2VSMB

Nipah virus attachment glycoprotein in complex with human cell surface receptor ephrinb2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
137
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Nipah and Hendra Virus Attachment to Their Cell-Surface Receptor Ephrin-B2
pubmed doi rcsb
molecule keywords HEMAGGLUTININ-NEURAMINIDASE
molecule tags Hydrolase
source organism Nipah virus
total genus 27
structure length 137
sequence length 140
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vsmB00
5FC9A 5I28A 1AG6A 3ZBMA 3WI9A 3X1EA 4DP5X 1AZCA 1J5DA 3JTBA 4GXFA 5B1AB 1J9SA 3WNJA 4A2HA 2OCCB 2EIJB 3CDZA 1J9RA 1J9TA 1AS7A 4A68A 4DP8X 5I6OA 1ASPA 2YAPA 4M4RB 4DP1X 2GI0A 1JZJA 4KNTA 1NIEA 4TXVB 1N68A 2QDVA 3KW8A 5AZUA 4PCYA 1XB8A 1OCCB 1PMYA 1ZPUA 3AG2B 2UXTA 3NSCA 3ZIYA 2H5UA 1L9TA 1OF0A 4BWTA 3WNIA 1PLAA 2VSKB 2BP0B 1X9RA 4BWUA 1MG3C 1JZGA 1L9PA 1ADWA 3GDCA 1AZNA 4CSPA 1JZHA 2AZUA 2I7OA 2YAFA 3FQ1A 1KBVA 1JZFA 4E9VA 3QJQB 2J5WA 1CYXA 3NJGA 4YSPA 2MRYA 1ZIAA 3FYEB 1A4AA 4YSTA 2CALA 1FWXA 4DPAX 3OD3A 2PPFA 1N70A 3RYMA 3SBPA 4HCGA 2EINB 2PLTA 1ID2A 3EH5B 1JXFA 1IBZA 4UAHA 1BEXA 2FJSA 2I7SA 3X2QB 4E9XA 3UADA 4AI7A 3OMNB 3NJIA 2YXVA 1E5YA 1TEGA 3FU7A 2WO3B 3AG1B 1AACA 2XUWA 1XB6A 1DYZA 1NINA 1A65A 2CJ3A 1TU2A 1KV7A 2OJ1A 1L9QA 5D4IA 3UAEA 1AIZA 1IC0A 3TA4D 2Y1AA 2ZOOA 1WAEA 3AG4B 2GB2A 4YSCA 4GYBA 3H56A 2IAAC 2FWLB 3NJNA 4A2FA 2J56A 1SDDB 1PLBA 1T5KA 3AZUA 1SFDA 2GHZA 2XXGA 1ILSA 2B08A 2FQEA 2XLLA 4WKXA 1WA2X 2OV0A 3X1NA 3EHBB 1JVOA 2MTAA 2VW6A 3S8GB 1E30A 4A2DA 1ET8A 3TBBA 1BXUA 2PP9A 2BZCA 2CBPA 2PP8A 3SQRA 3FPXA 3IBOA 4QKTA 3V9CA 3QJRB 1V55B 2HX7A 3GXUB 1SNRA 4JKNA 3N2JA 3X1FA 2AFNA 3WG7B 4FAAB 3AW5A 1BAWA 2PPAA 3ASNB 2QPDB 3DTUB 1YLBB 7PCYA 1IKOP 1GS7A 3CVBA 1L9SA 4BDVB 1NZRA 1TKWA 3CZUB 3BVDB 3QPKA 3JT2A 2BP0A 2IDQA 3T9WA 1RZPA 2VM4A 2UXFA 1GS8A 4EF3A 1ZDSA 1IUZA 2TSBA 3NSYA 4E9SA 2IDTA 1L9OA 2VN3A 4YSRA 3CG8A 4P5RA 4Q8BA 2WSDA 4GP8B 3T6XA 2ZXWB 1WS8A 2XU9A 3NJJA 1SHXA 2XWZA 1E67A 5IY5B 1NPNA 1SFHA 3ABMB 2X88A 1FA4A 2HRGA 3IEAA 5LDUA 2IDUA 5PAZA 4BXVA 4W9ZA 1CC3A 1BYPA 3L45A 2VM3A 3PCYA 3OMIB 4M3HA 4YSEA 2A3TA 3NP4A 4G71B 2PPEA 2FTAA 4A2GA 2PCFA 2XVBA 4HALA 5B1JC 2Y69B 1W6LA 3G5WA 4AKPA 5TK4A 4KO6A 3TBCA 5B3SB 5D4HA 3T6WA 1CURA 3FU8A 4G7QB 3NSFA 3ERXA 5F7BA 1GW0A 4UF7C 2EILB 4BXSV 3PPSA 1MZZA 3X1BA 2DV6A 3QJTB 4QLWA 3MX0B 3IN2A 4L0PB 2BHFA 2FT7A 2BP8B 1CUOA 4AKQA 3IE9A 4RH4A 3EH3B 3NT0A 1KYAA 4NB7A 1AR1B 1SDDA 1NICA 4E9WA 4YSUA 4DPBX 3FQYA 2H3XC 1JZEA 5B7FA 2LLNA 1JOIA 4DP0X 2YAMA 1AQ8A 1AZBA 4AX3A 4AZUA 4A66A 3PAVA 5B1KA 3CVDA 3PAZA 4DP4X 4HAKA 3FPYA 3FT0A 4UANA 2IH9A 2HXAA 4E9QA 1FFTB 4HZ1A 1MZYA 2FT6A 5I6MA 1SHWA 2QT6A 3SBRA 2UXVA 3S3BB 1WA1X 1X9UA 2JXMA 1QLEB 5PCYA 2VW4A 2Q9OA 4HCIA 5B7MA 1ZV2A 8PAZA 3NJHA 3FYIB 1ETJA 5AKRA 4F7KA 2YAHA 1AZUA 4BDVA 4DP7X 3FU9A 2VMJA 1KCWA 2DY2A 1V54B 1AS6A 1AAJA 1OE1A 3NJKA 1KBWA 4KOBA 5ANHA 3FSAA 2YAOA 1AG0A 5TK2A 3FQ2A 3BQVA 4BWWA 1M9WA 4YVNA 1NWPA 2BW5A 1R1CA 4YSAA 1GY2A 2PPDA 2QDWA 3AG3B 4G7RB 4CSZA 4DP2X 3EH4B 1V10A 4BK5C 1XB3A 3DIVA 1EZLA 2W88A 1BXAA 1E5ZA 2E86A 1PNDA 3C75A 4F2EA 1MG2C 1L9RA 1A8ZA 1GY1A 4MFHA 2BWDA 4A2EA 1PLCA 1I53A 2XX0A 5I5MA 2CCWA 2EIMB 1ET5A 3AY2A 2IWKA 1PZCA 1SF5A 1QNIA 4PAZA 1BQ5A 3PLYA 4N8UA 2BP8A 1OCRB 2PPCA 4JHVA 4F2FA 6PCYA 4HCFA 4G70B 1M56B 3V9EA 3QJSB 1OE3A 3KW7A 3ABKB 3S8FB 4YSQA 1MDAA 1PNCA 2RACA 1OE2A 2IDFA 2DYRB 1NIFA 3U25A 2XYBA 3NJMA 4E9RA 2EIKB 2DWTA 1SJMA 2GSMB 3UAAA 2UXGA 1KDIA 1WA0X 2HX9A 2CAKA 2B3IA 2FQGA 3QQXA 2R7EB 1F56A 3OMAB 3PXLA 5A7EA 1J5CA 1A4CA 1OV8A 2AVFA 2FQDA 1QHQA 2QPEB 2WO2B 2BO0A 2HLEB 1PY0A 2XV2A 4ZK8A 2FNWA 3ABLB 3S3CB 4KOCA 5EHFA 3SBQA 4KO5A 1GS6X 1GYCA 5F7AA 4YSSA 6PAZA 2VSMB 4HHWA 1KGYE 2PP7A 4K9JA 1BQRA 2BZ7A 3TU6A 3IN0A 7PAZA 1VLXA 3CVCA 1E65A 4GP4B 1NIAA 1HAWA 2ZWNA 1XMEB 1PAZA 4WTQA 1CYWA 3OM3B 2XV3A 4YSOA 2JKWA 4DP6X 4JHUA 3HEIB 4W1TA 3QJVB 1ASOA 1HFUA 2H47C 1BQKA 3T6VA 1AZRA 1KCBA 2GBAA 4Q89A 1JVLA 1JXDA 1NTDA 1TEFA 1ZIBA 1BXVA 2XV0A 1GR7A 1PCSA 1UATA 2UX7A 2N0MA 4N4YB 4HHGA 1AANA 2XXFA 1M57B 4P5SA 5D4JA 3DKHA 4NERA 3H4FA 4DP9X 2YAQA 1GSKA 2UX6A 3TASA 5I6LA 1NWOA 1ET7A 2PCYA 2GIMA 3EF4A 2CUAA 3UGEA 1OCOB 1PZBA 1OCZB 3T6ZA 3PAUA 2DWSA 3N55A 3NSDA 3CDZB 1B3IA 2IH8A 2P80A 2BW4A 4G72B 1RKRA 3D12B 1JXGA 3ASOB 5I5JA 1NPJA 2W8CA 4KNUA 3S3DB 1PZAA 1AOZA 5I6KA 2GC4C 2J55A 3FSWA 1NDTA 2HZHA 1HAUA 1J9QA 4A67A 2R7EA 2BWIA 1BYOA 5E9NA 3ZX1A 3NYKA 3X1GA 2P80D 2ZONA 2IWFA 1ZDQA 4E9TA 4GP5B 4AKOA 5I5IA 4YL4A 1W6WA 2FT8A 1IBYA 2X87A 3GYRA 4KO9A 4X4KA 2HX8A 3MBWB 5B1BB 3T71A 2NRDA 2GC7C 1URIA 1ASQA 1SF3A 2YARA 9PCYA 2XX1A 4FA7B 1DZ0A 4HIPA 2AANA 3FSVA 1NIDA 2TSAA 5I6NA 3H4HA 4GY4A 1JERA 3WKQA 5B1JA 1KDJA 1AS8A 2JFCA 4KNSA 4G7SB 4E9YA 3WKPA 2J57A 2Q5BA 4YVUA 1RCYA 5AFAA 4YSDA 4ENZA 3FU7B 2VW7A 1OOWA 1W8EA 3ABGA 1RZQA 5I6PA 2YQBA 2YAEA 5I26A 2YXWA 2IDSA 5B7EA 4NAJA 3NJLA 3OQRA 2AZAA 1WS7A 3HB3B 2DYSB 1A4BA 4DPCX 1JZIA 1PF3A 3WIAA 3NJFA 1A3ZA 4KO7A 1NIBA 3UACA 3FS9A 1ILUA 3UABA 2FQFA 2HRHA 1EHKB 3NP3A 2I85A 2IWEA 3ZDWA 3QJUB 3FSZA
chains in the Genus database with same CATH superfamily
1YEHH 2KQNA 3GI8L 5I28A 5CJQL 4DP5X 4BKLA 1HEHC 5GGUA 5DURD 3VD1A 4PJ9B 5KBPA 4NBZB 1ZV9A 2JQZA 2UZXB 2X70A 4ZQKA 1AS7A 4GAGH 3HS8A 4A7GA 1XF5B 3MRDB 3QYNA 1DDHB 1E4KA 1E4XH 2BVOB 3MLTA 4J2XA 1ZWIA 2Y7OA 3D1MC 4J3OH 3SPVB 3MRBA 4D3CH 3WNKA 4UIKH 4EQ3A 4ZMAT 5DJ2A 1MOEA 3AG2B 1JI2A 3FQRB 5ID1A 2VRAA 3IXAB 5D93C 2CDEB 3ZIYA 3KCPB 3S3SA 4D9LH 4LCIH 4JE4B 4BWTA 2LFGA 3TO2A 4W68A 1ADWA 2BNRB 5AB2A 1I4FA 4X6CA 5FYLH 4ZW3A 4NN5B 4L8CA 4MLIA 1S7VB 1P7QD 3DGDA 2XACC 4MXWL 4DPAX 5GRUH 3NIGE 5KG9A 5J13C 3PABB 1HH9B 2AV7A 1U8LA 2CDGA 2QKIC 3PJLA 5DEGB 2X1QA 3KBFA 3WTSA 1EERB 1CFVH 2WZ5A 3BDYH 5FM8A 1A64A 4BRVA 1CGXA 4TL5A 4Z7VF 4M4PA 5JHLL 4EOWL 1DFBH 2WOBA 4IDJH 1U2YA 1V8HA 3ARFB 1DBBH 2G5BB 4HSCX 4K7FA 4L1SA 4LZKA 3VVVA 1S78D 5CEZD 3A3YB 1GKEA 5DI8B 5B3NA 3AG1B 4PY8I 4KFZC 1T89C 2F1AA 3B4NA 2IPUK 4H13C 1XCWA 4HCRH 4B3VA 4GUPA 3BLKA 1SLWA 1G6RL 1WH0A 2NR6D 1S2EA 1IAKB 3MMEB 4I13B 1MFAH 1AIZA 1MHEA 2QL1A 4L3AA 1HHJA 2DQEH 1MAML 4QYOA 4IIQA 4MA3A 5ADPH 3MJ9L 5MHSE 4OUUA 4PCKA 2ZCLL 4GUCA 5ANME 4WO0A 1PLBA 1ZHBB 5HGAA 4P23D 3RGBA 2GHZA 1F2QA 2IC2A 3MRJA 5F1NA 3EHBB 5DDHB 4FZEH 2ADGA 1E30A 2Y06H 5AW9B 4A7QA 3QWOB 2F8OA 3US9A 5MEPA 2FGWH 4XNYL 1JZ4A 3QCUL 1KJ3L 5I75C 4IBUA 1A1MA 3MV9E 4MZ2A 3GT6A 2QV2A 2JJTC 1XGYL 1Z9OA 3I6SA 3QIBD 3SKMA 5BQ7B 3U0PB 2QVFB 5I8EB 1A2YB 3IETB 3S35H 1H3WM 2WWNA 3M1BB 5FGSA 4JDTL 3LKOA 3U1SL 5IFAH 5CIPA 2WCGA 3OV6A 5IHBA 4LCUB 4X99B 3IAGC 5DZPA 4UNIA 2B1HH 4BBWA 2W65A 5LNEA 2R0LH 3TVMB 3OLGA 2XJLA 2ZOLB 3HG0A 3ZL4H 4QOKE 1G9MC 2WCPA 2WXLA 1UOKA 5I9QC 1NEPA 1XT5A 3FCUB 5D7LE 3EO0B 5IMMB 2DQTH 1TKWA 4FQJL 3ZDZF 3UZVB 1RZPA 5I74C 2NW3A 5C0AE 3QIWC 3JUZA 2ZCHL 4WK2B 5EZLA 3DXAE 3QULB 3ALXA 1NJ9A 3IF1B 3WO4C 4RFOH 2ZXWB 4JM4H 3VXMB 3TZVC 5I17B 3ARDA 3BLBA 4YDZA 3QNYB 1XX9C 2W9LA 3V52H 1B6DA 2Y24A 2CPCA 1U92B 1HEZB 5A2AA 2C3GA 4FQCH 2HRGA 3GJFA 3SJVE 1IGIL 1XIWA 3C8DA 3NJXA 4AYFB 4Y19B 2DYPD 4J12A 3C87A 3BVWA 4FLHA 5INDA 2ITCA 4W9LC 3T2OA 1JNNH 2PPEA 3BUYB 4GUQA 2Y69B 4TNFA 1FC2D 5TK4A 3IXTA 2OSYA 2XVGA 4M7ZC 5LCVL 5F7BA 3UG3A 3UPCA 4F1ZA 3KYNB 1G9EA 5C0BE 2LAGB 3U9PL 2EC9U 3L5XL 4WZ9A 5KW9H 1P53A 4N6QA 2ZUQC 3BH9B 2DJSA 1KSRA 3KPPB 1HJCA 3SDYH 2X0VA 4CNIB 2PTTB 1E4WH 4XCCL 1J48A 1K4CB 1UC6A 2FYYA 2H32A 3NT0A 3U2SA 3UTZB 3RDTC 2XG5A 5BO1L 5DYFA 5B7FA 2LLNA 2YAMA 1AQ8A 3BJLA 3IJYA 5ANMA 1B9ZA 4ZAKC 4UMGA 1R0AL 4PP2B 1F1DA 4OZHB 4PLKC 3RWHA 5CP3H 4ZW6A 5CXPA 2NLJB 4B5ZA 5BVPL 5HYEA 1AP2A 3PQYE 1S5IL 3JWOL 1V3LA 3B7UX 3HR5A 5TE6L 1BQHA 2OW6A 2XZAL 1AO7D 2GCYB 3MV9A 4JPKH 3DBXB 4X8GA 5BV7C 2RAMA 4OM1H 4Z8FL 4B60A 2OZNA 3B2MA 4KXBA 4XO9A 1QLEB 3C5XA 3R8BB 5AVZB 2EH8L 1MLCA 3MCKA 3QEQD 4OZFA 1FNGA 1CTMA 3VSVA 1ETJA 2XXCB 1I7ZA 4IHOA 1XGTB 3V6BR 8FABB 2A1WH 4GAJH 4BCYA 1O75A 5F1OB 4QOKA 3NCFB 5JHMA 3QEHA 4GG6E 4OCXL 4M8UA 1RURL 2PCPA 1UUNA 5D7LA 4JUTA 4NFDA 4KC3B 2G2RA 4Q58C 2AKRB 1Y0LA 2C4FU 4X9IA 1E6OH 3QP3A 3IPBA 4WUUE 1AFVL 5DT1L 3IS1X 5C0AA 1NC4B 3GMPB 3DXAA 3IU3B 3RVUD 5DRZB 5IV2B 4JR9H 1FSKC 1UFUA 4Y4FC 3QDMB 5DD0L 4ZMTA 1U8NA 2DQUL 5GGRA 5JW3L 3MRRB 2OL3A 4JFSA 4PB0L 4KX8A 4DUVA 3SJVA 4LIQE 1T1XB 4PRAA 2FX7L 2R39A 3V0VB 4ZMNA 5AOIA 2IBZY 3WOVA 4EIGB 5BW7A 1RUAL 4AL8C 1YHPA 5HJ3A 1BVLB 1RMFH 5MERB 5I8CA 1KJ2H 2DW5A 1UWYA 4Y1SA 4MMZB 3QXAB 4YAQB 3K4ZA 4MNQE 4YZWA 1CFBA 5GRVK 3HZVB 3QH3B 5E23A 2ARWA 2F15A 4PAZA 5F1KC 2ERJC 2Z31C 3MA7A 5CP7B 2P48B 4M6NH 5C0BA 3ZE0F 1P4IL 1S3RA 4XNAA 2EDWA 1AD0A 2BC4B 2C7FA 3HC4L 3G7TA 3JT0A 3WJJA 4MLSA 1KB5H 2DQ6A 2NX5D 3KW7A 3WENA 4YSQA 5LUMA 1PNCA 5TTRA 1JN6A 2DYRB 2ICEC 4LSVH 3ZLQC 5D6DC 4KGLA 3H3PL 4O2EB 4NXSA 1YY8A 4F92B 2B7DT 1Q9WA 4YE0A 3LH2H 4TUUA 4FQIL 4UTCA 5CFAA 3BKYL 3FFDA 1KBGL 4DHLA 2X2JA 3CK0H 3QQXA 3M1CA 3N41B 3PQYA 4U1LA 1DVZA 3KGTA 4YX2H 3C60D 4JQIA 4Q2ZA 3RY4A 1UQSA 2Y07H 2XWDA 3KPRD 3MRNA 2D7TH 1P4UA 4PJAF 1U8OA 2GJZB 2X41A 2XV2A 3KXFB 4LLDA 3RZCD 2D2CC 5TDOA 4GW1B 3VTAA 3OMZA 4N9OB 1GGBL 3P1VA 3DJRA 3PNWA 4HP5A 2FJHA 2YMTA 3L4CA 2CD0A 3LVTA 4MAYD 4EZMA 5LXGL 1A9VA 3IRZA 3QJXA 1T7WA 2BSBA 3ULUF 4E5XG 3VXUE 4J23A 3CLEH 3CFBB 3S4SB 3CPLA 1DDTA 3AVEA 1MCPH 3AAZB 2YMXL 3QQ3A 3ZGHA 4WWPA 3AY4C 1XBRA 3OM3B 5DTFA 3WXWL 4D8PB 5C9KA 4WUUA 1ETZA 1FVDB 1KCVL 2NSQA 2V7HA 3ZDYE 2QQKH 3QG7H 4HH9B 2N7BA 1IT9H 3SE8H 3SE4A 3O6MH 4JFYA 4S1QH 3VFSB 3ESVF 4NO0D 4TTDD 1I85A 3QJVB 4K23L 4Q6IA 3UP6A 1RZFH 3UIYA 2YD0A 1PX8A 4GI9A 2ZCZA 1OWRM 2DQJH 3LKRA 1T03L 3II3A 1OGAE 4TUJA 4ODWB 4WNQB 5FM5M 1NTDA 2P5WB 1T66D 4JGUA 3OKDA 1U3JA 3TCXA 1ORSA 2A9CA 1UATA 1XH3B 2UX7A 1Q9LA 4HPYH 2CIIA 1BGXL 3OWRA 4P5SA 4YL9A 2WJ7A 5KVGE 2ZPKH 3IMWA 1RVFL 3VFPA 1QSFE 5C0GA 4BK5A 3DJ9A 2XTJE 1NWOA 2XIIA 1ET7A 4MNQA 5FAAA 2HFGH 3O3BB 1MQKL 3BMWA 2AJ3B 4U1GB 5I15L 1PZBA 5HHOE 3G6AB 3JVGC 5I0DA 4M1CD 4IU3B 3R1GH 1A47A 1A4JB 2BVUA 5ABZA 1B4RA 3VJ6B 3UBGA 3KDPB 4GKOA 5CUSH 2OI9B 4ICXA 3BIKA 2PR9A 1NEZG 2XSKA 2VLJE 15C8L 4ABVA 1P7QB 1F58H 1QR1A 2AJUH 2HMIC 1UXLA 2B4CH 2EXSA 2B59A 1S3KH 3HUJE 3PWJA 1P9MC 3VFMA 5IW3A 3NYKA 3ZX1A 4NCC1 5L88H 2EVIA 1EJOH 3ECVA 4K3DL 5DXWA 5AAMA 2R23A 1S7QA 3JYCA 3MFFB 1BLNB 4KROC 2E59A 3DX8A 4HX1A 1YN7B 3NK3A 4MVBD 4E9LA 1SQ2N 4OJFL 3TFKD 3CFIC 4PJIE 1IQDA 1QI3A 2ADIB 3IB4A 9PCYA 4BFKA 3FONB 2VUYA 2YD3A 4F2ME 5EO9A 1TZAA 1J88A 1U9KA 3M8OL 1KENH 1EFXD 5CCKH 1R5WB 5K59F 2R0ZH 4NZUH 1MW0A 3AS1A 4IMKC 1ZLWH 1TYEB 2ICWJ 3VXUA 3GXPA 4L3ED 2Y36L 1BQUA 3I2CH 4P23B 3VI4B 4AEIH 3NZHL 4YSDA 3QJZA 1D6VH 1OARL 1JRHI 2Z1KA 3B2VL 2Z3FA 3LCYA 5E5UB 3UMTA 1LEGA 3RI5F 5H35A 2Y5EA 3AM8C 3LRLA 3NACH 3NZ8B 3MNZB 4HDIA 4YDJB 3WEOA 1F13A 5J11B 5CU9A 3OJ2C 4MWFB 1A7NL 3X3GL 4DPCX 5EO0B 3DUHA 4EXPX 4Y0GA 3RFZA 1AGBA 1KGJA 4P2RA 1OGAA 2LR4A 3W39B 2IPKB 4JDVA 2FQFA 3C5JB 5I0XA 1AHKA 3CH8A 1S7XA 2CBOA 3Q8BA 4ORGB 5C07E 5DQDH 2X12A 5FCSH 1DJWA 5EBLA 1QSFA 5HHVL 4ZFZB 1FJ1A 4RZCA 2KPNA 4HJSA 4ADGA 4G3YH 4NO5B 1DVYA 4U3SA 3ULVE 5HHOA 3DURB 1QFWM 3EYUL 3D07A 3ARDD 4PJDF 3QBTB 5DHVA 3D09A 3O3EA 4LHUG 1M9SA 1U36A 4AJYV 3QC6X 1BBJB 5EV7A 4Y4KD 5E8OA 3WY3A 5E8DL 1JDDA 4I88A 1FHNA 4FXKA 1XIWD 1TG8A 1GZHA 1ZKAA 4BIKA 4IM8A 2VLJA 1IFHL 2OZ4L 3QQ9C 3QYCA 4PJ5B 3CFKB 3HPLA 3VYOA 4AIXA 2VSKB 2G0LA 3QCVH 2NCEA 1A3QA 3QEGL 5K9OB 1BDYA 3HUJA 1AY1L 1B2WL 5CEYA 1BIIB 4DGYH 1YNTA 3BXNB 2Z64C 1JZFA 3NESA 2O61B 3B2UD 4WSJA 4ANVA 3U9WA 4GPVA 5JMOC 1VCBC 2VDNL 1A7BA 1JCVA 2XRAH 5D7IE 3HG2A 3VH8G 5KVEL 1GOGA 2OR9H 4QY8B 3S36H 3OGCB 4PJIA 1U8HA 1ZGLP 5HHMB 5F7MC 1KB9J 3DV6B 1QWHA 4F2MA 2RMNA 4ABWA 1TCRB 4E9XA 5MHSD 3MRPA 4HWEL 2HFTA 2FYVA 2BHZA 2OM5A 3OMNB 1HH6A 1YG9A 3HI6L 3OB8A 3GMQA 4K2UL 1TEGA 3FU7A 1X4XA 1XB6A 3DHJA 4OD3H 3H7LA 3X14B 1UXWA 1U3YA 2CG9X 4CVUA 1IGMH 2ZUYA 3L4VA 3V0GA 1LO3H 4RMTA 3MV9D 1H3UA 5D1QD 3MR9B 3CFTA 4RFEA 2GB2A 3FB5B 4YSCA 5IZ7A 5KVMC 4NPKA 1TCMA 1FG2A 3OR7A 4OT1H 1N3NB 4JS7A 3MZTA 4I48B 4IRJC 1NGZB 1I1AB 5F7NC 3VGHA 4NP4H 1M7DB 3S5YA 2PO6A 3WKML 3CFCH 2OK0H 4WF7A 4AMKH 4P2QD 1ZS8B 3I6GB 3AS3A 4QOKD 4TVPH 3FT2B 1HSAA 3MOBH 2CBPA 2NY5H 2VDLB 2WVTA 3EYQD 3HZMA 3KPSD 3LN4B 3FPXA 4IJ3B 1A7QH 2H2PD 5C07A 4EO5A 3LVEA 4NO3A 4YS4A 5CU5A 1EHAA 4J3SA 4Z7WF 5C0AD 3X1FA 3BYYA 4MQ7B 4OZ4B 3FL7A 1MCFA 4QRAA 5G4MA 4DAGH 1TJHH 1Z3GH 3B9KB 3GMLB 5IB4A 3NFPB 3GEFA 5MENE 5AKSA 4QHKJ 5AVUB 1KYOK 3BAIA 3ME0A 3VG0L 4UV7H 4FNRA 2EEBA 2YC1A 3CVBA 3WCYA 1VAHA 3HG1B 1BM3L 1SXCA 1QNZL 1Z5LA 3CFDB 5EBWB 1H3PH 4WHTA 4U1NB 2LVCA 3QPKA 4G6JH 3SJVD 2AGJH 2VM4A 3F7PC 1P4LB 2X28A 3TN0B 4IOIA 1WHPA 4Z7IA 4FHKA 5EOTB 1SOSA 1TJIH 4LSTH 4ZUVA 1XSIA 5GJSL 1IZJA 4EKXA 3GTNA 5HI4D 1Z9NA 3G6DH 2CK0L 3B8SA 1AE6L 2BVTA 3IJ7A 1SHXA 4BJLA 5E8NA 1CJYA 4G1MA 1NGYB 3GSQA 1RUKH 3DUSB 4F15B 3ABMB 5KZCD 5C7XH 5C0BD 3Q6GH 1DVXA 4WNJA 4UTBH 5HY9A 4UIMB 1E2WA 5DRWA 5D7IA 1I8IA 2A6IB 4AYDC 2Y22A 4NKDB 1UT2A 3V6FA 3AREC 4FE9A 3K72A 2W07A 5KYYA 1ZLVH 3P73B 1LK3H 2NX5B 2R59A 3L2MA 4Z95L 1B0RA 5DO2D 2E4TA 3K5SA 4HGWA 5EEZA 3DO3A 3P2BA 4OJYA 1O7DE 3GBMH 5L9DH 1Z9MA 3OC5A 4BEIA 5MP6H 1G9NC 1ZGLB 3VMOA 1EEZB 3PQYD 3HE7D 5IIEA 4Q74A 4G8FA 2EDMA 3EJZD 5EOQH 4IW4C 1T5XB 1HK6A 4MNHA 4OGYH 3QNXA 4DSYA 1V7NL 2GHWB 3C60B 3KPMB 4JFUA 3DPBA 3PAVA 4XN5A 4PLNC 3BX7C 3WFBH 1QFOA 1RJZB 2J2ZA 3QNFA 4X4YB 2WYZA 2E46A 2QQLH 4OI9A 5IB3B 1MY5A 2HXAA 4WIQA 3M1OA 3RA7L 3G5YB 3OPZH 3RZCB 4QHNB 4YZFE 3LNFA 2XYCA 3PL6D 4FFZA 1MCOH 2Z92A 3LN5B 2JXMA 1FL5B 3V4PB 1M7IB 4HIJB 1DQML 2VXQA 4GG8A 4NYLB 4X0KB 5TGBA 1NFDF 1WLHA 1G7HB 2MQCA 1VEMA 4OKDA 2HFEA 2V2XA 4JDEB 4WUUD 1I8AA 4H88H 3TIEB 3DX7B 3MGTA 4I5BA 4BA8A 2DWYA 4PJEE 1BCIA 4Z0XB 5HVHB 1DBKL 2CKBH 3ARBA 1HTYA 2BJML 3S8WA 1Y6MR 1D5MB 1W0WB 2DTML 4M1DH 5MENA 1F4YL 4MDJA 4X6DA 3DSFH 1A1OA 1OD7A 4JVUA 5BUAA 4PGCB 3UX9B 5AOLA 1ZK5A 2V9QA 4F9LA 5A43C 3AT9A 2YAOA 1D9KC 3GSNL 3ECQA 3BCDA 4XZ4A 3L1OL 4MJ2A 3FB7A 5D2NB 1CF8L 1WC7B 1MW1A 3P11H 4PJ8C 3K2MC 1A6WH 2LTQB 2CGRL 2JJUA 4MNQD 4Y5VB 3K3QA 4KMLB 4OTXH 2X9ZA 1WFTA 2EH7L 1XB3A 4J8QA 1WTGT 4JY6B 1F8TL 4U7SA 1Z7JA 1HOCA 5TE4L 4LLUB 2YSTA 3DPDA 1SXAA 4PV9A 2H8PB 4RMSA 2EIDA 3QGVA 4MA8H 4MFHA 4TUOB 1QO3A 1PLCA 1HXMB 4Z7QF 2FGZA 1CF1A 3NCYP 1GGIH 2BVPA 3KYOA 4Z1PA 4TNWK 1B0IA 3K80A 5EBMA 3VGFA 3LZOA 4CAGA 1BV8A 3BQUC 3MX0A 3SE3C 4LASL 4KJQD 2BP8A 4PRBB 3T3PB 4XTRC 1MFCL 3O3DB 2JB5L 2ZG3A 6CGTA 1IE4A 5DHDA 1X4YA 4PJGF 2COQA 2AJYL 4GXVH 1L5GA 1TFPA 5FW7A 2YD6A 4DN4H 4OZIF 3COOA 4U1SA 1WP6A 5IB1B 4ZFFB 2IDFA 5CSBA 3MUGA 4E42B 4HWBL 3ZE2B 2VN7A 1CL7L 4Q4EA 2WD0A 3L3DB 2MHAB 1OEZW 3N0AA 4ZUSB 3HHSB 1O5PA 1CDGA 3CHPA 3GSWA 1INDL 1J0KA 3SPJA 3ZTJH 3ZSSA 4Z6AT 2ITDB 2QGDA 4P2OC 4ZMOA 1N8OE 2R7EB 2APVA 1BX2A 1JPTL 2NTFA 2ZUTA 5DRXA 1B0WA 3VXUD 4M61B 1TETL 1OM3L 4B0MB 2FQDA 3INUH 4ZPVB 2GVYA 3N44B 3F05A 4JANA 3FZUC 3VWJD 1OGTB 5DEFA 1IM3A 5E00A 3S3CB 4IDLA 4LEBA 2WLLA 1BVKA 3MRKB 4F7PB 5SX4I 3ZDXB 1OXYA 1IGTB 1ZSHA 3MRQB 4PJEA 4KUZH 1YSOA 1U93B 2WXQA 2W38A 1AJ7H 4L8SC 4GSDL 2Y6SD 4F7EA 4XNMB 1DSFL 4WHDA 5CD3A 5KSUA 3CVCA 4FYSA 4PEEA 4XXDA 1NIAA 4FXTA 1AR2A 3E6HA 1N5AA 3KLDA 4QO1B 3VXTA 2FL5B 4QRRB 5ITBL 1CU4H 1AYRA 2X42A 1CR9L 3NCJL 4LHQB 4MXQC 2OTWA 4KJYA 2ZCKL 1F90L 1YAZA 4ZX3A 1A1NB 3B9AA 3P3TA 1GIGL 3MJ7B 2XTJD 4C58B 5D5MF 2O5ZH 2WMPB 1XEUA 3GRGA 3G6JF 4JQXA 3EO1A 4MX7A 4L4TB 1QASA 1BQKA 5HHOD 2HRPL 3ARFC 4L1DA 1PD6A 4LPXA 1Z9SA 3FUDA 1EXGA 2D3JA 1MRCL 2BLFA 4Y2LA 3RNKB 3QUYD 2ROYA 3WAJA 3FCTA 4HS3A 2FO8A 3MDJA 5E1GA 3QFDB 5D4JA 4QRQA 4XBEL 4XPAL 1KLUB 2VLJD 4I1PA 4Y4KB 1SYSB 2DL2A 3EZJB 4CDGC 1I82A 3SO3C 3KBPA 4TNVK 2GIMA 3FOMB 4PGZA 2E7LC 4NC1E 4FFYL 1IC1A 3D3VA 3O11A 4FQQA 1KN4H 3VFNB 3L7EB 4G72B 3QQDA 5E1HB 2XKUA 1TFHA 2UY6A 3R7RA 3VQ2C 3EHBC 2WIIA 5CJ8A 3ZVVA 4EI6B 2AEQH 3QQNA 4J27A 1UB6B 2HKFL 1Y18B 1E9QA 2Q8BL 4U2YA 1UWGL 5HGDA 3B2DC 3ILPB 5HDWA 3QDJE 4NO2B 2X0WA 3G04B 4OCRH 2JKIS 4R7NA 3WIHH 4A67A 4JO2L 5T3XE 1NBZA 2GFBB 4BQCA 2E7BA 1BYOA 3ILEA 1SVBA 3WGVB 1PSKH 2XWBA 2WP3T 3MLUL 1PIFA 5KVFE 4P5MA 2OSLB 3LOWA 2OPCA 2Q7AA 1NEUA 4WHCA 3S5LB 5FIEA 4KVCL 2HVKA 4YE4H 3MLWH 4AW4A 2FEJA 3G5ZA 4G11A 1O5DT 4Z0BL 4KDWA 2AANA 4S1DD 2W60B 3FFOA 4OFKA 3RHWK 2AQPA 1U95B 2XWRA 4E36A 5D1QB 4XXWC 4B97A 5EZIH 1KELL 1TO4A 3EIFA 3AB0B 2DIJA 3IMTA 4H5SB 2CLRB 3IGKA 4YVUA 2ZX5A 3FCBA 4ZXBC 3F65A 4H8WL 2D3NA 5JW4M 1FFPA 4XX5A 2FRGP 5C07D 4OBSA 4P2QB 1QYGH 4V1DA 3QWRA 4A1RA 4TYUA 4GMSH 5JQ6H 3TESA 3LIZL 1VCAA 4F9PA 1MCJA 5D9SB 4M7LT 4EE2A 4ONHB 3GIZL 2B1OA 3ULVD 4AV4A 1ZTXH 3HC2A 4FFWD 2VDKH 1F97A 3I9GL 1XGQA 1P6WA 3VM7A 4TV3A 4D0BB 3O9WA 3NP3A 2ZWLT 3DETC 4KZCA 1F4HA 1PZ3A 2CJUH 4PTUA 1T2JA 4ONGH 1KTCA 5JW4R 3BPOC 3SDDC 2IH3A 4DKTA 2LT9A 4A68A 4LLMB 3CDGB 3DO4A 5D7KE 1S7TA 4ACPA 2NQ3A 1UXSB 4UNUA 2RIKA 1N18A 1E4JA 3EYVB 3U0TA 2BCMA 2MNUA 5TPWL 1CI5A 1BZQK 3LX9A 5C6WH 1SLUA 1JGUL 2CM6A 2EICA 1QI4A 1ZT7B 3B34A 3AFLA 5T3ZH 4PN6A 4ZYKB 3SYAA 3BDXA 3PXJA 4P3WA 1MN4A 1OGSA 3DHUA 2BRRL 1PLAA 3RNQA 3QDJA 5E5MA 1EMTL 4KZDH 1GC1H 4LMQI 3ML8A 4QWWC 4M7KH 4UZSA 1KYUA 5E99L 2KYIA 1WFJA 1NA8A 2QZQA 3OKKB 3HKZA 3GXTA 2HT3C 4BGDA 3F85A 4ANKA 3QXUA 3TEWA 3OXSA 4FQ2H 2JNZA 1FL6B 2MRYA 2Z34A 3L9YA 1XCQB 5F7EL 2L7EA 4NWUL 4FI8A 1G6RB 3ARPA 5EUKB 1N70A 5GZOA 1MFEL 2PW2B 3CPUA 3RWGA 2EINB 1IEBB 4XBMA 3EH5B 1IBZA 1PKOA 3C6LA 4PG9A 1SY6A 1YMHB 1TVHB 3HE7B 4N8VG 4U1IB 5LJYH 5M7QA 3OF6A 1RIHH 3LHPL 4CVXB 1KPUA 5IWLC 2PCFB 5HDQH 4B9IA 2FCBA 1MUJA 2Q76A 4M7LL 1AACA 3D30A 3RZWA 1DLHA 4TSCL 1W8OA 1P7HL 1QRNE 2BY0A 2DI7A 3P3UA 2OXHB 1Y6KR 2ZG1A 2BMKA 4U0RB 1D5BB 4DETA 1OGPA 3VXPB 1DUZA 1JPSL 1A3RH 1PZUB 3VGBA 4JM0A 3RWFB 3SEPA 4ESKA 3H56A 5DZLA 3PL6B 3RWEB 3GPEA 2CHXA 4GBXA 3GJEA 3U79A 1V7ML 2P8LB 3MODH 4NQCE 1JIBA 2P28B 2YLKA 5B3JF 2XTSA 4HOMA 4LVNC 5MEND 2R1WA 3T0EC 4HK0A 4X5QA 2P47B 5AVYB 3SQBB 4X5XB 1CDJA 2V4LA 4H1LG 1MJUL 3L5WA 4JM2A 4KKLD 2WUBH 2HUHA 2EUXA 5EU3B 3VXRE 4X6EB 5D7SH 4G5AA 4FKKA 4HG4K 5KBLA 4YHML 2V9TA 3FCSB 3NPSC 3F7YA 5K5YA 1JWSB 1JPFA 1DVFC 2C9AA 4BSJA 1BFOB 2E6PA 4IGBB 1J8KA 3TYFA 4QNPF 4WHYH 3VXSE 5HYSA 5LHDA 3PWVA 4N0CD 2G3ZA 4FQHB 3T1FB 4ZO8A 7TAAA 2CA3A 3VCLA 3OR6A 3T77B 3BP5A 3KM2A 5HPMA 1ZEAL 1IUZA 1TLMA 4X7CC 4E9SA 2PN5A 1L9OA 4XVSH 2ZWYA 1MXDA 2DD8L 4KJPC 3UTSE 3N1MC 4U6YA 3DOHA 4JO1H 4P59H 5AVXB 3NRQA 4FXGC 3UROR 3MV7E 4CMHC 5JXEC 2NY4D 1UADC 2A6JB 3QZPA 4CSTA 4NQXB 3FAWA 1AH1A 1EEYB 4UAOC 4QF1A 3IEAA 3DMMB 4G6FD 4BXVA 1GZQB 1G0YR 1NGPH 1X6NA 5LG1A 5EG6C 4BH8B 1MWOA 1XCTA 3P02A 3SKNB 1J18A 4PSPA 4UM9B 3VD2A 4AGMA 3WGUB 4NC2B 1BVNT 4IK7A 4CBPA 4GRWB 3BKJH 1JNLL 4LAQL 4A7TA 1WAAF 4OCSL 2ZKMX 3VMPA 4LHUA 2EILB 3D4CA 3RTLA 1WZLA 5IQ9B 3X11A 1W0YT 5L2KB 1NCJA 1MZZA 3X1BA 5IB2A 1HIML 1GGTA 4L0PB 5C0FB 3GI9L 5ICYA 1T1ZB 3PY9A 1QRNA 5HSFA 3L4TA 5I66B 2EDDA 1JZ8A 3U48A 4YSUA 2APFA 1PG7L 4HIHA 5H37G 2J8UB 2Z35A 4LKCB 3A4FA 3HI5H 3PHOB 2H41A 1IM3D 5T5NF 1FLTX 2X6MA 1BQLH 1TMCB 2NY2D 2R1YB 4LO9A 5KSBB 3GMOA 2LVEA 4NQCA 5GJTH 4HULB 1IAMA 1SJXA 1FFTB 1TMQA 1SJEB 5FKAA 3I74A 1ADQH 1IE5A 2CBMA 3FQUA 4Y9CA 2X1XR 5J6HB 3IDYB 4JKPH 4C57C 1SHWA 3MROA 3TM6A 3VTMA 4Z3JA 2FD6L 2LOEA 2NZIA 3S3BB 2XFGB 5CNHA 4O51A 3FB8B 5C7ZA 4CGUB 5JHBA 3VXRA 4PCSA 5DJZA 4YHKH 2Q9OA 25C8L 4KRNA 3RUGF 4BKTC 3F04A 2OI9C 1YEDB 4AEHH 4C4KT 1HNYA 1KEGH 1Z3RA 5F7UA 1YQ2A 3NFNA 4NQEB 4DP7X 1KACB 1T80A 3DJTA 3VXSA 5CWSA 4ZW7A 1HI6B 1LD9B 3PGCA 3U0WH 4QRPE 3EGXA 5I1AB 1EVTC 1OE1A 3D5OF 2WNGA 3ZYIA 2VM9A 3QAQA 4YJZL 3AWGA 2OMWB 3BGAA 3MJ6A 5AZEL 4LE8A 1SXNA 2YQ3A 2YKLL 2YRBA 3BQVA 5E8EB 5BRZB 1M9WA 1HZKA 5FYJU 1GYVA 4OLWL 3UTSA 1YYLL 4HXBH 1N5YL 5IMLB 5IQMA 3QUYB 1R1CA 2ATPA 3DC0A 4CU7A 5CEZH 1GY2A 2PPDA 2VKXA 3MV7A 4XI5C 2NNRA 4CSZA 5I0ZA 2VE6A 4P5TC 1SXZA 3MO1A 2OMTB 1J87A 1BXAA 4JPQA 2YSSA 3PP4L 2QV4A 4JFQB 5I24A 2BOCB 4LVEA 1DQQB 4K5PA 1ZXKA 1GY1A 3V0WL 3SE6A 4IOSA 4P4KC 2UVEA 4XOAA 2HLAB 3OZKA 2R8SH 1P1VA 1QNIA 4EI5C 2JKSA 2HG0A 1T20B 5ITFB 4MTMA 2XWJB 4R0LA 4IBTA 1M3JA 4Y5YA 2OYPA 4LT7A 2F53E 2BSEA 4X8XA 5F97E 6PCYA 4ZOAA 1VKXA 4HCFA 4K71C 3DVGA 4Y89A 3SE9L 1QW8A 4G8GD 4J3BA 5FK9A 1LO4H 4GQRA 3PGDA 4NQQA 3RE0A 2W92A 4XPGL 1PD0A 1UZ6E 1VPOH 1P5UC 3PWPE 4MRCA 4QTFA 1LXMA 5JORA 4ZBJA 1AQHA 4ONFH 2HX9A 3NCEB 1ETA1 1HSBB 4QYAA 2CAKA 4NQVB 4U0QB 4B9FA 1C12A 3RWJB 5EIIB 5TQ2H 4ELMF 3EO9H 4UQAA 1TVBB 2A83B 3VFGL 3T8MA 3O3AA 5HI3C 1HNFA 3O8XA 5IT2L 3B9DA 2ZXGA 4F80A 2MQ0A 5E6IC 4LLAA 3TONA 5FLUA 3SBQA 4NRXA 1YA5A 3QWRD 3WN5B 4ZUUA 4PGBB 5DD3L 3KLHD 5EC1B 4IKNA 4IRZH 3JVFC 1AQDB 1R3LB 2CRIA 3ZDZE 2OL3L 4UT9A 1OLZA 1NBVH 4QRPA 3WEXA 4JVWA 3AQXA 1QMUA 2ZP8A 4P5KA 7PAZA 9CGTA 2K9FB 1U30A 2CLZA 4GP4B 2XA8L 1SM3H 3HCVB 2A4EA 4EVNB 1HILA 3O9WD 1BAGA 4IKIA 4OD1L 1XH1A 2BWQA 2GBTA 2XV3A 1A4KB 4XHJD 3IGUA 3B7SA 5FOBA 1DQDH 1KB3A 2H0FA 1MFMA 3GZPA 4JFZL 5IBUG 4C4BA 3HLAB 4UQEA 3DUUB 2W0FB 3ROOA 2AK4D 2WUCH 2LU5A 1JE6A 1J8HE 3NA9L 2WVSA 4N2GA 1KBBA 1ZLDA 3WE6A 4B7LA 5CLWA 4W4OA 1AZRA 3UYOD 2DEXX 4QGTA 2E5EA 5CMAB 3CFEB 1NAMB 2R83A 3AADB 3TBTB 2JJSC 5T1LB 3BE1H 3QUZA 4QTIL 5D7JA 3HKFA 3P3YA 3MBEC 1DFXA 2AQ3A 1QP1A 4W6WB 3H4FA 4RQQA 2C9VA 5D2LF 4CILA 1J8RA 1UD4A 2VDQL 2OQJB 5HHXH 4RGNE 1ZY9A 3P4NA 3QDJD 2YZ8A 3P4OA 2QBWA 1CGYA 4X80H 2CH8A 3KJ4B 4XBGB 1UTDA 3DECA 5T3XD 1F11B 1I7RB 2F53A 3D25B 3MZGB 1RZ8A 3Q5OA 5D70H 2XQBL 5FHAH 3MBXH 2HJFA 4EKJA 1K3ZA 3H9YA 1I1AC 5F7LB 1I3RB 2CBQA 3ESOA 1KWKA 3MCG1 5CBAA 2N7SA 4N0YL 1YMMB 4X98A 5GZOD 2WLKA 3LKQB 3PWPA 1CG9A 4PWEA 1Y7VA 3WNLA 3C6LD 2IPTH 3ZO9A 2H45A 3A6CL 1KLGA 2WXKA 4WJ5B 2CGZA 4PRIB 3A6BH 3FRUA 3VU2A 2ZX7A 3B9KC 4JGMA 1E9OB 3ZUCA 3FFCB 1CXKA 1T0NA 1H6UA 3NZSA 3GYRA 4KKPA 4N26A 3CN4A 4PJBF 2I9TB 3QNZB 5C0IA 1YEIH 4K8RH 4L29B 5IOKA 1AI1H 1CB4A 5EZJA 2WN2A 1LMIA 2VLKD 1N4XL 3H4HA 3DNKA 4IBYA 2MMXA 4FN0A 1ORQB 4GBXD 1A02N 3JV6A 1JGDB 2VWEC 4YDKL 1IGYB 3Q1EA 3WFEH 2OBGA 5T1DH 1OSEA 3LNHA 4JFFE 4HJGB 4PREB 5J57B 1CFMA 1O0VA 3BSZH 2ENYA 3ABGA 3JWNC 2Y5TB 3ZPDA 1X7QA 3QPQD 4F15C 1UKTA 2PYEA 2YXWA 3BP6A 3KPOA 4JM2D 5EORH 5FW6A 4AIZA 4HVBA 1CBJA 2AZAA 1HESA 3CXHK 4NBYB 2YPVH 1LP9B 4APXA 1EBAA 2E27H 3WD5L 5IROD 4UINH 5F96L 4GO8A 3D51A 1WGOA 3JV0A 3NJFA 2Z4QA 4HETA 3VWKD 3WFCH 1J8HA 1XF3B 1OAJA 4LPUA 4R4FH 2W9EH 5C6PB 2D0FA 3Q7JA 5D7KD 2G5RA 3STBA 4XCFL 4ZTEA 3BWUC 5AD0A 3J07A 3MNVB 1QUNB 1JGEA 4D94A 1UT9A 3NZUA 3HJ0A 3V6ZB 5DEZA 3H54A 3RI5K 3IDXL 3MLRL 3EDKA 2JELL 1JK8A 2XXMB 2Z91A 1CYGA 3QFJD 1UD3A 1J86A 4A6YA 2IOOA 3BPCA 4KUCF 3WNJA 1YEGL 1ES0B 1SZNA 1J9TA 3D0LB 3RGVA 4BFIA 5I6OA 1ASPA 1ED3B 2WQVA 4P46B 3QZWG 1WE5A 3MOAL 3KPNA 1U6AH 2IEPA 4LSRH 3EOTL 3NAAH 1OQOA 3WJMB 1JZ5A 4R2GC 2QDVA 2ALAA 1XB8A 5HHQB 3D9AL 4AITA 1CXLA 4ZMZA 4PY8J 4OGZA 1KXTA 2NY4B 5ALCL 3C8HA 4M5YL 3OAUL 4YPGB 5FM5O 4F33B 5IJDC 4I18C 3RY6C 4HWUA 2R69A 1WT5A 1X9RA 1MG3C 1OT2A 4TOYL 1DANT 4YPJA 2R56L 4ATWA 5C0JB 5JIKA 2DQGL 1R5IA 3D33A 1KGXA 4YC2C 3V4PH 3ZKMC 1WWCA 4CSPA 4O4YH 1R17A 2AZUA 2YN3A 4LSUH 3WSQL 4DESA 4LHUD 5F3HB 1QA9B 1CYXA 1U8QB 2ZP9A 2HN7B 1Q0YH 1IZKA 1WDAA 3MLVL 3JTSB 5HVHC 4LSPL 4XVTL 4ZUTA 4OD2B 3QUKA 4QRSA 1ACZA 5LGJA 1QRND 2A0LD 4ZPTA 1LK2A 1UEMA 4DTGL 4DQOH 2PLTA 4YEEA 5E2UH 5AW2B 1GOFA 4F37F 2YLHA 3UL4A 1IQWL 3ULUE 2X2IA 4FKEA 3QJFA 1A9EB 5LQBL 2XJKA 1G7PB 2D31A 5CD5D 5FHBL 2YXVA 3RB7A 2X7LA 3ES6A 1YNKL 5SWQA 3GK8L 4XBPA 4G1EB 3LH9A 3UCQA 4NQCD 1JV2B 4KWUA 1K2DB 2EE0A 3K71A 4CMMB 4JFFA 5JPMC 4JFPA 4QXUH 4F7CA 5L2JA 4WGVB 1GJUA 1T21A 3RL1B 3O6FA 2WSPA 4K3JH 1TTUA 5DJDA 1HWGB 3J8F7 2VDMB 4MSWB 4Y5XC 1R4XA 2O6EA 4AGOA 3NJNA 2VLRD 4LCYB 2A77L 4OCWH 1UA6H 4NAQA 2DWEB 1KIRA 3LSOA 3TO4A 2FQEA 1KGCE 4NENB 4QRTA 3NTCL 2E4FA 5EPMB 4CC0A 4NHCL 3DI3B 3CIAA 3HNVH 3KCWA 3OJDB 5D1ZB 2WWMD 1FZOA 2FX9L 3W3BA 3CZNA 2QEJA 3MXVL 2V17L 1MW3A 1MWAB 2CR6A 3FU5A 4NRZA 1IVTA 5LWYH 4WU7B 1QOKA 4LKXB 3PRZA 4K4KA 4Q9RH 1D5ZA 2EO7A 2HWZL 4U31A 2AEPH 2FB4H 4HJ0D 3ZZSA 1WUZA 4R26L 3MUJA 3UAJC 1R5VA 2I69A 3P3SA 5FECB 1IL1A 4XZUA 3AW5A 3VRIA 2ZE0A 3BZFA 3QZMA 4J6RH 7PCYA 1KXQE 2BNUB 5F44A 1DQIA 1YYCA 3MV7D 3CHOA 2AJVH 3DTXA 1FIGH 3KYKL 4HUCA 3VFVB 2LU4A 3CZUB 1ZE3H 4GIPD 3JT2A 2IDQA 3WLWD 4I0PA 1CXIA 1GS8A 1UWXK 4QAMB 3L81A 1M7UA 3FW6A 3Q2NA 1V3KA 3HI1B 1KIUA 1WK0A 1KCRH 4HXAL 3T1WA 3BVNB 2HT4C 2MCPH 2WSDA 2ZOWA 4GP8B 4XCYB 2C3WA 4NLHA 4O00A 2F7QA 3FN0L 1I9RL 3F7KA 2XWZA 2CDFB 2Y3NA 1IAIL 3ORJA 2FVNA 1D3CA 3E6FB 4UT7L 5J1AB 5E5LA 3EGDA 1E8ZA 5ILTH 4PJFE 5CJBA 1AR1D 4JFHE 2QELA 43CAB 2AMGA 5KSAC 5AB1A 5J89A 1NCCH 3F7LA 4O02A 4X4XB 3ZYZA 1PZ2A 5KBKA 4Z78B 5IJVB 3HN3A 2FHCA 3T8VA 5BZDB 2R0KH 3BESR 5I1KH 1TR7A 2VLLA 1GJWA 3IMRA 4TN9A 2IFFL 1FZKB 2F7RA 1F4WL 4FNSA 5CIPH 5GS2D 3RPIB 3QR1A 1CE6B 3U4KA 1LE5A 2FX8L 4FA8A 2CIKA 1OF2B 2VC2L 3ZK0A 43C9B 4UUJB 3T3MB 4K7PY 5FUOL 5CEXA 5IESH 3HTLX 2K45A 4TQEH 4OQTA 4Q0XL 1CUOA 1I7TA 2H1XA 3HS0C 2G3MA 2MEJB 4X7FC 1KYAA 3H55A 4J1UB 3FUJA 4UBDD 3CQQA 1YEEL 3MTRA 4N0FB 4JNXA 4MQSB 4LRIA 5C0CD 3E38A 5HI5D 3PWUA 5GPRA 4LSSL 3K46A 4JY4B 3CVDA 1NOFA 3BD4A 3HPJA 4X0NA 4D0CA 5IEHB 2ICES 3ULVL 1MIMH 3IDMB 4XP9H 3QIUD 3KHOA 3V79C 2MNWA 1QEWB 5DMKA 4YGVA 4HZ1A 3N1PC 4ZUWA 1TTAA 4MA7L 5BCAA 4NN7C 2N59A 4HPOL 4S1SH 4OIIL 4QRPD 3GJFH 5FDWB 3TA3A 4HJJH 2HTLC 2F7IA 4N8VA 4WI3A 3QHZL 1QBAA 3GSNB 2OLDA 4KH9A 4TSAH 3UBFA 4TPRL 2D4DA 2R1XB 4HCIA 5B7MA 1UH4A 4K94H 5F89A 2LLGA 4PJDE 4WV1B 4XWGL 5IG7B 3U46A 2VKWA 3GLAA 3GSUA 4X7EC 5JA8B 2O5NA 1S7SA 1ETB1 5HDBB 3SB3A 1KXQA 1J0HA 1BVOA 3V4VB 3F84A 1YUHB 3MRGA 4R7XA 3HE6A 1DQLL 4M5ZL 3TBSB 1CI3M 1RZJL 5IFHL 3FSAA 3V6OE 4E5XB 4JK0D 4JHAH 3CZLA 5KSVA 1AG0A 5DJAB 4H20L 4GRLA 3VFRA 2GEQA 3KR3L 5D7JD 2MKWA 4M48L 1GTNA 3CN1A 3IGAA 3LKSB 4KKAC 3FH7A 2NY6B 2QDWA 2OTUB 3HZYB 4OGQC 4Z7OE 4FC3E 1KIQB 1AQKH 2PWFA 4FOMA 1EXUB 4OF6A 1EZLA 5D1XC 3MGOB 1I3GL 1E5ZA 3GBNL 4N2DA 1W72A 1H5BB 5B38G 5TF1L 4N1HB 4PJFA 1XGUA 4HQQH 1FRGL 1UOVA 1FFQA 5I1JH 4O58H 2X4OB 2BWDA 4A2EA 4WO4C 5EC2B 1Z6JT 1GHFH 2MOGA 2H26A 2CCWA 4ORZC 5I8OH 2OJEA 3PWPD 1RUQL 2GT9B 5CO1A 2FBJL 2IV8A 3PLYA 1MCIA 2EUVA 2PPCA 5I71B 4FKHA 4JHVA 4F2FA 1TF4A 3WNPA 4AQ1A 5C09B 5F21B 4FFZL 1KCUH 4PTTA 1IIIA 3O2WH 3DO7B 5HDRA 4QRUA 2BSTA 2QMKA 3UJJH 4HWZB 1XCXA 2A6KB 2ADFH 1D6EB 1NIFA 3ILQD 3U25A 3BW9A 1ZJBA 3DI2B 1JGLL 3LV3B 5IJKA 1ROWA 5DWUH 1NEZB 4HFWA 4B96A 4YBLB 1XGRB 2F74B 3O6KL 3L3GA 2X89D 3CSGA 5KYXA 5CINL 5KANI 2NZ9D 1IFGA 3CSPA 5DLML 1F0LA 1J5CA 3ZYJA 1WVZA 1LWJA 4NP9A 5G5DB 2AVFA 3QXDB 4HMEA 3M17B 3Q48A 3G5VA 4Z7WE 3VD4A 3PUUA 5GS3A 2VUKA 1RZKL 2VCOA 2M83A 2IWGA 1KPVA 3UDWC 3P4LA 3H3KA 2FNWA 1TZHA 1KPRB 4N6RB 5FXCH 3E2HC 3IDJB 3WFHA 3KJ6L 3Q6FA 5C0DB 1JYWA 2HFFB 4PJDA 1TYJA 1EHXA 1IEHA 3JTTA 2ZYHA 4KQ4L 3TT1H 3X12A 1NCBL 2W91A 3DX9B 1HHIB 4GKNA 5HHNA 3FQ4A 1TENA 3K5RA 4KKNA 2MOVA 4HKZB 2FLBT 1V27A 2QHRL 3F5WB 2R27A 5H37A 3VWKB 3V6OA 4HCRA 1B0GA 4ISVA 2P8MA 3SY0B 4EZKA 3K6SA 4R90L 5BVJB 1T7ZA 5KS9F 4KVNL 5T5NG 4MJ5A 1K85A 4HF5L 4RGND 1CT8B 2NY3B 1M71B 1HFUA 4LP8A 3QFJB 2JH2A 4ODUB 3OKOB 2V3EA 3T6VA 1UHVA 1NMBH 3LJ3A 4NLAA 2C1PA 2OJZL 1BXVA 4JQIH 5EUOB 1ZT4B 3GZOA 3LS5H 5FA4A 3DVNA 5SV4A 1QKZL 1RJYA 3A23A 3ETSA 4JZNB 1A3LL 3IVKB 2AHIA 1M2OA 3OKLB 5CR1A 1C1EL 2XWXA 3FUHA 3LNDA 4YIQB 2PCYA 3OAYK 1C08A 5E2WH 3VE0B 3SKJH 1T4KB 4BYHA 2C7UA 1T0MA 1XVSA 1G7QA 3T0XA 3LD8C 3Q1SL 1XSOA 4N87A 4N2HA 4XO5A 1OAZL 2O26U 4K3EL 4OLVH 1FFNA 3O45B 1TPXB 5FPIA 2QADB 1NKRA 4MZ3A 3VW3H 4DZ8B 4Y1TA 2BSSB 4MMYA 3FSWA 3FQXB 3K6IA 3VO0A 3QZBA 1PX4A 3EG9A 2NXYD 4RZKA 1FZJB 1NLBL 3CSYA 3D85A 3MOQA 3D50A 2WZPA 4Z7NF 5K39B 4HMCA 5SX5K 1NUDA 5DMIL 2Z8WC 3J27A 3LEVL 5MEOA 1U91A 3HZKB 3NGBC 4MCMA 1A7RL 5JXAH 4IGBC 1LNUB 1W6WA 4JFFD 1IBYA 4KDTC 4LIQH 4EZLA 4LEEA 3ZTJG 4Q9CA 4Z7WA 3T71A 5FYJD 5D96B 2GTWA 1QFWL 3DX2A 3WU1A 4FFVC 4BUGA 4KZEH 1UFGA 2Z7UA 3VH8B 3CFMA 1RZGA 2HJLA 4DH2A 1MJ7H 3GXDA 4FG4A 1EEUA 3DOIA 3BWUF 1BM7A 1FCCA 3C09B 4L5FH 2JCCE 4BV1A 5C71A 2FHFA 1FBIH 3ALPA 1TDQA 3TO4D 5ISZE 5F7KC 2VLRB 2WLMA 4JPWH 4XX1G 1JFQL 3UGXA 4CADB 2VMDA 1IAOB 3L1FA 4LBEA 1OOWA 5I6PA 3RPKA 3L5IA 3HRZB 1FORL 1UVQA 1YZZA 2I5YH 3LEXB 3DMMC 5FS5A 3CFJB 4C55A 5F8RC 2V5TA 3UJTL 3HMWL 5D8JL 4DUWA 2PWEA 2WQAA 1XAUA 4Y7OC 2Z1PA 1VHPA 4LBAA 5GJSH 1MQ8A 1JP5A 1MCDA 1TQSA 1X5ZA 2VZUA 3LRSB 4GRWH 2N0KA 1BWMA 4RGMB 4JJ5B 3E9UA 2Q3XA 1JRHH 3OLDA 1ZPLA 3ARGD 2XTLA 3JWOC 4I0PD 1FNEB 1WBXB 3SYPA 1AG6A 3ZBMA 4WFGE 4AENB 4YLQT 3X1EA 3QJHB 4A2HA 3RDJA 4X5PA 3BFWA 4JLRA 1BZ7A 4XC3H 4LCVA 4G8EB 1H3TA 3KPQA 2C5DC 3ZKND 4EBQL 1D5IH 4OLYH 1CICB 2Z93B 1FVCA 2GI0A 3ZTCC 3ARWA 1B2YA 3FUMA 5AW7B 1N68A 3NVQA 5E1IA 5CLZA 2ZKHL 1OTSD 2HA1A 2VSCA 3CE1A 4X5RA 2YEZB 3IDYC 1OF0A 4IEFB 5ICXB 5KBNC 3ZSTA 2IQ9H 4U1KB 2EYTB 3NN8B 4EQ2A 3ULUD 4JZOA 1JZHA 2JTYA 3VXNB 1JHKL 2CO7A 1HU8A 2W95A 4B3EA 1K72A 3LPWA 3QRLA 4ODVH 4YQXL 1AIFA 4X9HA 4ZTPL 2W5PA 1U58A 4KK9D 4YHIB 2K1MA 3NFSL 4QXGL 5GRZA 3WIIL 1A66A 4PJHF 3OAZK 4ZD3H 5KVGH 1WV7T 3UO1L 1AD9B 3UAFA 5KJ7E 1KJ2A 1A9BA 4L3CA 1SHSA 3DSNA 1THAA 2JCCA 2VZOA 2OMZA 2WQXA 3GHEL 3GMNB 3MLTB 2WN3A 3OB0K 4PR5A 5C0CB 2V9UA 4JG0H 5ISZA 1KGCD 1TNNA 4TULL 5CN3A 5ALBH 1GMIA 3EH1A 5EU4B 1MJ8L 5MI0B 5IJCC 5DHVH 4NUGL 4AUUA 3QIUB 4KK8C 5D4IA 2NY7L 5AAWA 1KB5A 3TA4D 3NIFF 1P4BL 2BIIA 3TO2B 1JG9A 2ADJA 4Q9BA 3ZE2F 3R0NA 1Y1UA 3ULSA 2WNXA 4B27A 1OAQL 4TNEA 2J56A 1UXMA 1U2HA 4KY2A 4X6CB 2PW1A 5F3BA 2OV0A 3K2UH 1JF1B 4PB9H 5JOFA 1GMEA 3TBBA 1BVNP 1S7UB 4FYTA 4OY9A 3KNBB 5TH2B 1FE8H 1K5WA 4HUUB 4JN2A 4F3FA 3V9CA 3HE6D 3N44F 3GXUB 5F88A 4ALAL 1SJHA 2FSEB 4HKBA 5GRJL 3APMA 1R3JB 5JPNB 3WKYA 3O41B 1QLRA 4K7FB 5DA0B 3OKMA 3SDAB 5DZ9A 3ZDXF 3QXTA 1KTLA 2PR4L 4AUJA 4Z7VB 2V5MA 2WBJB 1DO6A 3G5XB 3CDYA 3CVHB 4BGLA 5KVFL 1R3HA 1PEWA 2LABA 5C1MB 1IX2A 4R97B 4RCAA 5HD8C 2OS7A 2F1EA 1OAYH 3U7WH 5AWNH 4X9BA 1XR9A 1DJGA 2GPZA 1MHEB 1IMHC 4XMPH 2BS71 2UXFA 4JFHD 1JMZA 1ZDSA 2QQNH 4MCYA 4DOHB 4KHTH 3NDYE 4LOUC 4F24A 4EN3B 3CZJA 4KMTH 4X7TB 1SY6L 4XCEB 3C08H 3NIDB 4X42A 3Q05A 3MLZL 4M43L 3VACA 1YJDL 4BQ6A 4CC1A 3WL9B 3OZ9L 1FA4A 2Y2TA 1PBYA 4QD2E 1BG1A 1A1MB 1U8JA 5HHPA 1CTNA 4AQOA 2VM3A 1L7IL 2O6CA 5INCA 1JJUA 4D7PA 3IMBA 2DQFB 4DW2L 3BP7A 2DLIA 3ARVA 1W6LA 4PS3A 4DKAA 4P9HH 3FU8A 4PI2A 1GW0A 5KYUA 1V05A 2DQIL 4YEFA 3T09A 3QUMB 3H9SB 1OW0A 1RIVL 2AEWA 3FOLA 4KPHL 2J8HA 4ZO7A 4KH2A 4YDIL 1UJ3B 3LPFA 4TQIA 3P9MA 4JKMA 4QHLB 2XY1A 4O2FA 3LZRA 1QBLH 2OCFD 2X4NA 4WQOA 5FCUL 5JDSA 1JDAA 1KLFB 5D71H 4WWKA 5B1KA 4HGKC 5J6SA 3WUZA 4U6TA 1NAMH 4R4BA 2X4QA 4XNQB 2ARJQ 2EQDA 3OHXA 2Y2YA 2R0WL 1IC4H 1JV5B 5BRPA 2WB1A 5EF1A 3CBKB 3UZEC 4ZZKA 1YN6B 3S37L 1MIEH 3BKML 3NIGB 4G9DB 2UYLB 2FHBA 2ITCB 5DZOA 1NL0H 2BVQB 1NDMA 3GXFA 3L4UA 1MRFH 2GKIA 4HU2A 5E2TL 2IIJA 4HEME 1OO2A 2HJKA 3FO1B 4XVUD 1KT2A 4H25B 4I9XA 4NJAL 3R06A 1WIOA 5E1AB 2J44A 4WEBH 2AQ1A 3TNMA 3BN9D 3N1FC 1OK8A 4V11A 5ICUA 5C0RL 3KDMB 1PKQB 2YBRB 1N64L 4IMKA 4N86A 4U1MA 2JB6A 2MSPA 4XRCB 3B1UA 3BD3A 5I2IB 1FYHB 1O9VA 1ZJAA 2JSFA 1HOEA 5ANMB 3BPNB 4NNXB 1UZ8A 3BH8B 2FR4B 3BEVB 4AC2A 4RAVA 3QWNA 2WYIA 1A6VH 5B8CB 4YXLH 4PRHD 1AP2B 1E2VA 3DOSB 4W9CC 4AVIA 2ZSWA 1P5VA 1WGVA 4XO3A 1S9VA 4AJ0A 1JGVL 3IFNL 3QK0A 4TVPE 1TTBA 2VXQH 1NLDL 3EKCA 3MCKB 4XMKH 3LYRA 3QYMA 1QR4A 1KTDB 4OZFB 3ESMA 5LGHL 1Q0EA 3OG4B 2UWEF 4LCCA 1I7ZB 1CFNA 4IHOB 1UACL 1I8MA 1QSEB 2MPAH 4IK6A 1RD6A 5EN2A 3C9NB 2K6YA 5ACZB 3QIWD 3QI9B 3P0YH 2ODHA 5JIMA 2D0GA 2RFXB 3S4SG 3L3KB 4I89A 3RURA 1MLBA 3FB6A 3TZVD 2NQDA 3FUNA 1DQJB 1N59B 3ECWA 2A9MH 3SDCC 1UA3A 5I6XB 3RTQA 1R47A 4GLRI 4N3TA 5B3JE 1KCSL 4AV5A 4FTDA 4TUKH 3TGXA 3ARTA 4DO4A 1S9YA 4JX0A 4CN6A 2ID5A 3O81A 2AJSH 1U8KA 3UJIH 3PHAA 3QS3A 4YWGH 2P8PA 5GGRB 2DH3A 1HINH 2OL3B 3KM1A 4UOQA 5L4FA 4AXWA 3RU8L 4FQLL 2BP3A 2V3DA 4ZO6A 3I50L 5DVLA 1YDPB 4Z9KB 5ECJE 4P46C 4PJXB 1S7WA 4LGPB 1RK0A 3TCLA 1ZHNB 5EIVA 5I8CB 1RSFA 1CZ8L 3K6FA 3L3OA 2KT6A 4QNPE 2ZP0T 4GXUM 4XPTL 1J1XH 4IRSA 2W59A 4K9EH 2IV9A 3E1F1 4PY7A 5DJ8A 5DYOA 3P77B 4UT6H 1BXXA 2IF7A 4NM8H 2HH0L 5FKPB 3KLQA 4YSSA 3MA7B 5DC4B 4IMLB 3RDTD 2EXYC 1CD1B 1TZOA 4O5LL 2WZAA 2XWTA 4BH7B 2BOLA 1FYTD 1ODAA 1UD8A 5F1IA 3BT2H 4UM8B 4LLVA 1E65A 1WISA 2G4GA 3ZE0B 4IBVA 4OW6A 5ID0A 1JN6B 1CYWA 2E9JA 4XNZC 2AI0L 1E9PB 4P2AA 3TBWA 4HKXB 3UBXG 2DM4A 4X4ZA 1I9JH 5SX4H 1FLRH 4MA1C 5EZOH 1P84K 3KH3A 4FG6C 5CCHE 4DZBA 1MRDH 2ZOUA 2CO6B 4O9HL 4AE0A 1MI5E 3OKEA 1VFBA 3L9BA 4U1LB 4XVJH 2H1PH 4Q2ZB 4IRJA 2GITB 2VDOB 1IBGH 5HBBA 3LZFH 2Q86B 1PCSA 4XPBH 3OQ3B 4UILL 2DBLH 3MRNB 4DK3A 1NGWB 1U8OB 1M57B 2XXFA 1WAAE 3WIFB 1YEFH 1HDMB 1BOGA 4ZW8A 2FSDA 2ZSVB 2EVFA 4PJAB 3LRHA 3HBGA 3P9LA 4OSUL 4RGOL 1MCHA 5GS0L 4G42A 4QLRA 2VDMH 3NSDA 4EN2A 3CDZB 3FRPA 1J1PL 1DJYA 1B3IA 3ZQWA 3FO0H 5I5JA 1KYOJ 2IXQB 3HFMH 3CQPA 2XN9B 5DTFB 1CD8A 2JJWA 3D06A 1NDGA 1WIUA 5D1ZC 4AH2B 1M2VA 1UUSA 4NPYA 5EWIL 4LK4A 2YPLD 2J55A 2VXVL 4LNVA 3UG4A 2YD5A 5LAXB 5GGSB 1MWAH 5IMOB 4JB9H 1ODUA 4JFYB 5TF0A 3SCMA 4XC1H 2Y7SA 1H9VA 1U0QA 1U8PB 2K7PA 4IKKA 3X1GA 5B38A 4HIEA 4AG4H 4NWTL 4ERSH 1H3VA 1U8IA 5GZNC 5HGHB 5CJXC 3OKDB 1ORSB 3RUGE 2FIKB 3EJJX 4M6ML 2J1YA 4ZFOB 2VISB 3GS0A 4UTBA 3TS8A 4R83A 1EV2E 2CUMA 3ATEA 4XN2A 3PUCA 3EDDA 3KWTA 3RKDD 3ZR6A 4GRWF 2LV4A 2PUQT 1P7KB 4WI8A 2Q8AH 3L48A 3LXCA 5I8KL 2H6PA 2CO4A 3T04D 4F57L 1N2RA 3RVTD 1KDJA 4OR1A 3F58L 2YK1L 4XNXH 5JMRA 1X5FA 3RFRA 2C1OA 4P99A 1G7IA 1UZGA 2J73A 1SYVB 5I30H 5I26A 1ICTA 1RZ7H 1T2XA 4XMLH 4WAFA 3OL2A 1YQVH 5F0PB 4PRPE 1FO0B 2JKTM 4WVRA 1HZHH 4WFGD 1A4BA 1NCDL 4OCYH 3WIAA 1VFOA 5H4YA 1B4JL 4XP6H 2Z0UA 1MI5A 1IFRA 4YO0A 1S7QB 2HT2C 4IYKA 2VZ3A 2V5SA 3DX8B 4HX1B 2XKNA 1U3HC 3I85A 5E8PA 4DQAA 2HRHA 1G0XA 1IEAB 4Y4HB 2X3AA 4JN1L 3QJUB 1W9XA 2IOMA 1IQDB 2FECI 3QDAA 4L0YA 2VIRA 3I3DA 4H1LB 2NUTA 1SQMA 3OBAA 4F93B 4R3SA 2ORBH 2XG4A 4LNRA 1J9RA 1DBAH 4XX1E 1KYDA 1BECA 4I3RL 1VFMA 3JUYA 3SPIA 3F6LA 2J6EH 2FAUA 3NUKA 3PGFL 1WIPA 2CKBA 3GNML 3GWJA 1T1YB 3KWWB 4LRNH 2OFQA 5E94A 3D39B 4MDIA 4NSKA 5DFWH 2BNRE 1L9TA 4JAMB 3HLKA 1F4YH 1X5GA 3MYJA 4HDIB 4MXVF 5D6CB 3U9UA 1L0PA 2I07B 3KLSA 3FF7A 3OX8B 3SZKC 1X5LA 2M8XA 1IGJB 4N2BA 5FOJA 2DRUA 4PJ8A 4D8OA 2NUPB 3FQ1A 5F7DA 1JMXA 4BKSC 3BP4B 4P2RB 1OGAB 3ZY7A 3ARXA 3MBWA 1Q90A 4WV1C 1WEJH 2GYSA 4G9FB 4IS6A 4G83A 4KTEL 3QG6A 2LU3A 3RUGA 1OB1B 3VRLE 4XCNA 3V0IA 3DIFB 3PYCA 4NZTL 3RYMA 3X13A 1F3RB 1WICA 3E7JA 1QSFB 3FUIA 3V4VH 5A3ID 1MAJA 3V5HA 1FH5H 3B6SB 4WFFE 5C6TL 4NQUA 5T1MA 1JZ2A 3CIQA 5GGTA 4I4WB 2XUWA 3BQUA 2HMID 3SE3A 2NY6C 1MW2A 1TU2A 4Y2OA 5J13B 4HH8A 2XBDA 2QKIB 7FABL 4F37K 4LASH 4WY7H 2ED7A 1OM9A 4XMVA 5BJTB 2XZQH 1CLVA 5F3FA 4A6YL 5E08H 3GHBL 5EO1A 4PRPA 3N5AA 4KROD 4ZT1A 2PTUA 3VU1A 5JUEH 2XLLA 5T3XH 4HEPG 4Y1AD 5JYLA 3Q3GA 3S3PA 2BM3A 3MKGA 4N68A 1XH0A 3KGUA 4JFEB 5TE7L 4ODSL 4U6HA 4GRMB 4WDIB 3ZE1B 1QTSA 2BZCA 2CUHA 2PP8A 2YJQA 4HS8L 2F54D 5I71C 3KGSA 4C59B 2MCAA 4PJ9A 4JO3L 5DMYA 2UZXA 1NBYB 5HYFA 3T2PA 1HL9A 3QIBC 4XAWH 1XF5A 3MRDA 3LMJL 2QPFA 4GQ9H 2OXGB 2VXSL 2BVOA 5IF0B 2MQ3A 4JKKA 3SPVA 5I16B 2D03H 2H7WA 2R29L 4LLQB 3KPLA 2N56A 3D2UB 1IKOP 1CLYL 3Q8CA 3FQRA 3M7FB 3IXAA 3EYFB 5CCJA 2CDEA 3KCPA 1NZRA 1N7MH 1OCWH 2J1XA 4EUPG 2AABL 2QVMA 1AKPA 4FI6A 4DEWA 1MJJB 4PRHB 3F12B 5EEXA 1MNNA 4ZO9A 2BNRA 2TSBA 5T1KB 3SDXB 3VXME 1SLVA 3BKCH 4S0SD 5B39B 3HC3H 5EOCJ 3T6XA 1S7VA 3NJJA 3W0WB 2VC2B 4CGTA 4H0LC 2DLFH 2TRHA 4L37B 3IJSB 2PO6B 4JG9A 4Y19E 4OCMC 5CLTA 2X88A 1LO0L 4PP1D 5LBSL 5DEGA 1CR9H 3H2QA 4AM0A 5LDUA 1U33A 2IDUA 5PAZA 2VL4A 1ZTXE 5I74B 4J3UA 2JJVA 1J0IA 3JBG7 2C3VB 2CHZA 5TDNB 5F9OL 4DN3L 2AJXH 3AC0A 3ARFA 2G5BA 3QIWB 4G71B 3VMNA 1YUKB 2EVHA 4LSQH 3HG3A 5DI8A 3RTQD 3WO4B 3WXVL 4YNYB 3ERXA 5IB4B 4LU5L 4U33A 2J4WH 5LG6A 4L1LA 4JFOA 3ECBB 1IAKA 3MMEA 1B3JA 4AEFA 2PCXA 4ZDHB 5I1CH 2F68X 2AQSA 4DKFH 4EJ1C 3P4MB 3GZQA 3I75A 2NY3C 1A7OH 3APCA 3CZEA 3VA6A 4FERA 5K9JL 3O4LE 3MCLH 1ZHBA 2G2PA 4NEHB 2L7QA 1JZEA 4LGSB 4BFOA 2PXYC 1EHLH 4OLZH 4OZHE 4QTHB 4X7SL 2X10A 4NZFA 5T3ZE 4M7ZB 5DDHA 2E6JA 3BUIA 3ZZQA 4IRSD 2OTPA 3QWOA 3WIHA 1OZUA 4KHXL 4LARH 1X9QA 2DS4A 3CVIH 1OSPH 2XNAB 2K78A 4FJZA 5DR5H 5DZAA 3AS0A 3U0PA 5I8EA 1A2YA 2E56A 1RZIB 1I8IB 3GRWH 3M1BA 1WA1X 1X9UA 4KU1A 2IBZX 4Q4IA 1ZHLA 2F5AL 5EOCH 4X99A 4L1TA 2UZIL 4G59C 3FYIB 3IPEA 4XNBA 3ZXAC 4PI0A 4ZAKB 2XZCL 4ODXA 1TPXC 2QADC 3TVMA 4YXHL 2I25N 2BRQA 3DYMA 4JG1L 3X3FH 4ICWA 5IMMA 3EO0A 5T5FH 3MNDA 4Y7MA 3DYPA 1TT6A 2XQ0A 3UZVA 1LWRA 4OB5H 1CE1H 1J12A 4BZ1H 5BV7B 3OKNB 4G8FB 3BWZA 4IRJD 3GKWL 4M1GL 3QULA 1E6JL 2ATKB 1NAKH 1G6VK 3IF1A 3MLSH 5FGRA 3VXMA 4LF3B 3AQZA 2BFVH 4HUWB 2X4UB 3QDME 2VXTH 3QNYA 1E50A 1U92A 1HEZA 4H8WC 1JUFB 4MYWB 3T4AC 4YFEA 5D96C 3I9IA 3MJ8B 1S7RB 3H9ZA 3MXWL 4Y19A 1DBJL 4LESA 4LEXH 2QSCH 3GC3A 2CMRH 4ONOA 4OQTL 5I1EH 5IGXH 1SOQA 3EJYC 3D52A 5CJOL 1L9RA 1A8ZA 3BUYA 2YA1A 5DUPH 1Z5YD 1AKJD 3ROLB 1YECH 2DQHH 2YUXA 3QISA 3EJPA 1HQRB 5GGVL 3W9EA 5I1GL 2V2XB 1SN2A 1SUHA 5KYWA 5IQNA 1UM4L 1C9SA 3R7QA 2EUZA 1NFDB 5A2IH 1YNLL 3M88A 1FSKB 2DQDL 3ARBB 4Y4FB 3JQOB 3BH9A 2OMNA 2YPLB 3KPPA 4X6DB 1EJ8A 3L4ZA 2PTTA 4RA3A 3UTZA 1K4CA 3HVDA 1GTFA 2XN0A 4R7LA 4AE1A 4NJ9H 1OHZA 3BAEL 35C8H 1KC5H 2RACA 1CGSL 5I1DA 1WITA 3C6EA 1J5OH 2JF1A 3O4LA 2XYBA 4PP2A 4JVPA 1FVEB 5L7XH 1JL8A 1CGVA 3QORC 4OZHA 3W56A 4S1RL 4N2KA 4J8RB 2GSMB 3RIAF 2ERJB 1INEH 2Z31B 1CLZH 5DVOA 4D2NA 5IQ7H 2GCYA 1PY4A 3DBXA 1BFVL 2GSIA 3RIFK 5A7EA 1F4XH 5J8OA 3B7RL 3JWDL 3KXFE 3ALWA 5EB9A 2ICEB 3L3IB 2QR0A 1CICC 1P69B 1SPDA 4KTDL 2ENPA 3ELQA 1D2PA 2BO0A 3ZIMA 1OLLA 4XWOD 4Z7UF 1QTYT 1XGTA 3AITA 8FABA 2R2HB 3FTUA 3MLXH 4ZMQA 1BQSA 1K6QH 1YY9C 3SODB 32C2B 4Z7QB 5I1HH 5K1NA 5IREA 3ZKXB 2CLVB 4MAYC 3WNMA 5BS0B 4NKIL 1W72L 1HHKB 1MI5D 2BZ7A 1HX0A 1L5GB 3S2AA 4NKOB 4R5VA 3GXNA 3LHPH 1XF1A 4YBHA 1PQZB 1NC4A 1IGFL 3GMPA 3MUGB 5GHWH 4APQA 3GO1H 1BP3B 4BFNA 3JZYA 4DKEL 4LDCA 4L8BB 4OZIB 1A7PH 5DC9B 5IV2A 1DLFH 4ZJ9A 3TBYB 4DP6X 3QDMA 2VN5A 1YEHL 2BK8A 3PP3K 4OBRA 2IALB 1G84A 3MRRA 4UTAH 3L5HA 3QCTH 4HJIA 3VRJB 2NMSA 1ASOA 4Z77B 2P5WE 3T8XB 1T1XA 4LQFH 3V0VA 4GAGL 4TTDC 5I19H 5ADOH 2NTFB 2WBKA 1E4XL 4GAFB 4UOZA 2J20A 1BVLA 4FL4C 5MERA 2XV0A 2OYLA 4D3CL 4UIKL 2ZOTA 3S5LG 4MMZA 3QXAA 5AW8B 4YAQA 1T66C 1HJBC 3QH3A 4P3DB 5MI0C 5C08B 4DP9X 4V33A 2A4ZA 1T83A 4ILDA 4LCIL 2ZT9C 4OFYA 4P57B 4I1NB 4Q14A 4D9LL 4HG4J 3U6RB 4NNPH 1KXHA 5F7FA 2BC4A 3PWNA 4PBXA 4MD0B 4R5TA 3H42H 2R2EB 3WO3B 5LVEA 5FYLL 4PJ8D 2P80A 1O6TA 4UT9H 4XMZA 4G7YH 5HPOA 2WCSA 2WKLA 3VNYA 2BY1A 3MA9H 4LFHG 3UCRA 5GRUL 1MFDH 4BELD 2P52A 4G6AD 1NSNH 1NDTA 2ZF9A 4NHUA 1CFVL 1PZSA 3BDYL 5IFJB 4DGUA 1DFBL 2ED9A 2QZ5A 2A7BA 4IDJL 1DBBL 3K8MA 4F91B 4N0UB 1ITBB 1DN0B 5DS8A 3G6JB 4GP5B 4OM0H 3BQUD 3KXFA 1CK0H 4M3KB 4KO9A 2WBJC 4HCRL 1ZGLM 1FNFA 5AKVA 4AZ8B 4GW1A 3VI3E 2KZ1B 1JCKA 3CVHH 4MVBC 1URIA 1CFQB 1MFAL 3SIKA 3TFKC 2DQEL 4YHNB 5ADPL 1WFIA 4PRPD 3MTXA 2VXUH 4GY4A 3D3VB 3Q8FA 3O11B 1BFSA 1I9IH 1F5WA 2VJ8A 3S4SA 3SZ6A 3VI4E 2G3NA 3T3MF 4WW1A 3AAZA 1EO7A 4E9YA 3VQ1C 2Q5BA 5C70A 4FZEL 4D8PA 4RDQF 5KVDE 1RCYA 1TJMA 1FVDA 2Y06L 4XH2A 4HH9A 2FGWL 3GLDA 4Y1AB 1E9QB 4P2OD 2YQBA 4N2IA 4KDVA 2AXGB 3VFSA 4X8JB 4PJ9D 4R7NB 3S35L 3NH7H 4NQTA 1DVQA 2Y1VA 5IFAL 4FHJA 3VD3A 4XOCA 5GS1B 1BYNA 2AC0A 1C5BH 4ODWA 4WNQA 4UOJA 3NDZE 2B1HL 2P5WA 3FZUD 4HLJA 3RWDA 1KEMH 2AQRA 4PGDA 5E4OA 2R0LL 1XH3A 3IDNB 2X4TB 3ZL4L 5SWZD 5DWPA 3M45A 4I77H 2XY2A 5IMKB 5D72H 5CZXC 2DQTL 3GINA 5DVMA 3QUMH 3I6KA 3O3BA 1UJ3C 2XETA 2RQ8A 2AJ3A 3RAJH 3F7VA 2BNRD 1WCBB 1S5HB 1MCRA 1NM9A 3CLWA 1IGCH 3JV4B 3FTGB 4IU3A 3TV8A 1A4JA 4DO6A 3RVWD 3VJ6A 2EXTA 1N10A 2GTZB 1VJSA 4JM4L 4RFOL 4KNQA 2YA2A 4DP1X 5L8KB 1JZJA 1O7SA 3V52L 4NGHH 5AZUA 4JO4H 4PJ5E 1P7QA 4GSQA 2WXNA 4FQCL 4AVJA 1O7VA 1I8UA 3UTPD 2VRQA 4M29A 2ENSA 4HIIB 1XIWC 2GY7B 4B9CA 4V1DB 3ARFD 2B1AH 1JNNL 3K0YA 1LQSR 1JPGB 1GVIA 1AZNA 3MFFA 4OI8A 1MNUH 1BLNA 3I6LD 3MLPA 2GUYA 4GI6A 1HL5A 3D4ZA 3IJEB 3V9FA 5KW9L 3B2UC 5HHME 2NNCA 4PFEA 3FUFA 1FCGA 3SDYL 1YCSA 3VI3A 2NR6A 1E4WL 3UBXI 4PG2A 4POZD 5JLZB 1JXFA 1R5WA 4BZ2H 1M05B 3ZHDA 2EKJA 1E7VA 3EHBD 3FSOA 4UV4H 2BH0A 2HTKC 4H8UA 3VI4A 4P23A 3HRPA 2N1TE 2F58H 2XQYG 4QR7A 3NEOA 1KCLA 1SBSH 1DVUA 2QSTA 1A65A 4PWIA 3UO8B 2OJ1A 4XAKE 3SGEI 3BUBA 3MNZA 4YDJA 2Y6TE 5LXVA 4S10A 4MWFA 4B0MM 4JPKL 5BMFH 4E41B 4OM1L 5E5MB 5EO0A 5JW5B 4TLUA 2R69H 3SGKA 1XL6A 4YLCA 4WKXA 2XXGA 3B8YA 5DJ0A 2ZYSA 3TVMD 2XWCA 3VGAB 2LE9A 3W39A 3C5JA 1UCBH 2WKOF 4ORGA 1PLGH 2A1WL 2X0UA 4GAJL 3F01A 2WHVA 2PP9A 4ZFZA 4QKTA 5BRQA 4YHZH 5T8IA 5JYMA 1R3IH 3QI9C 3EYQC 5FO9B 1UM6H 3LDBC 4NO5A 1E6OL 2H2PC 5L0QB 3AABA 3VXMD 3DURA 3ET9F 1KPUB 1NMAH 2D0HA 1FIEA 2HYMA 4HSQA 4XP1H 1JHLH 1Q72H 4R96A 3HG1E 2C3XA 5KOVC 1BBJA 1I31A 1MUJB 1GS7A 3NCYS 1OAKH 4JR9L 1QW9A 4KKBC 4Y19D 4B5EA 2RALA 3HIZA 2J1KA 4XP5H 4CJ0A 3DWTA 4PJ5A 2R2BB 1E2ZA 3CFKA 1H15A 1RK7A 2C3HA 5FYJH 3T2NH 5K9OA 4XB7A 2DYPA 2NNAB 2FWOB 3R4DA 2ZXBA 1RMFL 4H44C 1I1YA 3CHQA 1DJZA 1KJ2L 3G9AB 2VDRH 4Q8BA 3BXNA 3N43F 3GJEB 5BW7C 4QRBA 5GGQH 2O61A 1M1XB 1WS8A 3DETD 1NCWH 1ZLSH 1AKJB 3IDGB 4PRDA 2R1WB 4CDHA 1MHPH 4XMWA 4M6NL 3OGCA 1YC7A 3W38A 3MJGX 1CC3A 2B9AA 4D9RE 3DV6A 3IMUA 1KB5L 2NX5E 3WY2A 3WJJC 1TCRA 1WZ1H 3L2NA 4JKLA 4HUXB 4LSVL 4JFVA 4WCYH 1BZ9B 2WSKA 2GIYA