3HHMA 3QPXH 3TPKA 4G8EB 1A25A 3BO8B 3QDME 3HHSA 2NY7H 3DO3A 2Y1VA 2NDFA 3HHRB 2G3ZA 1F8TL 3G9AB 2IBBA 5I75C 2PLTA 3HC3L 3UIYA 3UTSE 1FG9C 1WP6A 4Y1AE 5GIRA 3VFWA 1MCOL 3VSTA 1FCCA 1L9PA 1Q90A 2NNXA 4A7SA 4G43A 4UMGA 3HW7A 4WV1C 2HUEA 2A99A 3FTSA 5J1AA 3RDTD 3FDWA 3WL9B 2MPAL 3T8VA 5IHUL 3MDJA 1C12A 1MNNA 2UYLB 2ICWI 2IANE 1A6UL 3MUGA 5C0CA 2AJVH 1EDQA 2JQZA 2YPLA 5JIHA 2KQMA 2D7TH 5EUOB 2L7UA 2NLJB 2X4NB 1NCWL 2VXQL 3OMZA 5BQ7B 1XQ4A 3FN9A 3SEPA 3KPPB 3UBXI 3S5YA 5DC4B 5IJVA 3LRSB 4HF5L 3VXSD 4MASA 5GS0C 1NCAH 4N6RB 3WNOA 3NIGB 3VWKB 5KBDA 3GTNA 1WSST 1ADQA 4X4YA 3VI3B 1FI8C 4KJYA 3RY4A 4N2BA 5GGRA 3R4DA 3SQRA 2AV7A 1RUQH 2P48B 3MV9D 4XTRC 2X7LB 1EO8L 1I9RH 5D7JA 5JIIA 4ATWA 2WTRA 1R5WB 2YJQA 4MVBD 3ZW3A 2NPLX 3TCTA 1Q72H 2B2XL 5I24A 1C5BL 4HIEB 3LIZA 4WV1B 4ZX6A 3SDAD 3AS2A 4PRAA 1U42A 3T4AB 1PLAA 1T2QH 2V2XA 5EHFA 4QOKB 2X6VA 4F7EB 4WKZA 3HBPA 1UQSA 5B3JF 3KE0A 3Q2NA 2AXFA 5LN4A 2F7IA 4AQZA 3RZCD 3DHPA 2ICEB 3LRHA 4HCRH 3ZKSD 3ECUA 5BQDA 2KLSA 2XWTB 4J1UB 1YYLL 1B0RB 3BP4A 1I7RB 2Y5TA 3NCMA 2WWOA 4MJJA 6TAAA 4OLWH 1T04A 3EO0A 4F37F 4M7KH 3RWDB 4JG1H 4N2OA 3TGXA 1E9QB 5FFLA 1JZ7A 5ALBH 5I16A 3WTSA 3DIVA 3EJTA 4Y5XA 2H5UA 2J21A 4NBZB 4BXVA 3NEOA 2WSDA 1I4FA 5IFJA 2Z8WC 1MCLA 1JWMB 2FVNA 4DJMA 1J05A 1EFXB 3TVMA 1NCGA 1SXZA 4ZTOL 2ZXQA 4ZFOA 5DEGB 5H4ZA 1QI4A 5L2KB 4Q2ZB 3VUAA 2OMYB 3H2QA 4TM9A 2Z31A 4PJDB 2CDGB 3ARZA 1DBAL 3CIQA 4J2QA 3A0OA 3S2CA 1USQA 3DXAE 2IWFA 2QSQA 3L95A 3A4AA 3STBA 3O0LA 4NUQA 3M7FB 5JW5A 3BAKA 1IIKA 3O6LL 3BDXA 2EDNA 4JFHD 5I1AB 2WINB 1DBJH 2CPUA 4XVJL 2DJSA 2JKNA 1ODUA 2BZDA 1BJMA 3AWFA 4PY7A 4ANUA 2JTYA 3T71A 4C8XA 2XA3A 2XJKA 1KIQB 5A2IH 5KJRL 2R8SL 1DQIA 3BVNB 1XTLA 1NCBL 4JB9H 2P44B 1FH2A 1XX9C 2OR8A 5D96C 1A7RH 4NZFA 3IPEA 3IMBA 1G84A 1E4JA 1R34A 5D6CA 3ZTDC 4GYBA 1F1DA 5IVOA 2P80D 4K4KA 1BGXL 5DJCA 1CTOA 4ZAKA 3MVSA 3D85B 3BVVA 4E5XA 1VKXA 1FYTA 4IMKC 1HHHA 3VFGL 3TO4A 2XOTA 4KC3B 1PCSA 2OP4H 2WGNB 1AIFB 2ZP0T 4HUUB 1OAUL 5IKCA 4WUKL 3WEMA 4E9WA 5JORB 5F21B 5JDSB 4HWUA 1AKJA 5HYSB 5CUSL 1A1MB 2NY1C 1A6AB 1CK0L 4LRNL 3DHUA 1TDQA 3J7HA 4WJKB 4N25A 4CADB 1XD0A 4IOSA 5LQBH 4DP4X 3L8QA 4TVUA 3T8MA 1EX0A 5CEXA 5E51A 4BM7A 4JO2L 3JTSA 3Q13A 4NAQA 1E9PB 1MOEA 5BOJA 2NY0D 4IYKA 1HH9A 3L4YA 1K8DA 4IBYA 1I1CA 4LQFL 5D96B 3HMXA 3QUXC 1RQ5A 1M05A 4KQ0A 1LO4H 4GKZA 5J6HA 3CPUA 2LFEA 3RVVD 2Q7NA 4YDLC 3ZHKA 5BJTB 5DURB 1RIHL 4ZOCA 1TLKA 4IDJL 1Y18A 3NMEA 5FDYA 5FHAH 3S9DB 1BVOA 5GRVK 4NM8H 1NIBA 1PZ5B 3H9HB 2FYYB 1NBQA 2NYYC 1NUNB 3ECVA 3P73A 4JE0A 5E70A 4LLUA 4Q9QH 2WXHA 1YECH 3IRPX 5C0IB 1GOFA 3QPKA 5T5FH 2ENPA 2KLRA 4BINA 2P5WD 3OPZL 3UGUA 3DWTA 3WE6B 3IN0A 4ONGH 2FWLB 2K9FB 5KSAB 1EJOH 3OZKA 5KN5A 3MI6A 2C9VA 3B7TA 2NY1B 3D0LB 3K80A 4UBDD 3BRDA 2GC7C 2HLEB 3MA7B 1ZCRA 2DYSB 2EDBA 4G7VL 1XGPB 1FE8L 4MLSA 4BD4A 4H8PA 2B20A 4FCHA 5DRNB 4RGOL 4XNYL 5E94A 3AT9A 5J0BA 1WITA 3NABL 2EUXA 5IJDC 3CVBA 4Y5YA 1G6RH 4BZ1A 3PWPE 4G8GA 4DP9X 1E4XL 2X9YA 5DWPA 3ZKNC 2CRZA 2AABL 4JGJA 3K6DA 4XBPB 4XMZA 4L2YA 2E46A 2W1NA 3WKYA 3CE1A 1XFPA 1ID5I 4TSAL 3IMTA 3WFBH 5C0GA 4F7TB 5HHQA 2X2UA 1NPJA 4R7NA 2VQ1A 1ITBB 5TFSL 5FO8B 3GHPA 4GW5B 4FKHA 1IKFH 1T1WB 3PP4L 4IBUA 1QSFA 5F6HJ 3OKNB 1JNHA 4R0LA 2V7NB 3KBEA 4Q6KA 1DBBL 1RZKL 3FZUD 1OF0A 3QIUA 5FM5O 1J0HA 4AT6A 4DP1X 3PWUB 1QZNA 4YGVB 4K7PL 1D5IH 1MVYA 4YSEA 3PNRB 4WCYH 5IGXL 3PDDA 4UT6L 4XN9A 1OP3H 1FG2B 2CA4A 3E8VA 3RGVD 3T0EC 4F7MA 4J5VA 1ZS8B 4PGCA 1A6WL 1N9PA 3HLAA 1CFVH 3JVGC 5AVUB 4Z5RA 3QO0B 3HNTL 4FXGC 4Y5VC 1J0YA 3FB5B 4P49A 4XMKH 4JKKA 5CJ8A 1D7DA 1TVDA 5AEAA 2IXQB 4PJCA 1F86A 3U4EB 4G8FA 4MDIB 5ETUA 3BZFA 2FT8A 4ZXBA 3SDXF 4GKOA 1CL7L 3VG9C 3G08B 2HVKB 4ZW5A 1H8NA 4BQCA 2XNAA 1F58H 2JJSC 4P05A 5AYUL 4D3CH 1A2YA 3WUWA 2Y07H 3BUPA 4NNYB 5DMGC 4ZS7H 5T3XE 1SOKA 1SDYA 2YN5A 3ELQA 4KJQC 3UC0H 1WTLA 3RWFA 4XXDB 4J4PD 1WZ1L 3UGEA 4WHTB 3UCQA 1JNLH 5LWYH 3WHE1 3ZR5A 5F9DC 4RA3A 4ZMTA 1JPTH 1K2DA 3KL5A 3SJVD 5C08B 2VZUA 3V4VH 4XI5C 2D3NA 2WKLA 2HN7A 3TA3A 3WBDA 3WDIA 3T0EB 1SYSB 3KLKA 2YK1L 3LN4B 2E27L 4YXLH 5JOPE 2PYEB 3TTYA 1XF5A 3MRMB 4Y5VB 5ALCL 3SGJA 4AUYA 5E08L 1YRKA 4J28A 1CBJA 4N8CL 1ASOA 3MRGA 3BPLC 4B9JA 1DVFC 4Z6AT 3L45A 1NPNA 3CN4A 5J57B 5ID0B 5JQ6L 5KW9L 1J88A 3ZE2B 3QQ3B 2A0LC 4L4TA 3BFQG 5CU5A 7TAAA 1YQ2A 1A3LL 2ZAGA 3ECBA 2JIXD 4U1HB 3ARQA 3VQMA 3ZTJH 5F96L 3DDGA 3UBXG 5J3HC 5DRWA 3BISA 3UYRH 1BZ9B 3MLTB 4P5TD 5AVWB 4H8QA 2VE6A 3UZQB 4HKBA 1CT8A 1S9VA 3LEVH 1R75A 2CUMA 4FERA 4P2QA 3L5WA 3ZDXF 4OTXH 5JPMA 5IVZA 4NKMA 3LCYA 2Y4SA 4JKNA 2GI0A 4XMWA 3WTXA 2DQGL 1MHCB 2GBTA 1NH6A 4FJYA 2AJXL 2IBGA 2OX5A 4HJGA 3VRLE 3WLBA 2BJML 3CVHB 1OLZA 2N59A 4ODVH 1QR1B 2E8ZA 4NM4L 5EU6E 1MRCH 1N4XL 3HNSH 3II1A 1GVIA 2D31A 4WWID 1RZFL 1Y7VA 3NOIA 1DVFB 2AMUA 1QP1A 2R0KH 2C7UA 1TUPA 3Q8AA 4KMQA 3DJRA 2YUWA 3QBTB 1GC1C 5IBLC 3UO1H 3AQDA 1FL3A 3WY1A 3M45A 5IM7A 1YC7A 3Q0HA 2ENQA 1NDGB 1EEZA 2XKNB 4G1MA 3C6LD 3CVHH 2MSPA 3CXDH 5BUGA 1AHWC 2CR6A 1XH3B 3DV4B 4AK1A 1UHVA 2J6EH 4HXAH 3VD5A 2CHNA 4AW7A 1SXBA 4IBZA 3O3AB 3V6FB 2BVQA 3MTXA 1KEGL 2UX6A 2X4QA 3ZT5A 3KJ6L 5ENWA 3QP3A 3D25B 4M62H 4U1NB 4AH2B 4GB9A 3UTPD 3NK3A 2ZOOA 1MJJA 4TL5A 1DN0A 4WHDA 5AVQB 5I28A 2GK0B 4GW1A 2BNRB 3U6XA 1QNZL 4J3TA 4FP8L 1FF5A 4KQ3L 4I0PC 3KPQB 3PWJA 3PPEA 3UAJD 4NKIH 1DANU 4Z23A 1N2RB 4QCIA 3MLWH 2XCMC 3N42F 4FNTA 1RZIA 2XG4B 4K3EL 4CU6A 1MAKA 4ZMPA 3KAAA 4AYBA 3RFZA 4OLEA 1EXUA 4Z3EA 1MSPA 2X4OA 3LD8B 2FH6A 2PPCA 1N26A 3W9EA 5BUAA 4KNUA 2MPVA 5BZZA 1DCLA 4J7RA 1T1YB 4F33A 2GBUA 3P4NB 3QA3A 4UTBH 5IHZA 3KLAB 5I9QC 3AUWB 1NC2D 4HSAC 1RUAL 1U92B 1AHWB 4E9VA 2BNQA 2NX5D 3GB7B 2WQSA 1DJWA 1W72B 5IHHA 2ODIA 3DUHA 4GAYA 3ZL1A 4DP6X 2KI6A 3F00A 4N9GB 3GI8H 4UYPA 1M6OB 1L0PA 4TNVF 4WJ5B 2NCMA 5DJ2B 2W9EL 5AVYB 3S37H 4N1EA 1T83A 3EOBA 4EZJA 5BO0D 2VDOL 3K6FA 3TJHC 2E6QA 2FRGP 1PD0A 4Z3TA 1GC1H 1DUZB 1P4UA 3GSUA 1BAFH 1XBRA 1UEMA 5KVEE 2Y2TA 3G6AB 1VJSA 1QLEH 1V3LA 3CFCH 1H5BA 3MACL 4I0PB 3FN0H 3K2IA 5C3TA 1ID2A 2BSTA 4NZRH 5EOTA 3PY9A 1U3HC 4MCZB 4Z3HA 1F3JA 2HJKB 3K2UH 3H9YA 3DSFH 4MZ3A 4PJXF 1TVBB 5EUKB 2BIPA 4LSRH 4KKLC 4NEHB 4EDXA 3IJHB 2Y5EA 1R5VA 1JP5A 2H6PB 5D7LE 2R9HC 4LCIL 1KLGB 1MWAB 1NMCC 5GSVA 2X4SB 3FUFA 4GRWB 2CJUL 2DLHA 2HLFD 3QE5A 3QAZB 5G2NA 2I26N 3O9WD 4JFEA 1IBGH 5FXCH 3MLZH 1KCUH 4Y4HA 2DD8L 1NM4A 1G9HA 2DM7A 1JXKA 3HKZA 4QAWA 1KGCE 4NN5B 3GJEB 3IJSA 3EYVB 4V1DA 1CFQB 2C9XA 3MLSH 1RZ7L 2HT4D 3HAEB 3ILDA 5SWSB 2K4AA 2DN7A 3CFIC 4GMSL 3B3IB 3PCYA 2WVVB 2CJTA 3P3TA 1YUHB 5MENA 1UD6A 3MV7B 1KZYA 4EN3B 5E2VH 5I0XA 3BCDA 3MGOA 1S9KC 3CFBB 4GUOA 4BUQA 3MRQB 1RJLB 4PRBB 1BVLB 3SY6A 3Q8BA 3IXAB 1F13A 2JCCB 3EJZD 1ONQA 5TTRA 1OSZB 3SCMC 5DJDA 3SOTA 4QRRD 2WYZA 2ZOTA 3KPSA 2MJWA 3RLSA 1GGBL 1PX8A 5B1KA 3AZUA 3GXPA 4MJ2A 1FPTH 1FFOB 1MIML 1GKOA 2Z35A 2E4TA 3W9DA 5FYKD 3H53A 2AXHA 2XWJB 4QHLA 2ICWJ 1N59B 2AXGA 2NZIA 4CN4A 2CNYA 3FU7B 3DO7A 5TDOB 3HS0C 3ULVC 3EIFA 4FNLL 5J6GB 1MHHB 4GT7A 4POZC 3GMMB 2VN3A 5B1AB 4M6ML 2X44D 1SLXA 3C6LA 4AGNA 3L3KB 5EDSA 1MCWM 4M5ZL 1YSOA 3KHOA 2DMCA 2PWFA 2XWXA 3FQ2A 3FH5A 1O7VA 2PCXA 2IOOA 2BY0A 2FT6A 3GNML 5E6SB 3PL6C 4XH2A 2JB6B 5BZWB 1G9MH 3DMMA 2C9QA 5GJTH 3RHWF 3DX8B 3SDCD 1TQBB 4U1MA 4FQ2L 1A9EA 1EUUA 1Z2KA 5DHMC 1X5HA 3GXMA 5GRUL 3WNPA 4KI1A 5A2BA 1JDCA 2OJEB 3ZE1E 3CPLA 1J8SA 3GIZH 1UACH 3OF6A 4NZTL 4JPVH 4XP9L 3MBXL 4PV8A 2FO4B 1JVKA 3DRTA 5AUMB 3L3JB 1HTYA 3KCPA 2JB5H 2DM4A 2VO8A 3L3HB 1IQDB 4UU9B 1UWGL 4KTDH 3B2MA 2J88L 3BWUC 3FTUA 2HPOA 1GIGH 2RACA 2XFXB 5AVVB 5LAXB 4XRCB 2IALA 2LR4A 3VQLA 3OVUB 1FDLL 3R8QA 1N70A 2WBJB 2AI0L 4PS7A 2KZWA 4Q9CA 4RMTA 4MB4A 4FS0A 1EQWA 5DK0B 1I7ZA 4D0BB 3HC0B 5D5MB 4Z7VE 3H6AA 2H0JA 2VWEC 4M3HA 1CDBA 3PL6B 3CSYA 1IT9L 3MV01 1NFDF 1VACA 4E36A 4X7TA 4DNLA 2BSED 3I6SA 1QKZL 4UINL 3A6CH 4CAGA 4W4OC 5FUZH 1E4HA 1PIFA 4WO0A 5JIPA 1T21A 5E95B 3CZSA 3HOGA 4DGIL 1KB5B 2OMUB 1JRHH 4Y4FD 4JKPL 4K55A 2R0ZL 2PCFA 4YZFE 1Q9OB 1FO0B 4ODWB 2D0GA 1J9RA 2MQ0A 4PJBB 5F71A 4CGTA 3W37A 3KPRA 1KIUA 5D1XC 3IJYA 2YGOA 5EUOE 5I8KH 1YHPA 2F19H 4G80B 5D55A 2BC4A 4QAMB 4PJFB 3CIAA 5DVOA 3RVUC 2FWOB 5D1ZD 4RFOH 3P0YL 4N4YB 4OQTA 1ZTXL 4OIAA 1Y07A 5C6TH 5B3NA 1HXYB 4UM9B 4HIHA 5GGTL 1A7PH 1NZRA 1QTYT 2YBGA 3NIGE 4AC4A 1BSIA 8FABB 1KB5H 1KULA 3VI3E 4I13B 3VYPA 2VLRB 3B9KC 3OMAB 1T6VN 1AZUA 2FJSA 4QRPA 3C60A 2D7MA 3Q6GL 4I3SL 3MGTA 5L0QC 2JXMA 4FQJH 3FRUA 4X6EB 1MCPL 5E99L 1FFNB 1YEFL 4R5XA 4XHQA 2BSCA 2AKRA 1E0OB 3WOVA 1I8KB 3U1QA 3ZL4L 3EYFB 5DC2A 5IVXB 2B3IA 1C08B 5CILH 1L0YA 4KBPA 4LKXB 4JM0A 4QOKE 1G7IB 1OSYA 2CO7B 4F57L 4OJDH 3N5AA 4QRRA 5D1XB 4OFYD 3S35X 1SHSA 1ZJAA 2V17L 4XO8A 4P9MH 5I23A 4UV7H 3N6YA 3ZN6A 2EDTA 5F1OB 4CNIA 2AEIT 3VVVA 3FU0A 1I9IH 5ILTH 3T2QA 3WJJC 5DS2A 3FCBA 2E7HA 3DX0A 4BE5A 5KZCB 2FJFA 2QVKA 2KT6A 3FQ1A 3MNWB 4HT1H 2YQGA 4XVSL 3UTTB 1MVUB 2VZSA 2FX9H 1GYUA 5I18H 3L7EA 2QELA 4HKXB 3CXFA 3ARGC 2B0SL 2RMNA 1AQ8A 4QLRA 5A1AA 5L0QB 3DX6B 2YLKA 4LL4A 2YPVH 2ITCA 2WYTA 3OAZK 5CU9A 4L5FL 4X0NA 1AO7A 4PUBH 5IP4A 5L2KE 5ISZB 1UASA 3UPRA 1TTCA 3GFUA 4MJ6B 4P8QA 2JQMA 2ZCLH 2ESVA 4JN2B 3SDCA 4MXWH 4PJDE 1SJXA 5E8EA 4EF3A 1E28B 2CA3A 1O7DC 3E3QE 4HUKB 3AADB 4ZOEA 1UJ3C 4L8CB 1GMIA 3RWIB 1OGTB 2CHWA 3JT0A 4G7YL 4HWBA 4XZUB 5HI4D 5KVMC 3V7AG 4HVBA 5GGQL 2Z8VC 5H94A 1BOGA 3KYKL 5KSUB 3CN3A 4L0ZA 4XCYB 3THML 4JZNB 1DVTA 1WCBA 4KOBA 5EPMB 4LSDA 1GZHA 1R46A 3LSOA 3NIFF 2JCWA 1WFIA 2CDFB 1NA8A 4R96A 4YHNB 5FB8B 1TZIA 3SD5A 4YSCA 2J8UB 3SYQA 4AYGA 4TOYH 2W94A 4AEFA 1UM6L 3S34L 5INDB 1MH5B 3DURB 2Z91A 2E9GA 3ULUC 4QRSA 1TJIH 3ARGB 1WRFA 3SPGA 3TM6A 3FL7A 3NJGA 5F9JA 3CFEB 4ALAC 3IDIA 1EDHA 1TNMA 2K0RA 4P3CH 3BKCL 3JWNH 4JFDA 3VGFA 1IEHA 1V54B 4G11A 1HNFA 3GGWA 1SVCP 3BD4A 2WUCL 4OJFL 1PX4A 1LE9B 4DPRA 4OIIH 2DM3A 3RVXD 4D9LL 4ODUB 3BKMH 4MXQD 4NNXA 3S98A 5A2CA 4AJYV 1IRAY 5I6MA 2ETWA 3PDGA 4CSPA 1DQJB 1XF4A 4KNTA 4U6XB 3VXMD 4ZFGH 4MS6A 5JQIB 1EGJH 5K9JH 1JNJA 3KNBA 1N7MH 4S1SH 4NQEA 4H2CA 4NQDA 1ORSB 4ZFZA 5CBAA 2OL3B 5C0DB 3QDJE 3WLWD 2YAHA 1HC1A 4S2SA 3IN2A 5ADOL 4KITB 4M7LH 3J07A 1BX2B 4BKTC 3AAZB 4K71C 3QCTL 5DFVC 4P46A 3W38A 1IAIM 2D03L 3QEUB 3S5LG 4Z95L 2H0FA 5CJ5A 2PKDA 5L9DH 2NY4D 3C8KA 4RNRA 1RCYA 1KN2H 1JS4A 5D4JA 2R29L 5LJYH 1NDMB 1WA2X 1EBAA 1AS7A 2KERA 2VXQA 2ZJSH 4M4RB 1AZZC 1QUNA 5JMOC 5IB4B 4FG2A 1UD2A 4NRXB 1LK3L 4U6HB 2PXYC 3N0AA 3OR7A 1OSPL 2PPEA 4GI6A 1QFPA 4JAMA 2YEZA 4F9PC 2QGEA 4J6RL 3K6SA 3DVNB 4ACPA 4AYEC 3K4AA 1NICA 4U1KB 1GZPB 1XGRB 3GMQA 1RY7B 5FGBA 1U41A 1HQ4B 5FWRA 4Z3JA 4ALAH 4GQ9H 3N44B 5BV7C 2HG0A 3FFCD 5L6YL 5A7EA 1BQUA 3KPOB 4PJGA 1HHJB 3NIDB 3GSXB 1R33A 3BIKA 1MNUL 3Q1EA 5DUMH 2I25N 3AS3A 3EH4B 2AQ2A 5EZJA 2CUHA 4CDHA 5AAMC 5IB1A 4KROD 1HL5A 5EO9A 1K5NB 1SUHA 3RWCB 4AX3A 5DGRA 2B9AA 3DPDA 1B4TA 2P52A 4KK9C 4AM0A 3L5IA 1Q1JL 1BA9A 3LKPB 2YIHA 4PJIE 5AAWA 5BVPH 2UV3A 4RWHA 2NW2B 2ZG1A 1M9SA 3U1SL 3VXRA 3H9SA 3HLKA 1OTSC 5JXAH 4GSUA 3MO1A 4HU2A 4NWUH 4OI8A 3X1FA 3D51A 1HZLA 4CC1A 4JREC 5CGYC 1X4ZA 5JPNA 4HH9A 1KBPA 2CDEA 4KRLB 4AE1A 5D72H 1C7TA 3QWOA 3CFJA 3QPXL 4K23H 4OF6A 3T1WA 2PXYB 2NY7L 3UYPA 2GITA 1ZV9A 4JPQA 2ATKB 4M7LT 3S36X 4M48H 5C0BA 4HLZH 1PMYA 3O3DA 1YEJL 2GTZB 1I3VA 5CLWA 5MI0C 2JJVA 4JDZB 2VSMB 4YDIH 2ZAIA 4N0UE 4TVSa 2DYPA 2F7OA 3G9VA 2RIKA 4F15C 1EHLL 4Z0BH 2X6BA 3PQYB 4Q6IC 2AJVL 1Z9LA 1GHFH 2H32B 2SEBA 2D7TL 3MBWB 3OKYA 1X4XA 4L8DB 5ICYB 2YJLA 2A73A 4AOFA 4C56B 5ERWB 2OFQA 3B1UA 3VU2A 2BCKB 3RY6C 5F3HA 1H3XA 2L8AA 4BQ9A 1YC8A 4GLRI 4JHAH 4WEBH 1B2YA 4ELMF 2VN6A 2VIRA 4ORGA 2XUWA 3VJ6B 2FQDA 1NCAL 4BH7A 2OCJA 2E6PA 4XMXA 5LAPA 1P4LA 3STLB 3X12A 5BV7H 3FQUB 3X1GA 4Z7UB 2XIIA 3ZBMA 3O3BB 2QLVB 5KYUB 1RUQL 1I9RL 1KGYE 2H32H 5DHXB 2BZ7A 5HHPA 2WLKA 2WIIA 1SUJA 1IM3B 5G5DA 4Y2NA 3EJRA 2A77H 5I26A 1Q72L 1JF1A 1AGCA 5MI0B 1X7SA 4NKDB 4Z77A 1D9KC 2E86A 2HX7A 3OAYK 2ZXBA 5FLUA 2AV1B 5C08E 1MW0A 1T2QL 5DJ6A 3VXMA 4OB5H 4F15B 3MLPA 1MLCB 5IEKB 4Q6IB 2GJZA 2OXHA 2J1XA 4JPSA 1JV5A 1S7SA 1BAGA 3FT4B 5HXMA 3NDZE 2J7LA 2Z7UA 1J9TA 3F8UB 3T09A 4F2MB 2PYEE 4OI7A 3MR9A 2CIIA 2BVOB 4TUKH 4HCRL 2APTA 1GY2A 5KUKA 3W0WB 4OI9A 1DHKA 2QLYA 3KMDA 4WWKA 3EG9A 2X41A 4K73A 3Q5YA 4XC1H 2D0FA 4OLWL 4CU8A 3QRFM 4UNUA 3ZE2E 1SJEA 1XZ0A 5D7HA 3MCLL 2H8PB 4ZX3A 3UEZA 4M7KL 2PCPB 3UROR 1FNSH 3M8OH 1IEAB 4BIKA 1UXWB 2ICWB 3QJZA 5ALBL 1JK9A 4WDIB 4X2UA 3WD5H 2DQEH 2ZP8A 5LGJB 5C0AD 4YIQB 3EH3B 3LZFH 2GJ6B 3MRIA 4EI5B 1YLBB 4F8TA 1J7VR 1OB1A 1ZT4B 5IQOA 1EUTA 4JFWA 4APQA 1XEUA 1JZEA 2IDFA 4JY5L 1X5JA 2F1BA 4P2RD 4PJEF 4RSVA 3OZ9H 3KYOB 1WTGT 3LN5B 3FBQA 2L0DA 3PG2A 4AIZB 1OHQA 1PSKL 2A83A 5MEOB 3C9NB 5KTEL 2ICES 5E6IA 5DSCA 3X14A 2I7SA 2M2DA 1DBJL 5I1LB 1X5GA 5JHLH 2PO6C 3QHTC 3KLLA 3BAXA 1ZRUA 2AEQH 2EDYA 3ROLA 4JB9L 1NSNH 4GQZA 1LGVA 4HIIA 2OK0H 5IUSA 2H0EA 3MLUL 5C1MB 5I0DA 5D8JH 4A37A 1KNOB 1D5XB 3WN5A 4BRJA 3I9IA 1F3DH 1U8KB 3UAAA 3PWNA 1O0VA 4WO4A 4LLYB 4KY2A 4OZHB 4ZPVB 1DJGA 3MJ8B 4OZGF 1KBGH 4PS4H 3VFVA 5IW1A 2CLVB 2EO9A 3B6SA 3BGMA 4XAKE 4E41D 4G9FB 2BWDA 3HRZC 1T1XB 4NRYB 1FZOB 3WNJA 3PUUA 1U8HB 3QT2A 4APXB 2OP4L 4DEUA 5H37G 1U8QA 2A1WL 4JFFA 1KBKA 5LCVH 1O75A 1KXTB 2IQAB 1QAWA 3L3OA 4NQVB 4PP2B 2BNRE 1CXLA 5DA4A 4UIMA 1T4KB 1OXYA 1VAHA 2O72A 3FT3A 2AJZA 4MXVE 4N1CA 4WAFA 5LQBL 4AUJA 1QBBA 3P9LB 5F1NA 2PO6B 4WFGD 3U4BL 1FFTB 3W57A 2ZCHH 3ZHNA 2DWYA 4OLZH 4QJ4B 4C47A 1UB5B 5A7BA 2J5LB 5K39B 4KK5C 3RI5F 3TEYA 3S96B 1SBSL 1XB3A 1M71B 1E67A 3QISA 3MX0B 2X05A 3TU6A 1X4YA 4JFQB 5FW7A 4HK3N 4HWEH 3VFOB 1N0XH 3C5ZC 1RIUH 2UVFA 4UUJB 5GGSY 3GKZA 5FHAL 3WIHL 5TPWH 1I8IA 3BZ4A 2K8QA 4RVBA 4NM8L 1K5WA 4ZMLA 3QIBC 1JMXA 3OGCB 5K59F 1MAJA 1WWWX 4BBWA 4Q97A 4Y2DA 1YECL 2F7RA 3ABLB 4GUCA 2GSIA 3JTBA 3FUMA 1Q4NX 1SHXA 3HE6C 3UTQA 3P2TA 3MCG1 3QG6B 5CCGE 4A1RA 3H2PA 1BQSA 5E5MB 1UZ8B 4PBWD 1NGWB 1UXSB 3NCBB 4ONGL 3EH2A 1I53A 3D48R 3V4LA 5C09A 1ZLDA 2AEPH 2V5TA 3D50A 1LO5A 1RHHB 5DDHA 3NAAH 5IMLB 3V0DA 3VFSA 4QXGL 3F05A 4YHMH 3R06A 1Z32X 1FFQA 3D3VA 3TZVA 4A7TA 1CTMA 1XEDA 2CKBH 1JV2B 4Y19B 3CHRA 1C5DB 3NFNA 1TYEB 3SBPA 5MERA 4OAWA 3K8MA 3S3JA 2ZNXA 4XN4A 5D7SH 4YBQD 4ZRGA 2CNZA 2WKGA 1DYZA 4GRWE 4NPKA 3BWAA 3HIZA 3C5ZB 1QUPA 3EOTH 3VI4F 2OR7A 2X38A 1A6ZA 1AD9A 2WCSA 4O2EA 4YXKH 4LSVL 1PG7X 3KHQA 4FQPA 1NGQL 1ET8A 2HX9A 5HDQH 3WFBL 4PRHB 4GAJH 2VLMD 2JKLA 1FL5B 2DH3A 2H4EA 3LNHA 5SWSE 5C0AA 4P57A 2R2EB 3BGFC 3HE6B 3QH3A 3JV6A 4N2CA 5M95B 3M1BB 4JFXB 1VCBC 4EEEA 3O8XD 5TGBA 3ZQWA 2BCMA 4G1EB 3QJUB 4B96A 1TVHB 4RFEB 1QFWI 5JHDB 3DBXA 4ZO7A 5JOFB 1KXQA 1UZ6E 3QQDA 3VFMA 3AJ7A 3WGVB 1F90L 2JCCE 4MMZA 4PMFA 5EO1A 3Q1SH 5FAAA 4JG5A 1ILSA 1D5IL 3GKWH 1ZDSA 3MRPB 4FFVD 3HG1B 5EU5A 1DQQB 2KZBA 5CWSA 2DWEB 1OCRB 4I18C 2FWUA 4BKLA 1ZHLB 1RUKH 2ROXA 1PYWB 1CFVL 4GRLA 5DI8A 3U7AA 2JTDA 3UMNA 1CB4A 1IGTA 1Q8MA 4XWOC 3HRPA 1G9NH 4POUB 4X99A 3FUEA 4XMKL 3E6HA 4XHJC 1B90A 2EEBA 2DLGA 2ZYIA 4HK3J 3T0AA 4IRJD 1XCWA 3HVDA 4L8SA 4DKDC 2DQUH 1IGMH 3EYQC 1XH1A 4XBGA 5IWLA 4ZBJA 2Y7MA 4F91B 3LKNA 3DX9B 1KYAA 4B9PA 4F1SA 3VYNA 2YC1A 4GAGL 3WMPA 4NQCB 2ZCZA 1EAQA 4IKKA 1FP5A 1ZHNA 2Y07L 3SB3A 3TBCA 4KI5D 5IJCC 3MBEB 4H1LA 4ZS7L 4LE8A 3UC0L 5CZVH 2DH2A 2AJUH 4A04A 4H44C 4Y16A 4PY8I 4MZ2A 5LWYL 5DYOA 5JXED 4P59H 3QJFB 3BH9B 3GBEA 3V4VL 1I9EA 1SY6A 1QFOA 2GW5A 5DQ9B 2NMSA 4I18B 1QEWA 2OMWA 1KACB 1NCNA 2EKJA 4AQEB 5K33A 4ETYA 2Y3NA 3P4OA 2ITDA 4PI2A 1MI5A 3HR6A 3ULVE 2VC2L 1G5AA 1IM9D 1E5CA 3GJFB 4H8WC 4MHHG 1Q9WB 4CJ0A 4A7UA 2IGTA 1RPKA 1OM3H 5AW1B 3RGHA 3ZRSA 4JJ5A 3HHSB 3CDCA 4U1GC 1Q1PA 5D5ME 5EU3A 5I2IB 5KYWA 3UYRL 1K3ZA 5I17A 4XPFL 3HEIB 1S78D 3WS3B 3AG4B 4OD2B 2BXZA 3LEVL 1NANI 2BSRB 1UCTA 2W95A 3QZBA 1ZHKA 4OTXL 3SPVB 5DFWH 2F61A 4PR5A 2EE3A 3LN9A 2E8YA 3TJEL 5C0NC 5BS0A 3QZNA 5C0CB 1U3ZA 1BDYA 1KTJA 2YPLB 1N8ZA 3KPMA 4LLAA 1TCMA 1DJHA 2ZWKA 2MQ3A 5EBMA 2CCWA 4PJBE 4FQLL 3AY4C 1LEGA 3FPXA 3HUJF 4ZDHB 4MCYA 5IVNA 3SDXB