2VSNA

Structure and topological arrangement of an o-glcnac transferase homolog: insight into molecular control of intracellular glycosylation
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
544
structure length
534
Chain Sequence
AWLMLADAELGDTTAGEMAVQRPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLAGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XCOGT
publication title Structure of an O-Glcnac Transferase Homolog Provides Insight Into Intracellular Glycosylation.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
total genus 194
structure length 534
sequence length 544
chains with identical sequence B
ec nomenclature ec 2.4.-.-:
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vsnA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vsnA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vsnA02
4F96A 4BTBA 1NOJA 2KS6A 1XC7A 3H4IA 1NZNA 5EKQD 3CV0A 3IAAA 2G9RA 2X6QA 1PC2A 1RRVA 2BFWA 3OTGA 1K08A 3FROA 7GPBA 2JLBA 2XCUA 3HYMB 4BQIA 1KLXA 5G05C 4N2QA 2G9VA 3TGOA 2IV7A 3VDMA 3URZA 4H7YA 3OKAA 2ONDA 3OKPA 2MHKA 3MKRA 4CTNA 2R68A 2UY1B 5FZQA 5EX0A 2GEJA 1ABBA 2GPAA 2ACVA 3BD6A 1Y8MA 3MV3B 3G2KA 3D1JA 5DU2A 1KTIA 4GA2A 3Q4AB 3NPAA 2H1FA 1P2GA 4CTOA 1NVKA 3Q3HA 3NC4A 4APOA 1L6IA 4HWGA 4L22A 4NC9A 5HXAA 2X0FA 1E1YA 2QLLA 2FBNA 4ME2A 4GYWA 1P2DA 1FU4A 1RZVA 1WV0A 3AS4A 2E2EA 3H4TA 3G2IA 1FTYA 5I45A 3FFLA 3CKBA 5A6CA 2PRJA 3O48A 3MRVA 3Q49B 1ELRA 3BEOA 3MT7A 3FP3A 4G23A 2F9FA 5TVGA 3SYMA 3T3HA 4A1SA 1YA0A 3S2UA 3CEJA 3CUUA 3NP7A 4AMBA 2GT1A 5LQDA 2GW1A 3RT1A 4XIFA 1FC0A 2QN8A 4G2VA 2UWJG 3CX4A 5DBKA 2YJNA 1NLMA 2QRGA 4EKEA 4W9RA 2KCLA 2G9UA 3MS2A 3G2NA 3NP9A 4YVQC 1L5QA 2XGSA 4MI3A 3MSCA 2ZB2A 3DDSA 2QRHA 4AN4A 4I17A 4G25A 2C4MA 3SYRA 2XA9A 6GPBA 4GZ3A 3R9AB 3VUEA 3ASHA 2ECPA 4UI9C 5KJNA 4Y6CA 3NCHA 2PL2A 3K9IA 9GPBA 1WW3A 2AVPA 3HBNA 4BT9A 3OXLA 1FA9A 3RIBA 3RO2A 3TG4A 3CUWA 3ZCTA 3E3LA 4M60A 4KQMA 4MICA 1QM5A 3GZ2A 1WUYA 4NQ0A 5IKPA 1NZFA 3CVPA 4N3AA 3BCRA 4EQFA 2QNBA 3RJVA 1M5RA 1KT0A 3ZCVA 3L7AA 4F9FA 3LPZA 2VSYA 4J8FA 4JHRA 4AY6A 2F3PA 2IFUA 3CK9A 2QRMA 4G1TA 3U4TA 3D0QA 4MI9A 5TMDA 3NF1A 2IUYA 4H7XA 3BCSA 5BNWA 2O6LA 2PQNA 3C4QA 3MQFA 2Q7FA 1E4OA 3KS2A 3FWVA 4U0UA 3TOVA 4EL5A 2PYDA 1QQEA 2IV3A 4N39A 2PQ6A 2LNIA 1C50A 3HBFA 3WADA 3EBOA 3MTDA 4NEQA 4UQXA 3G2LA 3T5TA 2PZIA 3QOUA 1XKXA 1C8LA 4WNFA 2XCBA 4REMA 2GPNA 4GCNA 5D00A 1UQUA 4RIGA 4KYOB 5ENZA 3OXFA 4M7PA 1L7XA 3ZFWA 2X0DA 4BFCA 1Y8ZA 1JIUA 3EBPA 3N71A 3O3CA 4CDRA 3DDWA 5BT1A 5C1DA 4RIEA 2GJ4A 2WPVA 2AMVA 4YI3A 3L01A 3TG5A 3S7BA 4GZ6A 4AIFA 1P2BA 1HXIA 4RG6A 4GZ5A 3ASDA 3KAEA 3HBMA 3UYKA 2VCEA 3SZ7A 3ZHEA 1JIXA 2C1ZA 3QDNA 1GPBA 2QN9A 4MHOA 3LYAA 1HLFA 1UZUA 3DD1A 3TSAA 2KCKA 4QLBA 2GPBA 2R66A 3Q5MA 1K06A 4XI0A 1GPYA 2V5FA 1O6CA 1XNFA 1FTQA 3UYLA 2J9QA 4LDPA 3CEHA 4HOTA 3L79A 4RELA 4HOSA 4U0ZA 1Z6QA 4WUYA 1AHPA 3E3OA 3OY7A 3S7DA 2LSVA 2R4TA 3QKWA 4M83A 5LCWC 2XGMA 4BQEA 5AYWD 2QLMA 4MI6A 1YA6A 1BX3A 4CTMA 5D0QD 1A17A 2OOEA 3ZGQA 4GPKA 3CV3A 2SKEA 2AV6A 2VGXA 4RENA 3WXXA 3UPVA 5G04J 3MRXA 4RIIA 3CKCA 2F3SA 2VGYA 2C0LA 2QRQA 1HH8A 1J39A 3U3WA 5D01A 4LEUA 4BWRA 4KQ1A 3WC4A 3QHPA 1P4HA 2HY7A 2FO7A 3L7BA 3QWPA 1Y6FA 3LY7A 1GGNA 1WW2A 1FCHA 4AM9A 2X0EA 5HQ8A 3CK7A 2AZDA 3MS7A 3T3IA 3C48A 2SKDA 3CEQA 2HYZA 5FZSA 4JA7A 1B4DA 1FU7A 4F97A 5ARGA 3BDAA 3T3GA 1GG8A 5DXFA 1PYGA 1B89A 1GFZA 2VGXB 3SF4A 4X7RA 4WHMA 1C8KA 2XA2A 5FT9A 4MRAA 3GUHA 4EJ2A 4BQFA 1JG7A 2G9QA 1NZDA 3EDTB 4AY5A 4JA9A 1F6DA 3RO3A 5KJLA 1QKJA 4W6QA 4HORA 3ASGA 2FETA 2BISA 3QKYA 2ACWA 1KT1A 3BEEA 4GYYA 1IXYA 5JJ6A 2KCVA 3OTHA 5DLDA 2PQRA 3ZPJA 5JTTA 2ASVA 3MA5A 2Y4UA 3PDNA 3HBJA 5G05J 4I1AA 2P58C 4UQZA 2NC9A 4Z5XA 1A8IA 2C9ZA 3BD8A 3L7CA 3Q3IA 2XEVA 3S7JA 2XMPA 2IF4A 3ZCRA 5JJ7A 1L5SA 2R4UA 4NESA 5CHEE 2F3UA 4ABNA 3G2HA 2QRPA 3ZCPA 4LEIA 3VTXA 4EL0A 1F0KA 2P6PA 4WACA 2KATA 1Y6GA 1E96B 2QN7A 3CVNA 2IEIA 3S27A 4EKYA 4I9CA 2IEGA 4N5CA 2JZCA 5HI7A 3MT9A 3BD7A 2QLNA 4I2WA 1WUTA 4G26A 2IW1A 2Y4TA 2VCHA 2VYIA 4HOUA 1L5WA 3DZCA 5IKOA 1PNVA 1QZ2A 2H1HA 3L7DA 2XPIA 5FJYA 3NAZA 1WM5A 5BW8C 3COPA 1LWOA 1SXQA 1FU8A 3G2JA 4O6FA 3T7DA 1JEJA 5ARFA 4FKZA 4X7PA 3Q3EA 3RKVA 2ATIA 3ASFA 4KQ2A 3S28A 4UQYA 2FF4A 5M72A 1PN3A 3CK8A 3QWWA 2R60A 4RIFA 5JJTA 1FS4A 1L5RA 1XL0A 1NA0A 4RG9A 1YGPA 1VGVA 4N2SA 1XV5A 4MHSA 3VDNB 3S7FA 2AW3A 4GPBA 3UUXA 1JIVA 4CGWA 4CGVA 3LCAA 1ZBPA 3GYZA 4KBQA 4UI9J 1L5VA 4HLNA 3ZCQA 3ZHEB 2HO1A 3OY2A 4GYOA 4U04A 2QN1A 3CUVA 3LY8A 2XGOA 4RIHA 8GPBA 4N3CA 3E3NA 2BGTA 2I6HA 5JTUA 1FTWA 1NOIA 1P29A 3VTYA 1TJCA 3ZCSA 1JG6A 1XL1A 3MEKA 2SKCA 3ULQA 2QN2A 3KD7A 1NA3A 2XA1A 2XCIA 3PE4A 4RBNA 4G2TA 2BUGA 1EM6A 1ELWA 3OTIA 1SXPA 2KC7A 3IA7A 4WNDA 1IHGA 1WAO1 3GW4A 3BCUA 3T3DA 2FF5A 3S0JA 4YVOA 1IYGA 1P4GA 1RZUA 4J8DA 2FFRA 4PQGA 5DIZA 2WTXA 4G24A 5KJKA 3CUYA 1H5UA 2OFFA 4JL0A 3RSCA 3JYSA 1P4JA 1PSWA 2VQ2A 1Z6PA 1WV1A 5D0OD 4WNGA 1NOKA 3C4VA 4U0SA 2R5SA 5FTPA 2PRIA 2X6RA 3AMVA 3MRTA 3RSZA 2FI7A 3ZCUA 4FZRA 3CUTA 3LY9A 4BT8A 4HOQA 4IN3B 2QZSA 3CVLA 1C3JA 3MS4A 3AS8A 3VUFA 3OXGA 5G04C 2PYIA 5FZRA 3OKCA 1EXVA 1AXRA 3PE3A 4UI9K 4WADA 2FEZA 4YUAA 4F3VA 5TMEA 2XCCA 4BTAA 4GCOA 4GA0A 3MTBA 2GEKA 4GA1A 3CVQA 3S29A 2WQHA 5EX3A 4X6LA 4J8EA 2IYAA 4YNDA 1Z62A 5CCMA 3MBOA 2L6JA 4KXKB 4N9WA 5GPBA 5LCWJ 2C2LA 4U07A 3IEGA 1HZ4A 1V4VA 2Q6VA 4B94A 2BGUA 4AMGA 1W3BA 2LSUA 4I9EA 3ESKA 3OT5A 3GZ1A 1UQTA 3Q47B 1GZ5A 3UQ3A 4X7MA 3T3EA 5TMBA 4WNEA 4J0UA 5A7DB 2YQ8A 3GPBA 4N3BA 2IYFA 3TAXA 2C1XA 1IIRA 2F3QA 4XI9A 5KJMA 3MTAA 1ZU2A 3LKUA 1GPAA 2QFCA 2QN3A 3CEMA 2HR2A 4NRHB 3D0RA 3NB0A 4YI5A 2GM9A 2VG8A 3MV2B 2UY1A 2JJMA 1LWNA 4Y6WA 3MT8A 1P5QA 2C0MA 1OUVA 3E4BA 4I2ZA 5CCLA 1XOIA 2DBAA 3RHZA 2YHCA 3Q15A 3AS5A 1Z8DA 3RU0A 3QWVA 3ZN3A 2VSNA 3WAGA
chains in the Genus database with same CATH superfamily
4XR9A 2QLBA 3T6KA 2KS6A 3G49A 4E85A 4NBUA 4RFLA 2IEBA 1Z3CA 5A5DA 4B93B 1SHKA 2OAGA 2R25B 3OU7A 3HRKA 4CM3A 3MD0A 2GEJA 1AUOA 3F7OA 1MVOA 3Q3HA 5ESDA 1CDDA 4UMEA 2J67A 3ZLTA 4FU0A 4U02A 2JARA 3G1WA 2YFQA 5BVGB 1DAKA 3NHMA 5KDLA 3FP3A 2RGBA 2POCA 1A9TA 1WL8A 4G07A 2GT1A 2ATEA 4O0MA 1G19A 4BNTA 2CCJA 1W85A 3I3NA 1KBZA 3MILA 2EG5A 2GARA 3T9AA 4FYWA 3ASHA 5IF9A 2CE7A 4EZEA 4GTMA 1XN1A 1O77A 3DBLB 5FTNA 4RFVA 4NQ0A 4IEIA 2P6MA 3OOSA 1TZKA 5E3JA 1LPBB 1ACLA 1GDDA 3KQQA 4ND2A 3JV7A 4DIBA 1PE0A 3W2IA 5CG2A 1S1CA 3CTPA 1Z0ZA 2HBZA 2OD9A 3GRUA 4I50B 2JI4A 3VBCA 1FQWA 1XU7A 1F38A 5BMOA 4EJMA 3LFTA 2EFGA 2W9XA 5KC8A 3U3XA 4BO5A 4ZO7A 3IOCA 1AK9A 5CDUA 2DJIA 1TTTA 5IM4A 3MRSA 1VLJA 4WCFC 4BL5A 5FFFA 3IKOB 1ZN2A 3AUXA 4OFBA 5IYZF 1RRMA 4GR9A 4JLWA 1YDEA 5K8UA 3ZGQA 2WP8J 3NBMA 3FNIA 2N47A 1GYRA 1U28A 1TK9A 3AETB 2W90A 2QRQA 2JLUA 4RTKA 3C97A 1SELA 1SB8A 1Q22A 3ZOZA 1NHWA 3H2SA 4PS1A 4Z9AA 5MFZA 1QV6A 2OHGA 1EK0A 3EHDA 5FULA 4G0NA 5KDOA 4PLVA 2YZ2A 3G2SA 3SSOA 1NX9A 1L4UA 3BIJA 3AZOA 3TCNA 1E8DA 1R4AA 4AJPA 2PQRA 1LNZA 1UFOA 2A9QA 1H2FA 1L3BA 4E6EA 1X1AA 4GT1A 1KQGA 4DPMA 1EIWA 3S7JA 4CV3A 2DZNA 2FW8A 2I7XA 5IFKA 3CHQA 5SICE 4LW8A 2PMKA 3ZYLA 2PKQP 4DJFC 1JR6A 3MYRA 3RC2A 4XVUA 2IU4A 3B9QA 4XDYA 5A04A 1YA4A 1XLUA 3V32A 1EIZA 2PUCA 1E0SA 1V48A 2OXIA 4L7TA 4YGXB 4ERXA 4F5EA 4JHKA 3SXUB 3ZWAA 3NM6B 4MS6A 3ZDXB 1QRDA 2B5OA 3ZGXA 4I5FA 3LIPA 3FUUA 2WDPA 2I1KA 1FFAA 3H1GA 5BWMA 1NQOA 2I6HA 1N4DA 5CK4A 4EYGA 4KC0A 5G1OA 3GW4A 2JGNA 4BATA 1P4GA 3DXXA 1D8EA 1YHNA 4UHDA 4HLCA 4TL7A 4F6LA 1EUCB 4GBGA 3Q88A 1MO6A 1QCZA 3BXFA 4X97A 1X19A 3UCEA 4QC2A 4BP3A 7MHTA 5DCUA 4X20A 4KWCA 1R4MB 3MCZA 4HEHA 1HC7A 3ZNNA 3SLKA 2FMXA 2RKWA 2XUIA 1YDHA 1Z6ZA 1V1JA 3QEJA 1WXXA 2BGUA 3AR5A 4KMOA 2HCJB 3TI7A 5AUPB 3AP1A 1BKDR 3G68A 1ARZA 2DAPA 1AG9A 3WGIA 3AVWA 4QECA 4YAGA 3JQGA 1CU1A 1VC2A 1YR3A 2DY1A 3OTGA 3Q78A 1K08A 1KJQA 1QGOA 4BQQA 1Y63A 3GPLA 5DZSA 3UMJA 3PR3A 3APCA 5AVKA 1OZFA 1QRAA 3R8CA 1G5QA 3ESAA 3GLUA 1RHJA 4WLFA 1P7CA 4K6CA 5HVNA 4B83A 4QKQA 4B82A 4AY4A 3MT7A 5EVCA 2GWHA 5DT2A 4QDXA 1NLMA 3GGGA 2ZU6B 2QUJA 3W5UA 4HMPA 1FEZA 3LBHA 2VDRB 4DNPA 4I9UA 3OQHA 2PK3A 3C5EA 1JQLB 3HR8A 3L5KA 4BDSA 4QYWA 3BHIA 1AV7A 1BEUB 4YDWA 1G8YA 4AYXA 3DWFA 1UC9A 1OXBB 4MVYA 2OO3A 3ZNQA 3I9OA 2QTMA 2O7VA 4RK0A 2Q5FA 4OH7A 2IIBA 4JZKA 4J07A 3JASB 4U2GA 3DO5A 1KE2A 2WU4A 1N52A 2W98A 3L4EA 2J4BA 1NULA 2P2GA 1PV4A 3OZGA 1C3VA 2ZUSA 4C01A 3FGZA 1FMTA 2QF7A 4Q3OA 3VNSA 1L7VC 2VJBA 1S3SA 1CR6A 3D8BA 1KEPA 3CRNA 4MYDA 3REQB 2GPBA 3N8KA 2O5RA 5ER9A 1TU4A 2HPVA 3D9MA 2QEQA 2BGRA 3IVCA 2QT9A 2HBRA 1WO8A 3I5PA 2V7EA 1NMEA 1SQGA 4LHWA 3O8BA 3OZWA 2E85A 1Z4LA 1W59A 4HDSB 4NFSA 4FILA 3WWOA 3OTWA 4DVJA 4M1MA 3ONVA 5CD9A 3ICEA 2FEPA 4K7JA 3UC9A 4OQMA 1PVDA 4O2BB 3X2SA 3IDFA 5CLLA 3T5MA 4O4IA 4QOEA 3ZLBA 4EB6A 1U7DA 2MHCA 4AOFA 2I34A 3COVA 2WXNA 3QKYA 1PTJA 2M6LA 1IN1A 2KCVA 2WYWA 3ZHUA 5DYYA 1TF5A 5IBPA 4WBXC 2IQCA 1TYCA 4AXHA 4YCLA 3D1VA 2IH2A 3I9LA 2EWMA 5JNUA 1BDHA 3E8MA 4XKCA 2WUDA 4N47A 5WRFA 4C0KA 2CFOA 1QYMA 2DECA 4BJ1A 2F1IA 2OE2A 1Z68A 4BAUA 1I3OA 4LHZA 1Y3FE 5H16A 3OAAD 1VKHA 4GPBA 3OQ6A 3CLUC 1UJ6A 4HH0A 2JFNA 1LK7A 3ZV5A 5JZVA 1NXXA 2YJ6A 2NSDA 3LC2O 2PMEA 5DCYA 1ZH4A 4OOEA 1KAMA 2VSQA 1XXHB 5TF0A 3JARB 4RBNA 1BN6A 1ZJ5A 4IF4A 3LT2A 5F7ZA 4ZT4A 5T4FA 4YUVA 3KETA 3ONWA 1A7AA 4G24A 1SOUA 2YXNA 4C88A 9ABPA 4UM8B 1TJFA 4EPVA 4U3JB 2Q27A 4CMKA 1Y81A 4KO4S 1IN4A 3A6LA 1CP3A 1JLLB 3D6HA 2Q2OA 3VR2D 2R6ZA 4BXOB 2GOYA 4PYNA 3LUGA 4MS3A 5K0FA 5IAGA 1SG6A 1MNAA 3HM9A 1VA4A 2IHTA 1JUQA 5F76A 3OAAA 4LYHA 4G0WA 3IIKA 4KBGA 2Y76A 1QTNA 5DRTA 4DMMA 2CUKA 2C0MA 1P1JA 3IRUA 4TWZA 5J2TA 3AS5A 3BK2A 3RU0A 2ZI3A 4ZI2A 3ZHYA 1ONOA 2X6QA 3HJCA 3BWDD 3EIOA 1POXA 1IN8A 3DW3X 4H6VA 3TSCA 1GAJA 2UXCB 1UODA 3PENA 4EB3A 3VPGA 2BKVA 1UJCA 2D2XA 4UWFA 2V74B 4AIRA 2MINB 4JGGA 1Q0RA 5F7XA 3DB1A 4LOHA 4NR0A 3VR2A 2BZ1A 3G7SA 3ETEA 2B20A 2JAWA 2YVAA 4W8GA 1YONA 1LVHA 2REQB 3V7FA 2HDNB 2AOWA 4LDAA 1XAHA 2OAQ1 2YJNA 5FR1A 2QVGA 1F4PA 4UNQA 2APJA 3R0XA 2BKUA 4HK4A 3GLHA 2B69A 4C4AA 4MWTA 1G5RA 2FZKA 4WIAA 2J9GA 4QHYA 5CJ2A 2JIBA 3LDHA 4FS3A 4K5BA 3M9XA 1GADO 3ZK9A 1KYQA 4MICA 3S68A 4J90A 1NBOA 2C1EA 4EMTA 2CK3A 2HA3A 4WTOA 5KNCA 2I0FA 4H08A 1PUJA 4S1TA 4TV3A 1R4NB 3T7SA 4U4AA 3K1AA 1AV6A 5LB4A 3WB1A 3OFKA 1DZIA 1RCFA 1J6UA 4Y0NA 2XCBA 1YASA 1RHMA 1M73E 3KBBA 1HY3A 4MV7A 3AJRA 2A5GA 2VJ8A 3HJTA 3EMBA 4XOUA 2J0SA 4M38A 3M89A 9LDBA 3FLBA 4YT8A 1GT91 4DX1A 5CTJA 4NCAA 5BOSA 3AK4A 5KYVA 4MHOA 5TY0A 2BMJA 4TMYA 3F6CA 1GGHA 3UV3A 3KWLA 3W9UA 2RI6A 3LQ4A 1KEVA 2VT7A 2Q5EA 2BM0A 4ECEA 4V0RA 2FW1A 3TK1A 2VQFB 4C7VA 3E9RA 1ELKA 3RH0A 4UE3S 2PZAA 2FPGA 2UUAB 1D1QA 3PXXA 5HJ5A 1SC4A 3KPWA 2JEYA 3FFWA 1K5PA 4P0TA 4GWLA 3QVWA 2GZ2A 5JQWA 4XLTA 3KT8A 3GF4A 4X71A 4Q1FA 1IK6A 3GGCA 1CWUA 2FZGA 4NKRA 2YNMA 2Q5JA 3RFXA 3LV8A 2C8JA 3KEZA 4ZVOA 3U3OA 1PJ3A 4MR8A 4W6QA 4X1OA 4EY7A 5D51S 2KE5A 1E32A 3USES 2JFVA 5LYJB 1HK7A 2NQ2C 3E53A 4Q9LA 5JPIA 3PFHA 5GONB 4IH4A 4IGAA 1JEYB 2P6PA 5EN5D 3RRNB 1HS6A 3OT1B 1L3CA 3CVNA 4LJ5A 2QTTA 1A50B 1ZK3A 1VMAA 5ARFA 4FEGA 3RTGA 1XCPA 3U56A 3ZZ1A 2WZBA 4N18A 3TVYA 3FHJA 2JK1A 5C8VA 2ZYWX 1U81A 2P2CA 1YVPA 5K45A 3LCAA 2A5UA 3DDNA 4OP3A 2X8AA 4EF5A 3BL5A 3W79A 1L1EA 5A5GA 1QOZA 2FWIA 4EO4A 1X13A 5C81A 1I3NA 4DJAA 1UINA 4C14A 2OAP1 3TCXB 2WHRA 3QYJA 1SUAA 1R0YA 2QX8A 1KXJA 3DXZA 1ISRA 3CZMA 4IRUB 5JJBA 2HJ9A 3GDHA 3T9BA 4NZZA 3LY9A 2XOKA 5KTPA 1WPXA 2KZTB 2JI9A 3D7SA 1WF6A 2XXJA 4LGMA 1VPVA 3UPDA 4O6VA 3IEGA 1GRRA 4UHFA 2YXDA 1A71A 3N2EA 4LDNA 1FUKA 1XZPA 2A4ZA 4PIVA 3TQFA 3H5RA 2QFCA 2C2GA 1R5NA 2VDVE 2XEDA 3D0RA 2ZRMA 4ER3A 2Q5QA 2QSYA 1Z25A 3EXFA 2AR7A 2WABA 4UDNA 3DL0A 3B53X 1Z5OA 3EPJA 2ZCUA 2O8EA 4E5PA 1KO4A 3FROA 1PR3A 3K0HA 1WIWA 3WX0A 4JJ6A 2D54A 1G41A 4NG5A 2HDOA 5CEAA 4FHKA 4Z1MA 5IRCD 1ADJA 4HXYA 3QVGA 1CRQA 2V8OA 1LF8A 3G3EA 4CPDA 3NTUA 4DWOA 4AEZC 4FHDA 2QV0A 4ZD6A 2BN4A 2QQFA 4GQAA 2XH8A 2ZAOA 3F67A 4YMHA 2CL6X 2IOLA 1OC2A 2G9UA 5BXYA 1VHDA 1E5LA 1BXZA 3M1AA 1W0JD 1RP1A 2DUNA 4J1NA 2JGRA 2AX3A 1XCGB 1L4NA 3IVMA 1JHZA 3BSWA 1UMDA 4HAVA 5I9LA 1NVFA 2IXTA 4H7HA 2BMAA 4A8JC 3BGOS 3VR0A 2K2QB 4IEFB 3PE6A 3IESA 3RBVA 1E9DA 2HMYB 5TEWA 3HVEB 3D0OA 1P1BA 4IVNA 1P5FA 3BGIA 4Z7OB 3SFZA 1ZWLA 1A9OA 1A5SB 2ODQA 4DIUA 2Y69E 2PFSA 3CZ4A 4JW1A 1VA5A 1O9BA 4U6QA 2JGEA 3EZ2A 3H5LA 3R5HA 2UYOA 4F8JA 5D00A 2GDZA 3OXFA 3OEYA 4J1QA 3IKLA 1RZ3A 2ZQ5A 4JV5B 3TTWA 1OXMA 4BJHB 3WKDA 4P34A 4UU8A 5CAEB 3THXA 4G56A 1QNFA 4DLUA 5K05A 3L41A 1J22A 3VYWA 3CVYA 4M9CA 4LHEA 3UYLA 4JLKA 5FPKA 5GQSA 4J4BA 1OA0A 3IBCA 3K8YA 3R3SA 1Y0BA 4OL0A 2ERYA 1O4WA 3L0SA 1OCZE 1A88A 3INYA 4GPKA 3D02A 3RM3A 3QMVA 3JRWA 3X1DA 4NOMA 1ZG3A 1L5LA 1USKA 1UFVA 3BQOA 2BHRA 3WC4A 3C1UA 3K8ZA 1ES9A 4Y7DA 1GZVA 2AOTB 3MOSA 3OX1A 4HY3A 2COKA 1E2PA 4B8ZA 1QR2A 4WL0A 1V16B 4ARUA 4GKVA 3ERCA 4UZEA 4HMOA 2CYCA 4PGMA 2G9QA 1YR9A 2WSLA 2I5PO 2C4UA 1SQ5A 4M55A 4MR7A 3SZUA 1WB6A 3PX7A 1QWSA 2ONZA 3HCRA 1BPOA 4U7TB 2TSYB 5T3YA 2FN7A 4PYMA 1OYOA 4YO8A 4DX7D 3ZWQA 5HE9A 4OKIA 3FDHA 2ZSAA 1ZRNA 3AR9A 1ECGA 3COSA 4YCAA 4IIGA 2RMKA 4NBWA 4RORA 3IBGA 4R8VA 5AI4A 1R0LA 5EYLA 3CZPA 3NAMA 3OU6A 1TEHA 1RKUA 2C00A 1RLJA 2R7KA 3H87A 4KQWA 4ZXPA 3OJWA 1JAZA 2QNRA 1NMYA 3ANYB 5E1OA 4O6FA 5CTAA 2JLSA 3TUIC 4F56A 1MOPA 5ITZB 4LVNA 1YJAA 3HS3A 2AYZA 1KMHB 4KYVA 2BZGA 3GMIA 1ILWA 1C9JA 4Y7CA 1C1XA 3C3RA 3NHSA 4B4DA 4HXGA 4UOZA 1G4HA 3HYNA 5K9ZA 1XKQA 3R3VA 2XDQA 2PNFA 1DIAA 1UCFA 2EATA 2D74A 3F5FA 5A6SB 3I23A 4KHPB 1M2VB 2F0YA 2R6GA 3LF1A 2QD3A 5K3FA 3GJZA 2JD0A 3U4CA 3JQ6A 4AKHA 2WTXA 5ARCA 5LZ2A 3HXMA 5GM2A 4L28A 2LVBA 1UKZA 5TX7A 5DISB 3PV0A 4HDRA 3RO7A 1X70A 1RPAA 3EGOA 3P9XA 1QFXA 4OLFA 4DCOA 3JD4A 2I2FA 1ZQ1A 3C7CB 1NU6A 1AWCB 3L08A 5ALLA 1A3CA 1XALA 1OTXA 2O3QA 2EHDA 5A4KA 1ISGA 4US2R 4WY2A 2IVFA 3A1DA 4E08A 1G66A 1H1TA 3SVZA 4B2IA 1AOXA 1Z5NA 4X63A 3ZGLA 3NTQA 4G6ZA 2XHZA 2YJ4A 3RGWS 3PC3A 1YJ5A 2OV1A 3O1LA 3DH0A 2IXGA 4ZEXA 2J1LA 4EB0A 2LGJA 4J94A 3A25A 4YUXA 3R20A 3OKPA 5DHUA 1V5EA 5HRYA 4B8WA 5SY6A 4BPBA 5GADl 4I5GA 3EOAI 2CC2A 2BE7A 1OE0A 1DWOA 5FUMA 2P9TA 2ZJZA 2DFTA 3KDSE 3QVLA 4Y2JA 1UJJA 3FEYA 2P9GA 1N36B 2ADMA 4MQ6A 4RGQA 1TNOA 2I8LA 4L0QA 3AJAA 4LYJA 4ZAFA 1F0YA 4TV9B 4U95D 1VB3A 4YBZA 3KIPA 2HSDA 4TLEA 3LBNA 3TJMA 3QLVA 1DIRA 2Q3HA 4LRZA 1OLXA 4DRXA 2Q5IA 3TWXA 4AECA 3RK4A 1E9AA 2EFJA 4RPCA 1WMAA 3DZGA 4LMBA 4I50A 3GRFA 1J9EA 4F7AA 3ITNA 3I4LA 4QRIA 2Z1DA 3P9IA 2C3PA 2D0PB 1OCEA 1F0NA 3X1XA 2PQNA 3C4QA 5HUHA 1S2MA 1ULHA 2ZRQA 2PKWA 3H18A 3IJ5A 4PFKA 3NH6A 2C83A 2WJHA 3AI2A 2J6HA 3JRNA 1GVHA 1IY0A 1TZBA 4WVLA 2V98A 4D74A 3BTSA 1A5BB 4JYBA 3ZYZA 3VJKA 5FIUA 1GGEA 2DWQA 3MGCA 2C4NA 2NXCA 3ZU4A 2ZVDA 4ANWA 4A5SA 2I8AA 4LFBB 2ZJYA 2VCEA 3OOEA 3TBKA 3VGJA 4IIEA 4YV1A 3AETA 3TSAA 2WU3A 2PZKA 2VNIA 3CA8A 1II9A 2V3WA 4BVFA 4LHYA 1TECE 4WNYA 4B8YA 1X0VA 1NI4B 1FY2A 1QV7A 3L49A 3EJ6A 1A4IA 2XRYA 4KZ0A 5G4KB 4PC3A 2DZOA 4XLLA 3A3PA 4P4NA 3W9YA 1FFDA 2W2PA 2HCBA 3DZ8A 1J90A 2BKLA 2OCXA 4RQBA 3D3JA 4FJZA 4LQCA 5IDVA 2R17C 2AN4A 3LUKA 2FVXA 2V7BA 1PJLA 1BHSA 2VQ3A 5AW4A 3QAQA 3A2LA 2CUZA 1M74A 3PXBA 4GPAA 3KSMA 2PX6A 1N6IA 3OTHA 4JODA 3UKDA 1E8ZA 4ZYVA 5D3ZA 4IDEA 3D3QA 2NQTA 1WPRA 2PUDA 1VIMA 5LSAA 1N2EA 3DT9A 1X2EA 3U5ZB 3PZ3A 2PTGA 3SXUA 4TMTA 5HQ3B 3AUTA 1B3BA 3CIAA 4URVR 1RZRD 4RTLA 4MYSA 4M86A 2QWXA 2FJPA 3AKCA 1AQJA 2XW6A 3T7DA 2FFJA 4UU1A 2XYHA 2FF4A 3JQRA 1R6TA 2P8SA 5KAMA 3U7IA 2YZMA 4P4SB 5ANRB 2YC2C 2C59A 1E89A 3K8OE 4MCHA 1UFRA 4UBIA 5AJZA 1EUCA 1DEAA 3NEYA 3DNFA 4TVBA 3DDOA 5JTUA 3IKVA 1Y7HA 3TLYA 1PJCA 3O1IC 3ITDA 2XBLA 1W96A 5KSWB 4I14A 4JN6B 1R4MA 3T5VA 2GEVA 5IAOA 5JWRA 1MQ9A 2O3TA 1Z4JA 4JOBA 2CNLA 3C72A 2BV3A 3PWKA 3H13A 4MVJH 4BC1A 1DG3A 4AG5A 4XYLA 1IOWA 1Y6RA 4G0MA 1VBKA 4XX1A 1RZRA 1VBFA 2ZJFA 1UAGA 1GUZA 4KR3A 5GIPE 1LC3A 2C57A 1QCDA 1UK6A 1V4VA 1F5NA 1I1OA 5L6LB 4MULA 3KEGA 5BMVF 3I2GA 4Z0TA 1JEOA 3UWSA 4D2IA 3H9QA 5LJLA 3UEOA 5H02A 2ZUFA 1EFLA 1N2IA 4BE9A 4NJEA 1NW3A 2ZJ3A 3QWVA 4IWXA 2R0QC 1H05A 2WKSA 3AOEC 1MORA 3LUHA 4TRMA 4WY5A 4QXRA 4LJLA 2YWEA 3VX3A 1XVUA 2GASA 1NZJA 2B2CA 3BL8A 3PJDA 4HLDA 2X3FA 3DM5A 4L4SA 1GDTA 2GFIA 2H3EA 1Z8NA 5HILA 3PNBA 4PO8A 3ZZUA 1HFKA 1PJ4A 2A5FA 4QUBA 2M6RA 3T5BA 5P8WA 1JSRA 2JKYA 5CW1A 5J9FA 2C2ZA 2G80A 2QUKA 3BE5A 5CXQA 3IT1A 1SKUA 3L17A 1C14A 4CDNA 3J7AC 4PM4A 3TXXA 2A1TR 2FFBA 3RT1A 3CX4A 1L5NA 1PEAA 3FYUB 2VNKA 3D9NA 4GKAA 4DGQA 1NVTA 2EX4A 1TKCA 4B6GA 3K0CC 3VUEA 2CXNA 1IUKA 1FJ2A 4GYKA 5AKXA 3DNPA 4ZYYA 2AGVA 1DKOA 1KR2A 3JASA 4FC7A 1EFCA 3OF2A 5IZCC 2DPXA 4P3NA 3LPZA 3OCCA 2Q4RA 3VI3B 1RCTE 1XLVA 2ADOA 5C8DA 4AVXA 3TRFA 5AOVA 5IXSA 3KJHA 5SY4A 2VHEA 3AB3A 1VJGA 1DCMA 3HBFA 3REQA 4OG2A 3G8AA 3ZWVA 1C8LA 2CGEA 1E1QD 1XQXA 5LBIA 3QBEA 2A2ZA 3HBAA 3OF3A 4XX0B 4BX0A 4L5YA 2GTPA 4M1TA 3AI3A 3A2MA 5JS8A 1P77A 4KKXB 3OC6A 4QASA 3RT9A 1QYIA 3THWB 4HZUB 3RBAA 2C42A 2XUOA 3EY9A 3PNLA 3H7AA 4U0ZA 2NSLA 5KSOA 2LSVA 3ZIAD 2XQFA 4RUKA 2JLQA 4E4YA 3M6MD 4L4XA 1G1MA 2UZ0A 4ID9A 4LEUA 4BWRA 1EG2A 2BJHA 1QFYA 2X0EA 3CMCO 3SSMA 1B4DA 4WZBB 3OG9A 3EZNA 4P5PA 3K2IA 3DT6A 4DKXA 2A14A 5E1BA 2AI2A 4F1KA 1Q1EA 1RS0A 5AVVA 4Q96A 3FPHA 5BSTA 4B40A 1DDIA 2WJGA 2KJQA 3BD8A 2R84A 2VF4X 1GQRA 3VPSA 5EJFA 2WAAA 1SC9A 1RXYA 5JOQA 4ZCMA 1WUTA 4G26A 3NRBA 3S1LA 4BBPA 5T41A 4XZ3A 1XRMA 3SAJA 4Z9YA 1CQXA 1KAGA 3K16A 2WHXA 1UJKA 5JYDA 4WOKA 3BGVA 4YRKA 3N87A 2AT1A 4TS9A 1AS3A 3JARA 5BN5B 3RVDA 5CW2A 5EZYB 1B0AA 4HLUA 4I46A 1OH6A 2ISCA 4HPJB 3X3HA 1BQEA 5EJEA 2YVQA 5IZ4A 4HLNA 2Z5GA 4N8EA 3VSEA 5I7WA 4G9BA 1UDWA 5BO5A 2YFHA 1NXOA 1FYFA 2QN2A 1CTQA 3E7FA 1JLLA 1HFJA 4BXOA 4G0UA 4WXRA 1CF2O 3SIRA 2EKQA 2Z8ZA 4JB8P 4WZZA 5DMXA 4B3HA 1T1RA 1FFYA 5THQA 1PJQA 2P67A 4R1PA 3FB1A 3A9VA 3FOEC 1KK3A 5IJ0B 2C2WA 3BA1A 4RK6A 3HNRA 3CH5A 4BMVA 4EG8A 1GL6A 2NTJA 2ZWAA 4G09A 3WQRA 3ABLE 3PCTA 3M5PA 1BDJA 1I1QB 4GVLA 5AKKA 2QIPA 2F9LA 1GAQA 4YROA 3LZ6A 3AKEA 4UM7A 5KB3A 4MTLA 3NB2A 2XUZA 5LDGA 2Y0DA 3MT8A 3SZLA 1MMFB 1Z0KA 2B0CA 3RJMA 1I30A 2XITA 1ZGHA 2BLLA 4ENSA 3D3MA 2MINA 3M6LA 5EKQD 1PUIA 3K2EA 1H6DA 2IPMA 5BXOA 1OFHA 1O03A 3WGYA 4ZZ0A 1KLXA 2RAPA 3LHFA 3V1LA 3AY3A 4M3NA 2RAVA 4J8SA 1LPOA 3ZX5A 4R8RA 2EQAA 1NR1A 1QIIA 2JLVA 1F51E 4DSZA 3PDIA 1ZGZA 3U7QA 3RNLA 4EFKA 4ILGA 2FI1A 3DPIA 4JFRA 5EL0A 4JUFA 3UIPC 4K26A 4PZZA 3VZPA 5AW0A 4DWVA 4D9HA 4NAHA 1UPFA 5KQMA 3UGJA 4W9RA 5BYKA 2UVQA 1F8XA 5HM8A 1ZMBA 4AUKA 1U2SA 5CJJA 3D64A 3PT9A 2WMDA 2VPPA 5KJNA 2XUQA 3LXXA 5H7XA 4N4AA 4FMDF 4EPYA 1CBUA 4HVCA 2YFYA 1R4NA 3HXKA 5TIIA 1PL0A 5BSVA 3CLSC 3U9SA 3BMOB 2O4UX 4AY3A 3FBTA 3FPBA 2E5LB 1MA0A 5DTEA 3C24A 1R8XA 4LYYA 3WWDA 5D1HA 1R0XA 1W4RA 3CK9A 3JPYA 3FW1A 3ENQA 1B26A 1J0AA 2AVDA 3G89A 2XZPA 2Q50A 2GNPA 1Z26A 2AFIE 5DDIP 4QGFA 1IPFA 1ISIA 4I55B 3L4KA 3DSXA 3H6HA 5F4ZA 4FKMA 1BOFA 2X1VA 4RXUA 1F2UB 4LE0A 1E1RA 1SM4A 3ZWKA 4U2BA 1XP5A 3FNQA 1DAEA 1COWD 3IUJA 1PX0A 5JALA 2CHEA 2PN1A 1VMKA 4NS4A 2HSZA 3RUHA 1WRBA 3NYIA 1IBCA 3S7TA 3ZU6A 2F8YA 2WINI 3ZE0B 4CUZA 3E9CA 5HCUA 4EO7A 4LTNA 4TMWA 1E8NA 2MYTA 4LUCA 1X1CA 4G1BA 1Q0TA 3IAFA 5KNLA 2H5IA 2R7NA 2QG9A 4FFWA 3DHEA 1KQOA 4DE5A 1CY1A 1TRKA 4PFJA 2P9IG 3BWCA 3MTGA 3NETA 1MC5A 4ZOEA 4CM5A 2FP4B 4EHHA 1IXVA 4C1NA 5LYJA 3UPTA 2GSDA 3EZXA 2DULA 2CJWA 5DW0A 4D3SA 2W8BA 4FYHA 1MCZA 2C5EA 3Q98A 1JHXA 1DC7A 4M1OA 2BDEA 2W42A 2I99A 1COWA 4ATNA 4PLTA 1VJDA 4D1YA 2FZ4A 2WJVA 3RRNA 1JEYA 3OT1A 4EF6A 3VH4A 2VGEA 1G64A 1ENOA 1T2CA 4F4HA 3U4AA 4Q1EA 2WIFA 4QA9A 3TF5A 2QQ5A 1Z82A 4UWGA 3UT4A 4X85A 1L4YA 2W2KA 3TW4A 2Q2VA 2J8SD 5DEIA 1CUBA 5C1IA 3D9LA 3HGTA 4H77A 5L51A 3I34X 3T8KA 5JNRA 5B1SA 4ZXFA 1NP6A 4JLVA 3FHCB 5JSZB 1SXQA 2ORVA 5LYYA 1OFVA 4KQ2A 4B33A 1KS2A 2BTQB 3ZZMA 1H2EA 5FWDA 5J5AA 4MQLA 2XMGA 2V59A 2WNIA 4BN5A 2CL5A 1XMIA 4V0SA 4QQRA 2YHIB 1UIMA 3KVOA 3P71T 3O75A 4JGIA 4OMUA 2ID4A 2Q41A 3FM9A 3BE6A 3TJRA 4PZ9A 2W37A 3REGA 2IX9A 4IRUA 2LW7A 5DTMA 2V7WA 1G8JA 4IMIB 4ZGBA 1P29A 3RVMA 1AK1A 4IXMA 4RJKA 1E7UA 2I55A 3FX2A 1JTEA 3U44B 2KZTA 2GM5A 4EHDA 4R41A 2AZMA 2VHTA 4ZCQA 3WO1A 4TUYF 4PQGA 4C2UA 3P97A 4XUCA 3A37A 3P32A 3PQDA 1ZVKA 2J5RA 3FJ1A 3BILA 3A1TA 3CXRA 4BTAA 2H7XA 2MSLA 4KU4A 3BOSA 5K3OA 3O4RA 3MBOA 2JD1A 4WSOA 4L8FA 1ZVQA 4NCKA 4JOCA 3ROTA 3OJEA 5ELMA 3RYHB 1U8CB 2C1XA 4HX2A 4Q48A 2QN3A 1GPDG 1QG6A 3EOZA 1T9BA 2WUVA 2JJMA 1JH9A 4TUMA 3RHZA 2VJCA 4ZYLA 4JXKA 4F4IA 4TQAA 2XUFA 3UY4A 3L13A 3R76A 3H99A 1JHAA 2JCSA 2XKBA 5A5EA 4EELA 1OX4B 4JH0A 4DZRA 1N3LA 1FRQA 4G1MB 3N0WA 5D3MB 1WXWA 4DBZA 5KTYA 2M6SA 5BR4A 2X6KA 1EP3B 5L7TA 1QUEA 1SKAA 3AR7A 2H7YA 2H8KA 1QIJA 2FBNA 4LDJA 4MGZR 2B61A 3OQIB 3R0IA 4JL5A 1JZTA 2FZ5A 5FOTA 3HB0A 3HZHA 4MV1A 1AB5A 1AN0A 5TVGA 4F92B 3GP5A 2VP0A 3CNNA 3OPNA 1NJSA 4GTTA 2PD4A 1M8JA 3CVOA 3AF0A 5A6VA 4Q4HA 2AH5A 1DUIA 3Q85A 1KJJA 2VVTA 4MA0A 3SLGA 3I4FA 3VKUA 2IITA 1TQ4A 3LJ3A 3U16A 4UMFA 4R3UC 3TD2A 2GZHA 5IW8A 1GNPA 4WBNB 1W88B 2GAFA 3NKFA 2NT4A 3QMMA 1TNZA 3W5IA 4OA8A 1RPNA 3NT5A 4UQXA 4J4TA 1O7JA 3M83A 3HJFA 4LZPA 4IYRA 1JMVA 4EYEA 3BPSA 2VK4A 4GXTA 1XG5A 4GTPA 3DMPA 1VFNA 3RC9A 2HXGA 5HA5A 1KVTA 5FBKA 3PEVB 4UBMA 1E9CA 2FWNA 3FMIA 4KFCA 5CB0A 1Y9JA 2HV9A 1U8FO 2QZ9A 3CQCB 1CJMA 2Q5CA 3V31A 2AOTA 5ALYA 1UBOS 3FVVA 2QM8A 2BJWA 4LGCA 3TEFA 2BGKA 1TJNA 4MUJA 1KDYA 3E58A 1ISFA 1G5TA 1XVAA 2GD6A 4HQKA 1A4XA 1NBHA 5DX0A 2V4MA 2DX7A 1LBQA 4HN9A 4OQ4A 4L1BA 2OESA 4F4JA 3CLRC 3L8CA 2Q3JA 3R74A 1ZI6A 3MCTA 5TVKA 5HG0A 5J08A 1JQJC 4LRUA 3W9SA 1Z22A 1N9AA 2AKEA 4EDHA 1OWNA 4URUR 4X61A 3FU6A 1U0RA 1R0SA 3RF7A 2CDBA 1W4LA 4IQGA 3NHRA 5KJ6A 4X94A 3ZJUA 3JR3A 2HLDD 5K4AA 1KSGA 2X6IA 1K3FA 3T54A 3TZQA 3EYAA 1HKUA 4K6KA 4HNRA 1FDSA 1JCQA 5JS1A 1GT6A 5ITZA 4FDVA 1KMHA 3FDZA 2WA1A 3HJHA 2GGSA 3FUTA 3AY6A 2DRIA 1JVSA 1NQXA 3VC1A 4XTCS 1T4GA 2VYIA 4MA4A 3IELA 5FJYA 3N6XA 1FTNA 1EBUA 1PGJA 2J5XA 2Z43A 2QTVA 4OBXA 4PIPA 4M1YA 4LF9B 2PSFA 2M9MA 5A6SA 1ULTA 1M2VA 1JZSA 2VRWA 1TQ2A 3BREA 2FN4A 1WSWA 1E1NA 1V3UA 3P2IA 4EPTA 3T0GA 2ECOA 3CTMA 4C03A 4QT0A 4M9SA 3HB9A 2AK3A 4EVIA 3EZGA 2L42A 2C7QA 2HLDA 2PKRA 4H7DA 4CR8A 1IPHA 2F90A 4F38A 4JITA 2RAFA 1UEIA 1YB7A 5L53A 3BG0B 1UXKA 5FLXA 4R2WA 1SIUA 1C5KA 3QWAA 1DBVO 1W2GA 1V3QE 3WG7E 2P9CA 4FYMA 5LB2A 3V1YA 4R8LA 4K28A 1GGFA 4QUHA 3BXOA 1XJCA 2IUUA 4ZZ2A 3T5XA 5IJWA 4NE9A 4B3DA 2PUVA 5HRCA 1QK3A 1BDBA 3LQ1A 3T9EA 3A1FA 3D9PA 3R40A 3UQ3A 2LCFA 2FLKA 1FTGA 2AC2A 2VL7A 3UWKA 3JAKA 5FI3A 2WJ4A 4JI2B 2WHEA 1W87A 2HB6A 3G79A 3ZGYA 1HPLA 1L9XA 5JAHA 3DMTC 5EUQB 2K5UA 3DMGA 2DCUA 3ZN3A 3RIHA 2D2VA 4J29A 1A8UA 2IYPA 1PS9A 1N4SA 3FMFA 3AG6A 4KR7A 3PFFA 4JEHA 2AF4C 2IHUA 3EMDA 1O8CA 3PGA1 4HH4A 4M88A 4TV9A 5C37A 2XCQA 4IJKA 2JIZD 3LG2A 4MYTA 4B87A 4BKMA 4PH4B 3R3ZA 4N40A 2OSBA 4C3UA 3RBZA 1CIJA 2V3VA 4NMLA 1KH2A 2PAFA 2OECA 2VPIA 2J5BA 5DKFA 3RDPA 1LCIA 1QAOA 1KGSA 4YECA 4HAUA 4MARA 4HGOA 2B1RA 2WWXA 1TR4A 1UK8A 2IPAB 1GQQA 1HZZC 4GC9A 1KAOA 4NFHA 3A1CA 2PL2A 4L3OA 4Q1BA 5JBNA 3PFWO 2VT2A 4FOPA 1I51A 3FHTA 3N2ZB 4GMKA 4IUDS 3UMVA 5E8RA 5LP6C 3OWHA 4DLPA 4YRSA 2BL4A 3STVA 1XF1A 1N0RA 1Y33E 2XPYA 2IT1A 3EAQA 4I9GA 2SBTA 4AK9A 2BI4A 3RS2A 1W2HA 2W6ZA 3IODA 4BTEA 4IPTA 3DP9A 1KYYA 2C5GA 3DJYA 2JIZA 2Y9MB 1L7AA 2PMBA 2AFIB 4GCNA 2C2XA 4HI0E 4HMQA 4PDXA 3SPXA 1MRNA 3E8XA 3RSLA 3EBPA 5AQEA 2WJ3A 3TTTA 1LI7A 3FSGD 3Q11A 1NI4A 3PWTA 4J76A 3SYTA 3HBMA 1CUFA 4MAMA 1Y3HA 4R0MA 4D8TA 3CGWA 3U3ZA 3P9QA 4W5WA 5G4KA 4RK1A 1M9NA 4XEHA 1B2LA 3MFYA 4K9OA 3D7MA 3OY7A 2G5TA 3H5AA 4JBWA 4IV0A 2PGIA 3AFMA 5BVHB 4RIIA 1TNYA 4PZ0A 4LRWA 3OICA 2R8PA 2D1SA 2AZTA 1CUIA 2B3DA 4EFMA 1GHTA 3JPWA 2WUEA 5KU1A 2HUNA 3F9RA 4MKTA 3BDAA 2ZRKA 5LWQA 5JFGA 4RXMA 1W7AA 2P7IA 3GUZA 5IN4A 2JIMA 1I94B 2AXZA 4RLSA 3R7WB 2XD9A 4MKGA 4AP9A 1T2EA 2B7CA 2ZRFA 3GLTA 4GVPA 4GI5A 4WE3A 1D0IA 2AEFA 3FSGA 4GOLD 5HQ3A 4TS4A 1E3LA 2W6PA 1HG0A 1GV1A 2EGGA 1W6UA 1FFHA 3UMGA 1MGOA 3FDXA 2HQRA 2CV0A 2Q4DA 4DIMA 1QPZA 2MYUA 1M72A 1H2VC 5ANRA 4XSVA 5KVCA 2XUAA 3MLBA 2EZ8A 4D96A 3SZRA 4NBKA 3DR5A 3DF9A 4AG6A 3V8QA 4O1IA 1DXYA 1UUFA 5YASA 4YLGA 1PN3A 3LJNA 2CK3D 1TLTA 1FS4A 4B32A 2BBSA 4ARIA 5KNCD 3AH8A 4LSZE 5ALZA 3COZA 3N75A 4AKIA 3IP9A 3TQOA 1PL6A 1NQVA 5B1HA 3AG3E 1SHLA 4KPFC 2WFZA 4OHMA 1X81A 1COZA 3DB2A 3OVMA 2HGSA 4PLGA 1SU8A 3LX6A 2OOSA 2O1EA 1DTSA 1GPWB 1ZINA 4MP8A 3G0BA 4HOQA 4F60A 3MTIA 5G02A 2OGZA 2FEZA 4AU1A 4UBOA 4CZ2A 3OIDA 1UN9A 1HDGO 5LWHA 1E7QA 4CE6A 5HRAA 4B71A 1X77A 3DE5X 3MERA 2R7MA 3GW8A 1EMDA 4QLOA 4KPYA 1AUVA 2MTBA 3OPVA 2Y92A 3D9QX 3UGTA 4ILHB 4TTSA 2QP3A 4BVAA 4NRHB 2YJ5A 3L22A 4RGVA 5ALDA 3A9TA 2YHCA 1WKBA 3NCTA 3ICCA 3MMZA 2YNMD 5ALVA 3DQZA 3IAAA 2V54A 4WOPA 4XIIA 5A4JA 1SVOA 3KYDB 2ZBFA 2WI8A 2UY1B 3BF8A 3BIOA 1LX7A 1TAQA 4IFBA 3IS3A 3SVLA 1T1SA 1DAMA 1QX4A 1FQJA 2XV1A 1U0NA 2X0FA 1SXJE 4MROA 3KQSA 1MOQA 4WMLA 5IC4A 4LZJA 3FXAA 2W2NA 3RUCA 3BERA 3CG0A 1RC1A 3AEQB 2PV0A 6Q21A 5FBLB 2IQIA 4HRXA 2C3YA 4MYHA 4AQ7A 1SG9A 1P0PA 4I17A 2ZBPA 2XHEA 3ND8A 4ZOQI 5EPOA 5ADUS 2WTAA 1LSUA 2K87A 4JT4A 2F8TA 4PYRA 2X0NA 4CF7A 3CKMA 2VXYA 5ICCA 1ICEA 3RW9A 1R0CA 2B2XA 3A27A 5DXAA 4XX0A 3KKQA 3UICA 4QOHA 4P36A 2DHEA 3EFHA 1RMQA 4ARBA 2NVUB 2XQVA 5G55A 5ALOA 5BQ5A 1J8MF 2HEGA 3THWA 2RSLA 4HZUA 4FULA 5HKPA 2C8KA 2XOKD 2H6GA 2IYWA 5JSFA 1E0AA 4RIEA 3WA6A 1P3Y1 1W5AA 4URFA 1PS0A 1G3NB 3JSAA 5EPUA 5BW6B 1T9GS 5AOCA 2H2AA 1Z15A 3L0OA 1YCGA 5I5EA 1Q7TA 3RWMB 3DLTA 3K9WA 1RXUA 4UJ5A 4WUYA 1ESMA 3E3OA 3KXPA 1C3OB 5T8KA 2YRXA 1H4QA 4WZBA 1VXRA 1CDZA 3V5NA 5GJBA 3IB6A 1L7EA 3PUZA 5HM6A 3IXEA 3JCKC 2GCOB 3HFRA 4DR6B 1ZUNB 4TMFA 3TX2A 3WLAA 4BNKA 3CIFA 1N7JA 3D9OA 4JWTA 2CNOA 1GSHA 2QPAA 1GFZA 1FP7A 1WQ4A 4OJYA 4Z1MD 2MSWA 5FL3A 3EDTB 3UWPA 4H35A 2BGNA 2BKAA 2IZ6A 2PD3A 5FPQA 5L3QB 4WX2B 2ACWA 4RS3A 3UMBA 1G8KA 1L4EA 1JDTA 1OLSA 4EMSA 1HURA 3N74A 4PZLA 4UEOA 4F4CA 3L7CA 4AMUA 3D31A 1BE8A 1Z0IA 4BLOA 2QRPA 4LEIA 4EL0A 2OBMA 2Q5OA 5BN5A 3QK0A 3TZKA 1E96B 1DCEA 3L0IB 5EZYA 5FWYB 3WDKA 4BRZA 1DB3A 2AQKA 3P9RA 3RYCA 5DBEX 5EIBC 4PAGA 1EFUA 1SRRA 4JPSA 3PTZA 4QDUA 3G9QA 3UK7A 4MUEA 1W29A 3P7MA 4DQKA 4Z86A 1GITA 3G82C 2IZOA 2E1PA 4DCNA 2P79A 1GRVA 6LDHA 2ZJ6A 1ZNYA 3SXJA 4ID3A 2AEMA 5KNHD 4M7RA 1BMFD 4RLYA 2Q7DA 3ZE6A 1KZOA 1XGKA 1EH5A 1PW7A 3FCYA 3CRRA 3PZBA 1E0DA 5H83A 5LQSA 2IJGX 1MEJA 3UH0A 2B9EA 2YCBA 1BRMA 3F90A 3I2KA 1NM5A 2Q3CA 3ZQUA 5FWNA 4C7KA 2EEPA 1QH1B 5FZRA 4JU9A 4FADA 2IEJA 1ZDMA 4Y98A 1ZVJA 2EJVA 1W36C 1EE1A 2PHZA 1LKZA 2GWRA 1MH1A 3PA6A 2VJNA 3E9YA 4IDHA 3ROMA 2HI0A 2XADA 1Y9EA 3U19A 4DG5A 1D8TA 3JWGA 4P58A 1SBNE 2YUTA 2CBXA 3E2IA 3K31A 2R1ZA 4JBGA 3KYBA 1BMFA 3FRJA 3UM9A 5EAIA 1QYRA 2CMHA 4QUJA 1AXEA 1IEXA 2QAGC 4PX3A 2Z2JA 2NU8A 2W83A 1K7FB 3KAJA 2E82A 3WZLA 4PCUA 4H16A 1RE0A 2CVHA 2ZWOA 1DC8A 3Q4AB 2G7MC 5LOVF 2C31A 4APOA 1J7JA 3GUYA 1JS1X 3FNEA 2OCLA 2JFFA 1OTYA 3P0HA 3VPDA 5ABPA 4BNJA 3T1OA 5CFZA 3OM8A 1MYOA 4H4CA 2IXEA 3JQBC 1XT6A 1QRUA 4JAVC 5B58C 4UBKA 1ABFA 1XDDA 2OUKA 2CF6A 3GGJA 3ZD6A 2YWHA 4HDCA 3OOYA 4AJ9A 3U4MA 2DBRA 1T43A 5HZKA 4PLZA 1O0SA 3CR3C 1KZ9A 2HBQA 5BT8A 4EAAA 1BS1A 3ZV7A 5KQRA 4D26A 2AR0A 4I55A 4K46A 1VIYA 2QR5A 4K9QA 5T3RA 1ZD8A 1F2UA 4BO1A 2GZ3A 4TQ9A 2HJRA 1H2HA 2XS1A 2ETXA 4HRVA 4O1HA 3SVTA 1E63A 2BR4A 3IEMA 3E5HA 1T6XA 3AL0C 1EWYA 3DXKG 3EQ6A 3LI2A 3TQIA 3LX4A 4PLHA 3Q41A 1WLSA 3JQAB 5AVYA 4GZ6A 5KPJA 2W4QA 2GBCA 121PA 3FWNA 4L0DA 4FZ3A 5AJYA 3WGUA 4FBGA 1JWFA 3ZHEA 1NFRA 3FUIA 5JAOA 2QN9A 4AV7A 4RLHA 1WUHS 3GLQA 1HMPA 1JFLA 4NU0A 1WG8A 1ZLYA 2V9ZA 4DCCA 4K9MA 3WLIA 3WWPA 1DIGA 5JXHA 2FP4A 2ZJ7A 2P77A 3HB4X 3WYGA 4OSOA 2B6NA 4MWDA 4GAEA 1OXTA 5JS6A 4DX5D 1HE3A 4TM8A 1NUPA 2CHZA 4CF4A 2C2YA 3ZGVA 1RTKA 2XTJA 5TQ0B 3EGDB 2P91A 3QXCA 3EC1A 1KNXA 2HRZA 2YUIA 3GCDA 3RLFA 4G1EB 2IBSA 4A0GA 4TV8F 4E21A 2G28A 3JYOA 2I1LA 3TL6A 3HB7A 1NRXA 1VI2A 1GEGA 3KSZO 3PBKA 3NIDB 5B1YA 4BGEA 1XJQA 2XLBA 4MVJF 3STHA 2WWGA 4BB6A 3IL2A 3UW3A 5JSZA 4IJVA 4FMPA 3EEBA 2BTQA 2WM9B 4LBVA 1G5IA 3RAJA 1TNBA 1Y6GA 4JBHA 4W7SA 3W3AA 2VA8A 3CXUA 4HPWA 4F04A 1WBJB 2L17A 1L9KA 2KMLA 2WR8A 2RGGA 2PUBA 2O2GA 3LBAA 5BVGA 3P2KA 3B1YA 4G5OA 3EQ2A 1S8FA 3U44A 1VGVA 5EJ5A 4BFTA 4BNUA 1CF9A 1W35A 4NNOA 4E70A 4HI8A 4YRTA 1S4MA 3GK3A 5F52A 4RK4A 4CJXA 3TPZA 3EPLA 2FUKA 2CFTA 3FSJX 5JA4D 3KPVA 3CNOA 4RMGA 1HFEL 3DBLA 3O8CA 1PVVA 2FLVA 4RTMA 3GVHA 1YS7A 3DR3A 5EA2A 4D9CA 2Y1OA 1V55E 2PU5A 1Z17A 1YRHA 2QTLA 3HL4A 3HKCB 3RYHA 4BAGA 2JI8A 5TJ9A 1VGQA 4ENQA 2WV9A 1TUIA 4L9RA 3ZDEA 3MXTA 3VR3A 4HDKB 3GGDA 1WXIA 4HS2A 3Q8LA 2INGX 3VH1A 1C1DB 2Q8QA 3LC1O 3X1ZA 1RWNA 3ESKA 1NBAA 2HL6A 4OXQA 3SQVA 1OX4A 2VR1A 1EXWA 2YQ8A 4BV2A 4CMEC 2A0XA 3W0LB 4WLEA 5D3MA 3WDSA 4XVQA 4Y30A 2IOQA 3DEYX 2H63A 2BH2A 3I42A 3ZI7A 5EMHA 5J2UF 3S40A 3BQ9A 4HP8A 5B1BE 4JC0A 13PKA 4E2ZA 5F3WB 4LQ4A 1T4CB 2NV2B 7GPBA 2Z83A 1X80B 4LYAA 1NPTO 4XTRA 4FOSA 1ZJYA 4GX0A 4M7OA 1P0QA 1YOBA 3HADA 4O33A 3PFIA 1ISHA 3KXLA 3DT8A 4MUXA 2UVDA 3C3DA 3UAYA 1RT9A 2BFNA 3G2IA 5I9BA 1YBHA 2PKCA 1UZMA 3FF1A 4G23A 1SXJB 3KALA 1RFLA 2I7DA 3OI7A 2EV9A 4RGBA 4YVQC 1TNDA 4KVOA 1PGPA 3RRXA 4DABA 4EDFA 4ENPA 1IZZA 2G83A 1CUCA 1W88A 4JSTA 4GECA 5BW4A 3LNCA 4YLYA 5KTNA 2NLOA 4FK8A 2JH9A 4M0MA 4N3AA 3I9NA 3NPMA 4J0CA 2XNJA 1OXXK 1P18A 4UQLA 4N5LA 2R8BA 1Y3DE 3R7DA 2W2OA 3LT1A 4OVKA 1J1ZA 3NF1A 3OIFA 1IATA 5LP0A 1ZITA 3RQIA 4RKEA 4UM9B 1KK1A 4BLSA 1DGQA 5T7BA 2Z04A 4UBNA 4DI4A 3B13B 1A9YA 2HFJA 4TROA 4XWWA 1V7ZA 1ATIA 3MTEA 2HC9A 4TSKA 2O8CB 1N34B 3LWDA 2ILVA 1HOTA 2O4CA 2LIPA 2UZ1B 4MLDA 4OAPA 3LC0A 1N4PA 3RC8A 5LZ5A 1Y4UA 2QR3A 1W30A 1R00A 3HXBA 3A6KA 3R75A 4ZAXA 5EYPF 3U9WA 3ASYA 3OJLA 4IDNA 5C8YB 3LK6A 3QW4B 4EENA 3ZDDA 4FFDA 3QVKA 2ZWPA 3NS7A 1Q11A 1IVYA 3MD9A 2RGNA 2AN9A 3QJGA 2Z9CA 1UJBA 4ESVA 3EGWA 1IFXA 1OCCE 2FO7A 3FUWA 1JA9A 1UC5B 2YVUA 2XCOA 1D1TA 5DTRA 5FZSA 3SQWA 4ZT5A 3YASA 3QIVA 3E9MA 4LJYA 4RVSA 2NP6A 1WTAA 2BELA 1C8KA 3GNSA 1CUHA 1V25A 1IBRA 4ZOLB 2Y0BA 3H7IA 2I33A 3RC3A 2HH9A 3FU0A 2ZP1A 4NLLA 3JQQA 1IXYA 1N7HA 1EK1A 4DIKA 4RGYA 2K7ZA 1ZMOA 4ND8B 2CFZA 3FJYA 3FOFC 2NG1A 5DW3A 3UI2A 4MXDA 3CMMA 2MCFA 5HWSA 1EA5A 2QTCA 3LE8A 3UIOC 5AIAA 3PXEA 3H8JA 2IY7A 3M4JA 5BV1A 1GD1O 2XRMA 2A84A 5DTQA 4L76A 4QGGA 3G8BA 4NCJA 2YICA 4HGZA 4CL2A 1DC5A 2C5SA 2XY4A 4YAOA 2H48A 5L3RA 3ORQA 1UM9B 2ZU6A 4JNCA 1Y9DA 4YS6A 2GO1A 4INZA 4ZMSA 2FEXA 1YA8A 3CUVA 1ZNXA 5G0WA 1WUKS 4I5IA 2TMDA 1DG1G 2FSUA 1HFWA 3I52A 2O05A 5FTJA 1T8RA 2EX1A 1N0QA 1M33A 4QWMA 3VC2A 4MRSA 1WU8A 4M1ZA 1F6BA 2J7PA 5F1KA 5LUBA 3AXSA 3G13A 2V5UA 1F7UA 2IXFA 5TEVA 4Z9BA 3DLAA 2VAPA 3LLMA 4XR4A 3DW1X 1XPOA 4IRXA 1TA9A 3WGKA 1HM5A 3N2NA 3CJRA 3OQ1A 2R6HA 8AT1A 1HH4A 3EFOB 4H27A 1YKGA 3ZXXA 4ZYWA 1IJFA 1VCHA 1ZB1A 4RVHA 4BO6A 8ABPA 1N2BA 3EIUA 1OT5A 4IIJB 1IHBA 3LVQE 5CB8A 2Q6KA 3K09A 1M1UA 1FDOA 2GRAA 4C0MA 1U0HC 3EX7C 1CUSA 3SWWA 4I9NA 1UDXA 2ZR8A 2E4UA 2C4KA 1QZUA 1LZLA 1NKSA 3LDUA 1G59A 4TTJA 3V8RA 1NVWQ 3FOZA 1SU4A 3W2GA 3A58B 3QRWA 4E11A 4BEWA 1ZIDA 1JHOA 1B42A 2W6NA 4BMCA 4ZZ3A 1DAHA 4UUNA 2PGAA 3K9NA 5DU2A 4A82A 4R3WA 3QUAA 5BQFA 4U2FA 4KZPA 3IP8A 3W6NA 4HDSA 1CY6A 3CHMA 1WV0A 3VTAA 5AVTA 2A5DA 3WLJA 4O2BA 1KZ1A 4BNXA 4B8AA 1P2FA 1RKBA 1TTHA 3KTDA 1GR0A 1MEEA 4TZ6A 3V8NA 3W2EA 1P31A 5C1PA 3UK0A 5L3ZA 3T15A 4BLVA 2Q2QA 1JG1A 4A63B 4IDPA 2IS4A 1T3ZA 3OXLA 1FA9A 1ID1A 3MB8A 4C0JA 4V1CI 3TRIA 4V39A 3GV0A 3PNYA 1Z6YA 1IDOA 4GLBA 3RJVA 1H9BA 2AFIA 5A9TA 4WY8A 4GDMA 3V4VB 4UFOA 1UXGA 4U7HA 4E94A 3O8RA 5AMXA 1DBQA 4RMNA 3NW9A 1JG2A 2GEFA 5DYWA 5J40A 1PEYA 2WT9A 4RD1A 1XRLA 4PRYA 3T5GA 3DE6X 5TNXA 3LXMA 4C4SA 1DQSA 4AZWA 2WPVA 1Z7EA 4EYKA 1W46A 3F71A 1M1NB 1GPLA 3O0DA 1KMQA 1Z5VA 4PSDA 5BVHA 1CY2A 3V97A 3SDZA 5ENRD 1UT6A 1XXHA 4F7DA 1YE8A 1TN8A 2NO7A 1MA3A 3EGCA 3QKWA 3PXDA 1G42A 1KPGA 1XTIA 5JSUA 3U4QB 3WXXA 4ENWA 1AKYA 3TIFA 4U3JA 3I73A 1LPSA 2GGFA 5IVIA 3BMQB 3TWOA 2O0HA 2P4QA 2PEZA 1EX9A 4J91A 1MXHA 2H1RA 1DBSA 3GJYA 4D4LA 2FXIA 3LYHA 2AN3A 4DY6A 3RSSA 3BZUA 1MKYA 4NWIA 2NVBA 2ZRBA 3E48A 3UMSA 3PNKA 1INZA 5AFSA 3PDJA 5ICGA 1Y1PA 4EY6A 5IWAB 1KZ6A 4OQNA 3MINB 4LV8B 2Y4UA 5CR9A 1X3SA 2Q3MA 3AU5A 4EEZA 4J0HA 2REOA 4U8YD 3RSFA 4BNHA 2RARA 4NBSA 1KZ7B 4ZVMA 3CN9A 2QV7A 3AC0A 3FG9A 2V65A 3B7UX 1XTTA 4U2CA 3MK31 1L7DA 5HYVA 4BLRA 5K8LA 2H1HA 3L7DA 1T6NA 3ABKE 1RW4A 3EPHA 3MWGA 4Q3KA 4V0LA 2XPCA 5C9ZA 4K05A 4C4OA 3IAHA 5C5IA 3VISA 2REQA 4FBMA 4ZQIA 3QI2A 3A4LA 4ZVRA 2YIDA 3U60B 4X1IB 3KG2A 5CLQA 4XB2A 5DHTA 1MZPA 2EVWX 3KB6A 4OK5A 1LRKA 3GVXA 4RF4A 1E1RD 2F48A 3D2LA 4Q3AA 2P2ZA 5DJ5A 4NAUA 3L6UA 4P84A 2OFFA 1UMCB 3WL3A 3G6WA 3R24A 5G53C 1S8AA 3ZKAA 2DWCA 2H1LA 1PNOA 2A0WA 3PE3A 1J5XA 3FLMA 4MW0A 3AR3A 2I3DA 5T4HA 5EX3A 1NI1A 4YVFA 5FEMA 2CXOA 3UB2A 4MEBA 4K8RB 1ZRSA 5AKLA 1EUYA 5BN3B 2F7SA 2PZGA 4Q3LA 2G5PA 3V46A 2DOKA 3KYDA 1E2KA 2HR2A 2FR1A 1SCJA 1A72A 2UY1A 2PYZA 1T9HA 5JAIA 1IWOA 1IL0A 1VG1A 4G1FA 2HU8A 3ON5A 1NZNA 4BZZA 4YRQA 5DGDA 4FP7A 4XJTA 4CT5A 4LZLA 2Q7OE 1HNNA 2BEJA 1OH7A 3M3HA 2R9VA 4CQLB 1EVZA 5BY2A 1NDUA 1AGPA 4R0NA 1XZIA 2XF2A 1YRYE 3PFNA 5HIIA 4H1VA 2WF7A 4JJKA 3O82A 1FU4A 4B17A 3B3QA 1PJZA 2XZLA 1EB9A 4JB8A 3CEJA 1DOZA 3JZMA 3ZYCA 4MLZA 4DV4B 4EHFA 4EG6A 3MELA 3PEUB 3MS2A 4UCQA 3NP9A 1RQRA 3G7NA 1GKUB 5IEJA 3DYVA 821PA 2AVPA 1U0BB 5GAJA 5HGXA 1IG3A 1NRJB 5EIDA 3HJUA 1CQPA 3MJEA 5GONA 3HEBA 2PX8A 1DT5A 2GLUA 4NK5A 2VSYA 4IILA 2WTNA 3C6QA 3TOCA 1JPNA 3AV0B 3RCBA 4NECA 2J4FA 2CHGA 1ISJA 3NHUA 3A4YA 3LKZA 3OUUA 2IYLD 3HB5X 3QOUA 2IYZA 4C7XA 2GPNA 3UVEA 3HY6A 1N95A 4RIGA 1K8QA 2LUOA 2ZAGA 5LFAA 4OM7A 4ZCLA 1Y9AA 4AQYB 2ENWA 3O3CA 4CDRA 1KE1A 1C3OA 3K0AB 4MWEA 4P5DA 1Z4NA 4PS7A 4BN0A 1DU4A 3L4SO 1JQ3A 3NZUA 4J43A 1GPH1 2OHVA 3CQGB 1LFAA 2BEUB 4YASA 5AQ1A 1ZUNA 4M9QA 4EYSA 4ME6A 2VDLB 2P5YA 2IDMA 1UBNA 1IN6A 2R4TA 4ZVLA 4P53A 3RHTA 5JFOA 2V7XA 1WHSB 5B7NA 4MNTA 3LF2A 5CURA 2ID9A 4PPGA 1Y7TA 1HQYE 1DBPA 5L3QA 5I7EA 2H2IA 3PIIA 1Z2OX 4UREA 3IPCA 1BGVA 5G4LA 1RPJA 1I6KA 4AWAA 3DFZA 3CNEA 1E1MA 3H2YA 1KI7A 3G6KA 1G0OA 1FYWA 2DLNA 1NZDA 4EOGA 1B74A 1V9CA 1LTKA 4FFPA 1NV9A 3O0TA 2HTEA 1E96A 4HF7A 5FWYA 3L4BC 1D9SA 4WBSA 3E4DA 1DG9A 4HPXB 5EPEA 3C1OA 3NANA 2DCPA 1X1EA 1NBME 2OKGA 2H2WA 4RK7A 1KFEB 3BDVA 3W5JA 1H0SA 3RFFA 4CL3A 3WGGA 2YXEA 1GCUA 2ZB8A 2XNDD 1BJTA 2O14A 1A8SA 3E22B 3EXIB 3ZV3A 1TVKB 3L7MA 5A9SB 5C35A 1FSGA 2JW5A 3MVEA 1QC5B 5K3DA 1K98A 1VL1A 1F2VA 3F5SA 1KY3A 4I5EA 3CZRA 3V7YA 4MUBA 1O6GA 1SUCA 5FV7A 4IDGA 2OQRA 1KQ3A 1TRHA 1PD1A 3QPCA 8GPBA 2QL7A 1JJVA 4FDAA 4N0QA 1DVPA 3I09A 1B1AA 1V11B 2XB6A 1NLZA 1O1RA 4NMXB 3PVCA 2RKBA 1XNGA 3JQPA 2ZI5A 4HGYA 2RC5A 4WEQA 3O21A 1ZU4A 4WNGA 3HVEA 3BMCB 1FSSA 3GLFE 4BNNA 1DP4A 4HNTA 2XNDA 2ZS9A 1XN4A 1I3KA 3UOGA 1EHCA 2O2HA 3OZCA 1XJ5A 4DK5A 1EINA 3GRRA 3VZSA 1OPXA 4CDMA 2JFUA 2J9RA 3N0TA 2CJXA 3KKMA 2VHCA 4PRKA 3SC4A 4JLDA 4DILA 5CAEA 3Q87B 4E2XA 1MIHA 2O9JA 3KAKA 3OOJA 5JR3A 1NVEA 3GCZA 3TPCA 4FMCB 3HY3A 3RGGA 5EMKA 3OOWA 4Z2YA 3I9MA 3ZHXA 1X38A 1P2SA 1R10A 2IE8A 1KFCB 2MYPA 4HNVA 1IWPB 4QFDA 5KWDA 2ISQA 4ALJA 1R27A 3UJ3X 4RZ3A 2YDYA 5BV7A 1B1CA 4WV3A 2H1OA 2B34A 1OR8A 3G9ZA 3QE0A 1NE2A 3TSWA 2O3JA 5CVTA 3KFLA 1V5FA 3WLPA 2AOVA 5FUBA 3SS7X 1KAHA 4YJHB 4QRDA 4L73A 1V16A 3QNWA 3CLHA 4MJ3A 1OF1A 5DYGA 4ZVNA 4QSHA 3QB2A 4KI0A 1ZEMA 1MTOA 5HKBA 4P4LA 1V6SA 1IJBA 1QUFA 3Q7IA 1U5CA 5F21A 1HTWA 1K5HA 4LF5B 2NXPA 1N2SA 4FNGA 1MN6A 4KR6A 3RODA 2ORYA 3K70B 3EC7A 5AJUA 3F4LA 4BJ6A 1JPUA 1QTRA 2JFOA 2OP1A 1N9KA 1X74A 3V2UA 3SZGA 3JQAA 2CYAA 2FRDC 1WSAA 4Q3BA 2EXXA 1AMOA 2FQ1A 2OBYA 4O59O 4PPQA 4PSAA 2X2PA 3TZLA 2ZB3A 2W0MA 3BUSA 2DFNA 1JT9A 3T1QA 2GRQB 1QBQA 1UJMA 3FETA 4MEAA 4GPEA 4BX9A 1JIUA 4DNFA 3KR0A 4I1VA 2QTFA 1ADCA 3PK0A 4GLFA 4ZO4A 4L8GA 1L8XA 3WDMA 4EGSA 3ONNA 2Y68A 4LNBA 2IP2A 4PLCA 3V1NA 1HO8A 4EUFA 1TVMA 3ZJTA 4K6HA 4DMKA 2HD4A 4J1TC 2J3MA 1R3UA 2XUHA 3HCWA 5TQ0A 3EGDA 3QOXA 3H1TA 4D4MA 3BQNB 4G5QA 4Z4CA 3HYRA 1CZLA 1RIFA 2QTBA 4B84A 1KEEB 4V0QA 5BWNA 4AICA 3PQFA 3FEXA 4AP5A 2GCNA 4L6CA 4DCUA 2ZDGA 4LOIA 1XDBA 4QPNA 4F97A 3KT0A 1XD9A 4Q66C 1WDWB 3L6RA 5JZOA 1TZJA 3UKUG 3R1IA 3D6MA 1AKRA 3A4VA 3LLUA 3WYCA 1I80A 4NU5A 2EZUA 3EASA 1V54E 4EITA 2WM9A 1N2ZA 4CIYA 3RO3A 2XIJA 4V2UA 5F9FA 3FVRA 3GBSA 2FOLA 1E94E 1E6WA 2O57A 1L4KA 2PA0A 1NXQA 4BFXA 4I7EA 2CXHA 3V8EA 3BWXA 3VPFA 2YJTD 3HM2A 1YU6A 2NU9B 4NESA 4KRFA 2ZJ5A 2IEZA 4BDTA 1YL7A 1KMIY 1NMQA 4W1PA 4WXYB 1N5IA 1VPLA 4WXHA 2GYYA 1M2HA 3TTYA 3VKGA 3LOQA 3UJ9A 4UTXA 1J0DA 4J6EA 3NGMA 4O5AA 1U99A 3VO8A 1L6RA 3SJAA 3M3PA 3TCKA 4II3A 1C1YA 1SBTA 3LW7A 2J85A 5KYTA 1INLA 1Z3YA 1ST2A 1HRKA 1J1IA 2VKTA 3HKCA 3L8YA 1U5AA 5LMZA 2XQKA 3P20A 4QXOA 2X4GA 1V5WA 1TGVA 3E30A 2QP4A 2VBCA 5KCMA 1VSVA 4YDEA 1X5BA 4V0KA 1SUWA 1U3DA 4HDKA 1OI2A 2RH5A 1RI3A 1YL5A 4IQ8A 4QJBA 2PH3A 1C1DA 4M76B 5GINE 3II6X 3HVRA 1E6UA 4ESOA 4EHNA 4MMXB 4HN2A 4ALMA 3WDLA 3QLEA 2GEKA 4HZGA 3O3NB 3QKSB 2WQHA 4JEMA 1VI5A 2P2LA 3ZU2A 4C6TB 5MGNA 4G1VA 3UO8B 3UN1A 4YCJA 3IT3A 3KSBC 2MR6A 4Z9FA 5B6PA 1T4CA 1S3GA 1X80A 1YJXA 4ENVA 3RARA 1HLDA 2WJIA 1Y5IA 4L50A 3FCEA 2BCJQ 4M1WA 3TM5A 4O1MA 2W6MA 1PJBA 4UM9D 3H4IA 3MHTA 4Y67A 2NSZA 1SEPA 4LQLA 3VFDA 2VJQA 1J0BA 4GU5A 5HK9A 1A0OA 1SXJA 2ATVA 2B1JA 3A14A 4S1VA 3TINA 4Y2QA 2G9ZA 2HSEA 1AZSC 1B6SA 2G07A 2ZUBA 1H2BA 4R01A 3B9PA 1SHZA 1ZM3A 1WCIB 3UHAA 1E8YA 3QEKA 1Z28A 2VZEA 1YS9A 3A1SA 4H1WA 4YRNA 2IS6A 3KVRA 4NMMA 1UIRA 2PA3A 3VGPA 2QN8A 2NZYA 1N9ZA 3BWVA 4KWEA 4GI3A 4PG6A 4QXPA 1PZXA 5C32A 4PCLA 4OGWA 2GRLA 1SZCA 4DDKA 2R05A 2A33A 3NNNA 3M4ZA 6PFKA 3ZCTA 3EVTA 4GC5A 1QM5A 2COEA 2NU6B 1E6EA 2NO5A 4UPVA 4WOJA 5G0SA 1NJFA 1H6PA 3B13A 2GESA 4YJ2B 3DZIA 3ND5A 1W2WB 3M34A 3NFYA 4BOYA 1SCAA 2PPLA 3WNVA 2ZWMA 3IQHX 4UTOA 4QODA 2UYHA 3TDNA 4RVOA 3FE2A 2H1WA 4OXRA 5C5CA 2D1YA 2Q8PA 4S05A 1X1BA 5EE5B 4P4SA 3WLSA 3DVRX 1Y8ZA 4XDHA 1C9EA 3UC5A 4IDFA 3NUGA 1WZ2A 4HH1A 4CZ2D 4R1NA 1ZCJA 2XUKA 1OFUX 1ZC4A 4F6RB 1NWCA 4OGFA 2JFYA 1NX6A 2I87A 1JL3A 3HV0A 2V5FA 3KSUA 5K09A 4BX3A 4PLWA 5BW8A 4YJDA 4B7ZA 2AX4A 2QLMA 5A3JA 2RCNA 3JW8A 3UBTA 3IXMA 5EJ8A 2PUWA 1QVWA 4BU1A 4K5AB 1XZBA 1NLYA 3AFHA 1N6RA 2G9NA 1H0AA 1G16A 2D3TA 3A6HA 3G2OA 4CDGA 3O4VA 3QUTA 2ZIVB 1S3IA 5HKOA 4JY7A 3EDCA 5HBGA 2VP9A 3V48A 3K9CA 4K5CA 2L9BA 1XAJA 3N6VA 3OQNA 1SFRA 3MIIA 3KNZA 1HDXA 1ADYA 3H04A 5D6OA 3PUWA 4ND8A 5HF5A 1U7ZA 3Q4GA 1JQBA 1O95A 4IHJB 2OZLB 5TGTA 5BPPA 4FQ8A 2RKKA 3T3NA 5JTTA 4E15A 3UJAA 5JDCA 3UPUA 3GMDA 4Y6GB 4N8DA 3PDNA 3LCCA 3IAEA 4ILIA 1JXOA 2I6TA 3TG8A 5JJ7A 3GJQA 4WW0A 4QTTB 1M7HA 2SHKA 3KUCA 3B7GA 2FEKA 1EGMB 1JU9A 1L8LA 2HDHA 2ZUCA 2Z4TA 1TO2E 4EPXA 1S3FA 1U2GA 3BTOA 3NKVA 1R7RA 2DR0A 4M6WB 3DFIA 3AVUA 2VYCA 2EAUA 4XE0A 3ZYMA 4F53A 3O4JA 3FYUA 3EMKA 1QYXA 1MFZA 4QBHA 3NTVA 1OWLA 1HORA 5B7GA 3ENZA 1AQIA 2XJ4A 3MCVA 3ZD8A 1ESNA 3M5DA 2C4TA 3EFOA 4DSTA 2MOKA 2KM4A 3LNTA 1U2ZA 1FP1D 5AI6A 2IF0A 4PU0A 3E18A 3EJNA 3ZIUA 5D0OD 3GRYA 1RI4A 2AMJA 2FZCA 1C7RA 3VR4H 1JLMA 2GN6A 2WPDD 5TQ2B 4KK3A 3EDOA 3QF7A 3GLFB 2JA1A 3L18A 4HWKA 3AJEA 1X87A 4BTVA 2XMCA 4I3HA 3O8LA 1SWVA 2GF9A 1X8LA 4AS1A 3WIUA 1ZU2A 2Q6TA 5AJXA 4KMRA 1JIQA 1HI9A 2AJBA 1UH5A 4CV0A 1D6MA 4KDRA 4KGVA 1XRNA 3SO8A 1Q20A 5KKCA 2XWBF 2IHBA 1GLNA 4BTBA 4PWZA 3CPEA 4ZEWA 3H6KA 4W7HA 4L75A 4NFLA 4L72A 2AL7A 4PYOA 3GFVA 5KNBD 4CTNA 4DYDA 2AG6A 3AEYA 1KDVA 1TA4A 4JI5B 1M2WA 2WPDA 2PMFA 2X3MA 4LXXA 2ON6A 4MUNA 2WAYA 1TA0A 4PC2A 2B78A 2YW2A 4B4VA 1Y3AA 3I6YA 3EZYA 4BIMA 2IELA 1GQ2A 4Q3NA 4B4KA 4ZTZB 1C80A 1OY3D 1VCMA 5JYCA 5IM5A 3SX2A 5T64A 4YCCA 5EDSA 3FWYA 1PT6A 3EXEB 4YJ3B 3V8MA 5JQGF 3SZ3A 2XTMA 1O08A 2K6GA 1FL9A 3TXAA 1ZM7A 1SNYA 4TXMA 2JFQA 2DQ4A 2X6TA 4HV4A 1QU2A 3FTZA 4MV3A 5KNBA 2ONJA 4AKSA 1TFUA 4J3JA 3WWCA 4HQ6A 4EGAA 1O9GA 2H5LA 1CKEA 2ZYUX 5GZ6A 3ITKA 3VKFA 2C95A 4HGQA 1U2QA 4Q1AA 1RVDA 2O5VA 2ICAA 2C04A 3BIXA 2QMEA 4DSOA 4PFQA 2WILA 4HGRA 3NBUA 5FLEX 4UBJA 4JZYA 5B2ZA 4GWKA 2OAEA 1JDBC 4YYZA 3F5MA 3QY0A 4HUQB 5FA6A 4BAZA 1YB6A 5DVZA 3CEHA 3V7UA 1QGYA 1VXOA 3H2IA 1ECBA 2GLXA 1ZD9A 2RH8A 4DCMA 3INGA 4P22A 4DCSA 1RYEA 3V6MA 4UJ3A 5A5FA 4I2NA 3LEWA 3IEPA 3KKOA 1OH8A 1ND6A 4RXTA 3GZ4A 3O4IA 5G0VA 4X0EA 1JLHA 1M7BA 3ILXA 4KDFA 5IJ0A 2O8VA 4M8LA 1IZ0A 4JSRA 2NXNA 3CSFA 3I76A 4ICIA 4WXPA 4FI3C 3MINA 4KSYA 1AURA 4GVXA 4MDHA 1LDNA 2VZ0A 1KJIA 3SBSA 2F17A 4EVRA 3AIIA 4JU8A 2GBLC 5B36A 2PQMA 1XK6A 3CRMA 2GHTA 3Q8MA 4IS2A 1MB2A 3RU3A 1PJAA 4J03A 4ES6A 2PXXA 1LSJA 1E5VA 3PQ6A 1GR1A 4OI1A 2OCYC 1L5SA 1PI3A 3IPAA 5LXTB 2ZE5A 4EVQA 3S1SA 1CR4A 1PQPA 4ZFHA 3UG7A 3N7AA 2VCHA 4HATA 1D2CA 1Z63A 4X1IA 3ZRHA 4TOIA 4D45A 5FJIA 5M72A 4N76A 4H31A 4DJDC 1EVEA 1K97A 4YJGB 4MPRA 2GFQA 3DEKA 2NTEA 4IZOA 1XDWA 4KITB 3U0BA 2G7ZA 4ZEOA 1UMCA 2WZCA 4ML3A 3COYA 3NH9A 2QQEA 4JT2A 3LSYA 1B8UA 3LY8A 3FTDA 4QBFA 2BTDA 4HSGA 1H9AA 2F6RA 4LC9A 2I2DA 2FEMA 3S2AA 2AJCA 3BMOA 4RFSB 4CIDA 4Q7QA 2WYVA 1D4FA 4JL6A 4H6WA 1Y7PA 4WXEA 2MSNA 1DI0A 4M0FA 3SBDA 3LRXA 5BN3A 1LDGA 1B8VA 2C88A 2G6TA 5LZ4A 1K7YA 4Y6SA 3KEMA 1PGOA 2A0YA 2CVFA 2WXRA 5KI6A 1XTKA 2YNQA 1W8IA 1SZPA 3H2ZA 3I92A 4GEGA 4A2CA 1M2GA 5KWSA 2P27A 3AL3A 4L08A 4CQLA 4RA6B 3CEMA 3CIOA 5KS2A 3BAZA 3FTPA 2PV7A 4C48B 5B4TA 1TQ6A 5JRDS 1S2LA 2I2BA 3GEBA 2X9VA 3GJ7A 1VSTA 4ZJPA 1OXKB 4F2WA 3GXBA 1OC4A 1Z0DA 3HO8A 1J99A 2JJYA 5EP2A 2FUCA 3LOUA 4XWYA 1TAGA 4K9RA 4E5VA 4OI2A 5IFLA 2ODWA 1FXWF 1IWBB 4ZO9A 4E2YA 3K2BA 2ZPTX 3DOOA 1RQLA 3CR7A 2R03A 3HKEB 4KOEC 2G04A 1GGKA 3W3AD 4BS9A 3F6PA 2CFRA 3LL7A 3QQ5A 4HXFB 3X0DA 2WQ6A 3SIWA 1GAEO 4ZQHA 2B7BA 2C4MA 4L2LA 4M49A 4MUFA 1QGUB 2CWWA 3RSEG 1ZH0A 4EA7A 4P9NA 1GRNA