2VSMB

Nipah virus attachment glycoprotein in complex with human cell surface receptor ephrinb2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
137
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEMAGGLUTININ-NEURAMINIDASE
publication title Structural Basis of Nipah and Hendra Virus Attachment to Their Cell-Surface Receptor Ephrin-B2
pubmed doi rcsb
source organism Nipah virus
molecule tags Hydrolase
total genus 27
structure length 137
sequence length 140
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vsmB00
4GP8B 3D12B 1OOWA 2GC4C 2PLTA 3QJVB 4E9XA 2HRGA 4NERA 2J5WA 1JZFA 1B3IA 1AS6A 3CVDA 4DPCX 3NJGA 1GW0A 1GYCA 4YSOA 4A2DA 2DYSB 4TXVB 4KNTA 5D4JA 1W6LA 1KDIA 1YLBB 1KBWA 1V55B 2VM3A 1NZRA 1PMYA 2AZAA 4E9QA 2BZ7A 2IAAC 3FSAA 3KW7A 2PP9A 1ASQA 3QJSB 4YSQA 1GS6X 2TSBA 2XVBA 1I53A 1ETJA 3DTUB 1ET8A 3IE9A 3JT2A 7PAZA 2GHZA 3EF4A 4A2EA 2IDFA 1AQ8A 2I85A 1MG2C 4BDVB 2XX1A 2XXGA 1IBZA 2FJSA 3X1EA 1AG0A 5B1KA 1M57B 4G70B 1EZLA 5I6NA 2GB2A 1PAZA 3U25A 3NSDA 3UABA 2EIMB 1MZYA 5A7EA 4E9RA 3ZIYA 3NJKA 1ZDSA 3V9EA 1PY0A 1ZDQA 4DP0X 4BXVA 2VSKB 1AS7A 5B1JC 4KO7A 5B1AB 3QJTB 2YXVA 1BQ5A 3FQYA 1JVOA 2PP8A 3WIAA 2J56A 1WA1X 2FWLB 2FQGA 4N4YB 1OCCB 3ASNB 2HX9A 4W9ZA 2LLNA 1ET7A 2YAOA 3NP4A 4YSEA 3CZUB 4PAZA 1JZJA 3CDZB 2BO0A 4DP8X 1PF3A 1BXUA 4G7SB 4YL4A 3V9CA 3PAUA 3T71A 3MX0B 3FS9A 3X1GA 5F7BA 3H4FA 3NJMA 2BHFA 5F7AA 2FT7A 4F2FA 1GS7A 2N0MA 1J9QA 3CVCA 2PP7A 2JFCA 2BP8A 2DV6A 1E30A 1OF0A 3FYIB 1OE1A 1X9RA 3NJJA 1J5CA 2AANA 1NINA 3AW5A 1NWOA 2FTAA 2IDTA 3FU9A 1NDTA 4KO5A 2X87A 5B7MA 4JHUA 2EINB 1KYAA 6PCYA 4DPAX 1PZBA 4NB7A 4GP5B 5TK2A 4P5SA 1W6WA 3NJIA 1L9QA 1QHQA 1ASPA 1AZUA 1SFHA 2R7EB 1PCSA 1J9TA 2PCFA 1A4AA 2IH9A 3CG8A 1WA2X 3NP3A 4BWWA 1A65A 3N55A 2EIJB 2YAPA 3PPSA 2UXFA 2ZWNA 4F7KA 4KNSA 2XYBA 5PCYA 4X4KA 1BYOA 2IDSA 5I5IA 2MTAA 1R1CA 1AAJA 1E65A 1RZPA 1SDDB 1L9SA 3DKHA 3SBRA 3CVBA 2XLLA 2UXGA 2PCYA 4KO9A 3ABLB 1MZZA 1BYPA 6PAZA 3S8GB 2GI0A 4DP6X 2WO2B 1ET5A 2AZUA 4BK5C 3OQRA 2DWTA 3IN0A 1M9WA 4RH4A 1PZCA 1OE2A 3NJNA 3UACA 3GYRA 1MDAA 1WS7A 2J57A 1SNRA 1QNIA 2HXAA 2MRYA 1KCBA 3HEIB 3OMNB 4YSPA 2CCWA 4HAKA 1DYZA 2XWZA 1M56B 1L9TA 1ZV2A 3UAAA 4A67A 1NTDA 2EIKB 2GC7C 3QJUB 4FAAB 1PLCA 3GXUB 4KOBA 3WNIA 4HCGA 1CURA 2YAMA 2YAFA 1GSKA 5AKRA 2YQBA 4QLWA 2PPDA 2QT6A 3NT0A 1JZEA 1AS8A 2UX6A 3T6VA 2HRHA 2GBAA 2P80A 4N8UA 4MFHA 1JZGA 2IWEA 4HHGA 1KBVA 3RYMA 3ABGA 3CDZA 2HX7A 2WO3B 4P5RA 3NJHA 3AG1B 4YSTA 1AZNA 2GIMA 2VN3A 3EH4B 1RCYA 2BP0B 1RKRA 1KGYE 2E86A 3WKPA 4AKQA 3ABKB 2DYRB 2HZHA 2ZONA 3JTBA 3FU7A 3BVDB 2XU9A 1HFUA 3PXLA 4QKTA 1GY2A 1FA4A 1L9OA 4A66A 1JVLA 2VW4A 5B1BB 1GR7A 4E9WA 2YAHA 1AZCA 2Y69B 3G5WA 2BWDA 3GDCA 4UF7C 5B7EA 2AVFA 4DP9X 2B08A 1SF3A 1J9SA 2QDWA 1WS8A 5I6PA 4DP2X 1TEFA 2UX7A 1L9PA 2RACA 2UXTA 4BWTA 1AOZA 2R7EA 1NIBA 3ASOB 1PLBA 1BAWA 5AZUA 3FSZA 2FNWA 5E9NA 3SBQA 5B3SB 3OMAB 3PCYA 3FQ2A 2CJ3A 2DY2A 2IDUA 7PCYA 1NPNA 1ILSA 4HCFA 1GY1A 5D4HA 2W88A 1AZBA 2P80D 1IBYA 3WI9A 4Q8BA 4DP1X 3C75A 3FU7B 4UAHA 2XV2A 3BQVA 3T9WA 2BW4A 2IWFA 3DIVA 3NSYA 1JERA 1SDDA 3FT0A 1SHWA 1OCZB 4YVUA 2BZCA 2ZXWB 1XMEB 3X2QB 4CSZA 2QPEB 4JKNA 5B1JA 1CUOA 4F2EA 4YSCA 2X88A 3IEAA 3WG7B 1GS8A 1ZIAA 1JZHA 5AFAA 1A4BA 1VLXA 3PAVA 3X1NA 2UXVA 4AZUA 1KCWA 4AI7A 1IC0A 3X1BA 1AACA 2FQFA 3FSWA 1SHXA 1XB6A 1OE3A 4JHVA 1URIA 4GYBA 3SQRA 1N68A 4GY4A 4YVNA 2IWKA 1AG6A 2OV0A 3QPKA 1CYWA 3WKQA 4A2FA 1SJMA 2JKWA 4UANA 3IBOA 1IUZA 4E9SA 4G7QB 2A3TA 3L45A 4WKXA 5D4IA 8PAZA 1V54B 2HX8A 1TU2A 5I6LA 3S8FB 1PNDA 2BP0A 3T6XA 2FQEA 5IY5B 4G72B 4AX3A 3MBWB 5I6KA 1UATA 1BXAA 1HAWA 2J55A 5I5MA 4Q89A 4AKOA 4HZ1A 2XV3A 2IH8A 2GSMB 4A2GA 3NJLA 3S3DB 2W8CA 1OCOB 1XB3A 4E9TA 4NAJA 1WAEA 4YSRA 4DP5X 1TEGA 3QJQB 3NJFA 4G7RB 3EHBB 1CYXA 5PAZA 3T6WA 1IKOP 3S3CB 1BEXA 1T5KA 4HCIA 1PLAA 4ENZA 1BQKA 2YARA 2IDQA 1MG3C 4E9YA 4GXFA 3SBPA 3NSFA 1SFDA 2I7OA 1E67A 3AZUA 1BQRA 3QQXA 4CSPA 5I6OA 3T6ZA 3KW8A 4BWUA 3H56A 5TK4A 1QLEB 4EF3A 3FQ1A 3UADA 3OMIB 3TBCA 2FQDA 3H4HA 4YSDA 2CALA 1NPJA 1AIZA 9PCYA 2H3XC 2H47C 2OCCB 3AG2B 1E5ZA 3UAEA 1BXVA 3ZX1A 2DWSA 3TU6A 1JZIA 2NRDA 3FPYA 3NSCA 1NICA 1V10A 4DP7X 3OM3B 1ID2A 1X9UA 1ZPUA 2Q5BA 2QPDB 2CBPA 4WTQA 5FC9A 4E9VA 2XXFA 4DP4X 1ASOA 2QDVA 4GP4B 3TASA 3AG3B 3PAZA 4HALA 2VW6A 3EH3B 2VW7A 2Y1AA 4W1TA 2OJ1A 3EH5B 1W8EA 2CUAA 2WSDA 3FU8A 3WNJA 2VSMB 1OV8A 2CAKA 1NIDA 3AG4B 3HB3B 2BWIA 3FYEB 4M3HA 3QJRB 1A3ZA 1JXGA 1ADWA 3AY2A 3IN2A 1NIAA 3S3BB 3ZDWA 2PPEA 4FA7B 3NYKA 3PLYA 4L0PB 1XB8A 1KDJA 4YSSA 4YSAA 2I7SA 5I28A 2H5UA 4KOCA 2VMJA 3TA4D 1RZQA 2VM4A 2FT8A 1JXDA 1CC3A 3OD3A 1PNCA 2JXMA 3FSVA 2FT6A 2YXWA 1AR1B 2HLEB 1JXFA 2EILB 1A8ZA 1NIFA 2ZOOA 4M4RB 4DPBX 4KNUA 5I5JA 2BW5A 2XUWA 1FWXA 5B7FA 2Q9OA 1NIEA 3FPXA 2PPAA 5EHFA 3TBBA 2PPCA 4A68A 1SF5A 1F56A 2B3IA 5ANHA 2PPFA 3X1FA 1OCRB 4HHWA 1HAUA 4KO6A 1N70A 1AANA 1TKWA 1A4CA 3UGEA 4AKPA 2BP8B 2XV0A 1J9RA 1L9RA 3ABMB 5I26A 2YAEA 3N2JA 4BXSV 1AZRA 1J5DA 1KV7A 4YSUA 1JOIA 1E5YA 4ZK8A 1FFTB 1PZAA 2XX0A 1NWPA 1ZIBA 1ILUA 2AFNA 4HIPA 3ZBMA 4BDVA 5I6MA 5LDUA 1EHKB 4PCYA 2TSAA 1WA0X 1DZ0A 2YAQA 4A2HA 4K9JA 3ERXA 4G71B
chains in the Genus database with same CATH superfamily
3PGFL 3LZPA 1BVKB 2PLTA 5DC0A 4MJ2A 4E9XA 2APFA 1WBXB 2PWGA 1GW0A 2PR9A 4JPVL 1OM3H 2PXYD 4YSOA 2D4DA 4TV3A 5D1XD 5HPMA 3SE9H 4Z0XB 3ZHDA 1NCOA 2ZNWA 3F12B 5SWQB 1SJXA 1NJ9A 2FHBA 4TKWA 4Y16B 3T0EB 1AXSB 3WDJA 1HTYA 2XVLA 4HEME 4PJXB 1G6RH 3S9DB 3KW7A 5DQJB 5A6IA 4S0SD 1AHWC 2X4NB 2YD8A 2IOMA 3IGFA 2QLYA 1UB6B 3UZQA 2EDYA 4HFWA 2GEEA 5FECA 1IGTA 2GHZA 1K85A 5B1CA 3WJMB 1BM3L 3U0WH 1DJZA 3BKYL 4JPWH 5KJRL 3H85A 5DS2A 4TUOA 2ILLA 4XP5H 1QPPA 4UV4L 3IGKA 2BHYA 1XGRA 1T2JA 2CLVA 1ETB1 3E2HB 4JFFA 4M03A 4Z7OF 4I48A 1O7VA 4WJ5A 5D2LF 3UGXA 4JN1H 1P7HL 4X7TB 2JMRA 3TV8A 4JFEE 1AS7A 5ALCL 5FF6A 4M7LL 3U4EA 2FJHA 2GBTA 1OAXL 4HIXH 1F4AA 4JCLA 1RK7A 4TTDD 1UC6A 1A6ZA 5AW4B 4GRLD 3L5HA 1D6VH 2WMPA 1QW9A 4I9XA 1YNLL 5FECB 2IFFH 4YC2B 5E4OA 2AJXL 3NP4A 3KWWA 3H9SD 4EE2A 2NNAB 5TF0A 5IHLB 3CDZB 1GIGH 5E8DH 1N12A 1M6OB 4G8GD 4EN2A 1TSRA 5D5ME 1GC1C 1HHGA 3DX7A 1P69B 3SE8H 2X0VA 3LPPA 4ZTOL 5LGKA 1CCZA 1HH9A 2N0MA 1T5XA 3FCGA 43C9A 2JKNA 3RILA 3RTLA 4WU5B 1MHHA 1NGYB 1NCJA 1QHPA 1TZAA 1UYWH 2D0FA 4OFPA 4PW9A 1GCYA 3OAZK 1I1RA 4JFFB 4N8VG 5F3FA 5KS9E 1D9KD 4M8QA 3NJJA 2AXGA 4W9KC 5FKAB 3IGAA 2COVD 4EUPG 2OS7A 2V7NA 5HGGS 4Z5RB 4TMPA 3UBXI 4J3OF 1N59A 1PL3A 1XDTT 1BFVH 2XNAA 3GBML 2AQSA 4G6AD 4PRIE 1A6ZB 5L7XL 4Z3HA 2Y72A 3F00A 4N2DA 3R4RA 3T08A 3QFDA 3WEAA 2OSLA 1KWGA 1BVNT 4GRWE 4PRDA 2QV4A 3CG8A 2WJ7A 3AS0A 3FO2A 5LNDA 3N55A 3V7AE 2DPKA 1MH5A 3FTUA 3BEVB 1T5XB 2WNKA 1IM9A 3QA3B 1M2VB 3EOBB 2ZWNA 4KX9A 3MMEA 1N5YH 4UMSA 1BCIA 1SYSB 5FDYA 3VX0A 2GJPA 1CN4A 2Z8WC 1BYOA 4M8QB 5DMIH 3ZTNH 4YDJA 1OY3B 2V7NB 1SDDB 5E4AA 5E1QA 7CGTA 1K8DA 2HSIA 3SBRA 1J0HA 4L1DA 2VLRD 3GSNB 1VZHA 2XNAB 5B4MD 2CWRA 3ZHKA 2V5MA 4KO9A 5T5FL 1GGCH 2YKLL 4MXVF 1NC2D 1XR8B 4ZXBA 3OKDA 1E9OB 2V17H 3B1UA 4RAVA 1F2XK 4CMHC 3QFDB 1M3JA 5HDOA 3ZDXF 1OE2A 5KJ4A 3Q2VA 5DMKA 3GYRA 4PRDB 3EBIA 2BY2A 5HYEA 4WRLA 2MRYA 2WZ5A 3FO2B 3TPKA 2VSDA 4G8EB 3S2CA 4G6KH 4NO2A 3DC0A 4Z7UF 3D8MA 1J8HA 3DX6B 3VXNB 3P0YH 4A67A 4P23B 1IAIL 1PJ9A 2PYFB 3HW7A 2Z35B 4M7LT 2V37A 2Z8VC 4OCRH 4IIQC 1GSKA 4PTTA 2CLRA 5AW5B 3PHOB 3MCG1 1D5ZA 4DEWA 5IESL 1WFMA 3AQZA 1K8DB 2O93L 5I9QC 5HJGA 3VGAB 1SMAA 4N86A 4PLNC 3E8UH 2BNRE 2YMOA 5DT1L 1DFBH 5HD8D 2O5XL 4ZXBB 2EZ0C 3MV7D 4LVEA 4RAVB 5DHEA 3PJNA 3MX0A 4M48L 3FRUA 3G3LA 4RGOH 4HKBB 3FXIC 1UQSB 2DRUA 1FCGA 1I75A 2GSIB 5DA0B 2XQYK 4O2EA 4BK5A 4ZX3A 3LD8B 5I1GL 3M17A 2R29H 5IVXE 3DV4B 4PJ5A 3N43B 1DTUA 3W11C 3TA3A 2XKNA 4TQIA 4QKTA 4N2OA 1VESA 1FA4A 1J8RA 4YDKH 5DDHA 4PJ8A 3ETBJ 1N6UA 4L9LA 3RGVB 4ALAC 1UA6L 3LQAL 1FFNB 3SKOA 4WKZB 1QSFD 2B5IB 4RGMB 2B08A 5GGVY 3WTXA 3CCHA 2A9BA 2CH8A 1LO5A 1WS8A 3UH8A 5CBAA 4P2QE 4ZFGH 2E74C 4GI6A 4H1LH 1N18A 1AHWA 2MMXA 4LB8A 2KPNA 4KROC 2B2XL 4JAMB 4D3CL 2OMNA 3QC6X 5IW6A 3C5JB 2P52A 2FNWA 1BMZA 1MFEL 3FRUB 5EC1A 2JKJA 3OMAB 3OX8A 4IRZH 3HAEA 1G9ML 3US0A 3T5WA 4HBQA 4HXAL 2Y5QA 1PLGH 5CJQL 3T8XB 4AW7A 1JGEA 4Q2ZB 3IS1X 3BH8A 5A16A 1DDTA 3N1QC 3EYVA 4XN8A 1IT9L 2IWFA 2UZYA 3AWGA 3I50H 5I19L 1FZJA 1MDTA 4OB5L 4PLJC 3ULUF 4ZJ9A 4V1DA 4YDIH 3O45B 4OZGB 3M45A 3WFEL 5DQDL 2X88A 5I1HH 1ADQA 5F2FA 3WFHA 5HDRA 1I9IH 2E76C 1QKZL 4HGWB 4K5LA 2OXHB 2OJEA 1EUTA 1R33A 4ZW3A 1KLFA 5FCUL 4P4RA 2VDQH 2XTSA 4LFHG 1USZA 5D8JL 3VXSA 1RZIA 1JZ2A 4KZEL 4GYBA 3UPRB 2VDOL 1JGEB 2BNQE 3B9KD 1JNNH 4NPYB 4B97A 1MY5A 2XZAL 3BH8B 5A16B 3RTQD 4J1UA 1TETH 1F97A 4RGNB 3KPRB 2DQMA 1FZJB 3ZN6A 2BSTB 3HNSL 4UANA 3TJHC 3W0WE 2Z1PA 4KZDL 4LHJB 5FUOH 3OKLB 4DK6A 4LSPL 3VGDA 3U2JA 1BQLL 8PAZA 4DCQB 2O61A 1E6JH 4WEUD 5H37G 5C7XH 2XZQL 3HB3C 1KLFB 4PUBL 4MQXD 1GAFH 5I1CH 5C0IA 3LZQA 2NR6D 4ZZFA 3OAUL 1RZIB 3RBSA 1EVUA 3TJEH 2YGQA 1OWWA 4N1CA 2F53E 5CZVH 5F9JA 2BP3A 1ZVYA 5EU6B 1HYRC 3RPBA 2H3KA 1YCSA 3RX9A 1F18A 4A2GA 1ZS2A 2XFXA 3PWPE 3R8QA 4JANA 4NNXA 2A9NH 5FO7A 3C12A 4X5RA 5A40E 2NZ1A 2VWEC 4NGHH 3MLSL 3BC9A 4JFUA 4QRPE 2ZOLA 4FEMA 3EHBB 5SWZE 1AFVL 4F5CE 3UYRL 2EE3A 5CAYB 2OW7A 1N4XH 4DAGL 2E6QA 3TESA 3WNKA 1KB3A 1LHZA 4JRXB 1I7RA 2XBDA 1OSZA 3WFCH 3ARXA 5E9DB 3CMGA 4PJ9D 5IKCA 3RJQB 3KW8A 3SGDI 3WEOA 1ZA3A 5CP3H 4M7KH 4D9LL 4K0OA 4W4NA 4HDIB 3WUWG 5AB1A 4NJ9L 3MC0A 3S48A 5JXEA 1OLZA 4IOIA 1M7IA 3MGTB 5B3NA 4GRMB 2OL3H 2XFXB 2ZCLH 3DX8B 1YEEH 3L3HB 4JANB 2Y7NA 3QCTL 4ZPTB 5FO7B 4X80L 4XMXA 1SEBB 3IJHB 2AXJA 2C1PA 3C5ZA 1JK9A 4IIQA 4Y0GA 4N0RA 1MRCH 1HX0A 5EWIH 2Q5BA 5ILTL 1FHNA 5EO9A 3Q43A 3IKKA 3MRIA 3NCCB 1DZBA 4YHZH 1PD6A 4NPKA 3AG3B 5C1MB 3LKQB 1B4RA 1NMBL 3O81A 5J9PB 1I7RB 5FK9A 3VI3F 2FH6A 2XG5B 5FA4A 1RJYA 2CUAA 2WSDA 2X4SA 2NTSP 3IU4H 4K2UH 1XCXA 3C6EA 5FYJU 3BP6A 5IKCB 3N85H 4CGTA 2WVTA 1NIDA 5JOPE 2VDMB 5GJTL 5D7HA 4OIIH 4IOIB 5INCA 2JK5A 3HG1A 4QXVA 4M43H 3ARGC 4XP4H 3V0VB 3AABA 3MJ7A 1KDJA 3B2VL 4AH2A 4Y1SA 2C1PB 4FQHA 3TA4D 4KWUA 3FONB 3D25A 1OGAB 1MFCH 5EO9B 5IMKA 3RX7A 3MRIB 3RVUD 3JV5A 5CD3B 2D03L 2J20A 3BDXA 5MHSE 1SZNA 1T0NB 4YLBA 2AI0H 3QPQC 1BLIA 2D7QA 4GQQA 3BP6B 3K8LA 3SD2A 3HNTL 4BUGA 5MEOA 2DJ4A 4PGDB 5B8CC 3P0VL 5CEYA 4U6YA 4LEBA 5C0ND 3NZ8A 5ANME 1RUMH 4LLAA 1QYGH 1UEYA 2JK5B 7FABL 1DCEA 1SF5A 3DIFA 3HG1B 1LJMA 3E6HA 2OR8A 3ZDZB 1P4BH 4XO5A 2XTLA 3MJ7B 3V4PA 1A0QH 1K3IA 2ZJSH 4E41A 5C8JB 4FQHB 4AKPA 3REWB 1HZKA 1DVXA 3X3FH 4Z7QF 4XBEH 3RQ3A 4EN3D 5IMKB 8FABA 1UACL 3BUBA 4FG6C 1JZ7A 1DJYA 1YEGL 2V7HA 4HWBH 4YHNB 4J3OC 5DUBA 3MXVL 3CZFA 1FH5L 5ISZE 2BS9A 1WG3A 4FHJA 2Y06H 5E1IA 3K2KA 1QRND 4IRSB 5DVKA 1U95B 1Y7VA 3ARFC 5JHDD 3QAZC 4K3HA 4MASA 4MQTB 5FHBH 3QULA 4PJHA 4K9JA 4U6YB 3NZ8B 5ABDE 3D12B 1A7BA 3I2CH 3GLZA 3UTPD 1FE8H 3DIFB 3FF7A 3LDBB 4PLKD 1AIFA 1UENA 1YYLL 4GUQA 4MD4B 5I16B 1CF8H 2E0PA 1ZJBA 4Z3IA 5A2IH 1MIMH 1GGYA 2V3FA 2CBQA 4E41B 3O2DA 3AFLA 2VRAA 3SE3C 1Q90A 3GLDA 3UJIH 2HT2D 4CW1A 3PV6A 2AV1B 2WLZA 4E9QA 3IJEB 2V7HB 4XXCC 2R2BB 5LUMA 1OGTA 5E6SB 2XQYA 1J7VR 4EEEA 1ET8A 3VD4A 3BISA 1MRFH 5I0ZA 2G5BA 5IM7A 3OKMA 1K4CA 2YPVL 4LNVA 3GXDA 3C5SB 5JPNC 3VQ2C 5IBUG 3DURA 5T33L 2GIYA 3AXIA 1NA8A 4LASH 3SYOA 3WNLA 3LOWA 4OV5A 1RL1A 1IE5A 1PYWB 1UWGL 5JXAH 1PZSA 2GB2A 1AIFB 3TEWA 1NEUA 1PAZA 5KYWB 3FB6A 1W0YT 4AGQA 4E9RA 2J1XA 3OKNA 4G80B 5GZOD 1QZNA 3B7RL 1KCRL 4P5TA 3V6OA 1DBAL 4QT5A 1RIUL 3OR7B 4OF3A 3FQYA 2GY5A 1MWAA 5C71A 3WIAA 1O5PA 1OGTB 3PYCA 4KKLC 4JREC 2N1KA 2FQGA 3TF7C 4H20H 1K9TA 4P07A 4QNPF 2ZPKL 1UKQA 3VTTA 2YAOA 5KEZA 1CE6B 2VDLL 4WWKD 4M6OH 2DF3A 2G5BB 1BD2A 4OGAD 1UWYA 5AVWB 1K4CB 5MENE 4JY4A 2QQLH 5IMLA 3HCVA 1X5LA 4G5ZH 4Y19D 4XPBL 4UQBA 4YIQA 3RDTB 4OV5B 1VPOH 5AAWC 1J86A 1KCSL 4X42A 4QXUH 3LS5L 3SCMB 5TGBB 2ZKYA 3FB6B 1NH6A 3E8VA 5LJYH 2EDMA 1CDJA 1IAMA 4H5SA 4HU2A 3OKNB 3UBXB 3PF2A 4HJ1A 3SQOH 4YLQT 4RMBA 2A9MH 4P5TB 2RIKA 25C8H 5DLML 4JHZA 3L3JA 3Q7JA 1LK2A 4CRPA 1ES0B 1MWAB 5DJAA 4BQ9A 5GS2D 2YWZA 2D3LA 1ZS8B 3KYOA 1CICA 3CK0L 3NN8A 3QDAA 2NQDA 2IANA 4LHUB 1BD2B 4N1EA 1EFXA 2GBVA 4JY4B 5IMLB 3HCVB 3WE6B 4ZOEA 3NP3A 1WA2X 1DQDL 4HJJH 3ZYIA 1NAML 4JO1H 4HS3A 3SIKA 1JHLH 2YGNA 3QG6A 3TC9A 4IK6A 4J6RL 5FDWB 1I31A 3II2A 2K9UA 4P2YA 4PRPE 1U36A 3ORJA 3BVNB 2XI9A 5CUSH 3QP3A 1KLGA 2AJVH 1UH3A 2YSTA 3H6JA 4XOAA 4HUNB 1KWKA 4LCWA 4DGIL 2K70A 2XQ0A 5D2LA 1L9SA 3MUUA 5DWUL 3D50A 1TMQA 4L1LA 2VLJD 5F9OH 5IQ9A 4AL8H 4NUGH 3SSGA 5DJAB 4XXDA 5EPMB 2KBGA 3GSXB 3S8GB 2AZUA 1F4WL 1LO4H 4E9LA 3F8UB 1IAII 1RJCA 2IANB 4WNSA 2YK1L 1EFXB 5CZXD 3KL5A 1DANT 4YSPA 5K9OA 3OMNB 2JCCB 3SO3C 1HSAB 3EYUH 4G9FA 3CBJB 1JF5A 2Y0SA 2WQSA 4WUUD 3CDGB 1EDHA 3K4DA 4XI5D 1PLCA 2IH1A 3GMRA 4WO4B 4N5ED 2WQUA 2Z91B 3L54A 4TM9A 2YRPA 4LVOB 4QLWA 4Z7OB 4G6FB 2NSMA 3P2DA 1T80A 5JLZB 3B6SB 2H6OA 2P80A 1R5VB 2AQ1A 2PW2A 3TONA 4BCZA 4IBTA 3L4VA 2ZWSA 1H0DA 1NANH 4AV0A 1ZGLB 4HHGA 2XCMC 4Z7IA 1J1XH 4DEPB 3NJHA 2NNXA 3TX4A 2APTA 4S1DC 1YMMA 4TRPL 3DJTA 5TTRA 3JWDL 3HZKB 1GPOH 5LBSA 3HAEH 1YEJH 5K9OB 5JHLH 1CDYA 3OKEA 3H0TB 4M62H 4UMGA 3ZL2A 3NEXA 1OSPL 4HUWA 4A7GF 1G6VK 1DBKH 3K74B 3QIUD 4P57B 4LEEA 4QF1A 3MYZA 2KI6A 5E8OA 3HC3H 1KOAA 2VDNH 4E9WA 2FO4A 2WQAA 3L4YA 3G5WA 2EEFA 4XZ4A 3ZPDA 2IBZY 1I8IA 3H7BB 2EVIA 3CFBB 1ADQH 1N67A 4XXCA 1QUPA 2CIKA 5GHWL 1MVYA 3IWUA 2UXTA 2DLGA 3ARUA 2PXYC 4B9GA 5D1XC 1A6VH 5AAMA 4LNRB 2KZBA 1IFGA 3K6IA 3L3OC 4XBGB 1HH6A 2E9GA 3NG5A 5DHXB 2R0WL 4GUPA 3VFTA 4ELKA 5JPNA 4HW6A 4E2OA 2D7OA 2BPBA 4NSKB 1O9ZA 4PJ7B 5EBMA 3FRPB 3Q6GL 4LP5A 5IROC 1ITBB 1RIVL 3BZ4A 2ERJC 4O02A 1U33A 4G8IA 3VE0B 2E6PA 4W9FC 4Z7UA 3OAYK 1QFWM 3MLTB 1G1OA 3FOMA 2VYRE 5DK3A 2WK2A 5HYQA 1SXAA 4JG9A 2CK2A 1UZ8B 1DQKA 4XAKD 1I8IB 4MNGB 5FYJD 3SYQA 5D93C 2V2TA 4YO0B 4P2OA 2MPAL 2R0LH 1KTJA 2Z0BA 4PJFF 3VYNA 4PJAF 4OUUB 1KCWA 2DM7A 1U8PA 3LEYL 4WW1B 2JJVA 4PIBA 1HH6B 1WIUA 1IM3A 4GUPB 3MLUL 4ELKB 2I07A 3S96B 4RWHA 2ZG3A 1XBDA 1AQDB 3ARDA 4TTDC 2PYEB 4U33A 2DBJA 2VC2H 4GRLC 3BZ4B 1F4XH 1S7RA 2ORBL 4UOW1 4HS8L 4Z7UB 5E4EC 4B7IA 3FOMB 3OXSA 4PJCB 5T1JA 4E9SA 3O4OB 1R6VA 4QHNA 4OIBA 4WKXA 4RDQF 1O6VA 2Y3AA 5SX4H 3QRGL 4LSUL 3D39B 3AMLA 3FUMA 3QFGA 2JIXD 2J73A 4L4JA 1EEYA 4IOFD 4M8RA 4M1GL 2ZUQC 2VITB 4HOXA 2ODIA 2DEXX 2W07B 4P99A 2FL5A 5FW8A 3VG9B 4NN6C 3LN4A 3HNVH 1NCDH 4U1JB 2O5ZH 1CFMA 4HT1H 3TH2T 3CFMA 3MNVA 3AITA 5I5MA 3TIEB 5T3ZD 3ARDB 4G6AC 1OARL 2E8ZA 4C56D 2R27A 1I7ZB 5GGTA 1S7RB 3B37A 4WEMB 1UGKA 4IIZA 1RFDH 3MN8A 2ROYA 4J3TA 3ZLQC 5ADPH 4K07A 5E1HB 4QHNB 1CLYH 1TEGA 5DJ0A 3O3EB 3QE5A 3SGJA 3U6RA 3TTSA 3VXPB 1FFOA 5IB3A 4FQIH 2ZG2A 3CIQA 2CKBL 3WN5C 4JFHD 3ILDA 4FKEA 1RURL 1KNOB 4YWGH 3GZOA 1BQKA 2OTPA 5D71L 2Z1KA 4YZFF 3CN1A 4BRJA 3O6KL 1O9VA 3VGGA 1E4KA 3NSFA 1GJIA 2E8YA 3QIWA 3AZUA 4CVZB 1BQRA 4AIEA 4HLZH 4N87A 4PU2A 4EI0A 4M6AA 5DEFB 1ZPLA 3DHUA 4FP8L 1T4KA 3IJ8A 3OMIB 1GTFA 3OAZH 3Q5YA 1CG9A 4NFCA 1T5WB 4WFED 1CVSC 2GJJA 1EZSA 1QBMH 4ELMB 5KAQF 4PRAB 1IFHL 4FLQA 4ALAH 2ESVA 3F7VB 2NY4B 3MV8D 4XC3H 5DJ0B 1UM5H 3TWCL 1ID2A 3GSUB 2R59A 3VXUD 3LEXA 1AGCA 3D09A 5K5YA 5E6IB 3FTGB 3W5MA 5JA8B 3KPLA 2VW6A 1RJZA 5HHMB 2LLGA 3SZ6A 2LTQC 4KMQA 4R5XA 1KIUA 3BKML 3QIWB 5F96L 3RFZA 3L81A 3AS2A 3FHAA 1OV8A 4XWOD 1T4KB 1HDMB 4XN7A 1CG9B 1PD1A 4WHYG 1SXCA 2UUDK 3VA2C 5HD8C 2K3TA 3AY2A 3L6FA 3F7YB 5C70A 3VH8G 1Y6KR 1FNFA 2WBXA 3A21A 2ZAHA 3V4PH 4AQ1B 2DMKA 4L0PB 3ULVL 3WXVH 1S7WA 1NBZA 1XTLA 2YD6A 5CIPA 5LAXB 3ZRSA 3T8MA 3OZ9H 3MRGA 1IVTA 2B39A 4GAJL 1E9QA 3LEXB 1AGCB 1RK0B 1CC3A 2BH0A 2WQRA 2JLLA 1LNUB 5CJOL 3IDNB 1RJZB 3L7EB 4D0DB 3DJRA 1GOFA 1UM6L 2J12B 3F6JA 3N42B 4ZPVB 1UUSA 2PXYA 4CADA 4C83A 1NIFA 1JV2A 3BW9B 1R19A 3L3OA 3PGCA 4NN5C 4F8OA 4H44C 4QRRD 1FAKT 3JV4B 3O2VH 4TVSa 3X12A 4AG4H 3UTTB 4UIKH 2R4RH 2AABL 4NUMA 2XZCH 5D1ZI 2B3IA 4JVPA 4FJ6A 2DLFL 2QL1A 2UY6A 3IYLW 5ANHA 3PWJA 3U2SB 4KQ3L 4NJAH 3EO0B 5AKVA 1WITA 4I0PD 3QYCA 4XP6H 3O2DH 3N9GH 1XZWA 2XV0A 1TPXB 3MR9A 2EDEA 2X53A 1L9RA 1X5HA 5KVDH 4OJDH 3KZ8A 3O6LH 2OMYB 4WF7A 5KSUA 2N56A 1ZTXL 3VCLA 3KS0H 4DQOH 3FTWA 4LSQL 3QWNA 4Z95H 5JOFA 4ZMTA 3FQXB 1B2WL 1F1DA 4ISVB 3V10A 2XX0A 3VD3A 1ZIBA 4N1HB 4RAHA 3DO7A 4AE1A 3WSQL 1QQDA 1MCNA 3F04A 3VI3A 1H6FA 2A6JA 3HLAB 1INEL 5CN1A 3WFBH 2FAUA 2HFTA 5EO0A 3V95A 1IGIL 4CN4A 3P11H 3F2LA 2KMWA 2EIZB 1OOWA 4G71B 4BZYA 3ZIMA 5DUPH 3ZHFA 3QJVB 3M1CA 2IV8A 4Y2OA 2YWYA 4YGVA 2UY6B 4QR7A 3NJGA 5TH2B 5GRJH 5AW6B 3H9SA 3PHQB 2K6WA 2QKIC 4Y8AA 3ROLA 4APQA 1J8HE 3FBQA 5TDPB 3KPQA 4G8GA 4OZFB 1BA9A 3NFNA 2KKQA 1YLBB 2GY7B 4G1EA 4PEEA 1BQUA 2A77H 2VM3A 4MA7H 3B9KC 5IQMA 1KEMH 2IV9A 2YLKA 5KSUB 3F7KA 2N59A 5T1LD 3RTQC 1WZLA 2R9HD 2V3DA 3I6LE 1TZOA 3GPSA 2MQCA 4WNQA 2XVBA 3CXHK 4HC1L 3TT3L 2NXZB 1BZ7A 4LCUB 2GJ6B 4LARL 2IDFA 2Z31A 2OR7A 1D9KA 2VB5A 1FQ9C 3G5YA 4XBPB 1IBZA 4R0LB 1IEAB 2ZX8A 3SBWC 3O6MH 4NP4H 1QFUL 5IIEA 1QO3B 43CAA 1E28A 4JRWA 1DQML 1LE9A 4XO3A 5DFWH 5DVMA 4N2LA 3NVQA 5I76B 4Z7NE 5GIRB 1A1NB 4JKLA 4Y2OB 4YGVB 4P3DA 3ESVF 4LCCA 1YAZA 4ZS7L 1MQ8A 2DLHA 3KGSA 4APQB 2P5WD 3V9EA 4PJ5E 5L8LB 2PWEA 4GW4B 4ZQTA 1BZ8A 4G1EB 4MZRA 2VABB 2WYTA 5B1AB 2NYKA 3S35X 5AZEH 3F58L 1R17A 1N6QL 3OTTA 1E27B 1PFCA 1YEFL 2DTSA 3V9FA 4M1DH 2APWA 1MY7A 2Z31B 3R1GH 1D9KB 1HIML 3UJJL 4X6EB 4JPKL 3K5RA 5IIEB 4KQ4L 43CAB 1YMHA 5E51A 2VLRA 1LE9B 1CO1A 1FO0A 4DGWC 2FT7A 1XF1A 1S5IH 4B27A 1QHOA 5TDOA 2PP7A 5J89A 3R8BB 4P3DB 4LCCB 3RY6C 2NDFA 4PJ9C 3U0PB 1X5XA 2VUKA 4N0UE 3GSVA 4IGBD 3I6GB 1OP3K 2WZ0A 2BNUB 1UZ6F 2X87A 4P9HC 3MROA 1J10A 5DTFB 2D2OA 4E5XB 4IKJA 4JQXC 5JW5A 4XNUL 3BKJL 2GABA 4V1DE 2PR4H 5F1IA 4DGVH 4ONGH 3EDFA 5DC9B 2EIEA 4XPAH 4EI6B 5BS0D 3E2HC 2CXGA 1EX0A 2YBGA 3RUGF 1UVQA 3WUZA 2PCFA 1FDLL 2IH9A 5HHQA 4ZMYA 1P84K 1YEDA 3GJEA 1CBJA 4ZQKA 3KBFA 1VFOA 3QHTC 4Y9FA 3VFWA 3K4ZA 3VXSE 3MZGB 4KTDL 3S5LG 3MV7A 5I1EH 1D7DA 2X0UA 5CD5C 5PCYA 1FYTD 4KITB 1ED3B 4X4KA 1NGWA 4U1LB 1NSNL 2A74B 2MTAA 2P8PA 3C09C 4LEXL 2FEJA 3GSVB 2EEXA 3S4SA 2VZ3A 4X4ZA 3K1DA 1TJGL 1RVFH 2E5EA 4I1RA 4J3OH 4EO5A 3RWGB 3KGRA 1DN0B 5F1IB 4DO6A 3EO1A 1ETA1 3I74A 3SOBH 4CN1A 2K3HA 1RI8A 2F54A 4AW4A 5EEXA 2Y07L 3BPNB 3UO8B 4G82A 1IC5H 1BAFH 4M93B 1QSFA 1UVQB 1B0WA 1OAQL 5EH1A 3OJMB 4M3KB 5LBSH 1BF2A 1QTPA 2CIIB 2EDQA 2KL6A 1YEDB 3NCYP 5C7ZA 4F8PA 2KLTA 4UOQA 4ZQKB 2EUWA 3NCFB 4OCNC 2HWZH 4XC1H 5D7LB 5EB9A 2CCWA 2PWFA 2O6PA 2UZIH 2DI8A 4ODVH 2OZ4L 4ZOBA 2X4UB 4RMUA 3ZE2F 3QJUB 1MUJA 2AK4B 4N9OB 1FORL 2Q3XA 4O9HL 4K7PL 4XO4A 5DEGB 5CN3A 1MHPH 2WWKT 3P2BA 4M9OA 5EF0A 1TJHL 5C0NC 2BSBA 3EOYG 2LU4A 1S2EA 1AO7D 4JLRB 1DJIA 3BSGA 2WCPA 3RYMA 5AVTB 1KPRB 1E6OL 1IBGH 3IRPX 3ARBD 3Q2LA 2F54B 2GIMA 2UV3A 4I8DA 3MOAH 2W0LA 3H3PL 3I6KB 4PJDB 3INOA 4TNEA 3TYFB 4EN3C 3CMOL 4B7LA 1SUHA 4TNGA 2E86A 4UUJA 3WKPA 3ABKB 5AOIA 5FYLL 3RPIA 4L8BB 1P1ZB 3U0TB 1YZZA 3LSOB 4JZJC 4O02H 4WLCA 4R4FH 1GY2A 3CHSA 1F6FB 2BSED 3IFPA 2M8XA 4X98A 3CFNA 1JVLA 3EJZD 5HY9A 4HIIB 2BSRA 3MRCB 4AVIA 1ZKAA 1IEHA 5B7EA 4L18A 2G9HA 1DEDA 4UV7H 4PCTA 3GMOA 2YUVA 5CN2A 4HOWA 2YD9A 3F83A 2N7SA 4BFFA 3NAAH 2CDGA 3M7FB 3RTQA 5I15H 4HG4J 3WENA 3LJ3A 5KUMA 1L9PA 4RISL 4B3VA 4HKZB 4YDVA 2P47B 3WEBA 1FFRA 3TXAA 2NX5D 1WWCA 4P23C 1T83C 3UG4A 4WI0A 4XCYA 2GG1A 1UH4A 3BCFA 3BSHA 1L4IA 2HT2C 3MRBA 5HPOA 2NY6D 3SBWA 1FL6A 2HJKA 3NCXA 3UZVB 3FB8B 5E1GA 4EQ3A 1C5CL 2IQAB 1XF5A 2QVIA 2DWEA 3K6DA 4W4OA 4HUVA 4F3FA 4Q4EA 3ZYZA 1S7TA 4QTFA 3QDGE 2NCEA 4M4PA 1ROCA 4IDLA 4IJ3B 3JWNG 3W9EB 2HG5A 5BVPL 2QSCH 4L8SA 4YR6B 2VE6B 4PP2A 1MQKH 3QXTA 4U1IB 2K7PA 3MODH 3IFPB 1HILB 3GXIA 3FT0A 5IB1B 1A1OA 2DYPD 5HY9B 2NR6A 2B77A 3MCYA 2VDOB 4YH6A 1ORQA 3QZOA 1RD6A 2G9HB 3ZU8A 5E99L 5GRUH 4WFHD 1JGDB 3GMOB 3QT2A 3WS6C 1JFHA 1OSYA 4ZSOB 4YHPA 1ZT4A 2DD8H 4YDVB 3X1NA 1T22B 4WI0B 3N6YA 4DVBA 5GZOC 1MAJA 5DD0L 4XCYB 5D1QD 5C92A 1AACA 4PREB 3NIGB 2NUTA 5BV7C 3A0OA 3VFNB 2R0KH 1N68A 1XF5B 2CRMA 3SJVA 2Q3ZA 2J4WH 3VNZA 2J3SA 5GGTH 4M6MH 5BO1L 3GRWH 4L8SB 4LLYA 4WWKC 4XPTH 4PP2B 5LBGA 5I1KH 5I73C 1INDH 1IUZA 3CPUA 5EORL 2NDGA 4OJEH 4MNQB 1ORQB 2EKSA 5DGRA 5JQHC 1DHKA 3GLAA 4HWNA 3ZTDC 4GQPH 3ULUH 4TNWK 3CZKA 2ICES 4YHLH 4HF5L 15C8H 1N5AB 3QI9D 1ZT4B 5I6LA 4JQXA 3MV01 2FQEA 4OAWA 3WMSA 4U7MA 5FM5O 5I8OL 2DMCA 3JTSA 3HJEA 5EDSA 3MRQA 4GOSA 4S1SH 1FZMB 3VD0A 2WVVA 4Y4KA 3SJVB 3HUJF 2GSMB 1JGUL 1NOAA 3MV9B 4Y5YA 2IAMB 4PJHE 2AHIA 4LHQB 3QDMB 4HIJA 3RURA 4ZDHB 1M3IA 3DRTA 4UB0H 4RWYL 1NGPL 1YEKL 4JMNA 4K55A 4NAJA 4JFDA 1OP5K 3VWJA 4W93A 4FABH 4XCFL 5IFJA 2IGFH 2CCVA 1TKWB 2RQEA 2L0DA 2VERN 4N5UA 1I7UA 2LLLA 5IF0B 4L4VD 5IVZB 4R7DA 5I1LB 3BP5B 3EJQA 2ZD0A 1S7QA 3MXWL 4OAWB 5KVDE 1CFTA 4GXFA 5IREA 4G8FA 3MACH 1TQUA 2ZXDA 3JTSB 4PJFA 3QQXA 4PJAA 3O0RH 1Q94B 4YFDB 3DUSA 3C6SA 3PJSA 1VACA 4JQVC 2JKRM 1YQVH 4Y4KB 4XMVA 1ZT1B 1BV8A 1G7PA 4CA4A 4EZKA 2QSVA 4GMTH 1JF1A 2CQVA 4U6HB 4PGBB 4XMUA 3BWZA 1NFKA 3OLIA 4ACPA 2VR4A 1B6UA 4NZUL 4U1MB 2VZSA 5D7IF 4QRTA 5CIPH 1WFJA 1QAWA 5CZXC 4AT6A 3QDJA 4JFDB 3U6XS 3VWJB 3OM3B 4XGZA 1WBZA 1HC1A 5IFJB 1LWRA 1D2PA 2BHZA 4QHLA 5TQ0L 5CR8A 1XVSA 5KZCD 2VWEE 4H8HA 5AB0A 1CXFA 5L9DL 4NWTH 3CDYA 3QNZB 4XI5C 3V6OE 1S7QB 4IYKA 3VNYA 4N5EC 2OSWA 1LP9B 1CFTB 1AGEB 2HJFA 3ATEA 2GYSA 3IBEA 3ZHLA 4FTDA 5AL8A 3WNJA 4FI7A 3WNPA 2FWUA 3EHBC 5EBWA 1MCLA 5ESVB 4AGOA 1BD2E 4NLHA 1G7PB 2H8PA 1NMAL 4NO0D 1JXGA 2CHDA 3S3BB 3L9EA 3O6FD 4K5NA 2DLIA 2C9VA 1QRNA 4GMSH 2X05A 1HQRB 1MCJA 2I7SA 4KV5E 5JHDA 1BVZA 3QDJB 3VI4A 1NOFA 1PX8A 2V9TA 2YIHA 5JUEL 4TSBH 5IQNA 3FSVA 1QSED 2XWTA 3HC4L 3QIUC 4DK3A 1NM4A 2G4GA 4FQLL 2X44D 1T83A 1OZTG 3CFKB 4AM0A 2ZOOA 2DQTL 1HCFX 2CRIA 2P8MA 2JJTC 4HZLA 5EEYA 5D1ZB 1ACCA 5EBWB 2QR0A 3BKCH 4IDJH 1KN4L 3IFOA 3MNWA 2GK0B 1Q0YL 2H8PB 2YKKA 5FO2A 3VXTA 3HZMA 1I8MA 4KGJA 4WGKA 1XZ0A 3US9A 1NCNA 1DVQA 2ZKHH 1HJCA 1XGUA 3HRPA 4X7EC 5IFHL 2F1EA 3VXQB 1P7QA 5C09A 4B9IA 1J5IA 1DJHA 1MCFA 3VI4B 2VLMD 3DPDA 1QACA 4IMKC 2HT4C 4FRWA 2W9DL 4LGRB 4F7PA 2QMKA 4S1RL 3VMPA 3V4VL 3NCYS 3QWRA 3WS6A 5A7BA 4PJBF 1TUPA 1KCUH 2X9XA 1B4JH 1CK0L 2WLHA 4ADGA 3LXCA 4Z7OE 3K7UA 4LCWE 2V3EA 4JUTA 4AEIH 4DOHE 5D2LE 2OTUB 4GAYA 3S0PA 1IILE 3ARZA 4FMKA 3T1FA 2NNFA 2WOYA 5DGQA 3PDOB 4AM0B 5I6MA 1CD8A 4Z3FA 4K5MA 4FKKA 3DGCR 2J1ZA 4N24A 1Q38A 5SWSD 2WKLA 5I1DA 3DO3A 1DANU 4EBQL 3DVGB 3A67H 4HEPG 1MW3A 2QHRL 3BSZL 3MNWB 4JQIL 4X6DB 1M71A 4QRBA 1LILA 3WFDL 4AVJA 1I8MB 3Q05A 1TZHB 4S0HA 2ZCKL 2DWXA 4Z7VB 4RMWA 1XGUB 4WWKA 4G9FE 1P7QB 3BIAX 2YD7A 3ALXA 5C09B 4JHWH 3ZR6A 3IAPA 4AZ8A 4Y19A 2H32A 1UCTA 1PMYA 3VXMA 2AZAA 3KLLA 3RVWD 4P3CH 1X5KA 1ZXQA 2PP9A 3PWUA 5F7KC 5HGAB 4AXWB 1QEWA 3A6CL 4DPRA 4NQCD 4MMYB 3DTUB 5FKPA 4GAYB 3IE9A 3KPOA 3AACA 3T1FB 3EZ8A 4L8DB 3QRLA 4H8WL 1F3JB 1T2XA 2CKNA 5GRVK 5J6GB 3DBSA 3OAYH 1DSFL 4K3JH 4UTBH 2WIIB 2RFXA 1NUNB 2MKLC 1FO0H 1YMME 3W9DA 3A24A 5E56A 1JPGA 1R34A 4GG6B 3MRRA 2VDLB 1ECZA 1CLZH 1H8LA 2B4CL 2IJ0C 3FT2A 4BSWA 4OJFH 2YEZA 5K9QG 4TVPD 1O75A 2MQGA 4KH9A 1ID5I 2QVMA 1BPVA 1NAMA 1AY1H 1JRHH 2VSKB 3VFOA 3VXMB 4R26H 1IJNA 3PWUB 2VMCA 3DVNA 5F7HA 2VR6A 2PP8A 1QEWB 4NO3A 1A25A 1EHXA 4NN7C 5A3IC 4MXQD 3ZQ9A 1UWXK 2A4EA 1ACXA 5J1SC 4C55A 5IMOA 4OT1H 3DSNA 1J8SA 3DUUB 3EJCA 4WFFD 1JZJA 1PU0A 1R5WA 3SYCA 5E7FA 3QCUH 4OI7A 4MA3B 4Q97A 1CBVH 4MWFA 4BK4A 2KZ1B 2BY3A 4MXVE 2VLJA 4N0YL 1TTRA 3NIDF 3EGDA 3KPPB 3W9DB 1JPGB 3BUQA 3ZDXE 3MRRB 1E2ZA 4POUB 2A9AA 4QHKJ 5IOPB 4BSWB 3WKNA 1IBBA 2YEZB 5HJ3A 1JTTA 1NLBH 2A1WH 3BHBB 4R97B 1NAMB 1FNLA 1X9LA 1NINA 4OFYD 4RFOL 4Z7UE 1CDHA 4N68A 1HE8A 2H6PB 4R4ND 1XGQB 2ATKA 1Z1WA 3MLXH 2W92A 4JHUA 4WHDA 5ECGA 4NO3B 4WUUA 2XWBA 1FAIL 1Y0LA 4LBEB 1L9QA 1R5WB 1RMFH 1T89A 3IDGA 4XO8A 4UQ2A 4MWFB 4K94C 2ZF8A 4QI3A 2PN5A 1QBAA 2BZDA 2P45B 3MJ9A 3QHZH 5T1KB 4JDEA 3SPVA 4QCIA 5BUPA 3ARPA 2OMTA 1MLCA 1VJSA 4I1PA 1EK3A 3BAIA 5CGBA 5H4YA 4XWOC 2XTJB 4IQHA 4WU7A 3S36L 3KYKL 1RZPA 5DUMH 1XD0A 2XHNA 3PWLA 4IOSA 4JO4H 4AVKA 1ACYH 1MPAH 4NQSB 3CVBA 3NPZB 4H7VA 3V6ZA 4NQVA 1BYPA 2GI0A 5E23A 1GA2A 5F6IC 1ET5A 3SCMC 4N6RA 2HKFH 1MHEA 1U6AL 4JY6A 3MRNA 5FWRA 5G5DA 3TP4A 5EIVA 1HXKA 2VJ8A 4OH2A 3IDGB 1RP8A 4UQ2B 1U8MA 1ICTA 3FQNB 1G7QA 4HJUA 2BRRH 2XACC 5FUCE 4C58B 3FFOA 2D8KA 4JDEB 2FATL 3LB6D 4C4KO 5IT2H 2NY5C 5C07B 3SPVB 4HAKA 4QCIB 2DQUH 1T0MB 2YJLA 3DPBB 1DQJB 4AMWA 1JCVA 4ES8A 3RBGA 5KG9A 4AGNA 5C0GB 1MLCB 1NTDA 4GXVH 3LRMA 4L3CA 3JUZA 2C4XA 2G2PA 3ESOA 4S10A 1LGVA 2WHVA 1EZVY 1JV5A 1JPTL 1AS8A 1KTDB 2LVCA 4IMKA 1QPXA 2Z7WA 1WZKA 3FT1A 2IWEA 1BLNB 3B5TA 4KTEL 5ADOL 3LKRB 4UDTA 3FT4B 2ED9A 2VDKL 3IXTB 2ZUSA 3BN3B 3PWVB 3ULUE 2UUDH 3QZWA 1HZLA 1MHEB 2BXYA 2HT3D 3NEEA 4I0PC 1HSBA 5G5DB 2AXHA 2AJSH 1DEEB 3EYQD 1ZV5A 1RKRA 3HFFA 5IB4B 1G7QB 3FHQA 3GBNL 4CC4C 1QG3A 3LNDA 3RUGA 2DYRB 4KKZA 1N10A 4Z7WF 3RG1C 1O9WA 1H15A 2A6DA 3N1PC 4MBRA 5E2JA 1X5YA 2X2JA 5KG9B 4OQTL 4PJIF 4F33B 4J2XA 1O6TA 5ABZA 1J0YA 2SEBB 4LL9A 5BMFH 1S7VB 1JV5B 2R1WA 3S8WA 1T66D 3EGXA 4TULH 4MJID 3W81A 1JD9A 4YXLH 1BX2A 1GGBL 2ESVE 3FB5B 2DDQH 1GMIA 3EJJX 4UDTB 5MP6L 3MRKA 4KRPB 1XEDA 4X7SH 3ASOB 4BD4A 1DBBL 4WO4C 4TLTA 4NQDD 1NDGA 2DY2A 2ZWLT 3NIFB 2YBRB 4Z9KB 2R2EA 3KPMB 1DJXA 1NFIB 1OXYA 2R9HC 4M61B 1KTLB 4Q8BA 4W70A 2VLKA 2Y24A 3SDDB 3RRQA 4J3UA 2AEPH 2N0KA 5EV7A 3D3VD 5CCKH 4ZUVA 1UOKA 3HE6D 3TN0D 4U1SA 2VNCA 3OQ3B 4D9QE 1MEXL 3BAJA 1EZUA 3TO4A 2R1WB 2LR4A 3BUIA 4PJGA 1U3HA 3EGXB 3U82B 2NXYD 3GMNB 3POCA 1F42A 1ND0B 4TPRL 2NY3D 5D4QA 4P9HH 3MRKB 4QRUA 1F58H 3Q1SL 5IOKA 1HQ4B 1MRDL 4GAAA 5IQLA 3R7RA 1G7MB 3OPZL 4FZ8H 3BT2L 4R2GD 4KI1A 5I1JH 2UZPA 2HLAB 1G0DA 1KELL 1TJIH 1CGSH 2VLKB 4PS7A 5A2JH 1U2CA 1V7ML 2XWEA 2IWKA 1R47A 2OV0A 1A5FH 3BVUA 3QPKA 4ZMVA 1HOEA 1A7NH 3MVSA 4HFUH 3O2WL 4ODWB 2JKWA 2NNCA 4O51A 3A4DA 4BRVA 5CKAA 3TO4B 4RMTA 3ELAT 4PJGB 1TTBA 1U3HB 2AQNA 3G9VA 1MCEA 5DJCB 3LRSB 4MBOA 2FB4H 1BQHA 4OUOA 3INUH 3QRBA 4A7QA 3U7YL 2VL5B 1EIBA 4JDZB 4MHHI 3L1OH 4OLYH 1XAKA 2CKBB 2J55A 3VXUA 2MCPL 4BQ8A 2X9ZA 2A6KA 3VI3E 1RZJL 3CVIL 1U91B 2WGNB 2XQBL 4G6ML 5J13C 35C8H 3CXDL 5ERWB 3UTQA 2Y7QA 1HNGA 1Z6JT 2HKHL 4WI8A 2XKUA 2DIAA 3FZUD 4TS6A 2IG2H 2ID5A 4FQXD 2BVQA 1I8KB 1MJUL 3NDYE 1VFMA 2LT9A 2H3NB 5B38B 3H9SE 1KIQA 1YJDC 3CN3A 3L16A 5H8DA 2YSSA 4G8GE 4W68A 1WEJH 4Z78A 4F58L 4ODUA 5EOTA 4NZRH 1MJ8L 5ETUB 1CTOA 4P05A 5E24E 2XPZA 1SFDA 5MEQA 3D33A 2B7DT 4LAJH 4LSDA 1NDMA 3TVMB 3VWKB 3GNMH 2YUZA 2UY7A 2A6KB 3QORD 4O5LH 4NP9A 1LEIA 4Y1AA 3LPOA 1CB4A 1KCKA 1TVDA 3AG2B 3PNWB 4Y7MA 4ZW8A 2YRZA 1PZ5A 4XNMA 5HVHC 1OP3H 5EIIA 3VG9C 4RMVA 1R24B 5F0JB 3PP3K 4LVHC 5IGXL 4W6WB 2WAQA 4MKMA 4BEIA 4QRRA 1DUZA 5MI0B 4QY8B 4XNXL 2NYZA 4E9VA 1L3NA 4B9YA 3AB0B 5F0MB 1QLEL 1JK8A 4JR9H 5HDLA 2DQDL 2W5PA 3L3IB 4Z78B 4ODUB 3P4NA 3ZZ1A 3SYAA 1PQZA 3D2UD 5G55A 5IHZA 2AAAA 3N04A 1C8QA 4Z7QE 3EBAA 5FR3A 1A8JH 1NC4D 1HHJA 4I0PA 4M5ZL 3DI3B 2ETWA 3SKJL 4ZMPA 1N8OE 4YHYB 1NDMB 3KDMB 5F7DA 3AREA 1S78D 2UWEA 4CC4A 4HKJB 3G04A 4Y1AB 1KBBA 1WSST 3GM0A 3KJ6H 3T2QA 4TVUA 4PYGA 4LSSH 3HUJA 2FIKB 3FQTB 1MFNA 4FERA 4YXKL 3US1A 4BFNA 2VLRE 3NYKA 4YSSA 4MAUL 2HN7A 4ORZC 3DUHA 3IS0X 3P9LA 1DUZB 5HDBF 1JHKH 4DKEL 4PIRF 4WV1C 3DJSA 5F3BB 1JK8B 1SDAB 1MI5B 5GJSL 1KPUA 1IC7H 4JY5H 2HLEB 3EJZC 4IBQA 4F7CA 2UZXB 4OGXH 2IEPA 3VW3L 4IS6A 4FF9A 3CVHL 5EBGA 5BV7H 3AREB 3U4BH 2UWEB 3ECWA 4HC1A 2F74A 3G04B 5T1LA 3D85A 4JK0D 4WCYH 2FJUB 5AW9B 1OM3L 3HUJB 4PBWD 1TG8A 3SE9L 3A5VA 2IDCA 3QYNA 3R19A 2CSPA 1EUUA 1R3IH 3IPFA 1ZY9A 5KBMA 1A4CA 4KXCA 1G6RL 4PW3A 1YEWA 2NY6C 5D7IA 2NW2A 3MV7E 3RU8H 2H32H 5I74B 2XIIA 2B9AA 3QNYB 4XMKH 3VXRD 2C7FA 4JGJA 3U0WL 3UAFA 1P5UA 4JPWL 4NI3A 4AQ1C 4F7CB 1A6TA 1DCLA 3AC0A 1GGUA 4HUMB 2X4PA 4IS6B 1YYMH 5CJ8A 1MJJB 4PQXA 4XP5L 5AUMA 2F54E 4HK0B 4I5BA 4QNPE 3NZHH 1S9VA 3D85B 5GS2H 3LRHA 1K5NB 1QSFE 2V5YA 1A9EA 3Q5OA 4LCYA 4NOFA 3V0FA 4JN1L 3CH8A 1RP9A 3NEOA 3QAQA 4NHUA 5D1QC 5DJ6B 4DKTA 3G9AB 1GH7A 2BVUA 1UXSB 3NJVA 4TXVB 4B60A 2NW2B 5KYXB 4HIXL 4D8PA 4X8JA 3UBFA 2XIBA 3EBGA 3KH3A 1D6VL 1TZIA 3FSAA 4U1GB 1EVTC 1ASQA 2IFFL 3OZKA 2DI7A 3IRCA 3U83A 1RZ7H 2X2YA 4QOKD 2WXLA 3D07A 1GIGL 1U3JA 4GI8A 2EYTA 3B4NA 3JT2A 5E8DL 5IMMB 3MJ8A 3SE8L 4BZ1A 1AZZC 5IK3B 3K3QA 1YC8A 2X4TA 4IGBA 4RSVA 2OCJA 1JYWA 2K9FB 2J6EA 3QEUA 5A6MA 1S9VB 1UYWL 3QI9C 4JHBA 5CJBA 5AYTA 2CBTA 3HOGA 3D30A 5IG7A 3RY5A 5GGRY 1MZYA 4RESB 1SOXA 2F7PA 4KZCA 5A7EA 3NJKA 1ZDSA 5BS0A 1ZHNB 1BHGA 4CSTA 2FHCA 1BFVL 4HHAA 4U1HB 3STZA 4X8JB 5CLWA 4NBXB 4GI9A 1TZIB 1ONQB 3HBPA 4H26A 1T1XB 3ZY7A 3IJYB 4XH2B 4FFZA 4L5FH 4M6NH 2ZYRA 4HCRH 4PJBA 5AW3B 2HX9A 4XP9H 4N9GA 4PVLA 3A6OA 3WY2A 4NCC1 1KTBA 5HBBA 4R5VA 3SB3A 4QO1A 2C9RA 2AXFA 3MJ9H 3ARYA 1N5YL 1XHHA 1XBRA 1WUZA 3ENEA 2BP8A 3K0YA 5DMIL 5IG7B 4N20A 2NXZC 2O6FA 2P9RA 3ZTNL 1ZHLB 1FZKA 3FYIB 4OF0A 1J18A 5IEKA 2ADYA 1NEZB 3N1FC 1NWOA 1GGCL 1B0GA 1UXMA 4H26B 4XX1G 1TTAA 2V17L 4G1MB 4F1SA 5IJVA 4YNYA 3UG3A 4DN4H 1FVEB 1U93A 4WFGD 4XCNB 4DPAX 5DO8A 1YN7B 4FZEH 4NBZB 1ASPA 4G6KL 2I5YH 4JVWA 5HDWA 1FL3B 2CZNA 1EO7A 1OQOA 5AVYB 2VQTA 3P0YL 4LFHD 2NY2B 3F85A 2VOTA 5LGHH 3PPSA 4QAWA 2FUTA 4HJSA 1OP5H 1BMGA 3KMDA 5F9AC 1QWNA 4NYLB 3KYAA 4OCRL 3C2SA 2UXFA 3AU0A 3MRHB 3ARBA 4NM8H 2J5LB 4LDLB 3BZ5A 3AT0A 1ZJAA 3TPUA 1I3RB 4Q4IA 3DOSA 2C9PA 3E8UL 1U8KB 3K71A 4HIEA 3KNBB 3VFSB 5FB8B 4Y5XB 1DFBL 5CS7A 4YFLF 2BVTA 5EUOF 4WV1A 2PCYA 2AITA 1LWHA 3FSOA 3ABLB 4HIQA 1T6VN 1U93B 3FH7A 4OD1H 4RGOL 2WO2B 3SDYH 1IO4C 2P5ED 2BSEA 3AS3A 3BPLB 1AQKH 1TT6A 4OLZH 2P44B 2R29L 3GHBH 5IBLD 2ZAIA 5FYJH 2Q1EA 3KWTA 1KCBA 4OI8A 2P8LA 1WISA 3FCTB 3APDA 4YDKL 4A39A 2ENSA 3A3YB 2XWZA 1Z66A 1M56B 3CU1A 4RMRA 2NX5A 1ZV2A 2Q86A 5KVMC 1ZGLM 3GHEH 1L5GA 5JORA 1LE5A 2JTYA 1DBJH 1LDSA 3TPUB 4HWEH 2Q76A 3LRLA 4KJYA 1IAOB 3CFJA 4ZFGL 2P26A 5GRWA 2HRHA 5J06A 3TV3H 2X6VA 3VD5A 1KBPA 4F8LA 2IMNA 3B5GA 3KS0J 3LNHA 3SDCD 4PWJA 4MA1B 1IQDA 3QEQD 1H3VA 1S4IA 4OY9A 4IRZL 3QUKA 4N2KA 4LKXA 4U0RB 1JE6A 4D8OA 1K4DB 1AZNA 2DYPA 3O3UN 4I4WA 4PY7B 2XN1A 5GRYA 1PLGL 1ZSHA 3SGKC 2A74C 4AKQA 1Z5HA 4PJFE 3HMWH 4MDRA 4PJAE 3ZE1B 2WNGA 2Z6FA 3I50L 5A2FA 1I3GH 2VR8A 3N3EA 2XU9A 4JJHA 4Y4HB 5E8EB 4JPIA 1TQVA 2VXQA 2HTKC 1L5GB 5JORB 4YDIL 5F6HJ 3Q8AA 5D1QA 4DK5A 2QSTA 4I2XA 1OPOA 4KJYB 1Q9LA 1UXWA 5I1HL 4UM9D 3NQKA 1I9IL 4M93C 5T3ZH 4ZAKC 5ESQA 4Y4FD 1CFVH 1L7IH 3MUY1 3FUNA 3NZSA 3P3YA 2VDQL 4N2IA 1OM9A 3CU7A 2X1WL 4MDIA 4I4WB 2YPKB 1ZE3C 4MAYD 2X9WA 2IMMA 1JNNL 1EHNA 2XPGA 3U30C 3RVWC 1TETL 4MJ5A 2CCLA 1KPVA 2WTRB 4M5TA 2DWYA 1NCCH 1SJEB 3HG0A 2H45A 3QI9A 5BXFA 1F0LA 1Z32X 4ABWA 3BGFC 2KYIA 3DX9A 5FUOL 3LQAC 2L7EA 4I2XB 4U3SB 1Q9LB 2ZXWB 1E6JL 3GBLA 4FHBD 5C7XL 1QRNE 5ESQB 4F2EA 1Z3GH 5JHDE 5E8PA 1JZHA 2PO6A 3FU5A 4X5QA 1GAFL 5HYJD 5I1CL 3ALWA 1NUGA 4BFIA 3UTPE 2V5RA 3TJEL 4DFIA 5CZVL 4NQEB 2IH3A 3X1BA 2O6EA 2X3BA 2ISDA 2C8NA 3ATAA 4YZFE 4ZZKA 3SQRA 3EOTH 1EEZA 5CJXC 2FYYA 2VAAB 3KCPB 1NBYB 2A9NL 1OW0A 5DZAA 5C3IA 1AG6A 4L4VA 4JRYB 4EIGB 2YC1A 4NGHL 4Z7WA 2YRBA 4HJIA 3NRQA 1EFQA 4W9LC 3FUHA 3SKMA 4XE5B 1MSPA 2WLIA 1UJ3A 2HVJA 3G6JB 2H1LM 3KL3A 2MHAA 1S46A 3IFNH 1N4XL 4UYQA 2ZXCA 5A2KH 1M7XA 2XKSA 2CPUA 3V5HA 2WBJB 3WFCL 2PO6B 2X4QA 3AY4C 1PNDA 1FHGA 4IJ3C 5ID0B 2PCPA 4AX3A 2M2DA 4M7KL 4UTCA 1CS6A 1HAWA 3IF1B 1U8HA 4K7PX 3WYRA 1KT2A 5AVRB 1QVOA 4R4NC 4X99B 1UURA 4L3EA 2J7LA 1TZGH 2OL3L 5EU5B 2ZCLL 2G0KA 1YEEL 2FYYB 2XA8H 1INQB 5FO9B 2NY5H 2EIDA 4YBQD 4RVBA 1F41A 2O72A 1MRCL 1O7SA 1GYUA 5EWIL 3LCYA 5IR1B 3AT8A 1QA9A 4J8RA 1E9PB 2ICWA 4YHZL 1CMOA 3P73B 2WLIB 1UJ3B 1UWXH 1DR9A 4F15B 2D73A 2MHAB 4AQ8C 4ONHB 1E5CA 5D96B 5PAZA 3T6WA 4XE0A 4ODXB 5I82A 3V5HB 3UYPA 4E0RB 3ZMRA 4Z77B 4NO0A 5F72S 3O11B 4ZUUB 1SOSA 4Y19E 2YQGA 4K2UL 3IU4L 3O6FA 1IRAY 3N85L 2PCPB 3EDEA 5AOLA 3REVA 3HHRB 3AUVA 2F1AA 4F20A 4ANUA 4Q52A 4APXB 1MFUA 3QQ4A 1QVOB 4OIIL 4W6XB 4L3EB 1JDAA 2X4RB 4HV8B 4HWZA 4M43L 4L8CB 3SN6N 4XP4L 1L0QA 1TVHA 2EXYC 2XG4B 1KXQE 3SHSA 3QIBB 4PRNA 4BH8A 4R83A 1MFCL 3SDXB 2NRDA 2EYSB 3RIFF 3D0LA 2E7LC 3H3KA 5D70H 3FFCD 1Q1JH 1X9UA 2ED8A 4KNQA 2QPDB 1V3MA 2D7PA 2LE9A 3LB6C 4KKBC 4N2FA 2QDVA 2AI0L 3U4KA 3W38A 4HALA 4L2YA 3HC2A 3EKCA 4TQ8A 5C0DB 5I66A 2EDLA 3NA9H 4LL4A 3REVB 4KDTC 3DDFA 2ATAA 4Y2DD 3WLWD 3VJ6B 1RUML 3KBHE 1AI1H 1QYGL 4IRJB 4MZIA 4YDMA 3QEHA 5ALBH 3SGKA 5DVLA 5C0FB 1QABA 3B7TA 1JS4A 5B39A 1KCVH 4FA6A 1DBMH 4MMZC 1P4BL 3QUZD 4YHIB 1ADWA 4B95C 5GGSY 1A0QL 1O6SA 2ZJSL 5L8JB 3TEXA 3WDIA 2HT3C 5IFAH 1KJ2A 2VLJE 4PRNB 4TYUA 2J88H 3CFEA 3IDJA 3X3FL 4XBEL 1IGYA 3CFCH 3EYQC 2DAVA 2BOBA 2DEYX 3BZFA 2JI2A 4HWBL 1RULH 3UBXG 2YA2A 1PKOA 1P4IH 2VN6A 4QPEA 5F7EH 3ZE0F 2JXMA 3MBWA 2ED6A 2Y06L 1MCPH 3I02A 5KSBF 2X6BA 3N44B 2E3VA 4G2AA 4XTRD 2OMZB 5FHBL 5DI8B 1BEYH 3BN9D 2FDBP 3UJTH 1T3FB 4LOUD 4HMDA 4WUUE 4L5FE 3V4VB 4XNQB 1T66C 3I2CL 4LHUG 3HC0A 1FE8L 3C2AH 3RWDA 3OB0K 3GMLA 1CF8L 4KFMA 2N3JA 2VMDA 5CNHA 1S3KH 2PPCA 1MIML 3EAKA 1B9ZA 2A6IA 2ZE0A 4RX4D 3VFGH 5CSBA 2EE2A 2EVHA 4XZUA 3IDJB 1CD1A 4HWUA 2ADGB 1IGYB 4KO6A 5GRXG 3UJIL 3VMNA 2BOBB 1G0YR 2FJFB 4UNVA 1I85C 2YFOA 3BZFB 5CWSB 1N8ZB 4CBZA 5M95B 4G6JH 3H42H 1GOHA 4ZMNA 1KJVB 4FLRA 3DX4A 1CFNA 4BSVA 1XIWA 1BQSA 2J25A 5DK0A 1MRFL 4JFTA 3MRDA 2FO1A 3HG4A 2CLZA 3TN0C 3C8KA 1PZAA 5DJYA 3PY9A 1ILUA 3JUYA 2XN9A 3NABH 4G11A 1ITCA 4LASL 4P2RA 4BZ1H 2NXYC 4PSRA 2UVEA 3GPEA 1VERA 2NY3C 5C97A 3GMLB 2J6EH 2WZAA 5HDQH 5ICYB 1IBHA 1DQQA 3O8XB 1HESA 2A6IB 1MFMA 4XNBA 3DHJA 2YD5A 4BHUA 2OSXA 1TTFA 5CEZD 4R2GC 3VSVA 1JYVA 2GIXA 2OULB 3V0AC 4H8VA 4ZMQA 4HUUA 5KBKA 3NTCH 4JEGB 1KDIA 1SM3H 4F7MA 3NK3A 3QBTB 1NZRA 2P48B 1MAMH 3D48R 2OX5A 3F7PC 4HEMA 5CLTA 3WO4C 1XIWB 2DKSA 4H20L 3OVUB 5CSZB 5L0QB 1YJDH 5JIQA 2V9UA 2QLVB 4FFZH 4M6OL 3C8KB 2BFGA 1FNHA 3NUKA 2QQLL 2O26U 3CBKB 3GO1H 2ZAGA 5DJYB 1VEOA 2VZOA 3KPSB 4G5ZL 4O58H 2EUXA 1WCBA 2XN9B 2Q7NA 3GMPA 3CN4A 4P2RB 3V4UH 1UZ6E 4CVXB 2BIOA 1VPOL 3DLQR 1JGIA 2CD0A 3IVKA 3AVEA 4X5LA 4QXUL 3L9BA 3O3BA 2F15A 4Y88A 3PL6D 4G70B 2J1YA 4XAKE 1N0XH 3PXHA 5FYJE 3RUGE 3SQOL 2A9ML 5HYIA 1U8NA 2BIQA 25C8L 2L7UA 3KD4A 3ZIYA 5E70A 2ZKWA 4HUUB 1OGSA 5FWQA 1EQWA 4F7MB 4URTB 4JFEA 4JKWA 2OX5B 4KO7A 5GSVA 3V79C 3V5KA 3BQUA 5FGBA 3CZJA 5D7JD 2WZPD 3C60D 1XSIA 3E6FA 2F19H 4MDJA 3Q3GB 1JWUB 4GG8B 1LO2H 3FZUC 2CR6A 3GMPB 1UEMA 4HJJL 2G60H 3B9DA 4FQXC 5SV4A 1TQBB 4XVJH 2G9KA 4JO1L 4G7SB 1BXUA 1KZQA 4M5YH 4YL4A 5D5MA 5CBEA 1JHLL 1ZLWK 1V3JA 1JZ4A 3AJ7A 3O3BB 3P3SA 5L4IA 1G7JB 2GTZB 3ZRCC 4P4KB 3F65A 4BFOA 2CO4A 3CVCA 1QZ1A 4GH7B 5CUSL 3FRPG 3UXFA 3WHE1 2AJVL 2VLKE 3T1WA 3ZSSA 1C12B 4X9GA 4AL8L 5C9KA 4EI5B 1QLRB 3B2UD 5F9OL 4C59B 1UWFA 4NUGL 1CD0A 5EDXA 3QORC 4JFEB 4B5ZA 5GSVB 4LSRH 4MRCA 3ZE2E 1GGIH 1I1AD 1LO4L 3BQUB 4JFQA 1OTTC 4FS0A 2YD3A 1AD9A 2ARJA 2TAAA 3S88H 3ZHNA 3E6FB 5C3LD 5T3ZE 3UX9B 3QJHA 1W6WA 3NJIA 1JTPA 5MERA 5DURD 3A4EA 4C56E 2Q7YA 4QRAA 4WK2B 4KDTA 3RJOA 2IXQA 3MRPB 3EYUL 5D5MB 2R1YB 3FFDA 2Q87A 2WQ8A 5J11B 3QUYB 5ES4B 5FYKU 2KC0A 1B9KA 5HVFB 4GBXA 4MMZA 1G9NH 4W6YB 5AW7B 4JFHE 1FNGA 1IAIM 4LVNB 2K1MA 2R2CA 5KS9B 4N8CH 3L7FB 3BPOB 4MLSA 1S78C 5KUKA 3FW6A 5I71C 1ZHBA 2WN2A 2BLFA 1EAPA 2JTDA 1SPDA 4JFQB 1J1XL 3M1BA 3ZO0A 1AD9B 5HGDB 5FIEA 4J3WA 4LSTH 6PAZA 5KANI 1LEKA 5DK2A 5ACZB 1G1CA 1J1OH 1GPOL 2DQGH 3JVGA 5MERB 1YEJL 4PBXA 3EJRA 4WFEE 1FV1B 5JHLL 2IXQB 2JJSA 1MDAA 4GRWB 4M62L 4CMMB 2VTFA 5L2KD 2ZSWA 4GKSB 4R97C 2ENQA 1SNRA 3ES6A 3MA9H 1LVEA 1DBKL 1IBFA 3FO1B 2FD6H 3MV8E 2VDKB 2VXSH 3PP3H 4GBXB 1U8QB 3ECQA 4IEFA 5I18H 4U49A 1S9YA 4K71B 3HC3L 4U3HA 3VXUE 1P6AB 2CDEB 4U2YA 4CDGC 2VDNL 1YDPA 4C4BA 2VXQH 3TH4T 1ZK9A 3FNKA 4NQDA 1JFQH 1M6UA 5CGMA 2H0JA 3QHFH 1OB1A 2B59A 1ADQL 4K5OA 2GTWA 3TURA 2C9XA 1EAPB 4CN6A 2WUBH 4LLWA 2FK9A 1A6VL 4MTMA 5GGVH 4CSSA 3O3AA 3HE6A 2CXKA 5DK2B 3TN0A 2XJKA 1KBKA 2VZTA 4AIOA 12E8H 2KH2B 4WIQA 2BP0B 5DSCB 1U3NA 2XTJC 4QTIH 2RHEA 4ZNEE 3FO0H 2QFRA 4XAWH 5FLUA 4RAUA 4MNHA 1ZRUA 1FVCA 4QHUB 2XXCB 2NUPB 4B50A 2NSXA 1YDPB 5INDA 1F11A 4A6YA 1KY7A 2BOCB 5C0BD 3IPBA 4N3TA 1JHTB 1PFOA 5FFGA 4A66A 4D7BA 5KN5A 4CGUB 5CMAA 4JG1H 1OB1B 1CTMA 2R0LL 2DWDA 3C8DA 1MCWM 1FIGH 1T21B 1TZ8A 5A6LA 1T20B 3EFOA 2UVFA 4DP2X 2BNRB 1DLFH 4QRRE 4WI9A 5EUOA 1GSMA 3ZTEA 1ZWIA 4WTZG 1BAWA 3OXRB 1NEPA 3JWDC 2YRLA 4LRNH 3CJJA 2YFNA 2X2IA 3ZL1A 3GZPA 4X7DC 5ENWB 2VC2L 2DBLH 4GAGH 3B5HA 4OM1H 4K7FA 5F9WB 5J1AA 1A7PH 1F4XL 5IHBA 2FZ3A 4RAUB 5IVXB 3WKYA 2K6YA 1RZGB 2AJ3A 5CCGE 4DO5A 3FAXA 2GCYB 4EVNB 4QYOA 1T7VA 4JZNB 4IBYA 4PW4A 2OMVA 2YZ8A 3DIVA 4NX0A 3TBSA 5IQOA 5T3XD 2WSKA 2YA1A 5KN5B 2YGPA 1MCWW 4ETQA 5CMAB 4HOMA 3HUJE 4HH9A 3ZDYF 1XMEB 4N22A 32C2A 5IHUH 5HGBA 2V9RA 3QJFB 3EH1A 4QD2E 4P2QB 5IJDC 4ODTH 1I1FA 5EUOB 2QELA 3HNVL 4ANVA 1NCDL 1ZWIB 4RRPM 3EYOB 4AZUA 2O5ZL 3LKPA 4U1KB 2DZEA 2Y23A 3U36B 1FJ1B 2V6HA 3BVVA 1UZGA 1E8ZA 4HT1L 4W9JC 5IB5B 2I9TA 4I3RH 5GGRB 2O1AA 2WUCH 3KHQA 5CSGA 1JD7A 4FQXA 4LRIA 4R7NA 2VMEA 3T2OA 2BSDA 4K7FB 3S36X 1DJGA 4G43B 2VT0A 3TCLB 1CGTA 4FXGA 3T0WA 3NPSB 3P3UA 1RFDL 3L5XH 1FSKB 3VRJA 5ADPL 5SV3A 4GNKB 3S37H 2OMVB 3D69A 3QFJD 3TBSB 3WKQA 1CLYL 4RFNB 1U8JA 3AAZB 4FQIL 4ZUTA 3GJFB 3W0WA 3GB7A 3GTVA 1ZTMA 5H2BA 3Q8CA 3V0EA 1F02I 4YWGL 3L1GA 3AM8A 3QORA 4QHKI 4GSQA 5ECJE 1IEBA 5D7IE 1C5BH 1RLBA 2Z0UA 3LKPB 1WUNT 3QR0A 2EXTA 2X40A 2I9TB 2J43A 4RA0C 3IJSA 3QO1B 3RNKA 3SOTA 1Z9LA 4YK4B 1W72A 2P5WE 1DSWA 3IJ9A 1X4ZA 1QBML 5KSAD 4MCMA 1BDYA 2VAJA 1KG0B 4HOZA 4XHJD 2P46B 2G3ZA 4ALAL 4XC3L 1F4HA 3TT1H 1UM5L 3JZYA 1AJ7H 1NC4A 3ATFA 5EF3A 3MRJB 3T65B 3W0WB 2IQ9H 1LEGB 4NBYB 4LU5H 2PTUA 5SWZA 1QTSA 1L9MA 4OZFG 2ZUYA 3PQYD 1IKOP 4N2MA 2WD0A 4KX7A 1T5KA 3FUFA 2IO5A 1YUKB 3TZVB 2CMRH 2IBGA 4Z3EA 5E6YA 3T3PF 3ZTJH 1M53A 1KIPA 3G5ZA 1IGMH 1FFPB 3IJSB 1PY9A 4BWUA 1R0AH 1QLEB 4LIQH 4DF9A 4N8VA 1JNJA 3HZYA 1T1YB 2F53B 1N0LB 3CSYB 4JVUA 3V4PL 4PMFA 9PCYA 4EUPA 3I9AA 3EDJA 3WXVL 3QG7H 4G59C 5EUKA 4XMLH 5H35A 3PWPB 1KJ2H 3OZ9L 2YZ1A 3Q8BA 4ATTA 4H13C 3QUXA 1VFBB 3NK4A 3HN3A 1MN4A 1IL1A 4R6UA 5IBLC 1V10A 3WS3A 4QRPB 4WGVB 1P7BA 4GW1B 2CDFA 5SWZB 2CBPA 3BMVA 1HEZB 4X9IA 5BS0E 1A3LH 2R23A 4NZTH 2GK2A 2K4AA 2WLLB 4XNZB 4S1QH 4XVUD 1SOKA 3UTSD 2DQFB 2FIRT 2DJSA 4EZMA 3N5AA 4U6XB 1SXNA 3O2VL 4PJBE 4AG4L 1G5AA 4UIKL 1RIHH 2R4RL 5DFTA 3VFPB 2XZCL 2Q8BH 1JZ5A 3HZYB 1FYTE 2OI9B 1RU9H 3SDCC 4NJAL 4KY1H 3PU7A 4XP6L 3O2DL 3N9GL 4YDLB 3QUXB 4AEFA 3CVHB 2AQQA 3ESPA 4F9PC 2APVA 1X5GA 1EDYA 2WANA 5KVDL 2WWMD 2BHUA 2XBTA 3O6LL 1KTRL 3WS3B 4OGQC 1RZQA 4DQAA 3VVVA 5LN4A 4Z95L 4DQOL 5E5MA 1HL4A 3X3GH 3TVMC 3DBXB 3FQWA 2ADIB 4JFOA 2R23B 2ZOKB 3BGAA 2FBJH 2VM9A 4A37A 3RNQA 5I0YA 1G6RB 2CO6B 5FM4A 4NCDA 4E5XG 2QADB 2A73A 4TVPH 3GBDA 1ZEAH 3WFBL 5EU4A 1ZSDB 5I5JA 2GSGB 3P11L 2HYMA 4FL4B 1MKFA 5DUPL 4Y4FC 2GHWB 4WI3A 5ANMA 3UOAB 2QKSA 1AYOA 3KYNA 5GRJL 4N0CD 2BVOB 3L1EA 2EADA 1KN2H 1AO7E 3D18B 3ISRA 1U58A 2C1OA 4MAYC 5DZPA 4AV4A 4D0BB 2A77L 4G42B 4MA7L 1AANA 2KQNA 1KEML 3O4LD 4KBPA 2XC8A 2V5TA 2BIMA 2BCKA 2PWDA 2EXWC 3FQWB 4JFOB 4EXPX 2E6JA 3PHAA 2N7BA 1M42A 2FVNA 1MHCB 2J1KA 5FYKD 3RNQB 1BVLA 4F92B 4LLUA 1S7UA 3O6ML 4NP4L 4MSWB 4L23A 3ZBMA 3FN0H 2YPLD 3W37A 3ASWA 5ANMB 1H3PH 1MJ7H 3RKPA 2GTQA 4GP8B 5DZVA 2ICCA 2FJGB 1F1GA 4FXLA 3MAWA 5IJCC 3LKOA 5IHHA 1R5IA 1CT8A 4RNRB 3BZEA 1U58B 1HXYA 1GYCA 3NIDE 4PBVC 3ZL4H 3CXHJ 5AZEL 2NX5E 3C6LD 2VKWA 2EVFA 2BCKB 4M1DL 3K46A 3UAJD 1OK0A 3BLPX 3RFRA 5E94A 2FGWH 5ISZB 3R1GL 4CL7A 3MBEA 3IMSA 1FC1A 1KV3A 2WOBA 1S7UB 5KSBA 2I27N 2WQXA 4PD4J 4GPVA 3CGTA 1S5IL 3GEWB 3L3DA 4P8QA 4Y8DC 3GKZA 2A83A 2MPVA 2PABA 4AVHA 4WFHE 3IGUA 3LKOB 1R5IB 1RK1A 1PSKH 3G5XA 3L9RB 3BZEB 1HXYB 1H6UA 1THCA 1A7RH 2WLMA 3KVQA 1XCWA 1FP5A 1ZHKB 4X6BA 3ZTCC 1NKOA 2AAVA 2OSYA 4BXVA 4PYHA 1E3XA 3KGUA 5CCHE 4JGNA 1X4YA 3DROA 2PR4L 3QPQD 5FGCE 5D1QE 4DGVL 4ONGL 1J5OH 1ORSA 2V8LA 3MBEB 4N4YB 4XPAL 5C0CD 2X9YA 2WXIA 4ANKA 2W60A 3R0MA 1H8NA 3T3MF 1R3KA 1Q1PA 4UZGA 3T0BA 5F1SA 1AVAA 1P7KB 3IETA 1P4LB 1ZA6A 2CUMA 2HP4A 3BJ91 4W9GC 1WP6A 3OB8A 3K4AA 2VXVH 2I60H 3L3DB 4L1BA 5F7BA 1MVUA 4S2SB 5I1EL 4LLDB 3WTWA 5JHAA 4XMPH 4B9JA 1RHHB 4NENA 2HG0A 1E30A 3NRFA 2P5EA 2R29A 4FG6D 5H37A 5J12C 2YJQA 4PJEF 5BVJA 4F91B 4X6BB 4RETB 3QW9A 3IDMB 2AANA 3QJOA 5HHPA 1TF4A 1RVFL 2FTAA 2WP3O 3GI9H 1K2DA 4JM0A 4FNPA 1Q9KA 3ZKMC 2BJMH 4KO5A 2EDNA 3MREA 3IDIB 3SOBL 3R18A 6PCYA 4EDXB 4LLMB 5DJ8A 4N2GA 2ALAA 1IC5L 1MCBA 1BAFL 1YUHA 1P84J 2W60B 2QZ5A 1CU4H 4DERA 3CUPA 1R3KB 5LBSL 4UT9H 1VEMA 3IETB 1ZA6B 4QHMA 5KTEH 5MENB 4MA8H 4XC1L 2HWZL 3DVIA 1PCSA 2XJLA 2UZIL 1NANI 3GXPA 3H54A 1NBQA 5E00A 4EDWH 4ODVL 3FCUB 1A66A 2DQHH 2JV6A 4Y5VB 5J3HC 3RVXD 4WVRA 5FV2A 4WW2B 3SDCA 1UT9A 4AUYA 4LLVA 5HI3D 3QEQA 1MHPL 4RRPG 2AK1H 4PWGA 2ICEC 3WLWC 1HHHA 3F7QA 2QVFB 5BVJB 4O00A 4L4VE 1T6WA 1F6AA 3KL0A 1RJLA 5DMGD 3ETSA 5HHPB 4Z7WE 1AAJA 5BRZD 3NGBB 3I3EA 4R4BA 1K2DB 2WINA 1Q9KB 5BZXA 1I8LC 4HS6A 4YX2H 4PJIE 3MREB 1IBGL 1MLBA 1Q8MA 5DJ8B 3WUWA 4DP6X 3MOAL 1M05B 5C0AD 3OQRA 5GGSB 3IAGC 5ITFB 5D9SB 3T4AC 3D0AA 2DWTA 4QHMB 4H1LB 4RH4A 1AGDA 2I9LA 4UNUA 3GDBA 4X2UA 2ENPA 1KJMA 5E00B 4O02L 4Y4FA 3WY1A 4XCCH 2X89D 4R4FL 4BQBA 1GOGA 3DYOA 3NFSH 3N41F 1TFHA 3RAJH 1A6UH 1CLCA 4L3EE 3EYFB 4OW6A 2XSKA 3QXDB 3UAAA 1D6EB 3BN9C 3LKNA 4WK0B 4PRPB 3PNRB 4LOUC 4A6YH 3MNZA 4JM2D 4BKTC 1PDKB 5E2UH 2R8SH 4UV7L 1EANA 1RJLB 3DXAD 3GXFA 3SDAB 1ZANH 3RX5A 3LIZH 3NAAL 3NT0A 4MCZB 4ZUSB 4MMXB 5I15L 2UX6A 1CI5A 2P7TB 1DVTA 2AQR