2VSMB

Nipah virus attachment glycoprotein in complex with human cell surface receptor ephrinb2
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
140
structure length
137
Chain Sequence
IVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Nipah and Hendra Virus Attachment to Their Cell-Surface Receptor Ephrin-B2
pubmed doi rcsb
source organism Nipah virus
molecule tags Hydrolase
molecule keywords HEMAGGLUTININ-NEURAMINIDASE
total genus 27
structure length 137
sequence length 140
ec nomenclature
pdb deposition date 2008-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00812 Ephrin Ephrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.420 Mainly Beta Sandwich Immunoglobulin-like Cupredoxins - blue copper proteins 2vsmB00
2XXGA 1JZIA 2GB2A 4NB7A 4FAAB 3NP3A 4N4YB 3T6VA 1PZBA 2YAPA 1SNRA 4GYBA 1KV7A 3ABLB 5I26A 4DP2X 2XU9A 3FYIB 1GS6X 4DP9X 4ENZA 1L9OA 1AG6A 4N8UA 1OOWA 4DP8X 2UXTA 1J9SA 3EHBB 5B1JC 1GY1A 2J56A 5PAZA 3FS9A 3FSVA 4E9RA 2XX0A 1OCRB 3HB3B 3IN0A 4JHUA 4Q8BA 3QPKA 1JVOA 4YVNA 4X4KA 3NSCA 3JT2A 3FPXA 1PCSA 3U25A 4YSDA 3X1NA 4AX3A 1SF3A 1E67A 5D4JA 3EH5B 1NIAA 3S3DB 1CC3A 1KBVA 2R7EB 2CAKA 1ILUA 1AG0A 1PY0A 3PCYA 3ABMB 1M57B 4PCYA 2XYBA 3ZBMA 2DY2A 6PAZA 4DPAX 2VW6A 3IE9A 2QDVA 5AZUA 1NIFA 2H47C 4BWTA 2AZAA 1AZCA 2CALA 3OMAB 1BQ5A 4KO6A 3AG1B 3TA4D 1MG2C 3CDZB 5AFAA 3DTUB 4GP4B 1ZPUA 1RKRA 3OMNB 4EF3A 1V10A 2DV6A 1PLCA 1GSKA 1MZYA 4BWWA 4AI7A 3SBRA 4A66A 2GC7C 2AANA 4P5RA 5AKRA 2FWLB 4CSZA 1BEXA 1AZRA 4E9VA 1IC0A 3EH4B 1AR1B 5TK2A 3X2QB 2YAFA 2CUAA 4K9JA 4YVUA 3ASOB 4QKTA 2DYSB 3T71A 4F2EA 2PCFA 4GY4A 4KO7A 4DPBX 5B1JA 2ZONA 4HIPA 1HFUA 1ADWA 4YSSA 3FYEB 3PPSA 1WS8A 3WKPA 3IBOA 1SHXA 1NZRA 4KO9A 5I6MA 2YAOA 2VW7A 3X1BA 3KW8A 2VSKB 4YSTA 4MFHA 2DYRB 1MG3C 2OV0A 2P80A 1L9SA 1ZIAA 2BP0B 2PP8A 1MZZA 1TEGA 2EIMB 1GS8A 1SJMA 3NT0A 2Q9OA 4YL4A 1RZPA 3T9WA 1EHKB 3FU9A 1KGYE 3WKQA 1NICA 1KCWA 4PAZA 1SDDA 4YSQA 1ID2A 2HXAA 3ERXA 2JFCA 2BP8B 1MDAA 5I6KA 4DP6X 1BXVA 2FT7A 1AAJA 3G5WA 1AZUA 1KCBA 2PPCA 4BWUA 1QNIA 2XLLA 2ZOOA 3S8FB 2FQEA 5B1BB 1AZNA 4DPCX 2FT8A 2FQFA 3TBCA 2YARA 1DZ0A 1ET8A 3UGEA 3PAVA 3S3CB 1JZGA 1T5KA 3FT0A 3AG2B 3NSFA 2BWDA 1DYZA 2GSMB 4HCFA 1KYAA 3QJQB 4KO5A 5E9NA 2GIMA 4TXVB 1GW0A 1RCYA 3FU8A 3NJIA 5TK4A 2IWFA 1NINA 4F2FA 1L9PA 1PNCA 8PAZA 1OCZB 4HCIA 4GP5B 1V54B 2VN3A 1PZAA 1CURA 1IBYA 4NERA 2YAHA 2PPFA 2HX8A 3QJRB 1WAEA 2UXVA 4FA7B 1ASOA 2N0MA 2YAQA 3ABGA 2H5UA 2VM3A 1OE3A 1OCCB 1HAWA 1JZJA 2FNWA 1ETJA 1BAWA 4HHWA 3QJSB 4G71B 4A2DA 3NJGA 5PCYA 1A4AA 1NWPA 4A68A 1JZHA 5B1AB 4YSUA 3NJHA 3V9EA 1SF5A 2VMJA 3FSZA 3HEIB 3NSYA 3IEAA 1AZBA 2IDQA 2QPEB 4G7RB 1A65A 1A4BA 1BYPA 2YQBA 4A2GA 3CZUB 1SHWA 2I7SA 3PLYA 1SFDA 2HRGA 5B7EA 2PPAA 4QLWA 2FTAA 1ASPA 1KBWA 2UX7A 2YXWA 1JOIA 3S3BB 2YAMA 1A8ZA 3X1GA 2X87A 1PAZA 1J5CA 2PPEA 2IDUA 1AACA 1FFTB 9PCYA 1ZDSA 4KNSA 5I6PA 1QHQA 2UXFA 1PF3A 3FPYA 2HX7A 3MX0B 3AG4B 1SDDB 2FJSA 2CBPA 1UATA 2J57A 3BVDB 5F7AA 1E30A 3CVBA 3DIVA 4WKXA 2YXVA 1ZIBA 2B08A 3QJVB 3T6XA 4YSCA 1GYCA 2XVBA 1PLBA 4DP0X 4G7QB 2IDTA 4BK5C 4A67A 4CSPA 5I6NA 4JHVA 5B7FA 3V9CA 1FA4A 3UADA 3NJNA 2GI0A 2HZHA 3N55A 2YAEA 3OM3B 1PLAA 2IWKA 1XB6A 3ZX1A 1BXUA 4KNTA 2EINB 2LLNA 1OF0A 3L45A 3S8GB 2QPDB 1AIZA 2UX6A 1SFHA 2BWIA 2ZXWB 1XB3A 1AS6A 5A7EA 2AVFA 4KOCA 2P80D 2I7OA 3H56A 3X1EA 1ET5A 3GYRA 3C75A 2J5WA 1TKWA 4DP7X 1KDJA 3NJMA 3RYMA 1N70A 4WTQA 1A3ZA 1VLXA 1WA0X 3EF4A 2IAAC 2BHFA 4HZ1A 1JVLA 3CDZA 5F7BA 1GR7A 1OE2A 1KDIA 4RH4A 7PAZA 4A2HA 2NRDA 4YSEA 6PCYA 3TASA 3FU7B 2XV2A 1J9QA 5I6OA 2QT6A 2IDFA 4HAKA 2QDWA 2FT6A 5B3SB 2HRHA 3NJKA 2OJ1A 3WG7B 2BW5A 4KOBA 3QJUB 2CJ3A 2JKWA 1M9WA 2XWZA 1GY2A 3UABA 3AZUA 1IUZA 2B3IA 2TSBA 1OE1A 2EIKB 4G72B 1A4CA 2OCCB 1EZLA 3N2JA 4M4RB 1BXAA 3SBQA 1NTDA 2BP8A 3GXUB 2W88A 3MBWB 2HLEB 3KW7A 1CUOA 1FWXA 2PPDA 2IWEA 2DWTA 2BO0A 2H3XC 3FQ1A 4YSRA 5I28A 4E9QA 3JTBA 3QJTB 2GBAA 5ANHA 1QLEB 5LDUA 3NJLA 3WI9A 1AANA 3WIAA 3WNJA 1E65A 1W8EA 4UAHA 5I6LA 2AFNA 2E86A 4E9TA 3H4FA 1JERA 2PP7A 4KNUA 3CVDA 5IY5B 3PAUA 4UANA 1NWOA 2Q5BA 4AKOA 3SBPA 3UAAA 2FQDA 1JZFA 2VM4A 4G7SB 1ZV2A 4E9WA 2XXFA 4BDVB 1B3IA 4UF7C 3TBBA 4E9SA 1E5YA 4JKNA 2UXGA 4Q89A 2WO2B 2IDSA 1JZEA 2ZWNA 2A3TA 4HALA 1IKOP 4E9YA 3WNIA 1WS7A 2XX1A 3NSDA 5I5IA 1TU2A 4BXVA 1OCOB 4F7KA 4BXSV 1L9RA 2HX9A 2WSDA 3DKHA 1YLBB 3ZDWA 1JXGA 1R1CA 3CG8A 1CYXA 4DP1X 2PLTA 1L9QA 3OMIB 2J55A 1CYWA 3D12B 4BDVA 3IN2A 4YSAA 4AKQA 3NP4A 2EIJB 1NIBA 4GP8B 2VSMB 4L0PB 2R7EA 4ZK8A 2BZCA 2TSAA 3NJFA 1HAUA 1M56B 1NPNA 3GDCA 1JXDA 1NIEA 1JXFA 3FSAA 4W1TA 5D4HA 3ABKB 2X88A 5I5JA 1X9UA 4HHGA 1URIA 2PCYA 2RACA 3ZIYA 1BYOA 2GC4C 4M3HA 5B1KA 1J9RA 1XB8A 4HCGA 2W8CA 1GS7A 1I53A 3FQ2A 4AZUA 3PAZA 1AQ8A 2IH8A 1J5DA 3OD3A 1L9TA 2GHZA 1NDTA 5I5MA 4W9ZA 2XUWA 4A2EA 5FC9A 2MRYA 1AOZA 5B7MA 1WA1X 2CCWA 5D4IA 1ET7A 4YSPA 1ZDQA 3TU6A 3AG3B 4AKPA 2JXMA 2DWSA 1PMYA 4G70B 2XV0A 2EILB 4E9XA 2Y1AA 3ASNB 3OQRA 3QQXA 2I85A 3CVCA 3SQRA 1W6WA 1BQRA 1F56A 3UACA 1PZCA 1PNDA 4YSOA 2WO3B 1ASQA 1XMEB 1E5ZA 1J9TA 7PCYA 1OV8A 3X1FA 3AY2A 2MTAA 2AZUA 3NJJA 3FU7A 1NPJA 1WA2X 3FSWA 4P5SA 5EHFA 2XV3A 1BQKA 3T6ZA 3FQYA 1V55B 2BZ7A 3BQVA 2FQGA 3T6WA 1RZQA 3UAEA 1NIDA 2BW4A 1TEFA 4DP5X 4A2FA 3AW5A 2PP9A 3NYKA 3PXLA 1ILSA 4GXFA 1X9RA 2Y69B 4NAJA 1IBZA 3H4HA 2BP0A 1AS8A 3EH3B 2VW4A 4DP4X 1N68A 1W6LA 1AS7A 2IH9A
chains in the Genus database with same CATH superfamily
4FAAB 4HS3A 3CBJB 3O3DA 2CJUL 3GBMH 4N4YB 1JIBA 3WY2A 1F4YL 2H8PA 3FSOA 4MD4B 5E6SB 1VERA 1QRND 1PZBA 1F6LL 1BYNA 5EIVA 1UQSA 2PF6A 5I26A 1TJIH 5TD4A 2QVFB 3EHBB 1HCYA 1KTJA 2EC9T 4M6OL 5DVOA 5I8OL 5I1HL 1EGJL 3OG6B 5BMFL 3DXAD 5BQDA 4YDVB 2VDQH 1U8HB 2DF3A 2V3EA 1KCVH 2WXKA 3GNML 4XVOA 2BVQA 4E41B 1UT2A 3VD5A 5CJ8A 3DSFH 1JS4A 3P77B 1PCSA 3VX1A 5DZVA 3U25A 3WNOA 1W80A 1YEJH 2AC0A 2WXGA 3BN3B 4W4OA 1SF3A 4GW5A 4JPKL 1E40A 1NIAA 3S3DB 1RIVH 3G5XA 3DTXA 2YEVB 4Q6IC 1A1NB 1QHPA 2R1XA 4R7DA 4DPAX 1UYWL 3K71A 4ODUA 5ESQB 5AZUA 2OAAA 4DTGL 1SJHB 3IDGB 5JO5B 2NY1B 1O6SB 3POCA 3MRFA 5AZEH 2ENJA 3LN4B 5DCCA 1VEMA 1JDDA 3SYQA 2BIPA 3PGCB 2NXYB 5E23A 3MKGA 3PL6B 3A4DA 5EEXA 2DWDB 5D4QA 4TVPD 2EDOA 2QGCA 2B1HL 4CSZA 3KLAA 1NGWA 1FC2D 4OZGE 4LP5A 2YRLA 2R0WH 2WLIB 1V7NH 2J44A 3GSWA 1DQKA 2Y07L 5GJTL 2DQEL 5T1MA 2A77H 3FL7A 2XIIA 4NN5C 2VJXA 1Q9WA 1FLRH 1YZZA 5I1LB 1RHHA 1RMFH 2ZONA 3WFBL 4IKLA 2OKMA 1BQLL 4JQXC 4M62L 2QSVA 3HMXH 1NFAA 2AV7B 3O6KL 4OVUA 4Y9GA 2C1OA 5T1LA 3WKPA 4BFBD 5GISL 2XDHA 2QKSA 3DETC 1WZKA 2DL2A 3IDMA 5C97A 2XN9A 4GBXD 3SDCC 1HU8A 4C4KT 2VSKB 4DN3H 3BKML 3IJEB 4YLQT 2NW2B 5ENWA 5TQ2L 5JPMB 5MHSE 4IW4C 2XC8A 2BVPB 2EECA 3IPBA 3WDJA 2APTA 2N7AA 1UC6A 4XMKL 4XMPH 2WYIA 2NY0D 1FVCB 3FQWB 1U3ZA 4GEIA 1B4TA 1IKNA 1IC4L 3FU9A 4HFWB 4QF1A 5IMOA 2EVJA 3MRPA 4FL4C 4EOWL 2HXAA 3SBWC 2GCYB 3S5LB 5I6KA 2WP3T 3FT3A 5GGSY 3ZMRA 1H8LA 5IWLA 4KMTL 4N86A 4QNPE 2WNXA 3C60A 3IKCB 2QBWA 1WT5C 2FQEA 4TV3A 4YLCA 5CN3A 1P4IH 2YMXH 5C0JB 3WS3B 3BH8A 3OLGA 4W70A 2AQRA 1DZ0A 2VLLA 5KWYC 1A6UL 4FFWC 4XB3A 4UTBH 5D6DC 4EQ2A 1QO3A 2CGZA 3FN0L 4TPRL 3VWKB 5I76A 1NSNL 1CQKA 15C8H 4L9LA 4MS8D 3U4BL 3F6LA 3FQUB 4IJTA 2EXSA 2BS8A 3QZOA 3ZZLA 3FT2B 4PJBB 3CU7A 5B38B 4LHUB 5DEGB 3DX6B 1UH4A 4OH2A 5E9NA 5SX5K 1GMIA 4WJ5A 5K9JH 4LIQE 1CF8L 3PABB 4FNTA 4G7YL 3BP6A 4HCIA 3WJJA 4N8VB 2DQUL 4Y9BA 4NUPA 3WBDA 2WXJA 7FABH 5KSBA 4PHXA 3T2PA 1CTNA 3P4NB 3QWRD 1WZMA 2EDXA 3KVPA 3GXNA 4FA7B 2XJKA 2HYMA 1Y6KR 4LSSL 3V0AC 3EJZD 3VCLB 1MJ8H 3V6ZB 1CDJA 4JG1L 4G8FB 4XE5B 5C7ZA 4ZMTA 2J8UF 4JFEE 5IB3B 2XWBB 3H3BC 4TSBH 4LVOB 1PZ3A 4XNQB 4NGHH 2PXYC 5PCYA 3L3KB 4ORGB 1MAML 4F3FB 1KSRA 1NGXA 1IJ9A 1VF5C 3AY4A 2BVQB 2FO8A 1BZEA 4XI5D 4E9LA 4PJBA 4JN2A 4PW9A 3D85A 3IEAA 2F19L 2XWXA 1TZHB 5E6YA 4PB0L 3MV9A 1MLBA 1O5PA 2XY1A 1HJBC 5EN3A 3CZUB 2P5WD 5CMAB 2AK1H 1S7VB 3PLYA 4HH8A 5HJ3B 1FVDB 4UZSA 1FG9C 4IM8A 2OMTA 2YA2A 3GSOA 1P7KA 4QLWA 3QUYA 4Q97A 2FTAA 3DX9A 1Z32X 2A9CA 1NBCA 3HG1D 2VIRB 2YAMA 4HPHA 3PRZA 5SWZA 3V0IA 3O3DB 2IAMC 4HPOH 1A4KB 3NAAH 3INOA 1Q72H 4ONFH 3GSVA 1RIHH 1RLWA 5KVFL 1FNSH 3DGGB 3DOSB 4CL7A 2HX7A 2RGSA 1ZT1B 4TQ8A 5I30L 1LP9F 4PJ8C 1SDDB 2X2HA 3BVVA 1Z9NA 4AIOA 5J0BA 5DJDA 1OLLA 4XBMA 3S96A 4GUQA 3IB4A 4MB3A 3PNWA 5A2CA 3TBWA 3GQFA 1NCGA 1BQHA 2WZAA 3BXNA 5I23A 3IDNA 1LO2L 2QSCH 3O6FC 4XPFL 3ELAT 3QO0B 3QUGA 4JY5L 4LLYB 3PS6A 5IEKB 1AGBB 4FL4B 2JKRM 4PBWD 3OSVA 3N55A 1NMCB 3ME0B 3QPQD 5DYOA 5D2NB 3U79A 4AL8C 3L3DA 4DZ8B 3P4OB 4YQXH 4GT0A 2X6AA 4R7DB 4RMQA 2BWIA 3FFDA 1AS6A 4X6CA 5K9KB 2AVFA 2NYYD 4UQEA 3FTXA 4K15A 1QBBA 2XFXA 4G9DA 4ZS7H 1PEWA 3EADA 3LNDA 4A04A 4YXHH 4OZGA 1SM3H 2F54A 2DQFA 3EO1A 4WFGE 3C75A 2BWQA 2OSYA 2NZ9D 2VR4A 1MDTA 4FQCH 1MW2A 1GGYA 2FWUA 1TQCB 5IMKB 3HVNA 4UQCA 4J3OC 5CN1A 1TDQA 2BFVH 2W60A 2X09A 4YHZL 1T5WB 4HKJB 2QLYA 3RE0A 6PCYA 2UZYB 4EXPX 1GPOH 3QSKB 2C4FT 5E9DE 2X2IA 4R7NA 5DUBA 3Q2VA 4HIJA 3SQBA 2OJ1A 2X28A 4JM2A 1DBBL 1B2WL 2YPLE 3UDWA 5ETUA 3AWFA 1D7CA 4JPQA 3N2JA 3U46A 1I3GL 3LQAH 3P9MA 5IQ9B 3O0LA 5JW4N 3KDMA 4FXGB 3BKCL 2GITB 4X6FA 1P84K 5HHMD 4OV5A 3KW7A 1NDMB 3EO9L 4FQXD 1IBGH 3FAWA 5D7LA 2B7DT 4QUOA 2AKRA 4FXKC 3JTBA 1YNTA 4MNQA 4L1DA 3B8SA 4H1LH 1ZLEA 2UWEF 4PRDA 1OW0C 1BGXL 4A6YH 4WO4B 2WBKA 5E5RB 5HJGA 2EYRB 2IGFL 4W9CC 1K6QH 4XB7A 1E2WA 4QGTA 4WI5A 4ZO7A 3PAUA 2NXZB 3UZQB 5BCAA 1HYSD 1XGRB 4PGCA 4QGYA 4P2QB 3KYMB 1OP3K 2VXQH 4GG6F 2FEDC 4YFDB 1ZV2A 4WHYG 2BC4B 4GQZA 3VFOA 4BDVB 4E9WA 3DIDA 4X5XA 1JUFA 1TTBA 3E1F1 1JBJA 1Z66A 2BHUA 1UADC 1KIUB 4S0SD 1I3UA 1AXSA 4KJPC 3KLQA 4FLRA 2YIHA 2YGOA 3CG8A 3QNYA 1VEPA 1E4XL 4PJXE 5SX4H 4LU5H 5D71L 1VPOH 2K45A 3HE7C 1WC7A 2FJHA 3FONA 3H3KA 5HP5A 4V33A 3NCJH 3RFRA 2AJXL 4D0DA 1E9PA 2XACC 1QPXA 3EFOB 4JFTA 4TTDD 2DQDH 3FU6A 5CEXB 1SVCP 1KGIA 4PJAA 3NSJA 1U93A 2X1WL 1PYWA 4HCGA 4MNHB 1P5VB 1W15A 2XZQL 4U1IA 4IJ3B 3HR5A 2Y22A 4KQ3L 4N0YH 3RJQB 2V17H 4C56A 4C58B 5FYKU 4W9ZA 2EEAA 1TFPA 1CICC 5DHYB 2NY4B 3D39A 3J07A 4NQEE 5DK2B 4XOCA 3IGKA 3S35L 1MF2H 2X4RB 5FO9A 3TBVA 4L48A 1K2DB 4NFDA 3GI9H 4WFFE 5D2NA 1KEGL 1QSEA 3TZVD 3UO1L 1WG3A 3APNA 1N2RB 4GW4B 3BKMH 4G8IB 3L7EA 1FE8L 4JFDE 1Q0XH 4EI5D 1ZHLA 1IM3D 1V5JA 1YEDA 2FB4L 3S7GA 1Q1PA 1EEZB 1KYDA 3NRFA 2D31B 5EU4A 5C08E 4QOKB 3RRQA 1OM3H 4ZFGH 2GYSA 2ADFH 1P1ZB 2ALWA 4L05A 4EOWH 2LV4A 3MV8E 3DI3B 1PX8A 4TSAL 2AEQL 1OV8A 4P59L 5IFAH 2M1KA 2GSGB 1XIWB 4O2EB 4RFNC 1NPJA 3PFQA 1LWRA 4XCNA 2YPVL 4XZUB 2D2CC 3T6ZA 2HJLA 1CLZH 3DC0A 3DIFA 1JYVA 4D7PA 1I9IH 3IJSA 3TIDB 2J2ZB 2R15A 2BSCA 3O41B 1T1WB 3W9EB 5IHLB 3O3EA 2IH3A 2VXQA 4I9WE 5D9SA 4DCQA 3V7AE 2VDLH 4DTGH 3BVXA 4HUKB 1LEIB 4ZW7A 5D1QE 3TEXA 2ZCZA 4JEGB 3VM5A 5FECA 2VE6A 1YQ2A 3D85D 3WHXA 5I0YA 4PJDB 3WTWA 2A1WL 2PW2B 3SKJH 2WLMA 4U1SB 4XO8A 4N3UA 1SBSH 3DBXB 4B41A 1KJ3L 3QUZD 4MNQB 1UM5H 4G8IA 3VXRB 2GB2A 2WZPA 5CU9A 3WN5C 4L8DB 4S0TD 4U1NA 3EG9A 4KJPD 4JQVC 3L9RA 1RZGB 4AYGA 5DXWA 1G1KA 4CKVX 3TV8A 5T3ZE 1IGIL 2OSXA 3D6GA 3VXTA 3IPEA 2Q0ZX 3ROLB 4DP8X 4NUMA 3QNXA 1Y6NR 2EXYC 3UTSE 5PAZA 4N1CA 5T5NG 3GMPB 2QSQA 3ES6B 4F7PA 3QI9D 4MJ5A 4U1MB 1YJDL 1JVOA 4EQ3A 2EDTA 1ACZA 3ZVVA 1Q1JL 2RFXB 4OF8A 5FUOH 1MFDH 4URTB 2UZYA 1DUZA 1MXGA 4KV5E 4K3JL 3GJFK 4QRRE 4PM1A 3S37X 3EJZC 2BNRB 5L2KE 2GFBB 5DFAA 5D1XC 4PP1C 2HFEA 3B9KD 5FUCE 3ZK0A 3U0WL 1OP5K 3T0BA 3OMAB 3BW9B 3VI4B 1WV7T 1BX2B 4F7MA 2WWKO 5CR8A 1CXLA 3VGDA 4FXGC 1MZYA 2KDGA 3U2JA 5CCHE 5E2TH 3ZE2B 1CBVL 4KX7A 2OK0L 1V3LA 3OAWA 1N59A 1H9DA 1IEAB 1LO4L 2Z8SA 1M1XA 3VH8B 2ZCHH 2B1AH 5TDOB 3T5WA 4U1LB 3H2QA 3OKKB 3RIKA 1ZLDA 2YQ3A 4ZFFA 2Z7YA 4P2RD 3L2LA 3T71A 3LYRA 4AXWB 4GUPA 1LP9A 1MW3A 3GSNL 3QCVH 2JJWA 2LTQB 3A4AA 4JFPB 4NZDA 3MXWL 5BJTB 3H2WA 5E0FA 5JOFA 1EXGA 1TENA 5KS9A 1IVTA 1BQHB 4ZI8A 4KAQH 2CXKA 1ML0A 4OJYA 5L0QB 4WCYL 1DBMH 3CSTA 2CKBB 3MGOB 2BSDA 4NM4L 3VSUA 4TQEH 5DMGD 1SHXA 3ZKND 1WLHA 4HK3J 4MZIA 5I6MA 3VFNA 3N44F 3RWIA 1HE7A 1JP5A 3GT6A 4PJGB 4JHWH 4Q0XH 4P46C 3PL6D 2X2YA 5GS0C 5E4AA 4B9ZA 4EBQH 3D3VB 4PG9A 5FDWB 2Q9OA 1YYLH 4H20H 2VDKH 1RZPA 4Y2LA 3W5NA 2J2ZA 2QVTA 4EPSA 5GXBB 3DMMC 3MJ8A 4XVSL 4MA8H 4Y8AA 1LK2B 4YSQA 4OCWL 4P48A 2NY4D 1EZUA 4H4NA 3HZKB 2MNUA 4AGLA 1JHTA 5IUSA 3MRRA 2IALA 5DMYA 3CFJB 4PMEA 3VB9A 3WEXB 2JE8A 4AYMC 3DSNB 4YUEL 1QLFB 2W60B 1F4AA 4Z77A 1IVLA 3IFPB 5IF0A 1SXZA 1JFHA 3DROB 2CJSA 5IK3A 1J87A 4OLXH 3AQXA 3ARBB 5CKAA 4P9MH 5DA0B 4JPSA 3UC0H 5E56A 1OAZH 4Y5XB 3LPFA 3CFDB 4WFFD 4MTMA 3RVTD 1UVQB 1NFDE 1UOVA 2H1XA 4NQDA 1RD6A 4HCFA 5C7XH 1HH9A 3H9SA 1FCCA 3SO3C 2NY5L 2FK9A 3HC0A 1VESA 1X4XA 3FDWA 3FU8A 1TZOA 5KSBB 2AV1B 2ERJC 3LOWA 4DZBB 1OSZA 3NSXA 1ADQA 2G3ZA 2QPFA 3LRHA 1UQSB 2C9VA 5JNYB 3LX9A 2CJUH 3X13A 3NCYP 3P3UA 5H8DA 1A02N 1C5BH 1LTXA 1U4FA 4ZTPH 3QIUA 4LEXH 4MMZB 1M7XA 3Q6FB 1E27A 2IJ0C 1RZ8B 3VFTA 4ZFQA 2BM3A 3QFJD 3RWJB 1QVOB 4LFHG 4R26L 5C0CD 2FYVA 2HJFB 3BQUD 4WWPA 4A2DA 1EERB 4NWTH 4D94A 4ELDA 4H26B 4PRNA 2ATAA 1D5BB 5CEZL 2HVBA 2FIRT 5I66B 3GXPA 3OJ2C 1RZFH 1JPSH 3E6FB 2I07B 2YPLB 5IOKA 5IREA 4LBAA 2VB5A 4K7PX 3UOAB 1M05B 4OSUL 1J1PH 3LKRA 1MVYA 4PJ9D 3TZVC 4ENED 1BMGA 4ZMLA 3KPLB 3EBGA 4RAUB 5D71H 1EJOL 1AE6H 4Z3IA 5JA9A 4OGXH 1MI5E 1NUFA 5JPNC 1DQDH 3TEZA 1I75A 4XCYA 3DVGB 2OXHB 2C3VB 4Y1AD 1OTUD 4G2AA 5FM8A 3KJ4C 4RAVA 3TT3L 4K5LA 3HUJA 4HUMB 5G5DB 1WIOA 1UWEL 3RUGB 5ISZD 5DZAA 2B5IC 4NHUB 3ZTJG 4J6IA 1YYMH 3CZFA 3MX0B 5F70A 4TLUA 2PO6B 4AM0B 3ZYOA 4JFFD 1F8TH 2RA1A 1BG9A 2WTRB 4LEOB 2F7OA 5FO7B 4IU2A 1YEKH 1T0PB 1FO0B 4AGOA 1M7DB 4HA1A 1LMIA 3BH9B 3H53A 3SPGA 4G7QB 2Y25A 4QXUH 1AJ7H 2IDTA 2A6KA 4O02L 5F71A 2V5RA 4TVPE 2XN0A 3L4TA 4WO4D 3TYGL 1Q0XL 5ISZE 4HSCX 4B9IA 4PJAF 1UD6A 4A63A 3ALXA 3SHSA 4YGAB 2LAGB 4MD0B 2A74B 3FMGL 2YAEA 1R34A 3IS1X 3SY0A 1N4XL 3X3FH 1DFBH 3E3QE 3L1OL 4UT6L 2EINB 1SHSA 1LM8V 2GTWB 2PKDA 3KPRB 3RWFA 5HGAB 1KCUH 4B3EA 1XB3A 4JDVB 3BN9C 4XMUA 2NYKA 2XKNB 4FFZH 4ODSH 4RGOH 5A7EA 1HQ4B 4MA7L 5CR1A 4XGZB 3QR0A 4Y4KB 2EXWC 3S36L 3ZU8A 4RGND 2DMKA 3O2DH 3H56A 4QYAA 4OKVA 4WGKA 5D7SL 5AVUB 2FSDA 5I2IB 1NKGA 4XMWA 2JCWA 2ZF9A 5A6LA 3CK0H 5FUZH 3WKYA 4ACPA 4P5TD 2B39A 4IDJL 1KJMB 1N3NB 4KWUA 5MERB 4YEFA 1I7RB 1KYUA 5CAYB 5CEZD 5IJVB 3WSQH 3NFNA 4FLHA 4PGDB 4OF7A 4HOZA 4WZ9A 1KDIA 3FQNB 2XA3A 5E2VH 2OMUB 2DYPA 5I18L 1R3KB 2BIHA 3O2DA 3MLYL 1CG9A 1XR8B 4KK8C 2FT6A 4JO4H 4NP4H 4PEEA 2EE2A 4OIBA 4WFHD 5T33L 2JKWA 5SWSE 4NO2A 2X41A 3RZCD 1QSFE 1WHPA 5I0WA 5GRYA 3VI3B 2BMKA 3UTQB 5IVXF 3GXUB 3KAAA 5FFOA 4O9HL 2PWHA 3CFEA 3MBWB 4QD2E 3MFFB 2R2BB 4CUCA 5TGBA 4V1DB 3WIHA 2O5ZH 5D2NC 3EZ8A 1YEHL 1CF8H 2DWTA 5I28A 4WENB 4F8QA 3TZVB 1I8KB 4TUOB 1XGPB 4HUUA 4PJCF 1WRFA 3WI9A 2OMBA 1JGEB 1IGTA 4G6AC 4QRPB 1JF1B 4J8RB 3RDTC 1A6TB 1OTSC 4Y1TA 3ZIMA 3K80A 2BSED 3A6BL 2HG0A 4LSQH 3T2LA 3BRFA 1EGJH 5DRNA 1NCCH 1HVXA 4UF7C 3TYFA 4E9SA 2A6IB 1VAHA 4FTVD 3VXQA 3BCFA 2VERN 3KPSB 4L4VD 4J1UA 4NO0D 1I85C 4GJTB 4RAVB 5EU6B 4AQ1A 4E9YA 2A73B 3D8MA 1XF5A 4N2GA 2UYLB 3BAYA 3DX9B 4X6DA 3QA3B 4JHZA 5AYQA 1CYGA 4M61B 3MNZB 3QORC 2Y7QA 4GAAA 2NX5D 3HG3A 2YRZA 1YHPA 3SDDD 2WKOA 3D87B 4XO3A 1G6RA 1HKLL 2ALAA 4XHJD 1VEOA 2CO7B 3NJFA 3MYJB 3HNVH 4WV1A 3DVNB 2QLVB 3QW9A 4J3VA 4X98A 4JFVA 2H6PA 3C2SA 1UGNA 4I0PA 1IIIA 2B59A 5EU5A 3V5KA 5JTWA 1URIA 1IM3B 4O58L 2GC4C 4M3HA 5B1KA 4UT9L 5BO1H 2DWEB 1NL0L 2Z31B 2X4PA 1HCFX 3FQ2A 4HUUB 1J1OH 1PAMA 5IQLA 1I7UB 3P4NA 5JDJA 2HMIC 4CVZA 5C2BH 4HISA 2YC1B 4MNGB 5D96C 2YFNA 2I27N 3MRNB 1YO4A 3NTCL 1O9VA 3WFCL 4JMNA 2P44B 3FFOA 1MCDA 4ZMWA 4YSPA 1JZ8A 4G83A 2OA9A 3NCWA 1EO5A 4P23D 3MACH 5HHPB 3MRMB 1Z3RA 4MXWH 4CILA 3E8UH 4GBXA 4KVNH 1LEGB 1TCRB 2NUTB 2ZSWB 4G6ML 1UA6L 1IM3A 2GQHA 2I85A 5EEYA 1HDMB 3SDYL 3T1FA 4YZFE 1W6WA 5SWQA 3UBGA 5D6DA 4K55A 3P73B 3UACA 3MBEA 2IOMA 1XCXA 4CN4A 3AWGA 5KVEH 2FJGA 1MCOL 3QG7L 1I82A 1G9NL 3UTZB 2VQ4A 1QNZH 1OAYH 3B1TA 1T03H 2Z92B 2VAAB 4JG0H 2MOVA 2Z8WC 4HCRA 4HIXL 4HZAA 4PQXA 4PTUB 3N43F 5EHFA 3ZL1A 4Z7WB 1JYNA 4HIEB 4NI6A 5KJRH 3FO9A 3IETB 5AW6B 1OK0A 3VFVB 4L37B 4AGNA 1GKOA 1NANI 5CWSA 5IHUL 4YXLL 1WD8A 2K6WA 3PUUA 2EIZA 4HAGA 1WBXA 3BYTA 4MMYB 5DFTA 1E4XI 1BLNA 4N2HA 1LJMA 4JY5H 1DVYA 3UZEC 3V4PB 1MAKA 5D7IE 1ACYL 4TNFA 3F05A 4RBPH 4M5TA 1JFQH 3D4YA 3L9BA 3N1MC 3L81A 5A6IA 4RA3A 2C9AA 5C08A 1E2ZA 1BSIA 4EI6B 5C09B 4JLRB 3FO2B 1FUNA 1K72A 3ALWA 2ZUQC 4DP4X 3ILEA 3GZPA 3UJTL 1SM3L 1DJZA 1XD0A 3IMWA 4OD3H 1WEJH 4AW7A 5CZVH 1OTUC 1KPVB 3LH8A 1JVKA 2R59A 3WGVB 2JCCA 3ML8A 5F7LB 4BZ2A 2NY6B 4XAKD 2GJZA 1TTAA 2ZX9A 3U0TB 1WBXB 4P46A 1VFBB 4K7PH 2WBJA 3MRBB 2GBVA 3B2VH 1M7IA 3LXCA 3VUAA 4N8UA 2VISA 2K1MA 4JM2D 2ENSA 2QPUA 3CXFA 4RWHA 5DK0A 3OZ9H 3MJ6A 2J56A 1MQ8A 3FS9A 2NY7H 1A3LH 2O93L 3ROOB 3T4AB 3IN0A 4F7CA 1INDH 3TO2A 5I17A 1TJGH 3MGAA 2R56L 2VR9A 4N0UA 5LLIC 2NXYD 2MCPL 2VAAA 4X8XA 4ZNCD 4PUBL 3FO2A 4FNSA 4ORGA 3KZ8A 1I1AD 1Z9SB 5JW3H 5TE4L 1GJIA 3NEXA 5LBVA 4HG4K 5LN8A 2E9WA 1KB5B 3JT0A 5HDOA 3TT3H 5KSAA 3O6ML 5MEQB 3DECA 1YNLL 4I87A 2YPLA 1RU9L 4NEHB 1UXWA 2OI9B 2WAQA 2VH5H 2ZUWA 1A9EA 1OZTG 4UIKL 1UWXK 3VXSB 3D69A 4P04A 5D1XB 3TA4D 43CAA 3ZSTA 5AFAA 1FNSL 1BM3L 3Q6GH 1MCQA 5DEFA 1AYOA 1LL1A 3ZHLA 1A7NH 2NR6D 1GSKA 3HTLX 5JW4R 2PWDA 4P05A 1G9ML 4FQ2H 2VN5A 4H25B 5AKRA 4AZ8A 3AADB 1DBJH 2H2PC 4UQAA 1H3PH 1RK0A 3DK0A 1DQLL 5DHMC 2WQAA 5IB4A 4WWOA 4XNYH 1UCBH 3G6AA 2CSPA 3NH7H 4K7FB 4QKTA 5ANME 3QORA 5IQ7L 4PRHE 3PJSA 4GY4A 2CDGA 5CZVL 5GIRA 3DJZA 5HI5C 3RBGA 4HIPA 4IIZA 1I1AC 4W4NA 3ZHKA 4I2XA 3ZDXF 2EE3A 4MMXB 2B4CL 4PWHA 1OT1A 3SE8H 3BSZH 2ICCA 2G60H 1DO6A 4FFVD 3B7TA 4MA7H 4DW2H 2UZXA 4GG8B 3BEWB 2E9BA 2X10A 1H3WM 5J12C 2BOLA 1TIUA 1U2CA 2AI0H 1EAPA 2VW7A 3QS2A 3R7RA 2UY7B 5HHVL 4BH8B 5LAXB 5KVMC 4HLZG 2BP5M 4R7NB 2C4XA 3V4UL 1JRHI 5KZCB 2LLGA 2VDRL 2YK1H 4PJIB 3N41F 5AVSB 3WSQL 3NT0A 4NRZA 3G5VA 4KKRA 4YL4A 5E6ID 2IH1A 1MNUL 4AEHH 4OZHB 5CCKH 3WJMA 4Y19B 4OLUH 5AAMC 3IDIB 1G9EA 3KWWB 3NPSB 4CKQA 1T20A 3AREB 2LHAA 1AGCB 1YY8A 1S9YB 2QQNH 3BZFA 2CHZA 3VGGA 4AGMA 2BZDA 4IK6A 5E08L 1C08B 3AU1A 3ZE1F 2IC2A 3FQXA 2WCPA 3QC6X 4K3GA 3TTYA 1OWWA 5GRZA 1ZA6B 3I9IA 3M86A 5FW8A 1RIUH 4LNRB 1HZLA 3FUIA 1AIFA 3ESOA 3EH2A 3H6AA 1R6VA 1CDCA 1HHKB 2AJUL 4NN6C 3G04A 3FJTA 4M7LT 5AD0A 4UDUA 3UPAA 1DEEA 4Z7UA 2HWZL 4Y16C 5LGYA 4QLRA 1TITA 3P0GB 4Q9RH 4UM8A 4FQJH 3WFHB 4YPGA 2FWOB 2COVD 3RWHB 5JMOC 5K9QG 2A9NL 4JHBA 5HJBA 2Z91A 4QHNA 2LABA 1N8ZA 2B77A 2IPUG 2WZ5A 5T5FL 5DLLA 3U7WL 2Y6SC 2HFTA 4M1DL 3NUKA 5C9JA 4XNDA 4PJ5B 2FNBA 4XWGH 3ROOA 1T7WA 3T4AA 4KK9D 1JMZA 4N2AA 5C07A 3JXAA 5DK0B 1MCFA 1OPOA 1YNTF 4LVNC 4BHUI 4ANXA 4JAMA 4FFZA 5F88B 2E7DA 2LVEA 35C8H 3APDA 1DVZA 2Y7SA 5FIEA 2JKJA 3OBAA 1FORH 4A68A 3WD5H 4F92B 5GRWA 4N8VG 3N40P 4Z0XA 1E8XA 2OMWB 4EI5B 4FABH 2CO2A 1EHXA 1YEIL 5HDQL 4U3HA 2X9YA 2Y5TA 3EO9H 3ETBF 4BKTC 2E75C 4JY4A 5IGXH 4X7CC 3VX0A 4LQ1A 5E6IB 2KI6A 3PG2A 4EI6A 2B1OA 4UU9B 3S2CA 3UTOA 4Z3GA 3NGBB 3KE0A 3J27A 3WJLA 2X4UA 4P4RA 4AV5A 4XN5A 4UQ2B 3EJRA 2WW8A 5HD8D 5F9JA 4LLVB 4UOQA 2A1WH 5DD0L 5EUOF 3DOSA 1A7RL 4KTGA 3O11B 1JK8A 5AVWB 5T1KA 4OD2B 1A8JH 1M4KA 2DYPB 2XA8L 3IT8D 9PCYA 1UD4A 3CCHA 5I6PA 5IFJB 4JM4H 5FW6A 3ZDZE 2G3MA 3FRPA 4LCUA 1EMTL 3IDXH 4Z7VF 5H94A 1HKFA 1UATA 2CDGB 4P2QE 3GKWH 1UB5B 1DUYA 4X6CE 4CSTA 5T33H 4YDIL 3OQ3B 2V5YA 2Y5QA 1BXXA 3RWGA 4S1RL 3LHPH 1NMBH 1MCJA 2EKSA 5C0RL 4NWUH 3IJHB 2JI1A 4Y5VC 3WDHA 3S5YA 3ABZA 4CVXA 2WUBL 5FS5A 5J11B 3UTSA 3KLHC 1ICTA 3VGAB 1UJ3A 2ADIB 3KR3L 3NA9H 3VU2A 1BXUA 4LSDA 1S3KH 3TURA 2LLNA 1A3QA 1KJ2L 3L4YA 1F1AA 1NEZA 3CCHB 5A2KH 4ZOBA 4HOMA 2X9WA 2JKSA 4H8WL 4EN3B 4JMXA 2DLEA 3JTTB 1K8DB 2O5NA 2NY0B 1MCRA 1GAFH 1BOYA 2HKAA 4QRRA 3HW7A 3SE9L 5TQ0L 1D5XB 1ET5A 3L3IB 3LEYH 3NIGB 3QJFB 4GO6B 3KPPB 2YZ1A 3FUJA 4DJMA 2Q3XA 4UTAH 1A3ZA 2B0SL 2EO9A 2IQ9H 1G6RL 4FQHA 4HPYH 3QEHB 1AFVH 1XF5B 4TUUA 5TE6H 4AH2B 3DUHA 4MAZA 5F7BA 1KNOB 5INCA 3E2HC 4G9FE 4HGMA 2NRDA 4BZ1H 1SLUA 4KZDL 1VGKB 1WPCA 2Z34A 4LRIC 4ZW5A 4ODTL 1C1EL 4M7KH 4FQPA 4LLUA 1Z7JA 3DXAB 3WG7B 4EMZA 3EYQD 3DO7B 4UV4H 2QV2A 2EDFA 1GY2A 3V7MA 4D8PB 4YWGL 4KKLD 4R83A 3UABA 1UURA 4HT1L 5ILTL 2R4RH 3HS0C 3NCCB 4JG5A 3GMOA 2QSCL 3SBQA 2WM0A 2H7WA 4U1KB 4OBSA 4KITB 3ULVC 4IIQC 3W5MA 3I2CL 2AF2A 5IEKA 3MRHB 3GS7A 2IH1B 1IQDA 2Y23A 3OC5A 2ENPA 1DBAH 4Y16A 3SY6A 3CHSA 3V5DA 1YQVH 4ZQKB 2VDKL 5E70A 3D09A 1CFVH 1GJWA 3PIQB 4QRQA 4QXTA 5CN2A 3TFBA 2RQEA 3WIHL 2CR3A 2WVUA 3ARZA 4KNUA 4LCCC 4JFYA 3CVDA 1K9TA 1KCSL 4HUXA 2VDLB 1NWOA 3OB0H 4ZUSB 4A55A 5K93A 3UAAA 2Q6WA 5CJQH 3DTDA 3ZZQA 2Z4QA 3EYSH 5E8NB 1ETB1 1MSPA 2OMVB 1VGEH 3RJDA 1RZIA 4E42B 3L3GA 4IOFC 2WQRA 4JR9H 4YUEH 4OLYH 4NCC2 2FSEA 4V1DD 5EV7A 5KBMA 5EMYA 5SV4A 1YEGL 4JDEB 4TKWA 1DLHA 3L3JB 2AEPL 2OPCA 4KROC 3KS0H 4Y4FB 3FOMA 4P2RB 3ZDWA 1GPOL 3IM1A 1KIUA 4X5WB 5M94B 3V0EA 4OLWL 4A38A 4BSWB 1J12A 1QFUH 3LNHA 5F1IB 2I25N 1T7VA 3BKJL 4AITA 2V9TA 2MOGA 5JUEL 4EVNA 3PHOB 4N2MA 4JFQB 1N64H 2IV9A 4O2CA 1M56B 4N2IA 1JGUL 3BJ91 4UV4L 5D1QD 4ERSH 1JXFA 5HXMA 4XAWH 4NC0B 4PJ8D 2BJML 1X9UA 3QEQA 1G7JA 3LTVA 3LKQA 1N8ZB 3TFKC 2VN6A 2XNAA 4PJHE 3QDME 1SXNA 1YJDC 4CVZB 4Y4FD 4Q52A 5MP6H 4Y16B 1OAKL 2Z8RA 4FQXA 4EIBA 4TOYH 1UA7A 4OF5A 1XZ0B 2NZIA 2XG5B 2G30A 4LT7A 4LNVA 3VG0L 3RVWD 1G5GA 1NCBH 3MN8A 3QRLA 1OT2A 4X9FA 1GW6A 1RUAH 2VMDA 1ROWA 2G5RA 3G6JF 3QZWA 1Y1DA 2CCWA 1ZDQA 4RGNC 1Z0NA 1HINL 2Q6WB 2YPKB 4R3SA 4KXZH 3CDGA 4O02B 4H2AA 2V33A 1HQ4A 1MQKH 1K3ZA 4KU1A 5DLMH 1AE6L 1KIRB 5CO1A 3APCA 3U36A 1M9SA 3SCMD 3SN6N 3B34A 1CF1A 3WGUB 1GGCH 3IGUA 4DVBA 4Y9CA 3VXUE 1GXEA 3ASWA 1I3RA 1TKWB 2PTTB 2NLJB 2IAMD 3BC9A 3GM0A 5I6XB 4YSOA 5INCB 3AM8C 1YMHA 3T09A 4XCYB 1L7TL 4PBXA 4KK9C 1KCKA 5I24A 3TFKD 1BVNT 1A14L 5ICXB 1WH0A 4Q9QH 1E8YA 3I50H 3LXUX 1CICA 3RVUC 2FJUB 4GSQA 4J4PA 1AHWC 3F58H 2XN1A 5GRJL 2F54E 1BAFL 2DQDL 3BQVA 5E8OB 1M3IA 1U41A 3A6CH 3F04A 3B43A 1RZ7L 5K1NA 1PS3A 3TA3C 4J3OH 5DR5H 1D5IH 1T20B 2YEZB 4PLJC 4UWQB 5IG7B 5D8JL 1AOHA 2NQ3A 2VH5L 4YDJB 3WLWC 1JZ7A 2PCXA 2PP9A 3NYKA 2NCMA 3PXLA 3I75B 5L4IA 5GS0L 1NEPA 3UTSB 3GJFA 4JO1H 2FDBP 4EDWL 1IBZA 4UV7H 2E27L 2VERA 3QYCA 3BCDA 4X6BB 1NCBL 5T1DL 2VE6B 2A77L 1J9CT 4G5AA 3VXSE 2VDQL 3DRTA 3QJHB 2HMID 4QTHA 3LIZL 2A83B 2WXIA 2ZIDA 5DMKA 3QORB 1B0WA 5E4IA 5FUZL 3GMRA 5IESH 2J6EL 3HN5A 3SDXB 4PVMA 3RLSA 1QPKA 3ZGHA 2ZG3A 4MMXA 2WK2A 1ZXKA 5DJCA 2EEDA 4R2GC 2X6MA 1HXYB 1AG6A 4O5LL 1BFOA 3HRZC 3WL9B 2EEBA 1ND0A 2VABB 3AXLA 3V4VL 3CSBA 3EGSB 5D7LE 4PJDF 4Y2OA 3ZKXC 1FYTD 3OJDB 2D9QB 4RMWA 4ETQA 1SUJA 1ED3B 3AB0B 3PDDA 3QIWC 5BXFB 1FGVH 4D2NA 4YVNA 5D7IA 1F18A 3GO1H 1R46A 4NQDD 2YPVH 3PUCA 1R3LA 3JWDH 3X1NA 1I9IL 5H2BB 1CGSH 1PSKL 3EOBB 4BFRA 3WAKA 3QYMA 4W9GC 1RUKL 5IVZA 2H6PB 3GRWL 3FFCB 2DQHH 3GSNB 2OQJA 4I0PB 1S7QB 1S78C 3I3EA 5C86A 2C3XA 2CALA 2VDNB 4BIKA 5DS8A 3B5GA 2ZX8A 4JCWA 2OI9C 4NKDB 4UQ2A 3OMNB 2J8UA 3L3OB 3MREB 5IB1A 2BVOB 3K1KC 3STZA 3SQOL 4S1RH 3DMMB 4BWWA 3FN0H 4TVUA 4A66A 2A6DA 4I3SL 4R96B 4LKXA 4AIZA 3IAPA 2OMVA 2CR6A 1ROCA 4FHJA 3VD1A 2R69A 4CW1A 1IE5A 3RG1C 5EZPA 5I0ZA 4Z7VA 5FF6B 3SDXF 4DKTA 2AMUA 4HIIB 3L4CA 4NO5A 5DVLA 3DUUB 4K5PA 3I02B 4PLOB 1VB9A 3U0PA 2W0KA 3H0TA 1XVSA 1ZRUA 2ZXBA 3CC5A 2O72A 3OAZK 1GH7A 1WGOA 4M1DH 2X89A 4K23H 4DEPB 3WS3A 1G7HA 2R69H 1JZDC 4PJHA 1GCFA 2D3LA 5FUOL 3RX8A 1Z9MA 2D7TL 1EXHA 4R96A 4NZUH 4YXKL 5I15H 4C4BA 1BF8A 3RBSA 2FAUA 3C60C 3D2UA 3EBIA 2PR9A 4J3OG 4S2SA 1S9KC 1U3HD 1NC2D 4DH2A 5EDXA 5GJSL 1KBGL 3WLWD 5KVEL 1KGYE 4GXVL 2AJZA 1K8DA 4Z7WE 2GI7A 1NFDA 2F5BH 3ZXAC 1G0XA 4TNEA 4PHZA 4L8CA 1J8HA 3RWEB 1G9MC 4HGWB 4R90H 4XPAH 2AXHA 4QHKJ 1V27A 5C71A 3MV8A 2NNCA 4X0NA 1G87A 2ZG1A 3BPNC 4YHKH 3ZMEA 2PXYA 3CDGB 2FUQA 5CUSH 3AUWB 5I19L 3CU1A 3H54A 1HSBA 2H3KA 4AMKH 3FT0A 2VDKB 4FZEH 2W9DH 3NSFA 3NEOA 4ZRGA 3SZKC 3RAJH 3REWB 4MXWL 1DR9A 2AV1A 4Y4HD 1N7MH 3H2PA 3QRGH 4HMCA 1CFMA 2J4WL 4L8DA 3QJQB 4POYA 1IFRA 3JWOH 1V05A 5LN4A 4F2FA 4D0CA 3OXSA 3P3YA 1GKEA 1MREL 5DZPA 1PZAA 3GMRB 1WEJL 4OM0L 4BINA 4I18B 4HFUL 4BD4A 4BEIA 2W38A 5DJXB 5HVGB 4NYLA 2P7TB 4F80A 1D5ZB 1ZHBA 4FG2A 2DYPD 3VQLA 4X4XB 3A6BH 4L29A 4LPTA 3F00A 4QPEA 3WTVA 1TJMA 3GUFA 3ZTNL 4JFOB 3D4ZA 3O8XD 1E9OA 1T22B 5AG9A 3VXUD 1G0YR 2NY7L 1TMQA 4QHPA 4RSVA 4GFTB 4NZJA 4XVUC 1JG9A 2IDQA 3NFSL 4YDJA 4FTDA 3P9WB 2Z0BA 4Z7UE 2O5ZL 3OMZA 3UCRA 3KL3A 4OFQA 3ZTEA 4Z1PA 3GKZA 3V7AG 3MCLL 5LQBL 4APQC 1F6AB 5CIPH 3VACA 1RP9A 2ZKMX 2P5WE 5KW9H 2UYLA 5IF0B 5EBGA 1JOIA 3ESUF 1TZAA 2BCKB 4RIRA 4H8QA 1KENH 1ZDSA 1TQBB 1QHQA 5D7JC 3TJHC 3SYCA 4EAEA 1CFSB 3TIDA 4Z7VB 4WI9A 4DEPC 4PWFA 4ODXB 3BUBA 4FP8L 4HJJH 4NQVA 4XHJC 4W9EC 3T2OA 2WVVA 4P2RE 4IRZL 3CVHA 2R51A 1NLDL 4GRLD 1R3IL 4PJFB 4L0ZA 4ZO6A 4A67A 1RHHB 5ALBL 1UCTA 1W16A 2RH0A 3SKUD 4UDTA 3HMXA 2B4CC 1DQTA 1QFWM 3O3AA 1DQML 2C9XA 3MROB 2E0PA 3QO1B 4IOIB 3C8KB 2KLTA 1FPTL 3AAZA 2CQVA 3C6LA 5F93C 1ORQB 1GOHA 4KKZA 1UZ6E 3SPIA 1SVBA 1B4JH 1TQUA 3M8OH 1F41A 3ARDA 4L37A 3B2PA 5L2KD 4R3SB 3CPLB 1OP3H 1WC7B 3BKYH 3LN4A 4XCCH 5E4EB 2VSDA 3LH2H 3MXVL 1F97A 2L7QA 3LMJL 2CO6B 4G7YH 3D06A 1XL6A 3CD4A 2CGYA 3F62A 3GC3A 3VXSD 2XN9D 3QXUA 5F6IB 2KYIA 2O6EA 5IJVA 1MJUH 1EVUA 1U92A 3UP1A 1FG2B 1U2YA 2AW2A 3T2NH 1E4XH 2XSKA 4YFEA 1R4XA 2JTYA 3SD2A 5EUKB 1NAMA 1PQZB 2IDFA 3CLWA 1RVFL 2V8LA 4UTBA 1FZKB 3OHXC 3IETA 4JFQA 3BZEB 3BKJH 1FJ1B 3IDJB 3NACH 4AC2A 3QPXL 2KT6A 4OCLC 1KYFA 3Q3GA 5FV2A 5I6XC 4F8PA 3CSYA 1BXAA 1U8MA 3WN5A 3DDGA 2BP8A 3WDIA 5IFHH 3KGSA 3G08A 2HLEB 3WFDL 2QGDA 1CUOA 1FWXA 1D5ZA 1WTGT 4KRNA 5ALBH 2A9NH 2BO0A 4JRYB 3FQ1A 3K2IA 3EXLA 2IFGA 1ZGLA 3EUUA 5LDUA 4Y4KC 4U1LA 1KCRH 5AW8B 2V6HA 3D30A 1EQWA 1OAXH 2RCSH 1PJWA 5EUKA 5I1HH 3UTTA 4HC1L 5BRZE 1SXSA 3VXPB 4OI8A 3BZ4B 1V7ML 5DMKB 4HK0A 3KH4A 3NIDE 2Q5BA 4AKOA 3LEXB 3CIQA 1OB1B 1SJVA 4NNXA 2XTLA 3IKCA 4QTHB 4TVSa 2HJLB 2F68X 2X42A 3A24A 3DIFB 2J8OA 5B39B 4BE5A 4K73A 3QJXA 5TH2B 5LBSH 3TBBA 4JDTL 5B4MD 1GZHA 1BAGA 2OSLA 5CEYB 3TCLA 5I5IA 4F7CB 4X42A 4OQTH 3DV6A 1R5WB 4YZWA 1QWHA 4TSCL 1T83C 1WK0A 5GS2H 3OKKA 4OD3L 4XVUD 1A9BB 3P4MB 3Q8CA 4WK2B 4Z23A 4J1UB 8CGTA 2BVTA 1RURL 4KKCD 5DMIH 2Q3ZA 2NNAA 5FDWA 4HWBL 3BP5A 2J55A 2COQA 2XZCL 3D12B 4OD2A 2EVGA 3K81A 4G8GE 5E5MA 2IAND 3BPCB 4OIAA 3C5JA 1P4BH 3F84A 3NP4A 4L0PB 3B2VL 4A7QA 1V8HA 1BMWA 5CSGA 4KHXL 3ZR5A 1D9KD 4F7EB 4KK5D 4ZPVB 3ABKB 1QW9A 3O3BB 3FQTB 1K4DB 2V7HA 3MRDB 4LF3B 2RACA 3PP4H 1NGYA 3RTQA 2X4OA 1XZ0A 4JFEA 2WVVB 2BLFA 1U58A 3BIBX 1JE6A 5CEYA 1GCYA 1MWAA 5HVHC 5JOEA 2J8UB 3L3OA 3MREA 5C07E 3WOVA 2B9AA 3JZYA 5KUKA 3U4AA 4PJIA 3C6LB 5B4MC 2CBMA 4OV6F 5FC9A 4FCHA 1CDUA 2OW7A 1J8KA 4F5CA 1PFCA 1CU4H 3ULVE 5GRVL 3AG3B 1D9KB 3BD4A 4P2OB 5EBMA 5ESVB 2ETWA 3DPBA 2W80C 4X9YA 4E41E 4CMMB 1C5DB 1MFAH 1ZV5A 2IADB 1SEBA 3NCFB 4HD9A 1H15A 3U2IA 3ETTA 3BLPX 3SQRA 4ONGH 2MKLC 4L9DA 2BNUB 1U95B 1PNDA 3LZRA 3TNNB 3VQMA 4ES9A 1ASQA 4KQ4H 4KUZH 3T3ME 2WLHA 1E0OB 2CO6A 3BIAX 1MFDL 2C9SA 4JM4L 4BH7B 4AL8H 1T1ZB 3RL2A 2HH0H 2B2XL 5JHBA 3TPUB 1E43A 1FJ1A 2LFEA 3VWKC 4KMQA 4MKTA 2W81C 1TYJA 4AENB 2E7BA 3V52H 4M00A 3IPFA 4XMVA 2CM6A 4L8CB 5BO1L 2A4EA 1C08A 1X6LA 3N0AA 1KXTA 2DBLH 2P8PA 4FZ8L 3AW5A 4XN7A 4LHJB 3TNNA 1DFXA 5K59F 1AXTL 4GXFA 5JR1L 4LLWA 2FZ3A 5GZOA 4FLQA 3ZE2E 1CD9B 5L2KB 2HVKA 2D03L 1J05B 3CIAA 1PKQB 1G4MA 1FDLL 1N68A 1RUML 1R24A 4P2OA 5EBMB 2WBWB 2Y5TB 3ARWA 4FFYA 4FC3E 1ES0A 4HQQL 4IU2B 1YJDH 3K6NA 1IAOB 1QI5A 3QWQB 4MWFB 2JJSC 5GGTH 3VGAC 4IGBC 1X7QB 4MZ2A 3HNSL 5L4MA 3ULVF 3OKLA 4XT1C 1KV7A 1IAKB 3GXIA 4R4FH 1CK0L 3MV01 3DBSA 2JCCB 4RZKA 4PJEF 3RUGA 4MJIB 1FFRA 4YAQA 2DI7A 4E9RA 2LTQC 4FQHB 2CXGA 2DICA 2VDRB 3LZNA 3J8F7 4JE0A 2GPZA 3ECQA 3PGFL 4NO3A 3VMPA 4J3XA 5IGXL 3RZCB 5JHDB 4P59H 3S35X 1XIWA 4O2EA 3WIIL 1UOKA 1AO7B 2QMKA 5IQ9A 3U46B 2G5UA 2WIMA 1L7IH 1UH2A 3NZHL 3CX2A 5EZOH 4OLZL 4QJ3B 1HT6A 4U1JB 2CO7A 5EEWA 1QG3A 3DX7B 1OGSA 3BPCA 3VXSA 3UZEA 5LGHH 1EUUA 2GJPA 3DYPA 3ZUCA 2EKJA 1T21B 3O45A 3FO0H 1YC8A 4UAOB 5J9PA 3I2CH 4JKMA 5E03A 1F4WH 1AZCA 4P99A 4UAOC 1UXWB 4MNQE 3AG1B 4WWKC 5DVPA 1ZPUA 1YA5A 3L95B 1MEXL 1UJ3B 1V10A 1TLKA 4ZZKA 3WTXA 4KHTL 2KZ1B 3UZQA 4MMZA 4HWUA 1QQDB 2ZOTA 4XWOD 1HHGA 3OKDA 4D9LH 2PW2A 3RZCA 1I9JH 3MRNA 4WIQA 4M1CD 2CHWA 3VRIA 3DUSB 1DVFA 4XNZB 4JJHA 2YJQA 4YE4H 3EYSL 4EXKA 2J7LA 5LB1A 5C0AA 3VXTB 1HFUA 2VR6A 2Y4SA 3HRZB 5J1SC 2ZSWA 4LSUH 4FRWA 4XPBH 1N6VA 1JWMA 5CP7B 5C0CB 1HEZB 4WV1C 5A40E 4YXHL 4JFZH 3NFPB 3T2QA 1GIGL 5CM1A 3X3GL 3TJPA 4PLNC 1K5WA 3Q8EA 1FO0H 2LW3A 4PLKC 1PW3A 1DLHB 2UZXB 4GG8A 3UPCA 2DQEH 3W82A 5IV2A 1HZKA 1MG3C 4ZG1A 1KJ2A 5LNDA 1XH1A 1ZVHA 5TE4H 1FLRL 3CFIC 1T6WA 2G0LA 3VD7A 3LEYL 1AXIB 4PREB 1SJMA 5AOJA 4ALAC 4E5XA 4Z6AT 3JVGA 3DTXB 4HXAL 3OB8A 1T7XA 3NEEA 2CHDA 3V0VB 1K5NB 1L3NA 2ZSVA 4NKOB 4UIKH 1GJUA 1FZJA 1MFVA 3PDOA 4HZLB 4XX5A 3TA3A 1KCBA 3BQUC 1OEZW 3S36X 2UZIL 3RWCA 1F1GA 3OG4B 3CLFL 1QNIA 2IXQA 3ZTDC 1X3DA 1S7UB 4EI5C 2IV8A 1EO7A 4N0FA 1EEUA 5FXCH 5HYQB 1GAFL 1HINH 2KBGA 2VGLM 1CFBA 4XODA 4CMMA 2OZ4H 3WNKA 2OL3A 3QDMB 4PLKD 2Z91B 2H3NA 4JFPA 4JZOB 4CBPA 2Z4TA 1EA9C 4AXWA 3I6SA 4Y0GA 4X7DC 2BNUA 4K3JH 3VXQB 3KMDA 4M5ZL 4U6VH 1CLVA 2WLYA 3CDFA 4RSYA 5C0CA 2GJZB 3T65B 3QFJB 2VN3A 5MEOA 2LU3A 4BZ2H 1SEBB 2FEJA 3OVUB 4HD5A 4NERA 4FTVA 4JRYD 2JB6B 5F1NB 3T8XB 1JN6A 3GMQB 3HC3H 4GS7B 5HHVH 1U3JA 5ADPH 3A4FA 4YDKH 4P2OC 4AC4A 3RDTA 1QTYT 3QVAA 3L4WA 5FA3B 7CGTA 4FFZL 4ODSL 1H8NA 4P8QA 4RGOL 4BUHA 2VZ3A 2BVYA 1GYWA 2BNRA 2YD7A 3GXFA 2ZAHA 3U30C 5BV7B 2X4NB 4JRXA 5DR5L 3QUXD 2VO8A 3N40F 3ZOAA 3BUYB 3VA6A 3MLPA 2W65A 3CFMA 4HJTA 3LCYA 5GS0D 3ATEA 2I60H 4FHKA 4MQ7B 1R47A 3O6LL 3N1PC 1ONQA 4XC1L 1PD1A 1NGQL 1MJ7L 2F08A 4NKDA 5HHQA 3OJVC 2E27H 5D96B 4G3YH 2R1WA 4ZOAA 2C7FA 2PPEA 1Q9KA 4JS7A 4PRIA 2EJ1A 1CMOA 4QOKD 2E47A 2BK8A 2CZNA 3UMTA 4PGBB 4MAYD 4PJBF 2FL5A 4LCWA 5FGRA 5EF0A 1EDHA 1WVZA 4MA8L 2B08A 1BHGA 3ZQXA 2WJ7A 4QHUA 5EOQL 4XWGL 4K2UL 1IAKA 3T3PE 2J72A 1VIWA 4K8RL 3BI9X 2KZBA 4G8GB 1WFJA 1RIHL 2NY6C 4JQIH 3PHSA 1E27B 1ADQH 4GMTH 3V6OC 1AGDB 3WFBH 3ECVA 3E3QC 4IBYA 1PLAA 3RGVD 4YHNA 4L3CB 5J13C 4FNUA 3X14B 2A9AA 3US9A 2DDQH 3FT9A 5FOBA 4XX1G 2ZXWB 3OZKA 4HOXA 4O51B 3KXFE 4N6QA 3TP4A 3LZOA 1VDGA 4JRXB 3L4ZA 4PRHA 5AW5B 2C9RA 3ZKNC 3QEQD 3ARUA 3EJYC 2PW1A 4MCMA 4WFED 4DP7X 4NP4L 1Z5YD 3MCKB 2EDHA 2VLKA 4F33B 4ZTOH 1H15B 2DWDA 2VJ8A 2NR6C 1CFTA 3C09B 5EC1B 3ZTJH 5I17B 3DROA 2CLZA 3CH1A 4GT7A 3UXFA 4B0MM 2EDKA 4HXBH 1EBAA 1P7QB 5IJDC 3DSNA 3FFDB 1I8IA 1PGRB 4XO4A 1RUPL 5AZ2L 1UJ3C 1KC5L 2Y07H 5GJTH 3ZW3A 4MJ4A 4NQSA 5FK9B 2QT6A 1NCAL 2FO1A 1E5CA 2CM5A 2OXGB 4IRJD 4DKFH 5JZ7D 3AITA 5EG6C 1QYGL 3QCUH 4KOBA 5DHVA 1WZLA 3PQYE 3Q2LA 2CMRH 1T66C 1ZLVH 3L7EB 5E0QA 1SLVA 2YSSB 5MENA 3EXJA 4WNQA 1X5KA 1DCEA 2K70A 2N01B 2Y6TE 4K8RC 5DHVH 1PKOA 4CU6A 4P9HC 2MQCA 2AGJH 3U1PA 5B3JE 1R5IB 5CILH 3TIEA 1CXIA 3PV7A 5E2JA 4ZW3A 1Z5HA 5DVKA 5DHDA 2H1PH 3DMMD 1NOAA 4QAMB 2A73A 1S9WA 1VADA 4L4VB 2E9IA 5EU6D 4E9QA 1CS6A 3CJJA 4ODVL 5GGVH 4ZD3L 3E6HB 3LZFH 3GMLA 1QOKA 3PWUB 2C1PA 2E3VA 2HFGL 1JERA 2EE9A 3DOHA 1IAIM 3LHAA 4WFGD 3G6JA 4WK0B 4MWFA 1PLGH 2E7LA 4FULA 2MCAA 2YZ8A 4NRXA 4MAUH 5FCUL 1D7FA 5ERWB 3MLSL 4X5RA 1X4YA 3OGCA 3TN0D 1XGUB 5D5MA 3W9DA 4M5SA 3B37A 4JRLA 4PJGE 4L4TE 3TIEB 2KL6A 5F9WC 4JQXA 1D6EA 1F6AA 3CK0L 3GLDA 3QYNA 2FLBT 3L48A 1JZEA 4PJ5E 2VKXA 3EGXA 3STZB 4PB0H 1WS7A 4U1IB 4DAGH 1A6UH 1LO3H 4YHYB 2IGFH 4K94L 4PVBA 3GSOB 5AB1A 4NDMB 4KUZL 5D7EA 1TYRA 1MHPH 5AYUL 1C5CL 1OK8A 3FH8A 3H9YA 4XP6H 3KCWA 4JANB 4ETYA 1QD0A 4UT6H 5G5DA 1BVKA 1UENA 5KOMC 3KWWA 4WI3A 4RWYL 1SN5A 1KF9B 3EG9B 4PBVC 1U3HC 4JPIA 1P5UB 1WAPA 4YC2B 3U7YH 3QIUB 2L7UA 4EUPH 5AVTB 3NGBC 4WU5A 5F9AC 4A7SA 3IXTB 2C1OB 4QO1B 5T1LB 4BJLA 1BYOA 4L5FL 4OJCA 1HL4A 1BVNP 4NN5B 3JV6A 3EO0B 1YNTB 2O6PA 4HS8H 4J12A 3MXWH 1TNMA 4GSDH 4WWNA 4GMSH 4JREB 5K39B 2WGXA 4UDUB 1M71B 4IOIA 2Z3FA 5IBUG 1KCSH 1N59B 4S1DC 3TVMD 4XPFH 5F6HJ 3KPTA 1LDSA 2VUKA 4P2QA 3K6OA 4PWGA 3SPVB 5I1AA 2WCSA 3BE1L 4ZUVB 4QJ5B 4TL4A 2I9TB 2XVLA 4HMEA 5AZEL 3QCTL 4JDVA 4IEFB 4OZ4A 4N85A 4NXKA 5JOFB 1A6VL 3HI5H 1QBML 3H1ZA 3M6DA 3BH8B 1IKFL 2R56H 1JHKL 1SEQL 4YXLH 3TH3T 3V0JA 3HAEG 1DJXA 5FHBL 3FHEA 1TJXA 1Q94A 1J7VR 5G55A 4PJXF 1JTOA 2BCKA 3B6SB 1M7DA 4QXVA 2IPKA 3KYNB 1HYRC 2XZAH 3UYPA 2W9LA 2WQXA 5DUMH 2XKUA 2C9QA 4WV1B 4G8GD 5KSUA 2ADFL 1CICB 3N5AA 3CZJA 3KXFA 4XP5H 2XY2A 5JLZA 4FI8A 3FRPG 3FT3B 3LAFA 3QHFL 2JLPA 5A2FA 1TLMA 1PBYA 3ARFA 3EH1A 4BFNA 1N6UA 2W95A 4OGYL 1RV6X 1GTFA 2H32B 2ZYHA 1I3GH 4IMKC 4XBGB 2A9BA 4GSDL 2QEJA 2BP0A 2HP4A 4MBOA 2X3AA 3QAQA 4TTDC 3EH3B 3EO1B 4QRSB 3UYRL 4D9LL 5DWPA 4B97A 1SMAA 2VR3A 2BXZA 3WFCH 1IGFH 4R4ND 4XN1A 4KUCD 4O02A 3FH5A 3BZ4A 1DBKH 5JW4Q 4LSPL 3NPZB 4EI0A 2VQ1B 4IIQB 1XH3A 4DP2X 4DW2L 1BDYA 1LQBC 2CCVA 2NY0C 2OX5A 3QFJA 4KK8D 2OMUA 1G7MB 2LU4A 2IFFH 3D51A 4GKOA 1FYTE 1DJGA 1GY1A 1A2YA 1XF1A 2VXQL 5SWZB 3Q5YA 3GSQB 4Y89A 2O5YH 4Z8FL 1AQDB 2E7MA 4M3KB 4ADJA 4YS4A 1J1OL 1LK3L 3IFLL 3EOAA 4WW1A 4LPXA 1GC1L 1XCTB 1G9NH 4MXVF 1CO1A 5C3IA 1Z5LB 2FIKB 1A1NA 2DQTH 5CGYD 3ECWA 1Z3GL 5C0AD 1UA3A 3ZRFC 7FABL 1KLGB 2OMYB 1MH5B 2UUDH 4BWTA 2FEEI 4KKBD 2GTZB 5FUCC 1OHQA 1LO0H 5IFHL 3US1A 4KMLB 1IC7H 4DK5A 1NFDF 2BIMA 4YHPB 5HHOD 4DQOH 4YN3A 4KVNL 5EO9B 3T4YA 3UP6A 4GP4B 3O3AB 1RUQH 3MV7A 4JO1L 4P5MA 3ZO9A 4PWKA 5KSAC 1ECZA 4WDIB 1NFIB 5IROA 1DVFB 5IP4A 2RHEA 4YX2H 3AROA 5GHWH 3D39B 5D5MB 5DK2A 3W9DB 1OD9A 3WN6A 2AI0L 3EH4B 1J5OH 3M17A 5IESL 3S5ZA 5LBGA 4Z0XB 2F6AA 1S8DB 5LBSA 5FX3A 4H1LG 5C0FB 1HWWA 1DQMH 4NAQA 1J88A 2BSSB 2VZSA 3U0TA 4QHUB 4ONOA 5F7UA 1DL7L 4KC3B 5I8EA 4JFXA 4DUXA 4ZJ9A 1ZHLB 2NX5B 3QPQC 1X6NA 4M7ZC 5E2WH 1IQWH 1IQDB 4YHOH 3RVXD 2C3VA 1RURH 4FNLL 1ZWIB 4XH2B 2HVJA 3MHZA 4O2FA 4IDJH 1B9KA 3VWJC 1GSMA 2R4SL 1NA8A 1BLIA 1GGBH 1T0MB 5ID0B 2ZUQB 1HC1A 2BNQB 4H0GA 1YEIH 3V6BR 1PCXA 5D1QC 2VXTL 5E6UB 3FB8A 4HHAB 2GCYA 3S5LA 4KZ0A 5KSUB 4XPHH 4LASL 3LXBA 1PYWB 3FT1A 3L4VA 3FQUA 3CFNA 1DVQA 1IBDA 5JHLA 4XPTL 3BX7C 4HGWA 1KN4H 3TVMB 5CXPA 5IVZB 1RU9H 1S7SA 5ES4B 4Q74A 4UQBA 2BVPA 3O6FB 2J88H 4AQAB 2ATPB 4G43B 3Q6FA 3VO0A 3ARED 3P0VH 3NK3A 4EJ1C 5IHZB 4PJ9A 2GEEA 3ATBA 5JNYA 1BOGB 2F58L 1AHWB 3NIFE 4OCXL 1CD1B 1J10A 4I1NB 2APXA 3OAYK 5C09A 2ITCB 4HUWB 4G6JL 3CN4A 1OB1A 4XC3H 1KZYA 2GSMB 2I07A 3BP4B 2NUPA 5ESAA 3TNMB 6CGTA 1OTTC 5HI3D 3EYQC 4GNKB 5F1NA 2JB6A 4FG6D 3ZL4H 1NCIA 5C0GB 1FDLH 1RUMH 1QATA 3QZMA 4GP5B 4FYRA 1TZGL 2FBOJ 5I71B 3L9RB 4HQQH 4LGPB 4A7VA 1OAXL 2WBJC 2XWTA 4CA4A 3STLB 2G60L 1YPZE 2O6DA 2IWGA 4JRYA 4L4VE 4WUKL 3ABGA 4RESB 1U33A 5EOCL 3PGCA 3HNTH 2WXHA 4V1DA 3ULSB 4NC1C 4HIEA 3PWVA 2ZNWA 4N0CD 1HAWA 1RAMA 4JK0D 3CXDL 4MDJB 4JFDB 1BAWA 3P2BA 4AVJA 2IO5A 3K91A 4K5MA 2XJLA 2XWCA 4UQ9A 3CGTA 3HI1B 1D6VH 5LGKA 5CINL 4F15C 3VW3H 3GK8L 1A6AA 2I26N 2PYFB 3MNVB 2P1YA 1NMCC 3S4SB 4OFVA 4P4KB 3HHMA 4C83A 3C12A 4O9HH 3PGDB 4LRNL 4R97B 3OKOA 1EEYB 2NZ1A 4PJAB 2DOCA 1U8OB 1SFDA 3W9EA 2H2PD 3MLRL 1EAQA 5DZLA 2DM2A 4ZUTB 4HUVB 1E28A 1HILB 1I4FA 3U83A 4L18A 2OS7A 4PJIF 1UXSB 3C5ZC 3OHMB 1KXQE 5J1TC 1PIGA 2OYPA 2X87A 5GSVA 1J5CA 4M1CC 1ZANL 3U4BH 3MLXL 1IGTB 4GQQA 1F00I 2R29H 4A39A 5ITBH 2UXFA 3ILQC 4ZQKA 5CZRA 4WLCA 4PCKA 1EJOH 3BWZA 2BVEA 4HJGA 3KGUA 1IO4C 4OCMC 5BS0E 2WO4A 2YO3A 4NQTA 2O6CA 3CVBA 3LV3A 5I74B 4H5SA 1MRFL 1XIWD 4FQJL 2NOYA 1GGIH 2A6IA 3UC2A 2CGRH 3MOAL 1NGYB 3AXIA 3I6KB 1MW1A 4GAGH 3HRZA 4KK5C 4PCTA 1IL1B 2EICA 3QWOA 4HF5L 4BK5C 3LRSB 4EKJA 3MDJA 4JFUA 4N0UE 3RI5K 5KG9A 2J8UE 5C07B 1DDHB 5KVGE 4PJ8A 3GEFA 3HR5B 1S9WB 3MBXL 1XGYH 1Q1JH 2EH8L 1DLFH 2F54D 1QP1A 3HG1A 4L8BA 4KNTA 4F8NA 3AT9A 3QQ3A 4JO2L 3SGEH 4OLZH 2YC1A 4JZJC 3BUPA 4BFKA 5AOLA 1YN6B 5CJBA 4Y88A 4NHCH 4WKZB 1EPFA 4X99A 1I1CA 1CTMA 1WQVT 4ZTEA 4LHUA 3D2TA 5C09D 5GZNC 1I85A 4FABL 3MUGB 3AVEA 4PY7B 5JQIB 2PYEA 4B9CA 3GK8H 4DETA 1AQKH 3GYRA 3CMOH 3K46A 3S37H 3SB3A 1LDPL 2RR3A 3VTMA 3ARRA 1CGTA 3II1A 5A2IH 4FJ6A 4FKHA 2AITA 3B3BA 2FECI 4IS6B 4GQ9L 1I8LA 3AC0A 4IBWA 1AIFB 3BQUA 3GI8L 4MJ6A 1ESOA 1ZK5A 1R17A 4XCFL 3MBEB 1M6UA 1P0SE 7PAZA 1LE5A 4TLKA 4XP4L 2VZOA 3HCVA 3OWEA 3WUWG 1P84J 3FU7B 4ZPTB 2MWCA 4XNQA 3ECUA 3JWDC 2CBOA 3KEDA 2FYYA 1CBJA 1XGZA 4TNWF 3NJKA 4EUPA 4NO0A 1WWBX 1MOEA 4Y5VB 4TUOA 4U33A 3RTQC 3BPOB 4Z7WA 4FYTA 1DSYA 4AVHA 2JXMB 4JGMA 1KJMA 1N3NA 5MERA 4NQDB 3ZDXB 2EIKB 1U8IA 2K4WA 2V9QA 5CMAA 4MRCA 4TQEL 1G43A 3CQQA 4ODWA 3PDGA 1OSZB 5IFAL 5FCSH 1JV2B 4KPHH 3GMPA 1IB5A 2NY5H 5LDSA 2H3XC 4L9LC 5GGRB 3QJTB 3FUNA 4HH9A 3GSUA 3AQZA 5ACZA 5FPIA 3MBED 1E65A 4XBPB 4N5ED 1HNFA 1M71A 2AFNA 4O2FB 3ZKXB 3RVVC 2A9DA 3C2AH 2R1XB 4DFHA 4YBQD 2BSRB 2CLRA 4B9KC 1J11A 2NY1D 2VMEA 4YR6B 4HJUA 5EEZA 5HYIA 4DSYA 4QEGA 4NNPH 3KYKL 1NEUA 2CPCA 2ZCKL 1GGCL 2R83A 2F53A 2R2BA 3CVHL 3N44B 3KYOB 4DPRA 2PYED 2IOOA 1TMCB 3E1ZA 3VSVA 1DJIA 4WI4A 2QJDA 4YDIH 3HAEB 1S7VA 2RB8A 1JHTB 4HS6B 5HDWA 1Y18A 2WXFA 2X12A 3TEYA 2IPTL 1AGEB 5DRZA 3MMEB 1T1YA 1XGTA 1B0GA 1II4E 4OJEH 2HX9A 3DRQB 2E6QA 3WNNA 3HJEA 1ZV9A 4I0PC 3VSTA 3RVXC 4JPWL 1EFXA 3TT1H 4TYUA 1W91A 2QQQA 2J1XA 4W9IC 4AV4A 3MRIA 5IFJA 4LVNB 2ZT9C 4XP4H 3O6LH 2JLLA 3IKKA 3NQIA 4WSKA 4YSAA 1DBBH 3FTYA 4N90E 4OGAC 3T1WA 3Q5OA 4H8WH 1H6FA 1KB5A 1XMWA 4F5CE 3QDJD 4RQQB 4HGKC 4W1TA 3ILPB 1H3PL 5DVNA 4OR1A 3WJJC 2CKBA 2DPKA 1W72H 3DK2A 3KPSD 4YFLF 3T77B 5INDB 3BH9A 5F88A 4MB1A 1QRKA 2X0VA 3TZVA 4IKKA 5T1KD 3NABL 3PAZA 2IPUK 4K9EH 2OMWA 1IKNC 4EI5A 4FQCL 3EGDA 4PJEE 1KPUB 3HPLA 3I3DA 1JZ4A 3GMNB 2XZZA 2HJKA 2W91A 1S5IH 3AY4C 1X9QA 4QI3A 4R4BB 3NMEA 5I0DA 1BJ1H 3DPDA 4N2EA 2VAJA 2Y36L 2AABH 3V4LA 3VMNA 1UASA 2IOIA 2Y6SD 2EILB 5J11C 3H42L 3HG4A 2Z35A 3IXAA 2WQWA 3R4DA 1DBKL 1MFBH 1OTSD 4I9XA 3JVGC 4LIQH 4NXSA 3II3A 4KBPA 3SGKA 5K9JL 5C0BA 1TTFA 4RAUA 1MXDA 3MR9B 2YS4A 2ZYRA 3OKEB 1RHFA 3H3PL 1LE5B 2ZOLA 4CJ0A 2FBRA 4L1HA 5D2LE 4JFDD 2PETA 2VZ1A 5ITFB 1BVLA 4NCC1 1J9TA 2MTAA 1BLNB 4LLUB 4L9LB 1T22A 4ZAKC 1YEJL 1MLCA 3BP5B 3DX2A 2I5YH 4OQTA 4PJ7F 4RZCB 3VFUA 4P5SA 4IOFD 2DEXX 4NN6B 3NIFF 5LWYH 1K4CB 2JIXB 2UZIH 2DQJL 5EDSA 4OZHA 3GIZH 4P23B 2XV6B 3ARFB 5GGQL 2R2CA 3TLRA 2QZQA 3KBHE 1LD9A 1NCAH 1BBJA 5GGSA 1TTUA 3FZUD 3BWAB 4NPYB 3BZFB 1WFTA 3QC5X 4NENA 5CJOH 3QQ3B 3RZCC 4Q9RL 2FJGB 3PWLA 4OLYL 3WO4B 1KJVA 4X5LA 1AXSB 3MRKA 5D7LB 3CTTA 3UCQA 3Q7JA 1ZTXL 3VXRA 1D5BA 4HWBA 1T3FB 3F2LA 3F5WB 4ZOEA 4P5TC 5I2IA 4L3CA 1DVUA 2VW4A 3PPEA 3MV9B 1XAKA 4WUKH 1AS7A 3GSUB 5GHWL 2DH2A 3KPRD 1JZIA 4NB7A 2ED7A 2DLGA 5T3XH 1RMFL 2VMCA 2AJSL 3L2NA 4Q6YA 3GPSA 1UJTA 3OKNA 3T6VA 4IBLT 1QHOA 3ZE0E 1JPST 3II2A 1FFNB 3BWAA 3PREA 3QARA 4NPYA 1EHLL 4QHNB 2VO5A 4U3XA 3T3MF 1UXLA 2VLKD 1B4LA 3QNZA 3QQ9C 5CINH 3VW3L 3DURB 3B3IB 3MJ9L 4X9HA 5AW9B 1I1AB 2V2WB 5C0NC 4JFHD 3IFOB 1TU2B 2XX0A 4G7VL 4JHUA 3BSHA 4LBEA 4NO0B 3QUMB 4JN1L 5BVPH 1UEMA 1DUZB 1Q0YL 1E4KC 2DQHL 3KPSA 1FL6B 5IBTL 5ICYA 3VD0A 3NSCA 2WNWA 2OFQA 2VDOL 1A6PA 3N04A 4M48H 1IM9A 3DX7A 1RULH 4JL1A 4X4ME 2V2TB 5AWNH 2JKXA 4JZNB 3VTAA 4E68A 5J6HA 4FG4A 4BV1A 4RDBA 3S4SA 2X05A 1ZANH 1ILUA 1AG0A 4PCYA 2WKOF 1TQCC 3QR2A 1L4IA 1M57B 4J3OF 5GRVK 2DY2A 4MD5B 3WNMA 5MENE 2AQ2A 3L5JA 4Q14A 4QRPD 1L6XA 4XNXH 4X0KB 3U0PB 2YMXL 4M6NH 4DZ8A 3CDZB 1P53A 3NPSC 3D39D 2R2HA 1RKRA 2AQTA 2OXHA 2MHAA 4RISH 1OGAD 3VG9B 1PZUB 1RZFL 4A2LA 1HK6A 3OF6D 2WLLA 1ORQA 4AMKL 2D03H 2GC7C 4BFIB 4IBUA 3FBKA 2C7UA 2VLRB 4R4BA 3O4LB 4XNUL 5CJXA 25C8L 1AC0A 3V10A 1LE9A 4LCIL 2XBTA 3MRLA 3EGDB 3HG2A 5KZCD 4GLRH 5D6CA 2ZPKH 5IBLD 1GTNA 4YVUA 3OAUH 3QUXA 1IAOA 3VMOA 1N2RA 3KEHA 3EYVB 4R4FL 2Y06H 4QXWA 5FLVA 2VISB 1QBLL 3DGCR 4ZUUB 3KBFA 3I6KA 5D9SB 2EVIA 1OAUH 3QISA 2OTUB 3PPSA 2AXGA 4KJYA 3FN9A 1TZGH 4LPVA 3ULUL 4KO9A 3BAXA 1FNEB 1NC2B 1X44A 3HJ0A 4JREC 1UCBL 3NH7L 4I3RH 1MCBA 4U31A 5IQ7H 4HX1A 4LCWD 2OV0A 4UNVA 5CSZA 4MX7A 3QDJB 2DEYX 5FK9A 4PJDA 5DDHB 1Q0YH 4MJJA 4RIRB 3ZYZA 1O9ZA 3ILDA 4TUJB 1A4JA 3DX8B 2HLAA 3CVIH 5ABDE 5FHBH 3K2KA 1WBYA 2BIQA 1SDDA 2OYMA 4AGPA 3MRGB 2J12B 5F7MC 4L5FH 12E8H 3D18A 3BEWA 4W81A 4P0DA 3VFSA 4J2XA 4ODUB 4P06A 3MCKA 5ESQA 2KC0A 3O3EB 1XH2A 2ESVB 3ILPA 5GPRA 3DI2B 1CDBA 1QR1B 3GBLA 3NZ8A 4E0RB 3AU0A 1SUHA 3CFQA 1E8ZA 5FYLH 2EH7H 1FNFA 3L7FA 5IVXE 2K7PA 2YRPA 1BMZA 3P77A 4OGZA 3SDAC 3CLEH 1RK0B 2K6YA 4Z3HA 2EYRA 2CH8A 1T5KA 1HOEA 1Y0LB 5E5LA 3RHWK 4ODHL 1QW8A 1HXMB 3V55A 5FB8B 3E8UL 5C08D 3C8HA 2C4FU 1GW0A 1ZA3B 2P8MB 3RTLA 4OZFA 1YPZF 2V5SA 4K71B 4ZAKD 2X70B 1JYXA 1E8WA 3LPPA 2NUTA 5FDYA 3IFOA 1MWAB 3LKOB 3IMVA 5F8RC 4NT6B 4FGMA 3EAKA 4KZDH 4WI7A 3BD3A 5AKSA 1OCCB 1QYGH 2ZWYA 4DF9A 1C12B 2XPGB 4JCMA 3QIWA 4TLSA 2LQRA 5FO8B 5B1AB 1JNHB 2CWRA 2YR3A 4YPGB 4F7EA 1I1YA 5DF0A 2PCFB 4YDLB 4ACTA 1QTPA 5ILTH 4HFWA 4QF1B 1GC1C 1AZBA 1LO4H 3STBA 4AEFA 1I7TA 1LO3L 1QFUL 2HUEA 5JORA 1UKSA 1KCVL 5BOJA 1J8HB 3RWEA 1E5UI 2HRGA 4KY1H 3C5ZB 1KACB 3W0WE 1JGDA 3HUJB 3GSNH 4PGJA 1LO5A 5MI0C 3L4XA 5DURD 3LJ3A 3PWLB 4GQ9H 3S3BB 1LO0L 3OR7B 1KFAL 5DFWH 3ZY7A 3Q9QA 4G1EB 1M6OB 1U36A 3B9VA 3IRZA 3UJJL 3GM8A 4UINH 2XOTA 2Q10A 2AP2A 3HE6A 3KPLA 1PF3A 3QG6A 4QHMA 5A16B 4CU7A 4B7IA 2YD8A 3W11C 1BM7A 3PWJA 3K2UL 3RX9A 4KI5D 1ZMYA 4ZMVA 4RVBA 1CR9L 3BHBA 4X4YA 4GKZA 4P3CL 3FUHA 5IB4B 1AD9B 4AYID 3IMSA 2WJ5A 1YEWA 3LNIA 5JMRA 5LGJB 3M45A 5KSVA 3T65A 2BSSA 3K72B 4IU3A 4JFFA 1FA4A 5L8JB 1E6JL 1FYTA 3LRKA 3NJNA 2HZHA 4IBVA 2VDMH 3IDXL 5HGHA 1ZLSL 2N4IA 3KPMA 1EO8L 2JELH 2PWFA 1JNHA 1J05A 2LE9A 2ZUTA 3NIDF 3WHE0 1FVEA 4I1RA 4O4YH 5EU6E 3RURA 4NKIH 4QTFA 1DUYB 4OSUH 1NSNH 1SBBA 4JY4B 1QBMH 4IRJB 2LLLA 2XKSA 2PO6D 4I77H 2DI9A 2X3BA 3D85B 3BZEA 5J6HB 3U1SL 1JSYA 4HCRH 3EBHA 2I9LB 3MUJA 3PDOB 1FVDA 1BM3H