2VSUE

A ternary complex of hydroxycinnamoyl-coa hydratase-lyase (hchl) with acetyl-coenzyme a and vanillin gives insights into substrate specificity and mechanism.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
247
structure length
245
Chain Sequence
TYEGRWKTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYFREVGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINYGIPPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKLDQSRLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Ternary Complex of Hydroxycinnamoyl-Coa Hydratase-Lyase (Hchl) with Acetyl-Coa and Vanillin Gives Insights Into Substrate Specificity and Mechanism.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
total genus 98
structure length 245
sequence length 247
ec nomenclature ec 4.1.2.41: Vanillin synthase.
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2vsuE01
1RJNA 1UYVA 2DUBA 4U0HA 3FF6A 2PG8A 4U0GH 1HZDA 4LK5A 4JWVA 4JOTA 1OD2A 1XNYA 2FZSA 4FJWD 4MI2A 4B3JA 1EF8A 2W3PA 3OC7A 3IB9A 3QXZA 5CTBA 3ZWAA 4KD6A 2VSSA 1ON9A 3TT6A 4JCQA 3DORA 1PJHA 4ZDDA 4GM2A 1N6DA 1EY3A 5KJPA 4HC8A 3IBBA 4RYFA 3V5EA 3GF7A 4I52A 3TVWA 1NZYA 4I42A 2BZRA 4B3IA 4L6WA 3ZW9A 5DU8A 4K2NA 3MT6A 1K32A 2VREA 3T3WA 3STAA 3KTGA 4IZDA 3R9SA 1VRGA 3BPPA 3TLFA 1MJ3A 1N6FA 2Q2XA 3KTJA 2F9IB 3GKBA 1FC6A 1WDLA 1DUBA 4JCRA 4RYFH 3OT6A 1FC7A 3Q0JA 1N6EA 1HNOA 4L8KA 4ZU2A 5DU4A 1X0UA 4JYJA 3TDCA 1UYSA 3QMJA 3QKAA 3P85A 3R6HA 4JJTA 4FN8A 4ZDBA 2X24A 5DTWA 3PEAA 5E0SA 1Y7OA 2QQ3A 3TVUA 1XO6A 1FCFA 4KWBA 1DCIA 2J5IA 4FB8A 3BEZA 3V5IA 5INFA 3LAOA 3ZWCA 3Q0GA 2CBYA 3ISAA 2F9YA 2EJ5A 2HW5A 1HNUA 3HRXA 4DI1A 3OMEA 4FN7A 4ZDFA 4U1AA 2VSUE 5E0SH 4QIIA 3M6NA 3IAVA 3U9TB 5DZKH 3GF3A 1ON3A 1TG6A 2J5SA 3RSTA 3M6MA 5C9GA 2ZQRA 3H0QA 4ZDCA 1UYTA 5MGBA 3H02A 3SLLA 3HINA 2FBMA 3NJDA 3MFMA 1YG8A 3QK8A 4FNDA 1JXZA 1SZOA 4I4ZA 3Q1TA 3T89A 4FNBA 2FW2A 4NEKA 4KPKA 4QIJA 4WYOB 1WDKA 3KQFA 1OD4A 3TV5A 2ZL4A 3QYRA 1W2XA 4K29A 3Q7HA 1UIYA 3I47A 3TZ3A 5INGA 4WCZA 2F9YB 5CTCA 2A81A 4U18A 2ZL2A 1O8UA 2C8TA 4ELWA 1XNWA 4JCSA 5C90A 3HE2A 2VX2A 1FC9A 3MYBA 3TRRA 2DEOA 4HNKA 4G2RA 4RCNA 3T8AA 1WDMA 3PZKA 1Q52A 1TYFA 4IZBA 3KTHA 2VSUA 1YG6A 2VSSE 5DUFA 3GMAA 3K50A 4FZWA 4KNPA 4ASIA 3BF0A 3DJAA 4U19A 5G1QA 3P2LA 2F6QA 1XX4A 4GHNA 3QWDA 2UZFA 2PPYA 1XNVA 5DZKA 3T8BA 4JSBA 2J5II 2F6IA 2GTRA 5G1SA 5FUSA 3LKEA 3H0UA 2J5IB 2IEXA 4NNQA 3WG5A 2NP9A 3FDUA 3PGQA 2Q34A 3QREA 4JCTA 4ELXA 5INIA 3U9RB 3RSIA 4B3HA 2VSSF 4ELSA 3ST9A 1UYRA 2VSUF 3KTIA 2A7SA 2WTBA 3U9SB 2ZL3A 1SG4A 3GLMA 2D3TA 2PBPA 1Q51A 4F47A 4K3WA 4WZ8B 4JVTA 5E0NX 3ZWBA 2ZL0A 3QXIA 2A7KA 5FIFA 4MOUA 4JYLA 3RRVA 1K39A 3KTKA 4OLQA 2Q35A 3H0SA 2VSUC 1NZYB 4FZWC 3R9TA 4Z0MA 4MXIA 5DU6A 4ZDEA 3R0OA 3JU1A 5DL1A 2J5GA 5DUCA 4QFEA 2J5GD 3R9QA 3HP0A 4OMRA 3TT7A 1RJMA 4YLHA 3PE8A 3MOYA 5KDRB 4OG1A 3VIVA 4EMLA 5JBWA 3H0JA 3H81A 3SWXA 3ZW8A 3HLN1 2ZQQA 4Q1IA 5G1RA 4EMPA 1EF9A 3T88A 2CE3A 3L3SA 2X58A 1J7XA 1PIXA 5DTPA 5DKPA 4Q0GA 3K8XA 3G64A 5KDRA 3NJBA 1WZ8A 3P5MA 4IZCA 5JBXA 4U0GA 3N6RB 4EMMA 4JFCA 5IKLB 2F9IA
chains in the Genus database with same CATH superfamily
1RJNA 1UYVA 2DUBA 4U0HA 3FF6A 2PG8A 4U0GH 1HZDA 4LK5A 4JWVA 4JOTA 1OD2A 1XNYA 2FZSA 4FJWD 4MI2A 4B3JA 1EF8A 2W3PA 3OC7A 3IB9A 3QXZA 5CTBA 5HUQA 3ZWAA 4KD6A 2VSSA 1ON9A 3TT6A 4JCQA 3DORA 1PJHA 4ZDDA 4GM2A 1N6DA 1EY3A 5KJPA 4HC8A 3IBBA 4RYFA 3V5EA 3GF7A 4I52A 3TVWA 1NZYA 4I42A 4J2UA 2BZRA 4B3IA 4L6WA 3ZW9A 5DU8A 4K2NA 3MT6A 1K32A 2YJGA 2VREA 3T3WA 3STAA 3KTGA 4IZDA 3R9SA 1VRGA 3BPPA 3TLFA 1MJ3A 1N6FA 2Q2XA 3KTJA 2F9IB 3GKBA 1FC6A 1WDLA 1DUBA 4JCRA 4RYFH 3OT6A 1FC7A 3Q0JA 1N6EA 1HNOA 4L8KA 4ZU2A 5DU4A 1X0UA 4JYJA 3TDCA 1UYSA 3QMJA 3QKAA 3P85A 3R6HA 4JJTA 4FN8A 4ZDBA 2X24A 5DTWA 3PEAA 5E0SA 1Y7OA 2QQ3A 3TVUA 1XO6A 1FCFA 4KWBA 1DCIA 2J5IA 4FB8A 3BEZA 3V5IA 5INFA 3LAOA 3ZWCA 3Q0GA 2CBYA 3ISAA 2F9YA 2EJ5A 2HW5A 1HNUA 3HRXA 4DI1A 3OMEA 4FN7A 3BPTA 4ZDFA 4U1AA 2VSUE 5E0SH 4QIIA 3M6NA 3IAVA 3U9TB 5DZKH 3GF3A 1ON3A 1TG6A 2J5SA 3RSTA 3M6MA 5C9GA 2ZQRA 3H0QA 4ZDCA 1UYTA 5MGBA 3H02A 3SLLA 3HINA 2FBMA 3NJDA 3MFMA 1YG8A 3QK8A 4FNDA 1JXZA 1SZOA 4I4ZA 3Q1TA 3T89A 4FNBA 2FW2A 4NEKA 4KPKA 4QIJA 4WYOB 1WDKA 3KQFA 1OD4A 3TV5A 2ZL4A 3QYRA 1W2XA 4K29A 3Q7HA 1UIYA 3I47A 3TZ3A 5INGA 4WCZA 2F9YB 5CTCA 2A81A 4U18A 2ZL2A 1O8UA 2C8TA 4ELWA 1XNWA 4JCSA 5C90A 3HE2A 2VX2A 4HDTA 1FC9A 3MYBA 3TRRA 2DEOA 4HNKA 4G2RA 4RCNA 3T8AA 1WDMA 3PZKA 1Q52A 1TYFA 4IZBA 3KTHA 2VSUA 1YG6A 2VSSE 5DUFA 3GMAA 3K50A 4FZWA 4KNPA 4ASIA 3BF0A 3DJAA 4U19A 5G1QA 3P2LA 2F6QA 1XX4A 4GHNA 3QWDA 2UZFA 2PPYA 1XNVA 5DZKA 3T8BA 4JSBA 2J5II 2F6IA 2GTRA 5G1SA 5FUSA 3LKEA 3H0UA 2J5IB 2IEXA 4NNQA 3WG5A 2NP9A 3FDUA 3PGQA 2Q34A 3QREA 4JCTA 4ELXA 5INIA 3U9RB 3RSIA 4B3HA 2VSSF 4ELSA 3ST9A 1UYRA 2VSUF 3KTIA 2A7SA 2WTBA 3U9SB 2ZL3A 1SG4A 4NARA 3GLMA 2D3TA 2PBPA 1Q51A 4F47A 4K3WA 4WZ8B 4JVTA 5E0NX 3ZWBA 2ZL0A 3QXIA 2A7KA 5FIFA 4MOUA 4JYLA 3RRVA 1K39A 3KTKA 4OLQA 2Q35A 3H0SA 2VSUC 1NZYB 4FZWC 3R9TA 4Z0MA 4MXIA 5DU6A 4ZDEA 3R0OA 3JU1A 5DL1A 2J5GA 5DUCA 4QFEA 2J5GD 3R9QA 3HP0A 4OMRA 3TT7A 1RJMA 4YLHA 3PE8A 3MOYA 5KDRB 4OG1A 3VIVA 4EMLA 5JBWA 3H0JA 3H81A 3SWXA 3ZW8A 3HLN1 2ZQQA 4Q1IA 5G1RA 4EMPA 1EF9A 3T88A 2CE3A 3L3SA 2X58A 1J7XA 1PIXA 5DTPA 5DKPA 4Q0GA 3K8XA 3G64A 3NJBA 5KDRA 1WZ8A 3P5MA 4IZCA 5JBXA 4U0GA 3N6RB 4EMMA 4JFCA 5IKLB 2F9IA
chains in the Genus database with same CATH topology
1RJNA 1UYVA 2DUBA 4U0HA 3FF6A 2PG8A 4U0GH 1HZDA 4LK5A 4JWVA 4JOTA 1OD2A 1XNYA 2FZSA 4FJWD 4MI2A 4B3JA 1EF8A 2W3PA 3OC7A 3IB9A 3QXZA 5CTBA 5HUQA 3ZWAA 4KD6A 2VSSA 1ON9A 3TT6A 4JCQA 3DORA 1PJHA 4ZDDA 4GM2A 1N6DA 1EY3A 5KJPA 4HC8A 3IBBA 4RYFA 3V5EA 3GF7A 4I52A 3TVWA 1NZYA 4I42A 4J2UA 2BZRA 4B3IA 4L6WA 3ZW9A 5DU8A 4K2NA 3MT6A 1K32A 2YJGA 2VREA 3T3WA 3STAA 3KTGA 4IZDA 3R9SA 1VRGA 3BPPA 3TLFA 1MJ3A 1N6FA 2Q2XA 3KTJA 2F9IB 3GKBA 1FC6A 1WDLA 1DUBA 4JCRA 4RYFH 3OT6A 1FC7A 3Q0JA 1N6EA 1HNOA 4L8KA 4ZU2A 5DU4A 1X0UA 4JYJA 3TDCA 1UYSA 3QMJA 3QKAA 3P85A 3R6HA 4JJTA 4FN8A 4ZDBA 2X24A 5DTWA 3PEAA 5E0SA 1Y7OA 2QQ3A 3TVUA 1XO6A 1FCFA 4KWBA 1DCIA 2J5IA 4FB8A 3BEZA 3V5IA 5INFA 3LAOA 3ZWCA 3Q0GA 2CBYA 3ISAA 2F9YA 2EJ5A 2HW5A 1HNUA 3HRXA 4DI1A 3OMEA 4FN7A 3BPTA 4ZDFA 4U1AA 2VSUE 5E0SH 4QIIA 3M6NA 3IAVA 3U9TB 5DZKH 3GF3A 1ON3A 1TG6A 2J5SA 3RSTA 3M6MA 5C9GA 2ZQRA 3H0QA 4ZDCA 1UYTA 5MGBA 3H02A 3SLLA 3HINA 2FBMA 3NJDA 3MFMA 1YG8A 3QK8A 4FNDA 1JXZA 1SZOA 4I4ZA 3Q1TA 3T89A 4FNBA 2FW2A 4NEKA 4KPKA 4QIJA 4WYOB 1WDKA 3KQFA 1OD4A 3TV5A 2ZL4A 3QYRA 1W2XA 4K29A 3Q7HA 1UIYA 3I47A 3TZ3A 5INGA 4WCZA 2F9YB 5CTCA 2A81A 4U18A 2ZL2A 1O8UA 2C8TA 4ELWA 1XNWA 4JCSA 5C90A 3HE2A 2VX2A 4HDTA 1FC9A 3MYBA 3TRRA 2DEOA 4HNKA 4G2RA 4RCNA 3T8AA 1WDMA 3PZKA 1Q52A 1TYFA 4IZBA 3KTHA 2VSUA 1YG6A 2VSSE 5DUFA 3GMAA 3K50A 4FZWA 4KNPA 4ASIA 3BF0A 3DJAA 4U19A 5G1QA 3P2LA 2F6QA 1XX4A 4GHNA 3QWDA 2UZFA 2PPYA 1XNVA 5DZKA 3T8BA 4JSBA 2J5II 2F6IA 2GTRA 5G1SA 5FUSA 3LKEA 3H0UA 2J5IB 2IEXA 4NNQA 3WG5A 2NP9A 3FDUA 3PGQA 2Q34A 3QREA 4JCTA 4ELXA 5INIA 3U9RB 3RSIA 4B3HA 2VSSF 4ELSA 3ST9A 1UYRA 2VSUF 3KTIA 2A7SA 2WTBA 3U9SB 2ZL3A 1SG4A 4NARA 3GLMA 2D3TA 2PBPA 1Q51A 4F47A 4K3WA 4WZ8B 4JVTA 5E0NX 3ZWBA 2ZL0A 3QXIA 2A7KA 5FIFA 4MOUA 4JYLA 3RRVA 1K39A 3KTKA 4OLQA 2Q35A 3H0SA 2VSUC 1NZYB 4FZWC 3R9TA 4Z0MA 4MXIA 5DU6A 4ZDEA 3R0OA 3JU1A 5DL1A 2J5GA 5DUCA 4QFEA 2J5GD 3R9QA 3HP0A 4OMRA 3TT7A 1RJMA 4YLHA 3PE8A 3MOYA 5KDRB 4OG1A 3VIVA 4EMLA 5JBWA 3H0JA 3H81A 3SWXA 3ZW8A 3HLN1 2ZQQA 4Q1IA 5G1RA 4EMPA 1EF9A 3T88A 2CE3A 3L3SA 2X58A 1J7XA 1PIXA 5DTPA 5DKPA 4Q0GA 3K8XA 3G64A 3NJBA 5KDRA 1WZ8A 3P5MA 4IZCA 5JBXA 4U0GA 3N6RB 4EMMA 4JFCA 5IKLB 2F9IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RJN A;  1UYV A;  2DUB A;  4U0H A;  3FF6 A;  2PG8 A;  4U0G H;  1HZD A;  4LK5 A;  4JWV A;  4JOT A;  1OD2 A;  1XNY A;  2FZS A;  4FJW D;  4MI2 A;  4B3J A;  1EF8 A;  2W3P A;  3OC7 A;  3IB9 A;  3QXZ A;  5CTB A;  3ZWA A;  4KD6 A;  2VSS A;  1ON9 A;  3TT6 A;  4JCQ A;  3DOR A;  1PJH A;  4ZDD A;  4GM2 A;  1N6D A;  1EY3 A;  5KJP A;  4HC8 A;  3IBB A;  4RYF A;  3V5E A;  3GF7 A;  4I52 A;  3TVW A;  1NZY A;  4I42 A;  2BZR A;  4B3I A;  4L6W A;  3ZW9 A;  5DU8 A;  4K2N A;  3MT6 A;  1K32 A;  2VRE A;  3T3W A;  3STA A;  3KTG A;  4IZD A;  3R9S A;  1VRG A;  3BPP A;  3TLF A;  1MJ3 A;  1N6F A;  2Q2X A;  3KTJ A;  2F9I B;  3GKB A;  1FC6 A;  1WDL A;  1DUB A;  4JCR A;  4RYF H;  3OT6 A;  1FC7 A;  3Q0J A;  1N6E A;  1HNO A;  4L8K A;  4ZU2 A;  5DU4 A;  1X0U A;  4JYJ A;  3TDC A;  1UYS A;  3QMJ A;  3QKA A;  3P85 A;  3R6H A;  4JJT A;  4FN8 A;  4ZDB A;  2X24 A;  5DTW A;  3PEA A;  5E0S A;  1Y7O A;  2QQ3 A;  3TVU A;  1XO6 A;  1FCF A;  4KWB A;  1DCI A;  2J5I A;  4FB8 A;  3BEZ A;  3V5I A;  5INF A;  3LAO A;  3ZWC A;  3Q0G A;  2CBY A;  3ISA A;  2F9Y A;  2EJ5 A;  2HW5 A;  1HNU A;  3HRX A;  4DI1 A;  3OME A;  4FN7 A;  4ZDF A;  4U1A A;  2VSU E;  5E0S H;  4QII A;  3M6N A;  3IAV A;  3U9T B;  5DZK H;  3GF3 A;  1ON3 A;  1TG6 A;  2J5S A;  3RST A;  3M6M A;  5C9G A;  2ZQR A;  3H0Q A;  4ZDC A;  1UYT A;  5MGB A;  3H02 A;  3SLL A;  3HIN A;  2FBM A;  3NJD A;  3MFM A;  1YG8 A;  3QK8 A;  4FND A;  1JXZ A;  1SZO A;  4I4Z A;  3Q1T A;  3T89 A;  4FNB A;  2FW2 A;  4NEK A;  4KPK A;  4QIJ A;  4WYO B;  1WDK A;  3KQF A;  1OD4 A;  3TV5 A;  2ZL4 A;  3QYR A;  1W2X A;  4K29 A;  3Q7H A;  1UIY A;  3I47 A;  3TZ3 A;  5ING A;  4WCZ A;  2F9Y B;  5CTC A;  2A81 A;  4U18 A;  2ZL2 A;  1O8U A;  2C8T A;  4ELW A;  1XNW A;  4JCS A;  5C90 A;  3HE2 A;  2VX2 A;  1FC9 A;  3MYB A;  3TRR A;  2DEO A;  4HNK A;  4G2R A;  4RCN A;  3T8A A;  1WDM A;  3PZK A;  1Q52 A;  1TYF A;  4IZB A;  3KTH A;  2VSU A;  1YG6 A;  2VSS E;  5DUF A;  3GMA A;  3K50 A;  4FZW A;  4KNP A;  4ASI A;  3BF0 A;  3DJA A;  4U19 A;  5G1Q A;  3P2L A;  2F6Q A;  1XX4 A;  4GHN A;  3QWD A;  2UZF A;  2PPY A;  1XNV A;  5DZK A;  3T8B A;  4JSB A;  2J5I I;  2F6I A;  2GTR A;  5G1S A;  5FUS A;  3LKE A;  3H0U A;  2J5I B;  2IEX A;  4NNQ A;  3WG5 A;  2NP9 A;  3FDU A;  3PGQ A;  2Q34 A;  3QRE A;  4JCT A;  4ELX A;  5INI A;  3U9R B;  3RSI A;  4B3H A;  2VSS F;  4ELS A;  3ST9 A;  1UYR A;  2VSU F;  3KTI A;  2A7S A;  2WTB A;  3U9S B;  2ZL3 A;  1SG4 A;  3GLM A;  2D3T A;  2PBP A;  1Q51 A;  4F47 A;  4K3W A;  4WZ8 B;  4JVT A;  5E0N X;  3ZWB A;  2ZL0 A;  3QXI A;  2A7K A;  5FIF A;  4MOU A;  4JYL A;  3RRV A;  1K39 A;  3KTK A;  4OLQ A;  2Q35 A;  3H0S A;  2VSU C;  1NZY B;  4FZW C;  3R9T A;  4Z0M A;  4MXI A;  5DU6 A;  4ZDE A;  3R0O A;  3JU1 A;  5DL1 A;  2J5G A;  5DUC A;  4QFE A;  2J5G D;  3R9Q A;  3HP0 A;  4OMR A;  3TT7 A;  1RJM A;  4YLH A;  3PE8 A;  3MOY A;  5KDR B;  4OG1 A;  3VIV A;  4EML A;  5JBW A;  3H0J A;  3H81 A;  3SWX A;  3ZW8 A;  3HLN 1;  2ZQQ A;  4Q1I A;  5G1R A;  4EMP A;  1EF9 A;  3T88 A;  2CE3 A;  3L3S A;  2X58 A;  1J7X A;  1PIX A;  5DTP A;  5DKP A;  4Q0G A;  3K8X A;  3G64 A;  5KDR A;  3NJB A;  1WZ8 A;  3P5M A;  4IZC A;  5JBX A;  4U0G A;  3N6R B;  4EMM A;  4JFC A;  5IKL B;  2F9I A; 
#chains in the Genus database with same CATH topology
 1RJN A;  1UYV A;  2DUB A;  4U0H A;  3FF6 A;  2PG8 A;  4U0G H;  1HZD A;  4LK5 A;  4JWV A;  4JOT A;  1OD2 A;  1XNY A;  2FZS A;  4FJW D;  4MI2 A;  4B3J A;  1EF8 A;  2W3P A;  3OC7 A;  3IB9 A;  3QXZ A;  5CTB A;  5HUQ A;  3ZWA A;  4KD6 A;  2VSS A;  1ON9 A;  3TT6 A;  4JCQ A;  3DOR A;  1PJH A;  4ZDD A;  4GM2 A;  1N6D A;  1EY3 A;  5KJP A;  4HC8 A;  3IBB A;  4RYF A;  3V5E A;  3GF7 A;  4I52 A;  3TVW A;  1NZY A;  4I42 A;  4J2U A;  2BZR A;  4B3I A;  4L6W A;  3ZW9 A;  5DU8 A;  4K2N A;  3MT6 A;  1K32 A;  2YJG A;  2VRE A;  3T3W A;  3STA A;  3KTG A;  4IZD A;  3R9S A;  1VRG A;  3BPP A;  3TLF A;  1MJ3 A;  1N6F A;  2Q2X A;  3KTJ A;  2F9I B;  3GKB A;  1FC6 A;  1WDL A;  1DUB A;  4JCR A;  4RYF H;  3OT6 A;  1FC7 A;  3Q0J A;  1N6E A;  1HNO A;  4L8K A;  4ZU2 A;  5DU4 A;  1X0U A;  4JYJ A;  3TDC A;  1UYS A;  3QMJ A;  3QKA A;  3P85 A;  3R6H A;  4JJT A;  4FN8 A;  4ZDB A;  2X24 A;  5DTW A;  3PEA A;  5E0S A;  1Y7O A;  2QQ3 A;  3TVU A;  1XO6 A;  1FCF A;  4KWB A;  1DCI A;  2J5I A;  4FB8 A;  3BEZ A;  3V5I A;  5INF A;  3LAO A;  3ZWC A;  3Q0G A;  2CBY A;  3ISA A;  2F9Y A;  2EJ5 A;  2HW5 A;  1HNU A;  3HRX A;  4DI1 A;  3OME A;  4FN7 A;  3BPT A;  4ZDF A;  4U1A A;  2VSU E;  5E0S H;  4QII A;  3M6N A;  3IAV A;  3U9T B;  5DZK H;  3GF3 A;  1ON3 A;  1TG6 A;  2J5S A;  3RST A;  3M6M A;  5C9G A;  2ZQR A;  3H0Q A;  4ZDC A;  1UYT A;  5MGB A;  3H02 A;  3SLL A;  3HIN A;  2FBM A;  3NJD A;  3MFM A;  1YG8 A;  3QK8 A;  4FND A;  1JXZ A;  1SZO A;  4I4Z A;  3Q1T A;  3T89 A;  4FNB A;  2FW2 A;  4NEK A;  4KPK A;  4QIJ A;  4WYO B;  1WDK A;  3KQF A;  1OD4 A;  3TV5 A;  2ZL4 A;  3QYR A;  1W2X A;  4K29 A;  3Q7H A;  1UIY A;  3I47 A;  3TZ3 A;  5ING A;  4WCZ A;  2F9Y B;  5CTC A;  2A81 A;  4U18 A;  2ZL2 A;  1O8U A;  2C8T A;  4ELW A;  1XNW A;  4JCS A;  5C90 A;  3HE2 A;  2VX2 A;  4HDT A;  1FC9 A;  3MYB A;  3TRR A;  2DEO A;  4HNK A;  4G2R A;  4RCN A;  3T8A A;  1WDM A;  3PZK A;  1Q52 A;  1TYF A;  4IZB A;  3KTH A;  2VSU A;  1YG6 A;  2VSS E;  5DUF A;  3GMA A;  3K50 A;  4FZW A;  4KNP A;  4ASI A;  3BF0 A;  3DJA A;  4U19 A;  5G1Q A;  3P2L A;  2F6Q A;  1XX4 A;  4GHN A;  3QWD A;  2UZF A;  2PPY A;  1XNV A;  5DZK A;  3T8B A;  4JSB A;  2J5I I;  2F6I A;  2GTR A;  5G1S A;  5FUS A;  3LKE A;  3H0U A;  2J5I B;  2IEX A;  4NNQ A;  3WG5 A;  2NP9 A;  3FDU A;  3PGQ A;  2Q34 A;  3QRE A;  4JCT A;  4ELX A;  5INI A;  3U9R B;  3RSI A;  4B3H A;  2VSS F;  4ELS A;  3ST9 A;  1UYR A;  2VSU F;  3KTI A;  2A7S A;  2WTB A;  3U9S B;  2ZL3 A;  1SG4 A;  4NAR A;  3GLM A;  2D3T A;  2PBP A;  1Q51 A;  4F47 A;  4K3W A;  4WZ8 B;  4JVT A;  5E0N X;  3ZWB A;  2ZL0 A;  3QXI A;  2A7K A;  5FIF A;  4MOU A;  4JYL A;  3RRV A;  1K39 A;  3KTK A;  4OLQ A;  2Q35 A;  3H0S A;  2VSU C;  1NZY B;  4FZW C;  3R9T A;  4Z0M A;  4MXI A;  5DU6 A;  4ZDE A;  3R0O A;  3JU1 A;  5DL1 A;  2J5G A;  5DUC A;  4QFE A;  2J5G D;  3R9Q A;  3HP0 A;  4OMR A;  3TT7 A;  1RJM A;  4YLH A;  3PE8 A;  3MOY A;  5KDR B;  4OG1 A;  3VIV A;  4EML A;  5JBW A;  3H0J A;  3H81 A;  3SWX A;  3ZW8 A;  3HLN 1;  2ZQQ A;  4Q1I A;  5G1R A;  4EMP A;  1EF9 A;  3T88 A;  2CE3 A;  3L3S A;  2X58 A;  1J7X A;  1PIX A;  5DTP A;  5DKP A;  4Q0G A;  3K8X A;  3G64 A;  3NJB A;  5KDR A;  1WZ8 A;  3P5M A;  4IZC A;  5JBX A;  4U0G A;  3N6R B;  4EMM A;  4JFC A;  5IKL B;  2F9I A; 
#chains in the Genus database with same CATH homology
 1RJN A;  1UYV A;  2DUB A;  4U0H A;  3FF6 A;  2PG8 A;  4U0G H;  1HZD A;  4LK5 A;  4JWV A;  4JOT A;  1OD2 A;  1XNY A;  2FZS A;  4FJW D;  4MI2 A;  4B3J A;  1EF8 A;  2W3P A;  3OC7 A;  3IB9 A;  3QXZ A;  5CTB A;  5HUQ A;  3ZWA A;  4KD6 A;  2VSS A;  1ON9 A;  3TT6 A;  4JCQ A;  3DOR A;  1PJH A;  4ZDD A;  4GM2 A;  1N6D A;  1EY3 A;  5KJP A;  4HC8 A;  3IBB A;  4RYF A;  3V5E A;  3GF7 A;  4I52 A;  3TVW A;  1NZY A;  4I42 A;  4J2U A;  2BZR A;  4B3I A;  4L6W A;  3ZW9 A;  5DU8 A;  4K2N A;  3MT6 A;  1K32 A;  2YJG A;  2VRE A;  3T3W A;  3STA A;  3KTG A;  4IZD A;  3R9S A;  1VRG A;  3BPP A;  3TLF A;  1MJ3 A;  1N6F A;  2Q2X A;  3KTJ A;  2F9I B;  3GKB A;  1FC6 A;  1WDL A;  1DUB A;  4JCR A;  4RYF H;  3OT6 A;  1FC7 A;  3Q0J A;  1N6E A;  1HNO A;  4L8K A;  4ZU2 A;  5DU4 A;  1X0U A;  4JYJ A;  3TDC A;  1UYS A;  3QMJ A;  3QKA A;  3P85 A;  3R6H A;  4JJT A;  4FN8 A;  4ZDB A;  2X24 A;  5DTW A;  3PEA A;  5E0S A;  1Y7O A;  2QQ3 A;  3TVU A;  1XO6 A;  1FCF A;  4KWB A;  1DCI A;  2J5I A;  4FB8 A;  3BEZ A;  3V5I A;  5INF A;  3LAO A;  3ZWC A;  3Q0G A;  2CBY A;  3ISA A;  2F9Y A;  2EJ5 A;  2HW5 A;  1HNU A;  3HRX A;  4DI1 A;  3OME A;  4FN7 A;  3BPT A;  4ZDF A;  4U1A A;  2VSU E;  5E0S H;  4QII A;  3M6N A;  3IAV A;  3U9T B;  5DZK H;  3GF3 A;  1ON3 A;  1TG6 A;  2J5S A;  3RST A;  3M6M A;  5C9G A;  2ZQR A;  3H0Q A;  4ZDC A;  1UYT A;  5MGB A;  3H02 A;  3SLL A;  3HIN A;  2FBM A;  3NJD A;  3MFM A;  1YG8 A;  3QK8 A;  4FND A;  1JXZ A;  1SZO A;  4I4Z A;  3Q1T A;  3T89 A;  4FNB A;  2FW2 A;  4NEK A;  4KPK A;  4QIJ A;  4WYO B;  1WDK A;  3KQF A;  1OD4 A;  3TV5 A;  2ZL4 A;  3QYR A;  1W2X A;  4K29 A;  3Q7H A;  1UIY A;  3I47 A;  3TZ3 A;  5ING A;  4WCZ A;  2F9Y B;  5CTC A;  2A81 A;  4U18 A;  2ZL2 A;  1O8U A;  2C8T A;  4ELW A;  1XNW A;  4JCS A;  5C90 A;  3HE2 A;  2VX2 A;  4HDT A;  1FC9 A;  3MYB A;  3TRR A;  2DEO A;  4HNK A;  4G2R A;  4RCN A;  3T8A A;  1WDM A;  3PZK A;  1Q52 A;  1TYF A;  4IZB A;  3KTH A;  2VSU A;  1YG6 A;  2VSS E;  5DUF A;  3GMA A;  3K50 A;  4FZW A;  4KNP A;  4ASI A;  3BF0 A;  3DJA A;  4U19 A;  5G1Q A;  3P2L A;  2F6Q A;  1XX4 A;  4GHN A;  3QWD A;  2UZF A;  2PPY A;  1XNV A;  5DZK A;  3T8B A;  4JSB A;  2J5I I;  2F6I A;  2GTR A;  5G1S A;  5FUS A;  3LKE A;  3H0U A;  2J5I B;  2IEX A;  4NNQ A;  3WG5 A;  2NP9 A;  3FDU A;  3PGQ A;  2Q34 A;  3QRE A;  4JCT A;  4ELX A;  5INI A;  3U9R B;  3RSI A;  4B3H A;  2VSS F;  4ELS A;  3ST9 A;  1UYR A;  2VSU F;  3KTI A;  2A7S A;  2WTB A;  3U9S B;  2ZL3 A;  1SG4 A;  4NAR A;  3GLM A;  2D3T A;  2PBP A;  1Q51 A;  4F47 A;  4K3W A;  4WZ8 B;  4JVT A;  5E0N X;  3ZWB A;  2ZL0 A;  3QXI A;  2A7K A;  5FIF A;  4MOU A;  4JYL A;  3RRV A;  1K39 A;  3KTK A;  4OLQ A;  2Q35 A;  3H0S A;  2VSU C;  1NZY B;  4FZW C;  3R9T A;  4Z0M A;  4MXI A;  5DU6 A;  4ZDE A;  3R0O A;  3JU1 A;  5DL1 A;  2J5G A;  5DUC A;  4QFE A;  2J5G D;  3R9Q A;  3HP0 A;  4OMR A;  3TT7 A;  1RJM A;  4YLH A;  3PE8 A;  3MOY A;  5KDR B;  4OG1 A;  3VIV A;  4EML A;  5JBW A;  3H0J A;  3H81 A;  3SWX A;  3ZW8 A;  3HLN 1;  2ZQQ A;  4Q1I A;  5G1R A;  4EMP A;  1EF9 A;  3T88 A;  2CE3 A;  3L3S A;  2X58 A;  1J7X A;  1PIX A;  5DTP A;  5DKP A;  4Q0G A;  3K8X A;  3G64 A;  3NJB A;  5KDR A;  1WZ8 A;  3P5M A;  4IZC A;  5JBX A;  4U0G A;  3N6R B;  4EMM A;  4JFC A;  5IKL B;  2F9I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...