2VSNA

Structure and topological arrangement of an o-glcnac transferase homolog: insight into molecular control of intracellular glycosylation
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
544
structure length
534
Chain Sequence
AWLMLADAELGDTTAGEMAVQRPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLAGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of an O-Glcnac Transferase Homolog Provides Insight Into Intracellular Glycosylation.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
molecule keywords XCOGT
total genus 194
structure length 534
sequence length 544
chains with identical sequence B
ec nomenclature ec 2.4.-.-:
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vsnA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vsnA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vsnA02
3CUUA 2G9UA 5DU2A 3UYLA 2X0FA 1P29A 3QKYA 3NP9A 1PYGA 1WUTA 3FFLA 5G04J 1QQEA 4RIIA 3S29A 2IW1A 2XA2A 2C0LA 2V5FA 2WQHA 2BUGA 1FTQA 4UQXA 3RIBA 1XL0A 3MT7A 2KCVA 4G26A 3SZ7A 1WUYA 3E4BA 4EKEA 4KQ1A 4CDRA 2IV7A 2MHKA 2C1XA 2F3PA 1XOIA 3HBFA 1Z6PA 4RG6A 2IYAA 1NA0A 4LEIA 3VUEA 3RU0A 4HWGA 1F6DA 1P2GA 2GEKA 3CUTA 2XCCA 3U3WA 3H4TA 4BTAA 1IYGA 2IEIA 4QLBA 4HOUA 2Q6VA 8GPBA 4BTBA 1F0KA 4GPKA 1C3JA 2PYDA 3MEKA 2Y4UA 1NLMA 2BISA 4U07A 2IYFA 3NPAA 4M7PA 1HZ4A 2ECPA 1C50A 5IKPA 3T3HA 2F3QA 5C1DA 3OY2A 3EBPA 2BGTA 4MRAA 3RJVA 4JL0A 2HYZA 1UZUA 3ASHA 2KATA 4HLNA 3LKUA 4KYOB 4U04A 4I9CA 4J8EA 2P58C 4O6FA 3C4QA 5TMBA 3S7BA 4N5CA 4HOTA 5JJTA 3CUYA 1SXQA 3ASDA 3QDNA 5TMDA 3ASFA 3ZPJA 4NRHB 1GZ5A 4BT8A 2QN3A 2VGYA 1NA3A 1J39A 3ZCQA 3UUXA 4N3CA 4GZ6A 1P4HA 1WW3A 3T3IA 3Q5MA 5HQ8A 4BT9A 2C0MA 4EQFA 4KXKB 2G9VA 5LCWC 2XCUA 3GPBA 3R9AB 5JTUA 3OTIA 4GYWA 1V4VA 2VGXB 3CKCA 1Y8MA 2PYIA 2R66A 5FT9A 3ZGQA 4M60A 2SKEA 3S7DA 3SYMA 4CTMA 4RELA 5G04C 4HORA 3SF4A 4I2ZA 2ATIA 4H7YA 1ZU2A 4GPBA 1YGPA 3OXFA 3LY7A 2AMVA 3HBJA 1XV5A 2GPNA 4J8DA 4G2TA 4X7RA 1Y6FA 1KLXA 2L6JA 4AY6A 1FU7A 2XA9A 3T5TA 4FKZA 1L5RA 3IA7A 3KAEA 1QM5A 3O3CA 2QN9A 1JEJA 1GPYA 4B94A 4G25A 1W3BA 4BQFA 2QRGA 4HOSA 1FTWA 1PSWA 3S0JA 3ZFWA 1ELWA 2YQ8A 3VUFA 3CUVA 2UY1B 3D1JA 3QWVA 4WHMA 3MT8A 1GPAA 7GPBA 2LSUA 3BCRA 2UWJG 2ONDA 1Y6GA 1KT1A 2IFUA 3MV2B 3O48A 1YA6A 4EJ2A 1M5RA 2GPAA 2X0DA 4W6QA 5KJLA 2VYIA 3URZA 2YHCA 3RHZA 3CVLA 2QRHA 2ASVA 5CCMA 2FFRA 2XPIA 2PQ6A 2FF5A 5JJ7A 1E96B 3ZCTA 4JA7A 4MHOA 1O6CA 4GA1A 5DBKA 1L6IA 1PN3A 3S28A 2FF4A 1P5QA 3LCAA 3ZHEA 1GFZA 2PRJA 5DIZA 1NZNA 3MQFA 4N2SA 4APOA 4YNDA 3EBOA 5KJMA 3NAZA 3TSAA 1FU4A 3VTYA 4KQ2A 2R5SA 1WAO1 5A7DB 3Q49B 3MTAA 4GYYA 5D0QD 3MTBA 4KQMA 4WADA 1ELRA 3MBOA 3HBMA 1KTIA 3LPZA 2QN2A 5KJKA 1AHPA 3EDTB 3CUWA 3NC4A 3HYMB 5CHEE 2GW1A 4N39A 2IF4A 2G9QA 2ACWA 3S7FA 2J9QA 4AIFA 1NZFA 1VGVA 3ZHEB 3MRXA 1C8KA 4BQIA 2QLNA 2XGSA 2GPBA 2QLLA 2PQRA 3AMVA 1RZVA 4REMA 3G2LA 4N3AA 3OY7A 1RRVA 2FBNA 5D0OD 3S2UA 2Q7FA 2AV6A 4RBNA 4I1AA 3MS2A 4XI0A 3S7JA 1GGNA 3RO3A 2QRQA 4UI9K 2KS6A 4LDPA 1OUVA 5EX0A 1IXYA 3CVNA 3WXXA 1L5WA 3D0RA 4EL0A 4J0UA 5HI7A 2C4MA 3OXLA 3G2NA 2BFWA 3L01A 4GCOA 4GA2A 4LEUA 4I17A 1AXRA 3DDSA 4AN4A 2XCIA 5G05C 2FI7A 3MRVA 3Q4AB 3SYRA 5FTPA 4WNDA 2FO7A 1KT0A 1HLFA 4U0SA 4W9RA 3RO2A 1WV1A 3CV3A 4EL5A 4YVQC 1JG6A 1JIVA 4JA9A 3H4IA 3JYSA 3CVQA 3PE3A 2QN1A 5IKOA 4UI9J 5GPBA 3AS5A 1JG7A 1Y8ZA 1FS4A 1A17A 3E3NA 5EKQD 2QZSA 2ZB2A 2HO1A 2R4TA 3GZ1A 1ZBPA 2Y4TA 3QWWA 3WADA 2E2EA 3Q3HA 4NQ0A 2LSVA 2IUYA 1UQUA 5LQDA 2KC7A 3DD1A 3S27A 3VDNB 1B4DA 1RZUA 3BCSA 2VSYA 4XI9A 5KJNA 2VSNA 4WNGA 2I6HA 3E3OA 4MI9A 5JTTA 1TJCA 1XNFA 3GUHA 4WNEA 5ARGA 3WAGA 3UYKA 2G9RA 1K06A 3G2HA 3NP7A 3DDWA 2NC9A 2JJMA 1L5QA 2C9ZA 6GPBA 3Q3EA 4NC9A 4JHRA 1HXIA 4AMBA 3CKBA 1L5SA 2VQ2A 1XL1A 3COPA 3MT9A 4BQEA 3U4TA 4F97A 3KS2A 2XGOA 3KD7A 2QNBA 1FCHA 3TAXA 3MKRA 3L7AA 3OTHA 3G2JA 4EKYA 1L5VA 5ARFA 2QN8A 2HY7A 3L7CA 3OKAA 2BGUA 5FZRA 4CGVA 2XEVA 2VCEA 3QOUA 4UQYA 5FZQA 4F9FA 2C2LA 4YI3A 2C1ZA 5ENZA 1NVKA 3ZCUA 2PRIA 1NZDA 4NEQA 3T7DA 1B89A 3CK7A 4Y6WA 4GYOA 3G2KA 3AS4A 3BEEA 3TOVA 3VTXA 2AZDA 2R60A 4YUAA 2YJNA 1IIRA 1E4OA 1WW2A 3CX4A 5TMEA 5DLDA 4ME2A 3CK8A 3GW4A 4F3VA 3NCHA 3QHPA 3RSCA 5CCLA 5FJYA 4N2QA 1XKXA 1FC0A 3MS4A 3OKCA 2R4UA 1C8LA 3OT5A 3PDNA 1EM6A 3DZCA 4N9WA 4U0UA 3T3DA 1P4GA 3MA5A 1HH8A 4GCNA 2XGMA 4MI3A 5TVGA 3MRTA 1QZ2A 3L7DA 4RIEA 2F3SA 3QWPA 3CEJA 3Q15A 4YVOA 4ABNA 4G2VA 3L79A 3AS8A 3CVPA 1NOKA 4L22A 3WC4A 2GEJA 4G24A 3CK9A 2X0EA 5BT1A 3TG4A 1JIUA 2X6QA 3GYZA 4UI9C 3BD7A 3QKWA 2QRPA 4RIFA 4G1TA 3D0QA 3T3EA 1PNVA 3RKVA 5JJ6A 3RSZA 4Z5XA 4CGWA 4RIGA 1NOJA 2PQNA 3HBNA 5LCWJ 3MTDA 3MV3B 1Z62A 3BD6A 3CV0A 1FU8A 4H7XA 4UQZA 1NOIA 4M83A 5EX3A 2QN7A 3T3GA 4N3BA 2OFFA 4IN3B 3TG5A 2QLMA 4I2WA 3C4VA 9GPBA 4BWRA 3CEMA 2P6PA 2QRMA 1EXVA 1SXPA 3PE4A 3LYAA 2H1FA 3GZ2A 3BD8A 3UPVA 2ACVA 3MSCA 2PZIA 4PQGA 1A8IA 4AM9A 4WUYA 2VCHA 3BCUA 3NB0A 2GT1A 2O6LA 2VG8A 2OOEA 1GPBA 2KCLA 5BNWA 1IHGA 4WACA 4RG9A 2SKCA 3FP3A 3BEOA 4KBQA 4G23A 1PC2A 3N71A 4XIFA 2XCBA 3OXGA 4MICA 1QKJA 2PL2A 2AVPA 2LNIA 1BX3A 3MS7A 4HOQA 3ZCRA 2GM9A 4GZ3A 2X6RA 1Z6QA 4RENA 4AY5A 3RT1A 5BW8C 5M72A 1XC7A 5HXAA 3NF1A 4I9EA 4CTNA 2GJ4A 2FETA 1YA0A 3IAAA 5D00A 4AMGA 5I45A 3K9IA 3FWVA 2IEGA 2JZCA 3ESKA 3CEQA 1P2DA 3ULQA 1E1YA 1LWOA 2KCKA 4U0ZA 3UQ3A 1WV0A 2WTXA 1Z8DA 4CTOA 4RIHA 3ZCSA 1P2BA 2F3UA 3CEHA 4BFCA 2F9FA 3LY8A 5A6CA 1L7XA 2H1HA 1LWNA 1GG8A 3ZCVA 3IEGA 3ZCPA 3Q3IA 3L7BA 3ASGA 5DXFA 2VGXA 4GA0A 4Y6CA 1UQTA 3TGOA 2HR2A 3OKPA 2XA1A 3BDAA 2R68A 4FZRA 5D01A 3LY9A 4J8FA 3C48A 2SKDA 1P4JA 3VDMA 3Q47B 3ZN3A 1ABBA 1WM5A 1FA9A 3E3LA 2DBAA 4X7PA 2JLBA 4X6LA 1JIXA 5AYWD 2AW3A 4NESA 2IV3A 3FROA 4MI6A 5G05J 2FEZA 4MHSA 4GZ5A 4YI5A 2QFCA 3OTGA 4F96A 5FZSA 4X7MA 1FTYA 2UY1A 2WPVA 4A1SA 2XMPA 1K08A 1H5UA 4WNFA 3G2IA
chains in the Genus database with same CATH superfamily
1DVPA 2G9UA 4NNOA 4U63A 3QV1A 3UYLA 1Y8AA 1MRSA 4DMLA 3ORSA 3VPFA 2EKLA 1PR5A 1PYGA 2GERA 1JDZA 2JKVA 3INYA 3MUNA 5G04J 3NP9A 4MSUA 1B41A 1KHHA 2QRVA 4OQZA 5DYYA 1V9LA 1YCGA 2GJKA 3KTDA 3K9HA 4RFSA 5CNJA 1HG0A 1U5AA 1VJ5A 2Z43A 2WHPA 3H86A 5H82A 1RBZA 5DBFA 1JU3A 3JQBC 4UQXA 3PGLA 2PK3A 3NRJA 2H3HA 1F8UA 1JG2A 3G8YA 4ZU1X 3QKIA 4JBIA 5BQ5A 2FPMA 1YBHA 1Y8RB 4D5EA 1N5KA 3BS4A 1FDIA 3QE2A 1UDXA 4HAZA 3S5UA 5CCEA 1K1BA 3DSXA 3H1GA 3KKZA 4U7HA 3WB0A 1WBBA 1MH9A 1BMFA 1KZOA 1NFQA 1TR4A 1P44A 4JXTA 3MJFA 1OIWA 3RV4A 4B3JA 1V7ZA 2FVYA 1D0VA 4P7KA 4CI9A 4CL2A 3U7GA 3D8NA 4F1WA 4EBFA 1SPBS 3PRYA 2C3UA 4PYQA 4E5PA 3RU9A 2FEKA 3T5XA 3LLUA 2CHEA 3KE8A 2EDAA 3LV8A 1ORRA 1DOHA 1FPMA 3AIIA 4FD3A 2I3AA 1IZ7A 5K3OA 3TF5A 3LEWA 2LNDA 1IYGA 4U7EB 3TTXA 1ODFA 3R7NA 5HK9A 3AJEA 5EPOA 5CA1F 1JEDA 2WD7A 1A9RA 3HDXA 4FKBA 2VHEA 5UKDA 1U0JA 2W93A 3I2HA 3DDNA 2G5CA 4E09A 3D6JA 3C16C 5TMPA 3OEHA 1JHRA 2YWFA 3DOUA 2XWPA 4H15A 5IK2D 5K8UA 5KTTA 1O0CA 3WGUA 221PA 4JL6A 4DHWA 4D10C 1N92A 2HK9A 5I7UA 3SZLA 2HPHA 3UJCA 5FWYA 5LOVB 2CE2X 3WGOA 4D8VA 1BYIA 2BMVA 3KVYA 1KBZA 2E9SA 3FCSB 2ZYUX 4HH3C 4W7SA 3DPSA 4EM6A 1J1UA 5EJ9A 5K4HA 4YYZA 5TJ9A 3OY2A 3SC2B 4JL0A 1P9RA 3FYUB 1S4MA 4H6PA 4AF8A 1L5ZA 1QS0B 1X2BA 2PJRA 3EOZA 3IJEB 4B3RB 3SHVA 3HLYA 3CNHA 3QKSB 2QVYX 3KQPA 3DOHA 3LG2A 1W0CA 1XKQA 1CK4A 3K0AA 1NTRA 4Y6QA 3IESA 3L06A 5EDSA 2YYZA 1H0HA 1R0YA 1JYEA 1DLJA 3CUYA 3CXRA 4C0AC 4ETMA 2ZUBA 1OU0A 5BPFA 1QLJA 3A58B 2C9CA 4LX0A 3NOCD 1WB9A 1I6WA 2ZSFA 3EW9A 3QQPA 2E6UX 4IIDA 4Y2UA 3CLKA 3EFOA 4GZ6A 3M89A 3KYDB 1XN1A 3Q5GA 5AKYA 4B7UA 4JI4B 3Q5MA 1JH8A 4ZAFA 3HJHA 2VPTA 1PYOA 2H1IA 1KU0A 1E2DA 3NM4A 4JLKA 2HADA 4LNHA 4BUCA 5KVSA 4B3GA 2B5OA 2GJ9A 4JBLA 3AVUA 4C05A 5FPKA 3H9BA 4GMKA 1K6MA 1G5TA 2OM2A 3DLAA 2VLBA 3NUGA 4DE5A 4MYHA 3BT7A 1FNDA 1JWBB 4TTSA 4MB0A 3E1SA 4I99A 1Z28A 3S7DA 1MNAA 3C7CB 1N8TA 2P2ZA 1T0UA 4UU7A 3WJAA 3UXEA 1N9GB 4I2ZA 1W9HA 5BXUA 1YQGA 1YI1A 2OZLA 1NN3A 4I3FA 4TXMA 4CQMD 5TQ2B 2Q7OE 4Q69A 2O8CB 4II3A 1XZMA 4P7BA 3V1KA 5D7NA 3Q8MA 3FMFA 1P9OA 2WXFA 1E2PA 2ATCA 2RFLA 3AFOA 3O4RA 3I9FA 4L23A 1SXJB 5G02A 1FU7A 1ZNYA 2XA9A 3CWQA 3PG5A 1U28C 3AB7A 4H7FA 4KJZA 1KDZA 3SZUA 1IVNA 2FLWA 2HJHA 5AW6A 5B4VA 4PBRA 1RTTA 1T8WA 1XFDA 5JZOA 3GEHA 3ZG6A 1MPTA 2PT7A 3KPWA 2BF7A 3CVOA 4BNMA 4HOSA 1E3LA 4JB3A 2I9CA 1UOEA 3S0JA 3UAYA 4D8WA 2NO9A 2Z5LA 4CN9A 4D82A 1QAOA 1NQXA 3RRXA 1SQSA 2YICA 3HJAA 4I1PA 7GPBA 2YHBA 2PGIA 3WK8A 3B7GA 1UAAA 5KNCH 2YHIA 4RYLA 2WD9A 4ZVTA 1NZJA 3TK1A 1XAGA 2QBYA 2PL5A 1I2AA 2RI6A 1X8KA 2I22A 4V0QA 3VC7A 5J4HA 1T25A 4TKVA 1YI8A 3W4JA 4MRNA 3UOWA 4HCJA 3CB4A 3G68A 4IJUA 1XXLA 4Y2GA 4Z6KA 1QDEA 2ASVA 2VSXA 2GAFA 4EA6A 1D0SA 1U8CB 3ESZA 5GVRA 3EZ7A 3FJ1A 1H3FA 2WVJA 4G5QA 4BB0A 2P62A 2XUKA 1YS2X 3A1NA 4J0EA 1DIBA 1G60A 4GXRA 4KGXA 5LYJF 4R51A 1ZL2A 2C4UA 2FF4A 4IMPA 4OH7A 1CVLA 1YVPA 5C1OA 1P5QA 3EXHB 4O2BA 2WXQA 3AW9A 3T35A 1LLCA 5H81A 2N3ZA 5TV2A 3FTVA 4LXTA 4TLBA 3ECCA 3KWJA 3RHTA 1V5IA 1SC9A 3GWZA 3SZMA 3SJUA 1DIOB 2I2BA 2YWHA 4ZVVA 1GQ2A 2BGJA 3C3WA 5ES4B 2W6MA 3KSAC 1DCFA 3ZK8A 2BFCB 5D0QD 1ZKMA 5AVWA 5CMWA 1H8ED 1P2UA 3QX9A 4U6NA 4BGVA 4O29A 5ER6A 1QIIA 3O8QA 4L28A 5IJ9A 1CCWA 2IYWA 4QX6A 4KN8A 3BF7A 1H9AA 4IIVA 1DIRA 2I8AA 4TL7A 2VP2A 1NGSA 5ETJA 3VDQA 1SCNE 3ACBA 2AXPA 4WKOA 4LJSA 4BS9A 4PE5B 1WCYA 4PLGA 1FFBA 2B6NA 2H51A 2I71A 4V0SA 3ST7A 3LWNA 1GPUA 2Q1SA 4PTYA 2WM3A 4PO3X 1RACA 2I4TA 3M5WA 4NBVA 4G97A 4QDOA 2CVHA 5F98A 1YMPA 1A82A 3FF4A 3ED1A 3FFTA 4Q00A 4TVBA 2QDKA 2B69A 1Z2DA 4J6EA 4AICA 4LFAB 2WQ6A 1BEEA 1G8SA 3OZ7A 1XQYA 5HFJA 2P75A 3OY7A 3QVGA 1BOOA 3EXG2 2JHGA 3NAQA 3RDPA 4XUCA 4F8YA 5C53B 3PHBE 1WNFA 3EFEA 2AV6A 3GGOA 3MLAA 3MS2A 1SXJC 1CS0B 2CXHA 2WZQA 4WA8A 4XI0A 1V71A 4D97A 4DJTA 4RGQA 4H31A 3H0CA 1Y33E 3U4AA 1OVMA 1E7WA 1RRGA 3A9WA 3KV3O 3TJZA 4DIOA 2FPGA 4ZHQA 5AW0A 1OH5A 4LFCB 2Q3MA 1UPXA 2Y1LE 4JI6B 5T4YA 4QPDA 3P0JA 3R6GA 4TM7A 2IH4A 1MXFA 2FUCA 4RW0A 3TNFA 4CW7A 4YAKA 7ADHA 4DJEC 2BFWA 1XX6A 3WGGA 2HMSA 2QPAA 3OAAD 4UMFA 2W11A 1AKWA 2GGFA 1BROA 1W0KD 2W8BA 4B3HA 5CFQA 1WO8A 4TZ0A 1YRWA 3TXXA 4J9UE 4WIAA 5F7JA 2X3FA 2E4YA 2YY5A 2VNHA 4NE9A 1O9BA 1K2VN 2ZTLA 4CV2A 2WXPA 3N8IA 2UZ1B 1GTZA 2OV2A 2OMKA 3ABQB 1RXYA 3BDIA 3R1IA 4OXXA 4A36A 1AQUA 5DCWA 1LV8A 2W0SA 3QEAZ 1XEXB 1O5TA 2IQ5A 5IBQA 4B48A 1IQPA 3JQAD 2CNKA 3RRNA 4DXHA 1E7RA 1Z73A 3RFCA 1MX3A 1GGMA 1NVVR 3PVCA 3PXXA 4QULA 4RH3A 2FMXA 2FW0A 1JSLA 3CO0S 4RK0A 5CLLA 3WWYA 4BO5A 2EF0A 4O0MA 5JI3E 2I2FA 1ZJ5A 2OG1A 1SIWA 3AILA 2C4HA 2R8PA 1GQRA 4FUQA 4RL6A 3VH1A 4I9NA 4BNNA 3DL2A 4CKBB 5KINB 1B0UA 1Z07A 2PL9A 2Y1EA 1G20B 3KYCA 4GMXA 4NQRA 2NUTB 1BSVA 1G9TA 3OUZA 1R10A 1NJFA 4YAFA 5LLTA 1D09A 3I9V6 4TV8F 2C8JA 3DWFA 4NAHA 4IOJA 1UWKA 2JGRA 3ELBA 5EPEA 1QYCA 5JALA 4QGBA 3D8RA 3IKOB 3AHFA 4FGWA 2I3DA 2BI7A 2FMKA 3ETLA 3LGAA 4QXAA 3MCWA 2O54A 1VJ1A 1HDYA 2I1KA 1WM1A 2AKAB 3E3OA 4GNKA 2OXFA 3QK7A 4AM8A 1VL6A 4WNEA 3LU1A 3T7TA 5DM60 4HDNB 4G1MB 1S8FA 2F8YA 2DP4E 2C9ZA 4UWKA 4HFGA 2ENUA 1E9BA 2RHGB 3EDQA 5FBHA 1KI2A 2XBUA 4ABTA 3KCQA 1T5OA 1KY5A 2TSYB 4FZ5A 4OLBA 5JWHA 3GFSA 1EK6A 1WCV1 2IW3A 4N0EA 4A2WA 2IWHA 4UNPA 2EBHX 1TJPB 2A9RA 1U02A 2H52A 3LHKA 2ENWA 3OTHA 2GN9A 2DTXA 1POXA 3HU1A 3SC4A 1WZ2A 3LE8A 1GYQA 4RVUA 2HY7A 2FMFA 1XRRA 2IUFA 1VG8A 5HF9A 4RZUA 2XBMA 4EI8A 1MT3A 4DMKA 3ZHCA 1NJ6A 1SBTA 1T6NA 4JENA 2YW2A 3C3EA 3FBTA 4A5OA 3G5AA 2AOVA 3Q1KA 1ZY2A 3I32A 3L4BC 1ZJYA 1I3CA 1I3NA 4TKMA 4KCGA 5ENZA 3AJRA 5TQ0A 3QI7A 3UN1A 4TKZA 4BO9A 1I33A 1CY4A 4JYMA 4DCPA 1EUQA 5HG0A 2ZXWE 4CIWA 5AW4A 2Y9MB 2IEZA 2JDID 2LXMA 1X8JA 2OBXA 2DIWA 4G9EA 4IL5A 4U7TB 4MR8A 3LP6A 2Q2OA 3KCNA 3C2QA 3UGKA 3PRKE 3G7UA 4NP6A 1IAVA 2C98A 1BJKA 1GD1O 2YWEA 4QHTA 5ALOA 5FJYA 4N2QA 1P2FA 1FC0A 2JLAA 1USGA 2QD2A 1PJCA 2GYUA 3TO5A 1HFEL 1Z3IX 3IV0A 1NT4A 4Y98A 2M98A 4KFSA 2BEJA 3UJ9A 4IFBA 3EZYA 3QBVA 1Q1ZA 1BRMA 5AVYA 5TIIA 2C97A 5A9TA 2D4HA 1Z7EA 3RC1A 2XVZA 1DX9A 2QAGA 4J0IA 2O59A 2IELA 3IQXA 4EAQA 4G2VA 4B93B 5L4LA 4YMTA 4D45A 4DTCA 4ZDJA 5HJ2A 4A26A 2OZVA 2C0QA 3M6LA 3SEFA 1V39A 4C6TA 4MUIA 1F60A 2X6QA 2VJQA 2P2YA 2XMDA 2EKDA 5D3MB 2G1AA 2VF8A 4EHNA 1O96B 5AOBA 5K8TA 4QVIA 4G1TA 3U44A 1ID8A 3RHFA 1ZOPA 4G8JA 3A6ZA 1Q95A 4O2AF 2HWXA 2J3JA 2PKQP 4JB2A 4BFXA 3ELUA 2XF2A 4PFKA 1O5OA 4PAWA 4HJRA 1EFPB 1F0YA 1AN0A 2QYTA 3ABIA 2WMYA 3WJ2A 3LQKA 2XXAA 3VU3A 3FCXA 4KX3A 3LO8A 3PC2A 3PUKA 3QWIA 1ZGCA 1F48A 1T10A 1ATIA 4UHCA 4PPQA 4UPEA 3R9KA 1RNLA 3IP7A 3MOSA 2FQQA 3TWTA 4P7JA 4UTPA 5FWDA 3H9UA 1DKPA 2MCFA 2C5SA 1UIRA 3TTYA 5JQGF 1DG9A 4GMGA 4HUQB 3RRJA 4BUZA 3GCWA 1RM0A 3PDIB 3KLPX 4Q3CA 2BFPA 4XUEA 1JTFA 1KERA 2VDMB 2VG8A 2KHZA 3A05A 1XJWA 4DAOA 3OQIB 3VO9A 4JVOA 1NXTA 1TLFA 1QO9A 2Q4BA 3IX7A 1T5IA 5AQ1A 5A7GA 2OWDA 2JW5A 2ZQZA 3O4IA 5LQSA 4Y2SA 1HLPA 3D9OA 3OP1A 1OBFO 2Q5EA 1B8VA 1BA3A 4J29A 4CKEB 3R0VA 5AKHA 3FG9A 3E27A 3SSMA 3F3YA 2GM9A 4GZ3A 4ZEVA 5T8KA 1ZMRA 1T5LA 1WPGA 4JI2B 5FI1B 1IOLA 4HBZA 1PD1A 1JWFA 5BW8C 2QYOA 5HXAA 2VAWA 4PSKA 4UVDA 4NU0A 3H4VA 1ISPA 5ALGA 4KAFA 5DTQA 3R7FA 1I0ZA 1TJ4A 1TF5A 2IHBA 1WXGA 2C7QA 1XZLA 2GLUA 2Q4RA 3RFVA 2P4EA 2O3SA 1CEXA 1DBRA 3WYEA 5GZ3A 1XMSA 1OH6A 1U3VA 1K8XB 3DBVO 4DIMA 3SQMA 4ND8A 3CZQA 5DK4A 5IW8A 3DBHB 5AIAA 4AK9A 5A6CA 1AA9A 3SK0A 3FUDA 3UC5A 3FNGA 3SIWA 4F4FA 2FPIA 3T5BA 1UP4A 1OLSA 3PUXA 1P9WA 2Q21A 3GB9A 3JCZA 1RI4A 3AONB 4U02A 3F7OA 4OJYA 2YXBA 4DJ5X 4E12A 4GTQA 5GJBA 1CNMA 2YWJA 3R7AA 2C7RA 3BVPA 3FBWA 3O8LA 2RGYA 1ABBA 3IHKA 4EG5A 3UWKA 3RK6A 5G0VA 1GW6A 4W9NC 1ZM2A 2Q0SA 1TZMA 4ZV9A 3TAUA 2F37A 1ZR4A 3ORQA 3VYWA 3EW7A 3BFVA 1XZFA 5SY4A 1ZA1A 2IDKA 1IY8A 4XW2A 3ONVA 5KOJB 5TQJA 4CKXA 2A3NA 3OBBA 3FVRA 4FNAA 2HIMA 4N01A 4OXIA 2FWMX 5G1NA 4IDCA 4GX1A 1ODLA 3V97A 4BEPA 4M0PA 1P31A 3MJEA 1G291 5E9AA 3U56A 5FR2A 2QSJA 1A9ZA 5JDCA 2OL4A 4UWFA 1XVAA 4PANA 3AR4A 1WXDA 2DQ4A 1Y5NA 1R0SA 3FYSA 5K0GA 1PNOA 4MIKA 3CCBA 4QXMA 1B2RA 3H5RA 1OCEA 2QMQA 2DT5A 3B9PA 1VFNA 1HURA 3K9NA 4IH9A 4TQGA 4URXR 2QI9C 3BRQA 2PX2A 2ZAGA 3ZWOA 4B3CA 1QIHA 1RYMA 5H5JA 3UMVA 3OQOA 3HCOA 5D5PA 3U1VA 3QKTA 4ESEA 3FFLA 4GI2A 1QQEA 7REQA 4JU9A 5JCOA 3I2YX 1Y3AA 4ODIA 3TAHA 5A4KA 1ECLA 1THZA 2MSKA 4Y6OA 3TMKA 1W5SA 1TU4A 1MUUA 1D4FA 4DCNA 2R6GA 2QXYA 4RPHA 3LUAA 5DISB 5EJ5A 3THYB 1H6CA 1JX6A 3GQVA 4RJ2A 1USIA 2ZRJA 3A2NA 3KZOA 3ESAA 4JUDX 5G40A 3VJRA 1OI2A 3SDBA 1S4QA 4DIKA 5AVUA 3IAM6 1NKVA 4OQNA 4TUMA 3JRXA 3X2EA 3EIJA 1O5IA 3SXJA 5ICGA 1C3OB 1Y34E 3OZFA 3K9WA 5DNUA 1TK2A 4L4SA 1Q44A 2CJWA 1OLUA 2SHKA 3G5MA 1O0BA 3ZGYA 1C0IA 4ZYWA 4PXYA 3AI7A 3T0IA 4GKJB 4EKGA 8GPBA 4G37A 5T64A 1IMJA 1PLJA 3PVSA 4WPGA 3DPIA 1VQ1A 4NPAA 5EJ2A 4EH1A 1R2QA 2HSWA 2E21A 4BO7A 5I51A 4BN0A 3FNIA 1BXGA 1HDGO 1L3BA 3EN0A 3M7IA 3Q9UA 1L4NA 5EL0A 2HCJB 3GLGB 4XX1A 2RAPA 1BMTA 4X6UA 1N6HA 1ULUA 1OFVA 1TKRA 1T24A 3DEFA 3IEKA 5DNEA 4NNPA 1GGKA 2CHWA 1PJTA 1ZU5A 2AZMA 2QEQA 4XPIB 1G3QA 2C5FA 3H8WA 3KUXA 3LQ1A 4EJSB 2FSFA 1TYCA 3JD2A 2WSYB 3AKDA 1NURA 1EE9A 2R6ZA 2VNKA 2LKDA 1HTBA 3IDOA 5TT0A 4WWNA 2QW8A 3QMMA 2BGTA 4EYGA 4ZI7B 4RTNA 2PMEA 3FI0A 1T9GS 4GPD1 1AS0A 1EK5A 2XLBA 3FLMA 4J0HA 2EW1A 3GG2A 1TJNA 4ZT4A 4ZC8A 2YN0A 3GWGA 2DVMA 3ANLA 2BT4A 4OXYA 4XWOA 3L8EA 4GI5A 1C3EA 1IHUA 4HB4A 5G3YA 2K7FA 2PUDA 1XZJA 4AG6A 3HJUA 1NXWA 3QY0A 1J0BA 1O97D 4JHXA 4KPUB 2G67A 4GB9A 3GLGA 3U7HB 3W8NA 1WB6A 5H7XA 3TZKA 3KSLA 3BERA 4Z3OA 2WKRA 2GWRA 5EP1A 3OWHA 4K6MA 2I7XA 1FVHA 3T15A 2A5DA 1XWWA 4JP8A 2C58A 3NB2A 1E1RD 3G0CA 4NK5A 3QKRA 4EQ6B 1F2VA 1NA3A 3OE7D 2DHDA 4S1WA 4AUKA 5HOQA 2ZCUA 4QEKA 5KNBH 1TUBB 1IY2A 4FLEA 4LZAA 1EZ4A 2ZYHA 4BMVA 1Z7BA 4AWAA 4CKCA 1BTOA 1R8QA 2PVPA 2B4RO 2J6IA 3F5MA 3ZXPA 4DPMA 2P7HA 1CRWG 2JA2A 2XCUA 3DHYA 5KX5B 3FNRA 3I53A 2Z9BA 5AM4A 4GYWA 4J0FA 3RTBA 1U90A 4UFOA 3UCFA 1XXHE 2PT6A 4C43A 4R05A 5IN4A 4DA4A 3B3QA 1XJ5A 3UPUA 2W2KA 1IM5A 3OG9A 4ZA2A 1NIJA 1MP0A 1P8JA 3DF7A 2IO3C 4S0XA 4ZODA 4JUAA 1JA0A 3SF4A 2FF7A 2IPXA 2VTVA 3H6KA 4J7AA 3ADDA 1SCUB 3ZHXA 3JQEA 3DE5X 2XCTB 3HJCA 3O95A 4ANXA 1T2UA 3ZR4B 4PM4A 5LU8A 3EMDA 4X7RA 5C18A 4PAOA 1Y6FA 4AY6A 3DTVD 3QELA 2CT8A 3KG2A 1L5RA 4MS1B 3LQFA 1KQOA 4N54A 1TMOA 4YV0A 1INLA 3OETA 1PVDA 2PWYA 2D5AA 3MERA 4IFTA 1Y3FE 1K7EB 1U7DA 1P0QA 1UPCA 2EC5A 4LI3X 4ILKA 4MUXA 3P2OA 3MB5A 4OMUA 3PIRA 1A5EA 3UAZA 4K46A 4JC0A 4BLSA 3NWJA 4YJ2B 4YX9A 1J42A 1Z13A 5T4BA 3DZFA 3GW8A 4PYNA 1E61A 2YQ8A 1XCJA 3E4DA 2UY1B 1W9MA 1V5GA 1XK6A 4M89A 4XYEA 3RG2A 4FHJA 1OYYA 1XZCA 5EIHA 3ZN2A 4DBVO 1JZQA 2R47A 3GUVA 3PHCA 4CG1A 1SM4A 3OT1B 1RYZA 1HETA 2RKKA 4LNUB 4TMXA 4UE2A 2QTGA 1OBCA 1VRCA 4LXGA 4N3GA 5DYIA 3O48A 3LBYA 4O8CA 4NULA 4DLOA 1RQGA 3SMQA 4DV0B 4J75A 3KV1A 1DKLA 1T4GA 3LJKA 1QPZA 2G70A 5CCMA 4KO2S 2FF5A 4Z2AA 1WY7A 3H9CA 3H17A 4JOBA 4LA4A 4HB2A 5DP1A 3GBSA 1GVHA 3QX3A 4GA1A 2GN4A 3VPDA 1PR6A 2VTKA 1PN3A 3F8WA 4MNTA 4DC1A 3THWB 2NXEA 2H63A 3DRAA 3GLHE 4KDRA 3E0QA 3ENNA 2ZDGA 2A84A 1BNCA 1KAMA 4Z4GA 1TQ2A 1GPNA 2CLDX 1L7NA 5EUCA 2EYQA 5BWLA 1D8EA 1Y1QA 5B2ZA 4NCIA 2V6BA 1NMYA 5IARA 4B7CA 4D0NA 1TA4A 3V3TA 3W2GA 2XECA 4JVNA 4J8YA 1D2MA 4JHKA 3GGDA 2QTHA 4M3OA 4DXAA 5JZMA 4UAGA 4UWGA 3F8SA 1HTWA 3MTBA 4DV4B 1U7TA 1U4SA 3JWEA 1GRCA 1JDJA 2JGAA 1ZH0A 2RONA 2X6KA 1VHWA 1KYWA 1TCCA 2JHAA 2QAJA 1JMYA 4E3ZA 2IGBA 1UBOS 3BWEA 4OYHA 3T3PB 4W7HA 1ECCA 1Q22A 3RROA 5AD1A 4DLWA 1R9JA 3QU5A 2O19A 4S24A 4KE9A 2X8AA 2Q1XA 2PBRA 1JFTA 2J9QA 1MRZA 5THXA 1B23P 2FRDA 2IPLA 3HKCA 4NJMA 5JDCC 2OAEA 2Y1LA 1K7CA 2GZMA 3QKRB 1QBQA 3V6MA 5AENA 1KQGA 3AF5A 3AFIA 2QNIA 2QLLA 4M99A 2EGUA 4RVFA 5TPZA 1T3TA 2WG0A 4Q3BA 1K6IA 1QANA 1Z88A 4R1OA 3C4JA 3RARA 4KXMA 2Z83A 1NYTA 1V45E 5HIMA 2WT8A 3F5SA 3IHVA 5FQ7A 2C7PA 2C9MA 3WRYA 4P53A 1Y6QA 1SBZA 2PEYA 3OE5A 3RVBA 4DUZB 4LY3A 2AZXA 1QTIA 1UXHA 2D1QA 4MRVA 5TY0A 1S2OA 3A4NA 4PINA 3RS0A 4JI0B 3KZNA 3WYAA 1AK2A 1JVNA 1DKRA 2NX2A 3OZUA 3K70B 4IIBA 4ZYZA 2X41A 2PD4A 1BA2A 2Z04A 3AH8A 1T1IA 3ESDA 4IIJB 4F38A 4YMVA 5LYYA 1YVRA 3FTCA 4ZJUA 4EUFA 1Y63A 1AZTA 1SCDA 1TECE 1WMEA 1IWPB 3GNQA 3IPLA 3PLNA 3T4PA 1FP7A 2CMFA 4D8XA 1J1ZA 2UVQA 3O94A 3TX2A 4CF4A 4H3HB 4DEVA 1N6OA 5ERGB 1ZJZA 1SHZA 3RC8A 2HRCA 1VLJA 2WT4A 3GNTA 4A8JA 3ULYA 3OECA 2F1RA 1VBNA 1U0EA 2HRQA 2V3WA 2WT9A 2X58A 1S1CA 3R5HA 4KQWA 3L1HA 2GRJA 1ZCFA 3UJDA 2IYRA 3A37A 4NNJA 2LUHA 4DMMA 1VG9B 3W2IA 1NU6A 1Y8RA 4G5GA 3LUCA 5KNLA 3EFHA 2GCGA 3E0XA 5EC8A 2IC5A 4FGSA 4NARA 1UJKA 4OHKA 3BBPA 1C8BA 1ZMOA 1ZHHA 1YB1A 5D5HA 5AJXA 2W4IA 1L4MA 4YROA 4QT0A 3SG0A 2JLQA 4HGPA 5AIBA 3ONEA 1OX4B 5H68A 3AWIA 3ZHSA 1QMPA 1FDWA 4PC1A 1UKVY 1QGUA 3H0EA 3THRA 3L41A 2WJWA 2RJNA 2ZE7A 3GPIA 1NYLA 4BCBA 1BGWA 3ETGA 3WP0A 1TVEA 1QHEA 3CTPA 2QLTA 3SNHA 3MQ2A 3ZDRA 4MV3A 3OQNA 2OE2A 2G4LA 4B40A 2PUEA 1LQTA 2B37A 4M8NE 3Q9NA 1XA0A 3T1TA 2I6SA 1V4BA 2BV3A 4PX9A 3JD1A 4DFDA 1TJCA 3A6DA 4BZXA 1OASA 3DM5A 3E9EA 3P9CA 1LJ8A 2ZJ3A 3Q12A 3Q1LA 4FGZA 2ZWOA 1QHGA 3I3OA 2AXQA 2WD8A 1I30A 3X1JA 2XXAB 4JHRA 3FSEA 4FC6A 4WKBA 3CKBA 5A9RA 4G1BA 5EG5A 1JXQA 3H3XA 2QPOA 3EB9A 3P2YA 4R6WA 5HBGA 3SYNA 4A5SA 3TGLA 3DZIA 4M7RA 2OSBA 3OUUA 4D9CA 1MC5A 3FSGD 2IX3A 3W5AA 1B0ZA 4A23A 1H2BA 4AJNA 4BX8A 3BH0A 3ISVA 1X9HA 2O0HA 1YJCA 2H1SA 1BEUB 4M0DA 4H1TA 1P33A 2CCJA 1VLHA 2OO7A 3OHPA 4FXOA 3GJ3A 3UV7A 5J43A 2O3QA 5LJIA 1TIKA 3OKAA 4IGKA 4RVGA 1GNSA 1K5HA 4BPRA 2UXBB 1D03A 2XY4A 4AXBA 4E30A 2DLDA 4IIYA 2DQKA 1OGYA 2QAIA 4M7WA 3W4KA 1QE3A 2IDMA 3CT6A 3OFJA 4IUBS 2Y0CA 2RK4A 3IIIA 2X76A 1NSYA 4TN1A 3SHTA 3T7DA 3VU0A 3G0GA 5CLGA 2KI5A 4R8RA 5CBKA 4LYJA 4YJHB 3U9SA 3O8QB 4KFTA 3ORYA 2JLZA 2MYUA 3QG1A 3IH5A 3A1DA 5B3KA 2PUCA 2XQJA 1AB6A 1JLMA 3TFOA 1QUFA 1NBIA 4WT7A 1TVCA 5AAOA 5L40A 4S05A 3MAAC 2X8LA 2FTKE 3MM4A 2DVWA 2F55A 1US8A 3AG5A 5KTRA 1REQB 5L53A 3U4QA 4UPVA 1VPLA 2PM8A 5KDLA 1HTTA 2CXQA 2Y6UA 3AZOA 2D5IA 1YD7A 1YJ5A 1IOVA 3C14C 3T3DA 2VZ0A 5H3LA 1KFBB 3ITDA 3KHUA 3GDFA 4C03A 4R8VA 3O2QB 1Y1PA 2C9YA 3J5QB 1UZNA 3CEJA 4GMFA 4HRNA 6ABPA 3TXMA 1MV8A 3M6FA 4A8HA 4DIEA 2YY6A 2NUAA 3F9RA 1QH1B 3P27A 4X63A 2IH5A 1P1CA 1G8MA 2EJVA 4QTXA 2AJTA 4TUUA 2UDPA 4RA9B 1A77A 4LRYA 1EDZA 3A1EA 1YOVB 2HN9A 3PA8A 2GASA 4ZARA 5C35A 4KHPB 4H3VA 1F3LA 3K0FA 2C0CA 5ELLA 4ZK2A 1TJ5A 4ZVKA 4MVWA 3K32A 1P5FA 1PO7A 1TRHA 3MJHA 2JJ2D 4DGQA 4ANFA 1JMKC 1NJSA 4HAVA 4L9PA 4US2R 4UBIA 4C4ZA 3NORA 3HJBA 4UHDA 2W8BB 1YMVA 4LXQA 4M83A 4AZ3B 2DLNA 5EX3A 1AK1A 1RLJA 2ERCA 3L18A 3P9RA 4X8MA 3KU4A 3STXA 3W8DA 4Q05A 1DG3A 3RFUA 3B85A 5DLPA 4AJLA 3V00A 4M76B 4L95C 1JKMA 1SGWA 2D0OB 2W6ZA 3ZKWA 1YH3A 5IH3A 1ZM7A 3R23A 2HU5A 4BMCA 3I5YA 1SXPA 4P0PB 1HNXB 2H1FA 4HLUA 5ALKA 3AEQB 1AV7A 4A8JC 3OMWA 3DE3X 4ZO4A 3S2AA 4BDSA 2HH9A 1RWBA 3WMEA 1ZJWA 5C2YA 1ICIA 5AN8A 2GN2A 2QZJA 3D8TA 3GJ0A 4Z0PA 2VF4X 5C5EA 3FTYA 2PBZA 1WEHA 3WICA 4CR8A 2AN3A 4UCXA 5CBNA 3IUJA 2FRDC 1QE0A 1QIGA 2ZSDA 3Q4GA 3U7IA 5EHIA 4EYOA 5I7VA 3H1AA 3KYCB 5I5GA 5JROA 2GF0A 3OIFA 2J3MA 3M6WA 3E9DA 5EYPB 3BM5A 4HOQA 4EYSA 2YNMD 1EP9A 2ACKA 3G0HA 1K4MA 1CB7A 2P1DA 3Q87B 1P0MA 4JBNA 4XCVA 4Y6GB 3WK9A 4AJ2A 2WB4A 4PXSA 1GA6A 3EIEA 4RGYA 1GGHA 4P31A 4F1PA 5J1TB 2FETA 4S1VA 4YRPA 2V4UA 3M8KA 4ER0A 4U7GA 2DXIA 1HDOA 1XWIA 3BSYA 3KEOA 2QE7D 1IHPA 4HRXA 4O1OA 1SA0A 3FWVA 3VV3A 4Z68A 4EMTA 1G38A 2JK0A 3ZY6A 2B3TA 3PFKA 3OD1A 4YXWA 4Q6WA 3WIBA 1BXRB 4KMOA 1SQ0A 2QVZX 3F49S 4OHXA 3ZGVA 2GLTA 2OZKA 3SYLA 2VP0A 3MXTA 5EJ7A 3MMPA 3MTJA 2F9FA 2OG2A 1PQWA 2HPAA 1GG8A 3NTQA 3ZCVA 1SG6A 1BCRB 4TV9F 3URMA 2VT2A 4M6WB 3K1JA 1EKXA 2IF0A 2IDZA 1OXUA 4FE7A 5JY1A 3CCFA 1JAZA 3ZIAD 1H5NA 4FZRA 5E95A 5JD5A 3S44A 1G4UR 3LW8A 4AXXA 3JAWA 4ZCIA 3FUFA 1ZNZA 1E8YA 2OV8A 1W29A 2BR4A 5EE1A 3UHPA 1FA9A 3PFIA 4ITUA 1KEUA 2QWXA 2XB9A 2MMCA 2D8MA 3ETHA 2OBNA 4J3NA 2WK1A 3L8GA 2F67A 1PR9A 1JB9A 3NBUA 3RSHA 4BMSA 4DQXA 1PQUA 3CZRA 1IB6A 1XDBA 2Z98A 3HVJA 1KGSA 2GCIA 4XIGS 5JAIA 1WXXA 3L7JA 1B6GA 3R09A 2PUBA 2HNAA 3INRA 2Q2NA 1NW7A 2A3RA 2A1UA 3EULA 3GRYA 4Q9NA 3T7CA 2VXBA 4X1OA 1EIWA 1Y1KE 3AR3A 3O9ZA 4EP1A 1ADYA 2CLHB 5BPHA 3DXKG 4IXWA 1Q19A 1BDIA 1YYHA 3AUTA 1R8YA 2X6HA 1FVFA 3TWWA 1H5UA 4XD7A 4DV2B 3AM1A 2AVNA 2R1TA 5BWOA 5IM4F 5C34B 4MGYR 3G9UA 1NFRA 5KWSA 4L8WB 4IX1A 4MW7A 3FVVA 4HDMA 5JDIC 5FB3A 4YMSA 2JI6A 1MJFA 2ID4A 4CLHA 2E4WA 1J9ZA 1T8RA 2AL7A 5CR9A 1R6DA 4DY4A 1QQTA 4F7WA 1K88A 3JXIA 1V37A 5IFLA 3RU7A 1IATA 3T9EA 1EVEA 5B7PA 1QRRA 4C2UA 1T26A 3PCRB 2YBDA 4GC5A 4URYR 1AU9A 3NUZA 4HNSA 4Y67A 4IG4A 2BKKB 4RULA 4WOJA 1QCCA 4ER3A 4B6EA 4KQFA 5BOSB 1JSXA 2D3WA 3AGQA 1QGOA 4HS4A 1ZICA 3WTCA 1DARA 4PGMA 4DDKA 2WY2D 1H2TC 4FMDF 1XOIA 3FZEA 5AFSA 3A6FA 3PDJA 4OQDA 4RVOA 1O3YA 1N6KA 2Z8XA 4HLDA 4WE3A 3FUJA 1WW8A 2QQFA 4PG6A 4M8LA 1E6MA 2G25A 3CIOA 3O6VA 4YP9A 4CBVA 4TMKA 3U3WA 4ZO6A 3FU0A 3LT0A 4W9MC 1CW2B 1IUPA 1K86A 1P75A 621PA 5HKKA 3NRCA 4LRXA 5EMJA 3W5IA 3QHQA 2Y67A 3NQPA 5ARBA 1ZGBA 1FJ2A 3A9RA 1RM5A 2BFDA 5JBIA 1VMIA 1KZ9A 1J2EA 4FSDA 4KZKA 1AC5A 2RHBA 4L4XA 4LK3A 4BGUA 1P7YA 3MTGA 1MAUA 1QZUA 2ZEJA 1U2SA 3L6EA 2PBFA 3CR3A 4MQFB 4S1OA 4LRSB 5AXCA 3WDMA 3TKAA 2PS0A 4B3MB 2EQBA 5KI6A 3M6UA 4IEFB 4RY8A 4ZCLA 2IOSA 2A59A 2XYVA 4JX8A 4OXQA 3MJ4A 4LHSA 1J8FA 1ZH4A 3QLVA 1ML4A 1ZK0A 1LPMA 1LDEA 2UVPA 3K20A 2JABA 1Z74A 1BFKA 1II8B 5CEAA 1OROA 5ERXA 3SQDA 4BTVA 1Z6AA 4RUKA 4QJ5A 2F3QA 1A3CA 1E4EA 2FPSA 1D1QA 2FN3A 4LQLA 1LZKA 1GSOA 1HSOA 2BFDB 1OUMA 1Q1BA 2N46A 1F9AA 2R2GA 1MAHA 4D3FA 4MPTA 2GF2A 1Z6GA 4JBXA 3MX3A 1WA5A 1RYDA 1BWQA 1NG1A 3GEIA 4RVSA 4RZQA 3G2OA 2AW6A 2FUG6 1OAAA 3MMNA 4KWEA 4CV3A 4F9EA 4K9MA 3NBXX 3ZDDA 2ZRCA 3QOXA 3R44A 1BQEA 1HDZA 2GETA 4HT3B 4FP7A 3QVGB 3QGMA 4WZ6A 2QJOA 4ILHB 3AZPA 3AG3E 3ZNNA 2ZK7A 1P72A 2QN3A 3OQPA 4L75A 4KZ0A 3FUMA 3UUXA 3JQ7A 3QW4B 1ODTC 3WWZA 1DJQA 1IHOA 1HI9A 4TTAA 4AZTA 5TGZA 2GHTA 1GTSA 2NO5A 1RW4A 3TIVA 4JJ4A 2XDAA 5AW9A 5T8IA 3QUCA 1EFLA 4OMFG 4DCCA 2JAQA 1EE2A 4Q1DA 4EVQA 3GPBA 3SQLA 1SCAA 4BETA 4NAUA 4IF4A 4LAFA 4UTRA 2FRXA 3FVQA 4FQ7A 4KSYA 3U3JA 1WUJS 4YLGA 3VOAA 2D1RA 2EJBA 2R66A 5EXXA 8OHMA 2R8OA 4A0FA 3GAZA 1JYFA 5MDHA 1Y3DE 3C3BA 3WK6A 2J59A 2EDCA 1C4XA 5I7AA 1WDLA 1QHSA 3KHSA 3OF3A 3SHQA 5K0CA 2H1LA 2V45A 3P9PA 4E03A 3DUFB 2CVOA 3TBHA 2A9FA 2DHQA 2B1GA 2O8VA 3A4MA 2AMVA 5CECB 1LVGA 2PLRA 3PGKA 4CQJA 3JQAA 3UMGA 4EAAA 2L6JA 3H2ZA 3L17A 2YOFA 1OYWA 1IK6A 3HVRA 1CUZA 1YJQA 3OO1A 3BMQB 2PT9A 4PTLA 4OA8A 2PJZA 2W2QA 1QM5A 4M53A 4FLHA 1XDDA 5REQA 3EHMA 4NMHA 3V33A 4PC2A 3EXHA 4HAOA 1D8DA 1EVIA 1JNYA 3RHSA 3D7RA 3WLJA 2YIMA 1ENYA 1PSWA 2OV6A 3EUEA 3S1AA 4ND1A 1GVNB 2AN9A 1YK0A 1FX0A 1J2UA 3FTUA 4DILA 1EVLA 2R11A 4EHMA 4I19A 1C1HA 4C9BB 4LXUA 4MUEA 1DTEA 2QTMA 1T9CA 3PIDA 1YVUA 4HEJA 3OEYA 3MV2B 4ETIA 1N52A 1GNLA 1XYYA 1TC2A 2HIHA 3FCEA 4KQIA 3WGVA 3EPKA 2WZDA 1PKEA 1QFXA 4NEHB 4DTIA 2RHOA 2WU0A 4PR0A 5ALFA 3TLAA 1GTL1 3ZW8A 3CVLA 1CZHA 4LVCA 4BV8A 5ISMA 1YKFA 1M6VB 2F62A 3KVRA 1MG5A 2Q3DA 1CY8A 4Z9BA 5BNIA 2OXTA 1S63A 2C5EA 1W36B 2BE7A 4HDRB 1P5JA 3CRVA 2AE2A 4AN1A 2D06A 3S2EA 2ZYRA 2XCQA 3B3GA 5KWVA 5M3BA 4EO4A 3M6VA 3JWHA 3NVAA 3IERA 3AEKB 2OENG 1T9AA 2CLLB 4M1MA 2IODA 2JG3A 2FE4A 3DDOA 4V2IA 3SZGA 3RFTA 1IBCA 3TSAA 3ILXA 3GA5A 3FLBA 1RWXA 3R8FA 1NBME 3OU6A 4UCFA 1TAUA 3D2BA 3QEJA 5FWYB 3ACDA 5LOVA 1YRAA 2ZYSA 3DYBA 3I45A 2VHQA 4UNIA 4XIIA 4EYQA 3QFHA 4HDRA 4E7OA 5JS8A 2WQZA 3EVCA 4KT6B 1M6NA 1YR7A 2I8CA 4LMRA 4R2HA 2ZIAA 3DFKA 3D5TA 3JQFA 1V5WA 4JEUA 2O5VA 1VLVA 4N8EA 4BHTA 4ZQBA 2PE5A 2GPWA 3AV0B 4TMFA 1YB5A 5EKXA 2YIJA 4RPGA 4B7XA 1LEHA 1NZFA 3OQMA 2AYYA 2PRSA 3NWPA 4G8DA 4NCBA 2PCLA 1IHYA 1EXNA 1JR3D 1Z2CA 2GBLC 4ND2A 5CHYA 1HFWA 2PQRA 2J4DA 2GJ8A 4I5FA 5HRAA 4Q4JA 2DZNA 3HXCA 4REMA 4PS7A 2M9MA 3BFXA 3O7MA 1IZYA 4IXMA 4XVQA 2I1JA 1XCMA 4CEIA 2I29A 2XQVA 4XEUA 3LOPA 1A5BB 3QK0A 4ZIRA 1MBZA 3KYDA 4FJ0A 5CNIA 3SC6A 1J49A 2ZREA 5CK5A 5A3JA 1CUFA 1WP9A 1GKIA 3RO3A 1VMKA 4OXKA 3EYWA 1YS6A 4HX5A 1P4SA 2HJ9A 4RAQA 2ZJ0A 3BK1A 3SIPA 1JJ7A 4K9PA 4DQLA 3C3YA 4KWIA 5KNCD 5IT9A 3APFA 2CBZA 1XHLA 2QT0A 1GTVA 4HSGA 4TXJA 2O05A 4Y7CA 4GZCA 4O1PA 5HI7A 2AMJA 2BBSA 2DBQA 2WM9A 2YZ2A 3FWKA 4Q9HA 2Z1DA 3B20A 3HU5A 1W73A 4C7MA 3KSZO 3DJYA 5FNVB 4GA2A 4K1LA 3RBAA 1WXQA 4I17A 1SK8A 5EXDA 4U0JA 1DIAA 4EMUA 3EX7C 3T7RA 3PI6A 1BI8B 2B7CA 5AM2A 1V3UA 2I1QA 5H02A 1T0HB 3MRVA 3U3DA 3HA3A 1UJCA 1RI5A 4WUVA 3W6OA 4PLFA 4LC1A 3ZBQA 1XCOA 1MABA 3DR3A 3PL5A 2QZ9A 5SZIA 5JSKA 2NUTA 1E96A 5DBHX 1VBMA 1NXVA 3EF0A 5DTMA 1YHZA 2QMOA 4KGZA 4DEYA 2WVIA 4HWTA 4XH9B 4YBRA 3FTEA 2FEWB 3ZHTA 3H19A 3LGXA 2KE5A 4GPAA 121PA 3AOGA 3MWDB 4WECA 4DA8A 6REQA 3EZ6A 1I36A 1LFDB 2B3DA 1CF9A 1XZIA 4OD0A 1RP7A 4H17A 4RORA 4ZCRA 1SXJD 4JN6B 3VV2A 1KJIA 4K9SA 2FZVA 4MIYA 2VQEB 2WYHA 2Q1TA 3FLEA 4Z0HO 1IHBA 3LC0A 1DTWB 1O8BA 5E9QA 2J9ZB 5FQ6A 2Z8YA 5A6SB 4DWVA 3N6XA 4KG7A 1V4NA 3UH1A 3IXQA 3DS8A 2CKMA 1FPQA 1S2LA 1SR8A 2FPUA 1MVLA 4PC6A 5AMXA 2PX4A 4PYKA 3OKFA 5ADUS 2XUDA 1MIOA 1LK7A 2P30A 3KHTA 3OE1A 3QXHA 4W63A 1KPHA 1OXXK 1EM8B 1UJ6A 1YS4A 2MOWA 2C20A 3FTSA 5COQA 5TVKA 3KQNA 3FHCB 1D7OA 3T1VA 2VSNA 2Q0XA 4WFIA 2HT1A 1V7CA 3IRUA 1QWOA 4J1QA 4BEJA 2ZRFA 3HU3A 2JGIA 2C84A 3EWIA 1V11A 1RM3A 3HDHA 3IAUA 3PXEA 5KSOA 3L13A 2VJLA 2QMZA 3EZGA 1LTXA 1HE1C 1ONNA 3JUIA 2WMDA 3LFHA 1YQDA 4HDKB 4OHFA 2R2AA 5FXMA 1L5QA 5A6SA 3OQ1A 2VJCA 1HDEA 2F3RA 2WE7A 5JHHB 5AQAA 1H1LB 3K0CA 4OG2A 1ZUNA 4BMNA 2FU5C 5ITZB 3CLJA 1J0XO 1XT6A 2BFFB 2FN4A 3ISMC 4PYOA 1O95D 2WIGA 1Q3TA 4B6OA 2MR5A 1KQNA 1NUTA 4MVJF 2RFMA 1ZCBA 2ESRA 2PMWB 3ITEA 3L0OA 4JLUA 1LLUA 4XB1A 3CR8A 3WNVA 2WJVA 3RJ9A 5J40A 1V48A 4EKYA 2CV0A 2ON6A 3GARA 3T06B 4UJ5A 2QD5A 3DBRB 2DWPA 3RUAA 5A03A 3HY3A 4NURA 3UMRA 3LDAA 3UJ7A 2P5UA 4L8FA 3WOVA 4MJLA 2FPIB 1OKKD 1RLMA 4IJ5A 4DLXA 4CQNA 5HCUA 1I5OA 2Y1GA 1Z4IA 4C5BA 2L19A 2Y8EA 4TS9A 2BRUA 2G63A 5SYMA 2XQFA 1G17A 3I9KA 3ZHYA 5HKAA 3EAGA 3W5SA 2ZBGA 1PFUA 1B43A 2JGFA 1NBAA 3KU1A 3RYIA 1AGYA 4MV9A 4P6VF 3PFHA 3VPCA 4QOSA 3SI5A 2R60A 4ER6A 4YUAA 2YMLA 1RW2A 2MSCB 4ER7A 4H7KA 1WW2A 3KHKA 2YN2A 1U9IA 2X2FA 4MEAA 2XDYA 1NP3A 2ORIA 2J7KA 2IOQA 5TMEA 2EJTA 4K0KB 3HG7A 1TN6A 3F6BX 1A5AB 1QYWA 2QVLA 2N42A 3RASA 1XIVA 3IBSA 4LF9B 3D9KA 2PS3A 4KXNA 3RKUA 4Z7QB 2K87A 1S2DA 4IP0A 5FV7A 4AS2A 1JU4A 1VJRA 1EB9A 4IDFA 1L3IA 3QKUA 3GNSA 4TXQA 1P4GA 1HYBA 3M4ZA 4D7AA 5G2NA 5C8YF 2XWQA 3MRTA 4MKZA 5AJWA 2OCDA 4AP5A 2FP3A 3JVVA 3W5UA 2EZ8A 2QZPA 4Y6LA 1HE4A 3UT5B 5DASA 2AWNA 3ESCA 3GAMA 2B30A 3AFGA 3AP3A 3JAKA 4MVYA 4D9NA 2F2TA 1GR0A 1CDEA 3IB3A 1YR9A 2REBA 4CMGA 2B8EA 1SUSA 2DTEA 1SXIA 1G2QA 1T9KA 1U2TA 2LWIA 3DUWA 1UZLA 3FPKA 4D9IA 4IRUA 4RIFA 1AGNA 2QRPA 3NKVA 1NLYA 1U65A 3U19A 2BEUB 3I83A 1V5FA 2PAFA 3RSZA 4BDTA 3EIXA 2JARA 1UM9B 4PLTA 3A14A 1Q0QA 1RC8A 3HCNA 4H7JA 3MJDA 5CDYA 4RNDB 1O6BA 3I9MA 4WKGA 4PYIA 2YWBA 2XWJI 5AQBA 3HPQA 4YRJA 4G4IA 1O1YA 4M9UA 1DKUA 3L92A 4AURA 2VP6A 4TX1A 1IY0A 2WWXA 4YXFA 2PGAA 3TPZA 4GL4A 3EMKA 4U5XA 3CW9A 3WRWA 1MH1A 1QYVA 4MITA 4JKOA 1L1RA 1FFHA 1FQJA 3WHIA 3LYAA 1V16A 2GM5A 1CUSA 2RHHA 2PZIA 1GG9A 2ZSIA 3FUNA 1G55A 2P9YA 3BULA 4IHJB 2XRZA 3D3NA 4L8GA 2P4HX 3R7WB 2OOEA 2O2XA 2PSJA 4WINA 2DC1A 2KCLA 3F7MA 4J7XA 6PFKA 1OXBB 3EZ9A 4QARA 5F5LA 3WIVA 1CZNA 1RHRA 3BX1A 3G2VA 3R3YA 2VJAA 3LC7O 4IKOA 4WXYB 1JALA 1IL0A 1ZDMA 2XUAA 2LDBA 3IAM1 4OREX 4QU9A 3RS5A 3USES 3IEUA 5G4KA 4EJ6A 4C30A 3Q8LA 1Z6QA 4BYMA 1C8VB 1TM4E 2BPOA 2C8LA 1NV8A 4D9MA 1E3MA 3A9TA 1A8PA 4EJSA 4G0YA 2ZRPA 1DAFA 3QEKA 3CVYA 1SVLA 5HTOA 3QA9A 3TSYA 1LDMA 3BWDD 3GZTB 4FLMA 2FR1A 3BZUA 1XCLA 1YA4A 3L7KA 3MGCA 3IAAA 4P34A 4PBSA 2JIDA 3H11A 5T6BA 4QTZA 3WLLA 2VWGA 1CZRA 1GDTA 1JA9A 3CEQA 3DLPX 2OCXA 1LW6E 1D2CA 1EDDA 3DE0X 3BCHA 3QTTA 1E4YA 2FUEA 3KJGA 4BFCA 4TLMB 1F12A 3IQWA 8ATCA 2IPOA 2O2EA 3CHRA 1WF6A 3FOWA 3VH4A 2G08A 5DYWA 2ERXA 3D9PA 4LC0A 4GRAA 3M6IA 1A5SB 5ALHA 3JD0A 4NFHA 3CRMA 1QNLA 5ESRA 2BZ0A 1EP1B 4CRWB 3P4UA 2V4LA 1WZUA 3VHXA 4I1SA 4E4RA 3REFA 1I1NA 2HWUA 2BKAA 3FMIA 3WWDA 4BO1A 4UM7A 4YT4A 4G0VA 4QWWA 5D86A 1KFKB 3ZWWA 3SQWA 4CIAA 3L05A 1JCQA 3H1FA 3KKMA 2VH2A 4HNQA 1ESDA 2V58A 5KPJA 2FA9A 2AW3A 4NBLA 3FROA 2ZZMA 2WMOB 4KIJA 1UBUS 2WDPA 3LHFA 5P8WA 3ME5A 2FEOA 1ZVQA 3JAKB 3T12A 3LNCA 2QTFA 3I1JA 1OWMA 1CIPA 2DQYA 3KSQA 2HCBA 2N9UA 4HAYA 3CYFA 3ZY3A 4F96A 2FEXA 2PGNA 2WWHA 4ONEA 4S1NA 3G9ZA 2G5PA 1XDWA 3EMBA 5BXQC 1S7GA 2BGNA 5BXYA 1RRCA 2ZM6B 4X95A 5DU2A 1OF1A 2A6PA 2WXLA 2GVNA 2DWOA 1UQRA 2NO1A 3BB1A 1M2OA 2P6OA 3FLAA 3NZEA 3PNYA 3R74A 2FK7A 2IXDA 3FZNA 1A2KC 1IHXA 1S8OA 1QTNA 3KJEA 1QGZA 3PNVA 4FYXA 3B1YA 2ERYA 2XA2A 4YJGA 1H9CA 3WA7A 2C0LA 2J07A 2Y2UA 1B14A 1XAHA 1WY5A 2VHXA 1N6NA 5EFOA 3TIGA 3HJFA 1M67A 1YS9A 1M1XB 2XUFA 4ISBA 4B34A 5KKAA 1S96A 1MZCA 1SEVA 1TQDA 4U6SA 1X13A 1SO8A 3ML1A 4URVR 1I2MA 3EDMA 1I9CA 3WGZA 5F7OA 4PONA 1CRPA 1G5RA 2IY7A 4QPNA 3TLGB 4MW1A 3LF1A 4R1SA 2MHKA 4DRYA 2A9VA 1FFXA 4RQAA 2DECA 1DELA 1YBMA 4NCHA 4QG7A 2PH1A 4PNPA 3HXQA 1Y5IA 4RG6A 1TEXA 2MSLA 4IDGA 2OCKA 3VUEA 4M0KA 4B5KA 2PO5A 4KE6A 3RB8A 2FPKA 4YQFA 3O75A 4CUZA 2IP1A 1BYUA 4RPCA 2J6BA 1YUBA 3G82C 4GLJA 3NMUF 3ONLA 4EKNB 1MHQA 2B78A 2VPXA 1G6HA 3HDVA 3QG5A 4WLUA 1HQDA 5K7SA 5IXSA 2VPYA 3WFZA 1H0RA 4ZKEA 3BD9A 4R40A 4CDMA 3BL5A 1N94A 1MX4A 2FZCA 2OKCA 4G9BA 3R40A 1OCRE 1JI3A 1HT0A 3C3KA 4BJ6A 2G1PA 1WE2A 2RGNC 3KQQA 2BJWA 4FR5A 3OJXA 4MKRA 5AXDA 2FMUA 3U66A 2FWBA 1KC1A 3ZVRA 5BN5B 1UJNA 3RM3A 5HUHA 1I7QB 3MCAA 4M7PA 2RGXA 3CKLA 1XTBA 3FNFA 3DB1A 4CHGA 1ZEMA 1KYZA 4QXOA 3T3HA 1PE0A 4BAUA 5KOHB 2LP4Y 2ZR8A 1K6JA 1EXMA 5B30A 2H5LA 1YAJA 3MCUA 3HUFA 3LKUA 2ZXFA 3FGNA 3ROGA 3PDWA 5CW1A 4U04A 4DLQA 3EJ6A 4REQA 3MOGA 2NXJA 4OJMX 5BMVB 2PVCA 2J67A 3AC0A 3C4QA 4A63B 1RRKA 1QIJA 4YCDA 2A5YB 2V0PA 5G41A 5CBPA 2OHGA 3B6JA 3H2KA 5T5QA 1T35A 5AWFC 5J08A 1Y9AA 1YZUA 2BCGY 1PQPA 4BERA 3FAKA 5BRAA 1J22A 2YJGA 3NOOA 3MILA 5KYUA 4Q7LA 3ECAA 4V0RA 1HFAA 1XFAA 2V55B 4JGBA 1U0BB 4ER5A 2WJZB 2JJ8A 1J97A 1P4HA 3PV0A 5ALXA 2MOKA 1SCUA 2V03A 3JASB 4MQ5A 4OQQA 4DQDA 4U3JB 4GX5A 4BNWA 1K92A 4XOIA 3FVWA 4BUJA 1MPXA 3T3OA 1FYDA 4NXMB 4XDHA 5JBNA 1I5EA 2GZHA 3QIAA 4LG6A 4LTNA 3OPYA 2CL7X 1T2EA 1TZJA 1WQ3A 3BL8A 13PKA 2W6OA 4OTZA 1J99A 4GUDA 4JVSA 3AF0A 4ZVSA 4YLEA 5CDTA 4G1UC 2BGGA 2BI4A 3P19A 1LC3A 1XHFA 1BXZA 4OFBA 2WFMA 1TNUA 4QXRA 3U64A 1H2AS 4HORA 1LPBB 3JRWA 5J59A 3HLKA 2BM8A 3LHDA 3RAPR 4IQ0A 1E3WA 3N8GA 4U9HS 1XJQA 1RKXA 2JJQA 2X86A 2F8XK 1HG5A 2GPNA 5IULC 5BN1A 3FAZA 2PL1A 2OHHA 4GI7A 4YO7A 3IA2A 4LNUA 3BL6A 5D85A 2V97A 2YZ7A 3KTAB 4CEHB 1FTSA 1RAFA 1SB8A 2QJWA 3OESA 5B1EA 3C6MA 3CF2A 4GL2A 2WF7A 1EFRD 4HSEA 1UINA 4IS3A 2WAMA 5FNVF 3D6HA 3KAPA 1FVOA 3BFKA 3AJ8A 4GEGA 1J4AA 4HWSA 1VL0A 1NXXA 2GZDA 4WXPA 2CZGA 3B6IA 3L08A 2G88A 3C7KA 4CN8A 1RFLA 1U7PA 1WUHS 2WG2A 1ZLXA 5PNTA 4J91A 4IV5A 4X93A 4PNEA 4PCLA 2ZIUB 2WAAA 5JATA 1EJ2A 3GROA 4JWTA 2IFUA 1ZKDA 4Q02A 5JBQA 3F6SA 1UK9A 2NZUG 2XPYA 2XTJA 3G7SA 4QGHA 4GYJA 4MUNA 1E1QA 2AGVA 4EG6A 4ENTA 2XUHA 1DRVA 1TU0A 2BFNA 1NBMA 2PS1A 3D6FA 4QUAA 3P0IA 3SIXA 4QEZA 1Z29A 1O7JA 2A94A 2JAHA 2GK4A 3OQHA 5DBKA 4FOTA 4WN9A 1MJ5A 2OBLA 4X20B 4CLOB 4F5DA 3TGPA 2A4MA 5JAHA 4AX4A 5IG2A 5LDHA 5F1PA 3TOCA 5FYDA 1YR8A 4MDYA 1SUAA 3VNBA 1X38A 4D8YA 2FW6A 4NHEA 3T4XA 5INTA 4N2SA 2Q1UA 3B53X 2XKAA 3IDSA 1FUUA 2GOYA 3ZJYA 3HKCB 4LV8B 4NJMB 4R9VA 4B2IA 4CIYA 3MYYA 2QIPA 3VBEA 4EVRA 3G6KA 1EF1C 1P4RA 3HDTA 4F4DA 3UK6A 5A62A 1DTWA 4AO7A 4WV3A 4LKRA 1CF4A 4WADA 4MVJH 3FI9A 4FOSA 4ZYTA 3VPBA 2NP7A 1ZISA 2IUUA 1KEWA 3B7BA 3C98A 2I76A 1WMFA 1CR0A 2KYRA 3D8BA 3O8CA 4F4IA 3IEVA 3GVHA 3UTCA 1M3SA 3VSEA 2CMHA 3NC4A 5EPUA 4LN1A 1LLFA 1XVTA 1BIFA 2AD5A 3R24A 4NV3A 1MMFB 1C80A 3B5EA 3B8EA 4DGSA 4D5GA 4EGSA 4AQ7A 3RAEC 4GM4A 3LIIA 1NF9A 4IS2A 3A2KA 2J8ZA 3FVTA 3CNOA 2YV2A 4LOJA 3HXPA 1EG7A 4YMGA 4RHCA 3EY9A 4HX9A 3I76A 4QGGA 4JXXA 1KJ9A 5IS2A 5L6LB 3JPWA 4JJIA 4F21A 3ZEFA 1XJCA 2O20A 2O4UX 4IOKA 3PEUB 3TIXB 3VVLA 1DUVG 1BHSA 2GFHA 2IIBA 3C3AA 4B87A 1FDSA 1YZGA 2CDNA 4M1EA 4HNUA 4OHCA 4GT1A 3VNQA 1NTOA 4OGWA 5CPBA 1ZRHA 4FWTA 1TM2A 1I9GA 3IUPA 2J3EA 4UI9K 3IAS6 3Q2KA 4MVJA 3OCJA 3RT7A 4B81A 1RPNA 5EX0A 3HC7A 3QE0A 5HKKD 1G5HA 3WXXA 2WXMA 2HQBA 3DBSA 2J7PA 4JT8A 5KOJA 3PF9A 5K6TA 3LGSA 3L4KA 4WZAA 3LYLA 5CA1B 5EGSA 1N4PA 4BSXA 1LBHA 4CMEA 1UFRA 3K3PA 5GM2A 3QX7A 2A86A 5C2JB 4WNDA 4A6XA 4PLYA 3AY0A 5CBOA 5DN9A 3RABA 4PGFA 4G1EB 4GS5A 4LE1A 1GYPA 3L7MA 4LV5B 1FX1A 1C7IA 4PEVA 1LDGA 2VRCA 4IQ4A 4WBNF 4RSRA 3MZLB 3I64A 2WIDA 3IAXA 3BZBA 5B3JA 4E5UA 3CV3A 1GZ6A 3DTVA 3TSWA 4EQZA 5KYXB 3T9BA 2YQ5A 1RJFA 4PH4B 1NMEA 7REQB 3HPRA 4BZZA 1D2HA 4E6HA 2QUJA 3DVLA 2TMKA 1OR8A 3WZ2A 5GPBA 2A0FA 2JGEA 4MRRA 2IY9A 2W2LD 1RQ7A 1YE3A 5BN4B 2M63A 1PJZA 1D6MA 3EUFA 4UMDA 4Z1MA 3ZU7B 4QRIA 4DV1B 1KJ8A 1K0UA 3OUTA 2LIVA 1ZM9A 4QOIA 4BJHB 1DI0A 2PKYX 1SPXA 3FHEA 2VAVA 3Q7IA 4CMKA 2R8BA 1PR0A 2VDVE 1U31A 3QUBA 1AQJA 3O38A 3ZY2A 1K7FB 1II9A 3G8AA 4QNRA 3S40A 2GZSA 1VIAA 1W5TA 2H48A 3LBFA 5EIWA 5ICCA 5LQDA 4F4HA 4HUJA 4QGSA 3TWRA 1D07A 1MX5A 4A0RA 1GU1A 5HEKA 5CG2A 1C3OA 2DRIA 3GLHA 4RHYA 2PG3A 3H2JA 3PVLA 4ITVA 2RC5A 4PV7A 4C07A 1A4UA 1E94E 3HVKA 2ZRQA 1XNFA 3IT1A 1UUFA 5EP2A 2C7VA 5ARGA 2X77A 4ZVUA 3V6LA 5G2OA 2BTDA 3G2HA 3LT1A 3UWDA 2QTNA 1TKCA 3ANTA 3EQ2A 3HO1A 1W34A 1P19A 1PFQA 1XU9A 2UVPB 3DO6A 4YJHA 3VYUB 5A5VA 2P68A 5BRNA 5ALVA 1PVOA 4X41A 1SUWA 4E21A 3TH5A 1QRUA 2EL9A 1E5TA 2JCVA 1OTXA 2P8JA 2YINC 3IAHA 3MWYW 3NHRA 4LOHA 1YACA 3CW2A 3F46A 4XQ0A 3K5PA 5AI4A 5H16A 3ENEA 5KQMA 2H9IA 1EFHA 3TAXA 3TOSA 1FP6A 3WBFA 1QRDA 4UPDA 2OHJA 4RV9A 3OIUA 3STWA 3ZUGA 4F3RA 4DA7A 5JNWA 1HZJA 1PT9A 3VMMA 3HXTA 2DPMA 5LB4A 4TRQA 3SXPA 4JR0A 3BTOA 4N40A 3U7JA 2OCCE 2G17A 4Z0TA 2QRNA 4HGYA 4N5IX 3LDGA 2V7QA 3CF4G 2JD0A 1KMNA 3CPJB 3GEDA 1YWGO 4NF2A 1F2DA 1J8DA 1CUYA 4XKJA 4URFA 1BH2A 2XQGA 2C9DA 1CXZA 2FPLA 4KUGA 4TLCA 4CIDA 3UXGA 2F17A 3CR3C 1MA0A 3PEUA 4LECA 1PJQA 1ORWA 2GK3A 3BSFA 4D79A 1OFUX 4FA6A 2J4BA 2DY0A 5JECA 3BSWA 3BEEA 1X7XB 3UUWA 5C32A 1NVGA 4DMGA 1L5HA 5JYEA 1IDN1 2XOEA 3RD5A 3V7FA 2OXIA 3DEJA 4F3VA 1BW9B 1G3RA 3EZFA 3ZLUA 1XK7A 1XTTA 5BN3A 2BTEA 1LDBA 1OQAA 3L1IA 5DTIA 4MYDA 2X1LA 5ITZF 4CGYA 1BC5A 3EZ2A 2V65A 3EHEA 1MQAA 1Y82A 1AK9A 4AD8A 5C5CA 2XS8A 5F12A 4KO3S 1GRNA 1KY4A 3K6RA 1HT2E 3MA5A 2DWQA 1XSEA 3BQOA 1KO5A 4KREA 4FMCF 4EZLA 2QW1A 4WBNA 2GXAA 5ECYA 3PEWA 5GJCA 4QZVA 5JHGB 4ABNA 2C61A 4FYMA 5LCXA 1E62A 4RX1A 2ISSD 4INPA 4ARAA 4QGFA 4JT9A 2FMIA 1KVSA 4W1SA 4DZZA 2X0EA 4KO8A 2JLCA 1U1DA 1JAIA 4O2LA 4P4GA 4JLWA 4F46A 2I2OA 2UAGA 1CC1S 4PU0A 4G5SA 5FBQB 4B3DA 3GRRA 1CEQA 4EFMA 2CFIA 5H4GA 6ADHA 1HT3A 4LXIA 1Z62A 1QO7A 1PEYA 2RHTA 3OCYA 3U4QB 1FU8A 3RBXA 1NOIA 2ZUSA 4RDIA 1Y7PA 3UC9A 5FH9A 3BMNB 3H7AA 1IOZA 4AJHA 1E6CA 1EG2A 5IC6A 1EUDA 5JRDS 4F7AA 2CUTA 1AHNA 1D9ZA 1ZRSA 2QLMA 1KAEA 4I2WA 2QTCA 3EUVA 1M6EX 2C4KA 2YRFA 1KRHA 1ZESA 3GVXA 3QWAA 4UU8A 2V6IA 3KOXA 1FMFA 1QB7A 1FRQA 3ABZA 1QBKC 3BXOA 3CSUA 3J81k 3V1LA 5DF1A 3N2GB 3UKDA 1BWSA 2EKBA 3KD3A 4GLLA 1M75A 4QLOA 5EKUA 4BMDA 5LYJB 2O3UA 2PKEA 2AK2A 2GT1A 4WZBB 3X3HA 2ZZNA 1XDSA 4KO1S 2NTVA 4LJ6A 1T2AA 1E3DA 4EECA 1YI0A 3C74A 3BQMB 1JQKA 4MA4A 4UASA 5IAKA 3TQCA 3UATA 5LMCA 1QVAA 1PKXA 1UM8A 2B4KA 1LD7A 4RS3A 4YLYA 4W5JA 4B17A 2LXLA 2ODTX 5H1YA 4JDPA 2AZTA 4JLVA 4CG2A 3P71T 1N8SA 3MSXA 1Q57A 3S4YA 3VSDA 5C4MA 1W581 4C4SA 2N1MA 4QFCA 4B6QA 4NS1A 4M55A 3O8DA 3BUSA 2GJ4A 3AKCA 1IY1A 1IKND 1IJBA 1Z4JA 2XPZA 1GO2A 4OAUC 1HZZA 3JQRA 2PNNA 1Z6XA 3T8KA 1NAIA 4G09A 4MUHA 5I45A 2IEGA 3AL2A 4PO8A 5BNZA 3TPCA 3C43A 3UOGA 3UQ3A 4HI0E 3U13A 4CL3A 4ZZ0A 3ZW9A 2X9QA 1I6LA 5KPDA 3D9JA 3F96A 4F06A 1DXYA 2HRZA 4FT2A 1NF2A 3LVRE 3BJEA 1DBVO 3DLBA 2QUAA 3PJGA 2FOIA 1SHTX 2CUZA 1Z8FA 4GNRA 3OICA 3SF8A 5JSUA 1ZU4A 2BLLA 3P2MA 5D51S 4J07A 3WGTA 2PUFA 4U6QA 4Y6RA 4CMEC 1F4PA 2J8SD 3P0HA 2H5IA 3AFNA 3DVSX 3BIOA 4MCIA 2HIAA 2Q5OA 3WO0A 4EY4A 5EWMA 2HE0A 3PPYA 2AW5A 4O4HB 4J8FA 4W5TA 1GKYA 2VGEA 3H13A 5WRFA 4MHTA 2SECE 5BN3B 2CWWA 4UBMA 3DMRA 3MMZA 5FI0B 4AJ4A 4GPIB 2HJVA 4QOJA 1EQAA 2BD0A 2ZI7A 5K0EA 5FOVA 3L1VA 3VHXB 2DX7A 4PPGA 5EI5A 4JI8B 4IG9A 2C3YA 1GCAA 4AY4A 4K9KA 4LVOA 4Y1EA 3TL2A 5AYWD 4NESA 3FTPA 3Q0IA 4JUIA 1K4YA 3L8FA 5FNVA 4EENA 2AS0A 2IS4A 1U0NA 2C29D 3DE2X 1W4AA 3LH5A 5CT8A 3W7VA 3COVA 4GBGA 3MEQA 2JLRA 1GPWB 2GAIA 4U39A 1L4YA 4FX5A 3P9ZA 3A8TA 2JGJA 5K0TA 3ZDAA 4X7MA 4H0CA 3HZHA 1F0PA 2ZIGA 1ILEA 3FMOB 1E5VA 4AY2A 1BDJA 4INOA 2BYTA 2WR8A 3NGMA 5KYYB 1THGA 1PX0A 2FUKA 4CF7A 2EFDB 2JVJA 4GOND 4B4KA 3EBLA 3SVTA 4NDNE 2PMBA 2WSLA 3QLJA 4KR0A 2GCNA 2GRMA 3HGQA 4CM9A 4DNOA 3CBGA 3GJ5A 3S29A 2ZSUA 2CG3A 4U3JA 4Y6SA 5AVXA 5TNXA 3IUNA 1L4GA 2DUWA 1LV7A 3S6JA 5A23A 3BKXA 3JUEA 3QY9A 2BUGA 1JQLB 3RIBA 1GWNA 3LFTA 2VXOA 5EHXA 2MWMA 1HUQA 3V2OA 4EB3A 2YHEA 4X8QA 1DPGA 2CL0X 1GIAA 1OMOA 2CC2A 1DV2A 3E53A 3UM1A 3JQ8A 5K1ZA 3RLIA 4B9AA 2WV7A 4C9BA 2IV2X 3KM0A 4PSDA 2BFOA 3UKUG 1QYDA 3L4EA 3IRVA 2OK7A 3FDJA 3FOBA 4UNRA 4K0RA 4M1OA 4PC7A 2IVZA 3HBFA 4CFZA 4CMHA 4ZO9A 4DBLE 5FQNA 2V8BA 4ZOLB 3ZS9A 5BQ3A 2O07A 2HUNA 3MVEA 3EPJA 4U2KA 3HEBA 1T13A 3K0EA 4Q9LA 1FLDA 3Q85A 5SZJA 4IGIA 1UMDA 5I5EA 2C5HA 4M38A 1U2GA 4BZPA 4DA9A 4BTAA 4HTFB 1DJOA 4J1TC 4WCFC 1Q7RA 2C95A 1ZJ6A 2OCAA 4L9WA 3TGWA 4XEIG 1DCQA 1GUZA 2WC1A 5DCYA 1TMKA 3SDZA 2Q6VA 4WXEA 3HDJA 4QOFA 4ZCTA 4HDOB 4OATA 1OYVA 3EOAI 2XAAA 3GDGA 4NZMA 2GEUA 1LI7A 1GA4A 1AUXA 3B2EA 1YQEA 4UEOA 1QYXA 5BYBA 4N1AA 3PREA 1AUOA 1OBVA 3H8SA 3UJPA 3TM5A 2VBFA 5JFGA 2ODPA 1KVQA 5TPZD 3FTDA 1JE0A 2IYSA 4J2HA 1GT6A 4UM8B 1YTUA 4JP3A 5KNGA 3RFFA 4OMCA 5TDHA 1E4VA 3GBPA 3THXB 4MA0A 2REOA 3ULEG 1NMXA 1ZD4A 5DX1A 4I55B 5IDVA 4CM5A 1XROA 2WFLB 3BMXA 3EBPA 1FK8A 1ZGAA 2ZRNA 3W7BA 2YVQA 4BWVA 2KATA 2H29A 1T3GA 2IPMA 2R1UA 1U9CA 2YZKA 3B3JA 2WXHA 1EVYA 4KNWA 4ESOA 3QVOA 1XD8A 1USVA 2GUGA 3DXXA 4QWMA 1RCTE 4QBKA 5G4KB 3IDAA 4HNGA 5C4IA 2C77A 1FYWA 4D0GA 4DAEA 3D9NA 5L3SB 4KQXA 4U9IS 4HOTA 4AL4A 1YJAA 1ZL0A 2JIPA 2UZAA 5BSWA 3NR2A 4DPLA 4DWJA 2RGNA 3H16A 5TMDA 3L9XA 3S8YA 5EHNA 2O0JA 5J47A 1M7HA 3CNQS 3I62A 1WW3A 4UBLA 5AKXA 3RKSA 3BWYA 4AECA 2CSUA 3PR2B 3DTNA 3UG6A 3EDRA 4BB9A 4F7DA 3LK6A 3N2YA 3BBLA 3GA7A 5E7IA 2APJA 1SBHA 2FSSA 1QTQA 2RGGA 3GQBB 4OQXA 5DBOA 5JTUA 3FDZA 2YHSA 3I5UA 2CL5A 5HRYA 4BBPA 4P93A 1E2GA 4OGLA 4EGQA 2R96A 1GPH1 2XEDA 3EY4A 4K9LA 2MYOA 4Q18A 2WA2A 5F33A 4ZOEA 1PJRA 3I9V1 5F77A 2D7JA 2XGGA 3NJ4A 4K2HA 3F6QA 4WWPA 3PT5A 4IRUB 3K16A 1ZU2A 1FW8A 1RKQA 1D9SA 1NJ5A 1NX6A 2BEUA 1Q7BA 1YB7A 1FNCA 4NYMQ 1WZIA 3KUDA 5F9FA 3WYDA 3YASA 3H1BA 1VYHA 1Q7CA 3JQ7B 1PR2A 2NZYA 1L8XA 2ODEA 3MJVA 4IJMA 4PDXA 4N5NA 3WB2A 3FNEA 5HIJA 1WU7A 3O3CA 2QN9A 4EITA 2X6FA 3CZ4A 3HADA 3ZYZA 1EEXB 1OKKA 2VSXE 1X80B 2VWHA 4TWZA 3IHWA 1OCZE 2UZIR 1FTWA 3L04A 2C31A 4FDVA 4OYYA 1IBKB 3KQWA 4G11A 4D1YA 3EGDB 2OORA 4LNUD 1RWOA 1DAGA 4FI3C 3ZNGA 3AF1A 3BCRA 1DUSA 5HTKA 1URPA 1R8JA 4PXAA 3WGJA 2XQIA 1H94A 2ZJ4A 3E33A 1LKZA 1INZA 1RE1A 1IEWA 2YCBA 3JZAA 2FVXA 1ST2A 2XRMA 3KRTA 1W4RA 1V35A 2YUIA 3AEKA 2H5JA 4JASB 5ENTD 4OLJA 4Q9IA 1BS1A 2JFFA 3MIZA 5DX8A 4EJ2A 1M5RA 2GCOA 4RCZA 2ST1A 3OLXA 4BNUA 4Z7JA 1J90A 5B3SE 2Q4DA 4ACLA 2FFRA 4Z0NA 3TVTA 4YPFA 2HDOA 1AE1A 3ASZA 2QVCA 4TXHA 4D44A 5ENSD 4DA0A 1OFTA 1KIAA 2D00A 2KLHA 4D92A 1C9NA 1QZXA 1BU9A 1UDWA 3L5KA 3D5QA 3PUIA 4YPOA 3U7QA 3O7WA 4G0QA 1Q7EA 3GP8A 1XRMA 3NBYC 2VATA 3BXXA 1E9EA 3N0RA 4KBFA 1PZEA 3ER8A 3G89A 1TF2A 3VYVA 2BLNA 1W52X 1CQJB 1OXKB 2GD0A 2HSZA 4PBTA 3SR4A 4H08A 3S1AB 1XMJA 2WMNA 2A58A 2ZP1A 1L5FA 4LE0A 1CQZA 1PEDA 2AN1A 5I9IA 3OTOB 1CNFA 3ESXA 1F5SA 3T99A 4JP2A 2R5SA 4YPVA 4LF6B 2IEJA 1GN9A 3MTAA 4HZUB 4B8YA 2HK6A 5H59A 4BNHA 2B1QA 4YCNA <