2VSNA

Structure and topological arrangement of an o-glcnac transferase homolog: insight into molecular control of intracellular glycosylation
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
544
structure length
534
Chain Sequence
AWLMLADAELGDTTAGEMAVQRPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLAGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an O-Glcnac Transferase Homolog Provides Insight Into Intracellular Glycosylation.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
molecule keywords XCOGT
total genus 194
structure length 534
sequence length 544
chains with identical sequence B
ec nomenclature ec 2.4.-.-:
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vsnA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vsnA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vsnA02
2ATIA 2JJMA 2PQ6A 3IAAA 4RELA 1XL0A 4Y6CA 3OKAA 2C1ZA 4GCNA 2ACWA 4WHMA 2FEZA 2KATA 3DDWA 3TAXA 3IA7A 4J8DA 2R4UA 1L5RA 2BISA 3LY9A 4NC9A 3LY8A 5TVGA 2FF5A 4LEUA 3VDMA 4G2TA 4YI3A 1VGVA 4EQFA 3VDNB 4WADA 2SKCA 2LSUA 2X0FA 5EX3A 1QZ2A 4I9EA 4O6FA 3VTXA 2P58C 3Q3EA 3MTAA 3HBMA 3CVPA 4GZ3A 1K06A 1E1YA 5ENZA 3MT8A 2Q6VA 1TJCA 3C48A 1W3BA 3QOUA 1AHPA 3NAZA 3QWPA 4W9RA 3IEGA 1JEJA 5DIZA 5JJ7A 1C8LA 3CK8A 3COPA 3G2IA 1IIRA 4ABNA 3S2UA 2GPAA 3G2HA 3MTDA 3UQ3A 2PYDA 2AZDA 1GG8A 2KCVA 2PQRA 2ASVA 3CUUA 5D00A 2C2LA 3S7FA 5I45A 1AXRA 1F6DA 3WC4A 1L6IA 3SYMA 4WNDA 2FFRA 2C0LA 2XGOA 5EX0A 1L5QA 1A8IA 3GZ1A 2ACVA 3UYKA 2QRGA 3DDSA 3MSCA 3ASDA 3WXXA 2IF4A 2PQNA 3DD1A 5BNWA 4NESA 1FCHA 2VSNA 5EKQD 3CKCA 1FTYA 4EL0A 1FTQA 3MKRA 3RT1A 2ZB2A 3S27A 3BD8A 2H1HA 5D0OD 4YUAA 1WW2A 4BTAA 2V5FA 2FETA 3BCRA 1YA6A 3NF1A 3LPZA 2AMVA 4MI3A 4CTOA 4GZ6A 3RKVA 1WW3A 4KQ2A 1P2BA 5TMDA 1ABBA 3RHZA 3HYMB 5CCLA 3JYSA 3ULQA 3T3HA 4I2ZA 2R60A 2IV3A 3O3CA 4GA1A 3LY7A 4N9WA 3CEQA 4EKEA 2R68A 3AS5A 4WNGA 4N3AA 3CVQA 1Z6QA 3GW4A 1NOIA 1L5SA 3OTHA 3MT7A 3DZCA 4YNDA 3FROA 4AMBA 2XGMA 1XL1A 1NZNA 2GPNA 2PYIA 1Y8MA 4RIGA 3KS2A 2XMPA 3OY2A 5A7DB 5IKOA 1NOKA 2L6JA 5BT1A 2ONDA 3G2LA 2NC9A 4AMGA 3QWVA 4HOUA 2QZSA 3OXLA 2C0MA 4KQ1A 1P2GA 2F9FA 4BQIA 3SYRA 4I2WA 1Z8DA 2XEVA 4U0SA 1ELWA 3SZ7A 1GFZA 3C4QA 3H4TA 3Q5MA 3BD6A 1NOJA 2XGSA 5LCWC 5A6CA 2XA1A 4LDPA 2X0DA 4EKYA 1XOIA 4J0UA 4HOQA 2BFWA 1B4DA 1F0KA 4BQEA 3OXFA 2XCIA 1XV5A 3E4BA 4AY5A 2BUGA 4GCOA 3NB0A 3OTGA 2R66A 3CEJA 3GUHA 4RBNA 3S7JA 5JTUA 1YA0A 2GEKA 1Y8ZA 5ARGA 3S7BA 2QRPA 2QN9A 4MI9A 1JG7A 5BW8C 1FU7A 1B89A 2XA2A 3CKBA 3CV3A 1LWNA 7GPBA 3ZCPA 3ZCTA 3ZCVA 3PE4A 1UQUA 2SKEA 2UWJG 4BT9A 3VTYA 2O6LA 4JA9A 2GEJA 1GZ5A 3OTIA 3CK7A 5DLDA 1P2DA 2XPIA 3CX4A 3E3OA 5LQDA 3L7BA 4G26A 5CCMA 3AS8A 4UI9K 4U0UA 2IEIA 3MEKA 4N39A 1P4HA 1A17A 1M5RA 4MRAA 4BT8A 3ZGQA 1GPBA 5FZQA 4YVQC 2UY1B 2GT1A 2YQ8A 4BWRA 4M60A 4L22A 3ZHEA 5FJYA 5HXAA 4GPBA 1WAO1 4H7XA 5KJMA 3BDAA 4XI9A 3Q3HA 4MHSA 3L01A 3T3EA 1C3JA 5JTTA 2HO1A 1FTWA 3QDNA 2VCHA 4NEQA 4WNEA 2PRJA 3RSZA 4GYOA 2PL2A 3S28A 2KC7A 3MV2B 2IEGA 4CTMA 3ASGA 3BEOA 4F9FA 1KTIA 4B94A 2MHKA 3MQFA 3L7AA 2HR2A 3CEMA 5HQ8A 3NC4A 3K9IA 4CTNA 2QLMA 4MHOA 3U3WA 3AS4A 5GPBA 4JHRA 1KLXA 3QKYA 1WUYA 3CK9A 2IW1A 1NA3A 3C4VA 2X0EA 3CVLA 4GA0A 3TG4A 3QHPA 3OY7A 3D0RA 4MI6A 5D0QD 3MRVA 3LKUA 2AW3A 1PNVA 1FU8A 1SXQA 1IXYA 3MBOA 1UZUA 2F3PA 4GPKA 4F3VA 4REMA 5KJLA 2C4MA 4QLBA 4I9CA 2PZIA 5FT9A 5FZSA 1EM6A 3Q47B 5FTPA 4RIEA 2SKDA 2IFUA 3KAEA 4UQYA 2OOEA 3ESKA 3HBJA 3FWVA 3ZHEB 3N71A 1ELRA 3OKCA 3LYAA 3SF4A 2DBAA 2YJNA 5DXFA 1GPAA 3RO2A 3MS4A 2QN8A 3E3NA 2LSVA 1O6CA 3BCUA 1RRVA 4IN3B 2GPBA 1SXPA 3TG5A 2JLBA 3L7DA 1E96B 3QKWA 1KT0A 3Q49B 3EBOA 5JJ6A 4W6QA 2QFCA 1NZFA 4PQGA 3PDNA 2FF4A 2QLLA 4A1SA 5G05C 1HH8A 4CDRA 3FFLA 1ZU2A 5TMBA 3MRTA 4YI5A 2KS6A 2H1FA 3EDTB 1Z62A 4HOSA 2IV7A 4J8EA 3G2JA 3NPAA 2XCCA 4APOA 4G23A 2VCEA 5G04J 1RZUA 2QNBA 2OFFA 2VYIA 2HYZA 4AIFA 4RIHA 3QWWA 3ASHA 2J9QA 2GM9A 4N3CA 4I17A 3CUWA 2QN3A 4FZRA 2LNIA 4RG9A 3H4IA 4WNFA 3BEEA 5FZRA 2GW1A 5KJKA 1FA9A 5D01A 4X7MA 3OKPA 3U4TA 3ZCUA 2F3UA 3RU0A 4NRHB 2QRQA 2VQ2A 1EXVA 5DU2A 5KJNA 3KD7A 1P4JA 2F3SA 4CGVA 2C9ZA 3EBPA 1JIVA 1PYGA 4GA2A 4N2SA 5AYWD 1P29A 3T7DA 4JL0A 1JIUA 4G25A 3GYZA 4G2VA 4G24A 1UQTA 3HBNA 5DBKA 1JG6A 3GZ2A 1Z6PA 4U0ZA 4HORA 3CEHA 2FBNA 4AY6A 4GYWA 3CVNA 3BCSA 6GPBA 4KXKB 1NVKA 4FKZA 2WQHA 2VG8A 1QM5A 3VUFA 2HY7A 9GPBA 1C50A 2QN2A 4F97A 1GGNA 3CUVA 2ECPA 5TMEA 2P6PA 1WM5A 2QLNA 3RIBA 4KYOB 3NCHA 5G05J 3S7DA 3L7CA 3WAGA 5IKPA 3OT5A 2IUYA 1K08A 5CHEE 4WUYA 4J8FA 1H5UA 2R5SA 2PRIA 4RG6A 4UI9C 1QKJA 1J39A 4H7YA 1WV1A 3MA5A 4HWGA 3ZFWA 3FP3A 3D1JA 4N2QA 3MS7A 4BQFA 4U04A 2Y4UA 1NZDA 2R4TA 2VGXB 3BD7A 4X6LA 3HBFA 1Y6GA 1E4OA 1P5QA 1FC0A 4RIIA 2BGUA 2XA9A 4AN4A 5ARFA 1L5VA 3MS2A 3Q4AB 3TGOA 2KCLA 4N3BA 4LEIA 1WV0A 4CGWA 2XCUA 8GPBA 4KQMA 3RO3A 1KT1A 4Y6WA 3T3DA 3LCAA 3MRXA 3NP7A 3MTBA 4RIFA 3PE3A 3CUYA 2VGYA 2G9UA 1IHGA 3URZA 3UYLA 3ZCQA 4F96A 2BGTA 4G1TA 5HI7A 2X6RA 2X6QA 4UI9J 3UPVA 2AV6A 3T3IA 3S29A 2QN1A 4GYYA 3WADA 3Q15A 4N5CA 4I1AA 4ME2A 1WUTA 1YGPA 3Q3IA 4MICA 2G9QA 4RENA 4U07A 3ZCSA 1QQEA 2WPVA 3TOVA 1P4GA 2AVPA 2GJ4A 3G2NA 2VGXA 3D0QA 5LCWJ 2Q7FA 1FS4A 2UY1A 3VUEA 4EJ2A 2I6HA 4XI0A 4X7RA 1XKXA 1C8KA 1NA0A 1FU4A 2G9VA 2IYFA 3GPBA 4M83A 4WACA 1PC2A 2Y4TA 2YHCA 2QRMA 3CV0A 4HLNA 2C1XA 1V4VA 1HXIA 4JA7A 1JIXA 3CUTA 2KCKA 1NLMA 1IYGA 4EL5A 3ASFA 2FI7A 1L7XA 3MT9A 4KBQA 5C1DA 2FO7A 1RZVA 2QN7A 3RSCA 3E3LA 2E2EA 3OXGA 4GZ5A 3NP9A 4UQXA 4X7PA 3RJVA 3O48A 2WTXA 4M7PA 4HOTA 5M72A 1LWOA 4YVOA 3G2KA 3AMVA 3ZCRA 1BX3A 1XC7A 2IYAA 2QRHA 4AM9A 2XCBA 5JJTA 4Z5XA 4XIFA 3TSAA 1ZBPA 4UQZA 1Y6FA 4BTBA 2F3QA 3UUXA 1HLFA 2G9RA 4NQ0A 1PSWA 3ZN3A 3S0JA 1XNFA 2VSYA 3R9AB 3T5TA 1OUVA 1GPYA 1L5WA 3ZPJA 2JZCA 3L79A 4BFCA 1HZ4A 3MV3B 1PN3A 3T3GA 5G04C
chains in the Genus database with same CATH superfamily
4L4YA 2XODA 2AS0A 1MEEA 2VSOE 4F3KA 5JXGA 4MRUA 1C9MA 3KLNA 2WWFA 5FTNA 1WZCA 8LDHA 5EJ7A 1JFFA 2L17A 5LZ8A 2OV6A 4B74A 2KATA 4UXIA 1BMDA 1FFEA 8ABPA 2QWXA 2XIQA 3AHCA 4JHJA 5E4YA 1MGPA 2GEDA 2OOSA 3HYRA 3U4IA 4ZAVA 4Z2AA 3OOYA 1CKEA 1Q7EA 1AK1A 3FTVA 3QY9A 1B14A 3B9BA 5JAZA 3AU4A 4BGVA 3BMCA 5ALKA 1TCBA 5TXGA 1F51E 1TMKA 1BWRA 4IILA 3FTYA 4DMKA 3DT9A 2FDCA 4M38A 3VO1A 2WC1A 3NOVA 4EOGA 3BT7A 5FV4A 1OCRE 1H2HA 1SQGA 3NYWA 1M33A 3CURA 3MB8A 4QDOA 3G8CA 4XQ0A 3WLKX 2BHNA 2CV1A 2VYQA 2IXTA 4KE8A 2WD7A 1KFEB 1EGQA 2C20A 4JB3A 5DGCA 4LPSA 4TMZA 2SCUA 2J0VA 4JC8A 2R96A 3DKRA 3Q3GE 4HLQB 3QPCA 4IEEA 4N5MA 4ZCQA 4ZDWA 2ZRNA 5IHPA 1OXMA 2G72A 3COPA 4AMYA 1NVAA 4ZICA 3EDQA 1PTKA 1N9AA 1RT9A 4BEJA 5CG1A 721PA 5F23A 2Q6LA 3CXRA 1CUXA 1MORA 2DUWA 4UVIA 4L50A 3FGPA 4L2IA 5ELLA 1O9GA 1JYFA 2A5GA 3GFTA 1SHUX 2GX6A 3TD6A 3VVBA 2A92A 3QKRA 1QVVA 1UP7A 4AS1A 2DYKA 3KEOA 4GTVA 2KCVA 3ADPA 3PCTA 5C3UA 4ZK6A 5TQJA 3LW7A 4R51A 2H5JA 3HXLA 4FE7A 1C4OA 1O95C 1RQPA 4NPAA 3FWHA 2YV5A 4GMXA 3VA7A 2FX3A 1SBIA 2BR5A 5HDBB 3D3QA 5C37A 3U9LA 1HX7A 5HQJA 1QFXA 4QQFA 4BJ5A 1OFGA 2AD5A 1J6UA 1T9KA 2VDJA 4DW8A 5EN5D 1E79D 1S7CA 3ANSA 1T6XA 3DJFA 1VIAA 3G5UA 3N39C 1OX4B 3NTOA 2F0YA 3DZBA 2X77A 4PZYA 2WWXA 4DARA 1EFTA 1HOXA 1RJFA 5TX7A 2BCEA 1FCHA 3UIOC 3PUYA 5DNAA 5EKQD 3KKLA 4XX0A 3CX3A 3H19A 4HD8A 3QW4B 3TQOA 3IIJA 3OFJA 4RK4A 3PEVB 2WHQA 1JDBB 4EYQA 4NQRA 4OU5A 4A36A 3TRJA 1QVRA 3A9RA 2OO3A 5E95A 2QPLA 4RCYA 3CUEF 5H80A 2J45A 4B7UA 3FTQA 1RRCA 5IH7A 2ISCA 1OWNA 5ESXA 2XUAA 1BDIA 3L0YA 4BUJA 2CHFA 3I0NA 1W5AA 4WOCA 1MW8X 4RJLA 1E8YA 2I4RA 3FHCB 4KQ2A 2VF4X 3SQNA 3LO8A 4YFVA 3E33A 4Q7KA 3ICVA 1ILEA 3F4LA 3VDRA 5CCLA 2J87A 3HR7A 1BDBA 3BGIA 3OE7D 1CJCA 1M2JA 2AI2A 3ANYB 2CXPA 2CXTA 4NL4H 4CFZA 5B3JC 1FSZA 3DC2A 4Q1EA 4G63A 3F78A 3G7NA 1KYWA 1Q0PA 2OHIA 3KX2A 1PZXA 3QVJA 3ZXUB 1EJ2A 1PYDA 2JCXA 3RAEC 3UPDA 5FOWA 2BEVA 4QM6A 3UJPA 1URPA 2OT3B 3K0BA 5A7FA 3RYCB 3QU9A 3ZWQA 2OV8A 1I4DD 3EW9A 3IBYA 3GLSA 1NOKA 1Q1NA 3U39A 1ULBA 4PO8A 1HG0A 4KXQA 1RZ4A 3JS5A 1PL7A 4OYLA 5A7HA 1J22A 5CLGA 2YV1A 2NU6A 4AZ3A 3CLSD 2WMOB 4FJYA 2WYIA 2ZDHA 4P4SA 1AKWA 2JVKA 2IODA 2DTEA 5K8LA 2A9FA 3T4EA 5CD9A 3HCWA 1HF8A 3SZ7A 2HJVA 2VAVA 4D9GA 2PD4A 2G6BA 1KZYC 1OAAA 4AP5A 1AGPA 5FXMA 3B1JA 1JQBA 2XPCA 2QTVA 1L1QA 2IYLD 4RGYA 3MMNA 4YJ3A 5HCUA 3KU1A 4CDMA 1IXKA 4WVFA 3R7WB 4QOIA 1RXYA 3EOZA 2FKAA 1YCSB 3DCYA 3O1LA 3HGQA 3JASA 2HR1A 4Z2YA 1F9AA 5CT4A 2W8ZA 3G9UA 3TJMA 1UWVA 2HRCA 1N3BA 1NDHA 3HB5X 3RAJA 2FJPA 1EESA 4YRMA 4J0CA 4Q39A 1R15A 3ZNQA 3SZ3A 3TTXA 4QA9A 4U1RA 5HQ3A 2DLCX 2O3TA 3B7PA 1X13A 2A5LA 2VT2A 1PEKE 1QDEA 5J63A 4JVNA 4JI1B 5F7XA 1ACJA 3N0VA 1Y8ZA 3V8EA 1O87A 4RTPA 3GRPA 3DZ8A 4QVIA 3KR2A 3DH0A 4G0NA 5BW8C 1GFSA 1N2CE 4GC5A 4QASA 5ALJA 3W7VA 5D1HA 1DQSA 3EUFA 4XIGS 1HK7A 3RC8A 1T3SA 2YUIA 1V39A 1VMIA 3QVWA 4CMIA 2ODTX 4XW2A 4DGSA 4EMTA 1GPNA 3WLEA 2UWJG 3ZR4B 1QBQA 4W5RA 5FWNA 3E37A 1AGYA 2D8AA 2Q1WA 1IKND 3TECE 1P5RA 1SCJA 1AQLA 4MUYA 5LQJA 5CCMA 3K0AA 4LE0A 2HXYA 1GR0A 5H83A 4LSZA 1J07A 5BP7A 1MN6A 2WNIA 4UNRA 4S05A 3MWLA 3SPXA 4AMZA 4N0DA 4DQKA 1FTNA 3FCEA 1RM0A 1JIQA 3HV0A 2QBYB 3C7CB 3CR7A 5FUVA 4R05A 2GBIA 5T5QA 4KDEA 2GAOA 4AUNA 2RHOA 3BSWA 3OM0A 3TX2A 1XFDA 4BYGA 1KP2A 1OMOA 3PCRB 3UMSA 5AVXA 1YKSA 3HPQA 3D64A 5FWYB 2QI9F 4URUR 3UHFA 3KAQA 1BIFA 3VZDA 5EJ6A 3IPCA 3MQ2A 3QDNA 4JYAB 3SIXA 4S2EA 3VU0A 3S3TA 3LX4A 2Y0BG 1Z6ZA 2R1TA 4Q19A 4GYOA 2C8LA 2OO5A 3CR3C 2YQ5A 3MV2B 2ZRQA 4FWIB 4C03A 3FVVA 4O1IA 3WTCA 2BL4A 3L7AA 4C7VA 3NH6A 2ZIUB 3UKUG 1YU6A 1JAIA 3CEMA 4PZPA 4QNMA 3E23A 1M73E 3ZW9A 4F1KA 5AJXA 3NC4A 3THYB 4H7KA 4GXNA 1GNTA 3KKMA 1KU6A 3K9IA 4AOFA 1G7TA 1YB4A 1CSEE 2D2FA 3SFTA 4KPEC 3GJ6A 4C30A 1P7YA 4CT4A 1WWKA 4EW1A 3LM8A 2R2GA 3LDGA 3UMGA 1A9PA 4Q34A 1NYRA 1YBHA 2FVYA 3THXB 4UPEA 2QU7A 3C4VA 3OJ0A 4JLBA 3FBWA 4QGFA 3VISA 3AJIA 2W4IA 2Q8PA 3ZX4A 3CG0A 3SHQA 2Q0HA 1Y89A 4R1LA 3OZSA 1QPZA 1N5OX 3EK2A 1CUCA 1U7PA 3GRVA 1JHRA 3FCSB 2DFDA 1SXQA 2QDKA 2IOLA 2JFNA 4W8OA 3FNHA 3INYA 2LBPA 3DEJA 4IGKA 4XZ3A 1ZRSA 3N2YA 1VE5A 1F3LA 1LLDA 4I9CA 1TVCA 4NQZA 3U3JA 1Q14A 2ZYVX 5FTPA 2AX3A 3JQRA 3UUGA 2JLQA 3GFGA 1G9SA 5AFSA 1GTRA 2E18A 3RUPA 4F84A 1U8FO 2CNWA 5BXOA 1MX6A 2OXEA 3G23A 3RPEA 3ISTA 1OGYA 3T5DA 5CFQA 4B73A 1FK8A 1NW3A 1CHNA 1NUUA 4NE9A 4YP6A 4UOEA 5AUPB 2ZGDA 3RYTC 3EA0A 5HUHA 3TB4A 4ER6A 4B34A 4BO2A 3LA6A 2QXYA 2Y69E 2QRUA 3U6BA 2CJXA 1UK7A 2UZ1A 4QG7A 3R41A 2Y0EA 4V3CA 2P7HA 2PWBA 2BRUA 3HRKA 5I4BA 2FW7A 5K20A 1ONOA 4RABA 1E96B 2J08A 1KT0A 2PT6A 2X9VA 4OBEA 5BUQA 4EFKA 2P7IA 1AHNA 4FSDA 4WZBB 5D8DA 2ODNA 5BO5A 4D92A 1PR4A 4IM7A 4S0ZA 4YBZA 3M8KA 4J03A 4OL9A 4UUBA 3DDCA 1Y5LA 4TMXA 3U26A 4MVWA 4ARBA 2B4QA 2GEFA 3BIOA 2I3DA 3I64A 1GNSA 4RJIA 1XZEA 3PQ3A 3NUZA 4DYDA 3CW8X 4L02A 3LTEA 5BWCA 4LS3A 4NKRA 1ZESA 2R2LA 4PPQA 3T9AA 2QPTA 2V6FA 2EATA 2JRCA 3QX8A 5LYYA 4B46A 2P9QA 2JBAA 1NN0A 1KWKA 3ICEA 5AVYA 4ICIA 1K8RA 4MS4B 1HFAA 3TNFA 4CKXA 3WY9A 2XUPA 3ASHA 4HNAD 4HB2A 4Q4DA 1W5EA 4O2AA 3DL2A 4XIIA 5JOQA 2FMTA 1M2WA 1Z15A 5A62A 5K0JA 3BXOA 5D84A 1ZOPA 1IEQA 3QNMA 3E9YA 3R9MA 3SSNA 5FEUA 3FKQA 1AP7A 3EMDA 4P9NA 4DLYA 2WG2A 2FW9A 1U0HC 4JXKA 4OI4A 3BFVA 1N6LA 1OCEA 3AI3A 1B1CA 3MJHA 2W43A 3ECCA 4XPIA 2C7VA 5DK6A 3ZHBA 4RE6A 1KGDA 1WJGA 2WSIA 4B40A 2GKGA 2H57A 4OAUC 5A0FA 4DG8A 2CCKA 1HE1C 3V2OA 1UQTA 3HBNA 1RQ7A 1VC2A 2YINC 3ILSA 1N4AA 1DOHA 3U81A 4N5HX 4B4KA 1Z6PA 5JNLA 3KQQA 4HV4A 4K7JA 1FFCA 4MJXA 4BNDA 4BEBA 1QQTA 5B3JA 1A98A 5GADl 1WZIA 3TZBA 4YRGA 5KJ6A 4N47A 4OJMX 2XPZA 1YFKA 3LJ3A 3GLKA 4ZXFA 6Q21A 4UNNA 1TLTA 2IU4A 3GPIA 2XZTA 4YCBA 4CKBA 4L9WA 3UINC 2OFWA 4HEJA 2VP4A 3DPSA 3QVTA 3PH0C 3PUZA 4BQQA 2OE2A 2ZUSA 3WGQA 2H2DA 4PO9A 4DLXA 4A73A 5EJGA 1ZIYA 4XWWA 1TUEA 4WOJA 3NB2A 2ECPA 3I5YA 1JEDA 3EXFB 2J67A 4EECA 4NK4A 3MJWA 4WV3A 2PD6A 1XHLA 2VKQA 3S7TA 4EAQA 1NN1A 3E30A 1NUPA 3JV7A 4D43A 2XXAB 3A4TA 2BHLA 2DJ5A 2BLLA 5JARA 1N0IA 4GEGA 4RQAA 3RI3A 3FPSA 1PDVA 4A6EA 4M1EA 3EH1A 3R3ZA 3ZGXA 2W0SA 1R7RA 3GARA 3OIUA 5L40A 1T8WA 1WV1A 4CHGA 4NP6A 4DUYB 4PYRA 4IRMA 4EG4A 2HADA 1SEPA 4GB9A 3AB3A 1VSQA 2N47A 4C3OB 3MYRA 2DLNA 3B9QA 4H27A 5D51S 4LJ8A 4DLNA 4C6HA 5C9ZA 2BM8A 1AUXA 1HSOA 3CEAA 2A86A 3FTDA 3VH4A 2VGXB 3H17A 3Q15C 1ECCA 4UATA 1V6CA 2JCGA 1J25A 1TYEB 1DPGA 2VHYA 2ZRHA 2O3QA 3A36A 3CM0A 3NC0C 4K6CA 4Z49A 5ARBA 4D9HA 1W8IA 1C3XA 2O4CA 3Q88A 4G5XA 4L57A 5FBZA 5LDGA 3K4HA 2OPHA 4A6PA 1SKMA 3AOEC 1XELA 4IR7A 4TPKA 1J06A 4I55A 3A3YA 5TY0A 4Z7JA 3Q4AB 2C42A 2YS7A 1CR2A 5JXHA 3DKVA 2LAHA 3N3BC 4K9PA 1H6DA 2R25B 5FHQA 3LUFA 5ALMA 4HGRA 1UFKA 2P2DA 4GE3A 4QU0A 2PLNA 1CDOA 4FHDA 5HUJA 4TS3A 3K9BA 4FWTA 4KZCA 1BVYF 2A0KA 2R00C 3DSTA 5TC4A 1JQLB 3BTOA 1GO2A 3RIXA 1U1GA 2V8OA 3PHGA 3URZA 1MC4A 4Y2UA 1S8FA 2NUBA 2EC5A 3JQBA 3Q7PA 4M76B 3UVEA 2ENWA 4D44A 2W7TA 5EJIA 4DPMA 1QAMA 4JVLA 3DR3A 3T3IA 2ZZMA 3KXLA 2BKXA 3FHOA 2AGVA 2FHSA 5HBRA 5LZ9A 2PXHA 4RPGA 2HQSA 2RHJA 4EG5A 2GVZC 3BUAA 3EJ6A 3EWIA 3QPAA 4GSYA 3I45A 1OPXA 3W5JA 4MUMA 2X9QA 1T2UA 4H35A 3BIWA 1M8JA 5ITZA 2AVPA 3K35A 2RD2A 4QQ8A 4Y6QA 4PZUA 2PX2A 2QG9A 1R5BA 5LCWJ 4KDRA 4JC4A 3HY3A 3OQNA 3B78A 3EYAA 2YWFA 3PVLA 4LBWA 4TMFA 3K8YA 2PRYA 2VTDA 2PMDA 4M3NA 4OOEA 4NFHA 2CD7A 5C1PA 4K9RA 4JBGA 4ZTBA 1XEXB 3CV0A 1N5RA 3LPDA 5C4GB 4F93B 2P90A 3DYIA 2ZIGA 4I66A 4EYGA 1TT5A 1JIXA 2ZJ6A 5KQGA 1PW5A 3DRAA 1Q15A 4UEJA 3RRXA 3MVEA 4HJRA 2WYVA 5IN4A 3RANA 4EL5A 2NQ2C 2Q1TA 5BRNA 2OQVA 4GICA 2AKEA 1NFQA 1NFRA 2G0AA 3BMOA 3QWIA 1RAGA 4IZ6A 4MMZB 2AXZA 3ZWBA 4WCFB 2P67A 1RZVA 2ZYSA 4W63A 3V7UA 2CXHA 3WWOA 1OB2A 1EYHA 3FYUC 4HX2A 4RH1A 5KYWB 2Y0CA 2P1ZA 3FUFA 1KJJA 1EVJA 4NOLA 2IHTA 4FNMA 3IP5A 1DUVG 2ZJ8A 2ZBGA 3RFTA 4KFUA 2P9IG 2ZJ7A 2ODEA 3RIHA 1U9YA 3L02A 2PT5A 4HDSA 4HNAA 5DXAA 3FU5A 1T4MA 4TWZA 1ZBPA 3EIJA 1PQPA 3GA7A 2C7RA 2ZU6B 1H5QA 4I99A 5ALIA 5KNCA 1IBKB 1GV1A 3BGVA 3F3MA 1KKLA 2GHRA 5AI4A 3RVNA 3BE8A 1NN3A 3WZLA 4I9UA 4F4JA 4RHEA 2O5RA 3QQPA 4OHZA 3T5TA 5IVKA 2IH4A 1DIGA 1CEXA 3IBCA 3GEBA 4KYVA 3LUDA 1SBTA 1UT8A 2VKTA 4R0NA 2A1TR 1D6JA 4DZRA 4Y6CA 2J41A 1RYZA 1W4AA 2RDMA 2B99A 4FZVA 4RZIA 4CLOB 2HMAA 3CIAA 4GCNA 4HWOA 2OQ2A 2ECKA 3Q9NA 4WHMA 1RI2A 1EIWA 2IOHA 3WIDA 3G6KA 2FEZA 1WDMA 3NPMA 1SQSA 2X15A 1DAPA 4K5QA 4P58A 1UMCA 2PX0A 1BGXT 2HWUA 2OB2A 3N2KA 1T2CA 1V71A 4PICA 1ZINA 1G41A 1TO2E 3UJ9A 1M83A 1JLLA 4ZAWA 1PEYA 3M1LA 3HK2A 4M1KA 1AKUA 4CRWA 1VG0B 4FB4A 4O4HA 3C6ZA 8OHMA 3HXKA 1DCMA 1C7EA 3HI6A 2HU8A 3UFXA 3ZGOA 1QZ2A 2OM6A 1WPGA 4G89A 3JQCA 4GZLA 4IG4A 3C3OA 4WMLA 3C3XA 3GZ4A 4IJVA 5ALOA 4B6PA 4KRXA 1N6RA 2XOEA 4HAOA 4WZBA 1ZN9A 2NZJA 1BZYA 1EP2B 2PL3A 2X40A 3L1UA 5KUTA 2VDOB 4OBBA 3MGAA 2B6HA 2RFAA 3D5QA 1CUVA 2ZI3A 4LCJA 1UMDA 2C1EA 2I4MA 3GGJA 4HYTA 1IONA 5BV8A 3VHXB 4KOAA 2MINB 2X9GA 3OA0A 4HTFB 4M7RA 4YAFA 3FTWA 1QLWA 5KJ1A 5L3VA 2P41A 3T94A 3WL8A 4JGGA 3MZLB 1F14A 1K3FA 1YMQA 2FSVA 2VNJA 4U6SA 3VBCA 1PJ4A 4JP8A 5FRDA 2FB9A 1KORA 4ZAZA 1QP0A 1LF5A 3NTQA 4JEIA 3O91A 3IP8A 2XEEA 3CUUA 5BQ5A 5KREA 2VK4A 1U3UA 1KI4A 4AN0A 4MA4A 1L6IA 4LISA 4R9SA 4LWZA 1MOZA 5D5QA 1WB6A 1N7IA 1JL3A 2PUVA 1L2TA 1WVIA 4MOWA 4G0MA 3EWNA 4D57A 2WT8A 2PRKA 3PF9A 2GM5A 3RFVA 4BRZA 1N2JA 4O4JF 4AUKA 5BSWA 1CTQA 2GNOA 4JJ8A 4ZCSA 1NI4A 2GN1A 1CDDA 1JDTA 1N92A 3QOXA 5U4XA 3T1HB 4XQ9A 1I7LA 1QONA 3C98A 3CRZA 4DMCA 2VXYA 4C4TA 6ADHA 1KI7A 2D4AA 4N03A 4YXWA 2V7PA 3PRYA 3K9HA 1TEVA 5KZMB 2HU7A 4LBYA 4EHBA 1Q50A 3GLGA 4NHOA 3NVMB 3S27A 2QMZA 1REQA 2P2LA 3L4BA 3VBEA 1JWAB 5CNKA 4UBOA 4A6XA 1SU8A 5A71A 4MI3A 1DRJA 1NGSA 2GILA 3ND7A 2R8YA 4L16A 4LMAA 4OYRA 3SKXA 1D07A 5BSFA 2ZJ2A 4BXOA 1P2BA 4A0RA 1XCBA 1E99A 2PZKA 1ABBA 1OHHA 3T6KA 5ADHA 1TDJA 1OAKA 1II8A 1KVUA 1SOAA 1J5XA 1Z38A 1XD2B 2GRPB 3AO0B 1HT2E 1E3TA 2MSCB 3B53X 3ANLA 3OUUA 5GV8A 1RPJA 1BW9A 1XU4A 5CLHA 4JH0A 3GRZA 4ND4A 2CMGA 3CNEA 3GUZA 1NOIA 4PHCA 1ZBDA 5FAXA 1T24A 4EFDA 5ITWA 1BS9A 4RMGA 3DZCA 5T4HA 2D0PB 4B7CA 5BQFA 2Q5JA 1Y9EA 3L1HA 4M3OA 1X5BA 3DMNA 1JLRA 1UAGA 3CLRC 1XN4A 4X1OA 1JX6A 2NMVA 1UXOA 2MYPA 2PWYA 3IERA 4TKZA 1POWA 5A1TA 2P6RA 2FR8C 1WF6A 1SVXA 4HC4A 4OK5A 4QX6A 3ZGYA 4BZXA 2ZUFA 1NAIA 3SEQA 3M6WA 4JROA 1LSOA 2TMKA 4CKCA 4RHYA 2GNAA 4J0DA 3INNA 1PFKA 4MR9A 3W2IA 1GXSA 2OAP1 4EO9A 1SH7A 1ELWA 2WQ7A 1JFFB 1HGXA 1JTVA 1R4ZA 1PQ4A 2RGNC 1KSJA 1EZ4A 3AW8A 4TRRA 5K1ZA 3GFSA 3WJ7A 2NSDA 3GLIE 1P0FA 5HE9A 1H6PA 2O2XA 5EKUA 3BJMA 5DW0A 4BZWA 2XGSA 2JGIA 2AFVA 3B51X 4BX9A 3DOHA 4Q9IA 3TI9A 1DIRA 3UJCA 4G5RA 3BJRA 1ZAKA 1E79A 3PFIA 3ML1A 5DN6D 3PX2A 1G7SA 3AEUA 1VBFA 3L13A 1ZM3A 2G4VA 4RETA 1ZVMA 1IBCA 1MPXA 5IT0A 3OETA 4BWYA 4DBLE 3E4BA 4BC1A 1PGPA 3DJYA 1Y81A 2D62A 1US8A 2XWSA 1G20B 4PYIA 1BXGB 2C3YA 4KO4S 3VU9B 5JH7F 2I9CA 2V8BA 3GUHA 1RLUA 4GNRA 1JG7A 3F3YA 4BLTA 3HACA 5EXEA 4ZGWA 1ZI8A 4GZMA 3SYNA 1UG3A 4IQGA 4P7BA 3S1AB 4HVCA 1FW6A 2GK4A 1ZC4A 2NUPB 3P1JA 3M3HA 3RU7A 4K9SA 3UT6A 4BBAA 2W9XA 5G2OA 4C20A 1QRSA 3FPFA 4XXHA 2I4NA 3DEIA 3E48A 5T8IA 5J2TB 4H15A 3C7AA 3KPYA 4PEVA 3MAAC 1L4HA 4BO3A 5T41A 1TKCA 3FA2A 1Q92A 2A30A 1C7IA 3FNEA 3HSYA 3DYBA 2J7PA 2VDRB 3ITEA 1MO2A 3KYDA 3HXMA 1BXKA 2I0FA 1A17A 2WOOA 2NT4A 3BQOA 1B8OA 1NAHA 3L4SO 4ROTA 4LF9B 3JPYA 3HXDA 4OSEA 2PUHA 5JNRA 5A7GA 4JEHA 4OXKA 5CXXA 3D54D 3OX4A 3DMDA 1CS4C 1AKQA 4CEHA 2PH7A 5CITA 5EERA 1QHFA 3EVBA 1HDCA 1W85B 4EKIA 1BEEA 4H7XA 2VQ3A 2DIWA 1Q1AA 2QD1A 3IAEA 3KB6A 2VJLA 5DX8A 2DSTA 3SE0A 1C9JA 3H8WA 3WMXA 1HDRA 4UD6A 1LA2A 2XXBA 1ORIA 1ZIDA 2VCHA 3FB4A 4MWZA 1GA6A 4WLOA 1B3BA 3WGHA 3NYIA 1V43A 3RSZA 3HO1A 4OAVB 1G6OA 3QWHA 2QTWB 4AJ9A 4OMCA 4UDNA 5CIYA 3V4PB 6YASA 2H7VA 3KOZA 2Z4SA 3LKVA 2H6GA 2QZPA 4X60A 1TYAE 1RCFA 2HQOA 2WMNA 2PZFA 3BYZA 3FNBA 3EUAA 2P9CA 1UBLS 4MRMA 3TSWA 1I9CA 2DWQA 4FFRA 4JOSA 5DTEA 1N2HA 3TKYA 4DLPA 1ZMRA 1T4CA 3GMDA 4RX1A 4B47A 4YMWA 4KO2S 3CB2A 3THSA 1PG0A 4OH1A 3A9WA 4Y30A 5FKJA 4BATA 4BKUA 1M1YE 4DMGA 1EQAA 2ZIXA 4CKZA 1OH6A 4RJTA 5E38A 3KB1A 1EFUA 5MHTA 1N52A 3K2IA 3OLXA 3EIEA 2HCFA 3EVNA 3FUCA 4EY3A 2XTAA 2Q9CA 2BD0A 1T5DX 4A82A 4CLHA 5CMLA 1ZX1A 4YMHA 4KRFA 2BKAA 3PQCA 4WEOA 3KQSA 4RTRA 3DP9A 2LWIA 4G65A 3MBOA 4HN2A 4TYWA 5FTLA 3KTFA 1CXZA 4F8EA 5FT9A 4BDTA 2FMHA 4TWRA 3JAKB 4B0ZA 2OOEA 4HXFB 3RARA 1JHAA 3K05A 1CQJB 1X7HA 5HA5A 5EVCA 3DOCA 5LP0A 3KZMA 5DKFA 2AYYA 4XWKA 5E6SB 2WTEA 4MR8A 4UHDA 3SD5A 1I2ZA 3KWJA 5FNVB 2YN4A 4FHEA 3RYIA 1GPAA 4ALMA 1N1EA 2VRWA 4KVFA 3A05A 4D6YA 4ZI7A 1RWQA 5BQXA 5INTA 4X71A 1O6CA 5ENTD 2ZIFA 2HHAA 3GROA 1CUGA 3H9BA 2VP2A 5JADA 4NYJR 1U28A 2I78A 3AHJA 5DULA 4GKAA 4IIHA 1VL6A 5CM2Z 4LZPA 3NKLA 3WLNA 4I8DA 3AUFA 3WLRA 1JAXA 3QTTA 4U2KA 2YYSA 3PV0A 3QM1A 3IJEB 4M0EA 4XJXA 4QUHA 5I7SA 2NTYC 2CUKA 2UV8A 2O0MA 1M2GA 3IUQA 4WOKA 521PA 4J3FA 3AEYA 4EY6A 3DZFA 5BUZA 2OCXA 3BGWA 5FTKA 5TRTA 2IV7A 1ULSA 1OH5A 2HF7A 3NHAA 3DLCA 4G23A 3SXUA 4WXMA 2B69A 3G0DA 4MUEA 2XV1A 3UK2A 1U0LA 5LDDC 2Q6TA 4K6HA 4HDRB 3G0BA 2WWGA 3WXMA 4M1YA 5JUWA 3PQEA 2PU7A 1I7PA 3CF0A 3P2IA 3ER9A 1S8NA 2W70A 3LBIA 5TQ0A 1Q0QA 1Z07A 3FZEA 4UTXA 5B1IA 4RM2A 3V2GA 4YJ2A 3F8TA 2NUTA 5EJAA 4BNZA 3H2KA 4RZUA 2ZCUA 5NULA 2LNIA 4JT9A 1D0SA 4FJ1A 4PZZA 4RHUA 1OFVA 3DWIA 5F7ZA 3ZHSA 1XX6A 3BEEA 4RPJA 3HB0A 3T5MA 2C98A 3DO8A 1EJ6A 5HF5A 4CETA 2XDQB 1I13A 5EP4A 3IILA 3LQKA 4I50A 1NUQA 3PC6A 5KDLA 1Y0BA 4IIGA 3ANXA 3V33A 3USZA 4DMLA 5C51B 3R5KA 4A15A 1KZ9A 3N53A 2XYGA 1JIVA 1Q7BA 3IJ5A 4IDGA 1VE6A 5DTQA 2ATCA 4EI2A 4P2BA 4U2FA 4KI0A 2ZSJA 1EXDA 4G2VA 1FNBA 2ZGVA 3O95A 4MDFA 4DY4A 2J4DA 1G6Q1 2IS2A 1MX3A 5KKNB 3G2UA 1JVNA 2WU1A 2XXJA 5K0GA 4WY8A 2O23A 3W90A 2C9YA 3TE6A 4HAYA 4D9KA 4WAFA 3C0KA 4FGLA 4HH3C 4NIMA 3SBOA 1T10A 4F6RB 4BKMA 3WMGA 4BVBA 2BI4A 4BVLA 4ZQEA 1FNDA 1A76A 5E1BA 3VR2A 2GN9A 3H11A 3NOGD 2ZRGA 3K7EA 1MB3A 3KXIA 4PHGA 1NE7A 2GRLA 4RY2A 1LPPA 1YCGA 2BDEA 2OXFA 3GLVA 3RNOA 4EFMA 4IVNA 1M7GA 1W8DA 5D3QA 3BWEA 2PX8A 3OCUA 4G5SA 1LGYA 3CO5A 4YMIA 1Y42X 2QRNA 3S2AA 1UCFA 4IZOA 4ZVMA 3ZNGA 3VUFA 3T8MA 1WUJS 3ZVRA 5K3EA 2H07A 3GGPA 4EO4A 2ZJYA 4ANXA 4INJA 4AKEA 3C3QA 1PFQA 2C96A 1HKHA 1HH4A 1U8ZA 1UWKA 2DPHA 1XE3A 3QGMA 4YRDA 3RUDA 4BHTA 5C31A 3GEEA 1T5SA 3H1TA 3SZRA 1Q1GA 2BEKA 3KJGA 2C58A 1ODJA 4NMWA 4JC0A 4XGIA 4AIRA 2O7NA 2EW1A 3N3AC 5JBNA 1RRFA 3PPYA 4QTTB 3FAKA 4I3HA 2ZSIA 5GGYA 4DYVA 4TZ6A 1E1MA 2DPXA 2JLRA 2PEYA 3OM1A 3STXA 3ZZUA 4Q3AA 3MXTA 3BB4A 3WGVA 1V8DA 1D4OA 3X2EA 4R2WA 5DOZA 5AQAA 3GY0A 4AVXA 3SQMA 2VYVD 1JF8A 2BF7A 2JVIA 1N7JA 3MS7A 4Z4HA 2H16A 1U31A 3ZJYA 4BQOA 4KIFA 5C1BA 4X6LA 3V2XA 1V7ZA 4OQNA 2J1LA 4OMUA 1E4OA 4YB8A 1SXGA 5DLQC 3VPGA 3W06A 2FR1A 3HGTA 4H4EA 3EVTA 1MJNA 1D2HA 3LU1A 4EYSA 2YWEA 4O1HA 5CD1A 3CGGA 4EJMA 3VVCA 4I46A 4BB5A 1UXKA 1LBQA 1OI7A 2JBAB 3QLJA 3AEUB 5DF1A 5IDQA 3EW7A 4Z0PA 4Q4CA 4YJHA 3ZIAA 5L95A 5HKBA 4KMSA 5JSHA 1TNUA 1W44A 2EL7A 4R6WA 5C5IA 1NQXA 2IF0A 3BIFA 4I2NA 3QVXA 1TN7A 3TI7A 3UJDA 3L7KA 1I4EB 3CTPA 3ROGA 1VE3A 3OFVA 3I1JA 2Q8QA 3NT2A 4LNHA 1P4RA 2I6TA 4RU1A 4RXMA 4RIFA 3K30A 4YC7A 2QY6A 4BX3A 3LUGA 3OLYA 1W5BA 5AN8A 2HXSA 1CP3A 2AXEA 4LCTA 3EZ9A 4IJMA 4Q4AB 4H3SA 2H0RA 4FSXA 3PCXA 4LUCA 2GPYA 1C0PA 4WWOA 1X2BA 4G6ZA 4V0QA 5EHNA 3ZCQA 3ZQKA 1A8PA 3MJEA 1E7WA 2BHRA 4GQIA 4FFNA 1XLUA 2RSLA 1II0A 4HLUA 3RS9A 4N5CA 1K92A 1K3UB 2HIMA 4ME2A 2VNIA 5IRCD 1CJVC 1KFJB 2D1FA 2XVXA 5DN6A 3DBOB 3HA5A 3GLIB 4GI5A 1NSFA 1Y1SA 1L4UA 1KPHA 2HF9A 4QEKA 2AXQA 3LP5A 4M89A 4JR0A 1EGVB 4WUVA 4HVBA 1UPTA 3CT6A 2B5WA 3D0QA 4KN5A 3ZE2B 4PCLA 1ZKMA 3EXHB 5FNZA 3N1UA 1EA7A 3Q1KA 4ACKA 2D1RA 1TX4B 4NJEB 4R1TA 4YNBA 3TL2A 4M7CA 5KU1A 4BLPA 4DJTA 3FUHA 1ESZA 2BFEB 2R8XA 3RAUA 4E14A 1E3QA 3Q8LA 3ND8A 4I81A 1S2LA 3RC1A 4DCTA 1V4VA 3EASA 2G5TA 5CBNA 5JAOA 1RYNA 4ARAA 1ZK2A 2VJCA 4LSWA 4MB2A 4DK5A 1P1IA 3CSDA 2HFJA 3OA2A 1PR0A 4IPTA 3CR8A 3T4UA 1CBUA 1V3TA 3L8FA 1L7XA 3OO0A 3GOHA 4G1VA 1RU3A 4AY2A 5DB4A 1CUHA 3R0QA 5J43A 3NC1C 1CY8A 4ESEA 2ZSFA 4FR5A 5KINB 1TU4A 1ABFA 3I5MA 4CM4B 1RQRA 2DFTA 4U39A 1AE1A 4QPDA 1V9SA 1Y9DA 1ZPDA 3DBVO 4NOKA 2GUGA 2VXCA 3SXUB 4DDMA 4D0SA 2QUIA 1H9AA 4INZA 1J0CA 4JI0B 1N4DA 3AW9A 2PXAA 5LB4A 3WGMA 3SFZA 5ES3A 1D5WA 4PFSA 3UMFA 2DQYA 3VHLB 1MC8A 2L6BA 1YI0A 4BTBA 1FUYB 2AVNA 3G5AA 2P78A 2DBVO 1C9EA 2X19A 2YMPA 3MT0A 1GUAA 1QFMA 2QSYA 3MBKA 3A9TA 3KQWA 4I9NA 1X1QA 2N1MA 3ENNA 4K5BA 2E4VA 2WZBA 2PZGA 2ZIZA 4LNUB 1KP9A 3PUWA 1EFRD 4V02A 1WG8A 4J0FA 4TXJA 2VF8A 3L49A 4HDKB 1TLLA 3TAUA 2FW8A 2FWAA 1Z5WA 1R9GA 2PQ6A 3ELWA 1WM1A 4LJ7A 3WAKA 2Y99A 1NJ2A 1J49A 2R02A 1VRCA 1Z22A 4RVHA 4ZV9A 1ESDA 4JZYA 2KWIA 4F6CA 2GKSA 4OQXA 4J0GA 1HU3A 3DE0X 4W9NC 4YP9A 5IUJC 1ZMTA 2O14A 4V0LA 2JI9A 1IJBA 4BB9A 5GOZA 1RM4A 4LRUA 5CAEB 1GT6A 4PQRA 1C8BA 1JI0A 4HGPA 3W3AH 3GO4A 2WNSA 2Y6VA 4HNUA 1SA0B 4MVJM 1TIPA 3L8CA 5M04A 2F1JA 5K0SA 4MIOA 4ZK2A 2FF5A 3DV2A 3HUDA 3E2PA 1UJJA 4X9XA 4KLZA 1VIVA 4PLYA 5D2CA 5GONA 2NYUA 2X0FA 1F48A 3ZH9B 2KM1A 2BM0A 3ZDQA 3UMCA 1RYBA 1AN0A 4MKIA 3WV5A 4AJ2A 2NPFA 1YTUA 4I5EA 1H85A 4OLFA 5HYVA 2ZI9A 2X5XA 4GZ3A 1JBQA 3RKSA 4DBZA 1G8YA 2I22A 1R9NA 2IIVA 2PSSA 3S5JA 1E4EB 5IKEA 3NAZA 3QV1A 1Q0SA 1TYBE 3V48A 1W29A 1JEJA 3E22A 2F9LA 4NPHA 1N5JA 5DIZA 3EQ9A 1FW8A 4GWKA 3T5GA 3QELB 3DPDA 3H75A 4OLJA 3TGPA 2R8PA 2XF2A 1DXOA 1QQ6A 4FD2A 1XR3A 2AN3A 2PHZA 1OGJA 2NPIA 3MTDA 3KUDA 1IB6A 5FFNA 5J5VA 3VU1A 4UWGA 3NAWA 2QD5A 3OOSA 3W7BA 4XE0A 3KAJA 1CNMA 1W0CA 4BBJA 4DDWA 3GEMA 4XGNA 4RF3A 2GCGA 5HJ2A 3IV7A 4GIBA 4IGIA 4L07A 2XT9A 3TJPA 1ZD2P 4CL0A 1UOHA 4WBNB 5KC8A 2DWUA 5C8YA 1P0IA 1M8FA 1T2VA 2QL5A 2XGOA 1BX1A 3L05A 3E15A 3PDCA 2GEUA 5L9AA 1YK0A 1QQAA 2LKCA 1KI2A 4PINA 5KAPA 1JLMA 4AP6A 5AVQA 2QUKA 3G49A 1FYWA 4UCQA 4TRQA 3ZWVA 2XLCA 5P8WA 3TEMA 4JI4B 4YAWA 4TV3A 3MMZA 3ND6A 2VP6A 3CY6A 1X7ZA 3REGA 1RPNA 1QRRA 1GZUA 2AQKA 2ZR9A 2YHIA 1RTKA 2EF1A 4ZJZA 1QGYA 1AV7A 3TX6A 4C0JA 4LFBB 1TT5B 2ZB2A 5I9MA 1R0SA 2M63A 2O06A 3ZS8A 1KQGA 3W2FA 2E4AA 1L4EA 3PIRA 3KG2A 4HLDA 4UVDA 4X62B 2NZ8A 4N5QA 1G5HA 1G0NA 1PR3A 3EXEA 3K1AB 3KSRA 3L08A 3BHMA 3N2ZB 4RORA 2JIOA 4JN6B 3RHZA 1LVHA 4OQLA 4S0XA 4HEHA 4LGCA 4I2ZA 1Z0AA 3DOIA 4Q1BA 1Z47A 1DJLA 1UOPA 4U7GA 2Q2QA 2QQGA 2XS8A 1Z6QA 3BB3A 4FFLA 3EFOB 1FDUA 1UOQA 3AINA 4JU8A 4D8TA 1H6OA 1UADA 2QVZX 1ZCZA 1I24A 3N9IA 4G3XA 4YJ3B 5ALSA 3MWYW 2FPGB 4BO5A 4OGKA 4QC2A 1NF2A 1X9GA 1Y4DE 4NCXA 4W82A 5ER6A 1X94A 5TDHA 2L2QA 2QAIA 3FVRA 3OY2A 5M2QA 1VMEA 2FF7A 3O8BA 5ECYA 1YONA 1HC7A 4GPTA 1KH3A 4RPKA 4CU5A 4FLHA 1FE8A 1BH2A 4H1HA 1EE9A 5KCMA 2YIDA 3AKYA 1KYIA 3FUVA 4RANA 3RF6A 3W2EA 5CEJA 5HRUA 3IHYA 4LN1A 2Q5HA 1QH8B 1HT1E 1QHIA 3LUJA 1BW9B 2O0HA 4HTAA 3JXJA 3QF4B 5EIFA 2QE7D 5ILOA 1UKYA 4YJFA 1ZGCA 1YQ9A 4FWBA 1E7QA 1VCOA 2AJCA 4C22A 1V5IA 1MD9A 1LV8A 5DTMA 2ZWMA 4HAWA 3ECAA 1SVUA 4P98A 1UDAA 3WK6A 2JAWA 1UZLA 3GZNB 4EYEA 3AG5A 3FUTA 3GNSA 4DIOA 3IEIA 3N0WA 1P45A 4AQ7A 3RAFC 4E94A 2RE8A 2OHHA 2CDBA 4FM9A 1COWA 3WAJA 1DKPA 3SEZA 4RGQA 3O92A 4CV1A 2AFIA 3DL0A 3O8OB 4IWXA 2J8SD 1OZGA 2VUHB 1AKYA 1A5EA 1QGUA 1LI7A 2E37A 4Z86A 4O2BB 4DIDA 1RHRA 1U0SY 4YGYA 1V3QE 4KVMA 5B2EA 3SZUA 3CEJA 5AO9A 4GWLA 5FNVF 5AWFC 2YV4A 2GEKA 3APDA 2IE0A 3IP7A 2YMMA 2YC2C 5CXQA 3VZQA 5K5EA 2FEAA 1WP4A 4R1QA 2X0NA 2FQWA 3KV1A 3LWBA 4RDHA 3S2IA 3K8ZA 3VR5D 2XSZA 1KOGA 3WYGA 4A26A 4IULA 2Q3MA 1NW7A 5D87A 4YK7A 1W2GA 1OVMA 2GZMA 2EP5A 3C3DA 3MHPA 1SKBA 4FGKA 1UQUA 1W76A 5G0VA 4DXAA 1MRNA 1SW6A 4WX2B 2VP0A 3AR7A 3VJLA 4BNLA 5LZ7A 3LIPA 3I9OA 2H52A 2P2GA 3W5SA 1M1NB 3EGEA 3TE7A 3U44B 1BJRE 2W6CX 3RUCA 5B58C 3HXEA 4ANVA 1QZUA 2VXBA 5IBRA 3ETGA 3R8CA 1VIMA 1W88B 5I3ZA 2C0QA 1V11A 1CEEA 1E5TA 4I1MA 1IAVA 5E6UB 5KI6A 2M9MA 2JFGA 4GGPA 2HMVA 5EC8A 2DGDA 2F1HA 5JNTA 3C3CA 3ZGQA 2J6CA 4ZVLA 5CFPA 1JHOA 1IN4A 4WDQA 3DNFA 3NTRA 4OM7A 3ZQ6A 2R6JA 3VZBA 1E6WA 2R7NA 2W2MA 1C29B 4BWRA 4XEUA 1DGQA 3DLHA 3V8RA 4BB0A 3EPKA 1VLQA 4A3TA 3QUSA 3SIWA 5HXAA 3BTVA 1XQ1A 3HDHA 1CFJA 3V4ZA 1KMMA 1Z75A 2I7DA 1Z5ZA 3KFXA 1ESNA 1DKNA 1YQXA 3PFGA 1BMFA 3TLGB 2HO1A 4F3TA 2HRDA 1NJGA 2ZWPA 2BM9A 1ZOLA 4NEQA 1NXSA 3FYUB 3WA6A 1WBJB 1TN8A 2N46A 4YXFA 4UWKA 1UH5A 1Q74A 5JU6A 3MQ4A 2PK3A 3O26A 3V1YA 3FTZA 4CTMA 4EZEA 1JSLA 2YDYA 1XXHE 4KXNA 3A26A 4E5UA 5AJZA 1FPQA 3K6JA 1VCNA 4GAAA 2B3DA 4Q4HA 1RHJA 2GRRB 4QOHA 2IPMA 3FTNA 2QZ9A 4R8LA 4B3XA 1I3CA 3VYSB 1NQOA 1DEHA 2RGYA 2WJAA 1QORA 1LDGA 2D0IA 2DR0A 4IIEA 3VLDA 1HO3A 4ADSG 4Q3LA 5GPBA 4JHRA 1QK3A 3FNGA 1XQYA 4JDPA 3E35A 2LKDA 4QPPA 4NU5A 3KP1A 2PWPA 2QNIA 3TG4A 1ZUD1 2V5VA 1G3NB 3GDHA 3QXHA 1WL8A 3LBYA 4GVPA 4K9MA 5BSRA 4Z6KA 4YAGA 5CFRA 2BFOA 3FMGA 1W9MA 5CHYA 1GGJA 1CQZA 1TYCA 2BELA 2VH5R 5LNK1 2V4LA 3I8SA 1FU8A 1MAAA 3DBHA 2J9GA 5BVGB 4MGEA 3KTOA 4GPKA 4K6OA 5AKKA 3AF2A 5KJLA 4QFCA 1MVLA 1QV6A 3K5IA 2B4RO 3EG9B 5JSFA 1HNXB 5TGZA 1A95A 1M2FA 4KO3S 2AEMA 3HO6A 1E6UA 5MDHA 2COUA 3CF4A 3DF9A 1V3VA 4GTTA 3OKFA 3FR8A 4LY9A 3WBBA 4EG0A 5E4TA 5JAMA 2VPZA 2Q28A 3DXYA 1FNSA 2IKSA 3B1ZA 3KAKA 5K3SA 5DXFA 3REOA 4OYHA 5IF3A 4GOMD 1R5NA 1D3AA 5GWXA 4O0LA 3H0KA 4IVRA 1UXHA 1WQ4A 1UK8A 3E18A 4X20B 1J24A 3VLEA 2QR3A 4R7TA 3IBGA 1A7AA 3QXCA 5DNVA 4FFVA 1DJOA 3I9FA 3HCFA 4GMDA 4CF4A 1JCSA 3RREA 3P32A 1RXCA 2HQBA 1NX9A 4E6PA 2V54A 1I5RA 4FBMA 3O2SB 2AKYA 4LYJA 5LQSA 3RHSA 5HK9A 3EPPA 3P2EA 2I34A 2IA5A 3HJAA 3LUHA 1EINA 1BS2A 3GJ8A 3GUCA 1RZRA 2UZ0A 5ENSD 2ZRFA 2ZISA 4YUAA 4RAOA 5G05C 4O4JA 4YO7A 1HH8A 4IV0A 1WU7A 2VRCA 4F6RD 3MRTA 3WLFA 2M6SA 2R4QA 1Z0KA 2BZGA 2VHWA 1IVYA 1ONNA 3QPBA 4V0SA 3UJ8A 3WGGA 3W34A 1RBMA 1X3LA 1X14A 3ETEA 3PVZA 4FJ2A 5K8JB 4J1QA 2J5QA 4GMHA 1QKKA 4PCVA 1HDZA 1PJAA 3EMBA 1DWUA 1IE3A 1NF9A 3RIMA 1PUIA 1RXSA 2VYIA 2O0JA 4O5AA 2MOKA 1E69A 1TK3A 4M55A 3R3XA 3QOYA 4FS3A 4P54A 2DP4E 2AOTB 1XZJA 2IYXA 2VDUE 1G38A 1GIAA 2EKQA 4EB3A 4JD5A 3K70D 1FPMA 2QIPA 2ZPAA 5K0TA 1E2IA 1QHHB 4DCCA 2VJPA 2BUCA 2VDVE 3DDHA 3HEBA 2OYRA 4XSGA 1GM5A 4AV7A 3AI1A 3IHKA 3RROA 3LCCA 5LP6F 2IZ5A 4BEPA 4RY9A 4TMTA 3V8PA 5KJKA 2AXPA 3HM9A 3TXXA 5CFZA 1F0NA 3W9BA 2P9UG 3BWXA 3MM4A 3O8RA 2VQ2A 2FZ5A 1X7WB 4QYIB 1SCDA 4JC5A 3MCUA 1W85A 1O97C 4V0RA 5K0NA 5BMOA 3QOWA 5FV7A 3DW1X 2DQKA 5H3CA 1L3BA 1P1BA 5M7EA 3RU9A 1UODA 1U5CA 3PWTA 4PNHA 4CFYA 2I1VB 2GF2A 5BOSB 1QPBA 3R4CA 3UT0A 1YDHA 3U61B 3TTVA 1LDYA 5IKXA 2VBIA 1F2DA 2GD0A 4MMXB 1XKTA 2ZEJA 4YJ2F 3QH4A 1L7DA 2A57A 4UJ5A 3NRBA 3OHPA 3JCKC 3IA2A 4TZKA 3IKVA 4FFBB 4RYLA 3UOWA 1I2BA 4CQLA 3MEQA 5EIEA 5FLKA 1KBOA 3PQ5A 2YIVX 3E4DA 3WK7A 1CR6A 5JYBA 1HL7A 2ZIEA 4GI7A 2FH5B 2HRQA 2PT7A 3PRJA 4AUMA 1L5GB 1SBHA 2GD2A 3CUKA 3FNRA 4FEGA 7REQB 1DO2A 3GH3A 3KE8A 5CJJA 2CW5A 4R9NA 3RK0A 3AETA 1YDFA 2YFYA 1ECGA 1B0UA 4R2JA 1XDZA 1JTFA 5AKLA 2WWYA 4TXHA 2NYVA 3L5KA 4U2GA 3TR0A 2YNMA 3OZEA 3GN2A 1I1NA 4C9BA 3HDTA 3QENA 2WWWA 1IWOA 3A0UA 1Z0FA 3FKSD 1HQKA 3NASA 4JOQA 5EXXA 3RADC 5GP1A 1NBIA 1GT91 4MLCA 2IHJA 4OP2A 1I4LD 3SK0A 3VZSA 2IYYA 3KZCA 3C1OA 3VNSA 2QL6A 1Y9JA 2FPWA 5AJYA 3TTYA 3F7TA 4XTCS 2RHMA 1M6VA 2RHGB 3O7WA 5HGXA 3LHIA 1N34B 4X1IB 5C2YA 1RCTE 4PQFA 1JQJC 4PSCA 2I9PA 1P5QA 1TA0A 2C4WA 2DULA 4GECA 2XOXA 3RUEA 5LOVA 2IC5A 4J0KA 3D2AA 1FS5A 5CB8A 2GTHA 5JQWA 2GKOA 3ZE8A 2GXQA 4D9BA 4JDUA 1P6QA 3OCWA 3IMGA 2RCNA 2YXDA 1K97A 2AFIB 3PQ4A 2IYEA 3CRNA 3DSUA 1J5PA 4N7JA 3I1YA 1HNWB 1OT8A 3QUCA 4QGBA 4DYHA 8AT1A 5JMTA 1ODTC 2XCUA 3IDQA 3EGXB 3UN1A 5JS8A 2NO5A 3H7AA 3QVMA 1QGOA 1VJRA 2IXDA 3KSMA 4PGAA 2QYTA 3K6RA 2KM4A 4OY3A 1VECA 2Z5GA 2PMFA 5A4DA 4R2LA 1KVTA 4OH7A 1G8GA 1CY2A 5FUMA 1EBUA 4KO8A 2BZ0A 4ENPA 1TIBA 4NJMB 4LDRA 5HQTA 2OECA 1R1DA 4DMMA 4CDNA 1DCKA 3UYLA 4CTKA 2CFSA 2W37A 1AQ6A 1H8HA 1MDFA 1DQRA 2V3VA 5REQB 4KPUA 5JHHB 3UM2A 5KTSA 3R7DA 2ZYRA 4N1AA 2VQ6A 2CDNA 2MWMA 2WMYA 3Q15A 1KI8A 2J3HA 4MGYR 3NNNA 3UAYA 5KDDA 1GSAA 2VPPA 4DF3A 3ZWOA 5K6AA 1QKIA 4OO3A 1Z33A 3FDXA 4RENA 1T9BA 2QTMA 2VJNA 1P5FA 3WGJA 1K3ZD 2DZDA 2R8BA 3MOGA 3OOEA 2X6JA 1VCHA 4QNNA 3ZI7A 3HJRA 4F6RA 1JU4A 1C1YA 1UJ2A 1DTWB 1LTQA 1SCBA 2CLEB 2FOIA 4EJ2A 3CW2A 4UHEA 5EZ6B 3GNQA 3MF4A 3V2IA 3TG2A 1KJQA 1LK7A 1RWKA 2EKLA 2Z3VA 1V9LA 1QH1A 1V1RB 4EY4A 1ISJA 1WUIS 5GVRA 1I6KA 2A7XA 1XTUA 3HDGA 4FDAA 4DX5D 5L4SA 2K87A 1R8JA 5CX1B 3TIIA 2AUNA 4CMCA 1H2BA 3FPEA 2IYOA 2X23A 1SD5A 5T4EA 1U3WA 4YCSA 2DUNA 1DC4A 1T9ZA 2A0UA 4KXFB 1O1TA 3GMSA 4IYRA 4CEJA 1TM4E 4TV9B 3SLRA 1UDXA 3HXTA 4MUJA 3I04M 1KDRA 1RFGE 2ORWA 3E9RA 4WN9B 1DPFA 2QN7A 2WUGA 3EBLA 4UXJA 4G2NA 4EZLA 1S64A 1LTXA 1TJPB 3KT8A 4L0MA 5KSPA 4PAWA 2GM4A 1N4QA 1RLMA 1LK5A 3X1DA 2R05A 5GQSA 4RWZA 2BFFA 2HBQA 2P9HA 3AMVA 4ZYYA 5FOSA 3OD1A 4AM9A 1EPUA 1E9BA 4BL5A 4MXDA 1TQ4A 4FX5A 4S04A 3C85A 4MSUA 1DDIA 2OM2A 3DV9A 3CZ9A 3PYXA 2OXIA 3FSRA 3LDAA 1WABA 3OTQA 1ZUWA 4R9RA 3ZK8A 4EZIA 3EC7A 1N25A 3ABIA 5HIJA 5DVZA 1UKVY 4JI6B 4ZYZA 1E89A 5DCUA 1E5QA 3VYUB 3EHQA 1ZYUA 5EGSA 3O8CA 3ERCA 5K05A 1G1MA 4R5HA 1XZCA 4J7CA 4V3BA 4ZZ0A 3FFAA 1BHSA 3PSAA 3TQRA 1V1JA 1GZ6A 4QNRA 4AZ0B 4R2IA 1JILA 1PQWA 1H8ED 2SHKA 3G59A 2NUAB 5B30A 1YJ8A 3LF1A 1J2YA 1YUNA 4YRCA 1VB3A 5EXTA 1PR1A 4R8KA 1VPDA 4Q93A 4QWMA 3TAXA 3IA7A 3EHMA 4OJTA 1TU3A 2PG3A 2LUHA 1UL1X 1UKCA 1LRLA 1C1HA 2HLDA 1SWWA 1YB6A 2OMEA 3EEFA 4RVBA 1HT3A 3HY4A 4HYYA 1KBQA 3G8DA 4CI0B 3Q75A 4HQKA 5JQGA 4J2HA 5A0VA 1VGVA 4HDNA 3VX4A 5KNDA 5J08A 1H4TA 2ETVA 9LDBA 2DECA 4CIYA 4ZQBA 4HPWA 2PMCA 4Q3KA 4WFQA 1K8XB 3L41A 2QYUA 1JE0A 2HHCA 4IG9A 4CQNA 3CVPA 4BBZA 2R7LA 3BB1A 2ZPTX 1ATIA 2QMUA 3ZEIA 1ZA2A 1FP2A 1KEPA 1EFKA 1U28C 2EOAA 2IX9A 2TMDA 2W90A 3DBLB 3G0GA 3MT8A 3I2HA 4BVAA 3U4QB 1QRUA 4AK9A 2QQEA 2AT1A 3IEGA 4NBSA 5BUSA 4HS9A 1CZKA 1GFIA 2OCPA 4MWTA 3K9LA 4JL8A 3NAQA 3V7WA 4ESOA 1XDBA 4WNYA 3O4JA 4BVHA 2C7PA 3A58B 1GW6A 5AVJA 3QU4A 4CUJA 1ZOIA 2CZCA 3RS0A 5BWOA 3I4CA 1CE8A 1SR8A 1ST3A 2EEZA 4AJKA 1TQ8A 4C1BA 1XPUA 3MYVA 4FE4A 4IJ6A 3SF0A 1NI4B 2L69A 3G2HA 2IY8A 2XMBA 2Q4DA 2NXCA 4HGQA 2H4ZA 4N3NA 4R3WA 2DFVA 3MGCA 1OU0A 3H4VA 1Q83A 1C30A 3A6GA 4JJ4A 4Y9UA 1JCRA 2B83A 1F06A 2ASVA 3KOMA 3OQVA 3VDXA 1KEKA 4DLAA 1QG2A 4ZODA 5HSGA 2PVCA 3PJDA 3QMMA 3QWAA 4RSGA 3AQ4A 1P9NA 2F1IA 3B70A 1NU8A 1L5QA 4GRIA 4OA8A 1OVGA 5EUCA 2ZRJA 5CAEA 2F1OA 1SK9A 2ZSUA 3USCS 4Z4FA 1LRKA 3IEUA 4IIFA 3ULKA 1BVRA 2JAPA 2W6QA 3DDSA 4MPDA 4QDJA 3S99A 3IDZA 1C2TA 2AG6A 3NG1A 3CS3A 1G19A 3UKRG 1EGHA 2HRRA 3L8DA 5A4AA 4QGSA 2DHEA 2QTFA 2ZS7A 4HFRA 4GQAA 3IUYA 2BGNA 2VNHA 4ZDKA 2UUBB 2BFBB 2DG2A 5E2AA 4QLAA 1JR3E 2FGKA 3MAJA 4ZU1X 5JMND 4BLQA 4YV7A 2FFAA 4XZ4A 2P11A 1S2MA 2YWJA 1Y98A 3BSFA 5D85A 2ZT6A 2JJYA 4LQDA 3TVDA 3QIAA 3UBMA 2H54A 3F0TA 5AW2A 4PO3X 1ID8A 1W2HA 4KRYA 1LTKA 1AUOA 2WWVD 2FW0A 3Q87B 2NU8A 4KIJA 4CEHB 1CUJA 4B0PA 3KE9A 1XP5A 2J6HA 2R60A 2WPNA 3DG9A 2IP2A 5FB3A 3V7FA 2XUOA 2IY9A 2R68A 3G7UA 4LC1A 4PLHA 5REQA 1UC8A 2JABA 4EB8A 2IBMA 3AOGA 4PNZA 3GD7A 3EB9A 4M8LA 2NZYA 3RRNA 2FPKA 1J0DA 1EX7A 2PQ0A 2JVJA 4DM7A 1JDUA 1KETA 1MO5A 4MULA 5IJ9B 1T0HB 3DDZX 3OX1A 2VWHA 3UAWA 4BZZA 4MZXA 3W3ZB 4EX6A 2F55A 3K0KA 1XL1A 1XCMA 1D03A 1G8FA 2VT7A 5C7LO 2YJ6A 3KS2A 3DMGA 4R1MA 5A7DB 4PM4A 2IS1A 3MTQA 1L5YA 3FUKA 1S02A 1MC1A 4D3SA 4DDHA 4B9EA 1N1MA 3RSFA 2Q62A 4NZZA 4YCMA 4PV7A 1DU4A 2XQFA 3G0CA 2EZUA 3HCEA 1IZYA 1G17A 1NN5A 1Q91A 2DRIA 2LP4Y 2EJUA 5C7IO 2PZBA 2XQVA 3TLZA 1P7PA 1E4EA 4D45A 3ZEFA 4K8RB 3NQ41 1LBIA 4Z7NB 3HLTA 3O4IA 2NVWA 5HOEA 4LMBA 3CLTD 5FEMA 4MLZA 1O97D 2C4KA 4EKYA 5BURA 4RZQA 3P8ZA 3FZGA 1JPJA 3IURA 1M67A 1GUBA 3SI7A 3UENA 5I7WA 1KPSB 2UVDA 4CDGA 3RG2A 2H5LA 2O7SA 3GP5A 4FIDA 4I1OB 3X44A 3AL2A 1MHPA 3ILYA 1JDBC 4TLDA 2H9YA 3BMQA 3UX4A 1OLSB 4GMKA 4L8YA 5JD3A 1W48A 2YWHA 4UE6A 4C1NA 1W75A 3PD7A 1KJ8A 4NS1A 3C70A 4PC6A 4AMVA 4KK3A 4XVHA 3K0CC 1ZISA 1BVUA 5EXDA 3WGUA 4B6GA 1LBEA 1ZCFA 3VV3A 2XWQA 4IFIA 4XM2A 5CEEA 4J6IA 3GI1A 1GAQA 1UC9A 3CCFA 2WM2A 3L6OO 3LSTA 1XMSA 4NYMR 4DR1B 1XPOA 4LZAA 3ZCPA 1LCIA 3CMMA 4LXYA 1HFKA 3DDOA 3T9BA 4OQPA 3VOSA 2FJUA 2P2SA 1L3IA 2QD4A 2CY0A 4CN8A 3ZNNA 3GLFA 3KC2A 3ZWNA 3HO8A 4QHSA 4ONEA 5JJKA 4OAQA 4DM4A 1SC4A 1DKMA 1XWWA 1JHUA 1WG0A 1FLNA 1I4OA 3F5FA 3HZZA 4HZUB 2EIKE 1B6SA 1S96A 1NV9A 2HC9A 3E3OA 2BSAA 3PLRA 4U0UA 5FA5A 4D9EA 4N39A 5KHLB 1XVLA 1DC5A 2G9ZA 5DYWA 1Z5NA 4E1BA 3AG4E 2XUQA 3OEEA 5GJVC 2F43B 2GAJA 3ESXA 4DCPA 4CCYA 1KDYA 1F1BA 1FMJA 5BW5A 4YVQC 5F9FA 2V58A 4C0HA 3VPXA 3W8EA 3TIXB 2Y67A 1T5IA 5IASA 1FLDA 4OXQA 3WFZA 1UDBA 5FJYA 3FD8A 5SV2A 4QULA 3KL4A 3REQB 3UPUA 3N8NA 5TB5A 3V1NA 3NGXA 2I7TA 1C3JA 4Y9TA 1FTWA 3QA3E 1L5HA 2AJLI 3LLCA 1YC5A 5FR2A 2CMFA 1DBWA 1HQDA 2D1TA 5HCIA 2B36A 1ANKA 2GYUA 3OZVA 4BGDA 1YB2A 1RXIA 2IEGA 3TQSA 1G5RA 1BEUB 1DRWA 1JJ7A 1NBAA 1WULS 2C4TA 2PN1A 3MLEA 1N5KA 3WYDA 2WXRA 3MQFA 3AJDA 4BY9E 3Q10A 1QP8A 4G41A 4E46A 4MVJE 5IVHA 2PRZA 2B4KA 2Q2VA 2HF2A 4JQYA 4CL3A 3SJCA 2B7CA 2BJVA 2NO4A 2RI0A 5DBOA 2KZTB 3AERB 1IMOA 3EDMA 4MDHA 1DINA 5IDXA 1SU4A 1UEIA 2X3FA 3FCYA 3LUBA 4UDXX 4E22A 5TNXA 3IQFA 3RHTA 2VBFA 1E6MA 1D8DA 2ATXA 3UWOA 1R9JA 3ND5A 3KXDA 5DTIA 1HX8A 1E4VA 2GQ0A 4U3JB 3LKUA 1UPAA 3KR0A 5FPHA 5GONB 4EG7A 4AKTA 4YX9A 4KO1S 2XF8A 1O54A 1L7VC 3IALA 4OEHA 4R7GA 4W6ZA 3I8XA 2PM7A 2YASA 4WKBA 2ES4A 3ASVA 4REMA 5ALXA 4BGEA 4BMCA 4CLEA 2H2FA 2BW0A 2PLRA 4UU1A 2SNIE 3AVXA 1ML3A 3UCXA 4P3PA 3EIQC 5B1SA 2A67A 4TQ9A 1GGFA 1VP3A 1ZWKA 2EZ8A 5ADUS 1A9OA 3EUVA 5AI0A 1ECPA 4URVR 4GUAA 3U7HB 4LF7B 4LHVA 3JQEA 2P2ZA 3B7BA 1D2CA 1DXYA 3DC7A 2EGHA 4B79A 5DPMA 1ZH2A 4AWXA 2IWRA 1L4MA 3U09A 3WQBA 1G21E 5A9SB 3STUA 1RRVA 1RS0A 3ZUVB 1U2RA 1J7KA 4HQ0A 5B37A 3SBDA 3MKQA 1MQSA 1A1VA 1VGRA 3OP1A 3BH0A 2OR3A 2XNKA 2JKYA 4ITVA 2DHRA 3G9TA 1U7HA 2VJMA 3CF2A 4MLDA 5FAKA 2ZBVA 2VYVA 2RI6A 1TF5A 3NHBA 1VGQA 3QKWA 3EBOA 2IHYA 5FD8A 3IEPA 4WBNA 3QB2A 5C8XA 4O2BA 5KNHD 2LCFA 1NC3A 4FT4A 4NBUA 2ERCA 4FLEA 5HZKA 5FDFA 3HCCA 2IIBA 4JX8A 3SYKA 3LMKA 2V3WA 3R3HA 4RHCA 3FFLA 4RLFA 4RD2A 3FPBA 4XUCA 4D0RA 1UBMS 2GWHA 3D4OA 3Q9UA 4JELA 4I14A 1GKLA 2QGNA 3R75A 3J81A 3DPUA 4OHRA 4OL0A 5EQTA 1LFDB 3QVUA 1SU7A 3SFVA 4GR4A 2P65A 3KD2A 4WECA 1Q0RA 5LWQA 4BO0A 3MAGA 2NVUB 1L8XA 3FUIA 1MOQA 2AG1A 4KFSA 3KB2A 2VUTA 4P4SB 4GM4A 3DHEA 4BETA 1N2CB 4LG1A 1L7NA 4ZI7F 1EVYA 2IH5A 3V8VA 2XMRA 2JA2A 3HKCB 3IKJA 1EUCB 2V96A 3WIUA 1SUEA 2A35A 2R11A 1IHPA 2ONZA 1SHLA 3ZY4A 2ZE5A 4HNTA 2FSGA 3L82A 3NBKA 1N0RA 4YPFA 4ENWA 2OCDA 1UFRA 4FEAA 1FA9A 1HE4A 2D7JA 3PNQA 2Z8XA 4U7EB 1VMAA 5D01A 4ACLA 2V0CA 4K46A 2IV2X 2XUGA 3BE6A 5IAKA 5IMBA 2SECE 3ZQ4A 2WF6A 3E7WA 4RVFA 1C9DB 1P4JA 2GLXA 3QRWA 4WSOA 5KX5F 4XLZA 3ZV4A 2WD9A 1UPXA 3IV9A 4JL0A 1SKAA 4RTMA 3T5XA 1DX6A 1U98A 4IINA 3S8YA 2DTDA 2BGKA 2R86A 1EX1A 2RGWA 4JMPA 4D8XA 1HG5A 2EJWA 3KALA 4L5JA 5JZSA 3O0DA 5JHBA 4TRNA 1L5JA 2INGX 4TUYA 2C5EA 1Z63A 3EG5A 2W6OA 3UNXA 1N2SA 4KQXA 5L6LB 3GHYA 4FOOA 1SNYA 2AFHA 5F1YA 1PZGA 4D7AA 1ARZA 3AR3A 1IEVA 1MH1A 1NHGA 4DV5B 5AXDA 4LGMA 2ATVA 2HA3A 4GKBA 4O4HF 4IBOA 2QMHA 1N2IA 3MWEB 1JWLA 4GE0A 4Q1AA 5EUQB 4AROA 3HV2A 3RYIB 3UM1A 4DQVA 1EZZA 5KYUB 4CNBA 1PX0A 2IPXA 1O08A 2IUEA 3KOWA 3U3XA 1U9JA 2IUYA 3FCOA 5CHEE 2HA7A 3QLUA 3R5HA 2CXSA 5GOTA 2OO7A 3CH7A 5L8VA 3QX3A 1IZ7A 3KYJB 1C9NA 4XOUA 4XYLA 2ZTMA 3AESA 3BF7A 3HWX1 4EJSC 3B1KA 3TWXA 5E2IA 3V4VB 5IAAA 5C3MA 1M2NA 5EZYF 2OP0A 1UC5B 4R2KA 1X8KA 4M99A 2DLDA 2R6R1 1P60A 4ZI7B 3GJ3A 2R44A 1IY8A 4P34A 1ZGJA 3VKGA 5ENRD 1K6IA 2QX8A 1XEFA 3AEQA 1M0WA 3EY9A 5K3AA 1RLIA 1HE8B 4G8BA 4MV5A 3ZHZA 1S01A 1SOWA 2VSQA 4DIKA 1O9HA 3ZBUA 1PV2A 2OEWA 3VYRB 3PYLA 4EFLA 3NCTA 1G4AE 2OZLA 1X19A 4IAOA 1FDRA 1TEHA 5HMLA 5IC5A 1M8PA 4AN4A 1J0EA 1RE1A 2QYOA 1XXHA 3JATB 1AD2A 5UKDA 3DOFA 3IL2A 2O1SA 3WP0A 2CN1A 2C4UA 4A16A 1T4GA 3TGOA 4E2FA 1H4QA 1M6HA 4FFBA 3VNQA 2D8MA 3IOCA 1LJUA 5E6RA 5DGDA 1KQPA 4A92A 3JZMA 5JCJD 3ZWDA 5GJBA 2QP4A 3HM2A 4S1PA 4EJ6A 1KYQA 3VKFA 4RTSA 2B94A 1GYQA 2HD4A 3ITKA 2FDRA 3DEOA 4TLAA 2R2AA 3I8OA 1LLQA 2C2BA 4UM8B 4AG3A 5CA0F 1YJ5A 1DTEA 5D86A 4C21A 1IQUA 3QVLA 3BUSA 2P9EA 4W7HA 5AIAA 3MG9A 1EP1B 4C4YA 4RS4A 5G4KA 5KIAA 1Q0LA 3LOPA 1JQ5A 5CA0B 2DHDA 3UPVA 1DMRA 1F2UA 3EZ2A 2HM8A 3WRVA 4PYQA 1N9GA 1FX0B 3O3NB 1FJGB 3CG4A 5B7QA 4GYYA 3K4QA 2GB4A 1E58A 2NZXA 4LWPA 4PH4B 1ISRA 3C16C 5EVJA 3HNOA 4ZZ2A 3SYLA 1Y3FE 3V34A 1CJUC 2C3PA 1ZH0A 4U07A 4C7XA 4HEQA 3URKA 4MUGA 3PT9A 2ODBA 3MCAA 2Q4TA 2G08A 3UG6A 7ADHA 3NTLA 4TV8A 3TZKA 4B71A 3FFWA 4CGYA 1IDN1 2G5CA 3C72A 4W9MC 3NVKI 1WR8A 3VUEA 1E8XA 5IWAB 2WUEA 5HRYA 4JLDA 4BZQA 1T8SA 1ZVKA 3RV3A 2HMSA 1TNBA 3HB4X 1FU4A 4WWHA 2X3UA 5ILQA 2OC9A 5ALHA 3LF2A 2Y4TA 2JW5A 5G55A 2NO0A 5EUMA 4L7TA 4WWNA 4S35A 1TC1A 1JIJA 3P9KA 5H7XA 5LMCA 1U0FA 3MJCA 4JP1A 3E6AA 2LCIA 5HFNA 2V9PA 3MXOA 3TZ6A 1OU4A 2YV2A 4IXWA 3GMIA 5AQEA 2CCJA 2IGTA 5F7JA 4YT8A 5FR1A 1KQOA 1GDHA 3UUFA 3ASFA 4HQRA 4L4XA 1GRCA 1K6MA 2HCJB 3K2EA 3FRIA 5EMMA 3ZHCA 3D9QX 1HYQA 1JBKA 2CB0A 3EG9A 3G79A 3I2FA 4UTVA 4S12A 4CGZA 2XUJA 3B9PA 3QLVA 1JXAA 4G86A 4MV8A 5DMHA 3NMUF 1ZAYA 4TWAA 4R40A 1NG1A 2VIIA 2ECFA 1IK4A 4KLNA 4X8MA 1AUPA 2OHJA 4IOJA 4LBZA 5T57A 4M0FA 1XC7A 2IYAA 3BE4A 4Q9NA 2EFEB 4PBTA 5AHRA 1TGVA 1TF7A 4DR3B 3RU3A 1ILWA 5JXWA 3EDOA 4IQFA 4E51A 1ZM2A 3HC7A 3DMFA 4Q3OA 5IYZA 3EMVA 2GZ2A 2Q3FA 3H9UA 3ONNA 1IN7A 2OKGA 3EAQA 5EMLA 5KB3A 4LRTB 4KX5A 4WKCA 4X44A 3V97A 2JZCA 4RTQA 3L82B 3WGYA 4F06A 3P4YA 4F4UA 3DZKA 1F8FA 2HI0A 4KXVA 4L2LA 3ZW3A 2WAOA 5JSZA 4QGGA 2BH9A 1TD1A 1YZTA 1N8KA 2ACWA 3DLAA 3QBEA 4LKRA 2ZUWA 5EKTA 4QVKA 4ML3A 5HGJA 3T8YA 4EAAA 2FZKA 1SXJA 2RHBA 3L6AA 2Q1YA 1YHNA 4DB4A 5IBPA 1MAWA 3S4YA 1O0CA 3RTDA 2YXEA 3LY9A 5TVGA 2JCVA 4UM5A 3UXGA 2MSKA 3PA6A 4K0RA 3VHQA 3QELA 5T4BA 2QLJA 4XR9A 2UKDA 1DX9A 3VDNB 1YIAA 5CDSA 3EF3A 4KPUB 2R85A 3HCAA 3QYJA 5IH3A 3TNJA 1PR9A 4HKTA 4B3JA 1E98A 3TUIC 4PTYA 1IM2A 1WDWB 2WM3A 4BWVA 4PZCA 2XNDA 2ZYWX 3NNSA 3KDSE 4TMKA 2BFDB 2R47A 4EHAA 4RUKA 4CT0A 2XAAA 4R1OA 5F1OA 4HCJA 4DGQA 4GR9A 5KVSA 1JPUA 2AEEA 2ZRBA 2Z6AA 2CEKA 3CK8A 2CLLB 4CMIB 1FFAA 4LNUD 1DC8A 3GUYA 4NCIA 1K8YB 4RK1A 3R44A 2JHAA 2Q3EA 2QTLA 3D4NA 3QWFA 4U00A 4KUGA 4W8GA 5B4UA 1Y6QA 5AAOA 4RE5A 2DM6A 2GPAA 1QCCA 1K86A 2QX7A 2BMFA 3IUPA 3QLUC 4N9QA 5JC1A 3OVMA 1LPOA 1AKVA 3QMPA 4IIBA 3D0OA 4KZ0A 4GBED 4HNSA 4G0OA 1RLTA 1CX9B 3CF4G 1AC5A 4BO4A 5BSTA 2GCOB 5JDIC 4G0UA 1GG8A 3V00A 4F11A 2CYBA 1SEVA 1XZFA 3ZYCA 3AG3E 3WC4A 1ONSA 4AU1A 1T43A 4ZTZB 3LRTA 1FS6A 2RKWA 2BPOA 3ZU7B 3L0DA 3KOUA 4QQNA 5L3RA 3GZ1A 2NSHA 4YRBA 5LQNA 4UNSA 1P44A 3E1SA 3H6HA 1MO4A 4FC6A 1CQIA 1X8XA 3AUJB 4FMCB 1R5JA 4LHEA 1YULA 2OK8A 1HLPA 4CKYA 2E4UA 3L1KA 3SDBA 3VXKA 5DBIA 1IY2A 1N3IA 2D2EA 3TTUA 3DP7A 4RF5A 4Y9SA 2R1TB 2REQB 3QVGB 1ADBA 1E2EA 1LS6A 3PQDA 1OD6A 3EYWA 1KY5A 2D06A 1HFWA 2WJZB 3BHJA 2W8BB 3EY4A 2A5UA 4PF1A 3H1BA 4NYIQ 5E4JA 3ZJ5A 1YS4A 2QKYA 3KYDB 4Q12A 4CTOA 1E6LA 1NBOA 5LDHA 1WW3A 1ZQ9A 3BXXA 1BCSB 2I71A 3FAZA 3AY0A 2AVDA 5E4FA 4DNPA 5TQ2A 1AQIA 1Y3BE 2J7PD 3UI2A 2VC2B 1OE0A 1LSSA 3BC1A 3IKMB 4GX2A 4M1ZA 4Z1OA 5BV7A 1TAUA 1DOZA 2XZDA 2I33A 2FSIA 3B85A 3D7RA 4EKEA 821PA 5JAUA 3W5AA 5IM4F 3C6YA 2PIAA 1A0OA 3GW4A 3L1JA 3AL0C 4CQMA 3QKUA 4A03A 5HUQA 4I4CA 3VNBA 4CF3A 3IBEA 3K53A 4UQLA 3PQ6A 5JRJA 5KWJA 5BV2P 2XGMA 5LJLA 4RTOA 3RRBA 4L0QA 4C48B 1NJ1A 3ZWCA 5EJ8A 3BL6A 2CJWA 1IVNA 2PS3A 1DRVA 3IC5A 5JR3A 1VFNA 5BSUA 4M9SA 1RJDA 3RCBA 2UYGA 3UOGA 2R6HA 4F4DA 3H9QA 4IFBA 1TU0A 2QY7A 5JMWA 4PLWA 3TEJA 3SGLA 1OOEA 4HRXA 3R5XA 4BTLA 1JAZA 1OHHD 4FCVA 1YR9A 4XX0B 3RVQA 1TEZA 2ISSD 3U7IA 3VX3A 3RYFA 4U9HS 3WMWA 2HSDA 1D04A 3GBSA 3JQGA 3R0JA 1U8AA 4GGMX 3RT9A 4D9MA 3K6SA 2HJWA 3V2HA 1KMNA 1FXWA 1QVAA 3RO7A 3PTZA 4ENUA 1P62B 1V6SA 2VYFA 4H59A 2R5WA 4W9NA 1XVAA 2FLKA 1Y9AA 2A0YA 4QWWA 4F60A 3G5MA 2LPMA 4LY0A 3ZYKA 1QYWA 2QTBA 2NXEA 1CB0A 3N0TA 3FHTA 2Z9CA 4J1SA 1LPAB 1ZJZA <