2VSSE

Wild-type hydroxycinnamoyl-coa hydratase lyase in complex with acetyl- coa and vanillin
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
246
structure length
240
Chain Sequence
YEGRWKTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYFPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFSPLVACDLAICADEATFGLSEINYGIPPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKLDQSRLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Ternary Complex of Hydroxycinnamoyl-Coa Hydratase-Lyase (Hchl) with Acetyl-Coa and Vanillin Gives Insights Into Substrate Specificity and Mechanism.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
total genus 91
structure length 240
sequence length 246
ec nomenclature ec 4.1.2.41: Vanillin synthase.
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2vssE01
3OT6A 3GF7A 5DUCA 4U0GA 4WZ8B 2X58A 4RYFH 3I47A 1WDMA 3H0SA 3PEAA 4FZWC 1K39A 2VX2A 3PE8A 3Q0GA 1YG6A 3M6MA 1XNYA 4QIIA 4I52A 5C9GA 1NZYA 1WZ8A 4U0GH 2F9YB 2Q34A 3QK8A 5DKPA 4FJWD 1FC9A 4HC8A 4KPKA 3MT6A 4FNDA 3BPPA 2IEXA 4JFCA 3RSIA 3R9TA 3R0OA 4F47A 3GKBA 3RRVA 5INIA 2ZQQA 4U1AA 2QQ3A 2PBPA 4RCNA 4K29A 1DCIA 4GHNA 4WYOB 3ZWBA 3M6NA 3PZKA 2D3TA 4OMRA 3TT7A 3LAOA 3U9TB 3TVWA 5FIFA 4B3IA 4FZWA 3K8XA 4JCRA 4Q0GA 4JJTA 3G64A 5DU4A 3TT6A 3K50A 4Z0MA 2ZL4A 1FC6A 4NEKA 4QFEA 4EMPA 3L3SA 3QREA 3IBBA 4LK5A 3T88A 3GF3A 3U9SB 3ZW8A 3GLMA 2J5SA 3ZWCA 4ELXA 3QWDA 3HRXA 2VREA 3H02A 2UZFA 2ZQRA 1SG4A 2J5GA 5IKLB 5C90A 2J5IA 4GM2A 4ASIA 3P85A 3NJBA 4KD6A 2X24A 3OMEA 2FW2A 3TLFA 1N6DA 4MI2A 3FF6A 3ZW9A 5KDRA 4L6WA 3ISAA 3V5IA 1UIYA 3KTIA 4ELSA 4FB8A 2Q2XA 4ZDDA 2A81A 3NJDA 4KNPA 4ZDEA 2PG8A 3V5EA 1XX4A 3DORA 3TV5A 3HP0A 3VIVA 3Q7HA 2J5IB 1FCFA 1WDLA 1PIXA 3P2LA 3HE2A 4JYJA 3T8AA 2NP9A 5JBXA 4K2NA 4MOUA 2C8TA 5DUFA 4IZDA 1HNUA 4U18A 3DJAA 3T89A 2Q35A 4WCZA 4EMLA 4JCQA 3HLN1 2FZSA 2WTBA 3TDCA 2DUBA 2DEOA 1W2XA 3KQFA 3Q1TA 1K32A 1FC7A 4KWBA 1UYRA 1RJMA 2PPYA 3Q0JA 4EMMA 2W3PA 5DZKH 1HZDA 1X0UA 4JCSA 3SLLA 4FN8A 3H81A 2HW5A 4JYLA 4IZCA 5DU6A 5E0NX 5DZKA 4YLHA 3JU1A 3R9QA 3QXIA 2CE3A 3TZ3A 1YG8A 2VSUC 4U0HA 2ZL3A 2FBMA 2F6IA 4I4ZA 4JWVA 3H0QA 3IB9A 4B3JA 1XO6A 4DI1A 5FUSA 5E0SA 1UYSA 3H0UA 1VRGA 2F9IB 3KTHA 3FDUA 1Y7OA 5DU8A 2ZL2A 5KJPA 3SWXA 2VSUA 4U19A 3MYBA 2VSUF 3MOYA 3T3WA 1Q51A 4B3HA 1PJHA 3KTJA 1TG6A 4Q1IA 2VSSF 4L8KA 4HNKA 2VSSE 4I42A 1NZYB 5INGA 2J5II 1OD4A 3MFMA 2CBYA 1XNVA 4FNBA 4JCTA 3WG5A 3QKAA 3BF0A 1OD2A 2J5GD 3ZWAA 4JSBA 3IAVA 2A7KA 4NNQA 5CTCA 1J7XA 4ZU2A 1EF9A 3KTKA 3RSTA 4IZBA 5DTPA 5MGBA 4ZDBA 1UYVA 2BZRA 3U9RB 1N6EA 1ON9A 3N6RB 1O8UA 3P5MA 4QIJA 1ON3A 1JXZA 3GMAA 3OC7A 3ST9A 2EJ5A 4JVTA 2VSSA 3H0JA 4G2RA 1TYFA 2GTRA 5CTBA 1WDKA 1UYTA 3R6HA 4RYFA 1Q52A 3PGQA 4K3WA 3R9SA 3TRRA 1MJ3A 3QXZA 4FN7A 5DTWA 5INFA 1EF8A 3HINA 1DUBA 2F9YA 4MXIA 3TVUA 3T8BA 5KDRB 5G1SA 2ZL0A 1XNWA 4OLQA 1EY3A 4OG1A 5DL1A 1SZOA 2VSUE 5JBWA 1N6FA 3QYRA 3QMJA 2F9IA 5E0SH 4JOTA 5G1RA 2A7SA 1RJNA 3KTGA 1HNOA 4ZDCA 4ELWA 4ZDFA 5G1QA 3STAA 2F6QA 3LKEA 3BEZA
chains in the Genus database with same CATH superfamily
3OT6A 3GF7A 5DUCA 4U0GA 4WZ8B 2X58A 4RYFH 3I47A 1WDMA 3H0SA 3PEAA 4FZWC 1K39A 2VX2A 2YJGA 3PE8A 3Q0GA 1YG6A 3M6MA 1XNYA 4QIIA 4I52A 5C9GA 1NZYA 1WZ8A 4U0GH 2F9YB 2Q34A 3QK8A 5DKPA 4FJWD 1FC9A 4HC8A 4KPKA 3MT6A 4FNDA 3BPPA 2IEXA 4JFCA 3RSIA 3R9TA 3R0OA 4F47A 3GKBA 3RRVA 5INIA 2ZQQA 4U1AA 2QQ3A 2PBPA 4RCNA 4K29A 1DCIA 4GHNA 4WYOB 3ZWBA 3M6NA 3PZKA 2D3TA 4OMRA 3TT7A 3LAOA 3U9TB 3TVWA 5FIFA 4B3IA 4FZWA 3K8XA 4JCRA 4Q0GA 4JJTA 3G64A 5DU4A 3TT6A 3K50A 4Z0MA 2ZL4A 1FC6A 4NEKA 4QFEA 4EMPA 3L3SA 3QREA 3IBBA 4LK5A 3T88A 3GF3A 3U9SB 3ZW8A 3GLMA 2J5SA 3ZWCA 4ELXA 3QWDA 3HRXA 2VREA 3H02A 2UZFA 2ZQRA 1SG4A 2J5GA 5IKLB 5C90A 2J5IA 4GM2A 4ASIA 3P85A 3NJBA 4KD6A 2X24A 3OMEA 2FW2A 3TLFA 1N6DA 4MI2A 3FF6A 3ZW9A 5KDRA 4L6WA 3ISAA 3V5IA 1UIYA 3KTIA 4ELSA 4FB8A 2Q2XA 4ZDDA 2A81A 3NJDA 4KNPA 4ZDEA 2PG8A 3V5EA 1XX4A 3DORA 3TV5A 3HP0A 3VIVA 3Q7HA 2J5IB 1FCFA 1WDLA 1PIXA 3P2LA 3HE2A 4JYJA 3T8AA 2NP9A 4HDTA 5JBXA 4K2NA 4MOUA 2C8TA 5DUFA 4IZDA 1HNUA 4U18A 3DJAA 3T89A 2Q35A 4WCZA 4EMLA 4JCQA 3HLN1 2FZSA 2WTBA 3TDCA 2DUBA 2DEOA 1W2XA 3KQFA 3Q1TA 1K32A 1FC7A 4KWBA 1UYRA 1RJMA 2PPYA 3Q0JA 4EMMA 2W3PA 5DZKH 1HZDA 1X0UA 4JCSA 3SLLA 4FN8A 3H81A 2HW5A 4JYLA 4IZCA 5DU6A 5E0NX 5DZKA 4YLHA 3JU1A 3R9QA 3QXIA 2CE3A 3TZ3A 1YG8A 2VSUC 4U0HA 2ZL3A 2FBMA 2F6IA 4I4ZA 4JWVA 5HUQA 3H0QA 3IB9A 4B3JA 1XO6A 4DI1A 5FUSA 5E0SA 1UYSA 3H0UA 1VRGA 2F9IB 3KTHA 3FDUA 1Y7OA 5DU8A 2ZL2A 5KJPA 3SWXA 2VSUA 4U19A 3MYBA 2VSUF 3MOYA 3T3WA 1Q51A 4B3HA 1PJHA 3KTJA 1TG6A 4Q1IA 2VSSF 4L8KA 4HNKA 2VSSE 4I42A 1NZYB 2J5II 5INGA 1OD4A 3MFMA 2CBYA 1XNVA 4FNBA 4JCTA 3WG5A 3QKAA 3BF0A 1OD2A 4J2UA 2J5GD 3ZWAA 4JSBA 3IAVA 2A7KA 4NNQA 5CTCA 1J7XA 4ZU2A 1EF9A 3KTKA 3RSTA 4IZBA 5DTPA 5MGBA 4ZDBA 1UYVA 2BZRA 3U9RB 1N6EA 1ON9A 3N6RB 1O8UA 3P5MA 4QIJA 1ON3A 1JXZA 3GMAA 3OC7A 3ST9A 2EJ5A 4JVTA 2VSSA 3H0JA 4G2RA 1TYFA 4NARA 2GTRA 5CTBA 1WDKA 1UYTA 3R6HA 4RYFA 1Q52A 3PGQA 4K3WA 3R9SA 3TRRA 1MJ3A 3QXZA 4FN7A 5DTWA 5INFA 1EF8A 3HINA 1DUBA 2F9YA 4MXIA 3TVUA 3T8BA 5KDRB 5G1SA 2ZL0A 1XNWA 4OLQA 1EY3A 4OG1A 5DL1A 1SZOA 2VSUE 5JBWA 1N6FA 3QYRA 3QMJA 2F9IA 5E0SH 4JOTA 5G1RA 2A7SA 1RJNA 3KTGA 3BPTA 1HNOA 4ZDCA 4ELWA 4ZDFA 5G1QA 3STAA 2F6QA 3LKEA 3BEZA
chains in the Genus database with same CATH topology
3OT6A 3GF7A 5DUCA 4U0GA 4WZ8B 2X58A 4RYFH 3I47A 1WDMA 3H0SA 3PEAA 4FZWC 1K39A 2VX2A 2YJGA 3PE8A 3Q0GA 1YG6A 3M6MA 1XNYA 4QIIA 4I52A 5C9GA 1NZYA 1WZ8A 4U0GH 2F9YB 2Q34A 3QK8A 5DKPA 4FJWD 1FC9A 4HC8A 4KPKA 3MT6A 4FNDA 3BPPA 2IEXA 4JFCA 3RSIA 3R9TA 3R0OA 4F47A 3GKBA 3RRVA 5INIA 2ZQQA 4U1AA 2QQ3A 2PBPA 4RCNA 4K29A 1DCIA 4GHNA 4WYOB 3ZWBA 3M6NA 3PZKA 2D3TA 4OMRA 3TT7A 3LAOA 3U9TB 3TVWA 5FIFA 4B3IA 4FZWA 3K8XA 4JCRA 4Q0GA 4JJTA 3G64A 5DU4A 3TT6A 3K50A 4Z0MA 2ZL4A 1FC6A 4NEKA 4QFEA 4EMPA 3L3SA 3QREA 3IBBA 4LK5A 3T88A 3GF3A 3U9SB 3ZW8A 3GLMA 2J5SA 3ZWCA 4ELXA 3QWDA 3HRXA 2VREA 3H02A 2UZFA 2ZQRA 1SG4A 2J5GA 5IKLB 5C90A 2J5IA 4GM2A 4ASIA 3P85A 3NJBA 4KD6A 2X24A 3OMEA 2FW2A 3TLFA 1N6DA 4MI2A 3FF6A 3ZW9A 5KDRA 4L6WA 3ISAA 3V5IA 1UIYA 3KTIA 4ELSA 4FB8A 2Q2XA 4ZDDA 2A81A 3NJDA 4KNPA 4ZDEA 2PG8A 3V5EA 1XX4A 3DORA 3TV5A 3HP0A 3VIVA 3Q7HA 2J5IB 1FCFA 1WDLA 1PIXA 3P2LA 3HE2A 4JYJA 3T8AA 2NP9A 4HDTA 5JBXA 4K2NA 4MOUA 2C8TA 5DUFA 4IZDA 1HNUA 4U18A 3DJAA 3T89A 2Q35A 4WCZA 4EMLA 4JCQA 3HLN1 2FZSA 2WTBA 3TDCA 2DUBA 2DEOA 1W2XA 3KQFA 3Q1TA 1K32A 1FC7A 4KWBA 1UYRA 1RJMA 2PPYA 3Q0JA 4EMMA 2W3PA 5DZKH 1HZDA 1X0UA 4JCSA 3SLLA 4FN8A 3H81A 2HW5A 4JYLA 4IZCA 5DU6A 5E0NX 5DZKA 4YLHA 3JU1A 3R9QA 3QXIA 2CE3A 3TZ3A 1YG8A 2VSUC 4U0HA 2ZL3A 2FBMA 2F6IA 4I4ZA 4JWVA 5HUQA 3H0QA 3IB9A 4B3JA 1XO6A 4DI1A 5FUSA 5E0SA 1UYSA 3H0UA 1VRGA 2F9IB 3KTHA 3FDUA 1Y7OA 5DU8A 2ZL2A 5KJPA 3SWXA 2VSUA 4U19A 3MYBA 2VSUF 3MOYA 3T3WA 1Q51A 4B3HA 1PJHA 3KTJA 1TG6A 4Q1IA 2VSSF 4L8KA 4HNKA 2VSSE 4I42A 1NZYB 2J5II 5INGA 1OD4A 3MFMA 2CBYA 1XNVA 4FNBA 4JCTA 3WG5A 3QKAA 3BF0A 1OD2A 4J2UA 2J5GD 3ZWAA 4JSBA 3IAVA 2A7KA 4NNQA 5CTCA 1J7XA 4ZU2A 1EF9A 3KTKA 3RSTA 4IZBA 5DTPA 5MGBA 4ZDBA 1UYVA 2BZRA 3U9RB 1N6EA 1ON9A 3N6RB 1O8UA 3P5MA 4QIJA 1ON3A 1JXZA 3GMAA 3OC7A 3ST9A 2EJ5A 4JVTA 2VSSA 3H0JA 4G2RA 1TYFA 4NARA 2GTRA 5CTBA 1WDKA 1UYTA 3R6HA 4RYFA 1Q52A 3PGQA 4K3WA 3R9SA 3TRRA 1MJ3A 3QXZA 4FN7A 5DTWA 5INFA 1EF8A 3HINA 1DUBA 2F9YA 4MXIA 3TVUA 3T8BA 5KDRB 5G1SA 2ZL0A 1XNWA 4OLQA 1EY3A 4OG1A 5DL1A 1SZOA 2VSUE 5JBWA 1N6FA 3QYRA 3QMJA 2F9IA 5E0SH 4JOTA 5G1RA 2A7SA 1RJNA 3KTGA 3BPTA 1HNOA 4ZDCA 4ELWA 4ZDFA 5G1QA 3STAA 2F6QA 3LKEA 3BEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OT6 A;  3GF7 A;  5DUC A;  4U0G A;  4WZ8 B;  2X58 A;  4RYF H;  3I47 A;  1WDM A;  3H0S A;  3PEA A;  4FZW C;  1K39 A;  2VX2 A;  3PE8 A;  3Q0G A;  1YG6 A;  3M6M A;  1XNY A;  4QII A;  4I52 A;  5C9G A;  1NZY A;  1WZ8 A;  4U0G H;  2F9Y B;  2Q34 A;  3QK8 A;  5DKP A;  4FJW D;  1FC9 A;  4HC8 A;  4KPK A;  3MT6 A;  4FND A;  3BPP A;  2IEX A;  4JFC A;  3RSI A;  3R9T A;  3R0O A;  4F47 A;  3GKB A;  3RRV A;  5INI A;  2ZQQ A;  4U1A A;  2QQ3 A;  2PBP A;  4RCN A;  4K29 A;  1DCI A;  4GHN A;  4WYO B;  3ZWB A;  3M6N A;  3PZK A;  2D3T A;  4OMR A;  3TT7 A;  3LAO A;  3U9T B;  3TVW A;  5FIF A;  4B3I A;  4FZW A;  3K8X A;  4JCR A;  4Q0G A;  4JJT A;  3G64 A;  5DU4 A;  3TT6 A;  3K50 A;  4Z0M A;  2ZL4 A;  1FC6 A;  4NEK A;  4QFE A;  4EMP A;  3L3S A;  3QRE A;  3IBB A;  4LK5 A;  3T88 A;  3GF3 A;  3U9S B;  3ZW8 A;  3GLM A;  2J5S A;  3ZWC A;  4ELX A;  3QWD A;  3HRX A;  2VRE A;  3H02 A;  2UZF A;  2ZQR A;  1SG4 A;  2J5G A;  5IKL B;  5C90 A;  2J5I A;  4GM2 A;  4ASI A;  3P85 A;  3NJB A;  4KD6 A;  2X24 A;  3OME A;  2FW2 A;  3TLF A;  1N6D A;  4MI2 A;  3FF6 A;  3ZW9 A;  5KDR A;  4L6W A;  3ISA A;  3V5I A;  1UIY A;  3KTI A;  4ELS A;  4FB8 A;  2Q2X A;  4ZDD A;  2A81 A;  3NJD A;  4KNP A;  4ZDE A;  2PG8 A;  3V5E A;  1XX4 A;  3DOR A;  3TV5 A;  3HP0 A;  3VIV A;  3Q7H A;  2J5I B;  1FCF A;  1WDL A;  1PIX A;  3P2L A;  3HE2 A;  4JYJ A;  3T8A A;  2NP9 A;  5JBX A;  4K2N A;  4MOU A;  2C8T A;  5DUF A;  4IZD A;  1HNU A;  4U18 A;  3DJA A;  3T89 A;  2Q35 A;  4WCZ A;  4EML A;  4JCQ A;  3HLN 1;  2FZS A;  2WTB A;  3TDC A;  2DUB A;  2DEO A;  1W2X A;  3KQF A;  3Q1T A;  1K32 A;  1FC7 A;  4KWB A;  1UYR A;  1RJM A;  2PPY A;  3Q0J A;  4EMM A;  2W3P A;  5DZK H;  1HZD A;  1X0U A;  4JCS A;  3SLL A;  4FN8 A;  3H81 A;  2HW5 A;  4JYL A;  4IZC A;  5DU6 A;  5E0N X;  5DZK A;  4YLH A;  3JU1 A;  3R9Q A;  3QXI A;  2CE3 A;  3TZ3 A;  1YG8 A;  2VSU C;  4U0H A;  2ZL3 A;  2FBM A;  2F6I A;  4I4Z A;  4JWV A;  3H0Q A;  3IB9 A;  4B3J A;  1XO6 A;  4DI1 A;  5FUS A;  5E0S A;  1UYS A;  3H0U A;  1VRG A;  2F9I B;  3KTH A;  3FDU A;  1Y7O A;  5DU8 A;  2ZL2 A;  5KJP A;  3SWX A;  2VSU A;  4U19 A;  3MYB A;  2VSU F;  3MOY A;  3T3W A;  1Q51 A;  4B3H A;  1PJH A;  3KTJ A;  1TG6 A;  4Q1I A;  2VSS F;  4L8K A;  4HNK A;  2VSS E;  4I42 A;  1NZY B;  5ING A;  2J5I I;  1OD4 A;  3MFM A;  2CBY A;  1XNV A;  4FNB A;  4JCT A;  3WG5 A;  3QKA A;  3BF0 A;  1OD2 A;  2J5G D;  3ZWA A;  4JSB A;  3IAV A;  2A7K A;  4NNQ A;  5CTC A;  1J7X A;  4ZU2 A;  1EF9 A;  3KTK A;  3RST A;  4IZB A;  5DTP A;  5MGB A;  4ZDB A;  1UYV A;  2BZR A;  3U9R B;  1N6E A;  1ON9 A;  3N6R B;  1O8U A;  3P5M A;  4QIJ A;  1ON3 A;  1JXZ A;  3GMA A;  3OC7 A;  3ST9 A;  2EJ5 A;  4JVT A;  2VSS A;  3H0J A;  4G2R A;  1TYF A;  2GTR A;  5CTB A;  1WDK A;  1UYT A;  3R6H A;  4RYF A;  1Q52 A;  3PGQ A;  4K3W A;  3R9S A;  3TRR A;  1MJ3 A;  3QXZ A;  4FN7 A;  5DTW A;  5INF A;  1EF8 A;  3HIN A;  1DUB A;  2F9Y A;  4MXI A;  3TVU A;  3T8B A;  5KDR B;  5G1S A;  2ZL0 A;  1XNW A;  4OLQ A;  1EY3 A;  4OG1 A;  5DL1 A;  1SZO A;  2VSU E;  5JBW A;  1N6F A;  3QYR A;  3QMJ A;  2F9I A;  5E0S H;  4JOT A;  5G1R A;  2A7S A;  1RJN A;  3KTG A;  1HNO A;  4ZDC A;  4ELW A;  4ZDF A;  5G1Q A;  3STA A;  2F6Q A;  3LKE A;  3BEZ A; 
#chains in the Genus database with same CATH topology
 3OT6 A;  3GF7 A;  5DUC A;  4U0G A;  4WZ8 B;  2X58 A;  4RYF H;  3I47 A;  1WDM A;  3H0S A;  3PEA A;  4FZW C;  1K39 A;  2VX2 A;  2YJG A;  3PE8 A;  3Q0G A;  1YG6 A;  3M6M A;  1XNY A;  4QII A;  4I52 A;  5C9G A;  1NZY A;  1WZ8 A;  4U0G H;  2F9Y B;  2Q34 A;  3QK8 A;  5DKP A;  4FJW D;  1FC9 A;  4HC8 A;  4KPK A;  3MT6 A;  4FND A;  3BPP A;  2IEX A;  4JFC A;  3RSI A;  3R9T A;  3R0O A;  4F47 A;  3GKB A;  3RRV A;  5INI A;  2ZQQ A;  4U1A A;  2QQ3 A;  2PBP A;  4RCN A;  4K29 A;  1DCI A;  4GHN A;  4WYO B;  3ZWB A;  3M6N A;  3PZK A;  2D3T A;  4OMR A;  3TT7 A;  3LAO A;  3U9T B;  3TVW A;  5FIF A;  4B3I A;  4FZW A;  3K8X A;  4JCR A;  4Q0G A;  4JJT A;  3G64 A;  5DU4 A;  3TT6 A;  3K50 A;  4Z0M A;  2ZL4 A;  1FC6 A;  4NEK A;  4QFE A;  4EMP A;  3L3S A;  3QRE A;  3IBB A;  4LK5 A;  3T88 A;  3GF3 A;  3U9S B;  3ZW8 A;  3GLM A;  2J5S A;  3ZWC A;  4ELX A;  3QWD A;  3HRX A;  2VRE A;  3H02 A;  2UZF A;  2ZQR A;  1SG4 A;  2J5G A;  5IKL B;  5C90 A;  2J5I A;  4GM2 A;  4ASI A;  3P85 A;  3NJB A;  4KD6 A;  2X24 A;  3OME A;  2FW2 A;  3TLF A;  1N6D A;  4MI2 A;  3FF6 A;  3ZW9 A;  5KDR A;  4L6W A;  3ISA A;  3V5I A;  1UIY A;  3KTI A;  4ELS A;  4FB8 A;  2Q2X A;  4ZDD A;  2A81 A;  3NJD A;  4KNP A;  4ZDE A;  2PG8 A;  3V5E A;  1XX4 A;  3DOR A;  3TV5 A;  3HP0 A;  3VIV A;  3Q7H A;  2J5I B;  1FCF A;  1WDL A;  1PIX A;  3P2L A;  3HE2 A;  4JYJ A;  3T8A A;  2NP9 A;  4HDT A;  5JBX A;  4K2N A;  4MOU A;  2C8T A;  5DUF A;  4IZD A;  1HNU A;  4U18 A;  3DJA A;  3T89 A;  2Q35 A;  4WCZ A;  4EML A;  4JCQ A;  3HLN 1;  2FZS A;  2WTB A;  3TDC A;  2DUB A;  2DEO A;  1W2X A;  3KQF A;  3Q1T A;  1K32 A;  1FC7 A;  4KWB A;  1UYR A;  1RJM A;  2PPY A;  3Q0J A;  4EMM A;  2W3P A;  5DZK H;  1HZD A;  1X0U A;  4JCS A;  3SLL A;  4FN8 A;  3H81 A;  2HW5 A;  4JYL A;  4IZC A;  5DU6 A;  5E0N X;  5DZK A;  4YLH A;  3JU1 A;  3R9Q A;  3QXI A;  2CE3 A;  3TZ3 A;  1YG8 A;  2VSU C;  4U0H A;  2ZL3 A;  2FBM A;  2F6I A;  4I4Z A;  4JWV A;  5HUQ A;  3H0Q A;  3IB9 A;  4B3J A;  1XO6 A;  4DI1 A;  5FUS A;  5E0S A;  1UYS A;  3H0U A;  1VRG A;  2F9I B;  3KTH A;  3FDU A;  1Y7O A;  5DU8 A;  2ZL2 A;  5KJP A;  3SWX A;  2VSU A;  4U19 A;  3MYB A;  2VSU F;  3MOY A;  3T3W A;  1Q51 A;  4B3H A;  1PJH A;  3KTJ A;  1TG6 A;  4Q1I A;  2VSS F;  4L8K A;  4HNK A;  2VSS E;  4I42 A;  1NZY B;  2J5I I;  5ING A;  1OD4 A;  3MFM A;  2CBY A;  1XNV A;  4FNB A;  4JCT A;  3WG5 A;  3QKA A;  3BF0 A;  1OD2 A;  4J2U A;  2J5G D;  3ZWA A;  4JSB A;  3IAV A;  2A7K A;  4NNQ A;  5CTC A;  1J7X A;  4ZU2 A;  1EF9 A;  3KTK A;  3RST A;  4IZB A;  5DTP A;  5MGB A;  4ZDB A;  1UYV A;  2BZR A;  3U9R B;  1N6E A;  1ON9 A;  3N6R B;  1O8U A;  3P5M A;  4QIJ A;  1ON3 A;  1JXZ A;  3GMA A;  3OC7 A;  3ST9 A;  2EJ5 A;  4JVT A;  2VSS A;  3H0J A;  4G2R A;  1TYF A;  4NAR A;  2GTR A;  5CTB A;  1WDK A;  1UYT A;  3R6H A;  4RYF A;  1Q52 A;  3PGQ A;  4K3W A;  3R9S A;  3TRR A;  1MJ3 A;  3QXZ A;  4FN7 A;  5DTW A;  5INF A;  1EF8 A;  3HIN A;  1DUB A;  2F9Y A;  4MXI A;  3TVU A;  3T8B A;  5KDR B;  5G1S A;  2ZL0 A;  1XNW A;  4OLQ A;  1EY3 A;  4OG1 A;  5DL1 A;  1SZO A;  2VSU E;  5JBW A;  1N6F A;  3QYR A;  3QMJ A;  2F9I A;  5E0S H;  4JOT A;  5G1R A;  2A7S A;  1RJN A;  3KTG A;  3BPT A;  1HNO A;  4ZDC A;  4ELW A;  4ZDF A;  5G1Q A;  3STA A;  2F6Q A;  3LKE A;  3BEZ A; 
#chains in the Genus database with same CATH homology
 3OT6 A;  3GF7 A;  5DUC A;  4U0G A;  4WZ8 B;  2X58 A;  4RYF H;  3I47 A;  1WDM A;  3H0S A;  3PEA A;  4FZW C;  1K39 A;  2VX2 A;  2YJG A;  3PE8 A;  3Q0G A;  1YG6 A;  3M6M A;  1XNY A;  4QII A;  4I52 A;  5C9G A;  1NZY A;  1WZ8 A;  4U0G H;  2F9Y B;  2Q34 A;  3QK8 A;  5DKP A;  4FJW D;  1FC9 A;  4HC8 A;  4KPK A;  3MT6 A;  4FND A;  3BPP A;  2IEX A;  4JFC A;  3RSI A;  3R9T A;  3R0O A;  4F47 A;  3GKB A;  3RRV A;  5INI A;  2ZQQ A;  4U1A A;  2QQ3 A;  2PBP A;  4RCN A;  4K29 A;  1DCI A;  4GHN A;  4WYO B;  3ZWB A;  3M6N A;  3PZK A;  2D3T A;  4OMR A;  3TT7 A;  3LAO A;  3U9T B;  3TVW A;  5FIF A;  4B3I A;  4FZW A;  3K8X A;  4JCR A;  4Q0G A;  4JJT A;  3G64 A;  5DU4 A;  3TT6 A;  3K50 A;  4Z0M A;  2ZL4 A;  1FC6 A;  4NEK A;  4QFE A;  4EMP A;  3L3S A;  3QRE A;  3IBB A;  4LK5 A;  3T88 A;  3GF3 A;  3U9S B;  3ZW8 A;  3GLM A;  2J5S A;  3ZWC A;  4ELX A;  3QWD A;  3HRX A;  2VRE A;  3H02 A;  2UZF A;  2ZQR A;  1SG4 A;  2J5G A;  5IKL B;  5C90 A;  2J5I A;  4GM2 A;  4ASI A;  3P85 A;  3NJB A;  4KD6 A;  2X24 A;  3OME A;  2FW2 A;  3TLF A;  1N6D A;  4MI2 A;  3FF6 A;  3ZW9 A;  5KDR A;  4L6W A;  3ISA A;  3V5I A;  1UIY A;  3KTI A;  4ELS A;  4FB8 A;  2Q2X A;  4ZDD A;  2A81 A;  3NJD A;  4KNP A;  4ZDE A;  2PG8 A;  3V5E A;  1XX4 A;  3DOR A;  3TV5 A;  3HP0 A;  3VIV A;  3Q7H A;  2J5I B;  1FCF A;  1WDL A;  1PIX A;  3P2L A;  3HE2 A;  4JYJ A;  3T8A A;  2NP9 A;  4HDT A;  5JBX A;  4K2N A;  4MOU A;  2C8T A;  5DUF A;  4IZD A;  1HNU A;  4U18 A;  3DJA A;  3T89 A;  2Q35 A;  4WCZ A;  4EML A;  4JCQ A;  3HLN 1;  2FZS A;  2WTB A;  3TDC A;  2DUB A;  2DEO A;  1W2X A;  3KQF A;  3Q1T A;  1K32 A;  1FC7 A;  4KWB A;  1UYR A;  1RJM A;  2PPY A;  3Q0J A;  4EMM A;  2W3P A;  5DZK H;  1HZD A;  1X0U A;  4JCS A;  3SLL A;  4FN8 A;  3H81 A;  2HW5 A;  4JYL A;  4IZC A;  5DU6 A;  5E0N X;  5DZK A;  4YLH A;  3JU1 A;  3R9Q A;  3QXI A;  2CE3 A;  3TZ3 A;  1YG8 A;  2VSU C;  4U0H A;  2ZL3 A;  2FBM A;  2F6I A;  4I4Z A;  4JWV A;  5HUQ A;  3H0Q A;  3IB9 A;  4B3J A;  1XO6 A;  4DI1 A;  5FUS A;  5E0S A;  1UYS A;  3H0U A;  1VRG A;  2F9I B;  3KTH A;  3FDU A;  1Y7O A;  5DU8 A;  2ZL2 A;  5KJP A;  3SWX A;  2VSU A;  4U19 A;  3MYB A;  2VSU F;  3MOY A;  3T3W A;  1Q51 A;  4B3H A;  1PJH A;  3KTJ A;  1TG6 A;  4Q1I A;  2VSS F;  4L8K A;  4HNK A;  2VSS E;  4I42 A;  1NZY B;  2J5I I;  5ING A;  1OD4 A;  3MFM A;  2CBY A;  1XNV A;  4FNB A;  4JCT A;  3WG5 A;  3QKA A;  3BF0 A;  1OD2 A;  4J2U A;  2J5G D;  3ZWA A;  4JSB A;  3IAV A;  2A7K A;  4NNQ A;  5CTC A;  1J7X A;  4ZU2 A;  1EF9 A;  3KTK A;  3RST A;  4IZB A;  5DTP A;  5MGB A;  4ZDB A;  1UYV A;  2BZR A;  3U9R B;  1N6E A;  1ON9 A;  3N6R B;  1O8U A;  3P5M A;  4QIJ A;  1ON3 A;  1JXZ A;  3GMA A;  3OC7 A;  3ST9 A;  2EJ5 A;  4JVT A;  2VSS A;  3H0J A;  4G2R A;  1TYF A;  4NAR A;  2GTR A;  5CTB A;  1WDK A;  1UYT A;  3R6H A;  4RYF A;  1Q52 A;  3PGQ A;  4K3W A;  3R9S A;  3TRR A;  1MJ3 A;  3QXZ A;  4FN7 A;  5DTW A;  5INF A;  1EF8 A;  3HIN A;  1DUB A;  2F9Y A;  4MXI A;  3TVU A;  3T8B A;  5KDR B;  5G1S A;  2ZL0 A;  1XNW A;  4OLQ A;  1EY3 A;  4OG1 A;  5DL1 A;  1SZO A;  2VSU E;  5JBW A;  1N6F A;  3QYR A;  3QMJ A;  2F9I A;  5E0S H;  4JOT A;  5G1R A;  2A7S A;  1RJN A;  3KTG A;  3BPT A;  1HNO A;  4ZDC A;  4ELW A;  4ZDF A;  5G1Q A;  3STA A;  2F6Q A;  3LKE A;  3BEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...