2VSNA

Structure and topological arrangement of an o-glcnac transferase homolog: insight into molecular control of intracellular glycosylation
Total Genus 194
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
194
sequence length
544
structure length
534
Chain Sequence
b'AWLMLADAELGDTTAGEMAVQRPEAVARLGRVRWTQQRHAEAAVLLQQASDAAPEHPGIALWLGHALEDAGQAEAAAAAYTRAHQLLPEEPYITAQLLNWRRRLCDWRALDVLSAQVRAAVAQGVGAVEPFAFLSEDASAAEQLACARTRAQAIAASVRPLAPTRVRSKGPLRVGFVSNGFGAHPTGLLTVALFEALQRRQPDLQMHLFATSGDDGSTLRTRLAQASTLHDVTALGHLATAKHIRHHGIDLLFDLAGWGGGGRPEVFALRPAPVQVNWLAYPGTSGAPWMDYVLGDAFALPPALEPFYSEHVLRLQGAFQPSDTSRVVAEPPSRTQCGLPEQGVVLCCFNNSYKLNPQSMARMLAVLREVPDSVLWLLSGPGEADARLRAFAHAQGVDAQRLVFMPKLPHPQYLARYRHADLFLDTHPYNAHTTASDALWTGCPVLTTPGETFAARVAGSLNHHLGLDEMNVADDAAFVAKAVALASDPAALTALHARVDVLRRASGVFHMDGFADDFGALLQALARRHGWLGI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords XCOGT
publication title Structure of an O-Glcnac Transferase Homolog Provides Insight Into Intracellular Glycosylation.
pubmed doi rcsb
source organism Xanthomonas campestris pv. campestris
molecule tags Transferase
total genus 194
structure length 534
sequence length 544
chains with identical sequence B
ec nomenclature ec 2.4.-.-:
pdb deposition date 2008-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13432 TPR_16 Tetratricopeptide repeat
A PF13844 Glyco_transf_41 Glycosyl transferase family 41
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vsnA01
3.40.50.2000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Glycogen Phosphorylase B; 2vsnA03
3.40.50.11380 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vsnA02
1P4HA 4X6LA 4BTAA 3AS4A 2GPBA 2ZB2A 4CGVA 2QN1A 4XI0A 1K08A 4HLNA 1JIUA 4EQFA 4KYOB 1VGVA 4MICA 4U04A 2X0EA 3OXLA 3ULQA 3ZCRA 4AMBA 2F3QA 3VTXA 3ZCVA 4GA0A 3OTIA 1F0KA 1WUYA 3HBJA 5FJYA 3LY7A 4GYOA 4U0SA 2GM9A 1Y8ZA 1E1YA 8GPBA 3UYLA 4B94A 3TG5A 2G9QA 4MI9A 4AMGA 2AZDA 2PRIA 1A17A 2BISA 2BFWA 3ZCUA 3Q49B 3ZCTA 2P6PA 4I9EA 5A7DB 1P4JA 3RT1A 5JTUA 4Y6WA 4N2SA 4CTMA 4M60A 3D0RA 3TOVA 2VSNA 3LKUA 5IKOA 2VGXB 3BDAA 4FZRA 2ASVA 3WAGA 2J9QA 1SXPA 3OXFA 4WNGA 4F3VA 3ESKA 2QLLA 3S7FA 5CCLA 2L6JA 3KAEA 4GZ3A 3NB0A 5GPBA 1BX3A 2QRGA 2UY1B 3WXXA 2QRQA 9GPBA 2XCIA 3LY8A 1KT1A 3MA5A 2BGTA 4UI9J 3T3DA 2IEGA 2KCKA 2G9UA 2C0LA 3VUEA 2R68A 2PYIA 1QZ2A 2XEVA 3DDSA 5JTTA 3ZCSA 3T7DA 2QN7A 2WPVA 4N39A 3CEJA 1GPAA 2ACVA 3CVQA 1P5QA 4KQ2A 3VDMA 3UPVA 1PSWA 1NVKA 3ASFA 1Z6PA 3NCHA 3BD8A 3NC4A 3Q4AB 2IEIA 4KXKB 3CEHA 5TMBA 3T3IA 1O6CA 4JA9A 3LPZA 2V5FA 3S28A 2QLNA 4GYYA 2QN3A 2KS6A 1GGNA 2KATA 2IYFA 2AV6A 4NQ0A 1PYGA 4O6FA 2VG8A 1TJCA 3CUVA 1L7XA 1WW2A 3COPA 4ME2A 1RZUA 3MBOA 1LWOA 4F9FA 3Q15A 1GFZA 1HZ4A 4J8FA 4Y6CA 3DDWA 3HBFA 2XA1A 4GZ6A 3MRXA 2LNIA 4BWRA 4UI9C 4YVOA 1Z62A 3MTBA 1HLFA 5ENZA 1FCHA 1XC7A 1JIVA 2ONDA 2Y4UA 1ZBPA 3AS5A 3PE4A 4H7XA 4RG9A 3S7BA 4U0UA 1NLMA 2ATIA 2GT1A 2R4UA 1P2GA 3BD6A 3FWVA 5D00A 3RHZA 2X0DA 2HO1A 3C4VA 3GW4A 4BQEA 3OY7A 1IHGA 3EBPA 1HXIA 2PQRA 4XIFA 2QRPA 3Q3HA 3RSCA 2LSVA 2C0MA 4GA1A 5KJKA 4CTOA 1E96B 3IEGA 5DIZA 2QN9A 2XGSA 4Z5XA 1NZFA 2GEJA 1L6IA 4MRAA 4HWGA 3GPBA 1QQEA 2GEKA 3ZPJA 3C4QA 1JEJA 4G24A 4N3BA 2QFCA 5HXAA 1P2DA 3E3NA 1B89A 4BFCA 3G2HA 2SKCA 3CUTA 4CTNA 1KTIA 1GZ5A 3VDNB 2F3PA 1PN3A 1Z8DA 3CV3A 3O3CA 1Y8MA 2E2EA 3FFLA 3TSAA 1NA3A 3NP7A 2AMVA 1PC2A 2X6QA 4RIFA 3T3HA 1FU4A 1SXQA 4HORA 3MEKA 2KC7A 1C8KA 2XCUA 4NEQA 3OTHA 3L7BA 3PDNA 1XKXA 5ARGA 4N9WA 7GPBA 1L5QA 4WNDA 1XNFA 4UQXA 1UQTA 4HOSA 5DLDA 1ZU2A 3Q5MA 3MS4A 1A8IA 5CCMA 1K06A 3ASHA 2XCCA 3L7AA 4I2WA 1WV1A 3MT8A 4J0UA 4X7RA 5LQDA 1FTWA 2IUYA 2IW1A 2JZCA 4W6QA 4BQIA 1AXRA 1HH8A 3D1JA 4WADA 1E4OA 2ACWA 2PYDA 2QLMA 3BD7A 3U4TA 2FETA 2I6HA 2H1HA 1NA0A 2FF4A 3MRTA 3Q3IA 1FS4A 4AN4A 4GA2A 4H7YA 3ZGQA 1KLXA 3PE3A 4GCNA 4ABNA 3H4IA 2G9RA 2HY7A 2F9FA 6GPBA 4QLBA 5AYWD 3BCSA 1M5RA 3RU0A 4RBNA 1P29A 4F97A 5FTPA 3NPAA 4L22A 2XGMA 3OKCA 3RO3A 1GG8A 5ARFA 3MTDA 3LCAA 3LYAA 4LEIA 1NZNA 2KCVA 1YA6A 4F96A 2SKDA 4U0ZA 1GPBA 4HOTA 3QKWA 1FTYA 3CKCA 4EJ2A 4UI9K 2JLBA 4I17A 5IKPA 3G2NA 2G9VA 4G2VA 4M83A 3GUHA 4EKYA 2XA2A 4A1SA 4EL0A 2UWJG 2C2LA 3WC4A 2OFFA 4LEUA 1H5UA 4GZ5A 2FFRA 5DXFA 5A6CA 1UQUA 3NAZA 4RIEA 3GYZA 3OXGA 5D0OD 4X7MA 2IV7A 2WQHA 3JYSA 4CGWA 1JG7A 3ASGA 1XV5A 5I45A 3MSCA 4FKZA 5TMDA 3CKBA 2YHCA 3T3EA 2XA9A 3QDNA 2Q7FA 1RZVA 3H4TA 5FZRA 3CV0A 4IN3B 3SYMA 2FBNA 3RO2A 4EKEA 2GW1A 3SF4A 2OOEA 2XCBA 3ZN3A 5JJTA 1NOKA 5FT9A 1QM5A 2VCEA 1Y6GA 1WAO1 3CK9A 1XL0A 3CEQA 4N3CA 2QRHA 2R4TA 2FO7A 5BW8C 3MS7A 4APOA 3EDTB 1JG6A 2BGUA 5CHEE 2Q6VA 1YGPA 2FF5A 3HBMA 4BT9A 3NP9A 3FP3A 5G04J 2SKEA 3CUYA 1FA9A 4EL5A 3C48A 5TMEA 3CEMA 3L79A 3QHPA 3DD1A 4REMA 2GPNA 3ZCQA 3BEOA 4BQFA 5FZSA 4KQ1A 2MHKA 3E3LA 5EKQD 3BEEA 1ELWA 5DU2A 3ZFWA 2QNBA 5G05J 3OT5A 3S7JA 3OTGA 2C4MA 3CK8A 2R5SA 3L7DA 3KD7A 3KS2A 1GPYA 2DBAA 5C1DA 1AHPA 3L7CA 3VTYA 4XI9A 4GCOA 3E3OA 3NF1A 1C8LA 1PNVA 2QN8A 1P2BA 3MT7A 3OY2A 2PQNA 5EX0A 3Q3EA 2QRMA 5BT1A 2XPIA 1RRVA 2AW3A 4NESA 3HYMB 2X0FA 3OKPA 4G25A 3S29A 1Z6QA 4PQGA 4YI5A 4RIHA 5D0QD 1L5SA 2YQ8A 4JA7A 3MTAA 4AY5A 3CVLA 3URZA 3S27A 4NRHB 1FU8A 3IAAA 5HI7A 4RIGA 3RSZA 3L01A 3S0JA 4YVQC 2P58C 5G04C 4RG6A 3MRVA 1C50A 4I9CA 2IYAA 3CK7A 1YA0A 3QOUA 2ECPA 2BUGA 2C1ZA 3UYKA 3TGOA 3ASDA 1C3JA 3MT9A 1WW3A 1WM5A 3MS2A 2R66A 2VSYA 2PQ6A 2YJNA 3SZ7A 1IIRA 2VCHA 3TG4A 5G05C 4N2QA 1Y6FA 4M7PA 3CVPA 3GZ1A 4AM9A 1J39A 1NZDA 3MQFA 4BTBA 4MI3A 3EBOA 4X7PA 4NC9A 5KJLA 2WTXA 2VGYA 4WHMA 3QWVA 3QWWA 4BT8A 1L5RA 1L5VA 2KCLA 3T5TA 3MV2B 1OUVA 3E4BA 3VUFA 2NC9A 3ZHEA 4I1AA 4KBQA 2IFUA 1IXYA 2AVPA 5D01A 1FTQA 2QZSA 3O48A 3DZCA 3G2KA 4GPBA 4RENA 4WUYA 1FU7A 1NOIA 2F3SA 5FZQA 3CX4A 5LCWJ 2F3UA 3HBNA 3TAXA 4J8DA 4G2TA 4UQYA 1WUTA 1ELRA 2VYIA 3MKRA 4GYWA 1XL1A 2GJ4A 4RELA 3G2LA 5M72A 1JIXA 2C9ZA 4AY6A 3MV3B 4W9RA 1V4VA 3WADA 1EXVA 2VQ2A 3FROA 2HR2A 4JL0A 1W3BA 4RIIA 2IV3A 4JHRA 3T3GA 1B4DA 4LDPA 1KT0A 4G26A 2FEZA 2PZIA 1WV0A 1ABBA 5BNWA 3UQ3A 3AS8A 2HYZA 3N71A 5JJ7A 2X6RA 3D0QA 4MHOA 2C1XA 4WACA 1NOJA 3GZ2A 4WNFA 4YNDA 5JJ6A 4UQZA 1L5WA 2O6LA 3R9AB 4HOUA 5KJMA 5TVGA 3K9IA 4GPKA 3CVNA 4I2ZA 4G23A 2VGXA 4N3AA 4G1TA 2JJMA 3CUWA 3BCRA 1XOIA 4AIFA 4CDRA 3S2UA 3Q47B 2R60A 2FI7A 2IF4A 2GPAA 4YUAA 3QKYA 4WNEA 3RJVA 2QN2A 3UUXA 3LY9A 3G2IA 3AMVA 3S7DA 2UY1A 5LCWC 4KQMA 3ZCPA 1F6DA 2XGOA 5DBKA 3RKVA 1FC0A 5KJNA 3BCUA 3SYRA 2H1FA 4YI3A 1LWNA 4HOQA 1UZUA 5HQ8A 1P4GA 3IA7A 4J8EA 3ZHEB 2PL2A 2LSUA 3U3WA 4N5CA 1QKJA 4MHSA 3OKAA 3RIBA 4U07A 4MI6A 1EM6A 1IYGA 2Y4TA 5EX3A 2PRJA 3CUUA 2XMPA 3G2JA 3QWPA
chains in the Genus database with same CATH superfamily
3SQVA 3TINA 2SICE 4WVFA 1MBZA 1SPXA 2IPMA 3SDBA 3DZJA 3SF0A 4G8BA 4EJFA 3PD1A 2AXPA 3DTVA 2FFQA 5ANRB 3AL3A 1VA5A 1N9GB 2O8FA 2QSJA 2GYWA 1OX4B 1NJSA 3LSYA 1YUNA 4O3FA 3TOVA 3PNQA 2FSVC 3FVVA 4FN5A 4MAMA 5JAZA 5T4EA 1GA6A 4M7CA 1FUEA 3KVNA 3BK7A 4TWRA 2Q7XA 4MVJM 5COBA 1SXJB 3DRAA 8ADHA 3RAUA 1P1CA 5FDFA 3VKHA 3VYUB 2P1RA 2NZUG 2WJAA 2FGKA 2C7VA 2H9IA 3R5HA 2WTAA 1SQ0A 3DTVB 1TLTA 2UKDA 2O8FB 1VE3A 3RW9A 1M2WA 3BFVA 1WB5A 4U7DA 4QJBA 3IKJA 1WP4A 1WW2A 3KE8A 5CDTA 1SQSA 5K0SA 3G8YA 3DF9A 3CRZA 1AP7A 3ZUGA 4N4AA 1W581 5KNDA 2FHSA 2XSZA 2HHJA 4KO1S 2D2IA 2DWZA 4S2EA 3M9XA 1YIOA 3S8EA 3KJZA 1NNLA 3CUSA 5LOVF 2FPWA 3OEHD 2G88A 2WKPA 1W4BA 4OGGA 3HPQA 1HPLA 2GHRA 3AK4A 1NZFA 1WXHA 1D6JA 2GWHA 3I61A 2IYUA 4RD1A 2J08A 1UDBA 3OESA 1X9GA 2OA0A 3U3KA 1DPGA 1ZGAA 4UNRA 3TG8A 1G41A 2XTAA 5F3RA 3NIWA 1G3QA 1W2WB 4DIBA 1YL5A 3R2JA 1BWQA 1WDMA 2AD5A 5KIAA 4W6QA 3SZLA 4QREA 4KXVA 2EEZA 4H31A 3M81A 2A5JA 3UX4A 2QTWB 3I76A 4OQYA 3TIXB 1OPXA 2FA9A 1X7XA 4NJMA 1RRMA 3QLVC 4DLPA 1O94A 1DC4A 1SEVA 4JSTA 4LZPA 2AW6A 3ZLVA 3K0CC 3V46A 4LE0A 4DR1B 2YRWA 2RGRA 1XCJA 5L3QA 2HJWA 3DOJA 1B73A 1UKZA 1TFRA 3R0ZA 3PQ7A 2W8BA 4PNHA 2Y27A 2WP8J 1ZWKA 3RFFA 3RI3A 3DA8A 1H0KA 5LOVA 5FFFA 2XYRA 4FGJA 5ELXA 1YQWA 1WEKA 2ARKA 4H4DA 4QUIA 1QP0A 1NG1A 1DBIA 1KGDA 1JSLA 5G41A 4AJPA 4GLBA 3UICA 3G6KA 1GTZA 3KEZA 1T1GA 1X7XB 4P32A 3ESBA 4IH4A 5AKKA 4RJJA 3CZPA 3CNEA 4KWIA 3QP9A 3PGA1 2G63A 1CNEA 2WWFA 2QNIA 2W8ZA 1X7HA 2QIPA 1YJ5A 1Q0ZA 5L3QB 4WK0B 4CI9A 4P80A 2BI8A 2O7SA 2W8BB 3VOBA 5DOVA 2R84A 3GRKA 3BE5A 1NQ5A 1VC2A 4IS3A 4OMDA 5LOVB 1UBEA 3U9LA 2XZPA 5IP5A 4MV6A 5TSDA 2I6GA 1K7EB 1KI9A 3DWIA 5IWAB 1B8VA 3A27A 4DLUA 3SQWA 1E62A 3FTDA 4WLVA 4JVOA 4KGXA 3I8XA 2EKQA 2FJUA 4F56A 4UWKA 3NUGA 4JQYA 5ENNA 4U7HA 3BRQA 1AO0A 2CKMA 1QB7A 3Q15C 1X3SA 4WOBA 5C5IA 4XWTA 3F6RA 3HNPA 1SBNE 5L7YA 4L9RA 3M82A 2IOHA 3ZBPA 1MZCA 1DV2A 2ZBUA 1BDBA 3FPKA 2ZE6A 1B14A 3TCKA 1NMZA 3JX9A 1NBIA 4PSKA 1L7EA 4KBFA 4UQOA 2P4QA 3BSSA 3MMSA 4ZA2A 1HR0B 1FQJA 3ASZA 4EKNB 2CHQA 3PYLA 3KLMX 4AL4A 4JHKA 3THOA 4BTAA 4I9HA 3Q0TA 4KRYA 2VRBA 5C9ZA 1VHTA 3PHHA 5AXCA 2FR8C 2INGX 4KV9A 4A36A 2ZSDA 4DCVA 1AO3A 5K3EA 2WKWA 4LDQA 4YJFA 4LXGA 5JJKA 1CZKA 2Q9UA 1V6SA 5ERXA 2Z4RA 1T5HX 5H68A 3E9RA 4JI1B 5CD1A 1VPTA 4UI9J 3S2SA 4JBLA 2PO7A 1V4NA 3AUKA 1GTL1 2HBYA 4FW8A 3IV6A 1KIAA 4ZOCA 2HHHB 2VJAA 4Q3NA 4BLOA 5KC9A 4RHXA 1CCWA 2HPHA 4ISCA 4YJFB 5FUMA 4B0PA 4B47A 4AS3A 2BPOA 2CHGA 3B2EA 3SFYA 2NXEA 4I0WB 4MSUA 1BDMA 3ZW7A 5CITA 5THXA 2FUKA 1A7KA 2IEDA 4LSZA 4OOEA 2YJ4A 2Z2JA 4YBZA 2I2AA 3MT0A 2JHFA 4UCXA 1RPAA 4AXXA 2NUPA 3DEYX 2FKAA 4PC2A 1JR4A 1B1AA 2P2ZA 3IT1A 3BTVA 3ZWQA 1TEXA 1Z38A 4PIMA 2FQXA 1XKXA 4HS2A 4UZSA 4BE4A 2WG2A 3LZDA 4UM9D 3Q85A 3AKYA 3PRKE 4XRGA 4RESA 1UIMA 1CF4A 2Q4DA 1NW3A 1U2QA 2CG3A 2PZEA 4WNYA 4KO4S 1MOQA 3PX2A 1PUIA 4X3CA 4R9RA 4LC1A 2NUPB 1O5OA 1FUYB 4E3WA 2IE0A 4N49A 2CVPA 4X65B 3J7TA 1PJCA 4R5MA 2LV8A 3C16C 4URUR 4L74A 2ZS8A 1T4BA 5GJWC 5JD3A 1E2UA 2B94A 1RZVA 2D7CA 2JFVA 4B2YA 3WWEA 2NP7A 5DM2A 1KPIA 5H8WA 3GMTA 3X1MA 1N7GA 3I8SA 4RZXA 3EXHA 4ZJYA 3HU1A 3TBHA 3C7CB 4B1FA 1ZU5A 4I55F 5JASA 1RM3A 2QC9A 3MCWA 4YRFA 1V3VA 5EKQD 3TW6A 3CYFA 5ITZF 2CDBA 1EVJA 5BWMA 1N0RA 1FNDA 4BWVA 1OXUA 1PNVA 5DV9A 3SSNA 4KQ9A 3K6KA 3ZWWA 1Z6QA 1E89A 3OM1A 4W5WA 2OYSA 1I2AA 1R4NA 4M99A 1AMOA 3LYHA 2AR7A 2PBZA 3K31A 3T7JA 3P0IA 3ZWNA 2ZJ7A 3ORQA 4I5DA 4HAOA 4FD3A 4F53A 3RC8A 3EXHB 3PCRB 3U0BA 4WHMA 3IDAA 2P9UG 2BI4A 4J8SA 2IUUA 3C3CA 1YS2X 1NDQA 2BR5A 2FUNB 4FFBA 4X20A 5AVUA 4DLXA 1BGVA 4AMVA 2PGLA 3PPWA 4UUPA 3UENA 3GA0A 1PTKA 5TC4A 2AF4C 1BI8B 4OQQA 4QA9A 3TTTA 4J7XA 2H2GA 4L95C 3JVUA 2HQ1A 4RY9A 1ZD4A 3G0OA 4MV3A 1HYEA 1S2LA 1R4NB 4ANVA 2GF0A 1E2KA 2JLYA 3N2KA 5JJ7A 4KFCA 2H2HA 4IIBA 4UVIA 3PHLA 4NDAA 4E11A 1AKVA 2QUZA 4HTFA 4LQCA 4H1TA 1BYUA 1UPTA 2JLVA 4ZHBA 1M1UA 2Z5FA 4M88A 1IVYA 3SXJA 5ITZA 3GEHA 4FFBB 4X20B 1X15A 2CB0A 4DF3A 3KQOA 3C3YA 2UUCB 4YCMA 1U3TA 4U8YD 4JJEA 3ZE8A 2VSQA 3A37A 3ZQJA 2F7SA 1DXHA 5LNK1 2JLWA 2POQX 5C8DA 4Z49A 1Z7EA 2MWMA 3NX4A 1ZIYA 1QU3A 3N2KB 1KEEA 4XQ9A 1A0OA 3N2NA 1IFXA 5FO0A 1X77A 3IBGA 4HTFB 5FOWA 4KPYA 5HF9A 2I2BA 5KQMA 3Q7QA 5FR1A 2OSVA 4YQYA 2A14A 1K68A 2YHSA 4BUCA 4A5OA 3EHQA 1Y9AA 4ACKA 3EVEA 4B3GA 4OUDB 1P2UA 3C97A 5LIRA 2M2IA 1G98A 1V11A 1Z0UA 4HDCA 1MB3A 4HNUA 1V43A 1EUCA 1JFSA 4HBZA 3ADCA 2MCFA 1QQ7A 3TWRA 1OVMA 1E3LA 5LQNA 1YTUA 3FG9A 1WXGA 1JU9A 1Z5WA 3A9TA 4LY0A 2WIAA 1KEEB 2JLCA 1Z6XA 3K9HA 3V31A 4ARAA 1H4SA 3ZTTA 3IIMA 5IXSA 2JGJA 4PFSA 3ZWYA 3T52A 5EIDA 4IWXA 4LF6B 1L3CA 3GJQA 2OYRA 2YS7A 2YN2A 4KSBA 2H18A 3FF1A 1Z25A 1M5UA 1YZUA 1V11B 2XEDA 3VC7A 2XRYA 2HCFA 3DXMG 4DBVO 1EUCB 1GCGA 1L9XA 4ZARA 5F78A 2FK8A 1P4AA 3M4JA 4TSFD 1WXEA 3CJQA 5JNSA 4ZOLA 1PJAA 3WLJA 2P3SA 4B84A 1NIJA 3P2IA 4M3NA 3O95A 5IPFA 3T95A 3P4YA 5BYBA 3UI2A 1QE5A 1A04A 4GZCA 1U7PA 1BVYF 4XQEA 1T4MA 3H3FA 2F90A 5E0KB 3KR2A 2AN9A 2OFXA 4X00A 3QFRA 3R7NA 3APFA 2UZAA 1NZJA 4K40A 1RBZA 1X14A 4D9EA 4UI9K 5B4UA 2FWBA 4CUKA 3KEGA 2UYYA 1XYGA 4ITRC 4LZOA 5BNTA 5C1BA 3IGFA 3CSTA 4ZOLB 3OPNA 3GBPA 5LYJA 4M1OA 3KZNA 2O3SA 3A9CA 2WSIA 3CV0A 1M8PA 2D1RA 5ARDA 1I51A 1WOMA 2VJQA 4LQ4A 2RC5A 3G8AA 3VHXA 1DEKA 4XSVA 4EL5A 5TMEA 2VT3A 1UXGA 3EGIA 5DNWA 2EIHA 1D7OA 2FG7C 4CQMA 4E12A 4IYJA 1IN7A 3W5BA 4GCOA 1S8NA 1KKMA 2QN8A 3GIWA 4I08A 4H7PA 5LYJB 2X5JO 2BGIA 5IBRA 4LXYA 3ONLA 1RQXA 2I2WA 3V5NA 1Z3XA 2G1UA 2L0IA 3MTQA 5ALQA 2YC4C 4YRJA 5BN4A 1GKLA 1XZIA 1US8A 3P45A 1U0BB 1B6RA 5AQ1A 1IUOA 4QTYA 3VHXB 2ZYDA 1XZCA 3TSCA 1Q0TA 4ZYZA 3PC2A 4EKGA 2ODWA 2CYAA 1TGVA 2JH8A 3R9KA 4CQMB 4M87A 4ZJUA 1G8GA 2R05A 1E6CA 2CXRA 1TRHA 1W2HA 3TQHA 3JQ0A 1FXWF 4R2LA 3L6RA 1E8NA 2IV3A 3WGQA 5KYVA 1LBEA 3ZE9A 3L0CA 1WV0A 1ZP6A 3H83A 3GMIA 2PKWA 2WU1A 5EIWA 2REXB 4ZCLA 3B1ZA 4NBRA 4O60A 5BN4B 2P6RA 2PEZA 1EG7A 4FLFA 5H3CA 3B52X 2PUVA 3G2OA 2C2KA 2H4JA 5ALEA 5E1OA 4TV9F 1DE0A 3KE9A 5JATA 2X2PA 3JQ1A 1EGMB 4YRCA 3GI1A 3JD1A 4K9SA 4OREX 4MX8A 1DS6A 3L07A 2QN1A 3M6UA 2C5LA 4EF5A 2X0EA 1X7ZA 2WYOA 4MWBA 1WUYA 2VDWB 4D9MA 4QJ4A 2BMJA 5C1PA 1RJWA 4I9EA 4P58A 1WMSA 3AOGA 4OQLA 3F97A 4W63A 3IKTA 2PL3A 1IUKA 3NQPA 5CYOA 3ND7A 1E2BA 1E3DA 1T8UA 1XQXA 4UHDA 2OZPA 1FUUA 2ZIVB 4K1LA 1J8DA 4XKCA 4M1YA 2PZ8A 3BD8A 2AR9A 1QOPB 2C98A 2OCLA 3MEQA 2C8KA 5JO0A 1AKUA 5AM2A 2OG2A 3PICA 1Q7EA 2F2TA 1X7ZB 4GYYA 4MV5A 4ENVA 1CEXA 3SFZA 1OPRA 2VG8A 3HA7A 4POAA 2IGBA 1XQ6A 4WCDA 4EFNA 2I99A 5CXSA 2ODEA 3LW7A 3IEKA 1UDWA 3HY6A 5E1BA 2AJCA 5K5EA 4W9MC 3FYTA 3IAEA 2GZ3A 1O4WA 1UPUA 2G3YA 3PS9A 2PE5A 4JJFA 2RHCA 2AKYA 4KDRA 3RAEC 2NOAA 1KBOA 2VJCA 4K1XA 4D99A 1BRMA 4MR8A 1HMPA 1RYMA 2QP9X 3LZCA 4GMFA 3CR8A 1UDAA 3FNRA 1TAHA 2J45A 1AKEA 5CB8A 4RKQA 3WNZA 1M66A 2QX8A 1SHUX 3PUIA 2HMYB 1IIBA 3HJBA 1FTWA 1YQEA 3K6SA 3EPPA 2VTKA 4I5EA 4RJLA 1ZPDA 1A3CA 3LHDA 2FF7A 1ZMXA 4CT4A 2O2HA 1UXKA 3PZRA 2F9FA 3UMFA 1UPFA 1AHIA 2WSSD 3DO8A 5EC8A 3C6BA 5G1NA 1C14A 2XNDD 3LH5A 3WB2A 4RS4A 1T43A 3CZ5A 1U1FA 1P0IA 4MR8B 4YCBA 3OQJA 5SY4A 3CCCA 1K9SA 3D0KA 3GUHA 3LG2A 5JT1A 2ZIAA 1DOAA 2WXJA 3FUDA 2EEPA 4WA7A 2HA7A 4FKZA 4IKPA 3C5HA 4PZCA 1D4ZA 2XA9A 4KGZA 3LBAA 1YMPA 3ZIAD 4E7OA 2ZR8A 3A31A 1GSAA 4ALLA 2FXVA 3M49A 3HUFA 5FI0B 3JQEA 3F6YA 4TZTA 3AJDA 1QM5A 4JI3B 1V71A 4CT4B 1PYDA 3RSGA 4JC4A 1FFYA 1IPHA 1MOSA 3H5AA 4TWBA 4IXMA 2BE7A 3S8YA 4X71A 2E4ZA 2FULA 3R44A 3ZXSA 4JKIA 3LZ6A 3EIXA 1SXIA 4R83A 1T2VA 13PKA 2KJQA 5LA6F 2Q5QA 3E3OA 3JAMA 3N2LA 1Z39A 2QAGA 4A0SA 2AW3A 3QEKA 4M9QA 1MIOB 3ZYZA 4IJ5A 4S3MA 4K5BA 2IDMA 3PC3A 2WXLA 1SCBA 4NOLA 1H9AA 5DBOA 5BRJA 3TGOA 4E5NA 1K7FB 4R71A 3H5OA 4HB4A 4U3JA 3L6EA 4OGWA 3AHJA 3C14C 5EJ4A 1UKAA 3RT9A 4BLSA 3CKKA 3BIXA 1Z4PX 5K09A 3H16A 4JS0A 4W8HA 4RENA 3EW9A 1WCIA 2QMQA 4EZBA 1NYTA 2VP9A 5JBIA 3DSSA 2LAIA 4PLYA 1L5HA 3QRWA 5HFJA 2FMXA 3KG2A 4UNIA 1MOZA 2G0NA 3HEBA 1G19A 1BO6A 2GRRB 3TW0A 1JQEA 4RVSA 2PVCA 3QBJA 3U0VA 3ACBA 4ASUD 1J0EA 4WACA 4MWDA 1TJ5A 5DYTA 4U3JB 5E2AA 5AK0A 1QHHA 5AVWA 4W1QA 3NHJA 3UJBA 4ZVQA 3RJTA 5LP0A 3PKZA 3EOBI 3ZS9A 2VS1A 4XEIG 3WGKA 5FFNA 3UWKA 1Y9DA 1WCIB 4QBGB 4V0MA 4PO1A 1L5HB 5YASA 1DEOA 5KOJA 5G02A 2MOWA 3I4CA 1N9AA 3NZEA 4D26A 5H82A 3CHYA 1H4QA 1G7CA 1R8SA 1B23P 3KKNA 4BO3A 3MCUA 2P6PA 2VXOA 1VECA 4HL6A 1QBKC 4N2SA 2WWWA 2Y1EA 4D9HA 1DQYA 1C8BA 2ONYA 3STYA 2RFLA 2B4KA 4G8KA 3QEOA 1QOQB 2QVXX 1P4RA 4XEHA 3G7UA 3EEIA 5K4AA 4I1RA 1KWGA 4UEKA 4Q9KA 3WMXA 3NVDA 4F9TA 5EAIA 3OT4A 5C4IA 3LWBA 3IHVA 4ACAA 5KOJB 4OPMA 4BQOA 2H29A 4OI1A 4FJYA 2ZVQX 3TL3A 1YCGA 1JQKA 1D4OA 1V5WA 3ND8A 5AWFC 4TTIA 2ATEA 2VZEA 2O2DA 1B2RA 1J8YF 4L15A 1N4QA 3T0FA 1DWUA 4W8GA 1E7VA 3JQAD 3EARA 3V1NA 5IAGA 1GNPA 2J7KA 1JMVA 4XYGA 4X95A 2FZCA 5HMLA 3AFOA 4O1OA 2WM9A 1X0XA 2P9ZA 4EW3A 1Y5MA 3PZ3A 2H4YA 5JSHA 4TVBA 1V7PC 3KOYA 5AM1A 3N7UA 1LA2A 2ORYA 5G4LA 5BQOA 3T3HA 2BFEA 3KZCA 7GPBA 3W8EA 3TUJC 1NMXA 3MS4A 4YBRA 4BFRA 5FFMA 5JDCA 1EVIA 1KK3A 5KMGA 1KZGB 3RRNA 1PS8A 1TEVA 1GG2A 3GNLA 4YT5A 3LS2A 4KIJA 2WM9B 4DLOA 2AXEA 4MI1A 1XJ5A 4L3WA 2OHOA 1GQYA 5T4BA 3RE1A 4EH1A 5K3OA 7ADHA 4HFJA 3D6UA 3L0IB 4QT0A 3HV0A 5HJ5A 3KJEA 3WIVA 4EL0A 4UFPA 1PWYE 2BFEB 5I7VA 4GP7A 1L7QA 4LYHA 4M55A 1J49A 3GYZA 1R4ZA 1DSSG 2L2QA 1O6FA 2GPJA 1R2QA 3WP0A 1Q7TA 1UEIA 5LL6P 1HDCA 4JV5B 1X7YA 4JBWA 5ARBA 2XQGA 4OA5A 3K9GA 4MW6A 3GPDG 3DAGA 5KMGB 4RKFA 4A8HA 4DMRA 2V5QC 4YDSA 3RAGA 4DIDA 3B7TA 5LBUA 4TTJA 3EEBA 4TMYA 5EDSA 1AHHA 2J9YB 4B6QA 4CQJA 3A10A 3E3LA 3GJ5A 3I9MA 5HZMA 4NFSA 3W8RA 3I32A 4DIFA 3TK1A 1NJ2A 1L7MA 3LA6A 1IEQA 4APFA 2DF8A 2IYEA 4RIGA 1X7YB 2W71A 1MORA 4DX6D 1I30A 5COAA 4FBLA 2Z30A 2PRKA 4ZQIA 3GP8A 3FYSA 4UU7A 1FFHA 3PDWA 4L1KA 1XNJA 1H2XA 3AVVA 2V1XA 1IM5A 5KNDH 5FOQA 5TPZA 4ZO6A 2VPPA 1NJGA 1WUTA 1XD8A 1GJRA 1CUAA 5T4HA 3SC2A 2WHYA 3AF1A 1JEEA 2AQ8A 3AXTA 2A6PA 1OHHA 4GF5A 2C1XA 4RHTA 4L9WA 4MO9A 1FMTA 1ETUA 2NO0A 3L04A 5DDIP 4HD8A 3CUWA 1PFYA 3K73O 1BA2A 5LNK6 4YRIA 2HJSA 1WHTB 5JLJA 1THTA 4LZZA 5LCWC 3MGKA 4P5DA 5EGSA 1R0YA 3EF3A 3PUHA 1A7JA 1OYVA 2PL2A 5JANA 1DVRA 2P5YA 1Z18A 1N7JA 5BW8A 1U5AA 1WSDA 1VSVA 1QE0A 2Q50A 2ENUA 3KD2A 2PL5A 4X60A 3SC2B 1NMQA 3KQTA 5K1ZA 2FMHA 2HR1A 2IOFK 4LF5B 2WLSA 2WPDD 1TZ2A 3TJMA 2KM1A 3NHPA 1V8OA 2E6KA 3F6CA 5K0LA 1NUUA 2ZUEA 1CBUA 2ZI9A 1CZOA 3G6WA 1NP6A 2HRRA 2PDAA 4BDTA 4ZODA 3AVTA 1LPPA 4GTMA 3KL2A 4EHAA 3ZVLA 2Q4OA 3DDSA 3ANXA 4MA0A 1S8FA 4DNQA 2VNIA 5CHYA 5KNCD 4I99A 1GGJA 2ZUCA 3EDRA 1BIFA 2GM4A 4UXIA 1BMQA 4HLUC 3QQ5A 4HADA 1G64A 3QPUA 1QS0A 5FTJA 4NYJR 1Y81A 1EWTA 2WU3A 3NASA 3EFOA 2YFHA 1PNRA 1FNNA 4DLLA 4MKRA 4RKYA 1HDYA 1X1QA 1CZNA 3IV0A 4LPKA 3BFPA 3OH8A 4KH1A 1QNFA 1U7DA 4AJWA 3WNBA 1PEAA 4INZA 3ZN2A 2CHUA 2BMWA 1ZN7A 4PX3A 4H59A 2JAOA 3L9XA 4L4ZA 2EQ5A 4Z8YA 1UFKA 4YONB 1PL6A 3IL2A 4WLUA 3IMGA 1QS0B 4X8OA 3G1TA 3KLBA 4ILEA 3HGQA 4UAJA 3EFOB 3KHTA 4HI8A 2QA5A 5FA6A 1VKJA 2LUOA 3HWSA 4ATZD 2PNJA 4C04A 3AIIA 3HJNA 2IQ5A 2C4WA 16PKA 3WV5A 3IUNA 4G09A 1JX6A 4LHWA 2R6HA 1NBAA 4L3OA 2WQZA 5HCUA 4BYGA 3P94A 2IW3A 1FBNA 2V4UA 4FNMA 2GN9A 2HF9A 4FFLA 3AUSA 4EHNA 3W2TA 2Q1UA 3QK0A 4ZQHA 3PUZA 1Z4QA 4B75A 3WB0A 2FN8A 4NNPA 4A91A 3KQMA 3ORSA 3ZVMA 1M3SA 1XXLA 3DE0X 1YHNA 1Y6IA 4G9BA 3UATA 1JR6A 1XHFA 3VX3A 1NR7A 4IINA 2O2JA 3UG6A 3ZWBA 3WK5A 1U3DA 5GWXA 4F8YA 2BSXA 3RF6A 2VPTA 3VR3D 1XTZA 3WVNA 5FX2A 2LKCA 1S6YA 4I8XA 3S7JA 4Y9SA 3AM5A 2DBAA 3BHIA 1WMEA 1KS9A 4DHWA 1D4FA 1C30A 5C1IA 4LYEA 2KBXA 3D9IA 1UJBA 5BR8B 2OM6A 2A5GA 1HYQA 5FTKA 3DLPX 1NUQA 1AQNA 3A9VA 4XVQA 5CK4A 2FWMX 2B9EA 1LD7A 2BDEA 4JI8B 3N8KA 3AIOA 4DSUA 3PDHA 1TAQA 2VSYA 1K3ZD 2VBIA 1UZNA 4I3FA 4DWWA 2WT9A 1IK4A 3TLJA 3CHQA 4Y2JA 2QE7D 2BFNA 3RH0A 1XTIA 3PUKA 4BT8A 5CUQA 1XMVA 3R3HA 1SWWA 3FJYA 1YULA 1X5BA 2D7JA 1Q21A 1PGJA 4OBWA 1C30B 3ROEA 2GJ4A 4LVNA 4WAFA 5DE3A 4B34A 3H1FA 4TXQA 4ES6A 3IHLA 3SPXA 1EWKA 5DHUA 2M6LA 3L1VA 3OT1A 4CL3A 4C76A 3VTZA 1Q0SA 1KJZA 3FBTA 4GR4A 4OYRA 5E2BA 2AFRA 4HVTA 4G0XA 4GSYA 1EAMA 1AA6A 3DFFA 3SHVA 1U6IA 3V8BA 3DEZA 1SULA 2OBLA 3KP1A 2VUTA 5H1YA 3EFBA 1MX2A 3S2YA 4ZN6A 4MWTA 1XROA 3X0DA 3ZGZA 4L6AA 3BB1A 1LC0A 1N6OA 5EQTA 2F8YA 3LL4A 5FJYA 2PZAA 4QQIA 3CW2A 3RIEA 5EE9A 3R3YA 5J58A 3VSDA 2W83A 3OT1B 3OAWA 1EAYA 1G66A 4FLBA 1U3VA 3CZQA 2IHYA 2GOYA 3SQNA 4OXRA 1S2GA 2Y1DA 2P78A 3ANMA 3RFXA 1VJ0A 4OGKA 5CIYA 1DMSA 4QE3A 4GMLA 1QIHA 3KAKA 4IZOA 5T41A 3A7DA 4U1RA 4KPGA 3M9LA 2XODA 3AR3A 1NX9A 2H16A 3UT7A 2WMNA 4CTKA 3O7WA 3S8MA 1EFPB 3RUPA 1UWVA 4IYPA 4BZQA 3WLMA 3E35A 4AJIA 1NF8A 5KNLA 4EHLA 5EYLA 2ZYGA 3VKFA 4EZKA 4HP8A 1Z7GA 1YVRA 4D02A 4R2KA 2D0IA 4A7PA 4UBKA 3KTAB 3GLQA 4MH0R 5G1PA 3ZZNA 2PUBA 4R41A 1VLMA 3N9IA 2GKSA 4CKEA 3VR2D 3QNKA 1P17A 4BVAA 3ZWMA 4RMIA 5FLKA 3GPBA 2VJMA 4ZICA 1SUAA 3S5JA 2WMNB 1E5LA 2NADA 4S24A 4PAOA 1ZUD1 4YWHA 3VR4A 5TPWB 4FM9A 4CM1A 1AS3A 3I04M 4K9MA 2J6HA 4S05A 2C82A 2DWPA 2JLSA 1Z5UA 4RFVA 1V95A 3ZI4A 4O2LA 2IPNA 3GLKA 4FQ5A 3HCFA 5FLXA 2GPWA 1K06A 2YC2C 1KZOA 2XCCA 2RGBA 2PS0A 3H5IA 3WXMA 2CF5A 2CVOA 1N5KA 5JECA 3JALA 2H6GA 3GT4A 1N8TA 4EFKA 1CUXA 4EYKA 5J4KA 1BS2A 1VL0A 3KU4A 5K6AC 1K86A 3V00A 3TL5A 2VJMB 5AKLA 3AC0A 4R0MA 3AZPA 3LUJA 1DQSA 4Q4CA 1BJRE 4B5KA 4UNSA 1LQUA 3ETNA 4TXNA 1ZSYA 2Q4TA 3GZSA 3ZGOA 5ANRA 4N0QA 4ZRMA 1EFCA 3GLGA 4D3XA 1Z0DA 4DMCA 4WAUA 1I7QB 3MFYA 1AG9A 4US1R 3OA0A 3HVHA 1XN4A 2WT4A 3DTYA 3JALB 3NVMB 4UEOA 2PX3A 4AJJA 2EXXA 3TQQA 1FSPA 1GCAA 3GVXA 4TT3A 1C9KA 4BNNA 4FHFA 1Q44A 3C39A 3WGGA 3RVSA 3GAMA 2HRCA 2JPDA 4Q7LA 4C4AA 5IHXA 3T7IA 1TO1E 4RXTA 1K63A 3D31A 1PT9A 3A6KA 5SZJA 1E6WA 1PDWA 4JWTA 1NJFA 3GLGB 1XJQA 4R1QA 2GI4A 2ATXA 2LAHA 4IFIA 2X58A 1ENPA 3W6UA 4A73A 3DZIA 2P9PG 3VAYA 2O0KA 4M7PA 4X94A 1JYEA 1ESNA 1ETHA 3RSEG 2O7VA 2F0YA 6REQA 3U7GA 2Y4OA 3EBOA 5KJLA 3H4VA 2BEVA 2JFFA 1UN8A 1WZCA 1MRSA 1H2HA 2I6UA 2RH4A 2F9LA 4N5DA 1B7GO 3T9CA 2PM8A 3PIRA 1UJMA 4EBBA 2MIIA 3O8LA 4G0NA 3A6JA 3CR7A 3EVNA 5CRVA 4R8MA 2Z1NA 4ZTZB 2QP3A 2X0IA 2CLSA 2HF7A 3PC4A 1V4VA 1VI6A 4RMHA 1KKUA 5A3QA 2B35A 2ISCA 2B0JA 2GN6A 1IG3A 4QXPA 3IKVA 3B51X 3KETA 3MWGA 1XJ0A 1MC1A 3P97A 3Q4GA 5EZYF 5JXJA 1E8WA 3H04A 1E0AA 3KEOA 5B3LA 2BRUC 1BVUA 1IB0A 6REQB 1H2BA 1QKKA 4EHBA 1SVLA 3DMGA 1SUSA 1PK9A 2F1KA 3QLUA 2BEVB 3MOGA 1M5TA 5IJAA 4J8EA 2VF4X 5ALOA 3GJ6A 4A55A 4B44A 1ELOA 5CT5A 3R8CA 1NXSA 1P7VA 3C5CA 3K9QO 2DVWA 1RU3A 1FX1A 3AJ9A 1U94A 1M8KA 4CM5A 1U65A 4AMBA 2VDLB 1DJPA 2JI9A 2GM9A 4MAAA 2E5FA 3F47A 3TFOA 4L8VA 2LTAA 5EIEA 3FFXA 2ADMA 1YQDA 3RK0A 3IP5A 5AIBA 4CV2A 5FR2A 4F3VA 4X9XA 3WRVA 2XT9A 5EXPA 4PZAA 5MN6A 1DKUA 5BV1A 3H7AA 3CG4A 2ZSKA 5EIXA 1PWEA 2BZ0A 1E7MA 1ZMBA 2XEVA 3TSYA 3R9XA 4NQRA 1HDIA 1RHUA 4NFHA 3UPVA 3JUIA 3S1SA 3ZD7A 1Q0LA 4KIFA 1T34A 1ECCA 2PUAA 2KS6A 1GGNA 4KREA 1E9VA 4M9CA 3W4JA 1BCSA 4C4TA 1EJ2A 5CDSA 1EFAA 5EZYA 1SVWA 2ZYWX 1KEVA 1UANA 3ZWKA 1ZNZA 2YQ4A 2HUNA 5AKXA 3FBWA 4KWTA 3F49S 3N1UA 3RHZA 1N54A 3HCOA 3F90A 2Z4TA 3A6GA 1O95A 2V5AA 2XEHA 1K2VN 2JGIA 5FTWA 2VRCA 2QN9A 2GB4A 1OIVA 5KTMA 3IP9A 2W5UA 4JMLA 3FPJA 3R9XB 3IBYA 2ZITA 3K30A 2QFCA 4R3UC 2DQKA 3GAAA 3QOYA 3FU5A 2PUFA 3P52A 4NYIQ 4FMCB 1PQUA 1JB1A 1NW9B 4Y6LA 1BCSB 3D6VA 5IF9A 1Y4ZA 5HQJA 4LY3A 5EZYB 4ZZ2A 1E5VA 3QVWA 2IW1A 3BX1A 1G4UR 1TM5E 4HXIA 3RADC 3OE4A 2QRUA 3G2UA 2Z6UA 1KMNA 3EXAA 4LSGA 3OCJA 3SKVA 1G20E 3FWHA 3RO3A 1LPMA 4UHKA 1NZNA 2XS8A 2PH1A 3FWNA 4XYMA 4DQLA 2J48A 4ZT6A 4HQNA 4FOSA 4KTVE 3R5TA 3SXPA 3NHBA 5MDHA 4G0QA 2VHZA 1L8XA 4R1SA 4EHJA 5IABA 4NU6A 4U7JA 1WXWA 1EWVA 2ZP1A 3DLBA 4RKWA 1GILA 3BQNB 4NU5A 3KOUA 4CFYA 3KELA 1E32A 5E3IA 1U2GC 4DGQA 2GD1O 1YGPA 3GJRA 1ZO8A 4BJ3A 3HY4A 3KKQA 4A23A 3IXLA 2FRVA 3MERA 3UPUA 2DQZA 4EUKA 4YMIA 4TTAA 2YINC 1EFRD 2JGNA 3LJNA 4QEKA 2B4QA 1BQ4A 3AZQA 2QR5A 4Y6QA 2F62A 2XITA 3BL6A 3HUTA 1WXFA 1G63A 1B74A 2R96A 5A3SA 4F4FA 5AVRA 3WQSB 1ELKA 1YA0A 2ERYA 5CIQA 1U8XX 2IYSA 4XYLA 2C0PA 3BYZA 5GVSA 1A5AB 2C5GA 1Z0SA 4UMDA 2YZ2A 4ZYUA 3UJ9A 1Y9EA 4AD8A 2P9NG 4DX7D 3HGTA 4BERA 2ZRCA 3F9CA 4OXKA 5EEGA 1XCPA 4JT2A 1NTRA 1WG8A 1G8YA 5AJYA 2HCJB 2X9NA 3UKOA 1PFWA 1IH8A 2WDPA 5EE5B 2C9ZA 3TPZA 3GGJA 5C5DA 5HRUA 2QLTA 2DIWA 2IUSA 3FB1A 5E3HA 5F5NA 1E2GA 4IGAA 3MD9A 3D1VA 2H4XA 2JFQA 5JUWA 3VDRA 2ZI5A 1NY5A 1KXJA 2Q41A 1WZNA 4UTZA 2ODQA 2ZCJA 2VLBA 1MJGA 3FVQA 4EO4A 5A5VA 4U07A 2XOXA 1T3HA 3TOZA 2HPZA 1PHRA 3BWYA 1TD9A 1AF7A 1ZD3A 4EQFA 2H52A 2P41A 2ZBDA 1W0KA 3NHAA 3AM3A 1NV9A 1AKMA 1M6NA 2P91A 1FEZA 3FD8A 4W1SA 1M2FA 4AROA 1A97A 5L3ZA 4DRZA 1LPNA 1PQPA 4QDTA 5AVZA 2D1SA 5FV4A 2WAAA 1Z2DA 3A11A 3H7IA 2W2LD 4B2LA 2DR3A 4D81A 4DUZB 4G4GA 3MNFA 2CJYA 4J0EA 3L43A 3ROFA 1E8XA 3HJHA 5CFPA 4N8EA 1MX3A 4NV3A 4JB2A 3PUYA 1Z6AA 2HWWA 3LOUA 1GUDA 1ZI6A 3FMIA 3CEJA 3QVOA 2YWJA 3RTAA 3NHMA 2FW1A 1ZHOA 3AWIA 3M4YA 3SMVA 3ZW9A 1M1ZA 3L6AA 1RHKA 1N2OA 3AY0A 2FWJA 1W36D 2XF8A 2ONZA 3JYQA 2X6HA 4ZAYA 3C4JA 2Q6LA 4K0KB 1RC0A 2WIKA 3FF4A 3QMMA 3HSYA 5BSVA 4UI9C 4H1VA 4Z2YA 4PSUA 3C1AA 3C6MA 2AG6A 4CTOA 1XE3A 2YHIA 4EYEA 4ZCSA 4R6XA 2FX2A 3UT4A 5DZSA 1QH1A 3FHJA 2R8ZA 5K01A 3DGFC 3MRSA 4WOCA 4QJ3A 2FG5A 1GZ4A 3THWA 5B12A 1QRAA 1TMYA 3DTTA 2H54A 3RTDA 4DDHA 3HG7A 3VRHA 3S44A 4PHGA 5CCMA 2OB1A 5IEBA 2VT6A 2SHKA 1VIAA 2QMHA 4IDQA 1XLWA 4FS3A 1RPTA 4CM9A 4TYYA 2ENWA 4B87A 1OFUA 5FTPA 2YHIB 5J5CA 2QHXA 3UAXA 3MMXA 3G2PA 3LBFA 3OQBA 2EQXA 3LYAA 1QH1B 5CFMA 1W5SA 4MINA 1N33B 3N0XA 5HFNA 1OYOA 3TZLA 1QRSA 4L02A 4LA4A 1QDUA 3THWB 4FQ7A 2J4CA 2R8OA 3QU5A 4A5SA 1QQ5A 3DXFA 1K8KG 5ECYA 3WL6A 1IQUA 5CT9A 4PS1A 1B26A 1CD5A 1QIIA 1S8AA 2RHLA 1G8KA 1QHGA 4G9EA 3CG0A 4ZREA 1LFAA 2H51A 4HNHA 3K1TA 4IHKA 4P93A 1RCUA 3VDQA 4M2LA 4L51A 4HQDA 5JJCA 3O47A 2XE7A 3PQFA 2D5LA 4CR7A 3IQIX 1K0UA 3UMCA 1E9RA 4N3NA 4F3YA 1VKOA 3E9NA 4QRHA 4OUDA 3K71B 2IU4A 4INJA 2RI1A 5C34B 1A5BB 3LCCA 1MHQA 1XZAA 3HXQA 5DGTA 3UJAA 2FI1A 2QPAA 1TJPB 4GKVA 5MF6A 1L5SA 4GX0A 2X4DA 2ZJBA 2ZQYA 4PZPA 2ECOA 2FRDA 4PONA 4ZOLF 3ILVA 3PFHA 3U4AA 2OBYA 1OGYA 1II0A 3IV9A 3M5DA 4YCSA 3N5CA 5AKIA 5KSPA 2PQMA 1R5BA 1KETA 2QUBA 1PYOA 1EFKA 4QIHA 2FJ0A 1E8MA 4HBGA 2I4LA 2VHQA 1U3GA 4C5AA 4HWSA 4E09A 2CWWA 2W37A 4DV0B 4H3KB 4J0QA 1W94A 4LXQA 1PJZA 2ST1A 2ZRLA 4FU3A 2CNWD 4U02A 1ZN8A 3ESZA 3NHYA 5DYNA 3SM9A 2R8XA 2PIDA 3KAQA 1OFIA 2VF8A 4YDQA 1M74A 4HOYA 1N57A 1D8DA 5LYJF 1IVNA 2QDXA 4QU5A 2AG1A 2X8JA 2FLVA 4ZVSA 1ZJ5A 5LD2C 1Q6YA 3NLLA 3JZIA 1WABA 1K6JA 2IC5A 4H0NA 1II8A 4IAOA 3BAZA 3MWJA 4LOHA 3D9LA 1SURA 3IQXA 2X42A 3FMFA 3OLXA 5K8VA 1FP2A 2C9CA 4Y2UA 1XJCA 2OLJA 1KH1A 4LSMA 3K53A 2WVIA 1KMCA 1KAOA 2VSXE 2D1QA 3ROKA 8OHMA 2X8JB 2VKTA 1FLDA 3H2IA 3SVLA 4JLUA 4MROA 4P3KA 4KKXB 2PYZA 3B7PA 1H2TC 4Q15A 4TLAA 1II8B 3SN6A 3IP7A 5F4BA 4FOTA 2OO5C 3CPHA 4N0EA 4KQ2A 2PBRA 3JS5A 1PT6A 3I30X 4EYOA 5AESA 1TA0A 3A14A 1JHYA 3FMOB 3UMJA 3CO0S 3PITA 1C81A 1G0NA 1MKYA 3STXA 3SR4A 4BRUA 4B7UA 4GBGA 1VCMA 4IDAA 1GFZA 4Y8VA 4ANFA 3BK2A 2O05A 1JDBB 2CFIA 2YIDA 5G4KA 3DDNA 4ND4A 4OHVA 2R44A 3UK0A 3EZNA 4GNRA 1T2EA 4YB8A 3X1XA 4JQCA 4WKGA 2XTMA 4HQRA 5F7XA 4EW2A 1JXOA 3FTCA 1VE5A 4Z5XA 4RA6A 1OU0A 3I0ZA 1GITA 3GD7A 2CV0A 3QXJA 4BFCA 4BNIA 4XVUA 5IFKA 3U31A 1H0AA 4D6YA 1Z8DA 2K4MA 2HLDA 4GFDA 3C3QA 4DPMA 1JCRA 4IDPA 1P1IA 1UUFA 4Z0HO 4NDZA 3AESA 4UUAA 3UV7A 4M86A 5LQDA 5G4KB 4C4RA 4ITUA 1E4OA 1KBQA 4JJKA 4BTVA 4WPGA 3UJ8A 3E2IA 2IY9A 3CNNA 3GG9A 2EFHB 4R1TA 3RFVA 5ENTD 1NUSA 2P79A 4GX2A 4RA6B 1ZLXA 1JSRA 2PFGA 4MW9A 4K28A 2ZWVA 4UUBA 3N2ZB 2ISSD 1HOXA 1JZTA 1FF9A 3IA2A 2H6HA 1ULZA 4MQ6A 4DG8A 5CDFA 4DIMA 5G40A 1PZFA 2ZGGA 5I3ZA 4RZHA 2OORA 3BOSA 3AESB 3CLUD 4FR2A 2VDWA 4D0SA 3IR5A 5H70A 2GNAA 3DZKA 5KI6A 1ZM7A 2Q7FA 4RJKA 1NMYA 1H69A 4A0QA 2FP4A 4RSGA 2BCGY 3H1AA 1RC1A 2IDKA 4U95D 1KPGA 1P3JA 1QV7A 3PUXA 3EXEA 2MYNA 2RGEA 4ZT3A 1E7SA 3ZCQA 3VSBA 3ZFWA 4R84A 4R1UA 3V4VB 2JLUA 4PO3X 3SEFA 3NF1A 3B7WA 1ZH6A 2OZVA 1TO6A 2QRMA 4DTIA 2OD9A 3F2VA 5K8JB 3IBEA 4AY5A 2CVZA 3EB9A 4R0NA 2QNRA 3TO5A 3ZY4A 4L23A 2VK2A 3O84A 1T6XA 4I19A 5T57A 1ZD1A 3COVA 4H9GA 2FP4B 1XTPA 1OB5A 5CFNA 3IAUA 4BX0A 3AHIA 1U31A 1NF9A 2WWTA 3EXEB 3L1UA 3TJZA 3TW4A 1EB9A 3UWMA 4F5ZA 1HK7A 4EX6A 2JJQA 1G6KA 4BN5A 4MDFA 4GPBA 4RD0A 4UATA 2ID7A 5EJIA 1PK7A 4IOLA 2OHIA 3RUCA 3HCNA 1W4LA 1Q0RA 1WKCA 3PHJA 1CUJA 5BVHA 1MXFA 5EMMA 3WICA 1ZJZA 1J5PA 4YP5A 1MB0A 4ZKEA 1WX1A 2Q1SA 3NTXA 1ONNA 3D7NA 3CVNA 1P2TA 1NVTA 2O1WA 3D0OA 1JL3A 2HPVA 3GFQA 2IP2A 1WPGA 2QL9A 3BICA 4M9XA 3U3OA 1G7RA 3OFJA 5EE3A 3LY9A 2Q29A 3OCCA 3FPLA 1XZGA 3X2QE 3R7DA 1SK9A 3DPYA 2P65A 4IIJF 4C21A 1E77A 1IBRA 1TFUA 2HADA 5B7GA 5EPEA 1YI0A 3TI7A 2C31A 3Q8XB 3NWPA 4HVCA 1RVV1 3QEJA 4KE9A 3VTXA 3UXHA 4C06A 2AJAA 4O1HA 3C3WA 1K66A 5BVHB 2HK8A 4B9EA 3NHUA 1XUOA 1A17A 4A0GA 5ENDA 1P18A 1SOAA 2OGTA 4ALIA 2K2WA 4JU8A 4EMBA 4OQDA 5AICA 5I9BA 3HG0D 4WWOA 3LFUA 2JJYA 4MMYB 5AUPB 2IQCA 1N36B 4WZBA 1M83A 2YV4A 3SSOA 2V6JA 4FFMA 2IEGA 5AI8A 2QJOA 1Y8RA 3EGVA 2DR2A 3ECSA 1UM9A 1CUVA 2ZJ0A 4Q34A 3T9FA 2RK3A 3QU2A 1KGSA 3SFXA 1JXQA 3FHOA 1Q91A 1DKLA 1FYDA 1PNOA 2Q99A 2ZROA 3PF9A 2ZJFA 3FYDA 3DSUA 1ZVKA 2W4QA 5LP6A 1MIOA 4ZMRA 2LNIA 1KZHA 3L77A 3U2QA 2XTNA 4ILHB 3S7BA 1GZVA 4HDRA 3CRVA 3INYA 3NB2A 1R6TA 4RPGA 5FPKA 2H63A 3FXAA 3K1JA 2WJPA 4WZBB 5DULA 1MAWA 4D3DA 4IIJA 1OA1A 2IU6A 1Y8RB 1RKVA 1L5JA 1UM9B 3GF4A 4PVDA 3NOCD 4IEFB 4G01B 4C1BA 3M8KA 4LRWA 3I72A 3WG7E 4RKRA 2GAOA 5KTNA 4KDFA 2CXOA 4D96A 3WGLA 2NO4A 4F38A 3N0RA 4U39A 2VYVA 1QHXA 5FPHA 5LP6B 2VZ9A 4FZJA 4J0IA 4M0CA 2I6SA 1YGYA 4HDRB 1T0UA 5I7WA 3N0VA 4ZGWA 1V3QE 1RPJA 4FDVA 4YIHA 4MVWA 3PXAA 1Q3HA 1FDOA 4RSMA 4IIJB 2HM7A 3WDKA 1X1RA 4MCAA 2FZ4A 3MTDA 1W6UA 2PX4A 5FCDA 4GDMA 4R81A 3N5KA 3UJHA 2GZ1A 2R7LA 4HB5A 2VXBA 4QXQA 3MQ2A 1JPJA 4B8AA 4BVHA 2R8EA 1W48A 2HYDA 4E5DA 3DO6A 3VNRA 1OR8A 1QJ4A 1PVDA 1LNQA 3BGVA 3UCXA 5BT9A 3DLTA 1BU5A 4V1CI 2A5DA 3V6LA 2OR3A 5IAKA 2LXNA 1YZ3A 2EX4A 2OKGA 3AG1E 3ZNOA 1FQKA 3TKYA 4LYFA 4BN0A 3CNBA 4JX9A 4ZCRA 4C30A 1OIXA 5H7XA 2B4AA 2AQHA 2V4LA 5INTA 4KJXA 3T9KA 4RPHA 5IWCA 1X19A 4OLBA 1P75A 3FI9A 3UAGA 3VV3A 3G5AA 2RAUA 5IVDA 3MS2A 2V7XA 3F73A 3PA8A 4WT7A 1DAEA 4DLKA 1ATZA 4EZLA 2ZE5A 2AK3A 3SBXA 5A7GA 4AY2A 2ZPUA 4LERA 2HSEA 4J3JA 5A05A 3QTTA 3Q3JB 3HYRA 2GRAA 3GNTA 2VJOA 1HF3A 4E5PA 4L2IA 1ELRA 3PXEA 4EY6A 4OAVB 1NBOA 2ZT7A 5ELLA 3U60B 2P6OA 3C5VA 4UREA 2YJTD 4R7GA 3NC0C 2DZNA 4HFRA 2X86A 2FK7A 3VR4H 6AT1A 2JGDA 2ZBRA 3ICCA 4JMPA 1E3WA 2OHHA 4ABYA 3Q9SA 2ZVPX 4NPCA 1OFGA 1T24A 5DTRA 2XMSA 1UOOA 4BNWA 4KQHA 1HG0A 4EP1A 3TLAA 4FYKA 2GBLC 4JSYA 1CF2O 3I6ZA 4L2IB 2XB4A 3DEHA 3W5CA 3TZCA 1L5NA 5MFPA 4FX5A 2R1UA 1JB9A 1DG9A 4ROSA 4LE1A 2XGJA 4ZI7F 4PXAA 5FHRA 5DN6D 3NXKA 3SLRA 4U5QA 2P67A 5CM9C 4C7JA 1N25A 2JGDB 2QENA 3GG2A 2HU5A 3NHFA 1AKTA 2WJJA 2W6QA 3KD3A 3TW8A 1E3WB 1W88A 2YN0A 4CETA 4K9QA 1SKQA 2JGKA 4GHWA 1WW8A 3FSRA 1OD6A 3CVQA 1EVZA 2I7XA 4LQLA 2R03A 3VVCA 2IZ5A 3F5QA 3K70D 3FUEA 1VIVA 3DMNA 3H97A 1ZK1A 1H8ED 3M6VA 5KSOA 3JWIA 1AUVA 1D8AA 4PTYA 4H7XA 1EVKA 3FRJA 3ZE0B 1S5PA 2IEAA 3G7SA 4QFDA 3TW8B 5ALVA 3WWDA 2PWBA 1W88B 2KLBA 1JYSA 4HEJA 4PV7A 3Q8KA 1OAAA 3FA2A 3NBKA 1DBWA 1BPOA 4IJQA 1SVSA 1PN3A 1OAKA 5GOTA 4RIFA 5K0FA 2EKBA 1P1BA 1W5FA 2BFAA 1NM5C 1ZCJA 3OTHA 1VGRA 4ZI7A 3PQ5A 5F1PA 4MVJG 1FVXA 4HXEB 1B42A 3Q5GA 3MM4A 1OC4A 5A4MS 2ZDGA 1LW6E 4L1BA 1E8YA 4I14A 1DTSA 1EK6A 4AB1A 4QLBA 1KZ1A 2PUHA 2XKAA 2D13A 1O1RA 5K3SA 1D3AA 6YASA 2IIQA 1WHTA 4QUJA 5TARA 4ZCMA 5HKBA 5FOTA 2KB0A 4M38A 3B85A 1TQDA 6LDHA 1L5GB 1NU6A 1HQKA 4CMCA 3TJPA 1BTOA 4KO2S 4LRUA 2P7IA 1VJCA 1O1SA 3WC4A 2OFFA 1F8YA 5KNBD 1GVNB 5BXYA 5IDYA 1EP1B 4ZI7B 3UWSA 2BCJQ 1IATA 4B3DA 2R87A 3GFRA 3WB1A 3T5XA 3DHEA 1ZIOA 3GNQA 2JI6A 3AUFA 1H2YA 3ZHUA 3I1JA 3CMCO 3ZN3A 4KLAA 3HKEA 4C0BA 2P4HX 3BWDD 1N2HA 1DKRA 2DCMA 5AK4A 1FNCA 4OATA 1OI2A 3VR6D 1XVIA 2GPYA 5DN9A 5D5PA 4IV0A 2OK8A 1Z5OA 3NJ4A 3AEQB 1E2LA 4FI3C 1I4EB 4MQBA 4ZYTA 5C1DA 4LMPA 4KBYA 1YS7A 2IU0A 2Z8YA 1FVHA 4KQWA 5JAPA 4P7FA 4RIHA 3MTAA 4QQNA 2PGNA 2XMGA 2NQTA 3IOEA 3IAAA 4Q39A 5EP3A 2R85A 2O8EB 4O29A 1COWD 1AMNA 2F1HA 5DEOA 3E0XA 3PPYA 1SA5A 3MB5A 2VTBA 3F1LA 3HKEB 3QM1A 3LT4A 1T1EA 2ZAIA 4XJXA 4CYMA 1Z7YA 4X7PA 1P0FA 3T7AA 4MB0A 3QWVA 4UU0A 1JQBA 5BUZA 2Z2YA 1RQNA 1R66A 2QZSA 3OOEA 2Y2UA 3D6FA 4KR2A 2X3YA 1OE0A 5DIFA 5IJ0A 2YJGA 4HO1X 3WL7A 1YDHA 2FSPA 3MAAC 3QI2A 1HS6A 4W9RA 1BN6A 3ABOB 3ETCA 2WKQA 4MGHA 4ARIA 2D8MA 4ADSG 1E2IA 4GGMX 4C88A 4D4JA 3L0PA 1BW9A 3R75A 2VTBB 3GJ8A 2YYZA 2F55A 1ORTA 3AKEA 2H0AA 3GYBA 1T91A 1U9CA 4UHFA 2I2OA 1MGPA 3NHKA 2QX7A 2ZIXA 1Z35A 2QAIA 3F3SA 3PYXA 2FVYA 5IJ0B 3C3BA 2BKGA 2ID8A 2W2NA 5HJEA 1L7VC 3WBJA 1BAPA 4RF3A 3WLOA 2V5UA 3DH0A 2B34A 4G1FA 4HN4B 3DXXA 1S7CA 3U64A 1C7RA 3TRHA 1FS6A 1SBCA 1BW9B 2Y1FA 3BDAA 2LO6A 2H8GA 1X2EA 4FT2A 1MH1A 3A04A 3EXIB 5D66A 1TR4A 1FMFA 3U3MA 4FMDB 3UOAB 4UQLA 4V0LA 1HF8A 5DYIA 4EIWA 3B6EA 2ZIXB 4EG4A 3FRIA 3QKIA 4Y3UA 1RM0A 3OF3A 3H05A 3FHTA 4Q7KA 3MJEA 1ZEMA 1J9ZA 2G1KA 3KB6A 3DYVA 1WTAA 4H7EA 4YLEA 3W3AA 1RT9A 1N77A 4B6PA 4CIWA 4EVRA 3KS9A 3ABLE 2QTNA 5DYYA 3IUJA 1XPJA 1GXSA 2GROB 3AS5A 4U0UA 3JVEA 3Q7PA 3TKAA 1JHAA 5A4FS 3G5LA 3SHQA 4MYTA 4PANA 3Q9UA 3LRPA 1NT2A 5FWNA 3QKRA 1PZGA 3BGIA 4DXAA 3T3PB 1P6XA 1XZJA 3QBDA 4R3WA 3L54A 3CVOA 3AUAA 3QH4A 3PD0A 1QIEA 4A9AA 1NXVA 3OQIA 2ZVJA 3O0DA 5EGNA 4G86A 2AMYA 3FSJX 1QO7A 1TYEB 2ZCVA 3OEWA 3RYFA 2NO6A 3IEPA 4IDDA 4HPXB 4D8TA 3U6KA 1ISMA 5IKXA 2AXVA 4KXUA 1S3SA 1AKWA 3EVGA 2YYAA 3GGPA 4L85A 2BP7A 2H7VA 2AR0A 1GR0A 1T0HB 1GXSB 3K9BA 3LKZA 3OZSA 3KC2A 1M6YA 1UKVY 2XNSA 3VZPA 3QKRB 4HMPA 4RK0A 3HSKA 3I3OA 2DPHA 5FD8A 4P7JA 3KXKA 1ORDA 2HAEA 4EBAG 1SCJA 4GBJA 2V7GA 1XCMA 5T3RA 1SC1A 4MW4A 3NTQA 3OQIB 3H5NA 3K2QA 3ML8A 4LXIA 4HDMA 4M83A 1WMFA 4G0WA 2JIZA 3RYFB 4QBKA 1D2EA 1GZ3A 5KSWB 3DAPA 4NP6A 1CR2A 4B3TB 2WQHA 2OV6A 4MWZA 2EFEB 2BP7B 1X38A 2FMTA 2BBWA 1YA4A 1UDCA 1QGOA 2FN9A 1RFLA 2H3EA 2X14A 3U6BA 3ETLA 2VZLA 3FYCA 4ND7A 3BFXA 2IYXA 2JHGA 2ZSIA 4FFWA 2JJ2D 5BW5A 2HF8A 4LYYA 2OWDA 2RFMA 3B6MA 3IDSA 5DU2A 3JXEA 4RTSA 2H1SA 3AR6A 5CA0A 4KQFA 3AFNA 4HDMB 3KUXA 4AKGA 4AKHA 1RRVA 4LGCA 2REQA 1EFPA 1AK9A 2A5FA 1FK8A 1M75A 1VG1A 1XZMA 2CLHB 4MLZA 1N11A 1LKZA 3S5UA 3QKTA 4W99A 1WW3A 2FPOA 4C08A 3EUEA 3DCJA 3BIFA 3JD3A 1RRKA 3LXXA 3KTAA 4I4IA 1T3ZA 5FJJA 2D62A 4TRJA 1B76A 5HKOA 2LP4Y 5DXJA 5CA0B 1KDYA 1JJFA 1BCRA 3RODA 1PV4A 2Q2WA 3ICWA 3TAXA 2XOEA 3Q0EA 3D9OA 3RLIA 4HYQA 1XDSA 2AJ8A 5TPWA 2REQB 3CLVA 3FAKA 4B46A 1UXIA 3VU0A 3TI9A 4LDPA 1E9SA 5BORA 3ZS8A 5JPDA 2X6RA 4O5AA 1ZL0A 1V9LA 2X5NA 2YS6A 1D0IA 1PL0A 3VO9A 4Z1MA 4OQFA 4RD3A 4BEPA 1GKIA 1EE9A 3EGEA 3SNKA 4R8KA 3BE4A 5CW1A 2C5SA 2ZULA 4IW3B 2JZOA 1FY2A 2J9GA 2O5EA 1CJMA 3D5QA 2IYOA 1KEUA 2Y0DA 3HI6A 5CT4A 2WWRA 4XWWA 4RF2A 2J5KA 1BCRB 2FSIA 1ZOOA 3L6UA 4XI0A 4RTKA 3DUWA 3AVXA 1GQFA 4Z9BA 2CDNA 2JRCA 1ZIXA 3QF4A 1KJIA 2G9QA 3UYLA 3SAJA 5JWOA 3F2IA 2X7HA 2JDID 2LRHA 4W82A 5DNAA 5IH7A 1SCUA 1NR5A 4GX5A 3UJPA 3FDZA 5BSFA 2CT8A 4J43A 2QKYA 5ITVA 2BMEA 4F6LA 2QMOA 5HQTA 1EG2A 4RZIA 5DNDA 4H35A 5LPNA 1U6KA 1LI7A 2PFKA 3QUAA 1J9EA 3I01A 4L4SA 1XP8A 3FTNA 1G8JA 5AJUA 1RRGA 1LF8A 3NUZA 4HN9A 3M3DA 4OL0A 3LYLA 3QF4B 4TZ6A 5BMVA 5TE9A 3D2CA 2AQKA 1FFDA 2JIMA 1SCUB 3FU0A 4F5EA 4V3BA 1I3NA 3FDZB 2VR1A 4KIUA 4ENRA 1PGNA 4NX2A 3WYFA 1W0JA 1R00A 3QKUA 1S2NA 2BMVA 3FFAA 3ICQB 1KEPA 2GEKA 5AUQA 2XVZA 1UZMA 3RM3A 2X9GA 3C3AA 4UEJA 3H84A 1I9GA 3TEMA 4YX9A 4NXMB 2HX1A 2ZB8A 4BNTA 1H9BA 3L7OA 3ZBUA 1LTXA 5REQA 1KAMA 3IDQA 2B2XA 4HOSA 2QT0A 4Y6OA 5BMVB 4NXNB 1IDOA 4YJGA 2Q6OA 4E21A 4JQSA 1CRZA 2H2DA 3T99A 5ALHA 1L4GA 2WIDA 2Q8PA 2BUCA 1MJNA 3EZ9A 3LDAA 2WJIA 2BMFA 3TRDA 2ISQA 1UDXA 2W0MA 1IEXA 1ZQ9A 1P72A 2R48A 5FQNA 4F93B 4UULA 2C54A 4I17A 4QAJA 3UQZA 1GPWB 4NTZA 4Q9AA 2CXNA 4EHHA 4WBNA 1JQLB 2CD7A 1OXKB 5REQB 3I64A 2ZT6A 1GUAA 3T7SA 2FW8A 3KTOA 3NYIA 4J0KA 3UM1A 4FMCF 4YJGB 3PVCA 2D3TA 4PCAA 3SU8A 1W34A 3LVFO 4LMAA 5KWIA 2ZSBA 4B3IA 1NT4A 3VZQA 3L82B 1QMGA 3FVTA 2DY1A 5IM4F 3U66A 1FCJA 5I01A 1E94E 1AHPA 4FLHA 1C8LA 4WBNB 4DXHA 5AQBA 1PJLA 1HFWA 3W5JA 4BO4A 3K9WA 4QOFA 4S1NA 5AXBA 2C03A 4Q4DA 1JKXA 2RI6A 5LSAA 5IW8A 3G5MA 4R7LA 3R0IA 2ZRAA 3WLKX 3W1WA 3OLYA 2OQRA 3HKDB 4J0GA 3PRZA 2AUNA 5I7FA 2Q5LA 4M49A 1O4VA 4WH0A 2NYJA 3ACDA 4U9UA 2H6EA 1ZINA 2YICA 1ORHA 3F5FA 5CVJA 3ZXIA 2PT5A 4AV7A 3JQFA 2ZRBA 3UGKA 4Z9AA 2KWIA 4KGVA 4TLDA 3D9KA 1UOEA 4V39A 2X7XA 3IPAA 2R8YA 4ESHA 4UKDA 3MJVA 3UB3A 4FFSA 2X3FA 3TMAA 1ZONA 3IVRA 4RZSA 1UBJS 1VLLA 3WGJA 1CNFA 1FYEA 2IF4A 2AEFA 1UJKA 5KSYA 3UBTA 2VWPA 2OXFA 3DDCA 3KXLA 2QD5A 4KSYA 1ID8A 4CLOA 3C3RA 2CF6A 5IM4A 2C3YA 1T10A 3DKIA 1SELA 3OFNA 5E76A 1HTTA 2XT0A 3JQBA 3EDQA 3DSXA 4LF8B 4WK2B 5U1PA 4FIDA 1F0KA 2A9FA 3SF8A 4ZVPA 2QZAA 4K3UA 3PBKA 3HDJA 1CK4A 3IMKA 5AN8A 4JZKA 1VP9A 2P6NA 4UUOA 5DCWA 1MUUA 1NSFA 1TCVA 4WX2B 4J49A 1T9BA 1I4WA 4P4UA 2DM6A 3NB0A 5CU7A 4JCCA 4F4JA 4QTZA 3WXXA 4ENTA 4W1PA 4CLOB 1J0XO 4B40A 2W11A 2UDPA 1KRHA 2LUHA 2C2GA 1F0YA 4RTJA 2NAFA 2Y0BG 1JV2B 4OMCA 4Q02A 3JPYA 3IULA 4M1TA 5JARA 4F6RD 4YEDA 1Z37A 4DV4B 1YBMA 3SF8B 3Q6IA 4QHSA 1AOXA 2NWQA 1RI5A 2P0EA 4F9FA 2ERXA 3G0HA 3FPHA 1ZG3A 3MTJA 5C80A 6ADHA 2XKBA 1I4OA 2HDOA 5LLDA 4NCHA 1UJ4A 1TLLA 2DWOA 1D9ZA 2M32A 1EK5A 4L3VA 4BYMA 4YP6A 1UKYA 3NJ8A 3IXQA 4DEVA 1OH6A 1AZTA 1KQFA 1F7VA 3WBFA 1LZLA 3QEAZ 1NFFA 1WVMA 4YP1A 4ATNA 3BBPA 2AMVA 3L8EA 2CBXA 4R9NA 1OUMA 4CJXA 1PZEA 2OD2A 3SXUA 1TE2A 2NM0A 4Q9JA 4L8LA 1JJIA 1PQWA 1TDJA 2WHEA 3GFBA 1A27A 2IUYA 4WI1A 4YHBA 3T5AA 1SBHA 4MKFA 1JFTA 2ZYRA 5K6TA 1HKHA 1PZXA 1YJCA 1ULHA 1ODFA 3WLNA 4H7FA 1XDWA 4RPLA 1Q1NA 2V3CC 5F4ZA 3T8KA 1IZ9A 1SOUA 5KQGA 3CGGA 1YF3A 1ENOA 4Y0VA 5TQJA 3UIEA 5CXXA 4HNTA 2UUPA 1XTVA 4LWOA 4JEHA 4G5QA 1LVHA 3P5SA 3RC9A 2AOWA 2B78A 5I9SA 4AKTA 3LVRE 1FSGA 4ZCPA 3NUQA 3F7MA 3SXUB 2H1CA 4GMHA 1TJFA 3ZK9A 1UBOS 3QV1A 2PMEA 1MX4A 4DQUA 3PV0A 2ZPTX 4ZK6A 3TL6A 4ZVTA 1K5DA 3X44A 3PNYA 4EFMA 3ZJTA 2OPBA 4YWJA 5K3CA 1WCV1 4NZZA 1IZZA 2ZUWA 2DVMA 4G9GA 2D74A 1YU9A 1PLJA 4M22A 4CDMA 2CD9A 4PLWA 3LBIA 3QVKA 3TQOA 1P2BA 3TM5A 3Q3EA 4MVJD 4P6VF 4TKLA 4B6RA 1QANA 4KFUA 2AOUA 4HJRA 2IIBA 2BT4A 5D8DA 3EWNA 3L01A 1BHJA 1U1DA 1KAQA 2FLKA 2BUGA 3UXYA 4JLBA 2PR7A 5MFZA 4PUCA 1Z82A 2YNMA 3OX3A 4UHBA 3WRXC 5B3KA 4UAUA 4FNOA 4I1PA 3OPQA 3KOOA 3DO5A 1WF3A 3L1KA 1PJBA 3Q7EA 1PR4A 3HR7A 4JLMA 1KYTA 3S1LA 2R59A 4KQCA 4Q3BA 1YCFA 2X4GA 3NM6B 4HXYA 2RARA 3ITEA 1U2ZA 4XGQA 3ZV5A 1A9ZA 2VYQA 4G65A 2E4VA 3CF6R 2AOUB 4RVGA 2OV4A 4FINA 2IIVA 4B85A 3DKPA 5AKEA 4I6EA 5F9MA 3CXRA 1QO9A 3DSWA 4IIEA 2PL9A 4P38A 4QUBA 4XASA 3MMZA 1XXHE 4N6NA 5T5QA 2G40A 3BXFA 1P31A 3MPOA 5JADA 4U5XA 4KMSA 3RKVA 1L9KA 5KJNA 4R8VA 2C5AA 5HQ8A 5DMHA 1SIWA 4BC1A 3VJLA 1P4HA 4UMEA 2BIFA 1XRMA 1VIDA 2DBYA 4JP5A 3NOQA 3EZLA 4GA0A 1REQA 3E3MA 3COJA 2IZ6A 2ZSHA 3WKCA 3WK8A 1DIRA 2IYQA 1E9EA 2I76A 4PZEA 4ODIA 3RT1A 3B7GA 4OP1A 2MHCA 2B0OE 3UKJA 2GK4A 3ZHRA 2HREA 4II2A 4TXRA 2KHZA 3C7DB 5C4MA 2QRQA 3EVTA 5HIMA 4DG5A 1ILWA 4B4KA 1T5OA 5ES3A 1WY5A 2E37A 1HA3A 4C1NA 2RGNA 4KNVA 2NXJA 4E30A 3ML1A 1Z6PA 2R00A 2IEIA 4XDZA 1NKVA 2XZDG 5LQSA 5FAKA 1LV7A 1REQB 5SYNA 1QIJA 2NTVA 3KSDO 1NGSA 3KPYA 2XQKA 4ZI2A 3TX6A 4MUXA 2ONDA 2JIBA 5P8WA 2EJUA 2PT9A 3O8RA 1W6RA 5TVKA 4LCTA 4YDWA 4UTPA 3WWZA 1AGPA 2APJA 4Z4FA 4AP6A 4DQVA 7YASA 3ASUA 3R6DA 1YRWA 2ZSFA 3L4EA 4D7AA 1GZ5A 3UZUA 4DUPA 1AUOA 5HM8A 2A9OA 2X6QA 4I46A 1T0JB 1PR0A 2WOOA 3CZAA 2GWRA 1TLFA 2Q5IA 4ML3A 3ESYA 1ZSNA 4HUJA 2B92A 5E8RA 2JFNA 2RJOA 5AOAA 4CIBA 2RGCA 2NU6A 3IIKA 3MCTA 2VDPB 4H1HA 2XVXA 1CJSA 5KOHA 2XH8A 4KGDA 3W2EA 3LQKA 1M0TA 1OF1A 5LQRA 5FUYA 3GN2A 3FCSB 5DOZA 2HC9A 3BDIA 4F7AA 4HDKA 3FVRA 2JAQA 5JDIA 3NAMA 3NDBB 3JASA 1XNHA 3QY9A 4CI0B 3K9CA 3WGIA 3RASA 2NYVA 4GXQA 5CTAA 3EH2A 3BE8A 1X8JA 2NU6B 2EL7A 4Y2TA 3NONA 4PXSA 5KKAA 2FBNA 4FD2A 1NOKA 1BJKA 3OTOB 3OLZA 5KOHB 4J2TA 2LPMA 4KQXA 2QY9A 1N6KA 1RCTE 5CHEE 3W5VA 4GC9A 1YU6A 2WMYA 4F8JA 3PC7A 3MC1A 5LZ9A 5FV7A 3NXSA 5LVAA 3A6EA 4HDKB 3SBSA 1WNFA 1YRHA 1ZD9A 1GPYA 3Q1KA 4A4DA 5IKEA 4LJYA 3I1IA 3RBZA 4L9AA 3JASB 4GTVA 4BIIA 5NLLA 5DPMA 1FUKA 1Y1LA 4L8FA 3IIJA 5B58T 1YR2A 1Y37A 4GOOD 2RB5A 3CTMA 4HAYA 1W9HA 2QLJA 2JA2A 3GZNA 3KXDA 1GN8A 3WE7A 4QGFA 1WCYA 3OQMA 2WFMA 2W2VA 4XR4A 3O82A 1KDTA 1T6NA 4B9AA 3ZU5A 3HB5X 1NSYA 4QODA 9LDTA 4KQKA 2Y9MB 5T6MA 1Z45A 4LJ7A 5F77A 1NVEA 3IEVA 4LK3A 5BNZA 4F12A 1ICEA 5C81A 1YJBA 2Z6VA 1KERA 1KR5A 5CNKA 2GYVA 5FUWA 3GLUA 1EXVA 2V7BA 3ZE1B 3KZVA 1O6GA 2NP6A 3GZNB 4EKDA 1PT8A 5BN5A 4WNFA 1SUIA 3OWOA 3RUAA 4PZDA 4QPJC 1T9CA 1ADFA 4F1KA 3R3ZA 1A2KC 1JDZA 4JBXA 3USZA 3SX4A 2Q5HA 1XBTA 3ANYB 5B30A 3ELWA 1RS0A 1W4RA 1EF1C 3ZE6A 1LRJA 3KYCA 2BKVA 4MVCA 4CLXA 2QVBA 5K6RA 1MEOA 2B37A 2EJWA 5ABPA 3QW4B 2H4HA 3H9JA 3ZPXA 3LL7A 4EGJA 1M0SA 2CG2A 2HN9A 5ALYA 4KIWA 1U1CA 1NPYA 4NARA 3HP4A 1LLFA 1VL6A 2WFLA 1XCBA 2PWZA 2Z0MA 3WB9A 2PRIA 2MRIA 4N8SA 5BN5B 4KFTA 1E1RA 4GRAA 1RJEA 1ZUWA 2IWHA 2I8CA 3A3KA 4KLZA 2XKKA 3C85A 1L1EA 5CMWA 3O8BA 1NNEA 5BW6B 3Q7IA 3FPEA 3KAJA 3KYCB 3X43A 5FUXA 1M2EA 4X91A 2QN3A 4Y2QA 1E0KA 4AF8A 5BPFA 2WFLB 2FV8A 4GTSA 5DHFA 4IEIA 3AL0C 3BMOA 3IHKA 2VL7A 5ENZA 4F86A 4UFOA 2EGGA 4OLAA 2X38A 2UZ4A 2OYCA 3DLCA 1FUIA 3WGMA 1BS1A 6CHYA 3LX4A 1DKOA 1QQEA 3LUHA 3ZZUA 3BF8A 3C4QA 1TA9A 2EP5A 3VC3A 2F8XK 4PZYA 4OKIA 5C31A 4D45A 1BHO1 4JYAB 3BH0A 4EY3A 4LVOA 3OIVA 3GH3A 1PVVA 5BN1A 3U7RA 5A5GA 1FSFA 1TCBA 1VYHA 1WL8A 3AOEA 1A8IA 2AT1A 4QAQA 2BFMA 3QEBZ 2AGVA 4OP2A 3BMOB 4E5KA 3W6ZA 1N2JA 1VJ5A 1XKLA 1AKQA 3HVUA 5DASA 2O3QA 3W5IA 1WB6A 4R0VA 1M5RA 3WKAA 3ASNE 4PLHA 2WSLA 1OT8A 3VPGA 4IZHA 3P9CA 3HUUA 3D8HA 3GOQA 1H2RS 4MP6A 2G7MC 4TL6A 3NBUA 1P62B 1RAHA 3I6IA 5C3MA 4OGFA 4MTCA 5A0FA 2XA2A 3CR3C 4LCEA 1Z3CA 2OCDA 3BWXA 4DNOA 4G4IA 4I36A 3FTXA 1VL8A 1JKJA 2J67A 2X40A 3RU2A 5AK3A 3W9SA 4EG8A 2SCUB 2JABA 5LP6F 4HMQA 3PUWA 1JG6A 1CV2A 1QTIA 1ES9A 2I8AA 3EN0A 2GTHA 4B43A 2ODPA 1EX9A 3WLPA 2QNBA 4YRPA 3RARA 2OFWA 5K0EA 3DB1A 2W2MA 3R74A 1FMLA 2XPIA 4LY6A 3L7JA 4UDOA 3HFGA 4KLRA 4J6IA 3FUCA 1SG6A 2H6FA 3UAWA 3RVBA 2O3TA 3TMYA 4MYCA 4YJKA 5HI7A 3RJZA 1F4PA 4UXJA 1JKJB 4YMLA 3L02A 3TXYA 5F21A 3NRCA 4EJMA 4AVXA 1QO0D 2CDRA 2X1MA 5A0TA 2UYOA 2Z8XA 5FQOA 1KZPA 1I36A 4QNMA 4A0RA 3HB1A 3CISA 4XCVA 3SIRA 5CCXA 2DMRA 2VGYA 3W3AH 1GYQA 4JLWA 1LDBA 4PCVA 4PF1A 4WBSA 4DM3A 1HNXB 4O1PA 3PFCA 2NXPA 3O4VA 2YFQA 1JTVA 1Z26A 2C0QA 4N5LA 4PQRA 1I0IA 3J81k 1ZM4A 1BSVA 5CJJA 4J29A 3WYAA 1SWVA 2FI7A 1ZISA 5LLTA 4PSDA 3OU6A 4DVJA 1MX9A 2PA3A 3H11A 1GNSA 3TCXB 1U3FA 2GN8A 3RJ5A 1JIQA 3B3AA 4KPFC 2NNLD 3MILA 3OZAA 2HT1A 4QPZA 5HFAA 3TLMA 3NYQA 3R9IA 1RI3A 3H2KA 2ZTSA 3FIUA 3TLKA 3ZJUA 3BB3A 5D6OA 2NQ2C 1USUA 1FZTA 2QGZA 4X84A 3B9RA 5AK6A 1SZCA 2A0FA 3B12A 4KB5A 2P2DA 5FKJA 3H11B 1NI3A 3VO8A 1PG5A 4QL3A 2V8SE 1Y7IA 1QQBA 5K20A 3GDOA 4CLRA 3K15A 4D92A 1BQ3A 3WG9A 1NLZA 4U7EB 2B4RO 2H59A 2NZWA 1WETA 1N2IA 1T9HA 3S28A 4OH1A 3NRBA 3SIPA 4C0EA 2GFIA 2C2MA 4BO2A 1HLDA 5KHOC 2QM8A 5JAHA 5BNFA 1W19A 5HE9A 4DR2B 2XVMA 3FWVA 5ALRA 1XTBA 4YNBA 3SYKA 1J0DA 2HKIA 3EBPA 2IZ7A 3A1NA 3EYWA 3JRWA 1A71A 3ESLA 1DXQA 3LQRA 5JEDA 2G1PA 4CLRB 4TS1A 3NFRA 2ONCA 1S3FA 1RW2A 4GXRA 1TT7A 2PS1A 2UYQA 4CTNA 2RD0A 1IOLA 3FUKA 1PLKA 3SIXA 4YAIA 1J07A 2E1PA 1C8KA 2RH8A 4XVRA 3VH2A 1JQJC 4Q37A 4ZZ3A 3RJ9A 1XPUA 1P7ZA 3Q5MA 3S6JA 2HMTA 5LU8A 2CHZA 1VSBA 4LHXA 1SCKA 4Q9DA 4Z9YA 4CMIA 2XI4A 2IL1A 4YAUA 1UH5A 3WGOA 5FI5A 3TIGA 2PMCA 4L5BA 2K7FA 1EBFA 5FOUA 1QG6A 4BTLA 4MR7A 4QFBA 4GG1A 2H5EA 1BA3A 1CLEA 4AN0A 1XHEA 2L18A 4G0ZA 3EGCA 4L50A 1Z47A 5CLLA 3ODPA 1XJWA 2ZAGA 3EVZA 4DB2A 4QQFA 2Q49A 4M0MA 3JQPA 2VNAA 3PJFA 5F98A 4PPFA 5ESRA 1SVKA