2VSNA

Structure and topological arrangement of an o-glcnac transferase homolog: insight into molecular control of intracellular glycosylation
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
544
structure length
534
Chain Sequence
AWLMLADAELGDTTAGEMAVQRPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLAGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an O-Glcnac Transferase Homolog Provides Insight Into Intracellular Glycosylation.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
molecule keywords XCOGT
total genus 194
structure length 534
sequence length 544
chains with identical sequence B
ec nomenclature ec 2.4.-.-:
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vsnA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vsnA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vsnA02
3ZPJA 3Q3EA 4RENA 3MS4A 4RIHA 4YNDA 3NAZA 4I9CA 2XA1A 3BEEA 1PN3A 4M60A 1ELWA 4BTBA 1FC0A 2QZSA 3ZCPA 5DXFA 1L7XA 3OKAA 5LCWC 1YGPA 2BFWA 2PQNA 2QRGA 3CK8A 3C4VA 2YJNA 3MT9A 1KT1A 1WAO1 4JA7A 3FFLA 4RG9A 5M72A 1F6DA 3IAAA 3NPAA 3T3HA 3CVQA 3UQ3A 1B4DA 3VDMA 3EBPA 3S7BA 1IXYA 2VCEA 2XA9A 1FA9A 1PYGA 3ASHA 4KQ2A 1E4OA 3ZCVA 1ABBA 5G04C 4BWRA 1PSWA 3BD6A 1A8IA 2Q6VA 1QKJA 3ASFA 1P4JA 2IUYA 1C3JA 4WADA 4GYOA 4RIIA 3MA5A 3G2JA 2VG8A 2IV3A 3TG4A 3ZCRA 2QN1A 5HI7A 3OY2A 3RSCA 4W6QA 3L7DA 2QN9A 5DLDA 2XCCA 4F3VA 2V5FA 4U0SA 3L7BA 3MRXA 4F9FA 1FU4A 4EL5A 1A17A 4GA0A 3LKUA 4Y6CA 3HBNA 1HXIA 1PNVA 4APOA 1XL1A 3GW4A 5FZRA 4WNGA 3FP3A 3L01A 3S27A 4YVOA 3LY9A 5FT9A 5D0QD 3U3WA 2GPAA 5EKQD 3GZ1A 3WADA 2UY1A 2H1HA 2Y4TA 2OFFA 3IEGA 4GA1A 4KQ1A 3SYMA 3TGOA 1YA0A 4UQZA 2FBNA 4GZ6A 1ZBPA 1RZVA 3QKYA 2F3PA 4N5CA 1HH8A 3CEHA 2GEKA 4I9EA 2H1FA 3T5TA 4GYWA 1GPBA 1K08A 3UYLA 2JLBA 4AIFA 4JA9A 3E3OA 8GPBA 1RZUA 2FI7A 3CEJA 4N39A 2I6HA 1NOKA 4IN3B 3VTXA 4BQFA 3N71A 4RBNA 2O6LA 1YA6A 3ZHEB 4G26A 1IYGA 2XMPA 2VSYA 1JEJA 1WV0A 2X6RA 3C48A 4BFCA 2R60A 2QRMA 3HYMB 4F96A 3OT5A 4X7MA 1K06A 5TMBA 1AXRA 4UI9K 3ZCSA 5LQDA 5LCWJ 1NZFA 2PQRA 1Z6QA 4O6FA 3T3GA 4NEQA 4LEIA 4NQ0A 3AMVA 3LCAA 2VQ2A 3S2UA 4EKYA 1L5VA 1PC2A 1C8KA 4AN4A 1Z6PA 2XA2A 1P2BA 3EDTB 2PYIA 1ZU2A 3CK9A 2IW1A 4WHMA 3C4QA 2GPNA 5A6CA 4X7RA 2PRJA 2SKEA 2XCIA 3EBOA 4WNFA 5JTTA 2MHKA 4GYYA 3CUTA 3QKWA 3CKCA 2FEZA 2IYAA 4NRHB 3OY7A 4QLBA 2GT1A 1GZ5A 3VDNB 4WACA 2IFUA 2P6PA 4NC9A 5FTPA 2XPIA 3RO3A 2AW3A 2AZDA 2HY7A 3G2KA 3AS8A 1WM5A 5KJKA 2Q7FA 2FF5A 3CX4A 3T3IA 2C1ZA 3KD7A 4NESA 1FU7A 4HOTA 3D0QA 1QQEA 3BCRA 2XGMA 4EJ2A 1GPAA 3CKBA 3Q5MA 2R4TA 3UPVA 4G2TA 4CGWA 2ZB2A 1SXQA 5CCLA 2LSUA 4GCNA 1JIXA 4PQGA 4J8FA 4AM9A 3MRTA 3MT8A 3ASGA 3H4IA 9GPBA 3T7DA 3JYSA 1NA3A 4LEUA 2QN2A 4JHRA 4XIFA 1XL0A 3CK7A 3CVNA 4UQYA 1EM6A 4WUYA 4MI9A 4AMGA 2HO1A 5DU2A 1M5RA 3R9AB 4I2WA 5FZQA 3MV3B 3TG5A 1WW3A 3MS7A 4LDPA 2X0FA 4L22A 3KS2A 1L6IA 3FWVA 2ACVA 3E3NA 3HBMA 4BT8A 2AMVA 2X6QA 3ZCQA 2ONDA 3GUHA 1QM5A 2ACWA 4J8DA 1SXPA 4AY6A 5ARFA 1FU8A 1O6CA 1Y6FA 1P2DA 2R5SA 1IHGA 1NOJA 5BW8C 2VCHA 3LPZA 2ECPA 4RIFA 3RKVA 3T3DA 5D00A 3ESKA 3MQFA 1C8LA 3QWVA 1ELRA 1GGNA 4RIEA 3SF4A 2GPBA 3Q3IA 3OXFA 1L5QA 1B89A 3BDAA 3E4BA 1JIVA 5JJ7A 4GA2A 2GEJA 3K9IA 4I2ZA 2ATIA 4KBQA 2FFRA 4RELA 3GPBA 3CUVA 1NZDA 1AHPA 3QDNA 1FCHA 4AY5A 6GPBA 4UQXA 5ENZA 1JIUA 4MRAA 3ZCTA 2KATA 4RIGA 3BCSA 4J8EA 3CV3A 3VUEA 1UQUA 5I45A 3DZCA 5CCMA 1L5SA 1GG8A 4BTAA 4AMBA 4N9WA 2YQ8A 4WNEA 4YI3A 1JG7A 3L7AA 4UI9C 2R66A 5EX0A 4EKEA 1NA0A 3T3EA 5IKOA 2QN7A 1VGVA 3BEOA 1TJCA 3Q4AB 5D01A 3S7JA 3MKRA 1WUYA 3S0JA 2GM9A 3OXGA 3BCUA 4MI6A 5BNWA 1HZ4A 2KS6A 2IV7A 1RRVA 4A1SA 2P58C 4U0UA 3CUYA 3G2NA 3VUFA 5CHEE 2XGOA 4MHSA 3OXLA 4KXKB 4GPBA 2IEIA 4HWGA 3QHPA 1Y8ZA 3RT1A 4GCOA 2G9QA 1FTWA 3Q49B 2KCVA 3TOVA 5TVGA 2YHCA 4BT9A 1W3BA 5ARGA 3L79A 3QWWA 2L6JA 4G1TA 2BISA 4GPKA 1P4GA 3O3CA 2WQHA 4YI5A 3KAEA 3TAXA 4ABNA 1P2GA 1JG6A 3FROA 3LY8A 3ZHEA 2F3SA 3WXXA 4G24A 2PRIA 5C1DA 3UYKA 2NC9A 3ZFWA 3RHZA 5JTUA 2XGSA 4B94A 4YVQC 2QRHA 3S7FA 3PDNA 3PE3A 2VYIA 3ZCUA 1E96B 3QOUA 4ME2A 2BUGA 2FF4A 4N2QA 2JJMA 3D1JA 2G9VA 2C9ZA 3S29A 2VSNA 2WTXA 2IF4A 4I17A 4EL0A 3HBFA 3LYAA 4JL0A 3DDSA 2QN3A 3HBJA 2QLLA 4GZ3A 4HLNA 4H7XA 4FKZA 2J9QA 1LWOA 3NP9A 4CDRA 4HOSA 3U4TA 1FTQA 1LWNA 2FO7A 4CTOA 3D0RA 3MSCA 2G9UA 1KT0A 5KJNA 3G2HA 3QWPA 3CUWA 2X0EA 4HOUA 3E3LA 3Q3HA 1GFZA 3RO2A 4MICA 1L5RA 5G05J 5TMEA 5JJ6A 1XKXA 1F0KA 4BQEA 3COPA 2QNBA 2JZCA 2LSVA 3IA7A 3AS4A 7GPBA 3Q15A 1GPYA 3CUUA 5HXAA 3AS5A 3PE4A 2WPVA 3RU0A 3DD1A 3NP7A 2UY1B 1EXVA 4N3CA 4RG6A 4H7YA 3CEQA 3WAGA 1C50A 5DBKA 1WW2A 1P4HA 3OTIA 3NF1A 2FETA 2F3QA 3L7CA 3OTHA 2BGUA 2PL2A 4G23A 2ASVA 2IYFA 1XV5A 2VGXB 4U07A 2QN8A 3BD7A 3MV2B 5FZSA 2IEGA 1H5UA 2UWJG 4EQFA 1KLXA 2GJ4A 3LY7A 3OTGA 5IKPA 2QFCA 4G2VA 5JJTA 3MT7A 4HOQA 4KQMA 5G05C 3Q47B 4BQIA 4F97A 4N3AA 3MRVA 4W9RA 3S7DA 2SKCA 2QRQA 3RSZA 1E1YA 1HLFA 1P29A 2PZIA 2OOEA 4X7PA 1XNFA 2DBAA 4I1AA 4YUAA 2HR2A 3CVPA 4N3BA 1L5WA 4XI0A 5TMDA 3RJVA 3ULQA 2E2EA 2XCBA 3GZ2A 3MTDA 1Y8MA 5GPBA 3G2IA 5D0OD 2R4UA 2XEVA 2KC7A 3OKPA 4X6LA 1XOIA 1NLMA 4U0ZA 2C2LA 4U04A 4MHOA 2VGXA 2BGTA 3MTAA 3G2LA 3NCHA 1KTIA 4N2SA 3ASDA 4KYOB 2VGYA 4CTNA 3WC4A 3S28A 2GW1A 5FJYA 4FZRA 3RIBA 1UZUA 4XI9A 4G25A 2SKDA 1OUVA 3ZGQA 2F3UA 2PYDA 4M7PA 4CTMA 1IIRA 1XC7A 5HQ8A 2AVPA 3CVLA 1BX3A 2C0LA 2HYZA 3GYZA 5EX3A 4HORA 1V4VA 2F9FA 2Y4UA 5G04J 2QLMA 3O48A 1J39A 5AYWD 4MI3A 3ZN3A 2KCKA 5KJLA 3OKCA 4CGVA 4WNDA 1FS4A 1FTYA 2R68A 3MS2A 1Z62A 4Z5XA 4UI9J 2XCUA 3TSAA 3CV0A 2X0DA 2G9RA 3VTYA 2C1XA 2PQ6A 2QRPA 1QZ2A 2LNIA 3SYRA 3MBOA 1WUTA 4Y6WA 4REMA 3NC4A 1NOIA 3CEMA 3H4TA 1Z8DA 5A7DB 3URZA 1P5QA 2C4MA 1WV1A 3MTBA 3MEKA 3NB0A 1Y6GA 4J0UA 4M83A 1NZNA 2C0MA 4GZ5A 1UQTA 3UUXA 1NVKA 3DDWA 3BD8A 2QLNA 2KCLA 5BT1A 2AV6A 5KJMA 5DIZA 3SZ7A
chains in the Genus database with same CATH superfamily
5BV8A 1BD8A 4Y2HA 5F98A 1KQ3A 2WSSD 3R5HA 4I9CA 1TEHA 5I8PA 2OXCA 3UX4A 1M6VA 4HWTA 4DM4A 3L1UA 1QYRA 2C20A 2PSEA 3KEQA 4HLUC 1ELWA 3EXAA 4MGIR 1PEKE 5LJLA 1O6FA 3SKYA 5HK9A 5FUBA 2Q4TA 3LCMA 4HDNA 5B2EA 3C85A 1XDBA 4E09A 2C2GA 1C0LA 1LBEA 2PD3A 4J49A 1YGPA 1VHDA 3PT5A 1BCRB 2N46A 4JFAA 1BFKA 3GARA 4FK8A 4QELA 3TWRA 1Y7HA 2PGNA 3T1HB 3B85A 4GOKA 4S1TA 1KT1A 3IKMB 5AESA 3AJEA 3T06B 1O97C 2Q1TA 1KEEA 4R05A 4ETNA 1KEKA 1MQAA 4GBED 2MRIA 1IXYA 5TQ2A 5LQNA 4CMKA 1G4HA 4QVGA 1RKUA 2NM0A 3ZIAA 1G8MA 4CLOA 1W75A 3JR7A 4GLOA 2ZJ7A 1YB4A 3TTVA 2QM8A 2ZYHA 1KMIY 3IDOA 4RQTA 3RC7A 4NCBA 4UUMA 4OVKA 3W1EA 1IM2A 1PEAA 3AJ9A 2HIGA 5HA5A 2HW8A 3LL7A 1MORA 2W2MA 3WLLA 5M2QA 1WPXA 3NOVA 3I34X 1M5UA 4ALMA 5HI7A 3JQRA 3C3QA 1CB7A 1E3QA 3OICA 5CW1A 3RJTA 5IMSA 2VXCA 3HRAA 2PBFA 4EF6A 4HAUA 5DCWA 4K9RA 3H5WA 4L7QA 5ALTA 3OUUA 4RORA 2EKLA 4H9GA 5ALXA 4ANWA 4BX9A 5A1TA 3FOFC 5JR3A 2I87A 4ZJUA 3OCZA 1I80A 2K2WA 4LY3A 4M0MA 5FZRA 1CK4A 1FMCA 5FUWA 4D79A 1IAVA 1SU8A 4V0LA 3RT7A 4G8LA 2HXGA 3LY9A 4BCCA 3F6BX 4DQKA 3BOSA 3BF7A 4ZAYA 4BKMA 5I6DA 2AUTA 5C1OA 2UY1A 3JUEA 5FPHA 4ODIA 4HEQA 2ACKA 2ONKA 2AG1A 2VHXA 5KKCA 4MVJH 2ZOSA 4PYMA 3PQ5A 4KQXA 3ASVA 4A91A 1OFUA 2PFSA 4BXOA 1SXGA 1BG6A 2FFBA 4C06A 4F5EA 1YA4A 2V7GA 1GPBA 4U7FA 4DT1B 3GRKA 1QG0A 4KN8A 4KI7A 2JIPA 4RABA 4N39A 1QQTA 4PS0A 4HGZA 4Q3OA 1F4VA 3N2GA 4RBNA 3I6ZA 5EYPB 1XLTC 5T6BA 4OLHA 1EM8B 1JA1A 3QK0A 4DJAA 2BFEA 3BGSA 4C05A 4FHFA 3RAFC 4JC8A 2RG7A 5TMBA 4RHUA 5FJIA 5DFAA 3WIVA 4DUPA 4C2UA 5BYBA 1VC2A 4TVSA 2PQRA 1MV8A 4PO8A 4WL0A 5ITSA 4MA5A 2EC5A 2EKZA 2V9CA 2Y66A 2AHOA 3KKNA 3E58A 4ZQEA 3JUIA 3AYZB 1ZUD1 1NDQA 3SX2A 1QAQA 2R86A 1BMDA 1D7AA 1NMSA 5FYQA 1Z0SA 3WK5A 3WRXC 4BQSA 2UYCA 1JR2A 2ID7A 1KMHB 2KJQA 4DRXE 3FMIA 3LHIA 4OHVA 4ZZ2A 2VH2A 5KTYA 3LNTA 2G1PA 3VPDA 3EK2A 3BUSA 2XA2A 5KQRA 1HR0B 1S3FA 3IHWA 1E2HA 4P8RA 3HDHA 3WYGA 3I9V1 2EQ5A 2WJYA 2FW1A 1YJCA 5HGJA 1CZLA 2A4MA 4MITA 2VH1A 2IIPA 4IDNA 3RKSA 2C29D 3NTRA 4UWGA 1RCUA 3VR6D 4KFCA 5TJ9A 8ATCA 2HCBA 1ZX1A 1QLJA 2SKEA 3BWXA 2XKJE 1VPVA 3ONEA 1TM2A 4B7AA 1E79D 3K5IA 1T8RA 2HU8A 4YNBA 1IBCA 1UJ6A 1X9HA 1DC4A 1SAYA 2H2GA 2QSYA 3EYAA 4A63B 1GFWA 3DAFA 1QYMA 1GZ5A 3IVMA 3K0BA 3QVOA 4NMXB 4RLSA 3SFTA 3VDNB 2AFVA 4BU1A 1EFLA 4KGZA 3HVHA 4Z7QB 3ORRA 5K3FB 2QENA 1D2EA 2AG8A 4IHKA 3AEZA 3FYHA 2G08A 5BXOA 2G77B 4J7WA 1IJEA 2ZSFA 3CX4A 2IEDA 3HN2A 4YJ3F 3IO5A 1XVVA 4NYMR 4UHKA 1PR4A 2GK6A 3D7KA 2XQ0A 2I4MA 2Q3MA 3R7QA 5ALPA 3SY8A 4KPUA 2WG0A 4KV7A 4P3PA 3TXMA 4UBIA 3E9CA 4U7JA 1Z5SC 5LWHA 2ECOA 2IHJA 5FPKA 3LTNC 1NATA 1QLWA 3KR0A 2QB5A 1L4UA 2IO3C 1CY4A 3AHFA 2PUAA 1VCIA 1XKQA 1JS1X 3N74A 4GCNA 1MP0A 2E7ZA 3RFVA 4LYAA 3MRTA 1Q7CA 1S0UA 2ARKA 3QELB 1DWUA 1DPFA 4F6RB 5DGCA 4QYXA 1RDFA 1SFRA 4DSZA 1K1BA 4POOA 2UYHA 2X6TA 4ACAA 3O8OA 2DR3A 2YOFA 3E7PA 1NUUA 3U4QA 2Y0CA 1JNYA 3JZFA 1G5HA 1ZUWA 2YV3A 2W8BB 3B5JA 5HZMA 5IFKA 3UJNA 1EFHA 5ED0A 4PSVA 4C04A 3VGPA 4FZRA 4BN5A 2AYYA 2VP3A 3BWEA 3V1YA 3DO6A 2V55B 1Y63A 4HNGA 1F17A 3EGXA 1M5RA 5K8TA 3CO5A 3OHMA 4U39A 2Q5EA 2WINI 5EZQA 2Y4OA 5IAOA 4FWTA 3CINA 1K7CA 1ZCZA 1WZNA 3OFJA 4D8XA 1SCBA 1GTZA 2J5QA 3IEIA 3C1TA 2XADA 4INJA 5EXEA 2BGRA 2AMVA 5HJEA 3J80A 1HEUA 1V7CA 3DL4A 1WZ2A 1Q6YA 4L78A 3GRZA 3BXXA 4UDXX 4JI6B 3UFBA 2XCTB 1GTL1 1FU8A 1PT7A 4TMXA 5BO5A 3UGKA 3TTSA 3WY9A 3L02A 1NYTA 3CM0A 4HAYA 7REQA 2WXOA 1DKOA 2I71A 5G55A 4LGMA 1S4QA 1OI4A 5JS8A 2D1TA 1OD6A 2Q50A 1T4GA 5BYAA 4R98A 5CB0A 3TLKA 4IIGA 4C29A 2JBAA 2XH8A 4DMHA 1UBHS 3BMOB 5L3QB 2QVGA 1I10A 2DJIA 5CRUA 4WXMA 5EPUA 3UVEA 2FQXA 3KP1A 3UAVA 3I5YA 4IINA 5JSHA 1JIVA 1KI6B 2GH1A 3MN1A 5FP0A 3ZI0A 2VUSA 5CJ2A 3IQXA 1CNFA 3M1YA 5HKAA 1FCHA 1HTTA 2VHUA 1KZ1A 3EZ2A 1U2SA 2XUJA 5H0IA 3M5CA 1JG2A 3R3XA 1YZTA 1UBFA 2QT0A 4DR4B 4NRDA 3HPRA 4CIXA 5ENQD 3OPQA 1A5AB 1TM3E 1FRFS 4W7IA 5EGNA 1Z2NX 1PSDA 2ZEJA 3FLMA 3W06A 1R4AA 1RPJA 2CMFA 2QUHA 4MCIA 2YQ8A 1ZSVA 2FCAA 3F3YA 3O31A 5G0WA 5IHXA 2X2OA 5BWNA 1AN9A 3GT0A 4W1SA 1KGSA 3GCWA 3UJ8A 3AR4A 3C3BA 4OX9B 1QIDA 1TNOA 2PX3A 1OIVA 1VLZA 2VP9A 3EPPA 1MCZA 5ELMA 3DAGA 1G16A 5IUKC 3TXAA 1LQUA 1UQRA 5AMXA 4D8YA 4DLSA 2GQ0A 4J0JA 1JXQA 2FSSA 3R7WB 2ZI4A 4PQRA 2A92A 1BJTA 2L42A 4M7OA 3KOUA 4QDTA 3TYXA 3SC3A 4NYJQ 4XOIA 3IAM6 4YP7A 4FLHA 3VOBA 3E9MA 2IEIA 4HWGA 4L27A 1W49A 2IEZA 3T3PB 2NO9A 1ZXBA 3ZKWB 4EZKA 3RIXA 1PR5A 4WKCA 1DUIA 4O5OA 1PZMA 3JALB 5ALNA 1KZHA 1NM5A 1UBJS 1X80B 2XCQA 4KLNA 5EMJA 1FUYB 1II0A 4GGOA 3ADPA 1P61B 1NXOA 3Q49B 2DQYA 3WO1A 1S6YA 2ZE7A 4Q7LA 3UM3A 2YHCA 3U9WA 1AKWA 3DXYA 5JS2A 3WNDA 3U16A 2RGGA 3E9DA 2XCOA 3HN6A 5ALGA 1GPWB 1PYOA 5HTKA 2BLLA 3SD7A 4EJFA 1IXSB 2XLBA 1I3LA 2ZE5A 4V0OA 3QARA 3D1LA 1UP4A 4JOSA 4BS9A 2BGNA 2XJ9A 4ABNA 4D81A 1HC7A 3APCA 1YDHA 4YT4A 3CHQA 1HDIA 2JVKA 4PQEA 1D2RA 1T5OA 2ZXFA 5BNZA 3KQSA 1D9ZA 1G41A 2EINE 1F2TA 3IOCA 5KOYA 1W5FA 1Z5VA 1RZ3A 3E9QA 4KDFA 5LDGA 3SEAA 3TLBA 4YQEA 5KNCD 2UAGA 3MLAA 4QOIA 1A4XA 2GRMA 1N95A 3HJNA 4E2ZA 5JBQA 4ML3A 4MR9B 2VIIA 2VP2A 4X9XA 4F7WA 1V48A 4F93B 1PKXA 1V5GA 3A3KA 3FW1A 4YHBA 1F06A 4Z4QA 1YHYA 4QJ3A 5DX8A 4MDFA 1FXWF 3E32A 1M34E 1O96B 1I7LA 4KXUA 2NYUA 3N2LA 4MTCA 2JIOA 2CDAA 4UUCA 1U5BA 4HYEA 2JIBA 2OLEA 1DXHA 3T1VA 5LYJB 4D26A 1UKVY 1ZD4A 1MO5A 2O3TA 3WYDA 1TDJA 3I58A 1BWRA 5EIBC 2P2LA 2AXPA 2CHXA 2GYWA 1V8DA 4ARVA 5J23A 3JXEA 1SB9A 4UM7A 4OP2A 1Q91A 4Q96A 1YZVA 4E7OA 2HDWA 4OAOA 2C4VA 2PZAA 3HXOA 1SG0A 1IVNA 4LFBB 1CPYA 3PRHA 4JJ7A 3ITKA 3N2KA 1N1MA 2GDZA 2KM1A 4BKQA 5JT1A 5CBOA 1ZI6A 1KEWA 3WWZA 2ZROA 4BFVA 3WFZA 4JUDX 3LNCA 1ZJZA 2AMFA 2ASEA 4P35A 4XYBA 2HYDA 5AKLA 2B6HA 3JYNA 1VLHA 5JZBA 4UNSA 4MDEA 3QH4A 3IAEA 5E7IA 4FFMA 4J75A 4QTZA 4NBVA 2DKNA 2PY6A 2RC5A 5HJ2A 5AW5A 2PR2A 3A27A 4PAQA 3GU3A 1Z0IA 1U1GA 3QE4A 1N2EA 1XEXB 4RVGA 3KZXA 2WWIA 1W35A 3BJIC 4WCVA 3COPA 3NQPA 3KS9A 2NXNA 1CQZA 1XMSA 4MEJA 5LL6P 1B0ZA 3WHIA 1ODFA 1DJLA 4Q4AA 3BGWA 2G1KA 1IJBA 2NSYA 2O06A 2GYUA 4DN6A 2R48A 4JKYA 4URUR 4BEJA 3OX4A 2FQ1A 5EJ9A 1GADO 3DL2A 1WAMA 3MQ2A 1KDYA 3N1UA 4ATNA 2JHPA 4WCFA 1JAZA 1BCSA 1SO8A 3QJ5A 4TMZA 1V55E 1OFIA 3QA9A 4G23A 1XQ1A 4C0SA 3B3GA 2IBSA 3QNUA 1LDMA 2ENUA 3ZXUB 1N4DA 2AG6A 2QPAA 3KSUA 3PHGA 3QY9A 4PC6A 3TVDA 2WKWA 2ORIA 3P0RA 1KLXA 4QJ4A 1G0OA 4UBMA 5EWMB 1JKMA 4JLSA 4PH4B 2XVYA 1QDEA 1QYXA 2RH4A 5JD3A 1P6XA 4FB5A 2O2EA 2QFCA 2HO5A 4IJ5A 4ZQGA 3MT7A 1UG3A 2BCJQ 3PPWA 3HS3A 3E22A 3IPCA 3K9HA 1GNLA 2OY0A 4FFOA 4NMWA 1M3SA 4UDYX 1C9DB 1CQJB 1OWMA 4AQDA 5DJ5A 5ERGB 4YAKA 3WBFA 2GN0A 2GBLC 3E8SA 3HYSA 5A3SA 2EARA 1HT2E 3DT8A 3I2GA 4GPD1 3ZBPA 4FGSA 3DLCA 4JXJA 4WN9A 4C5BA 4EG0A 2ZJ3A 4JWKA 4GMRA 5SYAA 1Y3BE 3ROZA 3L49A 3ROTA 1DHTA 2WK1A 1KK1A 1MIHA 1SXJD 3F9CA 3I83A 1GSAA 2YIDA 3AB7A 4YUYA 2FJ0A 4NPHA 5GPBA 3ROFA 2DXIA 4G9GA 3P9SA 5FBWB 2QTAA 1KK3A 2GNPA 1XEWX 2GTPA 3RM3A 3TJZA 2JHCA 2C57A 3DAPA 3PFBA 4FS8A 4YGYA 2WTMA 3QKSA 3ZBQA 4ENWA 3FF4A 3KK0A 2FOXA 3WXBA 2FOIA 2VSOA 4D41A 3V7WA 2FPIB 2PRSA 2GHTA 4BUJA 5U1PA 2O8FA 1GCUA 4MVJD 4ZCQA 1JLHA 1P7ZA 2PMFA 1GSHA 2WRZA 5CTAA 4R31A 4YMGA 5ANLA 2WWRA 4CIVA 4PQYA 5KNCH 4YACA 4PG8A 2Y1KA 2GW1A 2XD9A 4RFSA 4BVKA 4ZOQI 3FYUC 1VCHA 1AK1A 2PZMA 1IHBA 4CQMA 4ZHQA 4ZJPA 3L4BC 2HHAA 4WNYA 1O1SA 2ZXUA 3D9NA 1DKRA 2VP6A 3S1AB 2WXQA 2GUWA 2AJCA 4CM3A 1N2OA 1OWLA 5TDHA 3TD6A 2ZSUA 2C0LA 3WK8A 5F7OA 1XJCA 1XD9A 2N42A 3AH8A 4EA7A 3CG0A 4JT9A 1OXTA 4O4JB 3OMWA 4NQRA 3TWQA 4DRZA 1VBFA 4PFSA 3TD9A 3DB1A 3DPSA 5DXAA 2DFTA 3ZN3A 2JIZA 3MCXA 1L4FA 3IMEA 3IUQA 1XGKA 4Z5XA 3KEGA 3MCAA 4HNAA 2BI4A 1FMLA 3AUTA 3CS3A 3I9JA 4RWZA 4FJ0A 2VTDA 3NTVA 2PRKA 2DT5A 4ZU6X 3CV0A 2WD7A 4GX0A 1JDNA 2ZJ1A 4FEYA 5J1TB 2X40A 3WNCA 4NJMB 3D3WB 1P74A 1NLYA 1A9QA 1BXGA 3CCCA 4HTAA 4AWXA 5LZ8A 3Q5EA 1T2NA 3IV6A 1BROA 1USKA 1TQ6A 1XFDA 1YZKA 4Q7JB 3NS7A 1P1HA 1G2PA 1VKJA 1WHSA 3AF3A 4S1NA 5AJYA 5LU8A 1L8LA 3SFZA 4D9FA 1U3CA 4KIJA 1AIPA 1KA9H 3EOAI 2VHJA 5HVNA 3NB0A 5ELLA 3DE7X 4ED9A 3MB8A 4QHSA 4C7OA 2VHVA 2GO7A 4LYDA 3G2VA 2AC4A 2WIKA 2HMYB 2EHDA 4N41A 2BFFB 4ZKDA 4X64B 2VGEA 2NYVA 5HR5A 3BFJA 2O8CA 2W93A 2QE6A 1K92A 2H2IA 4YN3A 3EDRA 4XD2A 1LRKA 5TXGA 1E7QA 2CNWD 5ISMA 3P2IA 3PRZA 3JD2A 4U1RA 2PYZA 1JFFA 2D5IA 4OH7A 2R3SA 3AP3A 1LF8A 2WBLC 1DT3A 2R8ZA 3DTNA 4LNUB 4JUBA 5EOVA 1QYCA 1FUEA 2NO6A 3CK8A 1TM7E 2NYRA 5JV5A 3FSEA 1ES9A 2XRZA 2P3QA 2V5UA 3EC1A 5IM4A 1CQPA 2BYTA 1WEHA 3FFLA 4HCJA 3NPAA 4IMRA 3UF0A 1P0IA 1A3CA 3AYXB 3MZLB 3S7BA 4R8KA 3KJHA 3RVRA 1T2FA 3V3TA 2OBBA 2AF3C 3L1VA 2ODAA 1HE2A 1E3WA 1G8YA 2JFYA 4Y2RA 1E5VA 1YCGA 2QRLA 2WF5A 4WFJA 3O3OB 4YDRA 2A4ZA 4ILIA 4NICA 2JAOA 1UBOS 1ODLA 2JI6A 1D09A 3HACA 3TE7A 1VOTA 4O4HB 2PUTA 4V0KA 3VJRA 3OOHA 4Y2SA 1N1EA 3A7DA 2L0TB 1EVEA 1SWWA 5T6MA 3RSCA 3TW8A 1PW7A 3HUDA 4MLCA 1IVYA 4US1R 1PK8A 4WNAA 2P6MA 3LA6A 4MUYA 4C48B 2FEOA 4OGWA 3F4BA 2EKDA 1JVNA 3QWIA 1V39A 4X41A 4Y6LA 4PG6A 1S2DA 5KCMA 1YUMA 1QAOA 1Z73A 2O20A 5ALIA 1PNVA 1XFAA 4EZEA 1TYEB 4M46A 2ZQZA 1GN8A 3GI1A 1T10A 1Z0FA 4PZPA 1QOPB 3T4EA 3TWSA 3G2PA 5CCBA 1H2TC 1OZHA 4IMIB 3GYBA 4YVOA 3AVTA 2DY0A 1PUIA 1HH4A 2NVOA 3IMKA 4KAJA 4YIHA 2UUBB 1QG6A 3ABLE 1RSZA 1ZICA 2WD8A 4IO0A 2X41A 3L6EA 5FRDA 4AK9A 2OFFA 5C2JB 1MPTA 1WXIA 4HAIA 4KBGA 5JCPA 5DKFA 5CCEA 1HTWA 4KVAA 1Q0QA 3FVWA 3IH5A 4LI0A 4MB0A 4UPDA 2UZ1B 4X1OA 5AUPB 3FBWA 1O8BA 3KWMA 3TW0A 4DDMA 3D7RA 1QVRA 4EA8A 3RGWS 3OZUA 1YAHA 4ND7A 4L4RA 4DWJA 4ZZIA 1Q0PA 3IULA 3E3OA 4C4YA 1FYFA 2Q0XA 3ITNA 1TZBA 3I9V6 3I01M 2DHEA 2H3HA 2AI1A 3HI6A 5JRJA 4L51A 4M9ZA 1FZQA 3UHOA 3EXEB 1PZEA 1SUIA 3X3HA 2WVIA 1HRKA 5FEUA 1YAJA 4JJZA 2V0CA 4PLVA 4IDAA 3JASA 2AFIA 4HDOB 2VSYA 1R5JA 4QRDA 5C3MA 5CFMA 3LFHA 3A11A 5BURA 1I2CA 3PJRA 2ZSIA 4Q15A 2B4TO 3SQXA 3R9XB 3ZCSA 2IEJA 2VF5X 1JIKA 1K6MA 5ECYA 4LNAA 4CTJA 2XUIA 1FP4B 4ZK6A 4ZYYA 5I7OA 1BW9A 4J3NA 1FJGB 3G1UA 4OHOA 1EUDA 4M99A 3I3SR 3M4XA 2C5SA 5IARA 2XXAB 1X13A 4XXHA 4EY4A 5C8DA 3L7NA 4D9CA 3PXDA 5DULA 5ADHA 1N5MA 4D6YA 1Z0JA 5CT5A 1CQIA 2FWRA 1NG9A 3UK1A 3TGPA 2Z2KA 2PYIA 3DJFA 5JARA 3H1EA 1GRCA 3NBZC 4FSDA 5DW0A 2QTMA 2FZVA 1Y80A 2PBRA 2XQJA 3BRCA 3JV7A 3SDZA 3U3JA 4PPQA 5KZMB 2C59A 3D6UA 3D8UA 3M9LA 4P4LA 2KHZA 2XCIA 2ZSEA 3JQ6A 4PN3A 3ILSA 1OJ7A 3ADOA 1BMTA 1U3DA 4CEJA 2FFHA 2Q1XA 2BRUC 2Q4OA 3BAFA 3C5HA 5KYVA 3ORFA 1G6KA 3FMVA 3IXMA 2JLRA 3U40A 6PFKA 2CXUA 3HO6A 3ELUA 1DCKA 3P7MA 3I05A 4QHTA 1O8CA 4N6GA 2F9MA 3MMNA 4AJEA 4RADA 4I08A 1YR8A 2DHRA 1JQJC 2TRSB 3GVIA 2R2LA 4FJ1A 5COAA 2ZRQA 1Q2ZA 3WNBA 2GEUA 4W5RA 2VT3A 2E55A 4Q02A 3LUFA 4QL3A 1IJFA 4FOLA 3UJ3X 4I3HA 4WJLA 2V9PA 2WHPA 2XNDA 4BWFB 2LIPA 4OQMA 4BAUA 1PWXA 2EJWA 4UBKA 3TNLA 1Z39A 3TXXA 1CQXA 1XRPA 3O1LA 2EVWX 4DCUA 2C7RA 2L6BA 1VE6A 3GELA 2EIME 3LSTA 3O2QB 4LAFA 5EFZA 1O9BA 3QEMA 5AIJA 1P6QA 5AM5A 1JIXA 1ZL0A 3FZYA 5T8KC 4AKEA 5AHKA 4HWRA 2O4CA 4BKPA 1G8GA 4B6PA 2AB0A 4TV9A 5HIAA 4U2GA 2HDHA 1T26A 2JFBA 1UJ4A 2QN2A 4BQOA 1ECPA 4N0QA 4NR0A 2WWWA 1MENA 1DWPA 1MW9X 2IYXA 5F33A 3UMGA 1TLTA 1V11A 5DHRA 1G5PA 3WMEA 3SF8A 4S24A 5AVKA 5G41A 3ZE6A 3ZIMA 2A8YA 2PIAA 5DNCA 2NTEA 1K97A 3UMYA 2LO6A 1YZHA 2AL7A 3M89A 5E6SB 4BFTA 4J1QA 1ISGA 4W99A 3TG5A 1IPHA 2R6DA 3GFRA 4M9UA 3LVQE 3DFMA 3ASOE 1ZIYA 2QMYA 3PZ4A 1WDLA 3GJ8A 2ZBVA 5BV7A 3WHLA 1II9A 4UHEA 3RVLA 4CNBA 2PH3A 3N70A 5ICGA 4PLZA 3M6AA 5JXIA 5JJBA 4B3RB 2X6QA 3DBRB 2QAGB 4MI1A 4HOYA 3KEAA 1BMFD 4HUJA 3X2FA 4IW3B 2BDEA 2H54A 1SD2A 1W19A 2O8BA 2XPZA 1PF7E 4BTVA 4B1FA 1N5IA 2AXZA 4KHPB 1H2UA 1QF9A 2RIPA 3NOQA 1LNZA 5FXMA 5COQA 3DOIA 1R9MA 3G68A 4RLFA 1L7DA 2G5PA 4KK3A 3NNSA 4WBSA 3VDRA 3WLFA 4F71A 1TEXA 2ZJFA 3C72A 4NYJR 1YRAA 1VKRA 4ZRNA 2XTZA 4N5NA 5CURA 4Z0HO 3WKCA 2PSSA 3V8MA 4ZCIA 4BEPA 3EC2A 3EWSA 1VE9A 3PREA 2DFNA 2AOVA 4MQ5A 3SF4A 1DIGA 4HYYA 5AD1A 2FW7A 4CDNA 1C7ZA 2HUPA 3UN1A 1Q7RA 3VPXA 4RUKA 3E4BA 3H7AA 1Z22A 5JS1A 2BV3A 4PPYA 5ENPD 1PQWA 2FFRA 2WWGA 3COZA 1UBUS 4Y3UA 1VL5A 1IZ8A 4RZQA 1R4NB 3U44B 1U6JA 4F11A 2V7UA 3CQCB 1JIUA 2Q99A 3IVGA 3KYJB 5HF6A 3ZZMA 3BCSA 3B9QA 1DFGA 5L6LB 2P67A 5A0TA 5CLLA 4MAMA 4XWKA 1DTSA 5JCOC 3DZCA 4BMDA 4UJ3A 3Q4GA 3RIMA 2CNNA 3RBVA 1KYYA 3D2CA 4CF5A 2O23A 2P9NG 3KT6A 4N18A 5JISA 1U0BB 2C5FA 2HIMA 2JK0A 1TUGA 4PHHA 4IIUA 1RAGA 1UPBA 3ZJYA 3MT0A 3R0XA 4QVKA 5DZSA 4F3CA 1JZQA 5D6NA 1R6TA 1DAFA 4BL5A 1DOHA 1A0OA 4BO2A 2EILE 3WGQA 1OH8A 4LTMA 1OJLA 4YCSA 1T3ZA 4UHBA 1FQOA 4O1MA 2OAEA 3QTLA 5A6SA 1L7RA 2E89A 2OCCE 4KJXA 3ZNNA 4BFLA 2WKPA 3NIWA 1EUQA 4J3JA 1XVTA 3KHKA 4BBPA 4YPVA 3JQBA 1U2ZA 1FNSA 3FRJA 1X7YA 4TQUS 2EKQA 1NYRA 2IYUA 4FFBB 1P5ZB 1WXDA 3L05A 3QHPA 4A3SA 2HHHB 5AOCA 1HZZC 3K0FB 3TLXA 2DU8A 1NRWA 1NAIA 1Q17A 4IX1A 1YRWA 4IX9A 5DMHA 1BGWA 1XA3A 2ZI5A 3HL4A 3AVWA 3HLYA 1N9AA 3Q5DA 4LYYA 4YT5A 3ZLVA 5LQCA 3R24A 1EQUA 1L5YA 4E31A 1GAQA 2IXDA 3QU7A 4JJ6A 3DLIA 4JS0A 5HM8A 2V0GA 4B8AA 4J0HA 1HE3A 1KJYA 2BF4A 5ER9A 4YAEA 5KQLA 3NWPA 3S5UA 3V48A 3NHAA 1KC3A 4HL6A 1E2GA 3B7BA 3V79K 2ZIRA 2H4FA 4GTVA 2OV2A 2F3SA 3WQBA 3Q9NC 3KAPA 1HM5A 2QP3A 1L8OA 2F8MA 5G1OA 1GLGA 1U3WA 3CLRD 4W82A 1H94A 3GUYA 4IV8A 3OTNA 3RVOA 3UYKA 5CXQA 2QBYA 2ZUEA 5I7RA 1IEXA 1EMDA 3N3BC 4LDQA 4BTLA 4E14A 4EHIA 1H5NA 5HKKD 2DF8A 2J0UB 4NMHA 1G60A 1MO6A 3GQBB 4QHYA 3O7MA 2HA0A 2FNAA 5CB4A 1MJ0A 2BR4A 4GWKA 1XLUA 2A1TR 3PDNA 2P0AA 2EOAA 3KQYA 1E2IA 1U7PA 3QOUA 1T9HA 4HXFB 4DQXA 1HPLA 4OJQA 2DPMA 4F3KA 3E8XA 2RGCA 4OK5A 3OJWA 3W8EA 4A23A 3CHSA 3NHUA 4KXQA 1EZ4A 1A72A 2O7RA 4YMVA 2GM3A 2JLZA 3E03A 4MWCA 4CIBA 4C0LA 1PV1A 3WNZA 1FSGA 2DFDA 3ONLA 5CK4A 2BFPA 5ER6A 5JADA 1X81A 3TRHA 3DCIA 3KKQA 3BTOA 3X2EA 4N5DA 1MR3F 2DVWA 4L5AA 2XAUA 5E7JA 4ZODA 2E2WA 3AHHA 4NEHB 3PQ7A 3NHRA 1RACA 1KE1A 2HLDD 2JGFA 2LP4Y 5AK5A 3VNVA 3F6QA 3Q75A 2QMOA 3L8EA 1FDOA 1TW2A 4L3VA 1FTGA 5GVRA 1U90A 1T24A 4RD3A 4WOPA 2H1WA 4XDGA 2FULA 3IQGX 3FUEA 2A5YB 2J3QA 4ND1A 3K6SB 4OY3A 2CV1A 3O38A 1P18A 2OOKA 3PUKA 4RTQA 1GNPA 4QXPA 4X63A 3UJAA 3BQOA 1E0JA 1EWVA 2I65A 3E7XA 3UENA 1WZUA 2RGWA 5AXDA 4BNMA 4JY7A 1GTVA 4RA6B 1QO9A 3W5SA 3PE4A 3CRVA 1JBEA 1OX4A 1VJRA 4V3BA 5ENVA 3NP7A 4GX1A 4WFKA 5AKXA 5GGXA 521PA 2IL1A 4TLAA 3WKDA 1QYIA 2GZHA 3NWOA 3OZ7A 4EKGA 1KOGA 2AZ4A 2G1AA 2KWIA 1KTVA 3PC3A 4YJDA 1DVRA 4Z9FA 2FETA 2JEZA 3LUKA 1Y9AA 1A1SA 4EG3A 1JCSA 2ASVA 4G1BA 1Y8AA 1XCBA 4O4IA 5ECDA 1PLLA 1JR3E 1Y5RA 1DBRA 2FSGA 3IEXA 3JU3A 3P2JA 4RJKA 4G0ZA 1HNZB 4ALLA 5EVJA 5BUSA 3DUFB 4QWWA 4MWTA 2HPVA 4U7PB 4Z9AA 2P2DA 3KXKA 1RLMA 3BRSA 3LY7A 1M5TA 2H0RA 2HHJA 5DTRA 5JFOA 4MIKA 1JXAA 5IKPA 3UOWA 1ONPA 1PI3A 2J9XB 4C4ZA 1XU9A 1EX9A 3NAMA 4QNNA 3D02A 4ZAXA 3WFIA 4ECAA 2FQWA 4ZN6A 3GF4A 3KOYA 3MCTA 2PAAA 3H0CA 1JKIA 3SR3A 1SW6A 1S2GA 1T4MA 3DFKA 2F00A 3EAGA 4EJ0A 1TUIA 3LDZA 1E4VA 3CVOA 4C0MA 4LMBA 4IIVA 5AYVA 4ZYUA 2HR2A 1NKSA 4W1PA 3EVAA 5HDQA 1OYYA 3QXHA 2N1MA 3OIDA 4XGRA 1K1EA 2Y68A 2D0DA 4DXHA 4R9NA 4Y0VA 2IZ1A 5BYKA 1Y8MA 2RHGB 4JBNA 2VHTA 3GFTA 3G2IA 3W8NA 1FYEA 4RD0A 1U6KA 1U04A 1DWOA 2HCRA 3CH7A 3P9YA 2GVNA 2PTHA 2IC5A 4I55F 1K4YA 2H63A 4KRYA 4ZOLF 3RRFA 4A8JC 4A36A 2FZWA 5FR2A 1EFCA 3L7LA 4MCAA 4CLRA 3NBAA 4U0ZA 1RI3A 4MMZB 5LMNB 4A8TA 4YPOA 2REBA 1OILA 1ZH6A 3DT6A 4DY6A 4N2SA 1UC4B 4FZ5A 3HKEA 4KEAA 4TKUA 1SKAA 4JI5B 2VGYA 1NXWA 4LWZA 4CTNA 1JR3A 3S28A 4LHWA 4WUTA 5JEDA 2LIVA 5E3JA 5FJYA 3ZIUA 3EEIA 3X1JA 1FCJA 2DWPA 1MABA 1L5GB 2JIDA 1R1DA 2DPLA 2PYDA 4TWAA 4UD2A 2JLXA 3IT3A 3OLZA 3P9QA 3C3CA 5EIWA 3F96A 4MKFA 4PO3X 2OA0A 3RI3A 3ZQKA 3AZQA 4DCMA 1N78A 4E70A 3JD4A 3U7GA 4TLMB 3NZEA 3PFGA 3I28A 3K53A 3N0XA 5FPSA 1UXKA 1VPDA 3M6UA 3OSZA 3QWBA 4FHDA 4URWR 5K45A 4B4OA 3EA5A 1QRDA 4NAUA 1SZ9A 3W8DA 4B75A 5IY5E 5BOSA 1E6KA 5K0CA 3RV4A 5CFOA 4JI8B 4YCDA 4AKHA 4FZJA 3MFQA 4ZZ1A 3DEZA 3H5AA 3W05A 1JI0A 1C30B 3NOOA 4EPTA 4YAIA 1QG4A 5G2NA 2A9KA 2BGKA 3WMWA 2CDRA 3AI7A 2BW0A 1PZHA 1QS0B 5ESDA 3Q9NA 3MBOA 3QEOA 3VYWA 3SG0A 2GI4A 1PJ8A 2YH2A 3T1NA 4TXJA 3H4TA 1WCWA 1Z8DA 4AIRA 1RLJA 4Z9XA 4K7JA 3MTBA 4Y0AA 4H7HA 3M34A 1NVKA 2C9YA 1LKZA 2QLNA 1AZSC 3AW9A 4LX8A 5HJ7A 5L4SA 4ON9A 4WZ6A 2N0SA 4W8HA 4JEUA 3DTTA 3QLVA 4ZEVA 5JH7B 1ILWA 1Z5NA 4KX5A 5KJMA 3OXLA 3BBPA 3QUCA 1CLEA 4I46A 4P83A 4R8VA 4BQPA 2GM5A 3QIAA 3PNPA 4N5MA 5YASA 5KTMA 1E2FA 2VQ6A 3JCZA 4C0AC 1PKEA 4D3XA 4TXPA 2WV9A 4XTRA 2BI8A 2XWQA 5ABPA 4TL6A 3ULYA 3N53A 4A16A 1VHQA 1G5FA 1QBKC 2A3RA 2I6UA 3BE8A 1XF1A 2ZRJA 4CF6A 5GJCA 1GD1O 4B9AA 4XYLA 1B8NA 2BEWA 3GMIA 1HZZA 3H17A 1GCGA 1TK9A 5AQ9A 4ZT2A 3GRAA 3K09C 2JFVA 1JH8A 1BI7B 2CC2A 4AG3A 1AK2A 1V9CA 4ITUA 2DWCA 4Z0NA 2BPOA 2DUNA 821PA 2DCPA 5K0TA 3LQ1A 3A6DA 1PT9A 4PZUA 1UMCB 3LSYA 5HILA 4JYZA 4GOND 2Z2IA 5AJHA 1QR6A 4FWBA 3OX2A 3VDMA 1JMYA 1O87A 1WNTA 3CF6R 4U63A 2HX1A 2KXPC 4MUBA 2P27A 3HM2A 5DHUA 3G2MA 3ZGYA 5BNTA 4D56A 2J3MA 4Q4HB 3ASHA 4XA8A 1OYVA 1YVDA 2BCGY 3AG5A 2WPDD 4GG1A 2HEGA 3IDFA 2GPTA 5FTLA 3QU2A 2Q0HA 1PY1A 3GEHA 1JZTA 2BC9A 1E3EA 2DLDA 2IUYA 3RC9A 3SM9A 2YNMD 3EFOB 5HS4A 3F8SA 4BFYA 1B23P 2QLBA 3KQPA 1A2OA 4FX5A 4Y2PA 4B82A 1CUSA 3V4OA 3QE9Y 4YFVA 1XP8A 3LBAA 3SLGA 1P9RA 4Z8YA 5DLDA 4PZZA 1GTG1 1DKUA 2AJTA 4G5SA 4PSDA 2DH5A 2PSFA 3CZRA 3N8NA 2KBFA 5GM2A 5T64A 4DDVA 4YJKA 3JAKA 2J5KA 2PFKA 1SQ5A 1KFCB 2I66A 1N2IA 1NM5C 2RI0A 3REGA 3ME5A 3QFRA 1LW7A 4FYKA 3PFIA 4WTOA 2F17A 3R7SA 5JALA 2NAPA 2DYRE 2BEKA 1IWOA 3HWWA 4J2OA 4O0MA 3QKTA 1RWNA 1TO2E 3CIAA 2ZSDA 2P9ZA 4MEBA 2Q7XA 5H02A 1XYVA 1VM6A 3MJDA 3ROMA 4EUSA 5IRCD 1P5HA 1SCJA 4AULA 3FUFA 3BILA 4U7EB 3LK6A 5DVZA 1WD5A 4AIIA 1TZMA 2CMHA 3PA6A 2PKCA 2Q45A 2ZK7A 5IW8A 3A06A 2NPFA 3TVTA 4E3WA 4X0EA 5K3EA 2AR7A 3IEGA 3ZKJA 3UT5A 4ZI7A 2JEKA 3TGOA 1GKUB 4MR8A 3U9SA 5B37A 1WMAA 4D43A 3JW8A 1XROA 1WABA 1UJJA 1SXHA 3GLRA 4ESEA 1HYEA 1OKKA 2AUNA 3CGWA 4NF2A 4P3OA 2V4ZA 1AO3A 4CV0A 3VKGA 5I9LA 3IQFA 3KV3O 4ID9A 1M7GA 2FX2A 3GRYA 1NOKA 4H31A 5LC1A 4J8PA 3F5FA 2P4SA 4TMVA 3RC2A 1TZ2A 3C48A 3IHYA 4WWPA 1M0TA 1JHYA 4KBFA 5GADl 1X8XA 2CUTA 1G8FA 3KFXA 4IMJB 4I66A 1KI1A 1DFHA 2YYSA 3K1AB 3IAHA 1ABFA 1G8AA 3P71T 3TSYA 1KZGB 2GMWA 2VZLA 1OH7A 5LCWJ 4GTSA 5ALDA 1H2EA 1W85A 2CZGA 1CZKA 1Z29A 3HV2A 4QE3A 2O0KA 4CN9A 3DLHA 2DIWA 1H9CA 1H1DA 3ST7A 1RC8A 5FI0B 2BSXA 3QVSA 3LUGA 3MWDA 4LV8B 1KRWA 4PLGA 3V2IA 1EFRA 1P1RA 3MUEA 2AN3A 3FDIA 3ABQB 4EZIA 3QI7A 4YDHB 1JG4A 1X7ZB 4QBTA 4ZVQA 3REFA 4XPIB 1P2BA 2QXTA 3ZY2A 1N1DA 1NIJA 1D6MA 2DSTA 1J8DA 3A36A 2VDPB 3FUDA 2ZBQA 5AI5A 4CT4B 1FW8A 1R5OA 3HY3A 2R8OA 1B8OA 2A1IA 2GPNA 1IY9A 2DKOA 4LY9A 1VI2A 4GE0A 5FLYA 1XZQA 3RFXA 5CFRA 1T4DA 3BZWA 5JY1A 1MZVA 1EUCA 4DNXA 2FY8A 3L0IB 1EQ2A 1QC5B 4PX5A 1GNTA 3HDYA 4HT3B 4NRHB 4ZEWA 4EYOA 1E7WA 3A14A 3ZYKA 3H87A 4YMSA 2W2KA 3RRUA 5CU7A 2IFUA 2WOJA 1YQDA 4A73A 2PLWA 1AP7A 1PVDA 4S35A 1UXIA 3LGAA 4YASA 5I9MA 4J16A 2IFTA 1XRLA 2WSYB 3NJ8A 4J0GA 3G2KA 2AN1A 4W5OA 3ASNE 4L2YA 1YE3A 5FD8A 1AGXA 1E7YA 2QYUA 1PFGA 1WM5A 2IPNA 3BJEA 3OFND 3MWLA 3MWEB 3PWKA 3CLUC 1WL8A 1U9ZA 3OCUA 4OHCA 3UH1A 1V35A 3GNSA 3KU1A 1UW4B 4PPFA 4QXAA 2BHSA 3ZPXA 2I7CA 2YHSA 3D0QA 3NV7A 2IIQA 3HWSA 1JDJA 2A33A 4Z3DA 2RKBA 3BYZA 4P7BA 1YZYA 3FPKA 5C51B 1L1RA 3GDHA 3SYNA 5JLJA 4YCAA 2NX2A 2LW7A 3E33A 1VJGA 5JYBA 4N48A 4R0VA 4UQOA 2NXJA 2Q07A 4R68A 3K70B 4Q9IA 2Z56A 2AW5A 2QD5A 4LRWA 4AS3A 3TWTA 1FDRA 1YR2A 5F2NA 1B0PA 1H3FA 1SU6A 1GDHA 4YIKA 5TNXA 4FYVA 3SHQA 1E1RD 1DUVG 1CUJA 4M37A 3QA3E 4IOMA 3RIGA 4YH1A 3QEBZ 1XTKA 2L2QA 4I3FA 3AESB 4CM6A 2HO1A 2F43B 1ZIOA 1CEXA 1F38A 3HXEA 1E1CB 2QAGC 3L8FA 5AIAA 1TVKA 4RKEA 3LPAA 2ZSKA 4TWRA 3X2SA 2XNHA 1ZN8A 5FB3A 1G20B 5AVRA 3Q1KA 1RQGA 3T3MB 1F8UA 3E0XA 3ND5A 4HDSA 1VZ3A 1KAOA 4HDAA 4B4WA 5KQGA 3MK31 2JJ1D 4IILA 3EIJA 2HCJB 2P62A 2ZVQX 4O2BB 2UYQA 2A1UA 3VJLA 2J0QA 3RHTA 5KX5B 1ADCA 1QQAA 4KFSA 4G0MA 1J0EA 4J0FA 4WOCA 2PUFA 2SBTA 4JB0A 4GAAA 1L5HA 4M8KA 4BVFA 1F3OA 4H1TA 2XAAA 3L8HA 2OZEA 2W43A 4H1VA 5I9SA 5AW6A 1MEEA 1Z83A 1SG9A 3GLIE 4AY2A 3G0CA 2JHAA 3ZK8A 1UAYA 1FVOA 1C8LA 1PR6A 3MQFA 3IXQA 5K3BA 3ZNPA 2PLRA 4YV1A 3PU6A 4Q9LA 1NI4A 2GD2A 3E27A 4B45A 2DETA 3E5MA 1M74A 1AV7A 4M8SA 3VR0A 1GAJA 3B53X 3H99A 1T43A 3E2IA 4P33A 5FIOA 2I6QA 3HKCB 1VKNA 3U3OA 5KYGA 3IQWA 3F73A 1YCFA 2FAXA 1SKQA 5KYYB 4X66B 1OTXA 2YHAA 3M2PA 2HR1A 2JFOA 3WDLA 1DKPA 3GLQA 4S0ZA 4U3JB 5IK2A 1YVEI 4B9EA 2CLHB 1SH7A 3L7JA 1IQ0A 3QX7A 4DLVA 3TBFA 2NQ2C 1DB3A 1FJXA 4LJSA 4REQA 3SSAA 4N82A 2CLEB 1RJFA 2CVFA 4W9NC 3KJQA 4K9NA 4MW5A 2GF2A 3Q9SA 1CTQA 3RJMA 2MYTA 4TTQA 5HCIA 3TLAA 1FPQA 1NP7A 3DMNA 4K8RB 4RACA 4R69A 4UTRA 5CCXA 1C9EA 1U8XX 4X93A 1WUHS 3K15A 2ZTLA 4Y7CA 1ZH2A 3VZRA 1J1IA 2EXXA 3HY4A 4CMHA 5K99A 1XX6A 5HK8A 4MVJG 2ES4A 3CE6A 4J29A 2WVGA 1RM5A 4HQNA 1IBRA 1ZJ5A 1AHIA 3AKYA 1T36A 3L93A 4DA0A 4NOLA 1CFZA 4LYFA 1AKTA 3HRKA 3IURA 5FBHA 3MYYA 2RI1A 1BDHA 3KR9A 4EZLA 5EJ7A 4OYRA 1OBVA 3CO0S 4C20A 1LS6A 3GH3A 4ZV7A 3WSWA 5FAKA 2BGWA 4BEWA 1OTYA 3IV0A 2IRWA 2OD2A 4WRRA 1QYVA 2W6ID 4YRKA 3FUUA 3GVPA 1ZZGA 5GOZA 3WWDA 4Y2GA 1M2OA 5JNRA 5EIOA 2D2XA 2GWRA 1JWBB 3AUYA 3UJHA 3F71A 4J7XA 2GKGA 3LHKA 3FFAA 2O7QA 2XZLA 3DOEA 4ZK2A 1P2GA 5E6UB 1Z08A 1XQYA 1JG6A 2E3JA 4IIYA 4MVJI 1FLNA 2XOKD 4EZJA 3G2OA 4DBLE 3HCOA 1YTUA 1FSPA 3WRWA 3CEAA 2R4QA 1I3OA 1Z13A 3H9GA 3NDRA 3PYMA 2IDJA 2EYQA 1IHDA 3A6JA 3FTDA 4XM1A 2NUTA 4N4AA 1JQAA 3R0QA 5JVDB 5LA6F 3STUA 4F7DA 1YRHA 2PQ0A 2H7XA 2XY4A 3L6CA 1YDFA 2M98A 2OWEA 3KB6A 1THGA 4N1AA 2MSLA 5JDIC 5C9ZA 4RVSA 5JTUA 1QGYA 3W1VA 1P7WA 1QOQB 2GCEA 3A4LA 3DFUA 3AHEA 3P9IA 5GIPE 2RD2A 2KBEA 4ESVA 2GGFA 4B84A 3K35A 4QPCA 3SFVA 2VJMA 4N0EA 2TSYB 2RK3A 5KVAA 3UINC 1J23A 3B2NA 1LI5A 3S2EA 1V4BA 3FOAA 3M3DA 5DF1A 2G9ZA 3LCUA 5ARBA 1G8HA 2POCA 2WD9A 3FNFA 4FHCA 1TLLA 3M4YA 4GRDA 2EG9A 1PNRA 1M2VB 4JJFA 4DIFA 2ANBA 1P7YA 4Z6KA 3HBFA 3LYAA 2QIOA 1ZXLA 1XQ9A 3GLHE 1GQ2A 3P2YA 3ZGVA 4CLDA 3AIIA 3MNFA 3RYCA 4UTXA 3HEMA 1X8KA 4MQFA 3NP9A 1KKLA 1VPTA 4GPEA 1DEAA 3MJFA 4WWHA 1PFWA 2QV7A 4ANFA 1UBCA 2XSZA 5EJAA 4GTTA 1U2GC 3EG5A 1N2HA 2CEAA 2HF2A 2Q0QA 1ZJ6A 2FLKA 1HRDA 4H77A 2J7PD 2OBXA 4LUCA 3CUWA 2AI3A 1OB2A 1T2UA 4WLVA 3TQQA 3SQWA 1Y7PA 3PNYA 1TUEA 2YXEA 3OE7D 4MX8A 3WAJA 4UU7A 1H6KA 1XTJA 3S2AA 4P4NA 1N2BA 1N32B 4PW0A 5AWFC 3CGGA 2RG8A 4F06A 3INGA 2IY0C 1AKVA 1QZZA 3C45A 3KSMA 4ZI5A 3OJLA 10MHA 2CB9A 3KJEA 5EVCA 4RLHA 4C6TB 4PLCA 1FYXA 1TEVA 3O74A 1DC5A 3CXUA 4Y9DA 3RU0A 4UE3S 1IPEA 4JJ4A 2O3SA 1XKLA 2G4LA 4XX1A 3FULA 3NASA 2KM4A 4DV1B 1DTWB 4U7HA 2B69A 3RRNA 1ZDMA 1XZ8A 1JLLA 4MLDA 4KE8A 3GIDA 3GJYA 1P81A 3D8SA 5I7HA 3ZEAA 4O4LB 2M6LA 3D9IA 1SU7A 2PZBA 2QTNA 4YJGA 2MHCA 5JSKA 3T7SA 4B34A 4D4HA 1GRRA 3UHFA 2W58A 1KO5A 2VKQA 2W48A 4KQKA 3KJNA 2G04A 1D0SA 3GZNB 2HRDA 4YXWD 3MBKA 3W2GA 4C01A 2P7HA 2J3HA 3FYUB 4G0VA 4URYR 2IH4A 3L5KA 4V1CA 1QHYA 1P0CA 2QVCA 3ZHSA 5JI2E 4RQAA 4FFSA 1H66A 1PQUA 2HD4A 5E3IA 5EL0A 1CG6A 1Y33E 3DVAB 2O2JA 1TJFA 4QUJA 2QF7A 1S3IA 3BERA 4Q9NA 2NUPA 4O4HF 1MA3A 1IZ7A 1U2VG 3VKHA 4CL0A 3ICCA 2DKFA 3IOYA 2VP5A 3VHXB 4DY4A 3I2YX 1DPGA 4IOLA 5IAAA 3I4CA 1MZCA 4RVNA 1CERA 2P5YA 1FY2A 2PWYA 1TM5E 2H4YA 3H18A 4YCJA 5IPFA 3WBKA 5JSFA 3GEEA 1IQPA 2M32A 4FT4A 2WJJA 3GGPA 3JWGA 3TFWA 1TC2A 4LYEA 3T9CA 3GK3A 1GITA 1GSIA 3R1IA 3AY7A 4IRUA 2B3TA 3WV5A 3UB3A 3JSXA 3RJ5A 1RJDA 1TZCA 2I67A 1NP6A 2IVFA 2Q9UA 3HI4A 2MTBA 3AFNA 4OQNA 4YMIA 3KKZA 2J9RA 3N0TA 4MDHA 3WWEA 1B14A 2J5RA 1L8XA 1LB1B 3R7NA 2GX6A 1I24A 1S2OA 1THZA 2FDRA 1NLMA 2X0NA 5CIWA 2NXCA 3VYRB 5TEWA 4RJJA 3L84A 4DWVA 1NURA 1JTEA 4KYOB 1WUJS 4D3FA 2NZUG 3BREA 3MVEA 1PNTA 1SC9A 1YGYA 2G6TA 3MA0A 3CKMA 1UZUA 4C7KA 4R7ZA 3NDIA 4OQEA 3ZV7A 1M72A 1EWQA 2B9VA 3IIEA 4XGIA 1ACMA 4EHFA 4XGQA 1JJ7A 4XVRA 3MOIA 4G0OA 3AAAC 3A4VA 2PX4A 3RGGA 4OYHA 4KYIB 4V0QA 1GEGA 1E2BA 2C0PA 2PBZA 3O48A 4CKBA 2PZKA 3AGQA 4U9HS 1VI6A 4LBYA 5FUXA 2HI0A 1TJNA 2VJLA 2G06A 4QA9A 5HRAA 3DXZA 2EEPA 3FUNA 3HUEA 2R68A 4QBIA 5A71A 2B5OA 3CG4A 1JXMA 4A0HA 1I2MA 1OT5A 4MKRA 4PCUA 4JV5B 2OBFA 2WG1A 3RR2A 1RHKA 3OM8A 3QOWA 3UOAB 1EP9A 3CNEA 3SAJA 1SPBS 2P75A 4RDCA 1I4LD 1K8KG 3OZFA 2LNIA 2I91A 3B6KA 1PNQA 4WBNF 3OEYA 1XJ5A 2QTWB 3KT0A 1OLXA 1ZGJA 1L4GA 3GLUA 2R65A 2JGJA 4REMA 4V2IA 2JLYA 2YS7A 3HUTA 3CEMA 1XEWY 5D8DA 4JHKA 2NSDA 4NYIR 4LDRA 4HUQB 2VJOA 2Q5QA 3KPUA 1EP1B 1I2ZA 2OZLB 1YWGO 2ZIWB 4XQ9A 3VTZA 4WZBB 2XB9A 1FX1A 1E9VA 4U7GA 3N2YA 4MWOA 3H75A 3VR4H 3VSCA 2FOLA 5B36A 4G1FA 2UVDA 2I54A 4WFIA 3FZQA 3GGOA 1AMOA 1FDSA 3LT5A 4ZTBA 2HU5A 4GF5A 4IFIA 4ESOA 1YJQA 3ZHUA 4FMDF 4AF7A 1E5TA 3A0UA 2V45A 4YWHA 4ZPJA 1ENZA 3OFVA 2BTQA 2WVJA 4OHRA 2WXHA 1WBBA 3F1KA 1MX1A 1NJ6A 1UAGA 2CJWB 4OOEA 3RJZA 4UAJA 1MB4A 4R3UC 4PC1A 1J2JA 1JHAA 3WA6A 3PI7A 3EHNA 3JTEA 4I2NA 4JVSB 2V0PA 1L7XA 3ND7A 2JJ8A 4D02A 2X0KA 4DREA 1T5TA 3JXJA 2M6RA 3C8DA 4ZYLA 1SCIA 1YL5A 3KDAA 3K0CC 1EUYA 4GPMA 3AEYA 2FUCA 4ENVA 4URXR 3JD3A 1LA2A 4PS3A 5DIFA 1T25A 4R4JA 3I12A 3HFGA 1RYBA 4LQDA 1X42A 1B3BA 4XM0A 1X1QA 2VEDA 2HGSA 1MGPA 1YACA 4TKZA 3ZI4A 4FDUA 1Y98A 5DWVA 5B1SA 1XELA 3SHFA 5IC6A 2C9CA 4QOGA 1MB9A 2CL5A 4ZAGA 2WJ3A 1BVYF 1UN8A 3C7DB 3G2QA 2PZGA 2WU4A 4LC9A 4IGKA 3VNAA 2ANCA 4NENB 3UBTA 4XDYA 3DSWA 3KEFA 4B4UA 1C3JA 2F9LA 3HP7A 1L0BA 3PHJA 4IZ6A 1CIPA 4U9IS 1NUPA 3ZCRA 4PLPA 4HRVA 3IJ5A 3PR3A 2D2FA 3OETA 3WIUA 4EA9A 2I4IA 4YCBA 5JAMA 1MV5A 3LC2O 4IF4A 5EWJB 4BBAA 3L7BA 3K30A 4YPFA 3L54A 4RTPA 3C98A 1NL3A 1TQ4A 2BE7A 1PEYA 1CJUC 1P75A 3GP5A 4CDGA 2QGZA 1JFTA 5AW7A 3RK6A 4R2MA 4GVPA 1ONBA 1UOHA 3BWBA 4OAVB 3FOBA 1ZMXA 3OBBA 4TV3A 2V6MA 1PAQA 2D0OB 3BSSA 4KVOA 1YQQA 2FX3A 4WIAA 1R0XA 4P81A 4II7A 1ISRA 2G70A 3SLRA 5KIAA 2GRUA 3G82C 2XRYA 4PSUA 1DCFA 3SDSA 4BRUA 4YEDA 2ENWA 2QL5A 3NETA 2UXDB 1CUFA 3EMBA 3FDZB 2HM8A 4DWOA 3PUXA 2ZT7A 4KQ1A 3STTA 1C2TA 3EG9B 2EF1A 3G2UA 4G11A 1T1GA 4QU0A 3B7PA 1TGVA 3LLSA 3K9GA 5HCNA 2CXHA 4G8DA 4A8HA 3JWIA 1K1AA 2ZP1A 3MPOA 1D8DA 3ZWXA 1N6LA 1OW3B 2XUFA 3F7TA 3MINB 2OENG 1YU9A 3WYNA 1DAOA 2XT0A 4LMAA 4O60A 3O91A 4ZOLA 1GTJ1 3BGDA 3GLKA 3T54A 2WFAA 1I2BA 4XUDA 4IIDA 3MTEA 4XUGB 4YUVA 3IT0A 5I9TA 3COYA 3RS7A 1N4QA 1ADJA 4EB0A 1ZM3A 2XMPA 1WV0A 1XRSB 2WTNA 4K9PA 5L3SB 2CXSA 5CNMA 4WOJA 1K7YA 5CEFA 4P9NA 3VZSA 4R1PA 2H6EA 3AU8A 4G8BA 1WY5A 3W2HA 1DIAA 4C14A 4WGGA 4NNPA 3TNYA 3V2OA 1EZ1A 4MWSA 4O6FA 5HX7A 2F3TA 3RPEA 4OL9A 2ISSD 1M34A 5KWSA 1W59A 2XDQA 5FBRB 1ZGAA 2F8SA 1L5VA 2ONJA 1E96A 3L8MA 3R8FA 4P6VF 5C1PA 3CVJA 4EECA 1Z6PA 2Z4SA 2Q5CA 2W42A 2DQKA 3TOZA 1ORWA 4DMFA 2AWOA 5BRNA 4WI1A 1YV9A 1TKRA 4MRMB 4IOJA 1ZU2A 2KBXA 1X5BA 1TK3A 3PT9A 4IICA 2AMJA 3L92A 2FN4A 2RK4A 3G8DA 5CYOA 1VXOA 4ZCMA 1NVTA 2CLSA 2ZXWE 4LZWA 4Q5IA 3THYA 2WKQA 1HYGA 5REQA 3QKWA 4QPZA 3BKXA 4HYQA 2IIVA 5SZJA 1E1QA 1VP9A 3I76A 1AQLA 3ZNQA 1VFNA 2W71A 1FYVA 2E4AA 3H3JA 1T0PA 1GGFA 1YQTA 4BLQA 4IDEA 3DSUA 1VA4A 3HFJA 3EH2A 2B4KA 3Q5GA 3QWFA 3VU9B 4ABTA 2F55A 4DB2A 2WFLA 2EJBA 5DM4A 2GXQA 3SLKA 5CDTA 3N39C 5DBHX 4I50B 1P9LA 5IDXA 2RD0A 2NZVG 2P78A 1GWNA 3IQZA 2C1ZA 2FPGA 5F73A 5TEVA 2RHDA 3IELA 2ETAA 4YRMA 3QF4A 4ZZ0A 3UPTA 1OI3A 1TMKA 4MHTA 2Y1XA 5IH3A 1QGED 3DQQA 5JANA 2NZYA 1MZPA 2DULA 2EDCA 3F78A 3T7KA 2EYUA 2ZAOA 3VVMA 4QO8A 3R0JA 4G2TA 2ODQA 5LQMA 2CWWA 1QMGA 3ZXPA 2O9JA 3WLIA 2O6HA 2I80A 2MR5A 3ASGA 3L7OA 3HR7A 4PYOA 1NJFA 3K9NA 3IUBA 3AHDA 4LEUA 1QNFA 1I4EB 1II8A 4ZOCA 3W90A 2A58A 4Y1GA 2P4HX 3GJ7A 4GL2A 4KN5A 1QCDA 2DWUA 1IM8A 4HFNA 2RHHA 1IBLB 1AD2A 1FLAA 4AMGA 5ELXA 1G5TA 1B8VA 4AJKA 2JDID 3W9SA 4G86A 2OVFA 2F1HA 4ZCRA 2WTUA 5DNEA 2Q3HA 1LLFA 1DJNA 3M33A 4NP6A 4C6HA 2JEOA 2W2VA 1ZITA 4TYQA 2RG1A 1SEVA 3IBYA 3EAFA 1NLUA 2Q5HA 2BGJA 2D5CA 4GSYA 3MXOA 2HU2A 4BYMA 4CM8B 4CKEA 4YAWA 4ZT7A 3C6YA 2ONDA 3PB3A 4RY2A 3DLBA 2XE8A 3B13B 2E1RA 4GMXA 1V3UA 4Z7JA 3KQMA 4TYWA 1IY2A 1KI9A 3LKVA 3RUIA 4HGNA 3COSA 4LYJA 2CBXA 2QX6A 4TV8F 1NOJA 2YUIA 4I3GA 1G98A 1YB1A 3ABME 2ERYA 1ZW6A 5G4KA 3ZTTA 2N47A 2ZATA 3ZZ1A 3GOQA 4PR0A 1EZZA 5FNZA 1RE0A 3UFXB 5AHRA 5T4EA 4FQ5A 3S44A 1YMVA 2PA0A 3IKVA 3EJ6A 4B43A 5FBQB 3RD5A 3LWBA 5THXA 2RGNC 4RIEA 5JYEA 4P92A 3NBKA 2XTAA 4R5MA 2D5BA 4Y6GB 5EE9A 4QAJA 1W36C 3OXFA 1XZEA 2QW1A 4ZGWA 4CETA 2PCJA 1JLKA 3KOWA 1A9XB 1KYTA 3VH1A 1LX7A 3EQ7A 2YIJA 1BAPA 2NPIA 2KB0A 3K9IA 3DO5A 3BCHA 4WZAA 1HT0A 1XD8A 2JKZA 5I48A 3L8YA 2YJZA 3LZCA 4QOHA 1ZK1A 1A8SA 3UAGA 4E21A 3VPCA 1TEZA 3TQCA 1DO0A 3LIPA 6GPBA 5ITZB 1SOUA 2OYRA 3TWOA 2J6BA 3VR5A 3HXMA 1J8QA 4WOKA 3R6LA 1QGUA 2CJYA 3O3MB 3P2EA 2AFHB 2VYVA 3AP2A 2OV3A 2XMCA 3OZVA 4YDOA 4KIUA 3UTMA 1OBFO 3UH0A 3W9BA 1S7GA 4N9WA 3P2MA 1NFIE 3VI4B 1ZHOA 2FSPA 2HL6A 3BIOA 2WSBA 5EKDA 1P3Y1 1KJIA 3AX6A 2IYLD 3QVLA 5M34A 2CGEA 1KE2A 3I5MA 1CUCA 2PZLA 3LDHA 3OPYA 2BFDA 1LPMA 4BY9E 2W6QA 4TPKA 1DC3A 1LBTA 1GL9B 4MMYB 1GLNA 3FI0A 4IL5A 3WB0A 5JRZA 5LMCA 4X5OA 2QSZA 5I9IA 5CHEE 2M1ZA 4WCDA 2DUJA 5CA1B 5JYDA 3IJPA 2FEKA 4NU0A 4R3NA 3RS5A 1IJKA 1H1LB 4RIFA 4BKOA 4J2HA 1RXSA 3T52A 1N0WA 2D1YA 3P2OA 3X1MA 4BQQA 2PVSA 3EIUA 1I94B 2IU3A 2XUGA 2ZBDA 4B6GA 5FWXB 1N5LA 2G0NA 4XE5A 5EG5A 4CIDA 1D2NA 5EE3A 1NULA 1KKUA 3LUJA 3MYRA 5EHQA 3QWWA 4HVLA 3FTXA 1F0NA 3F2IA 4FM9A 4JP5A 1H6CA 1PZNA 5A1JA 1T8UA 2O05A 3FU3A 2P0EA 2R8PA 4GOMD 4RSGA 5JCJA 4FOOA 4BESA 4I1OB 1TB4A 1C3OB 1NSYA 2P9YA 2YUTA 1WB4A 3PF8A 2RB4A 1WDTA 4I9NA 4KLZA 3UT0A 2H6GA 1DBWA 4IIHA 5F77A 4XASA 3T0GA 3TOCA 2E5WA 2GAAA 3FSRA 4JB2A 3WBJA 5EIEA 3AG3E 1VZ2A 1XXLA 3SXJA 4CMEC 2AXNA 1SVIA 4XYEA 5I7WA 3N2ZB 4HSEA 4NCAA 2WUGA 4Q4JB 1GU7A 3FDJA 1QCYA 3IC5A 3SC2B 3TRFA 1ORTA 2RB5A 3CZ9A 3KLMX 3BIFA 1SEPA 2HNBA 2WSMA 3BA1A 3FNIA 5IEJA 2HK7A 2PGDA 2PD4A 3V8VA 3KETA 3AUAA 2ZRFA 2JBHA 1ELKA 5JZSA 2JJMA 3VDQA 5BUQA 4AJPA 1BZYA 3LX5A 4RNCA 1TU0A 4G0PA 5HUHA 6REQB 2QW8A 2DH6A 4HFJA 3OPNA 1OC4A 3OEED 5TV2A 3SJZA 3R0ZA 3TOXA 2NU8B 5KYUA 1H3EA 2EZTA 3UJ7A 2ZYIA 2XCSB 2GF9A 4ALKA 3TI7A 4KUHA 2YN2A 3CZ4A 1KK2A 1R8XA 4ARBA 2J48A 2CDNA 4QGFA 2G67A 2I4LA 3DPDA 5FADA 5JG7A 2RAPA 3LVRE 4WUVA 3MSCA 4HVCA 1KT0A 5JRDS 1FVXA 4YRCA 4BV3A 1B7GO 1USWA 3ZQJA 2WXLA 3D5QA 2D4AA 4FA6A 4MIOA 3PFKA 4GX2A 4GT1A 4QFMA 3ORQA 3WLNA 1BVHA 1NXTA 3LWZA 1SA0B 1NE7A 3KQTA 5B1IA 5CB8A 5KSYA 1LI7A 1I0ZA 4KJZA 4HLDA 1TGYA 3U4IA 4NZPA 5HS6A 5PNTA 1NW8A 4JLVA 4OBXA 2PEZA 3O26A 1EFVB 2YMQA 4Z9YA 3ENVA 4EKNB 2ZR8A 4E4YA 3D9LA 2LSVA 2ZTVA 3CTMA 1ZSYA 2HE0A 1D1PA 3L6DA 1KBQA 1D2MA 1FEZA 1CRZA 2G40A 4LSZA 4MMXB 5CVEA 5PGMA 3UT6A 2G7MC 4TLLB 5JFGA 2JC3A 3IT2A 3LDFA 1C1XA 1KR2A 1Q7TA 1RJ9A 1HFAA 2ZJOA 1X7HA 3O73A 4EATA 2X4GA 5AI9A 1UOOA 2CNWA 3E5HA 3H5TA 3DAOA 5KCZA 1X2EA 4MCJA 3DC7A 3MGKA 2GFHA 5E7QA 4FDVA 3PD7A 2EIKE 3P45A 4UNRA 4RULA 3DSVA 1WE2A 1WXGA 4TT8A 4J91A 3UATA 3ML8A 3MV2B 1Y82A 1X0XA 4P84A 4EG8A 3WLEA 5A3QA 4M98A 2GRPB 1MRSA 2LR0A 5K6AC 4RS4A 4ZU3A 1ZD9A 3T15A 4KZ0A 3OZIA 5KJCA 4Q1VA 2IA5A 2FMXA 5BRAA 4TUYA 3P97A 2H16A 3B78A 1KIMA 3PWZA 2DZDA 1EFRD 5BWMA 4G5GA 3KXDA 3Q47B 1Y1PA 2WQZA 4OG2A 4BOYA 4BQIA 1ODTC 3EU9A 1ADYA 3PQ4A 5EERA 1VJDA 1YS4A 4CG2A 4EPXA 2IODA 1HLFA 1MC8A 3FCOA 3ZDAA 4IGIA 3CPJB 2X8WA 1JEYA 2LCFA 2ERCA 1CX9B 4KNVA 1EHCA 1DBPA 3E61A 3OM1A 3EVCA 3FZNA 5ICSA 1VXRA 3HVEB 1RAIA 2IP1A 2GDJA 2D7DA 3DPIA 3JVDA 2ZYDA 3VR3A 1XYYA 4IQFA 2D7JA 1PD1A 2H18A 3F47A 2COKA 4R84A 1LDEA 2B25A 2UVQA 3EXFB 2X8BA 2B7CA 3FCAA 3L6RA 4R2LA 4YAJA 2AD1A 3TF5A 4ZCTA 1ZL2A 3O1HB 9LDTA 1KR5A 2RFAA 5LBUA 1MKYA 4EZBA 2VA8A 1R6BX 4KXMA 4RV5A 3STVA 4MBGA 3TLJA 5J4HA 1LVUA 1BVRA 2J7KA 2I2CA 2HSDA 2CNBA 2R97A 3D8HA 3G8CA 3OFNA 1Y1RA 4BJHB 2YINA 1C9KA 4XWWA 3K7EA 3HJGA 4L4ZA 1KHTA 4CHTA 2HMWA 1X8JA 2VF7A 3S81A 2BI7A 5AVZA 4HXGA 2I6SA 4L08A 4YREA 1IEQA 3FPFA 4MV3A 5EZYA 3OU7A 1ULSA 3A8TA 3DVRX 4XFJA 5JHHB 3GHHA 3E70C 3L8GA 2B2NA 1XC7A 2HLDA 1IRIA 4JEIA 4MQUA 4OEHA 3MGBA 4AF6A 3MCZA 2VYCA 4NFHA 4HORA 4Q6WA 1VYTA 2JHGA 5CK5A 4Y9RA 3M8KA 3I0MA 4ZAFA 2PV0A 4K2HA 3QBDA 3OKCA 1Q74A 2X9LA 4M54A 5KU1A 2F8XK 2IX3A 4UI9J 1ZVQA 3H1AA 4J43A 2P5UA 3V4PB 5JS6A 9ABPA 4MEAA 3UWDA 3EQ9A 2EWWA 2PCLA 1UANA 4LYGA 4JBIA 3ESLA 3H2IA 4Z68A 3VTYA 3UQZA 1W94A 3L4BA 3OLQA 5D3ZA 2B4QA 2VDWA 4ACBA 4OSOA 1P7CA 2W22A 3SYRA 4URFA 1GAXA 3PK0A 1U8YA 1MIOB 3FBGA 1I01A 3HABA 4E85A 1JALA 2Z2YA 3V1KA 2IYVA 3EBLA 1Q1NA 3KU4A 4JASB 1TO1E 2PKEA 4HY3A 5FOVA 1E8XA 1OAKA 3ITDA 5I7VA 1VLLA 3PKZA 4J0UA 1J22A 2FK8A 1MAVA 1JDTA 2CFRA 2WKRA 3BS4A 1EU1A 2FZEA 1HE4A 3P27A 3PCRB 2KCLA 3R23A 1Z4LA 3I6IA 4FLMA 4MV6A 3V97A 3VNRA 5KQMA 3CGHA 3K32A 1LJLA 3EHEA 1N8SA 1LQTA 4QEKA 2HDOA 5FOWA 5LD2C 2OE2A 1RXIA 4YP0A 4Z8XA 2WUDA 4UVGA 4YAGA 5IZCA 3NNDA 2C8JA 2FPKA 3GGJA 2Q6LA 3C6QA 3HHEA 1MG5A 1SRQA 4QUBA 2HUNA 2JARA 2I2AA 2HBZA 2B4YA 1GUFA 2GLUA 2VDOB 2WTAA 1FT2A 3C3RA 2DBRA 2QTBA 4L0DA 4RCVA 5BQPA 3WZ2A 5AKZA 2R6ZA 2HM7A 3ZWNA 3F67A 4AJIA 3HCWA 3ZU6A 2LXLA 3USCS 4QEZA 2PQ2A 1R74A 4EHKA 1QH0A 4TQ9A 1L9XA 1XZJA 2J46A 2MSKA 3VAYA 5KMGA 1TF2A 2IYEA 3D64A 5FTJA 1TXGA 4AZVA 3R7FA 3WLSA 1Z17A 3R0IA 2QT1A 1N11A 1B1AA 1O58A 4I4TA 3UNXA 5EESA 3FCUB 3WDKA 1AU9A 3H8WA 4ZHQF 2Y05A 2WAAA 1UP7A 1W1IA 4HDKA 2Q5IA 3T94A 3ZCVA 4EAQA 1OLSB 1REQA 4X00A 4GH5A 2WNIA 5AXAA 4A8JB 4B3FX 2VK4A 2GHRA 3L0PA 4CKYA 3QXCA 3FXAA 2REQA 4FW9A 5ERXA 4ACKA 3MA5A 4DX1A 2RE8A 1QGOA 2GXUA 1PUJA 4IDPA 4L9PA 2IU1A 1NFRA 4KWEA 3AV3A 3EF3A 4Z0PA 3D31A 2YHUA 4B48A 2B94A 4XX0B 3SFYA 2OO5A 3GRPA 4G97A 3SJBA 3WQRA 1N2CE 1KETA 1YKSA 4CE6A 2WHYA 4BFUA 3SBSA 1C0KA 2QPLA 3M6MD 3KR2A 3H1TA 1WVGA 3KVNA 3T9EA 3CSDA 1PWYE 2FO1E 2O1WA 4LJ4A 2WMOB 5IH7A 2ZBEA 3AM1A 3MWFA 3ONKA 1S4MA 1EB8A 3RC3A 3DKPA 1AF4A 1E3DA 3C6KA 1TCBA 4IXNA 4MTLA 1HOXA 5HQJA 1SUSA 5EJIA 4IH1A 3UJBA 1GA1A 4GMKA 1OR8A 3PVZA 4YMHA 2XMGA 1H19A 3UMFA 2HWYA 4M1YA 2FRDA 5BPPA 1EFPA 1B43A 1SJ9A 1X3LA 1GL6A 1UBNA 3ER6A 4M1QA 5EE0A 2H11A 3VNSA 3GLIB 2CK3D 4DSNA 4N0DA 2C96A 2D3TA 2P90A 1YBVA 3UAWA 1GEEA 1U7HA 2A57A 1W8IA 3A1TA 4PSAA 3STYA 2IOLA 3ZWMA 2LAHA 3TR0A 3I4LA 3O6VA 1ZBPA 2BEUB 1GPJA 3BRWD 4N5CA 3CEHA 3U3DA 1GKLA 1RAFA 2GEKA 3KAJA 3KQHA 4URZR 3A3OA 3HL0A 1D6JA 1RVDA 2B2CA 3O7WA 4ZV4A 5KX5F 4JXZA 3UYLA 4JJAA 4JA9A 3X1DA 5DRYA 1BHO1 2JJYA 4A0QA 1KVSA 2D0PB 4JLJA 4RKFA 1T29A 5BNFA 2CHUA 3UWMA 1VI5A 2V6BA 1KI8A 3NVKI 2H85A 3PD1A 1RFLA 5B55A 3ZHEB 1P3DA 1BE6A 1ZONA 2YWRA 4FTWA 4HMPA 3AFHA 5DLPA 1MYOA 5ANRA 3OWOA 3I4GA 1V41E 3FHJA 1LJ8A 3GJ5A 4UBLA 4ZAVA 3CZMA 4DDWA 2RI6A 3TIFA 1RCTE 5AAOA 1GKKA 2PKRA 4PZCA 5EJGA 3P4YA 4ESHA 1JHXA 3B3JA 4ZZ3A 2WZCA 1KWKA 1FBTA 1Q7EA 4LEIA 4NX2A 3PRYA 1GGVA 3AKZA 1TI7A 3Q7AA 4XH9B 5CTJA 3OCJA 4G4SO 1QTRA 1R4MB 3HMKA 1PC2A 3QOYA 1T4CA 4NCIA 5AUNB 3BA6A 3EW7A 3AWIA 3QX8A 2VHEA 4Q66C 4DZTA 3HR8A 2I99A 3RARA 3DKRA 3BHJA 5AVQA 4EHJA 4A15A 4I55A 4TSFA 4KHZA 5HNKA 5F9HA 4LSMA 5CM2Z 5HQ3B 1FF9A 6LDHA 4TQAA 3SD5A 1VYHA 16PKA 1QP4A 2D5LA 1HA3A 2I2BA 3CUTA 4P34A 4NNJA 5TQJA 4D0SA 4DV0B 3AFGA 2EP8A 2WPDA 1OXSC 3GDWA 1DAIA 1VCMA 4NATA 2DTDA 5F21A 4R51A 3U4AA 1T0JB 3G7UA 3DXFA 3ENEA 5J2UF 4P3NA 4FYPA 3PX7A 1HY3A 4DVJA 4Z4IA 3M6WA 1U0LA 3TOSA 3R7DA 1IZZA 1Q3HA 4DRYA 5JSQA 1Y3IA 4XEUA 4UMFA 4GSLA 2REOA 1X0VA 2EDAA 3FYCA 1PRYA 4NIMA 1UDCA 1WY7A 2B8EA 5F12A 5BQOA 4NKRA 3AM4A 5DP2A 2CMGA 5DTQA 2VPZA 3OFSA 4AJNA 5LOZA 1V7PC 2C3PA 4NESA 2V3VA 5ADWA 4AZ0B 3O8BA 2XGMA 1ZK2A 4RC9A 2X4IA 5B4UA 1QIJA 4J03A 1COWD 5GP1A 1W4RA 5CA0A 4JBHA 1T6BY 1RYEA 2UZ0A 2JH3A 1GGHA 3MWKA 1E61A 3IR7A 3PVSA 4RZ3A 5C8XA 3EN0A 2BE9A 1KF0A 3ANLA 1HX7A 1NV9A 3QBVA 1R8YA 4PRZA 4R16A 1UFQA 4JSRA 1YR1A 3OE5A 1TQHA 3C1AA 2R1VB 2SHKA 3HDVA 1GUAA 2MSDB 1U3VA 1IU9A 1SD1A 4UCFA 4UHCA 5AHXA 3VSEA 4I2WA 1NVEA 1SMKA 4GZCA 3H6GA 3AEKA 1A27A 1W6RA 1X9GA 1U0RA 1YZLA 2FN9A 2FSUA 1OWNA 3PL5A 4XUCA 2J85A 2NUAA 2XWPA 3I1YA 4X8LA 2VA9A 3RSFA 1DAPA 1MOPA 4JVMA 3A6EA 4U5XA 2ZUWA 4RDIA 4DCJA 2P2YA 3FWVA 2ACVA 2BP7A 1E1LA 1GZSA 4UUQA 2FVYA 3ISJA 3V1MA 2OCPA 1RI1A 1QRSA 2Z4TA 1NUTA 1T2CA 2IT1A 2VDLB <