2VSUE

A ternary complex of hydroxycinnamoyl-coa hydratase-lyase (hchl) with acetyl-coenzyme a and vanillin gives insights into substrate specificity and mechanism.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
247
structure length
245
Chain Sequence
TYEGRWKTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYFREVGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINYGIPPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKLDQSRLLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Ternary Complex of Hydroxycinnamoyl-Coa Hydratase-Lyase (Hchl) with Acetyl-Coa and Vanillin Gives Insights Into Substrate Specificity and Mechanism.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
molecule keywords P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
total genus 98
structure length 245
sequence length 247
ec nomenclature ec 4.1.2.41: Vanillin synthase.
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2vsuE01
4U18A 3P5MA 3OC7A 1WDLA 1XO6A 5DU8A 2NP9A 1FCFA 2W3PA 3R9SA 4K3WA 2J5II 3TDCA 4F47A 1J7XA 4B3JA 2F6IA 5INIA 4RYFA 3R0OA 1WZ8A 2VSSF 1SZOA 2J5SA 3OT6A 5INFA 3NJDA 3L3SA 2FW2A 3FDUA 4NNQA 5DU4A 2BZRA 1FC7A 1YG6A 1NZYB 4ZDEA 2CE3A 5MGBA 2F6QA 3JU1A 4OG1A 2VSUE 3H0UA 1OD2A 3IAVA 3QMJA 2QQ3A 5DUFA 3KTGA 4FNBA 3T3WA 4FZWC 4ELSA 3SLLA 4WZ8B 4JCTA 2X24A 2FBMA 1WDMA 4QIJA 4JCRA 2A81A 3GF3A 2F9YA 4K29A 4ZDDA 1DCIA 1RJNA 3QWDA 4L8KA 1UYVA 5G1SA 2WTBA 5E0NX 1JXZA 2ZL3A 3WG5A 3HRXA 5CTCA 4Q0GA 1HNOA 3HLN1 4HNKA 4I42A 4IZCA 4JYJA 4WYOB 5DZKH 2J5GA 3MOYA 5INGA 3GLMA 4K2NA 4U0GA 3ZW9A 3H0SA 5KJPA 4QIIA 1K39A 5IKLB 1XNVA 3GKBA 3Q1TA 4G2RA 3KTHA 1PIXA 1N6EA 3GMAA 3ST9A 3RSIA 2GTRA 2Q35A 2PBPA 4U19A 2A7SA 4EMMA 3RRVA 1TG6A 2PG8A 1HNUA 4U0HA 4RCNA 5JBWA 3T8BA 4JOTA 3MT6A 5FIFA 2A7KA 1N6FA 2CBYA 5DTPA 4U1AA 1UYRA 3VIVA 3OMEA 4FJWD 3N6RB 3MYBA 3PE8A 4KNPA 1EF9A 4ZDCA 2J5IA 4L6WA 2D3TA 4DI1A 2IEXA 4ASIA 1Y7OA 3G64A 1XNYA 5FUSA 4B3IA 5CTBA 4EMLA 1EY3A 4B3HA 3H0QA 3FF6A 1O8UA 3ZW8A 1XNWA 1NZYA 3TZ3A 3H0JA 3LKEA 3ZWCA 2VSSA 5E0SH 3SWXA 3Q0JA 3QREA 3Q7HA 1OD4A 1PJHA 3TT7A 3TT6A 2X58A 4KD6A 3K8XA 3I47A 3K50A 4KPKA 4RYFH 5G1RA 5KDRB 2C8TA 2ZL0A 3KQFA 4FN8A 4JJTA 3RSTA 4ZU2A 4FZWA 5G1QA 4JFCA 4IZBA 1UYSA 3T8AA 4JCQA 3ISAA 3V5IA 1W2XA 1FC9A 1ON9A 5C9GA 4Q1IA 2VSUC 4IZDA 4JYLA 3KTJA 3QXIA 2VSUA 4ELWA 4MXIA 3QYRA 2F9YB 2VX2A 1SG4A 3DORA 5DKPA 1UYTA 2HW5A 3QKAA 4OMRA 4EMPA 3QXZA 1EF8A 2VREA 3HP0A 4FNDA 3LAOA 1Q52A 4Z0MA 3PGQA 5DL1A 4FB8A 1WDKA 2DEOA 3U9RB 5DTWA 1YG8A 1ON3A 3PEAA 2EJ5A 3U9TB 2F9IB 3QK8A 3M6MA 3TRRA 3HINA 4HC8A 3STAA 1XX4A 4I52A 3ZWBA 4NEKA 4WCZA 2Q34A 1UIYA 3H02A 2J5IB 4ELXA 1HZDA 4MI2A 2UZFA 3R9QA 3TVUA 4QFEA 2ZQRA 5C90A 3BF0A 1Q51A 2VSUF 3TLFA 4GHNA 3P85A 4I4ZA 3T88A 1VRGA 2J5GD 4OLQA 1N6DA 3BEZA 5KDRA 3Q0GA 3M6NA 1DUBA 3NJBA 1FC6A 4JWVA 4ZDFA 1RJMA 3TVWA 3T89A 3GF7A 5JBXA 4KWBA 4JVTA 2F9IA 3MFMA 3H81A 2ZQQA 5DUCA 3R6HA 5DZKA 1X0UA 4U0GH 5DU6A 4GM2A 3U9SB 3HE2A 3TV5A 4LK5A 1TYFA 3DJAA 3P2LA 4MOUA 4FN7A 4JSBA 2Q2XA 1MJ3A 2ZL2A 3IBBA 3KTKA 2PPYA 3ZWAA 2ZL4A 4JCSA 2FZSA 3PZKA 4YLHA 2VSSE 3BPPA 2DUBA 3IB9A 3KTIA 3R9TA 1K32A 4ZDBA 3V5EA 5E0SA
chains in the Genus database with same CATH superfamily
4U18A 3P5MA 3OC7A 1WDLA 1XO6A 5DU8A 2NP9A 1FCFA 2W3PA 3R9SA 4K3WA 2J5II 3TDCA 4F47A 1J7XA 4B3JA 2F6IA 5INIA 4RYFA 3R0OA 1WZ8A 2VSSF 1SZOA 2J5SA 3OT6A 5INFA 3NJDA 3L3SA 2FW2A 3FDUA 4NNQA 5DU4A 2BZRA 1FC7A 1YG6A 1NZYB 4ZDEA 2CE3A 5MGBA 2F6QA 3JU1A 4OG1A 2VSUE 3H0UA 1OD2A 3IAVA 4NARA 3QMJA 2QQ3A 5DUFA 3KTGA 4FNBA 3T3WA 4FZWC 4ELSA 3SLLA 4WZ8B 4JCTA 2X24A 2FBMA 1WDMA 4QIJA 4JCRA 2A81A 3GF3A 2F9YA 4K29A 4ZDDA 1DCIA 1RJNA 3QWDA 4L8KA 1UYVA 5G1SA 2WTBA 5E0NX 1JXZA 2ZL3A 3WG5A 3HRXA 5CTCA 4Q0GA 1HNOA 3HLN1 4HNKA 4I42A 4IZCA 4JYJA 4WYOB 5DZKH 2J5GA 3MOYA 5INGA 3GLMA 4K2NA 4U0GA 3ZW9A 3H0SA 5KJPA 4QIIA 1K39A 5IKLB 1XNVA 3GKBA 3Q1TA 4G2RA 3KTHA 1PIXA 1N6EA 3GMAA 3ST9A 3RSIA 2GTRA 2Q35A 2PBPA 4U19A 2A7SA 4EMMA 3RRVA 1TG6A 2PG8A 1HNUA 4U0HA 4RCNA 5JBWA 3T8BA 4JOTA 3MT6A 5FIFA 2A7KA 1N6FA 2CBYA 5DTPA 4U1AA 1UYRA 3VIVA 3OMEA 4FJWD 3N6RB 3MYBA 3PE8A 4KNPA 1EF9A 4ZDCA 5HUQA 2J5IA 4L6WA 2D3TA 4DI1A 2IEXA 4ASIA 1Y7OA 3G64A 1XNYA 5FUSA 4B3IA 5CTBA 4EMLA 1EY3A 4B3HA 3H0QA 3FF6A 1O8UA 3ZW8A 1XNWA 1NZYA 3TZ3A 3H0JA 3LKEA 3ZWCA 2VSSA 5E0SH 3SWXA 3Q0JA 3QREA 3Q7HA 1OD4A 1PJHA 3TT7A 3TT6A 2X58A 4KD6A 3K8XA 3I47A 3K50A 4KPKA 4RYFH 5G1RA 5KDRB 2C8TA 2ZL0A 3KQFA 4FN8A 4JJTA 3RSTA 4ZU2A 4FZWA 5G1QA 4JFCA 4IZBA 1UYSA 3T8AA 4JCQA 3ISAA 3V5IA 1W2XA 1FC9A 1ON9A 5C9GA 4Q1IA 2VSUC 4IZDA 4JYLA 3KTJA 3QXIA 2VSUA 4ELWA 4MXIA 3QYRA 2F9YB 2VX2A 1SG4A 3DORA 5DKPA 1UYTA 2HW5A 3BPTA 3QKAA 4OMRA 4EMPA 3QXZA 1EF8A 2VREA 3HP0A 4FNDA 3LAOA 1Q52A 4Z0MA 3PGQA 5DL1A 2YJGA 4FB8A 4J2UA 1WDKA 2DEOA 3U9RB 5DTWA 1YG8A 1ON3A 3PEAA 2EJ5A 3U9TB 2F9IB 3QK8A 3M6MA 3TRRA 3HINA 4HC8A 3STAA 1XX4A 4I52A 3ZWBA 4NEKA 4WCZA 2Q34A 1UIYA 3H02A 2J5IB 4ELXA 1HZDA 4MI2A 2UZFA 3R9QA 3TVUA 4QFEA 2ZQRA 5C90A 3BF0A 4HDTA 1Q51A 2VSUF 3TLFA 4GHNA 3P85A 4I4ZA 3T88A 1VRGA 2J5GD 4OLQA 1N6DA 3BEZA 5KDRA 3Q0GA 3M6NA 1DUBA 3NJBA 1FC6A 4JWVA 4ZDFA 1RJMA 3TVWA 3T89A 3GF7A 5JBXA 4KWBA 4JVTA 2F9IA 3MFMA 3H81A 2ZQQA 5DUCA 3R6HA 5DZKA 1X0UA 4U0GH 5DU6A 4GM2A 3U9SB 3HE2A 3TV5A 4LK5A 1TYFA 3DJAA 3P2LA 4MOUA 4FN7A 4JSBA 2Q2XA 1MJ3A 2ZL2A 3IBBA 3KTKA 2PPYA 3ZWAA 2ZL4A 4JCSA 2FZSA 3PZKA 4YLHA 2VSSE 3BPPA 2DUBA 3IB9A 3KTIA 3R9TA 1K32A 4ZDBA 3V5EA 5E0SA
chains in the Genus database with same CATH topology
4U18A 3P5MA 3OC7A 1WDLA 1XO6A 5DU8A 2NP9A 1FCFA 2W3PA 3R9SA 4K3WA 2J5II 3TDCA 4F47A 1J7XA 4B3JA 2F6IA 5INIA 4RYFA 3R0OA 1WZ8A 2VSSF 1SZOA 2J5SA 3OT6A 5INFA 3NJDA 3L3SA 2FW2A 3FDUA 4NNQA 5DU4A 2BZRA 1FC7A 1YG6A 1NZYB 4ZDEA 2CE3A 5MGBA 2F6QA 3JU1A 4OG1A 2VSUE 3H0UA 1OD2A 3IAVA 4NARA 3QMJA 2QQ3A 5DUFA 3KTGA 4FNBA 3T3WA 4FZWC 4ELSA 3SLLA 4WZ8B 4JCTA 2X24A 2FBMA 1WDMA 4QIJA 4JCRA 2A81A 3GF3A 2F9YA 4K29A 4ZDDA 1DCIA 1RJNA 3QWDA 4L8KA 1UYVA 5G1SA 2WTBA 5E0NX 1JXZA 2ZL3A 3WG5A 3HRXA 5CTCA 4Q0GA 1HNOA 3HLN1 4HNKA 4I42A 4IZCA 4JYJA 4WYOB 5DZKH 2J5GA 3MOYA 5INGA 3GLMA 4K2NA 4U0GA 3ZW9A 3H0SA 5KJPA 4QIIA 1K39A 5IKLB 1XNVA 3GKBA 3Q1TA 4G2RA 3KTHA 1PIXA 1N6EA 3GMAA 3ST9A 3RSIA 2GTRA 2Q35A 2PBPA 4U19A 2A7SA 4EMMA 3RRVA 1TG6A 2PG8A 1HNUA 4U0HA 4RCNA 5JBWA 3T8BA 4JOTA 3MT6A 5FIFA 2A7KA 1N6FA 2CBYA 5DTPA 4U1AA 1UYRA 3VIVA 3OMEA 4FJWD 3N6RB 3MYBA 3PE8A 4KNPA 1EF9A 4ZDCA 5HUQA 2J5IA 4L6WA 2D3TA 4DI1A 2IEXA 4ASIA 1Y7OA 3G64A 1XNYA 5FUSA 4B3IA 5CTBA 4EMLA 1EY3A 4B3HA 3H0QA 3FF6A 1O8UA 3ZW8A 1XNWA 1NZYA 3TZ3A 3H0JA 3LKEA 3ZWCA 2VSSA 5E0SH 3SWXA 3Q0JA 3QREA 3Q7HA 1OD4A 1PJHA 3TT7A 3TT6A 2X58A 4KD6A 3K8XA 3I47A 3K50A 4KPKA 4RYFH 5G1RA 5KDRB 2C8TA 2ZL0A 3KQFA 4FN8A 4JJTA 3RSTA 4ZU2A 4FZWA 5G1QA 4JFCA 4IZBA 1UYSA 3T8AA 4JCQA 3ISAA 3V5IA 1W2XA 1FC9A 1ON9A 5C9GA 4Q1IA 2VSUC 4IZDA 4JYLA 3KTJA 3QXIA 2VSUA 4ELWA 4MXIA 3QYRA 2F9YB 2VX2A 1SG4A 3DORA 5DKPA 1UYTA 2HW5A 3BPTA 3QKAA 4OMRA 4EMPA 3QXZA 1EF8A 2VREA 3HP0A 4FNDA 3LAOA 1Q52A 4Z0MA 3PGQA 5DL1A 2YJGA 4FB8A 4J2UA 1WDKA 2DEOA 3U9RB 5DTWA 1YG8A 1ON3A 3PEAA 2EJ5A 3U9TB 2F9IB 3QK8A 3M6MA 3TRRA 3HINA 4HC8A 3STAA 1XX4A 4I52A 3ZWBA 4NEKA 4WCZA 2Q34A 1UIYA 3H02A 2J5IB 4ELXA 1HZDA 4MI2A 2UZFA 3R9QA 3TVUA 4QFEA 2ZQRA 5C90A 3BF0A 4HDTA 1Q51A 2VSUF 3TLFA 4GHNA 3P85A 4I4ZA 3T88A 1VRGA 2J5GD 4OLQA 1N6DA 3BEZA 5KDRA 3Q0GA 3M6NA 1DUBA 3NJBA 1FC6A 4JWVA 4ZDFA 1RJMA 3TVWA 3T89A 3GF7A 5JBXA 4KWBA 4JVTA 2F9IA 3MFMA 3H81A 2ZQQA 5DUCA 3R6HA 5DZKA 1X0UA 4U0GH 5DU6A 4GM2A 3U9SB 3HE2A 3TV5A 4LK5A 1TYFA 3DJAA 3P2LA 4MOUA 4FN7A 4JSBA 2Q2XA 1MJ3A 2ZL2A 3IBBA 3KTKA 2PPYA 3ZWAA 2ZL4A 4JCSA 2FZSA 3PZKA 4YLHA 2VSSE 3BPPA 2DUBA 3IB9A 3KTIA 3R9TA 1K32A 4ZDBA 3V5EA 5E0SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U18 A;  3P5M A;  3OC7 A;  1WDL A;  1XO6 A;  5DU8 A;  2NP9 A;  1FCF A;  2W3P A;  3R9S A;  4K3W A;  2J5I I;  3TDC A;  4F47 A;  1J7X A;  4B3J A;  2F6I A;  5INI A;  4RYF A;  3R0O A;  1WZ8 A;  2VSS F;  1SZO A;  2J5S A;  3OT6 A;  5INF A;  3NJD A;  3L3S A;  2FW2 A;  3FDU A;  4NNQ A;  5DU4 A;  2BZR A;  1FC7 A;  1YG6 A;  1NZY B;  4ZDE A;  2CE3 A;  5MGB A;  2F6Q A;  3JU1 A;  4OG1 A;  2VSU E;  3H0U A;  1OD2 A;  3IAV A;  3QMJ A;  2QQ3 A;  5DUF A;  3KTG A;  4FNB A;  3T3W A;  4FZW C;  4ELS A;  3SLL A;  4WZ8 B;  4JCT A;  2X24 A;  2FBM A;  1WDM A;  4QIJ A;  4JCR A;  2A81 A;  3GF3 A;  2F9Y A;  4K29 A;  4ZDD A;  1DCI A;  1RJN A;  3QWD A;  4L8K A;  1UYV A;  5G1S A;  2WTB A;  5E0N X;  1JXZ A;  2ZL3 A;  3WG5 A;  3HRX A;  5CTC A;  4Q0G A;  1HNO A;  3HLN 1;  4HNK A;  4I42 A;  4IZC A;  4JYJ A;  4WYO B;  5DZK H;  2J5G A;  3MOY A;  5ING A;  3GLM A;  4K2N A;  4U0G A;  3ZW9 A;  3H0S A;  5KJP A;  4QII A;  1K39 A;  5IKL B;  1XNV A;  3GKB A;  3Q1T A;  4G2R A;  3KTH A;  1PIX A;  1N6E A;  3GMA A;  3ST9 A;  3RSI A;  2GTR A;  2Q35 A;  2PBP A;  4U19 A;  2A7S A;  4EMM A;  3RRV A;  1TG6 A;  2PG8 A;  1HNU A;  4U0H A;  4RCN A;  5JBW A;  3T8B A;  4JOT A;  3MT6 A;  5FIF A;  2A7K A;  1N6F A;  2CBY A;  5DTP A;  4U1A A;  1UYR A;  3VIV A;  3OME A;  4FJW D;  3N6R B;  3MYB A;  3PE8 A;  4KNP A;  1EF9 A;  4ZDC A;  2J5I A;  4L6W A;  2D3T A;  4DI1 A;  2IEX A;  4ASI A;  1Y7O A;  3G64 A;  1XNY A;  5FUS A;  4B3I A;  5CTB A;  4EML A;  1EY3 A;  4B3H A;  3H0Q A;  3FF6 A;  1O8U A;  3ZW8 A;  1XNW A;  1NZY A;  3TZ3 A;  3H0J A;  3LKE A;  3ZWC A;  2VSS A;  5E0S H;  3SWX A;  3Q0J A;  3QRE A;  3Q7H A;  1OD4 A;  1PJH A;  3TT7 A;  3TT6 A;  2X58 A;  4KD6 A;  3K8X A;  3I47 A;  3K50 A;  4KPK A;  4RYF H;  5G1R A;  5KDR B;  2C8T A;  2ZL0 A;  3KQF A;  4FN8 A;  4JJT A;  3RST A;  4ZU2 A;  4FZW A;  5G1Q A;  4JFC A;  4IZB A;  1UYS A;  3T8A A;  4JCQ A;  3ISA A;  3V5I A;  1W2X A;  1FC9 A;  1ON9 A;  5C9G A;  4Q1I A;  2VSU C;  4IZD A;  4JYL A;  3KTJ A;  3QXI A;  2VSU A;  4ELW A;  4MXI A;  3QYR A;  2F9Y B;  2VX2 A;  1SG4 A;  3DOR A;  5DKP A;  1UYT A;  2HW5 A;  3QKA A;  4OMR A;  4EMP A;  3QXZ A;  1EF8 A;  2VRE A;  3HP0 A;  4FND A;  3LAO A;  1Q52 A;  4Z0M A;  3PGQ A;  5DL1 A;  4FB8 A;  1WDK A;  2DEO A;  3U9R B;  5DTW A;  1YG8 A;  1ON3 A;  3PEA A;  2EJ5 A;  3U9T B;  2F9I B;  3QK8 A;  3M6M A;  3TRR A;  3HIN A;  4HC8 A;  3STA A;  1XX4 A;  4I52 A;  3ZWB A;  4NEK A;  4WCZ A;  2Q34 A;  1UIY A;  3H02 A;  2J5I B;  4ELX A;  1HZD A;  4MI2 A;  2UZF A;  3R9Q A;  3TVU A;  4QFE A;  2ZQR A;  5C90 A;  3BF0 A;  1Q51 A;  2VSU F;  3TLF A;  4GHN A;  3P85 A;  4I4Z A;  3T88 A;  1VRG A;  2J5G D;  4OLQ A;  1N6D A;  3BEZ A;  5KDR A;  3Q0G A;  3M6N A;  1DUB A;  3NJB A;  1FC6 A;  4JWV A;  4ZDF A;  1RJM A;  3TVW A;  3T89 A;  3GF7 A;  5JBX A;  4KWB A;  4JVT A;  2F9I A;  3MFM A;  3H81 A;  2ZQQ A;  5DUC A;  3R6H A;  5DZK A;  1X0U A;  4U0G H;  5DU6 A;  4GM2 A;  3U9S B;  3HE2 A;  3TV5 A;  4LK5 A;  1TYF A;  3DJA A;  3P2L A;  4MOU A;  4FN7 A;  4JSB A;  2Q2X A;  1MJ3 A;  2ZL2 A;  3IBB A;  3KTK A;  2PPY A;  3ZWA A;  2ZL4 A;  4JCS A;  2FZS A;  3PZK A;  4YLH A;  2VSS E;  3BPP A;  2DUB A;  3IB9 A;  3KTI A;  3R9T A;  1K32 A;  4ZDB A;  3V5E A;  5E0S A; 
#chains in the Genus database with same CATH topology
 4U18 A;  3P5M A;  3OC7 A;  1WDL A;  1XO6 A;  5DU8 A;  2NP9 A;  1FCF A;  2W3P A;  3R9S A;  4K3W A;  2J5I I;  3TDC A;  4F47 A;  1J7X A;  4B3J A;  2F6I A;  5INI A;  4RYF A;  3R0O A;  1WZ8 A;  2VSS F;  1SZO A;  2J5S A;  3OT6 A;  5INF A;  3NJD A;  3L3S A;  2FW2 A;  3FDU A;  4NNQ A;  5DU4 A;  2BZR A;  1FC7 A;  1YG6 A;  1NZY B;  4ZDE A;  2CE3 A;  5MGB A;  2F6Q A;  3JU1 A;  4OG1 A;  2VSU E;  3H0U A;  1OD2 A;  3IAV A;  4NAR A;  3QMJ A;  2QQ3 A;  5DUF A;  3KTG A;  4FNB A;  3T3W A;  4FZW C;  4ELS A;  3SLL A;  4WZ8 B;  4JCT A;  2X24 A;  2FBM A;  1WDM A;  4QIJ A;  4JCR A;  2A81 A;  3GF3 A;  2F9Y A;  4K29 A;  4ZDD A;  1DCI A;  1RJN A;  3QWD A;  4L8K A;  1UYV A;  5G1S A;  2WTB A;  5E0N X;  1JXZ A;  2ZL3 A;  3WG5 A;  3HRX A;  5CTC A;  4Q0G A;  1HNO A;  3HLN 1;  4HNK A;  4I42 A;  4IZC A;  4JYJ A;  4WYO B;  5DZK H;  2J5G A;  3MOY A;  5ING A;  3GLM A;  4K2N A;  4U0G A;  3ZW9 A;  3H0S A;  5KJP A;  4QII A;  1K39 A;  5IKL B;  1XNV A;  3GKB A;  3Q1T A;  4G2R A;  3KTH A;  1PIX A;  1N6E A;  3GMA A;  3ST9 A;  3RSI A;  2GTR A;  2Q35 A;  2PBP A;  4U19 A;  2A7S A;  4EMM A;  3RRV A;  1TG6 A;  2PG8 A;  1HNU A;  4U0H A;  4RCN A;  5JBW A;  3T8B A;  4JOT A;  3MT6 A;  5FIF A;  2A7K A;  1N6F A;  2CBY A;  5DTP A;  4U1A A;  1UYR A;  3VIV A;  3OME A;  4FJW D;  3N6R B;  3MYB A;  3PE8 A;  4KNP A;  1EF9 A;  4ZDC A;  5HUQ A;  2J5I A;  4L6W A;  2D3T A;  4DI1 A;  2IEX A;  4ASI A;  1Y7O A;  3G64 A;  1XNY A;  5FUS A;  4B3I A;  5CTB A;  4EML A;  1EY3 A;  4B3H A;  3H0Q A;  3FF6 A;  1O8U A;  3ZW8 A;  1XNW A;  1NZY A;  3TZ3 A;  3H0J A;  3LKE A;  3ZWC A;  2VSS A;  5E0S H;  3SWX A;  3Q0J A;  3QRE A;  3Q7H A;  1OD4 A;  1PJH A;  3TT7 A;  3TT6 A;  2X58 A;  4KD6 A;  3K8X A;  3I47 A;  3K50 A;  4KPK A;  4RYF H;  5G1R A;  5KDR B;  2C8T A;  2ZL0 A;  3KQF A;  4FN8 A;  4JJT A;  3RST A;  4ZU2 A;  4FZW A;  5G1Q A;  4JFC A;  4IZB A;  1UYS A;  3T8A A;  4JCQ A;  3ISA A;  3V5I A;  1W2X A;  1FC9 A;  1ON9 A;  5C9G A;  4Q1I A;  2VSU C;  4IZD A;  4JYL A;  3KTJ A;  3QXI A;  2VSU A;  4ELW A;  4MXI A;  3QYR A;  2F9Y B;  2VX2 A;  1SG4 A;  3DOR A;  5DKP A;  1UYT A;  2HW5 A;  3BPT A;  3QKA A;  4OMR A;  4EMP A;  3QXZ A;  1EF8 A;  2VRE A;  3HP0 A;  4FND A;  3LAO A;  1Q52 A;  4Z0M A;  3PGQ A;  5DL1 A;  2YJG A;  4FB8 A;  4J2U A;  1WDK A;  2DEO A;  3U9R B;  5DTW A;  1YG8 A;  1ON3 A;  3PEA A;  2EJ5 A;  3U9T B;  2F9I B;  3QK8 A;  3M6M A;  3TRR A;  3HIN A;  4HC8 A;  3STA A;  1XX4 A;  4I52 A;  3ZWB A;  4NEK A;  4WCZ A;  2Q34 A;  1UIY A;  3H02 A;  2J5I B;  4ELX A;  1HZD A;  4MI2 A;  2UZF A;  3R9Q A;  3TVU A;  4QFE A;  2ZQR A;  5C90 A;  3BF0 A;  4HDT A;  1Q51 A;  2VSU F;  3TLF A;  4GHN A;  3P85 A;  4I4Z A;  3T88 A;  1VRG A;  2J5G D;  4OLQ A;  1N6D A;  3BEZ A;  5KDR A;  3Q0G A;  3M6N A;  1DUB A;  3NJB A;  1FC6 A;  4JWV A;  4ZDF A;  1RJM A;  3TVW A;  3T89 A;  3GF7 A;  5JBX A;  4KWB A;  4JVT A;  2F9I A;  3MFM A;  3H81 A;  2ZQQ A;  5DUC A;  3R6H A;  5DZK A;  1X0U A;  4U0G H;  5DU6 A;  4GM2 A;  3U9S B;  3HE2 A;  3TV5 A;  4LK5 A;  1TYF A;  3DJA A;  3P2L A;  4MOU A;  4FN7 A;  4JSB A;  2Q2X A;  1MJ3 A;  2ZL2 A;  3IBB A;  3KTK A;  2PPY A;  3ZWA A;  2ZL4 A;  4JCS A;  2FZS A;  3PZK A;  4YLH A;  2VSS E;  3BPP A;  2DUB A;  3IB9 A;  3KTI A;  3R9T A;  1K32 A;  4ZDB A;  3V5E A;  5E0S A; 
#chains in the Genus database with same CATH homology
 4U18 A;  3P5M A;  3OC7 A;  1WDL A;  1XO6 A;  5DU8 A;  2NP9 A;  1FCF A;  2W3P A;  3R9S A;  4K3W A;  2J5I I;  3TDC A;  4F47 A;  1J7X A;  4B3J A;  2F6I A;  5INI A;  4RYF A;  3R0O A;  1WZ8 A;  2VSS F;  1SZO A;  2J5S A;  3OT6 A;  5INF A;  3NJD A;  3L3S A;  2FW2 A;  3FDU A;  4NNQ A;  5DU4 A;  2BZR A;  1FC7 A;  1YG6 A;  1NZY B;  4ZDE A;  2CE3 A;  5MGB A;  2F6Q A;  3JU1 A;  4OG1 A;  2VSU E;  3H0U A;  1OD2 A;  3IAV A;  4NAR A;  3QMJ A;  2QQ3 A;  5DUF A;  3KTG A;  4FNB A;  3T3W A;  4FZW C;  4ELS A;  3SLL A;  4WZ8 B;  4JCT A;  2X24 A;  2FBM A;  1WDM A;  4QIJ A;  4JCR A;  2A81 A;  3GF3 A;  2F9Y A;  4K29 A;  4ZDD A;  1DCI A;  1RJN A;  3QWD A;  4L8K A;  1UYV A;  5G1S A;  2WTB A;  5E0N X;  1JXZ A;  2ZL3 A;  3WG5 A;  3HRX A;  5CTC A;  4Q0G A;  1HNO A;  3HLN 1;  4HNK A;  4I42 A;  4IZC A;  4JYJ A;  4WYO B;  5DZK H;  2J5G A;  3MOY A;  5ING A;  3GLM A;  4K2N A;  4U0G A;  3ZW9 A;  3H0S A;  5KJP A;  4QII A;  1K39 A;  5IKL B;  1XNV A;  3GKB A;  3Q1T A;  4G2R A;  3KTH A;  1PIX A;  1N6E A;  3GMA A;  3ST9 A;  3RSI A;  2GTR A;  2Q35 A;  2PBP A;  4U19 A;  2A7S A;  4EMM A;  3RRV A;  1TG6 A;  2PG8 A;  1HNU A;  4U0H A;  4RCN A;  5JBW A;  3T8B A;  4JOT A;  3MT6 A;  5FIF A;  2A7K A;  1N6F A;  2CBY A;  5DTP A;  4U1A A;  1UYR A;  3VIV A;  3OME A;  4FJW D;  3N6R B;  3MYB A;  3PE8 A;  4KNP A;  1EF9 A;  4ZDC A;  5HUQ A;  2J5I A;  4L6W A;  2D3T A;  4DI1 A;  2IEX A;  4ASI A;  1Y7O A;  3G64 A;  1XNY A;  5FUS A;  4B3I A;  5CTB A;  4EML A;  1EY3 A;  4B3H A;  3H0Q A;  3FF6 A;  1O8U A;  3ZW8 A;  1XNW A;  1NZY A;  3TZ3 A;  3H0J A;  3LKE A;  3ZWC A;  2VSS A;  5E0S H;  3SWX A;  3Q0J A;  3QRE A;  3Q7H A;  1OD4 A;  1PJH A;  3TT7 A;  3TT6 A;  2X58 A;  4KD6 A;  3K8X A;  3I47 A;  3K50 A;  4KPK A;  4RYF H;  5G1R A;  5KDR B;  2C8T A;  2ZL0 A;  3KQF A;  4FN8 A;  4JJT A;  3RST A;  4ZU2 A;  4FZW A;  5G1Q A;  4JFC A;  4IZB A;  1UYS A;  3T8A A;  4JCQ A;  3ISA A;  3V5I A;  1W2X A;  1FC9 A;  1ON9 A;  5C9G A;  4Q1I A;  2VSU C;  4IZD A;  4JYL A;  3KTJ A;  3QXI A;  2VSU A;  4ELW A;  4MXI A;  3QYR A;  2F9Y B;  2VX2 A;  1SG4 A;  3DOR A;  5DKP A;  1UYT A;  2HW5 A;  3BPT A;  3QKA A;  4OMR A;  4EMP A;  3QXZ A;  1EF8 A;  2VRE A;  3HP0 A;  4FND A;  3LAO A;  1Q52 A;  4Z0M A;  3PGQ A;  5DL1 A;  2YJG A;  4FB8 A;  4J2U A;  1WDK A;  2DEO A;  3U9R B;  5DTW A;  1YG8 A;  1ON3 A;  3PEA A;  2EJ5 A;  3U9T B;  2F9I B;  3QK8 A;  3M6M A;  3TRR A;  3HIN A;  4HC8 A;  3STA A;  1XX4 A;  4I52 A;  3ZWB A;  4NEK A;  4WCZ A;  2Q34 A;  1UIY A;  3H02 A;  2J5I B;  4ELX A;  1HZD A;  4MI2 A;  2UZF A;  3R9Q A;  3TVU A;  4QFE A;  2ZQR A;  5C90 A;  3BF0 A;  4HDT A;  1Q51 A;  2VSU F;  3TLF A;  4GHN A;  3P85 A;  4I4Z A;  3T88 A;  1VRG A;  2J5G D;  4OLQ A;  1N6D A;  3BEZ A;  5KDR A;  3Q0G A;  3M6N A;  1DUB A;  3NJB A;  1FC6 A;  4JWV A;  4ZDF A;  1RJM A;  3TVW A;  3T89 A;  3GF7 A;  5JBX A;  4KWB A;  4JVT A;  2F9I A;  3MFM A;  3H81 A;  2ZQQ A;  5DUC A;  3R6H A;  5DZK A;  1X0U A;  4U0G H;  5DU6 A;  4GM2 A;  3U9S B;  3HE2 A;  3TV5 A;  4LK5 A;  1TYF A;  3DJA A;  3P2L A;  4MOU A;  4FN7 A;  4JSB A;  2Q2X A;  1MJ3 A;  2ZL2 A;  3IBB A;  3KTK A;  2PPY A;  3ZWA A;  2ZL4 A;  4JCS A;  2FZS A;  3PZK A;  4YLH A;  2VSS E;  3BPP A;  2DUB A;  3IB9 A;  3KTI A;  3R9T A;  1K32 A;  4ZDB A;  3V5E A;  5E0S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...