2VSNA

Structure and topological arrangement of an o-glcnac transferase homolog: insight into molecular control of intracellular glycosylation
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
544
structure length
534
Chain Sequence
AWLMLADAELGDTTAGEMAVQRPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLAGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords XCOGT
publication title Structure of an O-Glcnac Transferase Homolog Provides Insight Into Intracellular Glycosylation.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
total genus 194
structure length 534
sequence length 544
chains with identical sequence B
ec nomenclature ec 2.4.-.-:
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vsnA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vsnA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vsnA02
3VDNB 4W6QA 2P58C 4YNDA 4HORA 3ASHA 2GPAA 4GPBA 1P4HA 4I17A 3EDTB 5G05C 4GZ3A 5KJLA 2PRJA 1NZFA 3S7FA 1WM5A 1A8IA 4ME2A 1C50A 2XEVA 3CEQA 3LPZA 2JLBA 3ZPJA 1C8KA 3Q3EA 5FZQA 3UYLA 3ZCPA 3MSCA 5D00A 5LQDA 2FO7A 3DDSA 2QN2A 2C1XA 4N39A 3OXGA 1L5SA 3L7AA 1HH8A 2UY1B 1C3JA 3KD7A 1RRVA 2DBAA 3CX4A 4WHMA 3L01A 3IAAA 2KCKA 4JA9A 4F3VA 3OKPA 3NAZA 3T3GA 1ABBA 3L7BA 4I1AA 2QN9A 1WAO1 3GPBA 2QN3A 3LY7A 3UUXA 5JTTA 1A17A 4WUYA 2FETA 4GYYA 5EX3A 5KJNA 3LKUA 2PZIA 2XCCA 3MV2B 3OKAA 2SKDA 3CV3A 3AS5A 1NA0A 4U0UA 3BCUA 4AY5A 1PNVA 3RSCA 3NPAA 4HOQA 5C1DA 4GA1A 1FU8A 2O6LA 4I9EA 4FZRA 4LDPA 4IN3B 3GUHA 4GZ6A 3WXXA 2BGUA 3C48A 4EL0A 3NCHA 4YUAA 1GZ5A 2KS6A 2GT1A 3RJVA 4WADA 3QKWA 2HYZA 3Q49B 3AMVA 4XI9A 3LY9A 3VTYA 1L7XA 2C9ZA 1RZVA 4U07A 1UQUA 1XNFA 3UQ3A 4AMGA 4F9FA 2GEKA 2QN7A 2C0LA 5TMEA 2C0MA 1Z8DA 3VUEA 2XA2A 3MS7A 4WNDA 2FF4A 3FROA 3QWVA 3CKBA 4BT8A 4MHOA 1LWNA 3MRTA 3S27A 2GEJA 4AIFA 1Y6FA 3RO2A 4WNEA 2AW3A 2LSVA 4G2VA 3G2IA 1ZBPA 3OTGA 2PQRA 4CTNA 2YHCA 4RG9A 2ZB2A 3BEEA 2XMPA 3CKCA 2QN1A 1L6IA 5JJ7A 3FP3A 2QFCA 3KAEA 4EKEA 4REMA 1ELRA 2GW1A 1FTQA 2FBNA 3BD8A 2G9VA 1JEJA 2R4TA 5FTPA 4BTBA 2JJMA 4XIFA 2J9QA 1W3BA 5LCWC 2Y4UA 5GPBA 4J8FA 1QQEA 3BEOA 3CEHA 3JYSA 3S29A 5FZSA 8GPBA 3ZCSA 4CGVA 4BFCA 1UQTA 2G9RA 3H4TA 4B94A 3RSZA 5JJ6A 4BQEA 5KJMA 1EM6A 4G24A 5DU2A 2IEGA 5G04J 3ZN3A 1QM5A 3S28A 4EKYA 2QLLA 3TOVA 1FU7A 3G2LA 3MEKA 4Z5XA 2G9UA 3ESKA 3R9AB 2F3UA 1Z62A 4KQMA 4G2TA 4F96A 1ELWA 2R68A 3U4TA 1J39A 4O6FA 3SZ7A 4RENA 2XCUA 1C8LA 1NZNA 5M72A 1Z6PA 4CTMA 4AM9A 1FTYA 2H1HA 1HXIA 2QLNA 1P4GA 1IHGA 3EBOA 4J8DA 2JZCA 3SYMA 3HBMA 5JJTA 4UI9K 1JG6A 4UI9J 3HBNA 3Q4AB 3CUWA 4N3BA 4NESA 2IFUA 3CUTA 2BFWA 3NF1A 4UQYA 2Y4TA 4GZ5A 4N5CA 1O6CA 3PDNA 5BW8C 1P2DA 4YVOA 3Q3HA 2IV3A 3PE3A 3L7DA 4X7PA 3KS2A 5A7DB 3UYKA 2QZSA 3MV3B 3ZCQA 2AVPA 1JIXA 3LYAA 4AY6A 3C4VA 1LWOA 3QHPA 3MQFA 2H1FA 3HYMB 3N71A 3DZCA 2FF5A 4CTOA 5CHEE 2V5FA 2GPBA 4BQFA 5JTUA 2IF4A 2QRQA 1WV0A 5BNWA 3WAGA 1SXQA 3CVNA 3TAXA 3NP9A 5ENZA 3S2UA 2L6JA 2XCBA 4GYOA 4Y6WA 2KC7A 3QKYA 2XCIA 4L22A 4N2QA 4GCNA 3OTIA 2E2EA 5CCMA 1Y6GA 4MI3A 2PQNA 1FS4A 1AHPA 3G2HA 2X6RA 2VYIA 2F3PA 3Q5MA 3O3CA 4N2SA 3VUFA 1GPYA 4UQXA 4U0SA 4MI9A 3ZGQA 1IYGA 4LEUA 3RO3A 4APOA 2AZDA 4WACA 2VGYA 4F97A 3ZCVA 2WQHA 4I2WA 2F9FA 4M83A 1PC2A 1XL0A 4M60A 2IV7A 1OUVA 2R4UA 3S0JA 4RIHA 1WV1A 4QLBA 3S7DA 3T3IA 5DXFA 3O48A 4GPKA 3Q15A 1B89A 1V4VA 2Q6VA 1Z6QA 4FKZA 3QWWA 6GPBA 1JIVA 3BDAA 5AYWD 3BD7A 4N3CA 3CVQA 2R5SA 4H7XA 1EXVA 1QZ2A 2ACWA 3T3EA 4WNGA 3C4QA 2LNIA 3GYZA 3HBFA 1B4DA 2XGMA 3AS4A 5D01A 4UQZA 3MRVA 2C2LA 2QN8A 5IKOA 3TG4A 3ASGA 1F0KA 4N9WA 3MT7A 2Q7FA 2YJNA 1HZ4A 2HY7A 2ATIA 4MICA 4A1SA 1WW2A 2XPIA 2PYIA 3RIBA 4HOTA 4RIEA 1NA3A 5ARGA 1GGNA 3OKCA 2QLMA 1YGPA 2VCEA 4X7RA 4YI5A 4GA2A 2GJ4A 4BQIA 3T7DA 2OFFA 3G2NA 2VGXA 1XKXA 4BT9A 3FFLA 3CUVA 1YA6A 1L5WA 2WPVA 2QRHA 3MS2A 1Y8MA 3SF4A 5G04C 3CUUA 4EL5A 3BCRA 2SKEA 1FC0A 3G2JA 2IYFA 3S7JA 4CGWA 5BT1A 2BGTA 3TG5A 1FU4A 3CV0A 5HI7A 1NZDA 5D0QD 1PYGA 1PN3A 4EJ2A 1NOIA 2QRMA 5TMBA 1GPBA 3ZCRA 2C4MA 2X6QA 4JHRA 2BISA 2HO1A 2YQ8A 5HQ8A 4BTAA 3U3WA 2XGSA 4G1TA 1RZUA 2GPNA 1GPAA 3OTHA 4X7MA 3WADA 2OOEA 3UPVA 1JIUA 4I2ZA 4N3AA 2C1ZA 2XA9A 3MT8A 3ZCTA 3ASFA 3NC4A 1Y8ZA 1NLMA 1PSWA 1TJCA 3D0QA 3LCAA 3HBJA 4HLNA 4UI9C 3E3OA 5DLDA 4G23A 3K9IA 4U04A 1P4JA 3MT9A 2QNBA 1ZU2A 1L5RA 2MHKA 3EBPA 3RHZA 3S7BA 3ZHEB 1XC7A 5G05J 3MTDA 1K08A 2KCLA 1E96B 4EQFA 3MTBA 2FFRA 4BWRA 4MRAA 4H7YA 3ULQA 4RIFA 2VGXB 3DDWA 1P5QA 3MRXA 4PQGA 3SYRA 3H4IA 2X0DA 1GG8A 3MS4A 2KATA 1WUTA 2VG8A 3CK9A 4Y6CA 3QWPA 2QRGA 3L79A 2ONDA 3MA5A 4J0UA 4I9CA 1L5VA 4YI3A 2PRIA 4RELA 3T3HA 4XI0A 1M5RA 5D0OD 1UZUA 3URZA 1SXPA 4JL0A 4NC9A 1GFZA 2F3QA 2G9QA 1NVKA 4NEQA 1VGVA 5EX0A 4G26A 1FCHA 5IKPA 3NB0A 3CVPA 2FEZA 3GZ1A 2IUYA 3GW4A 3PE4A 4RIIA 3OY2A 1P29A 3WC4A 2XA1A 2ACVA 1QKJA 4HWGA 3CVLA 3RKVA 1WUYA 2VSYA 4CDRA 1KT0A 4RG6A 4HOUA 3CEJA 4X6LA 4AN4A 3VDMA 2AMVA 4WNFA 3AS8A 4U0ZA 1FTWA 4W9RA 1WW3A 4KYOB 3E3LA 2R66A 1KT1A 3ASDA 5KJKA 5CCLA 2LSUA 4KBQA 4KXKB 2IYAA 2ECPA 3T3DA 3OXLA 2PYDA 3ZCUA 2FI7A 3CK7A 3LY8A 1XOIA 3Q3IA 2HR2A 5TVGA 4AMBA 2I6HA 3COPA 1KLXA 3OT5A 4KQ1A 4GCOA 1P2BA 4ABNA 3E3NA 1FA9A 2IEIA 2GM9A 1E4OA 3MTAA 5ARFA 5FT9A 2NC9A 3G2KA 3Q47B 3GZ2A 2P6PA 2R60A 3IEGA 3ZHEA 5DIZA 1IXYA 1K06A 3OY7A 3TSAA 3QOUA 4MI6A 3L7CA 4RIGA 2WTXA 3FWVA 3CEMA 1NOJA 5A6CA 3CK8A 3CUYA 4GA0A 1P2GA 1KTIA 2X0FA 1BX3A 1H5UA 2IW1A 5LCWJ 2XGOA 3D0RA 4M7PA 4J8EA 1XV5A 4NQ0A 4NRHB 1JG7A 2F3SA 5FZRA 2X0EA 2UY1A 1NOKA 4YVQC 3RT1A 3VTXA 4MHSA 3MKRA 2PL2A 4G25A 4RBNA 2VQ2A 5EKQD 5HXAA 2BUGA 7GPBA 3BD6A 1XL1A 3BCSA 2KCVA 3TGOA 1AXRA 3D1JA 3NP7A 3ZFWA 5I45A 1IIRA 9GPBA 4JA7A 3RU0A 2UWJG 1E1YA 1HLFA 2VCHA 4KQ2A 4HOSA 3E4BA 5TMDA 2PQ6A 3T5TA 1F6DA 2VSNA 4GYWA 2SKCA 2AV6A 3QDNA 3DD1A 4LEIA 5DBKA 3IA7A 3MBOA 5FJYA 1YA0A 3OXFA 2QRPA 2ASVA 1L5QA
chains in the Genus database with same CATH superfamily
5I6DA 4B2PA 3GH1A 1YIDA 4YCMA 4J8SA 1KSJA 4HLEA 1VG9B 2JIZD 2ZRDA 2IDJA 3UXHA 3U16A 2P9KG 1GGEA 5FNVF 4DA6A 4X6XA 4ZTBA 1U28C 3DDSA 1SG9A 3QXSA 1JPUA 1NM5C 2Z5VA 1ZGBA 2QRVB 3MZ0A 4JYCA 4NFLA 5TQ0B 2QN9A 2FQQA 3UUXA 2H1SA 3S6JA 3GB9A 1YT5A 3OOWA 4TS1A 2VK2A 5AKLA 1DBWA 2RH4A 3LLVA 1L1FA 1JIKA 3L8FA 4YV1A 5EIEA 2LD4A 1CYDA 3SSOA 3RHFA 2V7QD 2V6MA 4CUJA 4Z8YA 5A6SA 5K5EA 2CKMA 4DCTA 1M33A 3NHFA 4OX9Y 3L40A 4QTTB 4MVJE 1UP6A 2HO5A 3I5MA 5HX7A 2PUDA 1OYVA 4WLVA 1JX6A 4N7BA 3P9IA 2QW0X 4WAUA 5K8LA 2QX4A 1Z38A 1G4UR 4YAUA 4JCCA 3BDVA 5IDQA 1BU8A 4PG8A 1NYRA 1R88A 3PFIA 1V3TA 2J33A 4JNCA 4Z99A 3ZHVA 3HKCB 4UWLA 4O60A 4N3GA 1KC3A 2P6OA 3AILA 3SAJA 3GUCA 5FWXB 3P52A 4LQLA 1F2UB 1WO8A 5LA6A 3M3HA 1KZ6A 3I37X 3WOHA 3NNNA 4Y2SA 4FP9A 3PR1A 2HLNA 4CTKA 4ZEMA 4M0CA 4PO8A 1XAIA 5A2GA 1SMKA 4FJ2A 3UCXA 3NWBA 5JJ5A 2GRAA 2QIOA 1GG9A 3S2ZA 3DOHA 5ALZA 3QTLA 1Z2DA 1ODLA 3E48A 4LV8B 3EFOA 3AR5A 1QIFA 2FWNA 3FOAA 1RAGA 1KDTA 4OHKA 3WHPA 3WK4A 1CFJA 1K89A 5JRDS 4N5DA 4NOKA 3VHRA 3DUFB 4RF5A 3KXDA 4CM7A 3HDHA 2XF2A 4FMBB 5JSYA 5IARA 2GVNA 1S2IA 2AVNA 3MCWA 1VZ3A 4TVOA 2C2LA 4LVCA 1K9SA 3JTMA 3UW3A 1NA3A 4YLEA 1I5OA 1NAHA 5FBRB 2ERYA 1WP9A 1RHQA 5FO0A 1BWSA 5KOHB 4QBFA 4QTYA 5F2EA 1I1QB 4QYSA 2ECQA 4MCIA 3W5UA 2ZZMA 5THKA 1LY1A 5C3MA 1GQFA 3R9XA 1SBQA 4G8DA 4XR9A 1JEOA 1BYIA 4RSYA 3E6AA 2IPAB 4EEKA 1U2PA 4AV7A 3PWTA 3WKAA 2I1JA 1WPRA 2WOOA 4BWRA 3SZMA 3DNMA 3VISA 3COJA 1K3FA 2D1FA 4R7TA 1C3VA 2WWTA 1RWVA 2IE8A 1ZMOA 1ZO8A 3ACDA 4QEDA 1EXNA 3DFKA 5GGXA 3UI2A 3EHMA 5IUNC 2AYYA 1EA5A 3CG0A 1DO0A 1SVUA 1TQ8A 4IQFA 4YMIA 3BIOA 2WJIA 4CIYA 4OLBA 2QC9A 1GZ6A 4RG6A 4JELA 3NETA 4I9UA 1NMQA 3GH3A 2OZEA 2QM3A 1DIHA 2NW6A 1QPZA 4Z1MA 1N8NA 3S2FA 3NTVA 3JQ6A 5GGYA 4WX2B 3BM5A 4H31A 3FCAA 2JS7A 4RFLA 2ZANA 5ALYA 1PK7A 4NH0A 2V5QC 2P1RA 4XM1A 3FDZB 3OOEA 4B80A 5ALGA 4MQ5A 3IKJA 2KLHA 1NUHA 2LO6A 2A4ZA 3KXIA 5JNSA 2QSYA 3R7RA 3Q9SA 3A3KA 1E9SA 4CV3A 2FHPA 2OD7A 2X58A 2WLTA 3RHTA 5JQWA 1J5EB 4UKDA 5C7LO 2K7ZA 4I50F 1F1BA 5EWMB 3BH7A 4MVXA 1JTEA 3EEIA 2C5AA 1SBYA 3QAQA 3TRKA 2RFLA 2EP8A 2CW5A 5IDYA 3LPZA 1IXZA 3BMQB 3PXDA 2NV6A 4XSHA 3U09A 1CE8A 1E2DA 4DV6B 2Q7DA 4YLGA 3ZOKA 3RAGA 3BWMA 5E1MA 1ZMXA 1SQSA 3SVTA 1NC1A 2I62A 5AD1A 1X13A 1ECBA 5AIBA 1NFFA 1NP6A 4BO1A 4DIOA 1YB4A 4UC0A 1NNI1 2OVBA 4H3VA 4F9GA 3UPUA 3RYIB 1PNRA 5K45A 3B1ZA 3M6LA 1KU0A 2I6XA 4FQ7A 3CGGA 4QXAA 4KX5A 5E6RB 1TU3A 3IAUA 1YMQA 4I4IA 2A9KA 3GFGA 4W99A 2Y4OA 2EIME 5CB8A 2OKCA 4EJ0A 1N2GA 3T15A 5HIJA 3JQBC 2C7QA 4IJUA 2A78A 5DHPA 3R44A 4GEKA 1YQTA 1MV8A 3EBLA 5CXXA 4OQYA 1ZUD1 1GLGA 5TQVA 3BG5A 1E89A 2RG8A 3LIIA 5GJBA 1ZBQA 1UF9A 3IESA 2AOVA 1N95A 2QLLA 1H2UA 2N1BA 3KJNA 3QV2A 3PZRA 8ADHA 3UTCA 3BN3A 3JW8A 3ROPA 5H4HA 5DKFA 4IGKA 3Q7RA 1LDBA 5GADl 3RBXA 1TF2A 1I0IA 1QF7A 2PUGA 3ZI7A 2NYRA 2BFBA 4B47A 5FOWA 1RYMA 1RS0A 4E3WA 1PWXA 3L0SA 1JZTA 1JPJA 2P0AA 4B4UA 1K6IA 3SU8A 1P31A 1Q0LA 5J4HA 4I5FA 3HYMB 3N71A 1K75A 3P0EA 2MIIA 4AF6A 4WK6A 2RAPA 1OAKA 4EYGA 2ETCA 3S55A 5CA0F 3MPUA 4DFDA 3EEBA 5EPOA 3Q5MA 2JRLA 1G16A 3SXUB 3LUDA 3PUZA 4A2WA 2R4UA 2CCGA 1OI2A 4X00A 4ANXA 1G4AE 1JDPA 4I2VA 4EMUA 2A5YB 4Q3BA 4RD6A 2GHRA 3K70B 4EW1A 5KYUA 1RJGA 1EFRA 1TW3A 1YBMA 2GD0A 3L82B 1H3EA 3VOBA 3CHOA 1YBAA 3QK7A 2P69A 1GPNA 4A1SA 4C7KA 1YZTA 2RGBA 1V11A 3DXFA 4RIEA 1KYYA 4EVIA 4PLHA 4ATGA 1ST2A 1WXQA 4GUAA 4EW2A 4C7XA 1R0BA 3H2JA 1OKKD 1QGZA 2G3YA 4BO0A 2ZRKA 1PYDA 2XUPA 5K0NA 5CDFA 1IN5A 5G55A 3ZCRA 3BXPA 3H3JA 1H9BA 2OO5C 3R3HA 1H66A 4WKGA 3G3EA 4P35A 4QFVA 2AI1A 2WWHA 1E1CB 1DUIA 3C7DB 1W96A 4RYLA 1XROA 4HATA 3V32A 3T61A 2YR0A 2JF0A 1ZOPA 2W2QA 2XMDA 1CS0B 3HUUA 3HZHA 1M0SA 1Z0FA 1O5MA 3T8KA 3R0QA 3UCFA 3JD4A 2HUPA 2FSIA 2VYND 1A3CA 5C1IA 2XXBA 1OAAA 2ZRPA 2Q62A 1FDWA 1LQ2A 5FPHA 3ZK8A 1AKMA 1GHTA 1QYDA 3TIGA 1RWBA 1XQVA 2X7XA 4HUQB 2ETVA 3JVDA 4OGLA 1MRSA 4FIDA 3SYLA 2GRLA 2HA2A 4JAVC 1JSCA 3PF9A 3N75A 2ZVQX 3KV3O 3KZMA 4CZ2A 4HYEA 5L7YA 4E11A 3DPYA 2R66A 1LSJA 1JJFA 1NRWA 4XQCA 3CK7A 3Q8KA 1DVRA 1K66A 4JFAA 1SKQA 3NDIA 4ABNA 4CQMD 1HFJA 4P0PB 4X24A 4XR4A 3WV5A 1M10A 4QASA 1YDHA 3S68A 1GV1A 4L07A 4V2UA 1KI2A 4YB8A 3SCZA 1SXIA 4NMWA 5U1PA 1QZ3A 3QEOA 1ATIA 1DMRA 3FNHA 1VBFA 2EZ4A 1PTJA 1H8EA 1XDSA 3E4DA 2NUAB 2X13A 5I45A 1MDBA 3L1VA 3Q2KA 1V6CA 4RE6A 4HN9A 1JKJB 3Q7TA 3CS3A 4NYIQ 1J8MF 1BS2A 5EXSA 3KC2A 3ECCA 1II0A 4OJNA 3D3WB 1B42A 3RNOA 3AEUA 4RLYA 3I34X 4C29A 4BWYA 2Y1CA 2ZIZA 4KKVA 1YA4A 2BKUA 1OC2A 3NOVA 1GJRA 2XLCA 1VG1A 3O1IC 3BCUA 4RFVA 1I4TD 1OBOA 1V43A 4F4CA 3DFUA 1K7YA 3HEAA 1QHSA 1ZM2A 5C2JB 1RWXA 5K0ZA 3ML8A 2YQZA 3HP4A 2B9EA 2FJUA 1P2SA 2YVAA 4ZDIA 5ELXA 3EVAA 4EFMA 2Z9CA 3ZV7A 1PJCA 2CHFA 4YJ2A 3L5KA 4QXRA 3EC7A 3A14A 1VHQA 5FTPA 1L5HB 2NXCA 1DWUA 4LJAA 1T5SA 4C88A 4WJLA 1LPSA 1FSFA 2QQEA 4CCYB 2IEGA 3GRVA 4NCNA 1BE6A 2X22A 4PXAA 3AUYA 3DLPX 3WL8A 4L4RA 3OEHA 4RA9B 3WKBA 1DCFA 1Q0QA 3GLSA 2EHDA 1O94A 3IHWA 4RHFA 4GB9A 2ODEA 3IV0A 1BROA 4JI5B 3LKDA 5JBIA 3B1KA 4JQCA 4Q9IA 1I13A 1UBLS 4TVBA 4AY6A 1XLTA 2W37A 3QHPA 1E3DA 2E3JA 3HXCA 4APFA 3EUWA 2OZPA 1UDWA 2EERA 3R5FA 3CN7A 5ELLA 4JLOA 4IIBA 2K2QB 2SECE 4V0KA 4B45A 3LF1A 3W8EA 1FVXA 1DFGA 4M22A 5A0VA 3SK0A 2C95A 4EFNA 1N6OA 1FMTA 4TYMA 2WAYA 3KQVA 4PICA 5IKOA 5D85A 3VSEA 4RVUA 3DEPA 4J0IA 1CHDA 4E07A 4JVSA 1JKMA 4N76A 3W05A 3W77A 3A9VA 2DR0A 4YI5A 3T7DA 4OUKX 2VH2A 3A4VA 5JWOA 1WOYA 2WM2A 2X4GA 1CDZA 1Z08A 1F3OA 3HCEA 4FU3A 1I36A 3KFLA 4EGQA 5AM4A 3ETNA 3MJSA 3W2GA 3WNDA 3DZKA 4B3HA 3U7HB 4MRMB 1U1FA 4RHTA 1K5PA 1VCMA 3O7WA 2RBKA 3UT5A 1J2UA 2VTBB 3W34A 1H5NA 4IKEA 4GUDA 4YCDA 5AFSA 3D3KA 1M34B 4JMLA 4GTMA 5BUQA 4ZMSA 4Y2XA 4QQFA 1JEQA 1RWPA 4IHAA 2ABWA 3QYPA 4ANVA 1XAJA 3CE9A 2Q6KA 3EU5A 1H0AA 2HFKA 1KH1A 3VR6D 1MHTA 4Z0NA 3KU4A 2IEDA 2PGDA 3R7NA 1ESCA 5EWJB 2BR5A 4KODA 4EHBA 2IYAA 2JFOA 4A0SA 4LDQA 1HF3A 3IRUA 4DNXA 5AO9A 3G2KA 1RQRA 5C32A 2P9JA 1EBFA 3OY7A 2AR0A 4HPWA 3LDZA 5EN5D 2CL5A 2BEUB 4KN5A 1EVZA 2WVGA 3SX2A 1I9GA 3KUXA 1SOVA 3RW9A 1R4ZA 4MHSA 1CR2A 5EE9A 3ANTA 2XZOA 3ZV5A 1EESA 4AB1A 4NZYA 4FHKA 3WLQA 2VFAA 2D1RA 1QP4A 1DWOA 3C7KA 1L4LA 1WQ3A 4ZQEA 3G9UA 4Q9JA 5HE9A 3IE2A 1Z4PX 4MV0A 9LDBA 2GKOA 3LP8A 5I4BA 4C4OA 1J00A 2Z5GA 2QRZA 3W8RA 2ZU6A 2JD0A 3S4YA 3EGCA 3BIFA 3SYNA 4RXUA 3QM1A 5DF1A 4WGGA 3TZQA 1ZN7A 2ERCA 4UWHA 4LW8A 5FOTA 2VR1A 2IZOA 4GC5A 4P7BA 1UJ6A 1KPGA 5B1HA 4EO4A 1IB0A 1U2SA 3R9MA 3AVOA 5GONA 1KDOA 4RYDA 3C6MA 4CFSA 3C0KA 1M7HA 2JAPA 4I9EA 2P9UG 3W5HA 1RYEA 2RHMA 4MDHA 3ZDDA 4KQHA 4URWR 2CHVA 3QTBA 3IBYA 2XV1A 1XZLA 5ESWA 4DUIA 3BG1B 1KI9A 3DHWC 4LG1A 4QPDA 5BWBA 1DHTA 2P68A 2D1TA 1W36C 2ZKLA 3G9QA 1KA9H 2I3BA 1SQ5A 2YOGA 8GPBA 4B9EA 3AR8A 2VT7A 4TS3A 5F2OA 1GRQA 1RI1A 4UATA 4CLXA 5BXOA 3SC3A 5ALVA 3ZS9A 4EFKA 1M8GA 4Y8VA 1J9EA 5EZYB 1XRPA 2FMHA 1W6UA 3HN6A 5M34A 4FW8A 1PIWA 2E4UA 3L8GA 1ZK3A 2V6GA 4R83A 1P4RA 2FZKA 4JHKA 3K05A 4F3TA 4PHHA 4Z53A 1L5FA 3HBNA 3QF4A 3M4NA 3G7UA 3ZNOA 1O6CA 5SV2A 2BGRA 3SC6A 2AVPA 1YTUA 4EKIA 1JMKC 4F72A 1LWOA 2FP4A 2PS0A 1N4DA 2OOSA 2P90A 6ABPA 2RHLA 4JLMA 3G2WA 2DR2A 2FR1A 3R6GA 5JHHB 1ZHOA 1XZPA 3ND5A 1VRVA 3IURA 2Z30A 4ME6A 2R1VA 4NNPA 3O8OA 5CB6A 2PWZA 1J0BA 2BBOA 5HIMA 2Q6VA 1JA9A 1HKUA 3TM5A 2AFVA 4D0RA 2BE7A 2AX4A 3P9SA 5AXDA 3DKVA 3PV0A 3TFWA 4PYOA 4A15A 1ZSNA 3G5LA 3DYBA 2NVOA 2M98A 3X1DA 3WLRA 5HM8A 1T5TA 4FN5A 2J5XA 4MTLA 4EGAA 2ALJA 2X1VA 4F9TA 4F93B 5FOUA 4YDWA 4HZGA 4BPBA 1N1EA 2UVQA 1UOQA 5KNHD 1AWCB 1VHLA 3E33A 4JJGA 3L02A 3GX1A 4URFA 2QORA 1GKKA 3R5HA 1FVOA 1O5IA 1PG5A 2OBYA 2X5KO 2J8ZA 4RF3A 4YROA 1CEXA 3FB1A 2ZVPX 1XTIA 2Y1DA 1TD1A 2JJ2A 3KAQA 2AYZA 1EJ6A 4HJRA 1CVLA 2H0RA 5IF9A 1QQBA 5THQA 2YMQA 4OHRA 1HC7A 5C51B 3FBWA 3NVAA 3ULQA 3DUWA 4RELA 1Z13A 1NVAA 3Q2OA 2R48A 1IN4A 3KEFA 4NL4H 5JAOA 4L0QA 3R7SA 3GZ1A 1QX3A 3NMUF 1JBEA 4TGLA 4LI0A 1D04A 1ZC3A 2KBFA 4XA8A 1ZB1A 4YQEA 3FUUA 1WNTA 4A8TA 1EYZA 2HRRA 1D2CA 3DFMA 1BZYA 2GFHA 1GZVA 1Y37A 4ESVA 3CNOA 3ZUGA 3VQTA 2GBFA 2BJWA 3JXEA 3RC8A 3X44A 4KLAA 1XXHA 5HRAA 3E27A 2MSDB 1D6MA 3LHDA 4UNPA 2DHRA 3JWHA 5KNCD 4YAEA 1NJSA 4FFSA 3L6AA 1JLKA 1I6LA 2H00A 2X4DA 2R97A 1USVA 1IXSB 1K6EA 1YRBA 1OYYA 4B6QA 2BFEA 4ZA2A 2ZR9A 4RW0A 4U8GA 5DO9A 3H84A 4I5DA 2YJGA 3RTEA 2IHKA 1HG0A 4CCSA 1G8YA 1KMHA 3ABSB 3CLRC 2QTFA 3U4AA 3FDXA 3QUSA 5BXQC 2WF6A 2W6QA 2IZ5A 4PC6A 1TVKB 3B1FA 3T3GA 3F1LA 1YJBA 2GRNB 3TG8A 3FUKA 3WGVA 2X1HA 4KUHA 1JWFA 1QBQA 2I54A 1HG2A 4DW8A 1EPUA 3WGGA 1ZQ9A 2IH5A 3R9WA 1NIJA 3DBVO 5A4DA 3WWYA 5K6RA 4PPFA 4ZI5A 2EQBA 1A7UA 4UULA 4PPQA 2OSVA 3L46A 4IIFA 2GCIA 5I7RA 5F9FA 5F1OA 2EG9A 5KNDA 1YK0A 2BF7A 3HCWA 2OPBA 3VSBA 4K6OA 3IOBA 4IJMA 2Q07A 4KFUA 4HAZA 4RLQA 2AFHE 3IV6A 5I9SA 1DTSA 2XHZA 2CHQA 2ZWVA 3WBJA 2Z09A 4BN5A 1BXKA 4XQ9A 4BVEA 1YRYE 2WWXA 2E6UX 1H3FA 4A3VA 1OZAA 3ZZUA 4BIMA 2PLFA 4BGVA 2EP7A 3RUPA 3BG0B 3ZY6A 2J9FB 4JXZA 4GKKB 1E4EB 3Q3HA 4KQXA 1SA4A 3A6FA 4DK5A 4FE7A 3NHBA 1UBEA 3LYAA 7REQA 2IQ5A 1TTPB 2VJKA 2YOHA 1ISHA 3FAZA 3UH0A 4DPMA 2P9ZA 4ZJZA 1Z37A 2L6JA 2QTGA 2XNSA 2VAWA 2FN4A 3IQEA 3OF3A 4F3CA 4PAGA 1XD9A 3AERB 4M60A 2WIJA 5BW4A 5HBRA 3GPIA 5JATA 5KO2A 4WIAA 3T3EA 4ZCIA 2BGKA 3HXMA 2DU8A 1A9ZA 1VKRA 2BHSA 2RKOA 2FUEA 3OF5A 4ZEXA 1CQXA 2CE7A 4R2KA 1WW2A 2OBXA 5EZYF 2VP0A 4RTQA 1HKHA 2VZ9A 3LWDA 3EEQA 4M0MA 3V8NA 3A6DA 2F6RA 3KB1A 4HDAA 3EQ8A 3JR7A 5JQGA 4MBGA 3WRWA 4RORA 2RFMA 4FFLA 3LS2A 1RZUA 4A27A 3FGZA 4M3NA 1P3DA 2FUG6 3AG5A 2C9DA 2ZJFA 1T2EA 3IQZA 3L07A 4NOJA 4IZIA 3V6LA 4ENTA 2WXJA 1NVFA 1P1FA 3I0ZA 5IJXA 3V2GA 3UJCA 1U65A 1P7PA 2BI8A 1XJ0A 3K30A 1FFAA 2XUGA 4QQKA 4GPTA 1ADJA 4MUJA 4TLEA 4TLMB 5HK9A 4NEQA 4OXYA 4OMFG 2J67A 1XDWA 5KTRA 2HKIA 4P32A 2QYTA 5ITZA 4H6VA 1G8MA 2A2ZA 1ODIA 4HYYA 1XLTC 5CJJA 4OYHA 2JJQA 1NN3A 2A0FA 2G76A 1C1YA 5MGNA 3ZYKA 3V80A 4FZVA 4KQIA 2GHIA 3DMDA 4D5GA 5BN5A 1FA9A 2IK8A 3JXIA 2PL9A 1OHHD 1W5TA 1Z5PA 3A9WA 3E1KA 1UT5A 3DF7A 1C1XB 3RS8A 1UL1X 2IS6A 1GPMA 2PLRA 2Y05A 1U2DA 4D1YA 4MUXA 3T8YA 1T2AA 4LS3A 4M55A 2DPGA 4EEZA 5C3UA 3BFJA 3L49A 1VDZA 4QECA 1A9PA 3G9XA 3SO8A 4RZHA 1G9TA 5EP1A 5IG2A 3VPXA 2OC9A 4O2AF 2PBLA 3W8NA 3IHLA 3WHLA 1J06A 1IYZA 3F9IA 1NVUQ 1ZY2A 2O8VA 3AIMA 3THWB 2Y3IA 3DEKA 1W0CA 3OFJA 1KI1A 3MA0A 1VL5A 3FNRA 3GY0A 2HSZA 2QN6A 2YV4A 1JGTA 2B5WA 1WKBA 4WKPA 1NV8A 4UTOA 3E8SA 1X9GA 3DDHA 1OXBB 5ITVA 3SIXA 1AUXA 3FVQA 4JB8A 2JGAA 1SCKA 2Q2WA 2GNPA 4XCQA 2BBTA 3MB8A 3UKUG 1ZI8A 3MGBA 3TD2A 1HMPA 1TK9A 1V9SA 5E8RA 1PR0A 4NBSA 4QXOA 4FFBB 2QJWA 1P75A 3AU5A 2PFGA 4OXKA 3RE1A 4EHAA 3STWA 3CYFA 3OCWA 5BN4A 2O5VA 1LEHA 3G2LA 5F2NA 1E1MA 2GM5A 1FZTA 3E2IA 2GFQA 4HDNB 1KGDA 4EHNA 1G3RA 4Z9FA 1NBOA 5IXYA 4UHKA 2CUNA 5TB5A 2AE1A 2PUCA 1CJMA 2HRQA 4KR6A 4B6JA 3G2TA 1V8FA 3T8MA 1RFGE 2AG1A 2ZS8A 1XTPA 3L7DA 4BVJA 4XEUA 4TV9B 3MV3B 1QFZA 4FCWA 3P4UA 1RQNA 4FZ3A 3BXXA 1SQGA 2GZMA 4AULA 1VCNA 2XKJE 13PKA 1SGWA 4O3FA 3T5AA 5TQJA 1RHMA 3KUKA 221PA 4IOJA 4OJKA 3O3CA 4QQNA 3O4GA 2NVUA 4K9NA 1DB3A 5FAKA 4NI5A 2J5BA 4BTLA 3AV3A 3UAZA 4NJMA 2RIRA 5BWMA 1AK2A 1GDTA 2W5UA 5E95A 4DEYA 3ND8A 2OHVA 5HVNA 3GYBA 2P3QA 3RSLA 3RSGA 1HDIA 2ZUCA 1ESZA 2C4NA 6LDHA 2WKPA 4RE5A 2FN8A 3LZDA 4C5BA 4D7AA 4QOSA 3D6FA 2AXZA 3VJRA 4IEIA 3PYXA 4LMRA 4HDRA 5LQCA 4QPJC 3CPSA 3ZGZA 2X6HA 1BAPA 1PYOA 4IIUA 3NYWA 4NE9A 5E7JA 2RD2A 3ER8A 2OZLB 1YKSA 3KSDO 3ZDCA 3AUKA 4AZ0A 3R0VA 1P7CA 1XKLA 4PCVA 4C07A 3OI7A 1N52A 3ZE0B 4KU4A 5IEJA 3B7SA 3NQPA 3I61A 1RYDA 4EQZA 2D5CA 3KNZA 3BQOA 1XNGA 1V41E 2YHUA 3VOTA 3H7AA 2XUHA 3UA3A 5ALMA 3EG9A 2BJHA 1M2GA 5A9SA 3G0OA 1EM8A 2JGRA 2NQ2C 2CFUA 1KVRA 4FBMA 2OWDA 5CNIA 1N0UA 1NVGA 3UW1A 1KI7A 1JCSA 1U8ZA 2CXTA 3LQ4A 1JE0A 2VDOB 4ZOEA 2D2XA 1WUYA 3ZOZA 3UV7A 5H16A 1GYRA 2ERXA 5I9BA 2OBNA 2YXLA 1KFCB 3D9MA 4BEVA 1PW7A 3L7OA 2PCJA 2XNDA 2PLNA 1P0PA 4MKRA 2IGBA 5D5QA 5SICE 3KT6A 3LH5A 4BVFA 4MR7B 3P27A 4D57A 1MRZA 1N5IA 4A82A 3DAYA 4KTVE 2ZIFA 1DT3A 1E6CA 1USUA 4LV6A 1SA0B 5LCWJ 4L4XA 1GKUB 3MGCA 1MAAA 1CB0A 2FR0A 3ZWQA 3AM4A 5EPUA 2JBHA 2VNKA 1TKBA 5HCIA 4YJFB 2DPXA 1FW8A 3MERA 3RU0A 3SBTB 4X65B 4BQRA 1A8PA 2VCHA 1F6DA 4BATA 1SKUA 3QDNA 1RLIA 3TN7A 4UUAA 2REQB 4YJGA 1KRWA 1RE0A 3U0BA 1E2BA 1E3QA 1PO7A 1J21A 4ME2A 4EZEA 4OLFA 4AJPA 2AZXA 3UYLA 1SAYA 1X1TA 2YQ5A 4OBWA 3B7TA 2C1XA 5BRAA 4IXTA 2ZI7A 2VBFA 3OU7A 3KL4A 4U7FA 3EXG1 1MX2A 3DZ8A 4MCHA 3AUFA 1JIQA 3E05A 4C1BA 4ZK2A 2GCOB 3UC5A 4P4UA 5DFAA 2CJFA 1Q0TA 4HLDA 1NMEA 2A7QA 2C03A 3ZIMA 3T7KA 1QORA 4PINA 2C29D 4RHYA 3WR5A 1R9MA 2X8JB 1B3BA 5TX7A 3FWZA 3D43A 3APDA 1N5RA 5IM5A 5T4FA 1Z82A 4QJ5A 1JFFA 2PZ8A 3HHEA 2IDMA 3BFVA 3WLPA 5ARCA 4UNNA 5EEGA 3KAEA 3F46A 4D8UA 3EJ6A 2ZE5A 3BIWA 3E2MA 1RPTA 4YJ3B 2WI8A 1H1DA 4DHWA 3OLYA 3CZAA 3N0TA 1X0VA 3IT1A 3CMCO 4C0QC 1OH8A 2FG5A 2BFCB 4BN4A 1KGSA 3RABA 4F96A 2VK1A 1NZNA 4P4LA 4H7HA 2VHXA 5AK6A 3T0IA 1O95A 3BWBA 1R9NA 2RCNA 4MIEA 1V4NA 3SYTA 4E7OA 3JRWA 5AM2A 3C4VA 3JQ1A 4XB6B 1GKYA 2A57A 1VA4A 2V1UA 3ST7A 3FMVA 4MI1A 3RANA 4AROA 3ZX5A 3EWAA 4TV3A 1GPYA 4ZVUA 3R77A 3W7VA 4INOA 2CNWA 2CXHA 3UXGA 4M0KA 5TEVA 2W6OA 3KKMA 4HEQA 3GWGA 1A9TA 4HBGA 2IOSA 1VC2A 4PCAA 2OBBA 2GZ3A 4DDHA 1I0LA 2OORC 1NURA 2ZG6A 3TX6A 1D7AA 5SYNA 1I80A 2BMWA 3FULA 4DUYB 3V4SA 1Y5MA 4M0UA 2AF3C 2XB9A 3NZUA 2VHTA 2EX0A 4TSFA 1QSGA 2C4HA 3CMMA 3LZ6A 1E8WA 3FTFA 3Q6IA 4C04A 2ZYHA 2OEWA 1SZAA 1F06A 3Q15C 4RXMA 5EZSA 2EYUA 2GA8A 5K09A 1DDOA 2DJIA 3CUUA 1CK4A 4HQDA 3D4BA 3CUSA 5D0QD 1YMUA 3L1HA 4ROSA 2PR2A 2IXAA 4GRAA 3D8SA 1L1QA 4FNGA 4KGDA 4S24A 4TV9F 2IHYA 1OA1A 2IYWA 5EWLB 2W43A 3K9IA 1JALA 4UFNA 2JFPA 2O54A 2Q6TA 3MTDA 2R8RA 1G20B 1VJGA 3C8ZA 4G1MB 4FILA 5JW6A 1Y8RB 2HLHA 2A1TS 2EIKE 3CWZA 4IUBS 2GD1O 3LY5A 4RZ3A 1YTLA 1RABA 2GXUA 2R8PA 4UM5A 3BCHA 4JZYA 4NC9A 3K35A 2XVAA 1RRCA 1VRWA 4IIXA 4PAQA 2V5VA 3JZFA 4ILGA 4NK5A 1X38A 2GR9A 4FOTA 2VF2A 2V7QA 4OI2A 3FH5A 3M6AA 2CK3D 4KQJA 4AO8A 3SQWA 1TKRA 1VLHA 1DLIA 4RD1A 4GI7A 4BFZA 1LU9A 1E2KA 2G5PA 3T3DA 1DELA 1PI3A 4Y2GA 2QDXA 4P83A 1RTTA 2YXBA 1GSIA 1M76A 1AZLA 4XIGS 2ODQA 3GZ2A 4E5PA 3DEIA 1IXYA 3BAFA 1QRSA 2HA6A 4H0CA 4RULA 2O48X 3FUHA 3R3VA 1MRNA 3SF8A 3KL2A 3VYRB 3PZBA 2XZDA 2Z8YA 1YJ8A 2BUBA 1BVYF 1W6RA 2B3DA 3AONB 1NQVA 3G17A 2WMYA 1YS9A 4BV9A 1L7OA 5KDDA 2BAGA 1G3QA 3IA7A 3LHKA 1COWD 4I9FA 1UW4B 2X77A 1Q83A 3KWJA 3FNBA 4J1QA 4A3TA 2GXSA 3OD1A 3O75A 5JROA 1T2CA 3EPPA 1S5PA 2POQX 2W8BA 1ZI9A 1PV4A 2IA5A 4TQUS 4ALNA 4X20A 3L8YA 3EYAA 1TMOA 1R74A 5DM0A 2FWBA 4IDEA 4NATA 3PZ2A 1JYFA 5EKXA 3L9TA 1KY5A 2XD4A 3FI9A 2I2OA 2RE8A 2X2FA 2PSDA 3PUXA 1BCSA 3SJUA 2C4KA 1IQRA 3QVKA 5HCUA 3C48A 1GU0A 2R2GA 2WVHA 2Q5EA 2GVZC 1G6HA 3AJEA 1G8JA 1N9GB 3FCUB 3CRRA 4W5JA 3Q9LA 4MP8A 4LDNA 3A1NA 4BE4A 3UG6A 1U31A 5LQRA 2YYYA 1IKND 3E7FA 4L6IA 5DLYA 4RTJA 1L4MA 4EENA 3ZHQA 2OPHA 4AZTA 1CTQA 5T3UA 4YRPA 3QJ5A 3R09A 1UODA 1MVLA 5DLPA 1Y3AA 3OFNA 4F3KA 5T4BA 4YP1A 3EOZA 4BQOA 1LUAA 3ANXA 5KYYB 1AS0A 1KXJA 1DVPA 4TWJA 5TT0A 5ALTA 3NEYA 1TM7E 4CWAA 2FOLA 1T3ZA 4C21A 3DSXA 1OR8A 4ZOQI 4RHXA 3GJ7A 1J39A 1LPOA 2J9GA 1Q22A 4AM9A 4AZVA 3NTQA 3DTTA 1A97A 3WB0A 1KO1A 1U2DC 2FGJA 2QJFA 4M49A 5D2CA 2IFUA 1PR3A 4FJ1A 4PNEA 1CUCA 3EEOA 3IXMA 3MWKA 4EHIA 3UT0A 4HNTA 5FPTA 3JQ0A 1V1JA 3S7ZA 3KS2A 3P9QA 3F6CA 1Z0IA 4LXUA 5C4IA 2YZGA 4URKA 1B74A 1WDMA 1Y6GA 3QPAA 4IIVA 1Z5OA 5JXIA 3ZC3A 5LPNA 4DV5B 1PQYA 3RV3A 3T7IA 1GGVA 1OX6A 2P75A 1XK7A 1TQHA 1QCZA 1UJMA 1IZ8A 1WV1A 1OI4A 1EA7A 1CT9A 1WEKA 1GGKA 1HY3A 4DQUA 2PS1A 1ZJJA 1U3GA 4YJ3F 3QEKA 3BB3A 4ENVA 1NA5A 3HJUA 1C29B 3QFTA 1ZM9A 4IVQA 3I04M 2XH8A 2XCLA 1WXHA 3LG2A 4OGFA 2EHJA 2Q5HA 5F98A 1EJ0A 1PSZA 1M1NA 3NWJA 3DBLB 4WZAB 5JC8A 1FE8A 4CLHA 1UXIA 2X40A 2XBLA 4CKWA 1H4QA 4Y9DA 3B9BA 3N2EA 1UJCA 2QRUA 5KPJA 5CG1A 2GTPA 4MO9A 3UJNA 4GL4A 1UAGA 4HS2A 4OQXA 2H7YA 5H80A 3IVXA 4MV4A 4YS6A 4DQ0A 3Q6NA 4MV7A 3HZZA 1VSTA 3K0EA 3RADC 2X6JA 3FTPA 3IIJA 4HRLA 4KZCA 1SK8A 1DS6A 1YR8A 1KEEA 3SZRA 1K0UA 3RU7A 2GUGA 4PIVA 1AA9A 4I9CA 2NX2A 1V3VA 5DISB 1OQAA 4PGMA 3LAWA 3K1YA 4MWBA 3SD7A 4EUFA 3K2QA 4DX1A 4PX5A 4ZCRA 1E5LA 3PNPA 2LRHA 4IWNA 1YC2A 1G5PA 3Q5EA 5JRJA 3ADDA 5BWOA 3BMOB 3IAHA 5JD5A 3G79A 2I8AA 3NOCD 2JATA 1BW9B 1ZA1A 3FM9A 3X1XA 4OAPA 3KVYA 2FSVC 2XENA 2QY9A 4BLVA 3QPDA 3MGKA 3UWDA 5JAUA 3MJWA 1GUDA 2MDTA 4MLDA 3B2QA 1KOFA 5AW9A 3CRNA 2P4SA 2HHJA 3NH6A 3TO5A 2IZ1A 4YGXB 1OOEA 3OVMA 1FSSA 3PC7A 3UUGA 1ENOA 1DAHA 2CD9A 4LYFA 3H6HA 2BM0A 2I5PO 2DFVA 5COBA 4C1NA 2IKSA 3FW1A 3R40A 6YASA 4R1NA 3CUKA 3BZWA 2EQXA 3DMFA 3RC9A 1M2JA 3FNIA 3FTQA 1S2MA 3SQMA 5DLEA 2R8EA 4KLNA 4JBWA 3JWPA 3P71T 5ICSA 5TGTA 1VYHA 2UYQA 4J0GA 1LRLA 1AZSC 1FK8A 1L7AA 1N6RA 5DEOA 2VRCD 4L5YA 1OLOA 1OV4A 2PGNA 2W2TA 2ZR8A 5B2EA 4G89A 1UXKA 4XB2A 2AZ4A 3RSCA 3NONA 4MMYB 3HO6A 2CBXA 4OCZA 1DAEA 2GT1A 1Y8QB 1P61B 4ZAZA 1ECFA 3HVEB 1YS6A 2CNKA 5FLYA 3RWBA 4HQKA 4DABA 2C2BA 4M3OA 1RAIA 1UKVY 1CJUC 3ZEAA 2PZKA 3E9MA 3OLQA 5CBPA 1E61A 3TL2A 5A4JA 3SVLA 3ZE9A 4JNKA 1AF4A 1N3BA 2DWPA 5IJAA 5LX8A 3ENQA 3COWA 4AXXA 1OKKA 4CGZA 3ODGA 2MYTA 4PNHA 3V4ZA 2WT8A 4F5DA 3WB2A 1TC1A 2ZQYA 3ANMA 1PT8A 1Q57A 2IF2A 1CUDA 4JU8A 4TKVB 4K6CA 3D2AA 4MGZR 4QFCA 3SZ7A 3KYJB 2QRKA 3OQOA 1OWLA 5JHBA 2M1ZA 3WGHA 3RCBA 3PVSA 5KBAA 3AX6A 2ONJA 2QG6A 2M32A 1LBSA 4K1XA 3DE0X 2B82A 3UK7A 3G88A 1EJBA 2WF9A 2JI7A 1A76A 3CCBA 5U4QA 4BVBA 4LFBB 2H1FA 5DYYA 4PFJA 4CEJA 4D0GA 4AAYA 2V0CA 2QRJA 5H0IA 4C4RA 4HXGA 3HYRA 5TF0A 1UK7A 3REQB 2AZDA 3D8RA 3VYWA 1T6NA 4AICA 3LO8A 3O26A 1HYQA 5IUJC 1KYZA 2RB5A 1Z3CA 2X9VA 1E8ZA 2ATXA 2P1ZA 1G55A 4QYIB 4FOLA 1EUCA 5EERA 4CIAA 3RIYA 1SK9A 4DLNA 2HMVA 4KE7A 2ZWOA 4CQMA 2I4RA 2QN8A 4D82A 5AW2A 1Y5LA 2GPWA 2XAUA 3L16A 4MROA 2FSFA 3RHSA 1ZRSA 4EY4A 3KCNA 3CF0A 3V4RA 2WD8A 1AD2A 2YWFA 1EVEA 5LLDA 4J94A 4EJ2A 5ITSA 3BE6A 3A1WA 4OBXA 1GA1A 2VPXA 4KDFA 1Q20A 4Y1RA 2G67A 1SBTA 2CB0A 3A9UA 3KP1A 4JP2A 1IDN1 3RS0A 4KOAA 2AN1A 1Q44A 4JWTA 1Z6TA 4G81A 4J0KA 2IHNA 3C43A 3SHOA 2WZDA 5HMMA 3MS4A 2HMWA 2P41A 3ROZA 1ZRMA 3PXCX 4U9UA 1ZISA 3CSSA 1FCHA 2Q7OE 1F8UA 1O95C 3IHKA 1QKJA 4OHZA 2XDWA 1Z7WA 4F6RD 3CHPA 1W1UA 5JBQA 3IUPA 5KVQA 1I1OA 4QDKA 3WLKX 1WW8A 5P21A 3NM4A 3K0CA 3PA6A 5REQA 4V1CI 3R75A 4BFSA 1ML3A 1Z3YA 4ZRNA 4DZZA 2WAAA 2ZJ8A 2WUEA 1AF7A 4UDXX 1XVUA 4JS0A 1HE8B 1OU4A 4MI6A 4MK4A 3IELA 4E12A 3CK8A 1KQNA 1VMEA 3NH9A 1SR8A 2XWSA 3P1JA 2ST1A 3FKSD 1J9ZA 4YX9A 1MJ0A 4XARA 4BEBA 1HYGA 2PR7A 1W52X 2SKCA 2O2XA 5GY7A 2VQSA 1MAWA 1K63A 2JJ8A 4V1CA 4BWGA 1SIBE 4B7CA 5KOJA 4HDSA 4NMLA 2OUIA 2G8LA 4D45A 1M0TA 4INPA 5LNK6 3EJNA 1HYEA 4RAQA 4NG5A 3QK0A 2W93A 1GN9A 3GWZA 2Y2UA 3T7RA 2DP4E 4BNXA 4EWLA 4UUCA 1HDCA 3VR5H 1LLDA 3FCOA 1W0JA 3TNJA 4Q1CA 1SUWA 5AJVB 2NP7A 1O6BA 3I1IA 4DGSA 2YZMA 1EK5A 2WD7A 3SLGA 2XPZA 4M1KA 2GUWA 2OHOA 4L2LA 3OZCA 2WHYA 1R0XA 3DF9A 5JPDA 3RO2A 2XVYA 1QIJA 1NW8A 1CB7A 1XR3A 3OTGA 5FIOA 3EFEA 4FEYA 3O31A 5JBNA 4ND2A 2HWXA 4IIEA 3DE7X 4N03A 2CFIA 4CM9D 1MHPA 1U4NA 4CT0A 3ZHUA 4QPPA 2Z2ZA 5F3DA 1DAPA 4TRNA 2D2IA 1J33A 4ZVLA 2WBLC 4EB6B 3DQPA 5JADA 4KQMA 2HE0A 1GQRA 3B9QA 2UUPA 2OAGA 4NNJA 4IJWA 4BVHA 2WQ6A 4RHEA 2R6ZA 2QRLA 4IILA 4Y0AA 1M0WA 2AN5A 4KPEC 3HSKA 1ZMBA 4BFWA 5YASA 1Z15A 3WGUA 1LPAB 1TL7C 4QXPA 1Y7HA 4MRVA 3BILA 3LVQE 2BEKA 2C7GA 1GEEA 4A26A 1HL7A 2IEAA 2E1RA 4JC8A 3NAWA 3FNGA 1FS4A 3VR6A 2HXYA 4ZYXA 1PGPA 4OBEA 3ZNQA 3K4HA 4MKGA 2OWEA 3WG7E 3KOOA 1TTTA 1TAUA 1SHLA 3VPSA 4TTSA 2RGEA 2I4TA 4IMPA 3PDJA 1K1BA 3EDCA 1JWLA 3HU5A 5AM5A 4D96A 4XD2A 3RS2A 5LB4A 3GNTA 1YXMA 4AJOA 4NMHA 3JQFA 5GVRA 5KQMA 3DOUA 1QFXA 1L9XA 1W5SA 3ZDEA 4TXQA 1H9CA 3R9IA 2ETXA 1GTZA 1UG3A 5DLDA 1DFHA 3F7NA 3FLBA 4MIOA 4F8JA 1JU3A 4DIDA 1QYMA 3I01A 4Y1EA 5IVHA 3I6BA 3P96A 1R0CA 1C41A 3KCQA 1AZTA 5F7JA 1MZCA 1BGWA 4TTIA 3KYCA 1VYVA 2D0IA 2DFNA 4GNRA 1KK0A 1B3RA 4GXNA 1B7GO 2OK7A 2D13A 4EIWA 2PFKA 3F2IA 1ESDA 3FPGA 4EUHA 3NIBA 3KPWA 3HNRA 4JI2B 2CLKB 2WFLA 3EEYA 1VSBA 3LY8A 3MVEA 1CFZA 3UK2A 3DVQX 4OHFA 1A9XA 3BORA 3ZQ6A 3NTOA 2GWHA 4WCFA 2IFTA 3M8KA 3R0JA 3I9V1 3VVBA 3GLVA 4R16A 2IPNA 3ICCA 1H5UA 5LVAA 4PE5B 3E3AA 1ZMTA 2B2CA 2PTGA 4OOEA 4PX9A 4NRHB 2F3SA 3MRSA 1EGVB 3IKLA 2YCLA 4BZPA 4AY4A 2GCPA 1PR5A 3OQJA 2XMCA 1LK7A 2HYIC 3LEWA 4ZYYA 1HLFA 1KRXA 4KQ2A 1RRGA 2OEVA 1NUSA 2PUWA 5KOIA 4XASA 2B6NA 5DCYA 3VDNB 2NAFA 1G59A 4MWSA 3ZWXA 3O8NA 1ZP6A 2WWFA 3OEEA 4U95D 2BKGA 3CA8A 4WXMA 3FJ1A 4JYZA 5HZGA 1PT9A 1SCNE 4J0JA 1HX8A 1VMDA 5EESA 1ADYA 1BG6A 1XEWY 4EX7A 1GAJA 4QVIA 1YH3A 1HT0A 2JFXA 4DJ5X 4I55A 3EXHB 1M34E 3I12A 1N6KA 4TM8A 1VDMA 3TCXB 3IT0A 4ED9A 3O94A 1PJLA 4ZAYA 5K05A 4XQEA 3K6SA 2O8EA 3GAFA 2ZVJA 3ANYB 3SM9A 4HP8A 1TIBA 1RXUA 1Y6FA 4RTOA 2VSXA 3REFA 2IP1A 3IODA 2VJBA 3AR6A 1L9KA 3CH7A 4EHFA 5DGCA 3KPYA 4ZWNA 1ULTA 4URHA 1H8HD 1CHNA 1ZLXA 2GJKA 4PFSA 2ODTX 3EAFA 1JSRA 2DERA 2ZS9A 3U26A 3H4TA 3NOQA 1JJVA 3CVYA 1T24A 2DHQA 4PF1A 1ONPA 4LXGA 2R17C 4L9PA 5JS7A 4PG7A 3RV4A 3BU8A 4EG7A 4MYRA 5AJLA 4GPD1 3EY9A 2WIGA 3CUWA 2VBIA 1K4YA 4CR7A 2BUAA 1TNZA 1O7JA 2Z4SA 3OWOA 2PX6A 3RRYA 4TUMA 4FUTA 1E2UA 1GQYA 1C4XA 4X91A 3C2QA 1YQ9A 3O8DA 2A5UA 5HQ3A 2LNDA 4ENRA 5T4EA 1KH3A 1GOTA 5J08A 5A4IS 2J9ZB 4HGRA 3GGDA 1QZTA 1UKCA 4IWYA 2JVJA 1WXFA 2J3IA 1NE7A 3IPXA 3A1CA 2Q3MA 5JISA 4C05A 1U3DA 1OMOA 1CF2O 2XQ0A 3HDJA 1H2AS 3MJFA 1B4DA 1KOJA 1XP5A 7ADHA 3KZNA 2YJNA 3ZDFA 4HWPA 2HY7A 1FYEA 4YHBA 5CBOA 1L8LA 5KNCA 1V8BA 2NZWA 2DFLA 3G5UA 1DCMA 1OLSA 1R00A 1X9IA 4X7RA 3PCXA 1VL1A 3FPLA 5M04A 2AFIA 2FX3A 1G291 3BYZA 3EZLA 1PS0A 4MP3A 3WWOA 2LE0A 3DC2A 2K87A 3O38A 5LP6A 5DI3B 1ZL0A 3RS5A 4WFIA 3GLIA 1ORWA 1DRUA 4GOJA 2OGWA 5KTYA 2G8NA 3AF4A 2NACA 3HJAA 1N8SA 2YNMD 2NPFA 1WSDA 3LXUX 4F11A 5HUHA 3SQOA 3NC4A 4QLAA 5P8WA 4BB5A 5BV0A 1A2OA 4JQOA 4MR9B 4KFCA 4CL2A 2W42A 2IOQA 2L0TB 4L16A 4IX1A 1SVOA 4L2YA 5K0BA 4DI4A 2JAUA 1OF1A 1TO6A 3UY4A 1ZICA 1WXGA 4Y6GB 1FPPA 3B5EA 2VWQA 4L75A 1G21A 1ZGGA 3HA5A 3DG9A 3PT5A 3S3TA 1UJ5A 1CY6A 3EC1A 3VAAA 3SPXA 4BJ6A 5BNFA 3E81A 3UZUA 1EBUA 1ZVQA 4X6YA 3OECA 2G36A 2Z6QA 1S3IA 5TDHA 1JTVA 1AUPA 3TZEA 3CTPA 2SCUB 1A50B 3ZXYA 4B3XA 2FFQA 3BHJA 1JJ7A 1JHPA 3HY6A 3QOFA 1NQAO 3BX1A 1K8ZB 2HBZA 2FDXA 3H99A 4F60A 1YQUA 4GDMA 1BKSB 3E5NA 4G9BA 4A0RA 2L42A 4BX3A 5FWNA 4D8TA 4ZYVA 1GCOA 1AS3A 2JRCA 3PP8A 2WVIA 1WULS 2PKRA 4D8XA 5KQRA 2XGOA 2GERA 3PUYA 1OLXA 2XPYA 5E4FA 3S2AA 1E62A 1BXGB 2VQ2A 2ZSAA 1TO2E 1CR6A 2IRWA 1U8AA 4F4DA 4H7DA 2WA1A 5T64A 1XPUA 3HGTA 4ZALA 1W4BA 5DHTA 1NUTA 3MBOA 5EIBE 3K9CA 5E0OA 2Q28A 4Q66C 3RG2A 3N8GA 3HWX1 2P8JA 4B3DA 1VCHA 3LA8A 5JPIA 2VJDA 5AVXA 2XQKA 3LJKA 5TGZA 3W8FA 1PTJC 1D4OA 3PJDA 2HJWA 3FSGD 3LX8A 4UU0A 1JL3A 3BGIA 3MV2B 5KYKA 1N8TA 3CR3A 4FMPA 1HFEL 4BC1A 1SA5A 5CVDA 5ED4A 4RPGA 1VFNA 4P31A 3WJ2A 3EDYA 2QP4A 3BK1A 3DBHA 2JB9A 2A1UA 2E37A 2NZUG 4A0FA 1YKGA 4GFDA 1Z8DA 1E2EA 5AOVA 3QVJA 3NVDA 4MUIA 1XCPA 5F4BA 2QZJA 3AFMA 3N8DA 3MWYW 3EW7A 4YRAA 3W5DA 1WAMA 4QOJA 3QEJA 3JD3A 2XMPA 2DFPA 5CGQB 4DBLC 2GM4A 2BONA 2JGFA 4WNAB 1YVRA 1IXRC 2AJCA 3K0CC 4FGZA 3SC2A 4YCLA 4BFCA 2R84A 2A59A 4GEGA 5KJMA 2B1IA 3WDLA 5CVUA 2B8JA 1XD2A 2WMOB 4EB3A 4U2BA 5B6PA 5IF3A 2H2IA 1I4LD 4GZMA 1OZGA 1MX4A 3LQFA 1SC4A 5B1AE 3ZYZA 4EY5A 3OBIA 3MMZA 1DSSG 4R9UC 4AYWA 4RF2A 2XKAA 3CBGA 3F6EX 4PTLA 4E5SA 4DT1A 4GMGA 2V4ZA 3K16A 2CG3A 4EARA 2GAOA 2V5FA 4QDOA 2J3QA 3PD0A 4M38A 3IDQA 1O94C 1IHUA 3EAQA 2R02A 3G2HA 1T91A 4QBKA 4W8GA 3Q0IA 1V95A 4DC0A 2ORYA 2FWPA 5HTKA 4UM9B 1MTOA 4B46A 2PQ2A 3ZY5A 5KSYA 3MLBA 4HAOA 2QQ5A 1TN8A 5LD2C 5DK6A 3JRXA 3CHRA 1JT9A 3UK1A 4R68A 4YBZA 2PGJA 1I7PA 2NSYA 3LHIA 4A1FA 3P2KA 3GJRA 1ZM4A 1OVGA 5A3VA 4CKEB 2ATIA 1S4MA 1S8FA 2ZQ5A 2OHGA 1QHHB 2GZDA 3EZ9A 2WKQA 4YY3B 1SKYB 4IZHA 2RMKA 1UBKS 2HN9A 2IYTA 1G2IA 2PXHA 3PDWA 4JD5A 3AESB 2RC6A 5HQ8A 1TTQB 2VJAA 1DBIA 3OZTA 1G7RA 3NC0C 3A2MA 2AUTA 4NHEA 3DCJA 4D3ZA 1EG2A 2FMUA 3GL9A 1I7QB 5BSEA 1H6PA 4BCCA 1WSAA 2QSJA 4H15A 4BKPA 5CXSA 1MENA 4Z49A 3SYRA 2X0DA 1AKQA 5ENRD 3TQSA 1QGUB 1JB9A 4UWGA 4BFTA 1U8EA 3P9KA 2BDTA 4R1QA 5BQOA 4GGOA 2XYHA 1K0FA 5B7QA 3F67A 3BWVA 2IEJA 2H6GA 2ZJ2A 3GW4A 3R0ZA 4RIIA 3BH0A 1P1JA 4ZQCB 3GO4A 3GZ4A 3CZQA 1SUCA 3EDQA 1CW2B 4Z2AA 3LTEA 1B15A 1CP3A 1HDOA 4AJ2A 4DVJA 3IB3A 3ZUVB 4QUHA 4XEHA 2P9GA 3E8XA 4QOFA 3CRVA 3MJVA 4MGIR 2FU5C 1BKYA 2CV1A 1IZZA 1ZUIA 4Q9NA 1JEAA 1RC1A 2ZSHA 4P86A 4W9NA 3QEMA 3WYGA 1KH2A 3NDRA 1J24A 2BHRA 2FXIA 4U00A 3LNTA 5JSFA 3U64A 1JG7A 3O03A 2D7JA 4NBVA 3PFNA 1WD5A 3RVPA 2QEQA 7GPBA 3FNFA 5G4KA 3WKCA 1NPYA 2QXUA 1OCZE 2WM8A 3I30X 4XZ4A 2BFOA 3LPCA 5IANA 4AXBA 1P91A 3FKJA 3PICA 1R0SA 2OZVA 1X7GA 3SM3A 1BPOA 2R6DA 4UPDA 5BP7A 1JHRA 4NOMA 4ZO8A 2X5XA 4PPNA 2ZRCA 1GL3A 4FSHA 3JQFC 3T95A 3PDCA 3MSCA 4X3OA 2UYYA 2WKRA 3RGWS 2VZEA 2YZNA 3AKEA 4ZZIA 4XVHA 3CQGB 4NBKA 4I1RA 3HJFA 4PSVA 2UUAB 2HHLA 1O5TA 3P97A 3VVMA 1XTQA 2O8CB 3H1BA 2QTVB 2NSZA 3MPOA 3HY4A 4L08A 3PNKA 3RFUA 5E38A 3KO8A 1ECJA 1HOXA 3LY9A 3PHHA 1T4GA 3RUDA 2C4TA 2GM3A 3Q1LA 4I9NA 2ZUWA 1F7VA 2RI1A 4HXYA 2JFQA 4HYQA 2GEJA 1HLPA 4ZJUA 1JXOA 4XD7D 2KBEA 1T15A 1UJ2A 4HUJA 5H5JA 1SUIA 1FTQA 4ZCMA 2ZZNA 4FHZA 3NV9A 4GG1A 3WWZA 2QDKA 1DDIA 1UANA 1XQ1A 1TE2A 5IBQA 5FI1B 3TLGB 1N0IA 4WCFC 2WM3A 2P7IA 3BPSA 3O8QB 4HQOA 2EQAA 3L4EA 3AHIA 5FNZA 4ZRMA 1DKNA 1GZ7A 5H83A 4BNUA 2XUJA 1NIPA 4CV1A 2HLPA 3NGXA 2Y4TA 5JS1A 1ZGJA 2PXXA 1E98A 5FJIA 4WGFA 4LFCB 4MINA 4ABYA 5GOZA 1L7MA 1U7DA 4W5RA 4JUIA 1KZPA 2WJYA 3ZYLA 3CHSA 3LLUA 5H82A 5SY4A 4Y6RA 4H1HA 3EWIA 3AQ4A 5B5SA 2PWBA 5CFMA 4BNJA 3EPRA 2L82A 4FYHA 4APOA 4RJ2A 5CX1B 2P9SG 1MDFA 1H1LA 4ZYZA 4LQDA 5JEDA 3WJAA 3C1TA 1VIDA 5AYWD 3O5AA 4C0WA 4IDPA 3C4QA 3T9DA 5EHIA 4QTUB 3O73A 4MQEB 3G2UA 4E4YA 4YXFA 5ES4B 2M1XA 1QVWA 4F4FA 1YRLA 4LNUA 2XOXA 3UWKA 3EIJA 5JPCA 4JITA 4BRWA 2VGXA 3CH5A 4ESHA 1KI6B 4F86A 3TXNA 1SBCA 3MFYA 2XUDA 2RHWA 3KBOA 4B84A 1FSGA 4AJ4A 1IHBA 2FW0A 2BL4A 4YCCA 3IMFA 5DCWA 3IR7A 2HO1A 3DE4X 2M63A 1J7KA 3WADA 1SXJD 1LCIA 1C3OB 4ANFA 1C4KA 1NR7A 2NIPA 4K9PA 2F8XK 3ZU5A 2WXLA 3E8MA 4QJIA 1XZNA 1V45E 3O90A 9ABPA 3VHXB 4LZOA 3I1YA 1XZCA 4BUZA 2ONDA 1DKPA 1Q0UA 1NNLA 2AQKA 3QBDA 1EFLA 1DINA 3VYTB 4V0LA 3WYAA 4DA9A 1TVMA 2J5RA 2NTJA 5KVSA 4F7AA 3M4XA 1EWTA 2HIAA 2Z5LA 4HFMA 1X7XB 2FEMA 1DIAA 2ZRQA 4LSZE 5AVJA 5FBLB 1L2TA 3I32A 4PCUA 1D2NA 4FLMA 3ZE8A 4TLDA 2O1WA 5JNRA 4QE3A 5AOBA 2WTNA 4YP6A 1NXOA 1QF9A 3G8YA 4A55A 4C6SA 4NFYA 4L0MA 5M29A 1S6YA 5GWXA 1ZKDA 2GN4A 3DOJA 3OZDA 3ZXPA 1N3IA 2YHEA 1J1UA 3QELA 1KK2A 4U5QA 1S70B 4C4SA 2BEJA 1WKCA 2ARKA 3Q7PA 4E46A 5ALSA 5EXDA 1NQTA 2XEXA 1UBTS 3FTZA 3UIEA 2SBTA 4C2AA 3PNSA 4HADA 2V5UA 3D7RA 4IDBA 2Q4TA 3U61B 3GVHA 2C5SA 2HBYA 2BGGA 3BXOA 1ECLA 2VSFA 1TEZA 2ZUVA 1IQ0A 1RQXA 1BQEA 1G6Q1 1UOHA 3CR7A 1M8KA 1HQKA 2FFAA 4KR7A 2ZRBA 3IMEA 3AF6A 1HT1E 4QJ3A 5BMOA 1R5JA 4DCSA 4KBGA 2XI4A 2W6MA 3IRVA 4Q4HA 1N7JA 4JZKA 1E2MA 2G28A 5UKDA 2YIVX 3QWIA 3W9GA 1H19A 4NE2A 3U4MA 2B83A 3QIVA 4Q7EA 1TADA 2A9VA 3PFKA 3GLFB 4NBWA 4UJ3A 2Y1FA 5B3AA 4KGZA 2WRZA 1FUYB 4J2TA 2FPGA 1GQOA 5CJPA 3MS7A 4YAOA 1CS4C 2AD5A 2CSUA 4WNEA 1B6RA 3MAJA 2QL6A 4LE0A 1TNDA 5SZHB 3KE9A 4CQLB 4ZVRA 5ULLA 1ZWKA 5EQDA 4J8FA 3OQPA 4H35A 1F0YA 1MKYA 2VWPA 4JR0A 3VKHA 4FZJA 4CV2A 4UBJA 3BGSA 1YONA 2AD1A 3B6IA 1UDRA 2AOUB 4GWGA 1NE2A 2IHBA 3ESKA 2JGEA 1L6RA 1Z26A 4EHMA 4GMDA 3SJ7A 1M8FA 1IBSA 4GZDA 2DCPA 4HS4A 2J3EA 1B93A 3PITA 4FK8A 3D7MA 4OQLA 1K27A 4MVJD 1INZA 2JIZA 3NBXX 1SPXA 2PL5A 1QPBA 4BE9A 4G0ZA 3BQ9A 4OLJA 1RWWA 5BVHB 4TWZA 2I7DA 2DZOA 1ORRA 5E2AA 3KTDA 5H02A 3W4IA 3RS3A 5I9IA 3RTCA 2D2VA 1JE1A 3INGA 2KM4A 4FDMA 3E1GA 3QBEA 3DV0B 5J43A 3GOQA 1E77A 4Y6OA 2Z04A 4GM1A 4AD8A 1K1EA 10MHA 2CL7X 2NNLD 2P0YA 1Z6YA 1KSFX 1VQ1A 3F5MA 4PCLA 2DWUA 3M5WA 5CAEA 4H1TA 4WZBA 4GRDA 5C53B 3INNA 4TQAA 4UUMA 1X87A 2Z6VA 3I9LA 1ACLA 3PNYA 1XJ5A 3CR3C 2MSLA 5BWCA 1D2AA 1Z5VA 4HSEA 3GDOA 1SCQA 4WKOA 4LHZA 4ARAA 4CEHB 5CEAA 3FCXA 4H7JA 4RVOA 4ACBA 2GK3A 2JHPA 1DZIA 2ET6A 4GVXA 3PKIA 5HF9A 4FDAA 4BLRA 1Y4AE 3HMKA 3P9RA 2DVWA 2WG2A 4WXHA 4I2ZA 3ZU7B 3QVWA 4XWTA 5CB4A 3FU3A 4X60A 2HF8A 1L4YA 1FS5A 3WNZA 3OC0A 1PR9A 1HL3A 3ZHBA 1XTKA 3BE8A 5IKXA 4DCJA 3E5RA 3P45A 3LSTA 4GWKA 1NWHA 5TPWA 3APCA 4C0AC 2O2IA 4BQPA 3I8XA 3V4OA 4BS9A 2QX6A 3KBBA 1P74A 1X80B 2R1TA 3QJGA 1L4HA 2TYSB 2G17A 4C5AA 4D3XA 4Q9LA 3E3LA 3BL8A 4Q4JA 1WHSA 2EATA 1PHRA 4JYMA 3TLEA 3RRNB 4Q69A 3DFIA 2WYHA 4II2A 1KQGA 4QFDA 3OZGA 5ARFA 1HDEA 4B85A 4CRWB 5C4GB 3V1TC 2VF7A 1RQPA 1Q7TA 4UQPA 5COAA 1ZHHA 2GK4A 3GJ6A 1D0IA 2YZ2A 5HXAA 3ROGA 5AKGA 4AP5A 5A0FA 4HC4A 1JQDA 3BCSA 4IG9A 2A1TR 3QLUA 2BPOA 1FP4B 2WJPA 2JGDB 4LBVA 3RR2A 1BWQA 1TF5A 4BNKA 3TTXA 1DKRA 1X7WA 4JT2A 3IVGA 4GAAA 2XZTG 5AKYA 3HHMA 1A5AB 3AW8A 1D5CA 4MLPA 2C2MA 3ORFA 2Z9DA 3J7AC 2IS4A 4GM4A 2ZSJA 1ULUA 1ZU4A 1CEYA 4QM6A 1FXWF 1TZBA 1MX1A 2ZK7A 4WK0B 1O89A 1G20E 2I87A 3PENA 3L05A 2GH1A 4OP3A 3I9KA 2I9PA 1WRBA 1H6BA 3G5AA 3QG5A 5ADVA 4B8YA 3FPAA 5INTA 3AKYA 4GBMA 5ALKA 2YIMA 3AF0A 4RPLA 2UZ0A 4E5UA 1GNPA 3B3QA 1TZMA 1PD0A 2ZWAA 2IT1A 3ROKA 4UVIA 1D07A 1T3TA 2QS9A 4B3JA 3DTVB 4L8VA 1EFPA 2GEUA 2ZDQA 4KXQA 2KSQA 3PZDA 3OJCA 3A36A 3IBSA 2AEFA 2DY1A 2OLEA 2ZE8A 4OLHA 5K0JA 2ONYA 4W9NC 4AKIA 5GOTA 4TKMA 2QBYB 1ZEJA 1RM5A 3IOEA 3X3HA 4WY2A 3HBMA 3MW8A 1JDZA 2OCCE 3OZEA 4KPUA 1XTBA 1YNSA 6NULA 1QHYA 5LQMA 3RBZA 3VNAA 3TZKA 2OZKA 1VDYA 1JJBA 2JAQA 4H08A 2WWGA 1FFXA 1S3GA 2EZTA 5FKJA 3VSCA 5DSZA 4AJJA 3ENWA 2DECA 2VP4A 5JV5A 5B7PA 4QNNA 2VCYA 4ER3A 3VKFA 4I4CA 3R3YA 3HXKA 1BXRB 2QG9A 4YJHA 3N86A 3IA2A 2CXSA 3H1TA 3PDUA 4UQZA 3ROMA 4IH4A 3QKSA 1IHPA 5EIFA 2A4MA 3TE6A 4BB0A 1J7JA 5LZ4A 3DCIA 4FOSA 2EJUA 1RZ4A 5IM4F 1AOXA 1IJKA 2Y1KA 2SKEA 5EJ7A 5BMVB 4L95C 3IDAA 1AS2A 3CLKA 2QRMA 5CT4A 3SOZA 4P2GA 4HVBA 3EVNA 4HDKA 4FEAA 3RIMA 3GNSA 4FADA 3AL3A 1U81A 4TZ0A 4ZT4A 9MHTA 4Y7DA 4P0QB 1FFCA 2WR8A 4DRXB 5A06A 2C82A 1V71A 4WBXC 2XSZD 3EVGA 2AMYA 3GZNA 4M8IA 1HU3A 2NSLA 3F5QA 2FFRA 2GOYA 5FQ4A 4HB5A 1P5QA 2WIAA 3ZW3A 4R8LA 1LS6A 2CJYA 2WXHA 4WWHA 3K5PA 3LE8A 1QH8A 3M3PA 1GPLA 4C5CA 1NVKA 1LBEA 5C37A 1YJQA 5CNMA 4YTEA 2DEUA 4ND3A 2IX3A 3JVEA 1L5YA 4ETWA 1RKUA 2PHZA 2VYFA 2ISQA 1Y7PA 3SG0A 2B4TO 5L3RA 3M5DA 3WGOA 4B6FA 4ZKDA 1DG9A 4DE5A 1U4OA 4QOEA 3UANA 4MULA 2XDQA 2W9XA 2HR2A 2J87A 2R9VA 2VZLA 3CLHA 3K9WA 4YMTA 1P2BA 2D3TA 1PRYA 2Y3AA 2GM9A 4JP1A 1ONOA 1GW6A 3AHGA 1IAQA 5HFJA 4HT3B 2IU0A 1XDGA 4EA9A 3IAEA 1WZUA 1FDOA 1KAOA 1G0OA 2NWQA 1WKVA 1GFWA 4HFGA 3P5SA 1NJ6A 2RG7A 1KBZA 3KIPA 4RZIA 1W1WA 4M88A 1FLDA 3RT1A 3MKRA 1R6XA 4XFJA 2BVNA 5HGXA 1FJXA 2M2IA 4OP1A 1U5BB 3ZVVA 2HX1A 5DHFA 1RWQA 2XTJA 4X7BA 1KDPA 1AGNA 1IWPB 4WZAE 4NURA 1FX0A 5LMNB 2XOEA 5E6SB 5MN6A 2PNNA 3D4NA 3KDPA 1X1EA 3GFSA 3WLTA 3T1NA 3UFXB 1Z29A 3VO8A 1WCIA 1QKKA 3H1AA 3CJRA 4FSDA 2EKZA 1P9LA 2ZYDA 2VYNA 2ZE6A 4QG7A 2PZFA 2XNJA 4U0UA 3AFIA 2BKXA 3AR3A 4IUDS 5IAGA 4O4IB 5F52A 4R7LA 4RVDA 1Q7GA 4JLNA 2AL7A 4YLYA 4PVCA 4F6CA 1L7XA 1NMXA 4EDFA 5AVTA 1LXCA 1VPLA 4RLHA 4DLTA 5BUZA 4EAAA 2J08A 4XWWA 2H1RA 3UKJA 1WZNA 1WB6A 5LZ8A 5T8IA 1L6IA 3BUSA 1E4VA 3OCXA 1RZRD 3N59A 3PEFA 4U6NA 2AVDA 2V3VA 1DCQA 2JAWA 4P3PA 2V65A 3EIFA 5FD8A 2HW8A 1WDTA 4K9SA 2W2OA 1E79D 4JUCA 4K86A 4PZDA 1XLVA 2D0PB 4G5RA 5T5QA 2MR6A 3ZKWA 2AN4A 3QLJA 4M6WB 3G6KA 1G3UA 2GAAA 3D6NB 5KWJA 4DAEA 3OSUA 1UPBA 2MINA 1GVHA 3EEFA 4XX0A 3I76A 3OSZA 2HQOA 4IIJA 2C7RA 3WTCA 1JIXA 5IYZA 4Q7JB 1Z35A 5JAIA 5EL0A 4P34A 2EFCB 3QKYA 1KJJA 2F1OA 4AMZA 2IU3A 3T5PA 4LYHA 1T4BA 4J49A 5JRZA 3SX4A 1OB5A 3S0JA 5LIPA 3FA2A 1T8UA 1KHHA 3QXXA 4PVDA 4Q1DA 5KJ1A 2VTVA 4FI3C 2H0QA 3AR4A 4MR8B 4Q4AA 4ZOLB 1CR1A 4NARA 3PS9A 3A8TA 5C52B 2X8AA 5JAQA 3QH4A 2PKYX 4DV7B 1B76A 3CE6A 1O1SA 2J7PD 3LKVA 1C9KA 2EVWX 2ZROA 1Q2ZA 4K9RA 3ZZ0A 1ZVJA 5HF5A 2AG0A 3L8HA 5JNTA 2OHFA 3I23A 2QJRA 5H7XA 1PT6A 4US1R 4D4HA 4DCMA 2E4WA 4RZUA 4R51A 2PLAA 5L4SA 2WXQA 1HEYA 1US8B 4FNOA 5HUJA 5D3QA 3WKDA 1NY5A 2HCTA 3DVLA 3CZPA 5AT1A 2FQYA 1PQUA 1ODJA 5ICFA 2ZBRA 2CVPA 1JWGA 2TSYB 3C5RA 2WF7A 1DO8A 3V2UA 1AUOA 2BM9A 5KQLA 3DW3X 1WA5A 1E99A 2DYKA 2HWYA 2X8WA 3MCZA 4D4MA 3TNLA 4NZ9A 3JYNA 2BZGA 5J2TA 1HA3A 1RWNA 3CEJA 4V3BA 1LQUA 4GXRA 3V4FA 3GR6A 4F85A 1IJFA 2E7ZA 2AHRA 4JBGA 1MZVA 3C6YA 2JKYA 2OL4A 3X2FA 4J4TA 3T9AA 3K5HA 3VX4A 4JLWA 3VTZA 1II9A 1Y98A 3OUUA 4L4YA 3KHUA 4HXFB 5BMVF 3GLTA 4O8ZA 4X1IA 2JA1A 4CM9A 2OLJA 1XEXA 2FMTA 3JPYA 3MQ4A 4XDZA 4C7MA 2G4VA 1TTHA 5AVWA 2D7DA 4EHDA 1KEWA 4B8AA 3UOWA 1QVVA 3ABKE 3PB3A 5C1BA 4H1UA 4PYMA 4DB2A 9GPBA 4DSZA 4JA7A 4XLZA 1WOMA 3H5WA 2O4CA 4GKAA 1ND6A 1XMVA 1ZJ6A 1RRMA 1QANA 4NU6A 2INGX 2BDEA 1LNZA 4D8WA 4G85A 2VHEA 4BZQA 3QQ5A 4WCDA 2P6MA 2WJAA 2DOKA 3QWHA 2ZJAA 3PDIA 4YMLA 1BEEA 4R41A 4D0LB 4PQFA 5JEEA 3K5WA 1IEQA 4MRNA 2ZAGA 2R2AA 4FOOA 3CKLA 1Q6YA 1ZDMA 2J41A 3LCUA 3GJZA 2FPWA 2B99A 1R16A 5J23A 4NZPA 1JDBC 5ILOA 2JCVA 3IKTA 1TQDA 5F5NA 5JO0A 3HUDA 2OFPA 2C8VA 2UZAA 3I2HA 5LQKA 2YFQA 3V42A 3G8BA 4YRZA 3B5IA 3G2IA 4D74A 2DZNA 1WXDA 1FLNA 2IYYA 1T43A 4U2CA 4LDZA 3TBFA 4MS4A 5EUMA 3JYLA 5DW0A 2PQ0A 3PXEA 3JYSA 3DLIA 2F62A 2J5KA 1WDKA 4M0PA 1GSAA 2CHUA 1QH1A 1D8EA 2QAIA 3F4LA 1E6KA 4UEQA 4YPFA 1JH8A 3G7SA 2E18A 3HXDA 1XPJA 5AP9A 1FYDA 4CLEA 2VPTA 1G8KA 4QTXA 3LWZA 3QLUC 3OZ7A 5EMHA 2H16A 3T7SA 4O4IF 1T8TA 1CQIB 2VEDA 4MYDA 5A3QA 1YS2X 4DV2B 4E6HA 1GA6A 3DKIA 3H5IA 5IC6A 1ZK0A 3O0TA 4FDTA 1GL9B 1PJZA 5BO5A 1W5BA 3CO5A 4KE6A 5KOYA 3PPWA 1JDJA 4KACA 2Y67A 3LX4A 2JFHA 3VC1A 3HZRA 4ZZ3A 4C78A 2G7ZA 1H9AA 3PI7A 2HNBA 3KSQA 3AUTA 5IHPA 5B1EA 4PZLA 5IEBA 4LF6B 1ODCA 5KNBD 1E7RA 1JQBA 1R3UA 4TSKA 1HTBA 1W76A 3EA4A 5EP3A 5L7WA 4LYAA 3SHWA 4DYVA 1ZIYA 4O4LB 1L4EA 1NI4B 5CT5A 2R7KA 3U7GA 1NW5A 1HLGA 2A6PA 1T3SA 2IH4A 1SVKA 4D4IA 2WU1A 3P9YA 2VQ3A 4G23A 4EFDA 2ZJBA 2Z95A 5G05J 1IXVA 3K71B 3PRKE 3H11B 4WWOA 4D9GA 3IGFA 4TL8A 4MWGA 2YWBA 2XQFA 4ENQA 1ADFA 5KTMA 1NRIA 3OIYA 3ZE2B 2OENG 3F6RA 3M5PA 1EX6A 4MITA 1FVFA 3AHDA 4BGIA 3BXFA 2PBRA 3ENNA 3QY9A 4ZI3A 1U63A 3I2IA 4D9MA 1KRHA 4BX9A 3K72B 2COKA 4L27A 3T54A 3IS3A 4KYVA 4L9WA 3C8HA 4C30A 1EWYA 4HOUA 3GYGA 1BCRA 4DL9A 2KI5A 5J90A 3M49A 5DULA 1Z6XA 2VT2A 1SH7A 2B4YA 1ST3A 4TKZA 4MXDA 4MS1B 1C0PA 3I9OA 1C2TA 2VSOA 3FPSA 2DT8A 4Z4IA 3A3OA 1H8HA 1N2ZA 1U0LA 3TUIC 3QX9A 4RIGA 2KQUA 3MG9A 4FSXA 2B30A 2MHCA 1NUUA 1B2RA 3PXXA 5FYDA 1KQPA 2V96A 5HBGA 3ETHA 3S1AA 2WJ4A 4EF6A 2WT9A 5G0WA 2GD6A 2RFAA 4L5JA 2E21A 4JYAB 1CETA 1WMDA 2JD2A 5AW5A 2Y92A 1AZWA 4BECA 1O97D 2ZYGA 5AH0A 2NV0A 5FJYA 2QRPA 3O91A 1MC1A 4BXOA 2DUMA 4BZZA 2BFNA 1F2TB 4GPBA 4K46A 1KC1A 2KZTA 1Z56C 3E7XA 3EN0A 2ZXWE 2JAOA 3H75A 5AXAA 2A9PA 5CU7A 1TNBA 4N0EA 3LBNA 4IOMA 3KXKA 4TTVA 4GVLA 1YDEA 1GG2A 1K3UB 2FSHA 1DPFA 1AKTA 3SN6A 2FETA 3CKKA 2QR3A 4J8YA 2FG7C 3FHLA 4DV0B 2C04A 4A63B 1RIFA 3PZ1A 3KKQA 3BJRA 4Z4FA 3ESZA 3WXXA 1H22A 2QLJA 5CFNA 1ZNXA 3U44A 1A77A 2CMHA 3M6VA 1U7UA 4FYIA 1P8JA 3DKRA 1T0HB 3FOEC 4YR7A 1GXSA 4H1VA 4G2VA 1NW4A 4QEKA 1ELRA 4DZRA 1Q19A 1K8RA 4XEIG 5GPBA 4CFZA 1B6SA 1UQTA 2DCUA 1D7OA 4MIYA 3UAOA 5CFRA 5I8ZA 2GYYA 4EMBA 3X1KA 3ITNA 4EKYA 5DYWA 3T1TA 2IOYA 4GMFA 2YNMA 3K9HA 3ONDA 2GN2A 3OCYA 3RWOA 3R8FA 4JJ7A 3MJTA 3SGHA 2QV7A 3ASUA 4DLAA 1JQLB 3AETB 5ESDA 3LXXA 2GPYA 3MX3A 1KJWA 4XZ3A 3PLAE 3TJRA 2FSGA 3Q10A 3G13A 2OCKA 4GZ5A 2JIDA 4R8KA 1EX1A 3RSSA 4ZO9A 4I8IA 5D86A 1Q21A 4HB3A 1V6AA 4B8WA 3W5JA 4K5QA 2GGSA 2WU3A 5DBGA 3ZD6A 2ZIUB 4N2QA 5IVPA 2YV1A 3ASZA 1VJTA 3QG1A 1TNUA 3QXCA 4BDSA 3DEZA 4BJ1A 5H70A 2LAHA 4I1OA 3NM5A 3O8RA 2CB9A 1PR2A 2WSLA 4I14A 1N0WA 1WIWA 5F21A 1RU3A 1SZCA 2JABA 4W5OA 1ODFA 2XS8A 2P30A 4EY8A 2F8YA 4GTVA 2GN6A 1U2GA 3R74A 4UEKA 2PYIA 2OLKA 2I9KA 2GZAA 4YV7A 4IF6A 1H94A 4YMWA 3I92A 4U7GA 5CPFA 5K3SA 1ZOOA 4BNTA 3MGAA 3S7JA 1LLCA 1I1NA 2GZ2A 1OH7A 3HUTA 4F3RA