2VSUC

A ternary complex of hydroxycinnamoyl-coa hydratase-lyase (hchl) with acetyl-coenzyme a and vanillin gives insights into substrate specificity and mechanism.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
251
structure length
251
Chain Sequence
b'GRWKTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYFREVDAGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINWGIPPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKLDQSRLLDTGGREQG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
publication title A Ternary Complex of Hydroxycinnamoyl-Coa Hydratase-Lyase (Hchl) with Acetyl-Coa and Vanillin Gives Insights Into Substrate Specificity and Mechanism.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 96
structure length 251
sequence length 251
ec nomenclature ec 4.1.2.41: Vanillin synthase.
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2vsuC01
2F9IA 4ZDEA 3TLFA 3DORA 2PPYA 3WG5A 4ASIA 3KTJA 1EF8A 4ZU2A 3GF7A 3T89A 4QFEA 1WDMA 2VSUE 5KJPA 2GTRA 2VSUA 4KWBA 1HNUA 4DI1A 4FNDA 1YG6A 4OG1A 3P2LA 4FN8A 5FIFA 1Y7OA 4QIIA 2EJ5A 3R9TA 4K3WA 4B3HA 3TT7A 4EMMA 4GHNA 4I4ZA 3TVUA 3GLMA 5C9GA 2IEXA 4JFCA 4F47A 1DUBA 2ZL4A 3MOYA 4NNQA 4ELSA 2D3TA 2WTBA 2HW5A 1VRGA 4U0GH 5INGA 5DU8A 2VSSF 3LAOA 2J5GD 4FB8A 1K32A 2VX2A 3ZWBA 2ZQRA 4JYJA 3SWXA 3QREA 3PZKA 2VREA 2BZRA 3L3SA 3OT6A 5DU6A 3RSTA 3BEZA 1MJ3A 4ELWA 3K8XA 4JSBA 1UYVA 3OC7A 3QMJA 3PGQA 1RJMA 3Q0JA 3G64A 3HRXA 3QKAA 1TG6A 3IB9A 3TRRA 3R9QA 4U0GA 3STAA 5KDRB 2A81A 5CTCA 3ZW9A 2C8TA 1UYRA 4LK5A 4JCQA 1SZOA 3BPPA 3TDCA 1RJNA 2NP9A 5INIA 5JBXA 5DZKH 1Q51A 1PJHA 2J5SA 3RSIA 5C90A 4MOUA 2J5IB 5CTBA 4ELXA 3GMAA 4U1AA 1FC7A 1PIXA 2VSUF 2PG8A 4GM2A 3U9RB 4IZCA 4YLHA 4FNBA 4K29A 3KQFA 1K39A 2X24A 3PEAA 2Q34A 1OD4A 4FN7A 4HC8A 5JBWA 4EMPA 4IZDA 3MFMA 5DZKA 3T8BA 3ZWAA 3R9SA 4K2NA 5INFA 1NZYB 3Q0GA 3T8AA 2FW2A 1FC6A 2X58A 1JXZA 1WDKA 3HE2A 4U18A 1XNVA 5G1QA 5KDRA 3DJAA 1Q52A 2ZQQA 4FZWC 4HNKA 1UYTA 1HZDA 4L8KA 3BF0A 4JWVA 4ZDDA 5DUCA 3HINA 2F9IB 1OD2A 1EY3A 3KTKA 1XO6A 1N6FA 4EMLA 4FJWD 2F9YB 2CE3A 3IAVA 3H81A 2FBMA 3MYBA 2CBYA 4MXIA 1FCFA 3ST9A 1WZ8A 5IKLB 1TYFA 1ON9A 3M6NA 3KTGA 4NEKA 1W2XA 4WZ8B 4G2RA 3Q7HA 3OMEA 3IBBA 2VSSA 4U0HA 1XX4A 3TV5A 4ZDCA 4KNPA 2ZL2A 4IZBA 3QXZA 2QQ3A 4I52A 1O8UA 3HLN1 2VSUC 3VIVA 3TZ3A 3T3WA 2DEOA 5DKPA 1NZYA 3GF3A 3QYRA 3MT6A 3FDUA 5G1RA 3TVWA 3JU1A 3H0UA 3ZW8A 3Q1TA 5DL1A 5DUFA 5DU4A 4RYFA 1EF9A 4Q0GA 3K50A 2F6QA 4JCTA 1XNYA 4Q1IA 3V5IA 4JOTA 2F6IA 5E0SH 3QWDA 2F9YA 1HNOA 5DTWA 3H0SA 3KTHA 4JCRA 3H02A 3FF6A 3KTIA 5MGBA 4RCNA 4L6WA 2A7KA 3U9SB 2J5II 3RRVA 2J5GA 4WYOB 4JYLA 3H0JA 5DTPA 4ZDFA 5E0SA 3V5EA 3ISAA 2A7SA 1FC9A 3M6MA 4MI2A 2UZFA 2DUBA 3HP0A 4ZDBA 4JVTA 3R0OA 4KD6A 1ON3A 4B3IA 1YG8A 3T88A 1SG4A 3LKEA 2PBPA 4U19A 5E0NX 1DCIA 3GKBA 3ZWCA 1J7XA 2FZSA 2J5IA 2Q2XA 2VSSE 3QK8A 3H0QA 4OMRA 3QXIA 2ZL3A 4B3JA 1N6DA 4RYFH 3P85A 1WDLA 4FZWA 5FUSA 2W3PA 3R6HA 3P5MA 4OLQA 3SLLA 4I42A 3PE8A 3NJBA 1UYSA 3NJDA 2Q35A 3TT6A 4QIJA 1X0UA 3I47A 1N6EA 4Z0MA 4JJTA 5G1SA 1UIYA 4KPKA 1XNWA 2ZL0A 3N6RB 4JCSA 3U9TB 4WCZA
chains in the Genus database with same CATH superfamily
2F9IA 4ZDEA 3TLFA 3DORA 2PPYA 3WG5A 4ASIA 3KTJA 1EF8A 4ZU2A 3GF7A 3T89A 4QFEA 1WDMA 2VSUE 5KJPA 2GTRA 2VSUA 4KWBA 1HNUA 5HUQA 4DI1A 4FNDA 1YG6A 4OG1A 3P2LA 4FN8A 5FIFA 1Y7OA 4QIIA 2EJ5A 3R9TA 4K3WA 4B3HA 3TT7A 4EMMA 4GHNA 4I4ZA 3TVUA 3GLMA 5C9GA 2IEXA 4JFCA 4F47A 1DUBA 2ZL4A 3MOYA 4NNQA 4ELSA 2D3TA 2WTBA 2HW5A 1VRGA 4U0GH 5INGA 5DU8A 2VSSF 3LAOA 2J5GD 4FB8A 1K32A 2VX2A 3ZWBA 2ZQRA 4JYJA 3SWXA 3QREA 3PZKA 2VREA 2BZRA 3L3SA 3OT6A 5DU6A 3RSTA 3BEZA 1MJ3A 4ELWA 3K8XA 4JSBA 1UYVA 3OC7A 3QMJA 3PGQA 1RJMA 4NARA 3Q0JA 3G64A 3HRXA 3QKAA 1TG6A 3IB9A 3TRRA 3R9QA 4U0GA 3STAA 5KDRB 2A81A 5CTCA 3ZW9A 2C8TA 1UYRA 4LK5A 4JCQA 1SZOA 3BPPA 3TDCA 1RJNA 2NP9A 5INIA 5JBXA 5DZKH 1Q51A 1PJHA 2J5SA 3RSIA 5C90A 4MOUA 2J5IB 5CTBA 4ELXA 3GMAA 4U1AA 1FC7A 1PIXA 2VSUF 2PG8A 4GM2A 3U9RB 4IZCA 4YLHA 4FNBA 4K29A 3KQFA 1K39A 2X24A 3PEAA 2Q34A 1OD4A 4FN7A 4HC8A 5JBWA 4EMPA 4IZDA 3MFMA 5DZKA 3T8BA 3ZWAA 3R9SA 4K2NA 5INFA 1NZYB 3Q0GA 3T8AA 2FW2A 1FC6A 2X58A 1JXZA 1WDKA 4HDTA 3HE2A 4U18A 1XNVA 5G1QA 5KDRA 3DJAA 1Q52A 2ZQQA 4FZWC 4HNKA 1UYTA 1HZDA 4L8KA 3BF0A 4JWVA 4ZDDA 5DUCA 3HINA 2F9IB 1OD2A 1EY3A 3KTKA 1XO6A 1N6FA 4EMLA 4FJWD 2F9YB 2CE3A 3IAVA 3H81A 2FBMA 3MYBA 2CBYA 4MXIA 1FCFA 3ST9A 1WZ8A 5IKLB 1TYFA 1ON9A 3M6NA 3KTGA 4NEKA 1W2XA 4WZ8B 4G2RA 3Q7HA 3OMEA 3IBBA 2VSSA 4U0HA 1XX4A 3TV5A 4J2UA 4ZDCA 4KNPA 2ZL2A 4IZBA 3QXZA 2QQ3A 4I52A 1O8UA 3HLN1 2VSUC 3VIVA 3TZ3A 3T3WA 2DEOA 5DKPA 1NZYA 3GF3A 3QYRA 3MT6A 3FDUA 5G1RA 3TVWA 3JU1A 3H0UA 3ZW8A 3Q1TA 5DL1A 2YJGA 5DUFA 5DU4A 4RYFA 1EF9A 4Q0GA 4JCTA 3K50A 2F6QA 3BPTA 1XNYA 4Q1IA 3V5IA 4JOTA 2F6IA 5E0SH 3QWDA 2F9YA 1HNOA 5DTWA 3H0SA 3KTHA 4JCRA 3H02A 3FF6A 3KTIA 5MGBA 4RCNA 4L6WA 2A7KA 3U9SB 2J5II 3RRVA 2J5GA 4WYOB 4JYLA 3H0JA 5DTPA 4ZDFA 5E0SA 3V5EA 3ISAA 2A7SA 1FC9A 3M6MA 4MI2A 2UZFA 2DUBA 3HP0A 4ZDBA 4JVTA 3R0OA 4KD6A 1ON3A 4B3IA 1YG8A 3T88A 1SG4A 3LKEA 2PBPA 4U19A 5E0NX 1DCIA 3GKBA 3ZWCA 1J7XA 2FZSA 2J5IA 2Q2XA 2VSSE 3QK8A 3H0QA 4OMRA 3QXIA 2ZL3A 4B3JA 1N6DA 4RYFH 3P85A 1WDLA 4FZWA 5FUSA 2W3PA 3R6HA 3P5MA 4OLQA 3SLLA 4I42A 3PE8A 3NJBA 1UYSA 3NJDA 2Q35A 3TT6A 4QIJA 1X0UA 3I47A 1N6EA 4Z0MA 4JJTA 5G1SA 1UIYA 4KPKA 1XNWA 2ZL0A 3N6RB 4JCSA 3U9TB 4WCZA
chains in the Genus database with same CATH topology
2F9IA 4ZDEA 3TLFA 3DORA 2PPYA 3WG5A 4ASIA 3KTJA 1EF8A 4ZU2A 3GF7A 3T89A 4QFEA 1WDMA 2VSUE 5KJPA 2GTRA 2VSUA 4KWBA 1HNUA 5HUQA 4DI1A 4FNDA 1YG6A 4OG1A 3P2LA 4FN8A 5FIFA 1Y7OA 4QIIA 2EJ5A 3R9TA 4K3WA 4B3HA 3TT7A 4EMMA 4GHNA 4I4ZA 3TVUA 3GLMA 5C9GA 2IEXA 4JFCA 4F47A 1DUBA 2ZL4A 3MOYA 4NNQA 4ELSA 2D3TA 2WTBA 2HW5A 1VRGA 4U0GH 5INGA 5DU8A 2VSSF 3LAOA 2J5GD 4FB8A 1K32A 2VX2A 3ZWBA 2ZQRA 4JYJA 3SWXA 3QREA 3PZKA 2VREA 2BZRA 3L3SA 3OT6A 5DU6A 3RSTA 3BEZA 1MJ3A 4ELWA 3K8XA 4JSBA 1UYVA 3OC7A 3QMJA 3PGQA 1RJMA 4NARA 3Q0JA 3G64A 3HRXA 3QKAA 1TG6A 3IB9A 3TRRA 3R9QA 4U0GA 3STAA 5KDRB 2A81A 5CTCA 3ZW9A 2C8TA 1UYRA 4LK5A 4JCQA 1SZOA 3BPPA 3TDCA 1RJNA 2NP9A 5INIA 5JBXA 5DZKH 1Q51A 1PJHA 2J5SA 3RSIA 5C90A 4MOUA 2J5IB 5CTBA 4ELXA 3GMAA 4U1AA 1FC7A 1PIXA 2VSUF 2PG8A 4GM2A 3U9RB 4IZCA 4YLHA 4FNBA 4K29A 3KQFA 1K39A 2X24A 3PEAA 2Q34A 1OD4A 4FN7A 4HC8A 5JBWA 4EMPA 4IZDA 3MFMA 5DZKA 3T8BA 3ZWAA 3R9SA 4K2NA 5INFA 1NZYB 3Q0GA 3T8AA 2FW2A 1FC6A 2X58A 1JXZA 1WDKA 4HDTA 3HE2A 4U18A 1XNVA 5G1QA 5KDRA 3DJAA 1Q52A 2ZQQA 4FZWC 4HNKA 1UYTA 1HZDA 4L8KA 3BF0A 4JWVA 4ZDDA 5DUCA 3HINA 2F9IB 1OD2A 1EY3A 3KTKA 1XO6A 1N6FA 4EMLA 4FJWD 2F9YB 2CE3A 3IAVA 3H81A 2FBMA 3MYBA 2CBYA 4MXIA 1FCFA 3ST9A 1WZ8A 5IKLB 1TYFA 1ON9A 3M6NA 3KTGA 4NEKA 1W2XA 4WZ8B 4G2RA 3Q7HA 3OMEA 3IBBA 2VSSA 4U0HA 1XX4A 3TV5A 4J2UA 4ZDCA 4KNPA 2ZL2A 4IZBA 3QXZA 2QQ3A 4I52A 1O8UA 3HLN1 2VSUC 3VIVA 3TZ3A 3T3WA 2DEOA 5DKPA 1NZYA 3GF3A 3QYRA 3MT6A 3FDUA 5G1RA 3TVWA 3JU1A 3H0UA 3ZW8A 3Q1TA 5DL1A 2YJGA 5DUFA 5DU4A 4RYFA 1EF9A 4Q0GA 4JCTA 3K50A 2F6QA 3BPTA 1XNYA 4Q1IA 3V5IA 4JOTA 2F6IA 5E0SH 3QWDA 2F9YA 1HNOA 5DTWA 3H0SA 3KTHA 4JCRA 3H02A 3FF6A 3KTIA 5MGBA 4RCNA 4L6WA 2A7KA 3U9SB 2J5II 3RRVA 2J5GA 4WYOB 4JYLA 3H0JA 5DTPA 4ZDFA 5E0SA 3V5EA 3ISAA 2A7SA 1FC9A 3M6MA 4MI2A 2UZFA 2DUBA 3HP0A 4ZDBA 4JVTA 3R0OA 4KD6A 1ON3A 4B3IA 1YG8A 3T88A 1SG4A 3LKEA 2PBPA 4U19A 5E0NX 1DCIA 3GKBA 3ZWCA 1J7XA 2FZSA 2J5IA 2Q2XA 2VSSE 3QK8A 3H0QA 4OMRA 3QXIA 2ZL3A 4B3JA 1N6DA 4RYFH 3P85A 1WDLA 4FZWA 5FUSA 2W3PA 3R6HA 3P5MA 4OLQA 3SLLA 4I42A 3PE8A 3NJBA 1UYSA 3NJDA 2Q35A 3TT6A 4QIJA 1X0UA 3I47A 1N6EA 4Z0MA 4JJTA 5G1SA 1UIYA 4KPKA 1XNWA 2ZL0A 3N6RB 4JCSA 3U9TB 4WCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F9I A;  4ZDE A;  3TLF A;  3DOR A;  2PPY A;  3WG5 A;  4ASI A;  3KTJ A;  1EF8 A;  4ZU2 A;  3GF7 A;  3T89 A;  4QFE A;  1WDM A;  2VSU E;  5KJP A;  2GTR A;  2VSU A;  4KWB A;  1HNU A;  4DI1 A;  4FND A;  1YG6 A;  4OG1 A;  3P2L A;  4FN8 A;  5FIF A;  1Y7O A;  4QII A;  2EJ5 A;  3R9T A;  4K3W A;  4B3H A;  3TT7 A;  4EMM A;  4GHN A;  4I4Z A;  3TVU A;  3GLM A;  5C9G A;  2IEX A;  4JFC A;  4F47 A;  1DUB A;  2ZL4 A;  3MOY A;  4NNQ A;  4ELS A;  2D3T A;  2WTB A;  2HW5 A;  1VRG A;  4U0G H;  5ING A;  5DU8 A;  2VSS F;  3LAO A;  2J5G D;  4FB8 A;  1K32 A;  2VX2 A;  3ZWB A;  2ZQR A;  4JYJ A;  3SWX A;  3QRE A;  3PZK A;  2VRE A;  2BZR A;  3L3S A;  3OT6 A;  5DU6 A;  3RST A;  3BEZ A;  1MJ3 A;  4ELW A;  3K8X A;  4JSB A;  1UYV A;  3OC7 A;  3QMJ A;  3PGQ A;  1RJM A;  3Q0J A;  3G64 A;  3HRX A;  3QKA A;  1TG6 A;  3IB9 A;  3TRR A;  3R9Q A;  4U0G A;  3STA A;  5KDR B;  2A81 A;  5CTC A;  3ZW9 A;  2C8T A;  1UYR A;  4LK5 A;  4JCQ A;  1SZO A;  3BPP A;  3TDC A;  1RJN A;  2NP9 A;  5INI A;  5JBX A;  5DZK H;  1Q51 A;  1PJH A;  2J5S A;  3RSI A;  5C90 A;  4MOU A;  2J5I B;  5CTB A;  4ELX A;  3GMA A;  4U1A A;  1FC7 A;  1PIX A;  2VSU F;  2PG8 A;  4GM2 A;  3U9R B;  4IZC A;  4YLH A;  4FNB A;  4K29 A;  3KQF A;  1K39 A;  2X24 A;  3PEA A;  2Q34 A;  1OD4 A;  4FN7 A;  4HC8 A;  5JBW A;  4EMP A;  4IZD A;  3MFM A;  5DZK A;  3T8B A;  3ZWA A;  3R9S A;  4K2N A;  5INF A;  1NZY B;  3Q0G A;  3T8A A;  2FW2 A;  1FC6 A;  2X58 A;  1JXZ A;  1WDK A;  3HE2 A;  4U18 A;  1XNV A;  5G1Q A;  5KDR A;  3DJA A;  1Q52 A;  2ZQQ A;  4FZW C;  4HNK A;  1UYT A;  1HZD A;  4L8K A;  3BF0 A;  4JWV A;  4ZDD A;  5DUC A;  3HIN A;  2F9I B;  1OD2 A;  1EY3 A;  3KTK A;  1XO6 A;  1N6F A;  4EML A;  4FJW D;  2F9Y B;  2CE3 A;  3IAV A;  3H81 A;  2FBM A;  3MYB A;  2CBY A;  4MXI A;  1FCF A;  3ST9 A;  1WZ8 A;  5IKL B;  1TYF A;  1ON9 A;  3M6N A;  3KTG A;  4NEK A;  1W2X A;  4WZ8 B;  4G2R A;  3Q7H A;  3OME A;  3IBB A;  2VSS A;  4U0H A;  1XX4 A;  3TV5 A;  4ZDC A;  4KNP A;  2ZL2 A;  4IZB A;  3QXZ A;  2QQ3 A;  4I52 A;  1O8U A;  3HLN 1;  2VSU C;  3VIV A;  3TZ3 A;  3T3W A;  2DEO A;  5DKP A;  1NZY A;  3GF3 A;  3QYR A;  3MT6 A;  3FDU A;  5G1R A;  3TVW A;  3JU1 A;  3H0U A;  3ZW8 A;  3Q1T A;  5DL1 A;  5DUF A;  5DU4 A;  4RYF A;  1EF9 A;  4Q0G A;  3K50 A;  2F6Q A;  4JCT A;  1XNY A;  4Q1I A;  3V5I A;  4JOT A;  2F6I A;  5E0S H;  3QWD A;  2F9Y A;  1HNO A;  5DTW A;  3H0S A;  3KTH A;  4JCR A;  3H02 A;  3FF6 A;  3KTI A;  5MGB A;  4RCN A;  4L6W A;  2A7K A;  3U9S B;  2J5I I;  3RRV A;  2J5G A;  4WYO B;  4JYL A;  3H0J A;  5DTP A;  4ZDF A;  5E0S A;  3V5E A;  3ISA A;  2A7S A;  1FC9 A;  3M6M A;  4MI2 A;  2UZF A;  2DUB A;  3HP0 A;  4ZDB A;  4JVT A;  3R0O A;  4KD6 A;  1ON3 A;  4B3I A;  1YG8 A;  3T88 A;  1SG4 A;  3LKE A;  2PBP A;  4U19 A;  5E0N X;  1DCI A;  3GKB A;  3ZWC A;  1J7X A;  2FZS A;  2J5I A;  2Q2X A;  2VSS E;  3QK8 A;  3H0Q A;  4OMR A;  3QXI A;  2ZL3 A;  4B3J A;  1N6D A;  4RYF H;  3P85 A;  1WDL A;  4FZW A;  5FUS A;  2W3P A;  3R6H A;  3P5M A;  4OLQ A;  3SLL A;  4I42 A;  3PE8 A;  3NJB A;  1UYS A;  3NJD A;  2Q35 A;  3TT6 A;  4QIJ A;  1X0U A;  3I47 A;  1N6E A;  4Z0M A;  4JJT A;  5G1S A;  1UIY A;  4KPK A;  1XNW A;  2ZL0 A;  3N6R B;  4JCS A;  3U9T B;  4WCZ A; 
#chains in the Genus database with same CATH topology
 2F9I A;  4ZDE A;  3TLF A;  3DOR A;  2PPY A;  3WG5 A;  4ASI A;  3KTJ A;  1EF8 A;  4ZU2 A;  3GF7 A;  3T89 A;  4QFE A;  1WDM A;  2VSU E;  5KJP A;  2GTR A;  2VSU A;  4KWB A;  1HNU A;  5HUQ A;  4DI1 A;  4FND A;  1YG6 A;  4OG1 A;  3P2L A;  4FN8 A;  5FIF A;  1Y7O A;  4QII A;  2EJ5 A;  3R9T A;  4K3W A;  4B3H A;  3TT7 A;  4EMM A;  4GHN A;  4I4Z A;  3TVU A;  3GLM A;  5C9G A;  2IEX A;  4JFC A;  4F47 A;  1DUB A;  2ZL4 A;  3MOY A;  4NNQ A;  4ELS A;  2D3T A;  2WTB A;  2HW5 A;  1VRG A;  4U0G H;  5ING A;  5DU8 A;  2VSS F;  3LAO A;  2J5G D;  4FB8 A;  1K32 A;  2VX2 A;  3ZWB A;  2ZQR A;  4JYJ A;  3SWX A;  3QRE A;  3PZK A;  2VRE A;  2BZR A;  3L3S A;  3OT6 A;  5DU6 A;  3RST A;  3BEZ A;  1MJ3 A;  4ELW A;  3K8X A;  4JSB A;  1UYV A;  3OC7 A;  3QMJ A;  3PGQ A;  1RJM A;  4NAR A;  3Q0J A;  3G64 A;  3HRX A;  3QKA A;  1TG6 A;  3IB9 A;  3TRR A;  3R9Q A;  4U0G A;  3STA A;  5KDR B;  2A81 A;  5CTC A;  3ZW9 A;  2C8T A;  1UYR A;  4LK5 A;  4JCQ A;  1SZO A;  3BPP A;  3TDC A;  1RJN A;  2NP9 A;  5INI A;  5JBX A;  5DZK H;  1Q51 A;  1PJH A;  2J5S A;  3RSI A;  5C90 A;  4MOU A;  2J5I B;  5CTB A;  4ELX A;  3GMA A;  4U1A A;  1FC7 A;  1PIX A;  2VSU F;  2PG8 A;  4GM2 A;  3U9R B;  4IZC A;  4YLH A;  4FNB A;  4K29 A;  3KQF A;  1K39 A;  2X24 A;  3PEA A;  2Q34 A;  1OD4 A;  4FN7 A;  4HC8 A;  5JBW A;  4EMP A;  4IZD A;  3MFM A;  5DZK A;  3T8B A;  3ZWA A;  3R9S A;  4K2N A;  5INF A;  1NZY B;  3Q0G A;  3T8A A;  2FW2 A;  1FC6 A;  2X58 A;  1JXZ A;  1WDK A;  4HDT A;  3HE2 A;  4U18 A;  1XNV A;  5G1Q A;  5KDR A;  3DJA A;  1Q52 A;  2ZQQ A;  4FZW C;  4HNK A;  1UYT A;  1HZD A;  4L8K A;  3BF0 A;  4JWV A;  4ZDD A;  5DUC A;  3HIN A;  2F9I B;  1OD2 A;  1EY3 A;  3KTK A;  1XO6 A;  1N6F A;  4EML A;  4FJW D;  2F9Y B;  2CE3 A;  3IAV A;  3H81 A;  2FBM A;  3MYB A;  2CBY A;  4MXI A;  1FCF A;  3ST9 A;  1WZ8 A;  5IKL B;  1TYF A;  1ON9 A;  3M6N A;  3KTG A;  4NEK A;  1W2X A;  4WZ8 B;  4G2R A;  3Q7H A;  3OME A;  3IBB A;  2VSS A;  4U0H A;  1XX4 A;  3TV5 A;  4J2U A;  4ZDC A;  4KNP A;  2ZL2 A;  4IZB A;  3QXZ A;  2QQ3 A;  4I52 A;  1O8U A;  3HLN 1;  2VSU C;  3VIV A;  3TZ3 A;  3T3W A;  2DEO A;  5DKP A;  1NZY A;  3GF3 A;  3QYR A;  3MT6 A;  3FDU A;  5G1R A;  3TVW A;  3JU1 A;  3H0U A;  3ZW8 A;  3Q1T A;  5DL1 A;  2YJG A;  5DUF A;  5DU4 A;  4RYF A;  1EF9 A;  4Q0G A;  4JCT A;  3K50 A;  2F6Q A;  3BPT A;  1XNY A;  4Q1I A;  3V5I A;  4JOT A;  2F6I A;  5E0S H;  3QWD A;  2F9Y A;  1HNO A;  5DTW A;  3H0S A;  3KTH A;  4JCR A;  3H02 A;  3FF6 A;  3KTI A;  5MGB A;  4RCN A;  4L6W A;  2A7K A;  3U9S B;  2J5I I;  3RRV A;  2J5G A;  4WYO B;  4JYL A;  3H0J A;  5DTP A;  4ZDF A;  5E0S A;  3V5E A;  3ISA A;  2A7S A;  1FC9 A;  3M6M A;  4MI2 A;  2UZF A;  2DUB A;  3HP0 A;  4ZDB A;  4JVT A;  3R0O A;  4KD6 A;  1ON3 A;  4B3I A;  1YG8 A;  3T88 A;  1SG4 A;  3LKE A;  2PBP A;  4U19 A;  5E0N X;  1DCI A;  3GKB A;  3ZWC A;  1J7X A;  2FZS A;  2J5I A;  2Q2X A;  2VSS E;  3QK8 A;  3H0Q A;  4OMR A;  3QXI A;  2ZL3 A;  4B3J A;  1N6D A;  4RYF H;  3P85 A;  1WDL A;  4FZW A;  5FUS A;  2W3P A;  3R6H A;  3P5M A;  4OLQ A;  3SLL A;  4I42 A;  3PE8 A;  3NJB A;  1UYS A;  3NJD A;  2Q35 A;  3TT6 A;  4QIJ A;  1X0U A;  3I47 A;  1N6E A;  4Z0M A;  4JJT A;  5G1S A;  1UIY A;  4KPK A;  1XNW A;  2ZL0 A;  3N6R B;  4JCS A;  3U9T B;  4WCZ A; 
#chains in the Genus database with same CATH homology
 2F9I A;  4ZDE A;  3TLF A;  3DOR A;  2PPY A;  3WG5 A;  4ASI A;  3KTJ A;  1EF8 A;  4ZU2 A;  3GF7 A;  3T89 A;  4QFE A;  1WDM A;  2VSU E;  5KJP A;  2GTR A;  2VSU A;  4KWB A;  1HNU A;  5HUQ A;  4DI1 A;  4FND A;  1YG6 A;  4OG1 A;  3P2L A;  4FN8 A;  5FIF A;  1Y7O A;  4QII A;  2EJ5 A;  3R9T A;  4K3W A;  4B3H A;  3TT7 A;  4EMM A;  4GHN A;  4I4Z A;  3TVU A;  3GLM A;  5C9G A;  2IEX A;  4JFC A;  4F47 A;  1DUB A;  2ZL4 A;  3MOY A;  4NNQ A;  4ELS A;  2D3T A;  2WTB A;  2HW5 A;  1VRG A;  4U0G H;  5ING A;  5DU8 A;  2VSS F;  3LAO A;  2J5G D;  4FB8 A;  1K32 A;  2VX2 A;  3ZWB A;  2ZQR A;  4JYJ A;  3SWX A;  3QRE A;  3PZK A;  2VRE A;  2BZR A;  3L3S A;  3OT6 A;  5DU6 A;  3RST A;  3BEZ A;  1MJ3 A;  4ELW A;  3K8X A;  4JSB A;  1UYV A;  3OC7 A;  3QMJ A;  3PGQ A;  1RJM A;  4NAR A;  3Q0J A;  3G64 A;  3HRX A;  3QKA A;  1TG6 A;  3IB9 A;  3TRR A;  3R9Q A;  4U0G A;  3STA A;  5KDR B;  2A81 A;  5CTC A;  3ZW9 A;  2C8T A;  1UYR A;  4LK5 A;  4JCQ A;  1SZO A;  3BPP A;  3TDC A;  1RJN A;  2NP9 A;  5INI A;  5JBX A;  5DZK H;  1Q51 A;  1PJH A;  2J5S A;  3RSI A;  5C90 A;  4MOU A;  2J5I B;  5CTB A;  4ELX A;  3GMA A;  4U1A A;  1FC7 A;  1PIX A;  2VSU F;  2PG8 A;  4GM2 A;  3U9R B;  4IZC A;  4YLH A;  4FNB A;  4K29 A;  3KQF A;  1K39 A;  2X24 A;  3PEA A;  2Q34 A;  1OD4 A;  4FN7 A;  4HC8 A;  5JBW A;  4EMP A;  4IZD A;  3MFM A;  5DZK A;  3T8B A;  3ZWA A;  3R9S A;  4K2N A;  5INF A;  1NZY B;  3Q0G A;  3T8A A;  2FW2 A;  1FC6 A;  2X58 A;  1JXZ A;  1WDK A;  4HDT A;  3HE2 A;  4U18 A;  1XNV A;  5G1Q A;  5KDR A;  3DJA A;  1Q52 A;  2ZQQ A;  4FZW C;  4HNK A;  1UYT A;  1HZD A;  4L8K A;  3BF0 A;  4JWV A;  4ZDD A;  5DUC A;  3HIN A;  2F9I B;  1OD2 A;  1EY3 A;  3KTK A;  1XO6 A;  1N6F A;  4EML A;  4FJW D;  2F9Y B;  2CE3 A;  3IAV A;  3H81 A;  2FBM A;  3MYB A;  2CBY A;  4MXI A;  1FCF A;  3ST9 A;  1WZ8 A;  5IKL B;  1TYF A;  1ON9 A;  3M6N A;  3KTG A;  4NEK A;  1W2X A;  4WZ8 B;  4G2R A;  3Q7H A;  3OME A;  3IBB A;  2VSS A;  4U0H A;  1XX4 A;  3TV5 A;  4J2U A;  4ZDC A;  4KNP A;  2ZL2 A;  4IZB A;  3QXZ A;  2QQ3 A;  4I52 A;  1O8U A;  3HLN 1;  2VSU C;  3VIV A;  3TZ3 A;  3T3W A;  2DEO A;  5DKP A;  1NZY A;  3GF3 A;  3QYR A;  3MT6 A;  3FDU A;  5G1R A;  3TVW A;  3JU1 A;  3H0U A;  3ZW8 A;  3Q1T A;  5DL1 A;  2YJG A;  5DUF A;  5DU4 A;  4RYF A;  1EF9 A;  4Q0G A;  4JCT A;  3K50 A;  2F6Q A;  3BPT A;  1XNY A;  4Q1I A;  3V5I A;  4JOT A;  2F6I A;  5E0S H;  3QWD A;  2F9Y A;  1HNO A;  5DTW A;  3H0S A;  3KTH A;  4JCR A;  3H02 A;  3FF6 A;  3KTI A;  5MGB A;  4RCN A;  4L6W A;  2A7K A;  3U9S B;  2J5I I;  3RRV A;  2J5G A;  4WYO B;  4JYL A;  3H0J A;  5DTP A;  4ZDF A;  5E0S A;  3V5E A;  3ISA A;  2A7S A;  1FC9 A;  3M6M A;  4MI2 A;  2UZF A;  2DUB A;  3HP0 A;  4ZDB A;  4JVT A;  3R0O A;  4KD6 A;  1ON3 A;  4B3I A;  1YG8 A;  3T88 A;  1SG4 A;  3LKE A;  2PBP A;  4U19 A;  5E0N X;  1DCI A;  3GKB A;  3ZWC A;  1J7X A;  2FZS A;  2J5I A;  2Q2X A;  2VSS E;  3QK8 A;  3H0Q A;  4OMR A;  3QXI A;  2ZL3 A;  4B3J A;  1N6D A;  4RYF H;  3P85 A;  1WDL A;  4FZW A;  5FUS A;  2W3P A;  3R6H A;  3P5M A;  4OLQ A;  3SLL A;  4I42 A;  3PE8 A;  3NJB A;  1UYS A;  3NJD A;  2Q35 A;  3TT6 A;  4QIJ A;  1X0U A;  3I47 A;  1N6E A;  4Z0M A;  4JJT A;  5G1S A;  1UIY A;  4KPK A;  1XNW A;  2ZL0 A;  3N6R B;  4JCS A;  3U9T B;  4WCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...