2VSSA

Wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl- coa and vanillin
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
246
structure length
238
Chain Sequence
YEGRWKTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLAGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKLDQSRLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Ternary Complex of Hydroxycinnamoyl-Coa Hydratase-Lyase (Hchl) with Acetyl-Coa and Vanillin Gives Insights Into Substrate Specificity and Mechanism.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
total genus 89
structure length 238
sequence length 246
chains with identical sequence B, C, D
ec nomenclature ec 4.1.2.41: Vanillin synthase.
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2vssA01
4JVTA 2J5IA 3K8XA 3U9TB 5INFA 5KDRA 2VSSE 2DEOA 2NP9A 4FB8A 5DU6A 1RJNA 3ST9A 5KJPA 3OT6A 4EMMA 1W2XA 2FBMA 5DZKH 3OC7A 1ON3A 2F6QA 4ZDDA 1NZYB 3KTHA 2ZL0A 3H81A 3Q0JA 4RYFH 4Q1IA 4NNQA 3P85A 4KNPA 3QXIA 5G1QA 4QIJA 4ZDEA 4U0HA 2J5SA 3R0OA 3OMEA 3TV5A 1O8UA 1VRGA 3PZKA 5JBXA 1OD2A 4GHNA 4RCNA 1XNYA 3R6HA 1SG4A 3IAVA 3M6NA 4WYOB 1UYVA 3ZW9A 3ZWBA 3PGQA 4LK5A 3HINA 5G1RA 1OD4A 2J5II 3QK8A 5DKPA 4G2RA 3HE2A 2ZQQA 3MFMA 4WCZA 1Y7OA 1PJHA 4QIIA 4ZDCA 3HP0A 2F6IA 2VSUC 4K29A 4ELSA 3R9SA 2F9YA 1FCFA 3GLMA 4JYLA 1MJ3A 3T3WA 2FZSA 4JSBA 1FC7A 1UIYA 3GKBA 3TLFA 4I52A 2VSUE 2BZRA 1XX4A 1PIXA 3H0JA 5FIFA 1N6EA 4OG1A 3GF7A 2PBPA 3BEZA 1XO6A 5CTCA 3T8BA 3I47A 2CE3A 1EY3A 4ELXA 3HRXA 2A7KA 3H02A 4ZU2A 3ISAA 1EF9A 2FW2A 4JWVA 5E0SH 2QQ3A 4FZWA 1WZ8A 4JJTA 3PE8A 4Z0MA 3VIVA 3LAOA 3QMJA 2WTBA 2PG8A 3PEAA 3QYRA 4YLHA 5IKLB 3KTKA 4RYFA 3N6RB 3L3SA 4U1AA 5G1SA 5DU8A 3P5MA 3P2LA 3SWXA 4DI1A 3KTJA 3FF6A 4KWBA 1RJMA 2F9IB 2J5GA 3RSTA 5DL1A 2F9IA 5DZKA 1SZOA 4FNDA 4U19A 3GMAA 4I42A 3SLLA 2CBYA 3Q1TA 3KTIA 3TVWA 4U18A 3ZWAA 1HNUA 2F9YB 2X58A 1HNOA 1UYTA 4FN7A 2X24A 3KQFA 3MT6A 3T89A 5E0SA 4ASIA 3TDCA 3TVUA 2GTRA 4K3WA 2EJ5A 1EF8A 5INGA 3Q7HA 3TT6A 4GM2A 5JBWA 1FC9A 3RSIA 4IZDA 3T8AA 5MGBA 1XNVA 3LKEA 1YG8A 5C90A 2C8TA 1WDLA 3R9QA 4IZCA 4K2NA 4EMPA 2J5GD 3G64A 5DTWA 5KDRB 4HNKA 2PPYA 1DUBA 3Q0GA 5DUCA 4FNBA 3NJBA 3U9RB 2ZQRA 1N6FA 3GF3A 3WG5A 1Q51A 1FC6A 1K39A 1UYSA 2D3TA 4ZDBA 3JU1A 2VSUA 3K50A 1K32A 1DCIA 2ZL4A 1XNWA 2VREA 4HC8A 3T88A 4U0GH 4L8KA 2VX2A 2ZL3A 3V5IA 1N6DA 5FUSA 2VSUF 3IBBA 3ZWCA 4MI2A 3TZ3A 3TT7A 2VSSF 3ZW8A 5CTBA 4JFCA 4KD6A 4JCTA 3BF0A 3H0UA 5DTPA 4FJWD 1ON9A 3TRRA 3QKAA 4JOTA 4MXIA 5INIA 4JYJA 4NEKA 3H0QA 4Q0GA 2Q2XA 1X0UA 4WZ8B 4FN8A 4OLQA 3H0SA 1WDMA 2ZL2A 1YG6A 2VSSA 3V5EA 2A81A 3MYBA 3NJDA 3HLN1 5C9GA 5DU4A 1HZDA 2Q35A 2IEXA 3RRVA 1J7XA 3QWDA 4IZBA 4ELWA 4FZWC 5E0NX 3MOYA 3KTGA 4L6WA 4F47A 2J5IB 4JCSA 3DJAA 4U0GA 2Q34A 1TYFA 4QFEA 4EMLA 4ZDFA 3U9SB 4JCQA 4KPKA 4JCRA 1NZYA 1UYRA 3IB9A 4I4ZA 2DUBA 2UZFA 2HW5A 4OMRA 4B3JA 1Q52A 4B3IA 3R9TA 4MOUA 4B3HA 1JXZA 3DORA 3STAA 5DUFA 1WDKA 3FDUA 2W3PA 3M6MA 2A7SA 1TG6A 3BPPA 3QXZA 3QREA
chains in the Genus database with same CATH superfamily
4JVTA 2J5IA 3K8XA 3U9TB 5INFA 5KDRA 2VSSE 2DEOA 2NP9A 4FB8A 5DU6A 1RJNA 3ST9A 5KJPA 3OT6A 4EMMA 1W2XA 2FBMA 5DZKH 3OC7A 1ON3A 2F6QA 4ZDDA 1NZYB 3KTHA 2ZL0A 3H81A 3Q0JA 4RYFH 4Q1IA 4NNQA 3P85A 4KNPA 3QXIA 5G1QA 4QIJA 4ZDEA 4U0HA 2J5SA 3R0OA 3OMEA 3TV5A 1O8UA 1VRGA 3PZKA 5JBXA 1OD2A 4GHNA 4RCNA 1XNYA 3R6HA 1SG4A 3IAVA 3M6NA 4WYOB 1UYVA 3ZW9A 3ZWBA 3PGQA 4LK5A 3HINA 5G1RA 1OD4A 2J5II 4J2UA 3QK8A 5DKPA 4G2RA 3HE2A 2ZQQA 3MFMA 4WCZA 1Y7OA 1PJHA 4QIIA 4ZDCA 3HP0A 2F6IA 2VSUC 4K29A 4ELSA 3R9SA 2F9YA 1FCFA 3GLMA 4JYLA 1MJ3A 3T3WA 2FZSA 4JSBA 1FC7A 1UIYA 3GKBA 3TLFA 4I52A 2VSUE 2BZRA 1XX4A 1PIXA 3H0JA 5FIFA 1N6EA 4OG1A 3GF7A 2PBPA 3BEZA 1XO6A 5CTCA 3T8BA 3I47A 2CE3A 1EY3A 4ELXA 3HRXA 2A7KA 3H02A 4ZU2A 3ISAA 1EF9A 2FW2A 4JWVA 5E0SH 2QQ3A 4FZWA 1WZ8A 4JJTA 3PE8A 4Z0MA 3VIVA 3LAOA 3QMJA 2WTBA 2PG8A 3PEAA 3QYRA 4YLHA 5IKLB 3KTKA 4RYFA 3N6RB 3L3SA 4U1AA 5G1SA 5DU8A 3P5MA 3P2LA 3SWXA 4DI1A 3KTJA 3FF6A 4KWBA 1RJMA 2F9IB 2J5GA 3RSTA 5DL1A 2F9IA 5DZKA 1SZOA 4FNDA 4NARA 4U19A 3GMAA 4I42A 3SLLA 2CBYA 3Q1TA 3KTIA 3TVWA 4U18A 3ZWAA 1HNUA 2F9YB 2X58A 1HNOA 1UYTA 4FN7A 2X24A 3KQFA 3MT6A 3T89A 5E0SA 4ASIA 3TDCA 3TVUA 2GTRA 2YJGA 4K3WA 2EJ5A 1EF8A 5INGA 3Q7HA 3TT6A 4GM2A 5JBWA 1FC9A 3RSIA 4IZDA 3T8AA 5MGBA 1XNVA 3LKEA 1YG8A 5C90A 2C8TA 1WDLA 3R9QA 4IZCA 4K2NA 4EMPA 2J5GD 3G64A 5DTWA 5KDRB 4HNKA 2PPYA 1DUBA 3Q0GA 5DUCA 4FNBA 3NJBA 3U9RB 2ZQRA 1N6FA 3GF3A 3WG5A 1Q51A 1FC6A 1K39A 1UYSA 2D3TA 4ZDBA 3JU1A 2VSUA 3K50A 1K32A 1DCIA 2ZL4A 1XNWA 2VREA 4HC8A 3T88A 4U0GH 4L8KA 2VX2A 2ZL3A 3V5IA 1N6DA 5FUSA 2VSUF 3BPTA 3IBBA 3ZWCA 4MI2A 3TZ3A 3TT7A 2VSSF 3ZW8A 5CTBA 4JFCA 4KD6A 4JCTA 3BF0A 3H0UA 5DTPA 4FJWD 1ON9A 3TRRA 3QKAA 4JOTA 4MXIA 5INIA 4JYJA 4NEKA 3H0QA 4Q0GA 2Q2XA 1X0UA 4WZ8B 4FN8A 4OLQA 3H0SA 1WDMA 2ZL2A 1YG6A 2VSSA 3V5EA 2A81A 3MYBA 3NJDA 3HLN1 5C9GA 5DU4A 1HZDA 2Q35A 2IEXA 3RRVA 1J7XA 3QWDA 4HDTA 4IZBA 4ELWA 4FZWC 5E0NX 3MOYA 3KTGA 4L6WA 4F47A 2J5IB 4JCSA 3DJAA 4U0GA 2Q34A 1TYFA 4QFEA 4EMLA 5HUQA 4ZDFA 3U9SB 4JCQA 4KPKA 4JCRA 1NZYA 1UYRA 3IB9A 4I4ZA 2DUBA 2UZFA 2HW5A 4OMRA 4B3JA 1Q52A 4B3IA 3R9TA 4MOUA 4B3HA 1JXZA 3DORA 3STAA 5DUFA 1WDKA 3FDUA 2W3PA 3M6MA 2A7SA 1TG6A 3BPPA 3QXZA 3QREA
chains in the Genus database with same CATH topology
4JVTA 2J5IA 3K8XA 3U9TB 5INFA 5KDRA 2VSSE 2DEOA 2NP9A 4FB8A 5DU6A 1RJNA 3ST9A 5KJPA 3OT6A 4EMMA 1W2XA 2FBMA 5DZKH 3OC7A 1ON3A 2F6QA 4ZDDA 1NZYB 3KTHA 2ZL0A 3H81A 3Q0JA 4RYFH 4Q1IA 4NNQA 3P85A 4KNPA 3QXIA 5G1QA 4QIJA 4ZDEA 4U0HA 2J5SA 3R0OA 3OMEA 3TV5A 1O8UA 1VRGA 3PZKA 5JBXA 1OD2A 4GHNA 4RCNA 1XNYA 3R6HA 1SG4A 3IAVA 3M6NA 4WYOB 1UYVA 3ZW9A 3ZWBA 3PGQA 4LK5A 3HINA 5G1RA 1OD4A 2J5II 4J2UA 3QK8A 5DKPA 4G2RA 3HE2A 2ZQQA 3MFMA 4WCZA 1Y7OA 1PJHA 4QIIA 4ZDCA 3HP0A 2F6IA 2VSUC 4K29A 4ELSA 3R9SA 2F9YA 1FCFA 3GLMA 4JYLA 1MJ3A 3T3WA 2FZSA 4JSBA 1FC7A 1UIYA 3GKBA 3TLFA 4I52A 2VSUE 2BZRA 1XX4A 1PIXA 3H0JA 5FIFA 1N6EA 4OG1A 3GF7A 2PBPA 3BEZA 1XO6A 5CTCA 3T8BA 3I47A 2CE3A 1EY3A 4ELXA 3HRXA 2A7KA 3H02A 4ZU2A 3ISAA 1EF9A 2FW2A 4JWVA 5E0SH 2QQ3A 4FZWA 1WZ8A 4JJTA 3PE8A 4Z0MA 3VIVA 3LAOA 3QMJA 2WTBA 2PG8A 3PEAA 3QYRA 4YLHA 5IKLB 3KTKA 4RYFA 3N6RB 3L3SA 4U1AA 5G1SA 5DU8A 3P5MA 3P2LA 3SWXA 4DI1A 3KTJA 3FF6A 4KWBA 1RJMA 2F9IB 2J5GA 3RSTA 5DL1A 2F9IA 5DZKA 1SZOA 4FNDA 4NARA 4U19A 3GMAA 4I42A 3SLLA 2CBYA 3Q1TA 3KTIA 3TVWA 4U18A 3ZWAA 1HNUA 2F9YB 2X58A 1HNOA 1UYTA 4FN7A 2X24A 3KQFA 3MT6A 3T89A 5E0SA 4ASIA 3TDCA 3TVUA 2GTRA 2YJGA 4K3WA 2EJ5A 1EF8A 5INGA 3Q7HA 3TT6A 4GM2A 5JBWA 1FC9A 3RSIA 4IZDA 3T8AA 5MGBA 1XNVA 3LKEA 1YG8A 5C90A 2C8TA 1WDLA 3R9QA 4IZCA 4K2NA 4EMPA 2J5GD 3G64A 5DTWA 5KDRB 4HNKA 2PPYA 1DUBA 3Q0GA 5DUCA 4FNBA 3NJBA 3U9RB 2ZQRA 1N6FA 3GF3A 3WG5A 1Q51A 1FC6A 1K39A 1UYSA 2D3TA 4ZDBA 3JU1A 2VSUA 3K50A 1K32A 1DCIA 2ZL4A 1XNWA 2VREA 4HC8A 3T88A 4U0GH 4L8KA 2VX2A 2ZL3A 3V5IA 1N6DA 5FUSA 2VSUF 3BPTA 3IBBA 3ZWCA 4MI2A 3TZ3A 3TT7A 2VSSF 3ZW8A 5CTBA 4JFCA 4KD6A 4JCTA 3BF0A 3H0UA 5DTPA 4FJWD 1ON9A 3TRRA 3QKAA 4JOTA 4MXIA 5INIA 4JYJA 4NEKA 3H0QA 4Q0GA 2Q2XA 1X0UA 4WZ8B 4FN8A 4OLQA 3H0SA 1WDMA 2ZL2A 1YG6A 2VSSA 3V5EA 2A81A 3MYBA 3NJDA 3HLN1 5C9GA 5DU4A 1HZDA 2Q35A 2IEXA 3RRVA 1J7XA 3QWDA 4HDTA 4IZBA 4ELWA 4FZWC 5E0NX 3MOYA 3KTGA 4L6WA 4F47A 2J5IB 4JCSA 3DJAA 4U0GA 2Q34A 1TYFA 4QFEA 4EMLA 5HUQA 4ZDFA 3U9SB 4JCQA 4KPKA 4JCRA 1NZYA 1UYRA 3IB9A 4I4ZA 2DUBA 2UZFA 2HW5A 4OMRA 4B3JA 1Q52A 4B3IA 3R9TA 4MOUA 4B3HA 1JXZA 3DORA 3STAA 5DUFA 1WDKA 3FDUA 2W3PA 3M6MA 2A7SA 1TG6A 3BPPA 3QXZA 3QREA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JVT A;  2J5I A;  3K8X A;  3U9T B;  5INF A;  5KDR A;  2VSS E;  2DEO A;  2NP9 A;  4FB8 A;  5DU6 A;  1RJN A;  3ST9 A;  5KJP A;  3OT6 A;  4EMM A;  1W2X A;  2FBM A;  5DZK H;  3OC7 A;  1ON3 A;  2F6Q A;  4ZDD A;  1NZY B;  3KTH A;  2ZL0 A;  3H81 A;  3Q0J A;  4RYF H;  4Q1I A;  4NNQ A;  3P85 A;  4KNP A;  3QXI A;  5G1Q A;  4QIJ A;  4ZDE A;  4U0H A;  2J5S A;  3R0O A;  3OME A;  3TV5 A;  1O8U A;  1VRG A;  3PZK A;  5JBX A;  1OD2 A;  4GHN A;  4RCN A;  1XNY A;  3R6H A;  1SG4 A;  3IAV A;  3M6N A;  4WYO B;  1UYV A;  3ZW9 A;  3ZWB A;  3PGQ A;  4LK5 A;  3HIN A;  5G1R A;  1OD4 A;  2J5I I;  3QK8 A;  5DKP A;  4G2R A;  3HE2 A;  2ZQQ A;  3MFM A;  4WCZ A;  1Y7O A;  1PJH A;  4QII A;  4ZDC A;  3HP0 A;  2F6I A;  2VSU C;  4K29 A;  4ELS A;  3R9S A;  2F9Y A;  1FCF A;  3GLM A;  4JYL A;  1MJ3 A;  3T3W A;  2FZS A;  4JSB A;  1FC7 A;  1UIY A;  3GKB A;  3TLF A;  4I52 A;  2VSU E;  2BZR A;  1XX4 A;  1PIX A;  3H0J A;  5FIF A;  1N6E A;  4OG1 A;  3GF7 A;  2PBP A;  3BEZ A;  1XO6 A;  5CTC A;  3T8B A;  3I47 A;  2CE3 A;  1EY3 A;  4ELX A;  3HRX A;  2A7K A;  3H02 A;  4ZU2 A;  3ISA A;  1EF9 A;  2FW2 A;  4JWV A;  5E0S H;  2QQ3 A;  4FZW A;  1WZ8 A;  4JJT A;  3PE8 A;  4Z0M A;  3VIV A;  3LAO A;  3QMJ A;  2WTB A;  2PG8 A;  3PEA A;  3QYR A;  4YLH A;  5IKL B;  3KTK A;  4RYF A;  3N6R B;  3L3S A;  4U1A A;  5G1S A;  5DU8 A;  3P5M A;  3P2L A;  3SWX A;  4DI1 A;  3KTJ A;  3FF6 A;  4KWB A;  1RJM A;  2F9I B;  2J5G A;  3RST A;  5DL1 A;  2F9I A;  5DZK A;  1SZO A;  4FND A;  4U19 A;  3GMA A;  4I42 A;  3SLL A;  2CBY A;  3Q1T A;  3KTI A;  3TVW A;  4U18 A;  3ZWA A;  1HNU A;  2F9Y B;  2X58 A;  1HNO A;  1UYT A;  4FN7 A;  2X24 A;  3KQF A;  3MT6 A;  3T89 A;  5E0S A;  4ASI A;  3TDC A;  3TVU A;  2GTR A;  4K3W A;  2EJ5 A;  1EF8 A;  5ING A;  3Q7H A;  3TT6 A;  4GM2 A;  5JBW A;  1FC9 A;  3RSI A;  4IZD A;  3T8A A;  5MGB A;  1XNV A;  3LKE A;  1YG8 A;  5C90 A;  2C8T A;  1WDL A;  3R9Q A;  4IZC A;  4K2N A;  4EMP A;  2J5G D;  3G64 A;  5DTW A;  5KDR B;  4HNK A;  2PPY A;  1DUB A;  3Q0G A;  5DUC A;  4FNB A;  3NJB A;  3U9R B;  2ZQR A;  1N6F A;  3GF3 A;  3WG5 A;  1Q51 A;  1FC6 A;  1K39 A;  1UYS A;  2D3T A;  4ZDB A;  3JU1 A;  2VSU A;  3K50 A;  1K32 A;  1DCI A;  2ZL4 A;  1XNW A;  2VRE A;  4HC8 A;  3T88 A;  4U0G H;  4L8K A;  2VX2 A;  2ZL3 A;  3V5I A;  1N6D A;  5FUS A;  2VSU F;  3IBB A;  3ZWC A;  4MI2 A;  3TZ3 A;  3TT7 A;  2VSS F;  3ZW8 A;  5CTB A;  4JFC A;  4KD6 A;  4JCT A;  3BF0 A;  3H0U A;  5DTP A;  4FJW D;  1ON9 A;  3TRR A;  3QKA A;  4JOT A;  4MXI A;  5INI A;  4JYJ A;  4NEK A;  3H0Q A;  4Q0G A;  2Q2X A;  1X0U A;  4WZ8 B;  4FN8 A;  4OLQ A;  3H0S A;  1WDM A;  2ZL2 A;  1YG6 A;  2VSS A;  3V5E A;  2A81 A;  3MYB A;  3NJD A;  3HLN 1;  5C9G A;  5DU4 A;  1HZD A;  2Q35 A;  2IEX A;  3RRV A;  1J7X A;  3QWD A;  4IZB A;  4ELW A;  4FZW C;  5E0N X;  3MOY A;  3KTG A;  4L6W A;  4F47 A;  2J5I B;  4JCS A;  3DJA A;  4U0G A;  2Q34 A;  1TYF A;  4QFE A;  4EML A;  4ZDF A;  3U9S B;  4JCQ A;  4KPK A;  4JCR A;  1NZY A;  1UYR A;  3IB9 A;  4I4Z A;  2DUB A;  2UZF A;  2HW5 A;  4OMR A;  4B3J A;  1Q52 A;  4B3I A;  3R9T A;  4MOU A;  4B3H A;  1JXZ A;  3DOR A;  3STA A;  5DUF A;  1WDK A;  3FDU A;  2W3P A;  3M6M A;  2A7S A;  1TG6 A;  3BPP A;  3QXZ A;  3QRE A; 
#chains in the Genus database with same CATH topology
 4JVT A;  2J5I A;  3K8X A;  3U9T B;  5INF A;  5KDR A;  2VSS E;  2DEO A;  2NP9 A;  4FB8 A;  5DU6 A;  1RJN A;  3ST9 A;  5KJP A;  3OT6 A;  4EMM A;  1W2X A;  2FBM A;  5DZK H;  3OC7 A;  1ON3 A;  2F6Q A;  4ZDD A;  1NZY B;  3KTH A;  2ZL0 A;  3H81 A;  3Q0J A;  4RYF H;  4Q1I A;  4NNQ A;  3P85 A;  4KNP A;  3QXI A;  5G1Q A;  4QIJ A;  4ZDE A;  4U0H A;  2J5S A;  3R0O A;  3OME A;  3TV5 A;  1O8U A;  1VRG A;  3PZK A;  5JBX A;  1OD2 A;  4GHN A;  4RCN A;  1XNY A;  3R6H A;  1SG4 A;  3IAV A;  3M6N A;  4WYO B;  1UYV A;  3ZW9 A;  3ZWB A;  3PGQ A;  4LK5 A;  3HIN A;  5G1R A;  1OD4 A;  2J5I I;  4J2U A;  3QK8 A;  5DKP A;  4G2R A;  3HE2 A;  2ZQQ A;  3MFM A;  4WCZ A;  1Y7O A;  1PJH A;  4QII A;  4ZDC A;  3HP0 A;  2F6I A;  2VSU C;  4K29 A;  4ELS A;  3R9S A;  2F9Y A;  1FCF A;  3GLM A;  4JYL A;  1MJ3 A;  3T3W A;  2FZS A;  4JSB A;  1FC7 A;  1UIY A;  3GKB A;  3TLF A;  4I52 A;  2VSU E;  2BZR A;  1XX4 A;  1PIX A;  3H0J A;  5FIF A;  1N6E A;  4OG1 A;  3GF7 A;  2PBP A;  3BEZ A;  1XO6 A;  5CTC A;  3T8B A;  3I47 A;  2CE3 A;  1EY3 A;  4ELX A;  3HRX A;  2A7K A;  3H02 A;  4ZU2 A;  3ISA A;  1EF9 A;  2FW2 A;  4JWV A;  5E0S H;  2QQ3 A;  4FZW A;  1WZ8 A;  4JJT A;  3PE8 A;  4Z0M A;  3VIV A;  3LAO A;  3QMJ A;  2WTB A;  2PG8 A;  3PEA A;  3QYR A;  4YLH A;  5IKL B;  3KTK A;  4RYF A;  3N6R B;  3L3S A;  4U1A A;  5G1S A;  5DU8 A;  3P5M A;  3P2L A;  3SWX A;  4DI1 A;  3KTJ A;  3FF6 A;  4KWB A;  1RJM A;  2F9I B;  2J5G A;  3RST A;  5DL1 A;  2F9I A;  5DZK A;  1SZO A;  4FND A;  4NAR A;  4U19 A;  3GMA A;  4I42 A;  3SLL A;  2CBY A;  3Q1T A;  3KTI A;  3TVW A;  4U18 A;  3ZWA A;  1HNU A;  2F9Y B;  2X58 A;  1HNO A;  1UYT A;  4FN7 A;  2X24 A;  3KQF A;  3MT6 A;  3T89 A;  5E0S A;  4ASI A;  3TDC A;  3TVU A;  2GTR A;  2YJG A;  4K3W A;  2EJ5 A;  1EF8 A;  5ING A;  3Q7H A;  3TT6 A;  4GM2 A;  5JBW A;  1FC9 A;  3RSI A;  4IZD A;  3T8A A;  5MGB A;  1XNV A;  3LKE A;  1YG8 A;  5C90 A;  2C8T A;  1WDL A;  3R9Q A;  4IZC A;  4K2N A;  4EMP A;  2J5G D;  3G64 A;  5DTW A;  5KDR B;  4HNK A;  2PPY A;  1DUB A;  3Q0G A;  5DUC A;  4FNB A;  3NJB A;  3U9R B;  2ZQR A;  1N6F A;  3GF3 A;  3WG5 A;  1Q51 A;  1FC6 A;  1K39 A;  1UYS A;  2D3T A;  4ZDB A;  3JU1 A;  2VSU A;  3K50 A;  1K32 A;  1DCI A;  2ZL4 A;  1XNW A;  2VRE A;  4HC8 A;  3T88 A;  4U0G H;  4L8K A;  2VX2 A;  2ZL3 A;  3V5I A;  1N6D A;  5FUS A;  2VSU F;  3BPT A;  3IBB A;  3ZWC A;  4MI2 A;  3TZ3 A;  3TT7 A;  2VSS F;  3ZW8 A;  5CTB A;  4JFC A;  4KD6 A;  4JCT A;  3BF0 A;  3H0U A;  5DTP A;  4FJW D;  1ON9 A;  3TRR A;  3QKA A;  4JOT A;  4MXI A;  5INI A;  4JYJ A;  4NEK A;  3H0Q A;  4Q0G A;  2Q2X A;  1X0U A;  4WZ8 B;  4FN8 A;  4OLQ A;  3H0S A;  1WDM A;  2ZL2 A;  1YG6 A;  2VSS A;  3V5E A;  2A81 A;  3MYB A;  3NJD A;  3HLN 1;  5C9G A;  5DU4 A;  1HZD A;  2Q35 A;  2IEX A;  3RRV A;  1J7X A;  3QWD A;  4HDT A;  4IZB A;  4ELW A;  4FZW C;  5E0N X;  3MOY A;  3KTG A;  4L6W A;  4F47 A;  2J5I B;  4JCS A;  3DJA A;  4U0G A;  2Q34 A;  1TYF A;  4QFE A;  4EML A;  5HUQ A;  4ZDF A;  3U9S B;  4JCQ A;  4KPK A;  4JCR A;  1NZY A;  1UYR A;  3IB9 A;  4I4Z A;  2DUB A;  2UZF A;  2HW5 A;  4OMR A;  4B3J A;  1Q52 A;  4B3I A;  3R9T A;  4MOU A;  4B3H A;  1JXZ A;  3DOR A;  3STA A;  5DUF A;  1WDK A;  3FDU A;  2W3P A;  3M6M A;  2A7S A;  1TG6 A;  3BPP A;  3QXZ A;  3QRE A; 
#chains in the Genus database with same CATH homology
 4JVT A;  2J5I A;  3K8X A;  3U9T B;  5INF A;  5KDR A;  2VSS E;  2DEO A;  2NP9 A;  4FB8 A;  5DU6 A;  1RJN A;  3ST9 A;  5KJP A;  3OT6 A;  4EMM A;  1W2X A;  2FBM A;  5DZK H;  3OC7 A;  1ON3 A;  2F6Q A;  4ZDD A;  1NZY B;  3KTH A;  2ZL0 A;  3H81 A;  3Q0J A;  4RYF H;  4Q1I A;  4NNQ A;  3P85 A;  4KNP A;  3QXI A;  5G1Q A;  4QIJ A;  4ZDE A;  4U0H A;  2J5S A;  3R0O A;  3OME A;  3TV5 A;  1O8U A;  1VRG A;  3PZK A;  5JBX A;  1OD2 A;  4GHN A;  4RCN A;  1XNY A;  3R6H A;  1SG4 A;  3IAV A;  3M6N A;  4WYO B;  1UYV A;  3ZW9 A;  3ZWB A;  3PGQ A;  4LK5 A;  3HIN A;  5G1R A;  1OD4 A;  2J5I I;  4J2U A;  3QK8 A;  5DKP A;  4G2R A;  3HE2 A;  2ZQQ A;  3MFM A;  4WCZ A;  1Y7O A;  1PJH A;  4QII A;  4ZDC A;  3HP0 A;  2F6I A;  2VSU C;  4K29 A;  4ELS A;  3R9S A;  2F9Y A;  1FCF A;  3GLM A;  4JYL A;  1MJ3 A;  3T3W A;  2FZS A;  4JSB A;  1FC7 A;  1UIY A;  3GKB A;  3TLF A;  4I52 A;  2VSU E;  2BZR A;  1XX4 A;  1PIX A;  3H0J A;  5FIF A;  1N6E A;  4OG1 A;  3GF7 A;  2PBP A;  3BEZ A;  1XO6 A;  5CTC A;  3T8B A;  3I47 A;  2CE3 A;  1EY3 A;  4ELX A;  3HRX A;  2A7K A;  3H02 A;  4ZU2 A;  3ISA A;  1EF9 A;  2FW2 A;  4JWV A;  5E0S H;  2QQ3 A;  4FZW A;  1WZ8 A;  4JJT A;  3PE8 A;  4Z0M A;  3VIV A;  3LAO A;  3QMJ A;  2WTB A;  2PG8 A;  3PEA A;  3QYR A;  4YLH A;  5IKL B;  3KTK A;  4RYF A;  3N6R B;  3L3S A;  4U1A A;  5G1S A;  5DU8 A;  3P5M A;  3P2L A;  3SWX A;  4DI1 A;  3KTJ A;  3FF6 A;  4KWB A;  1RJM A;  2F9I B;  2J5G A;  3RST A;  5DL1 A;  2F9I A;  5DZK A;  1SZO A;  4FND A;  4NAR A;  4U19 A;  3GMA A;  4I42 A;  3SLL A;  2CBY A;  3Q1T A;  3KTI A;  3TVW A;  4U18 A;  3ZWA A;  1HNU A;  2F9Y B;  2X58 A;  1HNO A;  1UYT A;  4FN7 A;  2X24 A;  3KQF A;  3MT6 A;  3T89 A;  5E0S A;  4ASI A;  3TDC A;  3TVU A;  2GTR A;  2YJG A;  4K3W A;  2EJ5 A;  1EF8 A;  5ING A;  3Q7H A;  3TT6 A;  4GM2 A;  5JBW A;  1FC9 A;  3RSI A;  4IZD A;  3T8A A;  5MGB A;  1XNV A;  3LKE A;  1YG8 A;  5C90 A;  2C8T A;  1WDL A;  3R9Q A;  4IZC A;  4K2N A;  4EMP A;  2J5G D;  3G64 A;  5DTW A;  5KDR B;  4HNK A;  2PPY A;  1DUB A;  3Q0G A;  5DUC A;  4FNB A;  3NJB A;  3U9R B;  2ZQR A;  1N6F A;  3GF3 A;  3WG5 A;  1Q51 A;  1FC6 A;  1K39 A;  1UYS A;  2D3T A;  4ZDB A;  3JU1 A;  2VSU A;  3K50 A;  1K32 A;  1DCI A;  2ZL4 A;  1XNW A;  2VRE A;  4HC8 A;  3T88 A;  4U0G H;  4L8K A;  2VX2 A;  2ZL3 A;  3V5I A;  1N6D A;  5FUS A;  2VSU F;  3BPT A;  3IBB A;  3ZWC A;  4MI2 A;  3TZ3 A;  3TT7 A;  2VSS F;  3ZW8 A;  5CTB A;  4JFC A;  4KD6 A;  4JCT A;  3BF0 A;  3H0U A;  5DTP A;  4FJW D;  1ON9 A;  3TRR A;  3QKA A;  4JOT A;  4MXI A;  5INI A;  4JYJ A;  4NEK A;  3H0Q A;  4Q0G A;  2Q2X A;  1X0U A;  4WZ8 B;  4FN8 A;  4OLQ A;  3H0S A;  1WDM A;  2ZL2 A;  1YG6 A;  2VSS A;  3V5E A;  2A81 A;  3MYB A;  3NJD A;  3HLN 1;  5C9G A;  5DU4 A;  1HZD A;  2Q35 A;  2IEX A;  3RRV A;  1J7X A;  3QWD A;  4HDT A;  4IZB A;  4ELW A;  4FZW C;  5E0N X;  3MOY A;  3KTG A;  4L6W A;  4F47 A;  2J5I B;  4JCS A;  3DJA A;  4U0G A;  2Q34 A;  1TYF A;  4QFE A;  4EML A;  5HUQ A;  4ZDF A;  3U9S B;  4JCQ A;  4KPK A;  4JCR A;  1NZY A;  1UYR A;  3IB9 A;  4I4Z A;  2DUB A;  2UZF A;  2HW5 A;  4OMR A;  4B3J A;  1Q52 A;  4B3I A;  3R9T A;  4MOU A;  4B3H A;  1JXZ A;  3DOR A;  3STA A;  5DUF A;  1WDK A;  3FDU A;  2W3P A;  3M6M A;  2A7S A;  1TG6 A;  3BPP A;  3QXZ A;  3QRE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...