2VSNA

Structure and topological arrangement of an o-glcnac transferase homolog: insight into molecular control of intracellular glycosylation
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
544
structure length
534
Chain Sequence
AWLMLADAELGDTTAGEMAVQRPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLAGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XCOGT
publication title Structure of an O-Glcnac Transferase Homolog Provides Insight Into Intracellular Glycosylation.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
total genus 194
structure length 534
sequence length 544
chains with identical sequence B
ec nomenclature ec 2.4.-.-:
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vsnA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vsnA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vsnA02
5JJTA 1PC2A 5IKOA 3CKBA 2FF5A 4MRAA 1L7XA 3CK7A 2GPBA 3QWPA 5CCLA 2X6RA 4M7PA 1F6DA 3NC4A 3CEMA 4O6FA 1QM5A 3VDMA 1GPYA 4Y6CA 4JA9A 5DLDA 3MA5A 3CUUA 3S7JA 3WADA 1ELWA 2VSYA 4FKZA 1BX3A 2FBNA 3JYSA 3ZHEB 3GUHA 3ZFWA 1GGNA 2HO1A 1Y8MA 4AY5A 8GPBA 3NAZA 1C3JA 2ZB2A 3MT7A 4RG6A 4G1TA 5FZSA 3G2IA 3BCUA 1SXQA 2XMPA 2C4MA 4I17A 2X0FA 4ME2A 1RRVA 2KCVA 1AXRA 2XGSA 2XCIA 4BQIA 3CVPA 4NESA 3VDNB 4EL0A 3ASGA 4GYWA 2Y4TA 2QRQA 4BQFA 5GPBA 2F3QA 1LWOA 4GPKA 5DU2A 3IEGA 3CX4A 1RZUA 5KJKA 3MKRA 3FROA 4GZ6A 4KQMA 1FTYA 3AS5A 2IUYA 4J8DA 2FO7A 2QRPA 4N3AA 1FU8A 3S29A 3MSCA 4AM9A 3E3NA 3LY9A 1ELRA 2ONDA 2IYAA 1KLXA 3ZCPA 4HOTA 2P6PA 2QFCA 3LKUA 4I2ZA 1E1YA 2QRMA 5HXAA 2DBAA 3OXGA 3PE3A 3T3HA 4QLBA 3D0RA 3CV3A 3QKWA 3Q15A 2PQ6A 2OOEA 4GZ5A 3ESKA 5A7DB 1GG8A 1PSWA 1XC7A 5TMBA 2PQRA 2R5SA 2AZDA 3T3IA 1W3BA 3C4VA 5G04C 3OKPA 1NLMA 4LDPA 1KT1A 3RO2A 1B4DA 2C1XA 1P4GA 2IW1A 3T7DA 3Q47B 6GPBA 5LQDA 2KCLA 2NC9A 5G05J 1UQUA 2BGTA 4JHRA 5C1DA 2XA2A 3TAXA 2PZIA 3OTIA 4RG9A 2VYIA 3GPBA 4B94A 4BTAA 1NA3A 2AVPA 4CTMA 4YNDA 2SKCA 3UUXA 5DBKA 3LY7A 5G04J 3Q5MA 1YA0A 3T3GA 4AMGA 2L6JA 2OFFA 5JJ7A 2XA1A 5D0OD 4YI5A 1L5QA 5KJMA 3U3WA 3RU0A 2VQ2A 2QN3A 3PE4A 3HBFA 4N9WA 2R60A 1P2DA 1JIUA 3CK9A 3FP3A 3QOUA 3S28A 5TMEA 1NZFA 3E3LA 4N3BA 4G26A 3S7BA 3CVLA 3RIBA 1B89A 3E4BA 4ABNA 4G25A 4APOA 2C9ZA 2QN8A 2G9QA 2R66A 3MT8A 2X0EA 2FI7A 2E2EA 1XL0A 2UWJG 2BGUA 3K9IA 4X6LA 3DDWA 3OT5A 3S27A 4W9RA 2HYZA 4HOQA 1A8IA 4GPBA 4BWRA 4LEIA 4RIFA 1GPBA 3FFLA 4AIFA 3Q49B 4XIFA 2XPIA 1IIRA 2IV3A 3GZ1A 2PL2A 2XCCA 3ZGQA 4HWGA 3L7BA 2IF4A 2XCBA 3CEJA 3OKCA 3KD7A 3H4IA 4RELA 3ASHA 2IFUA 1FC0A 4UQXA 1XNFA 2XEVA 3DZCA 1J39A 3QKYA 2F3SA 4N39A 4GCNA 5ARFA 3RJVA 3S0JA 3VTXA 4EQFA 1K08A 1JG7A 4WHMA 4CGVA 4HORA 1HZ4A 3T3DA 3CUWA 1QQEA 3VUEA 4WNEA 2UY1B 5FJYA 2F9FA 2Q6VA 2PQNA 1F0KA 2V5FA 1JG6A 3EBOA 5ARGA 1TJCA 4N3CA 1HXIA 3KS2A 3IA7A 2GJ4A 3NPAA 5TMDA 1QKJA 5BW8C 1P2GA 4XI9A 3NF1A 4IN3B 5HI7A 4A1SA 1Y8ZA 1P2BA 4L22A 3LCAA 2YQ8A 3DD1A 3EBPA 5BT1A 2KS6A 4YUAA 1LWNA 4CGWA 4G2TA 2XCUA 1PNVA 2MHKA 1NVKA 4NEQA 2LSVA 2LSUA 4I1AA 5LCWC 5EX3A 4U0ZA 1KT0A 1V4VA 1IYGA 1L5SA 3T3EA 1QZ2A 1ABBA 1NZDA 3AS4A 1YGPA 4EJ2A 5JTUA 1P29A 3C48A 1C8KA 3OXLA 4GA2A 4GCOA 4MI9A 3BEEA 2XGMA 4KQ2A 3O48A 4I9CA 2J9QA 4GZ3A 4NRHB 1Z8DA 4WNDA 3TG5A 1L5RA 2VCHA 1FU7A 3BDAA 5G05C 4U07A 2HR2A 3UYLA 5EX0A 2XGOA 5LCWJ 1WAO1 3OXFA 5FZQA 2VG8A 5A6CA 3AS8A 2IEIA 1WUTA 2IYFA 4J8EA 2QZSA 4YI3A 3T5TA 3BD8A 3ASFA 5HQ8A 4UI9K 2R4TA 1E4OA 1L5VA 4AMBA 4NQ0A 4BT8A 3CVNA 3CUYA 2UY1A 3MRVA 2O6LA 3MT9A 3ZCUA 4PQGA 2VGXB 3RSCA 4MI6A 3OTHA 5FTPA 4BT9A 2QN1A 4GYYA 4J0UA 3LY8A 3CK8A 5JTTA 2QLNA 3L7CA 2ATIA 3IAAA 2FF4A 1FCHA 2KATA 4WNGA 4AN4A 5EKQD 2BFWA 5KJNA 1IHGA 5DXFA 2C2LA 3UYKA 1WUYA 2SKDA 3MRTA 2QRGA 4MHOA 4RBNA 3TG4A 3L01A 3MS7A 4WACA 3BD6A 3G2JA 4G24A 3BCSA 2R4UA 1FTWA 5D00A 3OKAA 5IKPA 1P4HA 4Z5XA 2I6HA 1Z62A 2YHCA 1GFZA 3S7DA 2F3PA 3RKVA 3PDNA 3SZ7A 3VTYA 2YJNA 4F3VA 3OY2A 2KCKA 3GZ2A 2ACVA 3MS2A 2FEZA 3QWWA 5FZRA 3DDSA 3UQ3A 3MS4A 4M83A 3SYRA 2X6QA 3HYMB 1EM6A 4EKYA 4UI9J 4RENA 3OY7A 4F9FA 3AMVA 4KQ1A 3E3OA 4N2QA 2WPVA 3U4TA 1IXYA 1ZBPA 3MTAA 4UQZA 4GA0A 4JL0A 2FETA 4YVQC 4HLNA 3WAGA 4GYOA 4GA1A 4AY6A 5D01A 4H7XA 3S7FA 2LNIA 2VGXA 3MTBA 1NA0A 5TVGA 3H4TA 4G23A 3ZPJA 1C8LA 4M60A 4N5CA 4UQYA 5D0QD 4MI3A 3BD7A 3MQFA 3ZCSA 1Z6PA 3MTDA 1UQTA 3MBOA 3MEKA 2ECPA 3WC4A 4LEUA 2QLMA 1WV0A 2GEJA 1XKXA 2ACWA 3O3CA 3Q4AB 1C50A 4NC9A 3L79A 4RIIA 3NB0A 3QWVA 1FA9A 3ZCVA 3Q3IA 3TOVA 4G2VA 3ZCTA 2QN7A 1FU4A 4RIEA 3R9AB 3D1JA 2SKEA 5JJ6A 1E96B 2H1FA 5DIZA 3ZCRA 2QN2A 3RO3A 4I2WA 3EDTB 2C0LA 3ASDA 2VGYA 1L5WA 4X7PA 3QDNA 2AV6A 2Y4UA 1GZ5A 1XOIA 4W6QA 4CTNA 4HOSA 2VCEA 3G2LA 5KJLA 3S2UA 5I45A 4MICA 1ZU2A 1A17A 2JZCA 4WUYA 2BUGA 2X0DA 1GPAA 4WADA 1WW3A 3Q3EA 1VGVA 4U04A 5ENZA 1JIVA 3HBMA 1P5QA 4BQEA 4H7YA 4EKEA 1AHPA 4Y6WA 2GEKA 4F97A 1NOKA 3BCRA 2HY7A 3MRXA 4KXKB 3RT1A 1Z6QA 1YA6A 1SXPA 2C1ZA 2G9VA 1OUVA 3G2KA 2WTXA 4CTOA 1XL1A 2PYIA 2JJMA 4JA7A 7GPBA 3NP9A 5BNWA 3RHZA 3NCHA 2JLBA 3RSZA 1RZVA 2QN9A 5M72A 3C4QA 3COPA 3QHPA 1KTIA 2GM9A 3UPVA 3LYAA 2GT1A 2PRJA 3G2NA 3TSAA 3Q3HA 1WM5A 1WW2A 1NOIA 4UI9C 4I9EA 1NOJA 3KAEA 3CEHA 4KBQA 2AMVA 3ZHEA 1HLFA 3L7AA 4YVOA 4XI0A 3CKCA 3CVQA 2GPAA 3LPZA 4HOUA 4RIGA 1H5UA 2P58C 3OTGA 3CUTA 2KC7A 3NP7A 2ASVA 2C0MA 3FWVA 4F96A 1O6CA 3GW4A 3ZN3A 3ULQA 3TGOA 2F3UA 3D0QA 2QRHA 1K06A 4EL5A 3CV0A 2QLLA 1EXVA 2G9UA 4CDRA 2PRIA 4U0UA 3MV3B 3G2HA 2FFRA 5AYWD 1UZUA 3VUFA 2BISA 9GPBA 4RIHA 3BEOA 2IEGA 4U0SA 5FT9A 4MHSA 1WV1A 1HH8A 2WQHA 2IV7A 1P4JA 4REMA 2QNBA 3CEQA 1PYGA 2GPNA 4X7RA 3WXXA 2PYDA 1JIXA 2AW3A 5CCMA 1PN3A 2XA9A 3HBNA 4J8FA 5CHEE 2GW1A 4N2SA 1FTQA 4X7MA 2VSNA 4BFCA 1XV5A 3URZA 1JEJA 4FZRA 1M5RA 3ZCQA 1NZNA 2Q7FA 2H1HA 3L7DA 3CUVA 2G9RA 3N71A 3SYMA 2R68A 3MV2B 1L6IA 3GYZA 4BTBA 1FS4A 4WNFA 1Y6GA 1Y6FA 4KYOB 3HBJA 3SF4A
chains in the Genus database with same CATH superfamily
3WP0A 3NC0C 5EUQB 2QLBA 4MRAA 1WXHA 1ZU4A 5CERB 3WAKA 4BYGA 3MXTA 4JIMA 3G2TA 4XTCS 4NNPA 4FONA 1O9BA 1VMIA 3M4YA 1JN0A 4II3A 4HVCA 3T15A 2XE4A 2KZTB 2D2EA 4ZYZA 5ALXA 4CIDA 2D5LA 3OZRA 1NASA 2XXAA 3WLTA 3PRZA 2D06A 4IVRA 3GAAA 4JT9A 2A58A 4BBZA 2JCXA 3HXKA 3ZVMA 3JPYA 4EYQA 4Z53A 4I2ZA 3EY9A 5A02A 1DU4A 4N5HX 2JGNA 1C1XB 1PV1A 1R7RA 1KT1A 3RO2A 4LRSB 2JDID 1CCWA 3F9IA 2CXTA 1JR3A 2JARA 4JHRA 3MGGA 5JAUA 4YNDA 3FI9A 4F3TA 4MMYB 1Q21A 4NE2A 4CN8A 3MWEB 2ZE5A 4IY1A 4V1CA 3OFJA 2Q0XA 1H8EA 5LZ5A 2W6ZA 1A76A 1J20A 3HFJA 3K9IA 4MRNA 1U3VA 4CKWB 2PNNA 4Y18A 5JE8A 3ZGQA 2C5AA 3F8TA 2IYVA 4EUKA 1JDNA 2RGXA 3QMPA 2XQFA 1VXOA 2R7LA 4OH7A 3FTCA 3SJUA 3BM5A 5DHSA 3JUIA 2AF4C 1EXWA 3ZGXA 2GJ8A 1TJCA 1DKRA 5EJ6A 2FMFA 2W98A 4KSYA 4Q4JA 4GDFA 4JITA 2MHKA 3HR8A 1L3IA 3LX8A 4HMPA 5C7LO 2C57A 5T4EA 4O4HA 3OQ6A 3CSFA 4RA9B 4D4GA 821PA 1ZGGA 1R5OA 2XBUA 5IN5A 4TV9A 2HU5A 2I6FA 2WHYA 1Z0FA 1P4RA 3DEZA 4URHA 4L72A 1NXXA 2Q5HA 4JHKA 1GG9A 5EVJA 5L4SA 2XDWA 4M7OA 1OWPA 5DF1A 5JSZA 4XB1A 4X91A 2JC3A 4O4HF 3I5AA 3E7FA 1VCMA 2H4FA 1LV8A 4XGKA 2OHFA 5A71A 4QXMA 1FMLA 2HDHA 3QXGA 1X1AA 1RI1A 1ONNA 2ZRNA 5CLGA 1PVDA 4PTLA 4BFVA 1CUCA 3PEWA 2G6BA 2GOYA 4YXWD 3OHPA 3SE7A 3U4TA 4FGZA 2EIHA 4QECA 3O93A 1N1EA 3R8XA 4Y9SA 5F77A 3T9EA 1PGQA 4MR7B 1QG2A 3ANNA 1Z4IA 5KDOA 2QYTA 5FWYB 2OL4A 3J80A 4G81A 2GAAA 1B93A 1E3MA 3FTYA 2OHJA 2YV1A 5KQMA 1X14A 3BDVA 3EGDA 3PQ5A 3EXEB 5IK2D 2H17A 5C3MA 4MV9A 4BNIA 1NXWA 4RFVA 4I2WA 2QB5A 1Y4DE 1CJKC 2IODA 1TVKB 2IPMA 3T61A 4QULA 4PXYA 4LBWA 3RBAA 1E4VA 1C3OB 4Y6WA 2FTKE 2GNPA 2JI7A 1QIDA 3B6MA 3W2FA 1BFUA 4ZT4A 2IQCA 3EZXA 3PV0A 3MZLB 3TZ6A 3KYJB 2FWJA 3H9QA 1B0ZA 3V1NA 1OLUB 3KTAA 2KMLA 2E0IA 4EGJA 5FBVB 5JLAA 4DCSA 3LTEA 1KMQA 3V97A 2ASVA 5FUXA 1K06A 1DFIA 3DDHA 1UBMS 3FIJA 4KAFA 4MHSA 1UJ6A 1BLXB 5H59A 2V7WA 2FQ1A 2IIBA 2UZ3A 3QOFA 4ER6A 5EUCA 4I5IA 4P7KA 3V7YA 3FH0A 3MMSA 4KFCA 3STTA 1VIAA 4KYOB 1FFDA 1J8VA 4KWTA 4C1NA 3AEQA 1CQJA 3SF0A 3I9LA 1JQEA 4K46A 4ECEA 1E0AA 4KYTA 2RE8A 1RR6A 1NF9A 2VSYA 2FBNA 2MYNA 2JAUA 1T6NA 1H2VC 1K6IA 1GSOA 5JIBA 1A5EA 4LBZA 4OQLA 2LP4Y 1VBNA 3EX7C 1JFFA 2NPIA 3UH1A 3BXOA 3VLFA 3GA0A 1SVNA 2AQ8A 3CGGA 4JY7A 3SJZA 3DF9A 2BMWA 1W5EA 2QD2A 2I6UA 1I14A 3M0EA 2YNMC 4GP7A 2JH3A 4RVGA 3R4VA 2I8CA 1QH0A 3Q15A 5FLYA 2GTIA 1H22A 2PT5A 3EFEA 1YKGA 2AH5A 2XGJA 521PA 2I54A 3ZTYA 3EZYA 3EEIA 4B85A 5LQDA 2VNJA 3VU8A 2VSQA 1KI1A 2QTMA 4C43A 2QAGC 5ITVA 1EFLA 4WZAA 3DW3X 1W59A 1QUEA 4CCYB 3KFLA 3ONFA 4RH3A 1LDYA 3T7TA 1PO7A 1BX1A 2R25B 3E6AA 3NDJA 4X8HA 4MV6A 3A1FA 4QYWA 2VJAA 4JLUA 4IOKA 3DMTA 3OUTA 5A7HA 1S70B 1YCDA 1UMCA 3KD7A 1LZKA 4KN6A 4U0JA 2Q46A 1N8SA 4PS3A 3GJZA 4DT1A 2PX3A 4DLZA 3W2TA 4FHCA 4GQAA 4RJTA 5F5XA 4OXIA 3BBPA 3P2BA 1RHJA 1TZMA 3L8ZA 3GGJA 1DDIA 3L54A 1ORRA 3WO1A 3HVIA 2HC9A 4UI9K 4AMBA 1WPRA 4BFWA 2EILE 4LNAA 5EMHA 3GFBA 2B2NA 4WTOA 5AXCA 1J07A 3I05A 4E15A 1EG2A 3Q98A 2Y0CA 4WACA 1ZIDA 3S2FA 1QF9A 4FYIA 3UC9A 4IDCA 3NH6A 3R0XA 4DB4A 3V6MA 3Q11A 3GFSA 3CT6A 1E79D 3DL0A 3HYMB 2BFDA 3TSYA 1Z22A 4OXYA 1T1GA 1YR7A 1U2SA 5CA0A 3RLFA 5JROA 4UQPA 1DQPA 2OWDA 1W7AA 3ZS8A 1BH2A 1OXBB 4PEVA 5DBGA 3RI3A 2HF2A 3HXFA 4OP2A 2IIQA 2QLMA 4DIOA 3PDCA 2IHZA 3Q4AB 4ZJUA 4RGQA 5AQ1A 2WYWA 3JWPA 3TOVA 4GQBA 3IIJA 1H94A 3COYA 5CA0F 1Z3YA 4HWRA 2FMUA 5IXJA 3TWUA 3RYTC 4DSOA 4E22A 2C3OA 4B74A 3IH5A 3PTZA 4DMRA 4TMXA 5HPYB 1M2GA 2QOEA 4QKQA 2W8ZA 1TM2A 1A4IA 3KAPA 3S2UA 1G9TA 3E5MA 1A17A 1QHHA 1T4MA 2R7KA 3U4QB 4DIKA 4GM4A 2HWUA 4MV1A 3IAHA 2B36A 4WOPA 1U0JA 4JNCA 4IIFA 2CVQA 2ZXWE 3Q7RA 2F1RA 5A4IS 3MWYW 3SY8A 5HM6A 4DIEA 4WESA 5BUSA 3DHEA 5BVHB 4OJNA 1UJBA 4J0JA 4O6VA 2PX0A 4DXHA 2EP8A 4IDEA 3ZVLA 1U94A 3SDBA 4C7JA 1ODSA 4IIJA 3GZTB 1ZY2A 3JYOA 4KP7A 1DRWA 4HF7A 1C3LA 2VHCA 3I23A 1CDOA 5IUNC 2IS1A 3GLTA 4ON9A 5BQFA 2AYZA 1THTA 2VXOA 2AFRA 2EP5A 2GPNA 1AS3A 4J8FA 2D1SA 4H08A 2XEHA 4ZOQI 3ZJ4A 4QJ3A 4G84A 1I4EB 4IIJF 3M82A 3HA5A 4UD2A 3CN9A 1PK7A 1NONA 5E3JA 1L7XA 2ARKA 2XY4A 3R9IA 3JWEA 3JQBA 4M0UA 3R6TA 2HREA 1NVMB 1Z5OA 1H2UA 1X0XA 3R7DA 4I5DA 4ARCA 3ZUPA 2X0FA 2VAMA 4OP1A 2GWRA 4NJOA 1WOYA 3U19A 3F96A 4BO4A 2HJGA 1JWBB 5AW8A 3HZHA 3AWDA 4MR9A 2WF9A 1K68A 4F6RB 1IWOA 1QZZA 3ZJUA 1XNRB 2JAPA 2PPLA 2O8BB 5ALUA 3KKPA 1JAHA 1U8FO 1ZNQO 5DYIA 3HG0D 4WUTA 2OP0A 1S2LA 4M88A 1VPDA 1GQOA 1V37A 1PLJA 3HM2A 3L13A 3TVTA 1PR3A 3J81k 2D7DA 1OOEA 1B6TA 3FSGA 3V34A 3D6NB 1TTHA 5KAMA 4W7HA 4IL5A 1OIXA 4R7TA 1IDOA 4FA6A 1ZRNA 1YA0A 2DYSE 1XXHA 1DUVG 2CNNA 5E9QA 3FH8A 4N9WA 1ZN8A 4YAOA 4C21A 4TN5A 3IL2A 4LRXA 1QV7A 3Q7FA 3TVYA 3NV7A 2UWJG 4EENA 3O3NB 3RH0A 4LCBA 4XYLA 2VTEA 3B12A 1K97A 3KUKA 3PCTA 1HLDA 3UMVA 4X0EA 1N2CB 3V8QA 1XZFA 4V0KA 3KC2A 4KITB 2NUBA 3WJ1A 5B6IA 4GMRA 1DAFA 3VUEA 2CHUA 2Y1FA 3B1WA 4CEIB 3L4BC 4IIYA 4L0DA 2O52A 4RW0A 2H0QA 1NUQA 3EK2A 3JAWA 5BSEA 1WQ4A 3RUPA 5DGCA 1QCZA 3N7UA 5JZSA 1J70A 1M6WA 1PQUA 2ENWA 1ADJA 1LUAA 3ICQB 4MB0A 4AMZA 3BEEA 4KQ2A 3L5KA 2VP3A 3SYTA 4AJHA 5CUQA 5B1DA 1EVIA 3IO5A 3ZQUA 2WWYA 3VZRA 3FFAA 1MRZA 3WLAA 4MINA 5I01A 1KK2A 4LZLA 1WETA 5AVUA 4P0TA 4XRGA 1OX6A 1XG5A 3U4DA 4JA2A 4DDMA 1C2YA 1J25A 4EW1A 1ZCJA 3D3KA 1KMMA 4FNGA 4XCVA 4KRGA 3K9CA 2GJKA 1QGUB 3V8RA 2EQBA 2I8AA 3DOOA 1SUDA 3UYKA 1H4TA 2IF2A 4QUDA 3TIFA 5KX5F 4NBRA 4WWNA 3OKAA 1P1IA 4PQRA 5JOQA 2UXCB 3KEFA 3S1LA 2MT9A 3DDSA 1OCCE 1U0TA 4MA4A 5DV9A 5IZ4A 1BU5A 3TPFA 4CDGA 2Q21A 2V54A 2UUBB 1AT1A 2I0FA 2VDRB 1G64A 2YJGA 3MTDA 5JXWA 3ENNA 2WPDA 5BMOA 2JHGA 1U9ZA 2RKKA 1WV0A 3IR6A 2OV8A 4P5PA 3UPUA 5JWHA 4B34A 3QQ5A 3Q1LA 3UB4A 3G9TA 4M0FA 1T25A 5HIAA 4MCJA 1A8SA 3H5TA 4MYUA 1JYSA 5EPOA 1NJFA 4JJZA 4DCTA 5ESRA 3R7LA 1XTIA 1ZM3A 1WRBA 5IUKC 1WXWA 3Q12A 1F8XA 3A6LA 4JVSB 3A7DA 2C1ZA 2HLPA 3SHWA 1BQ3A 3HG7A 2G80A 3AERA 4BSZB 1CS4C 5AJTA 2RHBA 3QELB 3RT9A 2XYRA 4XWAA 2Y1WA 3SE0A 1TGYA 2Q0SA 2PUGA 4A3SA 2C0MA 1O6CA 3RC3A 4U00A 1A8PA 1RPAA 1YZNA 1ZMRA 1JDPA 3RW9A 5DYGA 4BBAA 2CL6X 2ZI6A 4Y6SA 3R09A 5BSHA 3A1TA 3KP1A 4R3WA 5JATA 2VGEA 3WNVA 1YSCA 3FMOB 4CMAA 3AF1A 2BGKA 3LHIA 1A88A 4CM1A 4MVXA 4XX5A 3VAYA 3JATA 3BL6A 2RFAA 4MRVA 4Y6CA 4JA9A 3SC2A 4BHTA 2WJIA 3QW4B 3NUGA 1NG9A 1ARZA 5F73A 1EFVA 3G2IA 5C5DA 1QYVA 3PUVA 3Q87B 4CZ2A 3KHTA 1M8GA 4BQFA 2V9CA 3Q10A 1UPXA 4D74A 3HCPA 4KQMA 3CT4A 121PA 1X1SA 3DTYA 1UM8A 1VRVA 4AKHA 1QH1A 2WSSA 3FNGA 2Q3JA 3CPEA 4KCGA 2FPKA 4M38A 5TRTA 1K8ZB 2F48A 2P65A 3BFJA 4BX3A 4K8OA 3FWPA 1ULZA 1PR5A 9LDTA 4GNRA 2PFSA 1R4NB 2BONA 2C7PA 5DI3B 2MJLA 3S1AB 3BRQA 1ZNWA 4JR0A 1YJCA 3ZWWA 1AH2A 3UK6A 3UJHA 4PIVA 2GJSA 1O58A 2XUZA 4TRQA 3QNWA 2VP6A 2NQTA 2Y8EA 4WCVA 3IEKA 3U49A 4X8LA 4F4FA 3RUEA 2X1VA 1KNQA 4OFWA 2J3HA 2X1HA 1C1XA 2LIPA 2Y76A 3ZV4A 4E5YA 3S4YA 3V4PB 1PUIA 4PS8A 3RV3A 1NN3A 1YR9A 2G40A 1OY1A 3DMHA 3ZV6A 1NYLA 1K8KG 1DJNA 1FJGB 3QYJA 4IMRA 2OV6A 4P0PB 1MX6A 3MWEA 2QZ9A 4EZBA 2AN9A 2WG2A 3CWQA 4X3CA 4H1HA 1U4SA 3J81A 1ORIA 1KIFA 1I6MA 4G2TA 2Z8YA 4DQDA 4L23A 3WGVA 4BASA 5EX3A 4WK4B 2CLKB 1SG6A 2VHUA 1RYBA 2ATVA 1EEHA 1H6KA 2MMCA 1P29A 2F8LA 4DCJA 4CKWA 3V7UA 4K6HA 2B94A 3K6KA 3FCAA 3GRCA 4F2WA 3SCZA 3TG5A 3DLHA 1UUFA 1GKKA 5JYCA 2Q2OA 2XGOA 5TB5A 5K45A 2V03A 1SA5A 2QKYA 1BC5A 2C59A 1KJ8A 1JS1X 3KOWA 4R5MA 5I9IA 3QU5A 4MI6A 2EKDA 4XZ3A 1F4LA 2QPTA 3A11A 5F3DA 3LSTA 4GKBA 2M6LA 3FMGA 4MHOA 2DETA 3CF0A 1GUYA 2K87A 2BGLA 1G3MA 3OPYB 5IDYA 1P4HA 2QDKA 1YTUA 4NOLA 2AXEA 1SZAA 3E2IA 3LBYA 3WE7A 2O06A 4M83A 3KXIA 3OY7A 4UW9A 1IBSA 2OEPA 1KORA 2F1JA 2PZGA 2HIMA 1S01A 2WNSA 1JTVA 5JFOA 1V1RA 3ED5A 3OEEA 3I0NA 1SPXA 1MCZA 1TIBA 4CLOB 1Q2XA 4E5DA 2YY5A 3Q3IA 5E3IA 3OAAA 3AP1A 4TN1A 2PMDA 2F9LA 3ERCA 3JQCA 1G8SA 1GILA 4M8KA 1NP6A 1YZYA 4UEJA 2O23A 1YASA 3HUDA 4FZ5A 1ISMA 1W4RA 4WIAA 1P0PA 1I4OA 5G02A 1O6BA 1P7YA 1G3RA 4WUVA 4F97A 4P4NA 4EG5A 4MTLA 4TMVA 3N2IA 5FWYA 1AMUA 5IY5E 1G42A 2UUAB 4A23A 3OPNA 3EEOA 5IAJA 1NMXA 3OOSA 4NULA 3FD8A 1NOJA 4RX1A 3EXEA 3P2EA 4V0SA 4HZUB 4QGBA 2WA1A 1U0LA 3KD2A 1M5TA 2FK7A 2JANA 3GNTA 3ELWA 4RWEA 3EMKA 3M5WA 3LUBA 3AVXA 5ALEA 1VZ2A 3KPJA 1UEIA 3VHQA 3N58A 1XQ1A 4D3SA 3JTEA 3UJPA 3VV2A 3WRVA 1IY9A 4L2LA 2VSNA 2W2LD 1K3TA 1UFRA 4CXMA 3L0PA 3ZYQA 3AZOA 1PX0A 1OLUA 3CKKA 3SC3A 4BGUA 4BNFA 3FGOA 4XIIA 3E9NA 3FMIA 4IDPA 4TQ9A 1PEYA 3MTQA 2CDAA 2R6JA 2O3TA 3JVEA 1DLJA 3O8LA 1BWSA 2XGSA 3DPYA 4KQ6A 4J7AA 1GIAA 2EINE 2P6NA 2GGFA 2V0PA 3EA4A 1XCMA 3QARA 1I1OA 1Z39A 5DSTA 1ZJ4A 2DUJA 4H1WA 1CQZA 3NWOA 1H6BA 2CSUA 5BV7A 4QOSA 1M2KA 4RZHA 1V54E 2ZVJA 1ZEJA 4RD6A 4BQNA 1ST3A 2YWRA 3ZHRA 3TTUA 4NMMA 3ZYKA 1XTTA 2H7XA 3T3GA 1N4DA 2FR1A 4AKTA 3HUEA 3JVIA 2YW9A 4UNNA 3ST7A 1HZJA 1WXEA 2XD4A 1DQSA 1G2QA 3PWSA 1N95A 2AJBA 3KEQA 1RJDA 1ZUWA 3SZOA 3VKUA 2EW8A 1Z5SC 5B2EA 1DKLA 3LK7A 1RXWA 4UJ3A 2XCBA 4G37A 4KQXA 2FEPA 1I0IA 3DZCA 3QKYA 2V74B 2DCUA 4P3YA 4RAQA 4BJ5A 4EOGA 4LKOA 3ZWQA 3KXPA 1I36A 5NULA 3PJRA 1UR5A 3GX1A 5FPPA 3HDQA 4KL8S 1Z4QA 2QUZA 4X9XA 421PA 3ZK8A 1WD7A 3IDFA 4RE5A 2LSUA 2IWRA 3PQFA 1FRVA 3FR8A 2JLVA 1YBMA 1OBCA 1N0IA 2AI1A 2QTAA 4V2IA 2XGMA 4X84A 2REXB 2X77A 4GRDA 1PDWA 4EKIA 3QYFA 1W8DA 3C39A 5A5EA 3SU8A 1ODLA 7MHTA 1A3CA 2H1SA 2AD5A 2L0XA 5KDLA 4L74A 4KV7A 3LBIA 4ZO7A 4TKUB 2FE1A 1IBKB 3AF6A 2WSYB 1UMBB 1DJOA 4TTJA 4KEAA 1JQ5A 1UM9B 4X1KB 4J0KA 1CY7A 2GPSA 3U26A 2WD8A 1T6XA 3B7RL 5LYJA 2PUJA 2JGDB 3TEJA 3OY2A 1J5EB 1P6UA 2LKCA 1NXTA 2R8EA 1CQIA 2R87A 3MYYA 3LHKA 3IUNA 3VV3A 2PA0A 3H1BA 4FP9A 4YUWA 5LYJF 2BEUB 3IP6A 5JJIA 1E64A 5JI2E 2ZR8A 3GI1A 3A0UA 5TJ9A 3LC7O 4JP2A 2VHEA 3I0MA 2JD0A 2PTHA 5C34B 3DDOA 1P0MA 4HYYA 2B37A 2HSZA 3GRVA 3MXOA 5JS7A 2VH2A 2YV3A 2CHFA 4Y6RA 4M55A 3IP5A 4R2LA 4RV5A 2JFNA 2G3YA 3O1JC 2YFYA 1CEQA 3MG9A 1GU0A 2A5FA 4JSTA 3I01A 4JB3A 1ZN9A 4JYMA 2WT4A 2D2IA 4ZI5A 1E66A 2V3VA 1KY5A 1O1TA 1ZK3A 2P58C 4F7DA 3H7IA 3VYRB 1EP1B 1IVNA 4EL5A 1XO1A 3JYQA 5DGDA 3OLWA 1M0EA 3H8SA 1AUQA 4REMA 5BSUA 4JZKA 3FPBA 3PFCA 5DFAA 1N2GA 5JY6A 4REQA 4PAOA 4RQBA 2CD7A 3QXSA 3PNKA 1JQKA 1Y7TA 5DBEX 4D6PA 1GQQA 3ZEAA 4Q3BA 3OTWA 4CF6A 3QUSA 4QHYA 3WWEA 3LUCA 2GPYA 4IBOA 1MX4A 5JG7A 2CLOB 2VRCD 1Y8MA 4Z9YA 4FINA 5E76A 1P6QA 4FR5A 1BQEA 2WW8A 4EJ0A 5L3ZA 3QVOA 2QM8A 3DXXA 4TTSA 3TSCA 1Y7HA 5JDIC 3VPCA 4RD0A 3INGA 4LYGA 1J1ZA 2C4VA 1MLDA 3SXUB 4YP5A 1E5TA 1UKEA 2C97A 4EHKA 1MTZA 3KJNA 3RRMA 4K3UA 1W1UA 2JKYA 5CEJA 2OOEA 4I81A 5TMBA 4Z4FA 4AQ7A 3KJGA 2JJ1A 1WY6A 1NMSA 3Q7PA 4DY6A 2A5YB 1X7DA 2F0YA 2ZUUA 2X2OA 3AFMA 3WQQA 4DA9A 2F2TA 3NHMA 1RXUA 4FD3A 2CHGA 3SZMA 1SCDA 2QPAA 4O02B 3JQEA 4IUYA 4M87A 3TZHA 3HVJA 5KYKA 1A82A 3D6FA 4GYJA 5I7UA 1EX6A 3EIOA 5TMEA 1TVMA 1KZGB 2O8BA 5HRCA 3IHVA 1PJ3A 3QUQA 1ONSA 3K6SA 2NO6A 4DG8A 1TAQA 3WGKA 3FHLA 3Q3GE 4RHFA 1YMQA 4BFRA 1J39A 2JW5A 2ZTVA 1QP4A 3NOGD 2CL5A 2VPXA 1BJTA 2R5WA 2C2BA 4J3NA 6CHYA 5JUWA 2FWRA 1IY2A 3WGQA 3GMSA 3JVVA 2IEZA 3AG3E 1M2VB 2PD6A 1NVKA 2I1LA 3GJ4A 3GPDG 1R0WA 4OJYA 3JYLA 3RB8A 4YCCA 4KLZA 3TZQA 4CNBA 2VTDA 2VDOB 1I3LA 4G89A 1N2CA 4P1ZA 3RCBA 2YMLA 4TRMA 2QSUA 2GQ0A 3EC1A 4YRJA 1YXMA 2AXQA 1O97C 3RYCB 4K87A 4AQYB 4MKZA 1PJAA 4GO1A 4CEIA 3TWVA 1CJVC 3DVLA 1NI1A 1HEIA 1IN1A 1YVPA 1M0WA 1OH7A 2QV0A 3CINA 1JKJB 2YVKA 6AT1A 4XEUA 3PYLA 1KI4A 4H60A 4ERXA 4LRZA 2AB0A 4QGSA 3CQ9A 1Y6JA 2GK7A 4EECA 4AT1A 1DINA 5JYDA 1N9AA 4JOBA 4EHIA 2DWOA 3ETHA 3MYVA 2QYHA 1YFKA 2J8ZA 3BUAA 3C3QA 5AARA 3OQPA 5ALWA 3PC8A 2YQ5A 2HAEA 3REQB 2FSSA 2EBUA 4FC7A 2WXGA 2VHXA 3Q8MA 2ZIXB 1Y9DA 3SKVA 1LZLA 4S1PA 4ZXPA 2AK3A 3H9BA 2JHAA 4YS6A 2RCNA 5ALJA 4TXLA 2R0QC 5L45A 3TLBA 2H1FA 1KI6A 1TKAA 3D3EA 3DR3A 1R6AA 1H6PA 2W7TA 5KKCA 2EKLA 2RHOA 2JZCA 3JQAA 4TSRA 1MEEA 4R83A 2H2GA 3AJRA 3PNLA 1UBKS 4FZ3A 5CB6A 4BB9A 1EUQA 2XJ4A 4JENA 5A03A 4R1SA 2PGLA 1ZGHA 1TQ4A 5A9RA 2ZT7A 4GI1A 2X41A 3COPA 3S55A 3WGUA 4HAIA 2A5GA 3BWYA 5EIBC 3FU5A 2DG2A 3VRHA 4QG3A 3TX6A 2D54A 1YKSA 5FO1A 3MTIA 4FFSA 1WY5A 3IR5A 2Z83A 1W49A 3TLEA 1AA9A 3O2JA 3HCWA 1I7QB 2QTWB 4LMAA 3H7AA 2AT1A 3TD9A 3VLEA 1NVVR 3LOQA 2ZKIA 4JVSA 1J2RA 1DEAA 1Q7CA 1IXKA 4R8VA 4Y6PA 2HN9A 3IXEA 2A5LA 1IQ0A 4A8TA 5KJFA 3UTMA 3L7DA 3IAUA 4LOLA 1KS2A 4P4GA 4BTBA 1UF9A 1JYEA 3SF4A 1YCGA 4FFMA 3M6FA 4A8JB 1TJPB 5JFGA 1KRWA 4S35A 2RGBA 3KZVA 4EI7A 3UHAA 4EITA 2Z3WA 2X0JA 3G2UA 3UNXA 2M32A 4MLPA 4LW8A 1O54A 1N6HA 3FUCA 5J5VA 1OFVA 1B2RA 4UUCA 3BFPA 4Q15A 4FPXA 4DMFA 2OECA 3WB9A 2VYVD 3LE8A 3HHEA 4BUZA 1VG1A 1E4EB 4QVIA 2GBGA 3BERA 4FP7A 4RD3A 1UBTS 4KIJA 2ODQA 2OZPA 4H4EA 4KMMA 4RPHA 5F7JA 1BGWA 2FWAA 1PJZA 3M8KA 3F9RA 4IGFA 1MJ5A 3QF4A 4ND2A 1DWUA 1QAQA 4EUEA 3PEUB 4R3NA 4V03A 1MYOA 4XYEA 2ZWIA 4NI5A 1A95A 2AEFA 2BGTA 4BMVA 1JHZA 4V38A 4NV0A 1X1BA 3N05A 3NFRA 3B6JA 1GGVA 2SKCA 4TXHA 5CFQA 3ULKA 5B1BE 4J4TA 2M6KA 2OA0A 3UV6A 1JIUA 3X3HA 3TJRA 5JPCA 2JGIA 4HK4A 4MDYA 3OCYA 1HNXB 4EF6A 4JYPA 4J8SA 2Z95A 4LGVA 4HRMB 1OX4A 1V5IA 3GEHA 3ZGVA 1DMSA 2PNFA 4HQNA 3RJVA 2EERA 4Z7NB 4ZQHA 5GJCA 4NZMA 5T3UA 4PM4A 4OYRA 1AUOA 4ISBA 5EZYB 5HFNA 4YAEA 3OH8A 4BSXA 5AW4A 4A0RA 4O25A 4F45A 4HRYA 1BOOA 2BZGA 2UYQA 3Q4GA 3PZ4A 3K9BA 3JWGA 4V1CI 1CNMA 2P69A 3HE3A 3JVDA 4QYXA 2C04A 3IUQA 4J75A 4FYPA 3SBSA 2IEIA 3FKSD 2Z6QA 4BMNA 3AUXA 3GVHA 3BJZA 3ADOA 3CSSA 5ED0A 1BCRB 4DLRA 1FVOA 5ECWA 1FNCA 4Q3OA 2BFFA 2N9UA 3ETDA 4B7ZA 1QOQB 1T3SA 1K66A 3PFFA 4TWBA 3I5UA 3SR3A 1N2JA 4BVEA 5IC6A 4GR9A 1QQAA 1TTQB 1NQTA 5JD4A 2G63A 1PL7A 1BGXT 3MTEA 4DXDA 4I9UA 3T99A 3TG2A 2AG1A 4NCBA 1UN8A 4C2AA 3K70D 2RJNA 4KPYA 4JB8P 3FPFA 3KVVA 4AY6A 4CEHB 3A3KA 3A6GA 3L1UA 4XAQA 1ODIA 4BUCA 3Q15C 1W88B 3PT9A 4EB0A 2JFQA 3ED1A 2ZUTA 2FWNA 4EVRA 1K6MA 1C50A 3TLJA 3HRKA 4EX7A 4DXAA 1B26A 4Y98A 4RV9A 3WB1A 1VKJA 2P0AA 4EYOA 5A1TA 3E18A 1KDRA 1MOZA 2QN2A 3PFGA 2SECE 2H06A 2VCEA 5JSYA 5KYVA 3MYRA 3GFPA 1H5NA 3HY3A 5B7QA 1Z07A 2HQRA 1YDWA 3TTYA 5LX8A 3DOIA 1EE2A 2YXPX 1CR0A 5JV5A 1Y3FE 2Y69E 3DMTC 1HS6A 4JL6A 5A5DA 3TKAA 2M2IA 2OEWA 4PAQA 3NCHA 4WOJA 1G3QA 5KC8A 4R8LA 3AVPA 4BLSA 2A8YA 2HFKA 3RVMA 2ZYDA 4IDHA 4AK9A 5GM2A 3ESZA 4EGAA 3M6LA 3LPZA 1LJ8A 1TNZA 1L4GA 2JFGA 1ADFA 1GZUA 1EKXA 1Y6QA 5JRJA 1SWVA 1QANA 2ZRJA 2AMLA 2J0VA 5BN3A 3AQ4A 2LXMA 3OWOA 4JLNA 1G8AA 2PDAA 1E6MA 1ABFA 4MLDA 3A4YA 1HY3A 3OTQA 4E07A 2GXQA 1PFUA 2GPWA 3HUTA 3QVUA 3SBTB 4P81A 1YCHA 2A59A 5EXDA 4KR6A 3AOGA 2IV2X 3CKBA 4M0EA 4LYJA 4HLEA 1E98A 4HZUA 3PEYA 1KSHA 5I7RA 3AG5A 3ICVA 3P9QA 3J5PA 3ILVA 3K0FB 1P1BA 2WJZB 3P8ZA 4IJMA 3RREA 3E33A 4PE5B 1YZ3A 4Y9RA 2Y05A 4U1RA 2WJYA 1E77A 1E8YA 4KQIA 2PVCA 1IHOA 4B6RA 4J8YA 5AAOA 2JK0A 4ITVA 2GPJA 4F21A 1P19A 4NZZA 4G1CA 3GGGA 4TS9A 4V3BA 1SZCA 3W7VA 1U1CA 5CR9A 2YIDA 4U8GA 2W2MA 2YHBA 4B82A 3VR5H 4FLFA 2PSEA 4TV9F 3WMEA 2CXOA 3ZE1B 5B55A 4FLHA 3ONVA 4B17A 3P2KA 5FOQA 3E37A 3BQNB 1BHQ1 3FKJA 2C8LA 3WGZA 3WNQA 2GFQA 1H85A 3DNPA 1C41A 1HE8B 4OATA 1QK3A 4MIEA 2I1VB 4URVR 4HWGA 3QVJA 2G67A 4DV1B 3IR7A 4RMIA 1GYRA 4CKXA 3IKVA 3D3NA 1M1UA 4NJEA 3NTVA 1BEUB 1ISFA 1R27A 2NXNA 1TZBA 3GLIE 2PQNA 4PONA 4FOPA 2PSSA 2D1TA 5JO9A 4MA5A 2GRPB 3LI2A 1ITZA 4DSZA 4Q9HA 3VR2A 3H1PA 1IBCA 5CM9C 3V00A 2KS6A 3RSEG 1GRCA 5F78A 1XDGA 4Y0NA 3HWRA 2II6A 1C29B 4NFSA 5CH3A 1N4QA 5EA2A 3WXMA 4ILKA 4JVNA 3GCWA 3EB9A 3JY6A 1KZ4A 2Q1TA 4BCCA 2WZQA 1V47A 3QX3A 2CXSA 2ROQA 1FF9A 1KJJA 1FDWA 5T57A 2BGGA 5JZMA 2CJPA 1SOVA 5LSAA 3BMXA 3HXDA 3QTLA 2YOFA 3TTXA 3N28A 1JLSA 4CKBB 1X1CA 3JQBC 2R47A 1ZYUA 4F9EA 2IC5A 1GCAA 4K5CA 4JWTA 4B8CB 4H6XA 2CNWA 3HADA 2AC7A 4BTEA 4LDJA 1HTWA 1QJCA 2HJSA 4TM8A 1D04A 5D51S 1E9CA 4L07A 1GRNA 2BGIA 3Q7TA 4POOA 5MHTA 2ZU6B 3A58B 3TSWA 4RPKA 3U9TA 1PTKA 3NHJA 5IJXA 4K6KA 4DCNA 2XDAA 2FW8A 1X19A 2YMPA 2XJ9A 4UBLA 1BHO1 3KLNA 1AMOA 2HSJA 5JWOA 4HNGA 4DV6B 2GD0A 3A04A 4D25A 4MQEB 4TKUA 1SNYA 1UMBA 5K8IA 3IJRA 3BMNB 3GK3A 3MWGA 2DHEA 3TWQA 4OG2A 3F73A 3TW0A 3TR6A 2QS9A 1MO3A 4PHTA 4PPYA 3FTQA 4Y7DA 5ILGA 1SA0B 1U9CA 2JGDA 5FUMA 1VI6A 2KXPC 1GCUA 3G0CA 3HKCA 1N33B 1MEOA 4ZGGA 3DZFA 3JQPA 5F3WB 4CVNA 4KPFC 1WDMA 5GTDA 1DRUA 1PJBA 1W1WA 1NBME 3THWB 1DWOA 1Z6QA 2BEUA 3ISJA 4BCBA 4BO3A 3IEVA 3OFSA 2O2SA 4JA7A 4WLUA 2HM7A 2A9RA 2GFIA 5CB8A 1H9CA 4GOOD 4XD7D 1GUBA 1O4WA 3G2NA 2AR7A 3FZEA 4XGIA 2P2DA 5SYNA 4GLFA 5EIEA 2I2AA 4Y1GA 2ZUEA 4PDXA 1YIOA 5FQ6A 3DE3X 4WBXC 2BKVA 3FLEA 3QC1A 1UBLS 1UBEA 2QX8A 3ONDA 3OQOA 5H4HA 4Y2QA 2VL7A 3MJEA 1IZ8A 4I46A 2ZSAA 1NPYA 4P36A 1E8XA 3CLHA 5KHLB 4MPPA 1JEJA 5CTJA 1PZMA 1DHRA 4Z54A 3GD7A 4HRNA 4X93A 1NNSA 3U7JA 3S8EA 2GPBA 4ZV9A 4M7PA 2NVOA 2NP7A 1QP0A 1D6SA 5AW3A 2JAXA 2CUNA 1H4VB 5E4YA 5FOTA 5CU7A 4NSNA 4D9HA 3SEAA 2BMFA 1U8UA 1UFVA 2Q4BA 4G8LA 4H4DA 5T6BA 1QHFA 1IHPA 4AJ9A 2J5QA 2N1BA 4Q05A 4M7RA 1JT2A 4G67A 4II7A 4PCVA 3HJNA 2NN3C 1ECLA 5JSUA 3QSYA 2VJDA 2DSTA 3OXGA 4S0ZA 1NURA 4R6WA 5TPWB 4ESHA 3FPCA 4NABA 5H9WA 4BKPA 2F4NA 1ZJ5A 2ERXA 4J07A 5HIMA 4B6PA 1KVSA 3IA2A 2R1UA 1DFGA 5DXJA 4JC8A 2QORA 2QVZX 3MUFA 1W0KD 5JBNA 2WYVA 1KH1A 2GI4A 1DIHA 1YDMA 2WMOB 2I80A 3CKLA 5L4NA 3ND9A 1NU8A 4R0VA 2PVSA 3F67A 5H8WA 1D5CA 2RHGB 1UJ5A 2OXFA 3DP9A 4QODA 1IONA 1DNPA 3EZLA 4ZIRB 1E0JA 4D4LA 4WASA 3ICOA 4XYBA 1WSWA 3MCAA 4HORA 3B1ZA 3FOBA 2OB1A 1ZSVA 3NPAA 2WF7A 4ZHBA 5L8VA 1DC7A 1MFZA 2EBWA 1N2XA 1UKAA 4LS3A 5K3DA 4X41A 5K0LA 3AW9A 3ZE9A 1V4VA 1NY6A 4LK3A 4IUDS 1KVTA 4DCGA 4MRRA 1XPOA 3A6HA 4PNHA 4MS3B 4TQAA 1GPJA 3MQ2A 1L5RA 3KKLA 3CSTA 2B61A 3OF3A 2J4CA 2PO5A 4DYVA 1T34A 5M04A 3TQHA 1ACJA 4OHBA 3ROKA 5L53A 3ZV5A 5GMOA 2H2IA 3JQFA 2ZJYA 2ATEA 3OM1A 4NBWA 5ALQA 3F6CA 5A3VA 1K63A 4U6NA 4RZQA 3ZQJA 3B7PA 4G24A 2XMBA 4B4UA 2I6HA 4BVAA 1JZQA 3L0CA 4XUDA 4ZCMA 4ML3A 2Z6UA 1FPQA 2XUAA 1EFRA 2GD2A 5IU6A 5DN6A 3C3OA 1WS6A 5BW4A 3QK7A 4MHTA 2B2XA 1Z7WA 4UQZA 2E55A 3RYCA 1N5OX 3T1OA 1SXJD 3L41A 3H4TA 4KQHA 2JJ2A 3FMVA 1FDSA 2X5XA 5J1TB 4XW2A 5JYEA 1JKJA 5HUQA 4CHGA 5ALIA 1QBQA 3MVEA 4C01A 2VOEA 3IE2A 3ZQ6A 2XYVA 1OFUA 1LDNA 1R8QA 1TTPB 3EBLA 1WQ3A 8ADHA 5AVQA 3F8WA 3RUDA 2Y4UA 3ZGYA 2FJ0A 2JLAA 3SF8B 3HKDB 3HXBA 3BB4A 3K1YA 1CV2A 3RS3A 1TCCA 2D1YA 3M6WA 2ZIXA 3OPXA 2AOVA 2ODTX 4OKNA 4EDFA 2CD9A 2CG2A 3ZBTA 1SC4A 2EIKE 1N0WA 1X7ZB 2J7KA 1L5KA 4POAA 4BWVA 3R3JA 3C6BA 2CJYA 5E6RB 2VQFB 2XBLA 3Q8WA 2PGIA 3A2LA 4G5YA 1U31A 2DIWA 1E6EA 1EJBA 1UPAA 3LW7A 5FI5A 4DDWA 3ZN3A 1Q0UA 3RHSA 3G2HA 1YFJA 3O1IC 3EDCA 4Z51A 3H5VA 4MBGA 5AVTA 3CE6A 1NP7A 4LWZA 1Z29A 2GILA 3O9ZA 3T95A 4OAPA 2PT9A 2FPWA 1Z73A 3IE1A 3CH6A 1DT3A 4YCJA 1P4AA 4IM7A 2CLCX 4MO2A 4B3RB 1RZ4A 4GI5A 5E4JA 4QM6A 1RW2A 2DT8A 4BMDA 3O9VA 1C4WA 4IDDA 5ICCA 5BWLA 3G17A 4L8WB 3O8DA 4F8YA 3WQSB 5HQ3A 3U81A 3S68A 2Y6VA 5JCJA 3VDNB 3LEWA 1FCJA 3ZWXA 3O8NA 3G2QA 3ZE2B 5FQ4A 4HLDA 4CTKA 1UMDA 4IXMA 3OIDA 3O7MA 4OSEA 4XVRA 3RODA 1K4KA 1VKNA 3EU5A 1GRRA 4PZZA 3UC5A 4RTSA 3Q6NA 4A8JA 1ULHA 1Z37A 2QMYA 4L7QA 1IFXA 3B78A 5KYXB 1XYGA 3LPDA 1BDMA 1U2VG 1YDEA 3WL6A 3KQOA 3JCZA 1U0GA 2P91A 3NQ41 1WHTA 2JFUA 4YQFA 2P9FA 5I4IA 4XQ0A 3ADBA 5K1ZA 1SC9A 3MGBA 2Y0DA 4PCUA 2QTGA 4OSOA 1E4EA 4AJKA 1C81A 1XRQA 3ROMA 3LL7A 4DY4A 3MJVA 5FHQA 2L42A 2FFHA 4P4SB 2A35A 4PSAA 5IMSA 1NC1A 4KQCA 1O8CA 3ZW3A 1XCBA 4M9CA 4F46A 3T35A 3MAGA 4W5NA 2VSXA 4QBKA 2FMXA 1ZGJA 4GKVA 1ISIA 4ID3A 1EWYA 1BTOA 1PSDA 5E7QA 1JLRA 4GBGA 4RPCA 4WNEA 1H0RA 1P1CA 3O2NA 3BA1A 1YR2A 1F2UB 1M8JA 4Q02A 1JHQA 4B6FA 2MMGA 2WM8A 4TTRA 3QA3E 4Q7QA 2CLEB 2FX5A 2JI6A 3U6BA 1NW9B 1V43A 3TWXA 1YDGA 2YC4C 2H2DA 3IJPA 2CLDX 3ZE6A 1G7CA 4H9GA 4WJLA 4MLZA 2RHRA 4DLLA 1P2TA 2FKNA 2LE0A 2R84A 2F4VB 5L7TA 4LQDA 3CG0A 4JXTA 2G07A 1DT5A 1PZEA 1V8FA 721PA 4LHYA 1RPNA 5EESA 1OIVA 1C3XA 1MAAA 1WULS 5AI5A 5EZYA 4E1VA 5KTYA 4MEJA 1Y1TA 3R41A 2R6GA 2CFUA 3S7DA 4HDMA 4YRSA 4EZEA 5HKKD 1HLPA 3N74A 3BH7A 4UM9D 3B5EA 3COZA 4XH9B 1CUZA 3SAJA 3S5JA 4DNOA 1KY4A 5EZYF 5ILQA 4BMPB 5J58A 2V5VA 1ML4A 4HYQA 4C04A 3OEHD 5DYNA 3TKLA 4WLOA 2O14A 2LAHA 1ZONA 2FJUA 4X97A 4F8EA 3M6XA 4RYLA 2RK6A 2CSXA 4X6XA 2P2YA 4JX9A 5C3UA 2ISSD 3ZX5A 1NLYA 1ZIXA 4X1OA 2VGYA 1CSEE 1QTIA 3MF4A 1NRWA 2VPTA 3PU6A 3WFJA 4YP6A 1JLLA 1G0OA 2P5YA 2QTTA 3ELBA 1UAAA 4BVLA 4FB4A 3Q3EA 3K5IA 1N6RA 1H0SA 3UCXA 4BQSA 5KHOC 1GQFA 2AUNA 2WSBA 4UCQA 4K2HA 3VI4B 4OHYA 3QE0A 1BS9A 5EWLB 3FAKA 4RU1A 3RJMA 3FDXA 5B5SA 4GZMA 3COVA 2DQSA 4MOWA 5EQJB 2Z1NA 4OYHA 3SQVA 4YV0A 3JQDA 1YQDA 1U81A 2WWWA 2KZTA 1Y1KE 1MG5A 3CV0A 2XUQA 2FAXA 3RUCA 3EHMA 3TQTA 1AN9A 3OCUA 1HH8A 5BPFA 2WINI 2IZ5A 2ZJBA 3HPQA 2HK9A 1LVUA 1SU6A 3KQTA 4RCVA 3W0LB 4KR7A 4K86A 4LVCA 3SYMA 1I80A 5JNWA 4QXOA 4UKDA 1K5PA 1ISSA 2G83A 4ZKEA 1JQJC 1AKYA 5FULA 2IONA 3CX6A 4FX5A 4EFDA 2JRLA 3OQBA 2HCFA 2VTVA 2BFBB 3NIDB 3MT7A 2BM1A 1UWVA 1CUWA 3WYNA 1N0QA 2BE7A 4LJ5A 2Y1CA 2YL2A 3TAHA 1G41A 3ZD8A 3RU7A 4DTIA 1DG1G 1N2ZA 4BE7B 5CTAA 1OAAA 3ABOB 4ECAA 1ELRA 1MKYA 5KJCA 1T9DA 3OM9A 2RDMA 3V31A 4Z0NA 4GOJA 2JH9A 1N6IA 5SY6A 3K0FA 2WUEA 2X22A 5EEHA 2WC1A 5EN5D 3GUZA 2HKIA 4S0XA 4XGQA 1P45A 2KLHA 2VJPA 3V46A 3GG9A 2AN5A 1VDYA 4QPNA 2BRUA 3K8YA 3ZVVA 4RA9A 2ZRFA 4YJ2B 2BHLA 1TA9A 1XFDA 4ANWA 1VLVA 3W5AA 3V8PA 1P2FA 5T5QA 4YYEA 1Q0SA 3OJ0A 2YMQA 2GPTA 1IM8A 1P2SA 3IEPA 1Z8NA 1I4WA 1GO2A 1Z4KA 3PSHA 2HCJB 3CEJA 3PCRB 5FI3A 1U9IA 4QARA 5JCZA 1Z6GA 1E2EA 3T4EA 2IK8A 1RQLA 3FWYA 4ALJA 2ZTMA 1JQBA 2GZRA 3ZXSA 1H1LB 1NM5A 2QTFA 2V6FA 2YINA 1SURA 1GTVA 3IUMA 2LSVA 3H1TA 3DOHA 2GRNB 1TKRA 3HXPA 5CG1A 3K31A 3L0ZA 5CDHA 4X90A 1G63A 2C20A 3DF7A 3E8SA 2FGKA 3KTOA 5KNBA 5HIIA 5EX0A 2AQHA 4MR7A 5ECDA 4J7UA 3GN2A 1T6YA 1AUXA 1US8B 2O7VA 3RSCA 2P3SA 1CJUC 3O6VA 1J9GA 4N5DA 3ZK7A 3ONNA 2EZ8A 4V0MA 2Q3FA 1OYOA 3W5DA 2J5KA 2N75A 3WGMA 4NZPA 1NVXQ 1IHDA 3ZR4B 1QQBA 1TVKA 1TYAE 2Z0MA 5FL7D 1N2HA 2PO7A 3K09A 3TO5A 4PLGA 2CV0A 2ZEJA 3IHTA 5F3RA 5I9LA 4WT7A 1V5WA 2QUHA 5T4HA 1R50A 4W7IA 4ZOBA 2JIOA 4HI9A 3SHTA 1C3OA 1T4CB 5CDFE 5GIPE 1Y9AA 3RJZA 3R3WA 2I1KA 5BWBA 3MCWA 4JBLA 1HEUA 3V42A 3FTPA 3N53A 1TD9A 1M8PA 2XPZA 3T7CA 5GIOE 2JCGA 4ZRNA 3NVDA 4WGFA 4BNDB 3DSXA 2Y0BG 1Y63A 1SR8A 4AULA 3TW4A 5JQWA 3FOEC 3T3PB 3WHLA 3WA7A 3EGVA 3E30A 2J7PD 4XWWA 4DUGA 3T4PA 4EKEA 2D13A 2HT6A 1CC1S 1G3IA 3BMNA 1YE3A 2IS2A 1T1SA 3VKHA 4I1YA 1YZLA 1G1AA 1S7CA 4S1TA 1R8JA 1FXUA 1N0HA 5DGXA 1JJVA 2I6QA 5JNLA 5JMWA 5LZ2A 2BUCA 1LPSA 2EHJA 5CMWA 4ZQFA 3E70C 2YDXA 3F5DA 2XEXA 3WLLA 4C0KA 3WXXA 1N77A 4MWZA 5A1JA 4FR0A 1J8MF 5AVKA 2QUBA 2QSYA 1GQSA 4HNSA 3T94A 3GLFB 3V32A 1EJ0A 1MV5A 3BRSA 1MHTA 3NXKA 1P77A 1EA5A 4HL6A 3QEOA 4JLBA 3VDMA 4N47A 3QW2A 3LVQE 4G8DA 3KSRA 1NW5A 3DEYX 1EQUA 3N39C 1IIBA 1C3JA 1JDBB 2H0RA 4G1TA 2O2EA 4R2KA 5CEEA 1YJQA 2B78A 1DDGA 4CCYA 3G5AA 1I51A 1X6VA 3T5PA 1P75A 4QOHA 4I2VA 3UMMA 5KJKA 2UU9B 3EWIA 1MC1A 3U7FB 2J4DA 4XZ4A 2EYQA 3T9KA 3IESA 3OE4A 3K0EA 3DEOA 3MX3A 3D3MA 3VPHA 3EXIB 3L5OA 1VE7A 4ZQIA 4LJAA 2G5CA 3PC8C 5SY9A 3RO7A 2JHFA 3I5MA 3L84A 3OECA 1Z26A 3L1HA 2EFHB 4PC7A 3CH4B 1VA4A 5KAPA 1Y3DE 3DLAA 1NYRA 3L8HA 1E1LA 1OLOA 2J4FA 1Z16A 3BJEA 2REOA 1KYVA 1U02A 1JR3E 3ESXA 4N5QA 5DEIA 4AMGA 3N70A 2ZIAA 4GXTA 3LDFA 3KSLA 1HNNA 1Y7PA 2YJ6A 1G1MA 4Q21A 2PLAA 2H5LA 2LW7A 3P52A 1QOZA 5TPWA 2MSEB 1IZYA 3W6OA 3QU2A 1FBTA 5AUPB 2NSJA 2J33A 2VOJA 4YDYA 4J1QA 3A70A 3G9XA 2OCXA 4MH0R 1FRZA 3M6VA 1XF9A 3SVZA 2QRJA 3V2XA 2JBHA 2PA3A 1CF4A 5EIBE 3AF3A 2IY7A 5IBPA 2YRFA 1M76A 2WMOA 1OJ7A 2I2XB 5ALMA 2JH8A 4U39A 3CNOA 2A2ZA 4YLEA 2J3LA 1SBQA 3LKBA 5MF6A 3GHHA 4HB5A 4QPZA 4E2XA 1XJ0A 5DMXA 4DA0A 1SCIA 4HTFB 2IYTA 4INJA 2P2CP 2ECQA 2ZAIA 2WXRA 1OBHA 4PQGA 5C51B 1G5IA 4UQLA 2PJUA 1ZOLA 3MRSA 1NWHA 3UMCA 5G41A 2QY6A 1D8EA 2CXRA 3U4QA 4F3VA 1RAIA 4HTAA 3KJFA 2PYZA 2XE8A 1MAHA 3TPCA 2GYYA 4IG4A 5LFAA 2FW6A 4M46A 5D3QA 4F93B 1W2WB 4WK0B 3QX8A 2PGNA 2P9IG 5I9SA 3E0QA 3LV8A 5BW6B 1FW6A 3FUKA 4B3JA 2J6IA 4OQFA 2ZQZA 2E2WA 5BVHA 2PY6A 2HDWA 1DQNA 2HYDA 1O9GA 1P80A 1QONA 2IUFA 4J2HA 1TUIA 4BEBA 2VPIA 4OX9B 2W6JD 5JJKA 3L6BA 4JI2B 1Q1BA 4IOJA 4HAUA 1OZ0A 1GW6A 3FCCA 3ZKWB 3ABZA 1GRVA 1TJYA 4B7AA 3MMZA 4Q16A 2EKPA 1KC3A 1TAGA 4ZMSA 3GRPA 3L7MA 5EJAA 3OZEA 5A5FA 1NVWQ 2C9BA 1GAJA 4ZV4A 5D2MC 4GLOA 3OZWA 3W06A 1GXSB 3D8HA 2ZS9A 1E6UA 2B35A 3TS1A 1SBTA 1IJFA 3WK9A 3LIPA 4BMOB 1G19A 4BGIA 1CUEA 1XGWA 1MG0A 5J1SB 3OT4A 4XX0B 1H6OA 5KPJA 3KEZA 4G9GA 3T34A 3VUFA 5K99A 5FEMA 4F6RA 5EMKA 4QOGA 5LOVB 4LMPA 4QUEA 5BVGB 1T43A 4JLJA 3G79A 4OLHA 4EX6A 4ZOLB 4TZTA 2QRUA 2IY0C 1K2WA 4LWQA 3FFTA 5E6RA 3W77A 1YQ9A 3GOQA 1RW4A 1P1HA 3QWPA 2MR5A 3KJZA 2MRIA 1U98A 5KQPA 1AV6A 4YASA 2V4UA 3W05A 3DVRX 2X38A 1WX1A 4AN0A 2W4QA 3A6KA 2ZB2A 3BRWA 4B46A 4YIHA 4JMLA 2CL0X 3DE1X 1IG0A 1LLCA 2DB3A 3CLVA 3FPKA 5CT6A 2HUPA 3B6EA 2DFTA 1TRHA 2CNKA 1QQTA 4KR2A 3WFIA 4G5QA 2AOWA 1WZEA 5HXAA 2A14A 1V8ZA 3QKWA 3GWZA 3L06A 5LL6P 4JJKA 3EIUA 4RWZA 1GZSA 5K5EA 4NAVA 4X94A 1KHTA 2W6IA 4FE3A 3EYAA 1V8BA 1Z2CA 3PGMA 3KKOA 1RM4A 3DLCA 1B0AA 3EZ2A 3L17A 4N49A 4WZAE 3SYKA 4Y6GB 1SEPA 3UF0A 1QHSA 2DULA 3N8HA 4ZVLA 1YULA 2COUA 3DZIA 3R5KA 1QE5A 3MOGA 5FJJA 2X8WA 3H2IA 1VMEA 1LF0A 5CCXA 2HYZA 4HOQA 4GPBA 2C07A 4OUDB 4RDXA 4AC9A 3OM0A 4GTOA 3W2EA 5D3ZA 2O2ZA 2JCVA 1QGUA 2QG4A 4C0EA 2WI8A 5TIIA 1ZM4A 1JAXA 1K0FA 2IZ6A 2HA7A 1JBEA 3NF1A 3BIJA 3O92A 1GUZA 4DANA 2IYSA 4KNWA 1Z6AA 4IFEA 3Q1KA 3JYHA 1M6EX 4M7WA 2YFKA 3NUQA 2R6CA 4P4SA 3BMOB 4BN4A 2CWWA 2A1TR 4QPCA 2P6MA 1V9LA 4I1RA 3C3MA 4HRLA 4ZYYA 2VRWA 3C3JA 3WOHA 3EAGA 3E35A 1K5HA 3N5CA 3CVNA 4ZWNA 1GQ2A 4M21A 2QQ0A 5CBOA 1B3BA 1UK6A 1F2UA 1E3TA 1W48A 2NXPA 2JAOA 4OGFA 2YICA 3A6ZA 2P1DA 1Z7GA 2OCCE 3G89A 4AJWA 2YHCA 4PLWA 2D3WA 5DCYA 1BX0A 4O60A 2W9XA 1ISRA 1KSFX 5K0TA 4IKEA 4MUJA 2A1IA 2ZZKA 2Y1EA 3GEPA 2Q5JA 4QHTA 1VHTA 1IXYA 3I5XA 4DILA 2EGGA 1YZHA 1W85B 5TVGA 5FRDA 1NUSA 4OVVA 5HG0A 2Y4NA 2GA9A 2VQ3A 5FBLB 1Y0BA 4LDZA 1LF8A 2FPSA 3DNMA 5JNVA 4C30A 2NUPB 4UNRA 3QELA 3QITA 2E5LB 4EA6A 4ZFNA 3JCKC 3NO4A 3ILHA 4DMKA 1BMQA 2BSQA 1XQ9A 4RHCA 4PZUA 2DHQA 3QDNA 3RASA 5HKOA 5B30A 2R8XA 3Q41A 1L5YA 1G21B 1XQ6A 3R0QA 2P7IA 1MT3A 1JVBA 4DKXA 3LL4A 2RIRA 4A0SA 3DLTA 1WBBA 1SUFA 2VP4A 2FRDA 8ABPA 4BGVA 1DI0A 2G9VA 5LXTB 2CXHA 2OHHA 1CUIA 4NV3A 2Y0EA 2RK3A 4HN2A 2ZPUA 3RGGA 4WECA 4YVOA 2I34A 2V7GA 3FEYA 3NETA 2RGUA 3BFXA 3R7FA 5F23A 4OHKA 4YAUA 4ZDIA 1JEYB 1A9TA 4H17A 1J8FA 4N8EA 2RIPA 5JC1A 1ZJJA 4OB7A 3KR1A 3ZWOA 2Q45A 3DC2A 1N11A 5EWLA 5FFMA 4AMYA 1ZJ6A 3ITEA 5TJHA 1DCEA 1ZJZA 4NF2A 2BW0A 3DFFA 4WZ6A 5J63A 3DLBA 2ADMA 4MYHA 2A5JA 1KQFA 4DV7B 2XZPA 5LQJA 1T0JB 4LAFA 1R4NA 4LHWA 4K26A 4PIMA 4INOA 1VDZA 3GFFA 5DI3A 4F2HA 4CL0A 3S1AA 5FPTA 4KGVA 4OBWA 4O6FA 1P4SA 5J4VA 1UOOA 2KW5A 1DIBA 5B7GA 4EIWA 3NAZA 4A5OA 2RGAA 3MJRA 2Y4TA 3UANA 3W6NA 3IDSA 3I2JA 1M66A 3MA0A 1S2MA 4BPRA 2DWZA 2DAPA 3CR7A 1XEXB 2A3NA 3R3YA 1QGOA 5SYMA 4CYMA 1OF1A 4PN7A 2VBFA 1KPHA 4QZVA 1VSQA 3DA8A 3EVTA 1M74A 5EJGA 4FBLA 2FUNB 4R1PA 2BFBA 2Y71A 4PX2A 4DLQA 1RS0A 2ZSIA 3Q88A 1XTJA 3U5ZB 3MLAA 3WLEA 3HI6A 2PS3A 2HRDA 4NOKA 3NDRA 4HGPA 5HX7A 3WBJA 4KU4A 4BZZA 3I1YA 1UKZA 2VK1A 4QJIA 2E21A 4YBZA 5JJ7A 2WHRA 4TTQA 2FHSA 4OXXA 4V02A 2XNJA 4MYDA 1YR1A 1QVAA 1XXHE 4PZDA 1WDWB 1RKUA 5AM3A 2WM3A 1JPNA 3A7EA 1WZNA 1ZLYA 1Y4UA 1IIRA 5JJ5A 4RL6A 2VP0A 1V7PC 3V30A 3DDUA 4GCNA 5C9ZA 1K08A 4OM8A 4HXEB 4U02A 3OPYA 1R88A 4JC5A 3G0HA 5LP6B 1MO5A 2Q49A 1Y8ZA 1R0KA 2B8WA 2ZBDA 1EJ6A 3T7AA 1B2LA 2CT8A 3DJFA 3FUVA 4DR3B 1O94A 2OMEA 5LD2B 3LTNC 1G7SA 5KOYA 1KH2A 1NUTA 4IYRA 1CUAA 3DMPA 2F3RA 4L78A 2ORVA 3GJ7A 1G8JA 4R2MA 3HO1A 4CLOA 5GONB 5E3HA 3O38A 2I99A 3O4FA 1H1LA 5EJ2A 1TM5E 2ZRBA 4UU7A 2O0LA 2BZ1A 3MD9A 4HGOA 2B9EA 5ITWA 1Z0IA 1BE0A 5AR1A 4BQOA 5EHXA 1RABA 4EUNA 4CQMD 3NBQA 1KK1A 1RZ3A 3FPHA 4QLAA 2DH6A 2IE0A 3NIBA 1WLYA 2RGWA 3I1JA 3JZDA 4QQFA 2WQ7A 2ID4A 3EQ8A 5H80A 2PZAA 1KETA 3D4IA 1US8A 3P96A 3VHLB 4H3SA 1G16A 1ABEA 3IMCA 2O6HA 4OA8A 5A9TA 2PH1A 3GFGA 3GN1A 1SB8A 2ONJA 3VJLA 3I4RB 2EDCA 2EFGA 3EN0A 4C5CA 1EK6A 5D5PA 5FR2A 4HX5A 3TL5A 4WWPA 1T4CA 2B4AA 1E2DA 4ADSG 2QVCA 4I4CA 1QZXA 3G2PA 3D0OA 2WKSA 3LNTA 1BMTA 2AA3A 2CZCA 1O5TA 2NZYA 3QBTA 2WMNB 1XRRA 3UKOA 1JDVA 1LXCA 3GDOA 4QA9A 3D9OA 2QMQA 3ER6A 1XL1A 2P2SA 4V3CA 3CIAA 3UT7A 4R6XA 2IBTA 4HFRA 2Z1MA 2ZYGA 4UHCA 2HTEA 5FJIA 4BNDA 1VJCA 4IDAA 3QF7A 3I6YA 5JMND 1ZQ9A 1D1TA 4B6JA 1GHTA 3VPBA 3WLFA 2PLRA 1UAGA 4XYMA 2NO0A 3O8QB 3QLUA 4D41A 3EDYA 3CXUA 4RIHA 1FQOA 1D4FA 2H1RA 5HF8A 4OD0A 3QIAA 2QC9A 3DKRA 5I7OA 2FZLA 4GWKA 5C2JB 4I8XA 1Z83A 3V8MA 2AFVA 4KQJA 1Y33E 4EBAG 2ZIEA 4MUKA 4PIPA 2N3ZA 3CK7A 4CUJA 4UREA 4BRWA 4GSKA 3JQFC 3O31A 3AK4A 3U3RA 1O5MA 2RGEA 4S12A 5FZSA 1K75A 3PHLA 1UKYA 1J2TA 2QUIA 2H1IA 1M2FA 1VIMA 5K51A 3U7IA 4BTVA 4F9GA 1UINA 2B20A 3T8KA 2QMZA 5LLSA 5TDHA 3GLFA 4IDNA 3DDCA 4W5OA 1DB3A 4P3PA 4KLRA 5HJ5A 3A9SA 1SBYA 4FDUA 1PSWA 2CLLB 1GKYA 4W1SA 4N7JA 1U2GA 2OHGA 1GDDA 5ADHA 5DLYA 5BV0A 2GGSA 2JFOA 1M7BA 2ZJ1A 3FOCA 2IW1A 3WB0A 1GAWA 1G18A 4HO1X 3KKKA 4AJPA 2C7VA 5B1HA 2AJAA 1USGA 4Y8VA 1NG1A 4WQMA 2HIGA 5IBQA 3TCNA 3DE6X 3OFNA 3FBGA 2PD4A 4W5RA 3C3EA 2EZUA 3EXIA 2E49A 3U4IA 3EZFA 4X6LA 1QF6A 1OAOA 4U95D 3TXYA 1G5FA 1SJ9A 2XOXA 4M0PA 3Q49B 3AU8A 2FPRA 5AK3A 2RSLA 1EFAA 5B3AA 1BGVA 2F3SA 2PV0A 1XGKA 1M2WA 1MP0A 1PJTA 3S0JA 3C3DA 1UM9A 3FTVA 1N5IA 3NAMA 3B7GA 4R2WA 4X1KA 3UVEA 1Z56C 1OT5A 4S1VA 3AM1A 6ABPA 3FJYA 2HPVA 5CG2A 5CNKA 4URXR 4B44A 3O4IA 1Q0QA 4WJKB 5LCWC 3O8OB 3HXLA 4D45A 1TMYA 4XQCA 2I03A 3A4MA 1XAHA 1TMOA 4PYQA 4EM6A 4ACLA 3QNKA 3COWA 1JWAB 5FUBA 3AB3A 2ZSDA 2OZKA 1NW7A 1IATA 4NQ0A 2FKAA 3NOXA 1E2LA 2YOHA 1K4MA 4BQPA 1QRRA 3YASA 3LUFA 2D1QA 3HDYA 2EL7A 3DL2A 1GLGA 5KVSA 3TG4A 1RWPA 5B1YA 1U2ZA 3IEXA 2QU7A 4AYXA 3H42B 4D4IA 2LD4A 1U4OA 5DIFA 2DZOA 4L1KA 4GMGA 4US0R 3AUKA 4FHKA 1YZVA 3OIFA 2L9BA 3N3BC 3P0IA 1W73A 4HTFA 2C2MA 1L8OA 1GN9A 2GZ1A 1CK4A 3MBKA 3ZNNA 1B6GA 5FUWA 2QE6A 2OBBA 4A8JC 3B89A 2FGJA 4P7FA 4B33A 4FE4A 5TX7A 4WKGA 2DPHA 1TJNA 3IEUA 1JAYA 3F6SA 3JWJA 5LDDC 3MJHA 3SX4A 5G55A 2FK8A 2AKEA 1DTEA 4LYHA 3OLXA 1AK2A 2W2VA 4RHTA 4XVUA 3L43A 3R3HA 3ITNA 2WTUA 4G4SP 2WUDA 2IHUA 1XTRA 4C0AC 1UJMA 3PICA 3C6YA 2XMCA 1R4AA 5KJEA 1MDFA 3CONA 2YCLA 1EI9A 4JJFA 4QUBA 1AHPA 2Q50A 4HB0A 3IAM1 2IEDA 4K5BA 2QGZA 4RUKA 2I91A 3H3FA 3ZYMA 2IXFA 4O8CA 3H87A 1Z6TA 2J8SD 2E85A 1XMXA 3C4QA 2GZSA 1IE3A 3U1BA 3OMLA 5F7XA 1WDYA 3UJ6A 4Y3UA 1K8XB 1HFAA 2JCBA 2YWBA 4C1BA 5IS2A 5DHFA 1FYDA 2D1FA 2G9UA 5IT0A 1D8DA 2IVZA 4IX1A 1W4CA 4OHXA 4DE5A 5EJ5A 2GKSA 1Y8QB 4R0NA 2DWQA 4AJJA 1WBJB 4BWGA 2QNBA 3SXUA 1J33A 4Z1MA 2PV7A 1H2HA 2DZNA 1BROA 4RMJA 1TJ5A 2VVTA 4D5GA 2ZYRA 1GXSA 1SPBS 4HC4A 3KOUA 2IYXA 4WNFA 2OUIA 4U7EB 4XVQA 3RFXA 1UG3A 3SOZA 4BLUA 5FF9A 2YV4A 4UE3S 4UM8B 5B12A 3V8VA 1JIIA 3A4NA 3C24A 5ETJA 1JHVA 2OWEA 2GBCA 1TAHA 3RYIB 3HC7A 2XCRB 1AGYA 1CUYA 2OFWA 1OILA 4BXOB 1ONPA 3STXA 2XDYA 1U0BB 1NR5A 4JJ6A 2GXSA 2FZVA 1QPBA 2FX2A 1FU8A 1NGSA 3EPLA 2P9YA 5C8XA 3EA0A 4JYCA 5E0KB 1A7KA 3HVUA 4A5SA 2JLXA 3NC1C 2I7DA 5EN4A 5FOUA 3MLBA 4O2LA 3WJ7A 4KVMA 4IMPA 1Z0KA 2V45A 3W2IA 4AZSA 2KCLA 2PSHA 4LJSA 1JIKA 2OYSA 1M2VA 1GARA 4M8LA 1R2QA 5CITA 3DHYA 3RANA 2DFKB 3NHPA 1G8HA 2QVLA 4PHGA 1NI3A 5ANRB 4LVOA 1ZL0A 1VHWA 4TTAA 1DDOA 1J2UA 1GGEA 4C89A 5DCLA 1ZIYA 4QNMA 4R8SA 2H92A 2XNDA 2DQZA 2LDXA 3KUCA 3OZVA 4W82A 2GHIA 3FHEA 3FN4A 1Q7GA 1QCDA 1XZCA 2AN4A 3GD5A 3Q2OA 1Q0TA 3A6FA 2MYPA 4ZU1X 3C0KA 2AJCA 1L4HA 2LDBA 3HXMA 1WVMA 2ORWA 2C8JA 3ZOKA 3HUUA 2X58A 3NDBB 3PB3A 2GO1A 3K9LA 3P2JA 1KOFA 3F4BA 3W3AD 4RGVA 4MSUA 2X19A 3R40A 3ASUA 4LJ4A 3FNBA 3HNOA 3REQA 1KZHA 4K6OA 1QRTA 4KIGA 1XTVA 5J4KA 4ME6A 4C48B 2O7SA 3CZ4A 4PGHA 2IS6A 2P9GA 4IDFA 3V4LA 4MVJM 3GROA 3HL4A 2AKAB 2PKEA 5T4BA 3GPIA 4DSTA 2PK3A 2HMUA 4HRXA 1Y1SA 1LLUA 3A2NA 4EY7A 4XRRA 2K7ZA 1KC1A 3OD1A 3ZWVA 4HS4A 1JQDA 4Z9AA 2F3PA 1V71A 1VJ0A 3BXEA 1TQ2A 1IBLB 1A77A 2EJVA 2QUAA 5A6SB 2XKAA 4ZVVA 3W79A 4S2UA 3B53X 1EVQA 5EWMB 3D6VA 4J3FA 2FXIA 1NA0A 3SSAA 4EFKA 1RAHA 4XJTA 5K3CA 3I72A 3EC2A 4Z4QA 4MRPA 4DNFA 2POQX 1UFKA 3E9RA 4Q47A 2YR0A 3EIEA 1EDUA 5ADVA 4EPVA 5A0TA 3LCVB 3ESRA 1E61A 4KRXA 3E05A 1JEQB 3D5QA 4JH0A 4YCDA 4YQEA 2I65A 2BRUC 1J21A 5EHNA 1IH8A 3GEDA 3G1TA 3DO5A 3K70B 4YUYA 1RBZA 1MB2A 4GXNA 3GA5A 4Q0MA 4PY2A 4B45A 1WU7A 2NUPA 4U63A 2JF0A 2JLBA 4CF7A 1VI2A 1G6OA 2GM9A 5JBIA 1U9IC 1EG7A 3ZWMA 1FUEA 2B21A 1NM5C 3TE7A 3VVMA 2YINC 4UVDA 1SCQA 2VNAA 3MJDA 4N7MA 1F5NA 2VJLA 1RWOA 3TR0A 3FWZA 5HCIA 1UADA 4ZVQA 1WV1A 4GE0A 2IV7A 4D9CA 3QNMA 4X8OA 4D81A 3IMEA 5JH7B 2VHWA 3VQTA 1G5HA 5LXTA 4EZJA 5HDBB 3P32A 2IYEA 3EDQA 5ALRA 2OXCA 3HBJA 2QJWA 1DKOA 3PEUA 2WVJA 2GA8A 4YAFA 1KPIA 5DGHA 2KWIA 1EP2B 1MTOA 4HQ0A 4JU9A 4LX8A 2Q9UA 4D8WA 5LXTF 2NZ8A 1GGNA 2XUIA 3LHDA 4E7PA 5I3ZA 4JJ8A 3M9LA 3LM8A 3EFHA 4YMHA 3PQDA 1A9RA 1TCVA 3H65A 4L5JA 3T6KA 4AZ3B 5HRYA 5ECGC 1B8OA 3KYDB 5DU2A 4YRQA 2UV8A 1HZZA 1E8MA 1CZNA 4NY1A 4TVOA 4CETA 1T2FA 1U65A 2JLCA 4XOUA 2VWPA 4J6EA 4OKIA 1NRIA 4M86A 2Z4TA 4EG6A 3SXPA 1TLFA 1JF8A 2R1VB 1XVIA 2UZ1B 1Z6ZA 1NQUA 1PNTA 3AKCA 4N01A 3O75A 4IJ5A 4L8GA 1YQGA 2P2LA 3G0OA 4GZLA 5B4UA 1I1QB 4ZAWA 3MZ0A 3S2IA 1PT7A 2CZGA 3D8NA 5DASA 4NMXB 4C0MA 4UUMA 5BWOA 2WXIA 3BG5A 1D2RA 3GPBA 4LHXA 1PX2A 3RK0A 1YL6A 2JLUA 1J42A 1IZZA 4HB4A 3U4AA 2GTHA 1K9VF 5DW0A 2R3SA 3QPVA 3LFTA 4FTWA 1MX5A 1B89A 4FILA 4WFJA 5C8ZA 1NYTA 5B4VA 5K6RA 2UKDA 4L51A 4YPFA 2YHSA 3L7BA 4NJMB 1BCRA 4EFNA 5LJLA 1WZUA 2Q6KA 1YAJA 4GTRA 3PJEA 3II6X 2FW0A 2ZRAA 3WMGA 2X8LA 4BB0A 4ZJPA 4PFJA 3WLMA 4E2ZA 4GSYA 3FUUA 4R8MA 1DBVO 4NK5A 3WS7A 4IS2A 2V3CC 4D46A 1AZLA 4MVJD 1YTLA 3L7YA 2JG3A 3QSGA 3ROXA 1JPLA 3S8MA 4RNCA 1YGPA 2N46A 4OIFA 1WSAA 3O73A 2N0SA 4CEHA 4EHHA 5HRAA 2F8TA 2H54A 3TLKA 3ANTA 4BYMA 3O3OB 1Q1QA 1W88A 4LK2A 4OLAA 1N2CE 2KSQA 3T5XA 1PYDA 1JG2A 4YRPA 3RUAA 4BVKA 3HM9A 4XKCA 5LP6A 4DCVA 1EK1A 1ETUA 1FTGA 1E7SA 2O05A 2Y6UA 3B7BA 4DLSA 2E37A 2VXCA 3TTTA 5CJPA 4MKGA 3COJA 4GL2A 4X00A 1KJ9A 1C7EA 5EP2A 4Q69A 4IZOA 1M83A 1MMFB 2QNIA 2AKYA 4JUDX 1P7PA 4JYZA 1PS9A 5LP6F 4QYMA 4LC0A 2FCRA 1LB1B 4F53A 4JLDA 4EPWA 3KFXA 4RPIA 4NKRA 3BJMA 1LTXA 2H16A 3G8DA 2H07A 2IW3A 1ZW1A 1XDZA 3D9NA 3PR2B 1W9HA 5TR9A 5KU7A 5DTJA 1JALA 3DZ8A 1I6LA 2NO5A 4BX9A 1HT0A 2JGEA 3DRAA 4TTVA 2FDXA 3FFBA 3RO3A 4U7FA 2FULA 1ENOA 5HK9A 3ZV3A 1PFYA 2L18A 5CPBA 4FFRA 2OGSA 4E4TA 2A9FA 1P2VA 1BVRA 1Z4LA 2I5PO 3D9JA 1XVVA 2XITA 2H31A 4OEHA 2FMKA 4H1TA 4HLUA 1D09A 3DZGA 4A6DA 3OZIA 4LCJA 4LVUA 3E3AA 2FUG1 1JWGA 4AY3A 3KM0A 4UI9C 3QAQA 2NOAA 5EI5A 1IN4A 3UJDA 3RR2A 3WNZA 3RJ5A 4RIGA 4BNXA 2Y1GA 2PZLA 4CU2A 3TSZA 1EDZA 2IY8A 3F3KA 5AYWD 3AF0A 2WMNA 4D6XA 4CMBA 3C7CB 4HH1A 1F1BA 1U90A 2AN1A 1TE2A 5CHEA 4ZOAA 3UJ7A 3IAM6 1A69A 2J85A 3LLCA 2PAAA 2WD7B 1T2EA 1JB1A 2QLJA 3K9GA 3AY3A 1DTWB 1YQTA 3D5EA 4X62B 4HGQA 3LVFO 4UDOA 4MUEA 2V7XA 3AI3A 1AHIA 2C77A 4B4VA 3DOUA 2LKDA 4HDSB 4JHXA 5JXJA 3ZHEB 1L5LA 2IL1A 4G41A 1DAMA 4US1R 5CFRA 2WTBA 1O2DA 2PCLA 2J08A 4KK4A 4BQIA 1JXMA 5LDGA 4APFA 1A1SA 2PFGA 3VA7A 4QRHA 5GPBA 3QPDA 3GJ8A 3LBHA 1P39A 2QAJA 1HE8A 5H7XA 3LUPA 3S70A 5TQVA 4BU1A 2O8CB 5FPKA 4JQSA 4ZK6A 4H16A 4EVIA 3KJEA 4CLEA 1Z6YA 2P5TB 3GLUA 1ZAYA 4XJVA 1A8QA 4OAUC 1GG8A 4D4JA 3VZDA 1QX3A 2DGDA 3OCWA 3A9VA 3MUEA 1B4DA 1NQAO 4LRWA 2IXTA 5KNLA 3B60A 4OBEA 1DRJA 2PZIA 2WKQA 4ZODA 4RG9A 3R3SA 3VISA 4RDCA 4D3ZA 4JGGA 1EGAA 1CNEA 3LWDA 1L5QA 1ZVMA 5B2FA 1E5DA 4AIIA 4CTJA 4MQBA 3P2MA 3DDNA 1XCLA 5BSRA 4AJ2A 2HQ1A 2PS1A 2LCFA 3NHUA 5CT9A 4RQIA 4KVGA 1CULC 2XOKD 1BEEA 4N39A 4CKBA 4RY9A 1TCBA 3TLGB 4O3MA 4QRDA 1Q83A 3VVCA 4JI1B 1Z9BA 1ZRHA 5BSWA 4BE9A 2GN8A 1MJHA 1QKJA 4YROA 3VSBA 1YRBA 1C4XA 1H4SA 2ZU6A 2Y2UA 1PHRA 5AKYA 3PI7A 5EQDA 1MD9A 1M34B 4MI9A 4P58A 2PM7A 2XB6A 3TB6A 2HLNA 1Z06A 4LE0A 2E87A 5T3RA 4MQEA 3ETLA 3G85A 4XKBA 4TLLB 3ZN2A 1CFJA 4J0UA 3OICA 1SA0A 3TF5A 3ML1A 1XNQB 4RY8A 1IHGA 1T2NA 1JLMA 3DMYA 4KWHA 1DHTA 2H0AA 3TTWA 3O8OA 4ZDJA 4QO7A 3RS8A 4J49A 3GZ2A