2VSUE

A ternary complex of hydroxycinnamoyl-coa hydratase-lyase (hchl) with acetyl-coenzyme a and vanillin gives insights into substrate specificity and mechanism.
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
247
structure length
245
Chain Sequence
b'TYEGRWKTVKVEIEDGIAFVILNRPEKRNAMSPTLNREMIDVLETLEQDPAAGVLVLTGAGEAWTAGMDLKEYFREVGPEILQEKIRREASQWQWKLLRMYAKPTIAMVNGWCFGGGFAPLVACDLAICADEATFGLSEINYGIPPGNLVSKAMADTVGHRQSLYYIMTGKTFGGQKAAEMGLVNESVPLAQLREVTIELARNLLEKNPVVLRAAKHGFKRCRELTWEQNEDYLYAKLDQSRLLD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords P-HYDROXYCINNAMOYL COA HYDRATASE/LYASE
publication title A Ternary Complex of Hydroxycinnamoyl-Coa Hydratase-Lyase (Hchl) with Acetyl-Coa and Vanillin Gives Insights Into Substrate Specificity and Mechanism.
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Lyase
total genus 98
structure length 245
sequence length 247
ec nomenclature ec 4.1.2.41: Vanillin synthase.
pdb deposition date 2008-04-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00378 ECH_1 Enoyl-CoA hydratase/isomerase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.226.10 Alpha Beta Alpha-Beta Complex 2-enoyl-CoA Hydratase; Chain A, domain 1 2-enoyl-CoA Hydratase; Chain A, domain 1 2vsuE01
3BPPA 3RRVA 3T89A 5DTWA 4JCQA 2BZRA 3U9SB 1HNOA 3U9RB 3ZWCA 2DEOA 1Q52A 4U19A 4RCNA 3T8BA 2IEXA 1FC6A 4MXIA 1VRGA 5C9GA 1ON3A 3TVWA 2DUBA 1EF9A 3SWXA 5MGBA 3PEAA 5FUSA 4I52A 3R9SA 4RYFA 4ZDFA 1FCFA 4I42A 2QQ3A 3Q1TA 2VSUE 2ZQQA 1Y7OA 3TV5A 1YG6A 1ON9A 3U9TB 2D3TA 4WYOB 3ST9A 3ZW9A 3T3WA 3HP0A 3P2LA 3MT6A 1FC7A 4ZDDA 2VREA 3FF6A 1XNVA 2VSUA 1UYVA 1UYRA 2ZL2A 3P5MA 3P85A 3QK8A 2J5GA 2FBMA 2VSSE 3DJAA 4QFEA 1PJHA 4WZ8B 4ZU2A 3T88A 4KNPA 5DU8A 4FN7A 3MFMA 3HRXA 3VIVA 2J5IA 3NJDA 4ELXA 3HLN1 3ZW8A 3SLLA 3QXIA 2A7KA 4HNKA 2VSSA 3MOYA 1N6FA 3STAA 1UYSA 2GTRA 3QWDA 1XO6A 2F9YA 4K2NA 3GF3A 4FB8A 5DU4A 1N6EA 4L6WA 3TLFA 1NZYA 1K39A 1SZOA 3KTIA 2VX2A 4B3HA 2X58A 3M6NA 1SG4A 5INGA 4GM2A 4B3JA 3GKBA 3GMAA 4ELSA 3KTHA 1Q51A 3IBBA 5JBXA 2ZL0A 3LKEA 3Q7HA 1WDMA 4JCRA 4KPKA 1WDLA 2ZL3A 2Q34A 3I47A 1UYTA 3OMEA 4G2RA 3TT6A 1TYFA 4Z0MA 3R6HA 4ZDBA 1EF8A 1WZ8A 4U0HA 3G64A 3R0OA 3PGQA 4JWVA 4WCZA 2J5SA 3H0SA 3FDUA 3QKAA 3H02A 4FNBA 4FNDA 3QREA 3R9QA 5INFA 3DORA 4QIIA 2X24A 4EMLA 3JU1A 4EMPA 3IAVA 4B3IA 5INIA 4FZWA 4NNQA 3ZWBA 4IZCA 4IZDA 4JYJA 4ASIA 1DCIA 4JSBA 4L8KA 4EMMA 1FC9A 2ZL4A 5DZKH 3H0UA 1X0UA 2WTBA 4F47A 3OT6A 3KTKA 3RSTA 2PG8A 4FZWC 3R9TA 1N6DA 3TVUA 3HINA 3QXZA 3V5IA 1JXZA 2A7SA 2Q2XA 4K3WA 4OMRA 4JJTA 5DTPA 4KWBA 2CE3A 4Q1IA 5IKLB 2ZQRA 3QYRA 4JVTA 4HC8A 2F9IB 5KDRB 2F9YB 2C8TA 5KJPA 2UZFA 2J5GD 2HW5A 3Q0GA 1RJMA 3KTGA 1HNUA 2FW2A 3NJBA 4ZDEA 1TG6A 4QIJA 4RYFH 3ISAA 2F6IA 2F6QA 5C90A 3HE2A 3TRRA 3K8XA 1K32A 4FN8A 4FJWD 5DUFA 2A81A 1MJ3A 1XNWA 3H0JA 5G1RA 1HZDA 1YG8A 3L3SA 3T8AA 5DKPA 1PIXA 5E0SH 4I4ZA 3WG5A 5CTBA 5G1QA 3V5EA 3BF0A 4DI1A 2PPYA 3PE8A 5DUCA 3M6MA 2FZSA 4JCSA 1OD4A 3TDCA 4U1AA 3IB9A 4U18A 3N6RB 5E0SA 2EJ5A 3KQFA 1EY3A 4JOTA 3RSIA 2CBYA 3ZWAA 2VSUF 5FIFA 1WDKA 4ELWA 1OD2A 4K29A 3PZKA 1XNYA 3TZ3A 3LAOA 1O8UA 3OC7A 3Q0JA 3QMJA 4JFCA 4LK5A 1W2XA 4U0GH 3H0QA 5JBWA 2J5II 2J5IB 1XX4A 4NEKA 4IZBA 3MYBA 2NP9A 5DZKA 2VSUC 2PBPA 5CTCA 3H81A 4OLQA 4ZDCA 4OG1A 2Q35A 4MOUA 3K50A 4KD6A 5G1SA 3KTJA 1UIYA 4U0GA 3GLMA 5DU6A 4JCTA 5DL1A 2VSSF 3GF7A 4MI2A 5E0NX 3BEZA 4YLHA 3TT7A 1DUBA 1NZYB 1RJNA 4Q0GA 1J7XA 2W3PA 2F9IA 5KDRA 4JYLA 4GHNA
chains in the Genus database with same CATH superfamily
3BPPA 3RRVA 3T89A 5DTWA 4JCQA 4J2UA 2BZRA 3U9SB 1HNOA 3U9RB 3ZWCA 2DEOA 1Q52A 4U19A 4RCNA 3T8BA 2IEXA 1FC6A 4MXIA 1VRGA 5C9GA 1ON3A 3TVWA 2DUBA 1EF9A 3SWXA 5MGBA 3PEAA 5FUSA 4I52A 3R9SA 4RYFA 4ZDFA 1FCFA 4I42A 2QQ3A 3Q1TA 2VSUE 2ZQQA 1Y7OA 3TV5A 3BPTA 1YG6A 1ON9A 3U9TB 2D3TA 4WYOB 3ST9A 3ZW9A 3T3WA 3HP0A 3P2LA 3MT6A 1FC7A 4ZDDA 2VREA 3FF6A 1XNVA 2VSUA 1UYVA 1UYRA 2ZL2A 3P5MA 3P85A 4HDTA 3QK8A 2J5GA 2FBMA 2VSSE 3DJAA 4QFEA 1PJHA 4WZ8B 4ZU2A 3T88A 4KNPA 5DU8A 4FN7A 3MFMA 3HRXA 3VIVA 2J5IA 3NJDA 4ELXA 3HLN1 3ZW8A 3SLLA 3QXIA 2A7KA 4HNKA 2VSSA 3MOYA 1N6FA 3STAA 1UYSA 2GTRA 3QWDA 1XO6A 2F9YA 4K2NA 3GF3A 4FB8A 5HUQA 5DU4A 1N6EA 4L6WA 3TLFA 1NZYA 1K39A 1SZOA 3KTIA 2VX2A 4B3HA 2X58A 3M6NA 1SG4A 5INGA 4GM2A 4B3JA 3GKBA 3GMAA 4ELSA 3KTHA 1Q51A 3IBBA 5JBXA 2ZL0A 3LKEA 3Q7HA 1WDMA 4JCRA 4KPKA 1WDLA 2ZL3A 2Q34A 3I47A 1UYTA 3OMEA 4G2RA 3TT6A 1TYFA 4Z0MA 3R6HA 4ZDBA 1EF8A 1WZ8A 4U0HA 3G64A 3R0OA 3PGQA 4JWVA 4WCZA 2J5SA 3H0SA 3FDUA 3QKAA 3H02A 4FNBA 4FNDA 3QREA 3R9QA 5INFA 3DORA 4QIIA 2X24A 4EMLA 3JU1A 4EMPA 3IAVA 4B3IA 5INIA 4FZWA 4NNQA 3ZWBA 4IZCA 2YJGA 4IZDA 4JYJA 4ASIA 1DCIA 4JSBA 4L8KA 4EMMA 1FC9A 2ZL4A 5DZKH 3H0UA 1X0UA 2WTBA 4F47A 3OT6A 3KTKA 3RSTA 2PG8A 4FZWC 3R9TA 1N6DA 3TVUA 3HINA 3QXZA 3V5IA 1JXZA 2A7SA 2Q2XA 4K3WA 4OMRA 4JJTA 5DTPA 4KWBA 2CE3A 4Q1IA 5IKLB 2ZQRA 3QYRA 4JVTA 4HC8A 2F9IB 5KDRB 2F9YB 2C8TA 5KJPA 2UZFA 2J5GD 2HW5A 3Q0GA 1RJMA 3KTGA 1HNUA 2FW2A 3NJBA 4ZDEA 1TG6A 4QIJA 4RYFH 3ISAA 2F6IA 2F6QA 5C90A 3HE2A 3TRRA 3K8XA 1K32A 4FN8A 4FJWD 5DUFA 2A81A 1MJ3A 1XNWA 3H0JA 5G1RA 1HZDA 1YG8A 3L3SA 3T8AA 5DKPA 1PIXA 5E0SH 4I4ZA 3WG5A 5CTBA 5G1QA 3V5EA 3BF0A 4DI1A 2PPYA 3PE8A 5DUCA 3M6MA 2FZSA 4JCSA 1OD4A 3TDCA 4U1AA 3IB9A 4U18A 3N6RB 5E0SA 2EJ5A 3KQFA 1EY3A 4JOTA 3RSIA 2CBYA 3ZWAA 2VSUF 5FIFA 1WDKA 4ELWA 1OD2A 4K29A 3PZKA 1XNYA 3TZ3A 3LAOA 1O8UA 3OC7A 3Q0JA 3QMJA 4JFCA 4LK5A 1W2XA 4U0GH 3H0QA 5JBWA 2J5II 2J5IB 1XX4A 4NEKA 4IZBA 3MYBA 2NP9A 5DZKA 2VSUC 2PBPA 5CTCA 3H81A 4OLQA 4ZDCA 4OG1A 2Q35A 4MOUA 3K50A 4KD6A 5G1SA 3KTJA 1UIYA 4U0GA 3GLMA 5DU6A 4JCTA 5DL1A 2VSSF 3GF7A 4MI2A 5E0NX 3BEZA 4YLHA 3TT7A 1DUBA 1NZYB 1RJNA 4NARA 4Q0GA 1J7XA 2W3PA 2F9IA 5KDRA 4JYLA 4GHNA
chains in the Genus database with same CATH topology
3BPPA 3RRVA 3T89A 5DTWA 4JCQA 4J2UA 2BZRA 3U9SB 1HNOA 3U9RB 3ZWCA 2DEOA 1Q52A 4U19A 4RCNA 3T8BA 2IEXA 1FC6A 4MXIA 1VRGA 5C9GA 1ON3A 3TVWA 2DUBA 1EF9A 3SWXA 5MGBA 3PEAA 5FUSA 4I52A 3R9SA 4RYFA 4ZDFA 1FCFA 4I42A 2QQ3A 3Q1TA 2VSUE 2ZQQA 1Y7OA 3TV5A 3BPTA 1YG6A 1ON9A 3U9TB 2D3TA 4WYOB 3ST9A 3ZW9A 3T3WA 3HP0A 3P2LA 3MT6A 1FC7A 4ZDDA 2VREA 3FF6A 1XNVA 2VSUA 1UYVA 1UYRA 2ZL2A 3P5MA 3P85A 4HDTA 3QK8A 2J5GA 2FBMA 2VSSE 3DJAA 4QFEA 1PJHA 4WZ8B 4ZU2A 3T88A 4KNPA 5DU8A 4FN7A 3MFMA 3HRXA 3VIVA 2J5IA 3NJDA 4ELXA 3HLN1 3ZW8A 3SLLA 3QXIA 2A7KA 4HNKA 2VSSA 3MOYA 1N6FA 3STAA 1UYSA 2GTRA 3QWDA 1XO6A 2F9YA 4K2NA 3GF3A 4FB8A 5HUQA 5DU4A 1N6EA 4L6WA 3TLFA 1NZYA 1K39A 1SZOA 3KTIA 2VX2A 4B3HA 2X58A 3M6NA 1SG4A 5INGA 4GM2A 4B3JA 3GKBA 3GMAA 4ELSA 3KTHA 1Q51A 3IBBA 5JBXA 2ZL0A 3LKEA 3Q7HA 1WDMA 4JCRA 4KPKA 1WDLA 2ZL3A 2Q34A 3I47A 1UYTA 3OMEA 4G2RA 3TT6A 1TYFA 4Z0MA 3R6HA 4ZDBA 1EF8A 1WZ8A 4U0HA 3G64A 3R0OA 3PGQA 4JWVA 4WCZA 2J5SA 3H0SA 3FDUA 3QKAA 3H02A 4FNBA 4FNDA 3QREA 3R9QA 5INFA 3DORA 4QIIA 2X24A 4EMLA 3JU1A 4EMPA 3IAVA 4B3IA 5INIA 4FZWA 4NNQA 3ZWBA 4IZCA 2YJGA 4IZDA 4JYJA 4ASIA 1DCIA 4JSBA 4L8KA 4EMMA 1FC9A 2ZL4A 5DZKH 3H0UA 1X0UA 2WTBA 4F47A 3OT6A 3KTKA 3RSTA 2PG8A 4FZWC 3R9TA 1N6DA 3TVUA 3HINA 3QXZA 3V5IA 1JXZA 2A7SA 2Q2XA 4K3WA 4OMRA 4JJTA 5DTPA 4KWBA 2CE3A 4Q1IA 5IKLB 2ZQRA 3QYRA 4JVTA 4HC8A 2F9IB 5KDRB 2F9YB 2C8TA 5KJPA 2UZFA 2J5GD 2HW5A 3Q0GA 1RJMA 3KTGA 1HNUA 2FW2A 3NJBA 4ZDEA 1TG6A 4QIJA 4RYFH 3ISAA 2F6IA 2F6QA 5C90A 3HE2A 3TRRA 3K8XA 1K32A 4FN8A 4FJWD 5DUFA 2A81A 1MJ3A 1XNWA 3H0JA 5G1RA 1HZDA 1YG8A 3L3SA 3T8AA 5DKPA 1PIXA 5E0SH 4I4ZA 3WG5A 5CTBA 5G1QA 3V5EA 3BF0A 4DI1A 2PPYA 3PE8A 5DUCA 3M6MA 2FZSA 4JCSA 1OD4A 3TDCA 4U1AA 3IB9A 4U18A 3N6RB 5E0SA 2EJ5A 3KQFA 1EY3A 4JOTA 3RSIA 2CBYA 3ZWAA 2VSUF 5FIFA 1WDKA 4ELWA 1OD2A 4K29A 3PZKA 1XNYA 3TZ3A 3LAOA 1O8UA 3OC7A 3Q0JA 3QMJA 4JFCA 4LK5A 1W2XA 4U0GH 3H0QA 5JBWA 2J5II 2J5IB 1XX4A 4NEKA 4IZBA 3MYBA 2NP9A 5DZKA 2VSUC 2PBPA 5CTCA 3H81A 4OLQA 4ZDCA 4OG1A 2Q35A 4MOUA 3K50A 4KD6A 5G1SA 3KTJA 1UIYA 4U0GA 3GLMA 5DU6A 4JCTA 5DL1A 2VSSF 3GF7A 4MI2A 5E0NX 3BEZA 4YLHA 3TT7A 1DUBA 1NZYB 1RJNA 4NARA 4Q0GA 1J7XA 2W3PA 2F9IA 5KDRA 4JYLA 4GHNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BPP A;  3RRV A;  3T89 A;  5DTW A;  4JCQ A;  2BZR A;  3U9S B;  1HNO A;  3U9R B;  3ZWC A;  2DEO A;  1Q52 A;  4U19 A;  4RCN A;  3T8B A;  2IEX A;  1FC6 A;  4MXI A;  1VRG A;  5C9G A;  1ON3 A;  3TVW A;  2DUB A;  1EF9 A;  3SWX A;  5MGB A;  3PEA A;  5FUS A;  4I52 A;  3R9S A;  4RYF A;  4ZDF A;  1FCF A;  4I42 A;  2QQ3 A;  3Q1T A;  2VSU E;  2ZQQ A;  1Y7O A;  3TV5 A;  1YG6 A;  1ON9 A;  3U9T B;  2D3T A;  4WYO B;  3ST9 A;  3ZW9 A;  3T3W A;  3HP0 A;  3P2L A;  3MT6 A;  1FC7 A;  4ZDD A;  2VRE A;  3FF6 A;  1XNV A;  2VSU A;  1UYV A;  1UYR A;  2ZL2 A;  3P5M A;  3P85 A;  3QK8 A;  2J5G A;  2FBM A;  2VSS E;  3DJA A;  4QFE A;  1PJH A;  4WZ8 B;  4ZU2 A;  3T88 A;  4KNP A;  5DU8 A;  4FN7 A;  3MFM A;  3HRX A;  3VIV A;  2J5I A;  3NJD A;  4ELX A;  3HLN 1;  3ZW8 A;  3SLL A;  3QXI A;  2A7K A;  4HNK A;  2VSS A;  3MOY A;  1N6F A;  3STA A;  1UYS A;  2GTR A;  3QWD A;  1XO6 A;  2F9Y A;  4K2N A;  3GF3 A;  4FB8 A;  5DU4 A;  1N6E A;  4L6W A;  3TLF A;  1NZY A;  1K39 A;  1SZO A;  3KTI A;  2VX2 A;  4B3H A;  2X58 A;  3M6N A;  1SG4 A;  5ING A;  4GM2 A;  4B3J A;  3GKB A;  3GMA A;  4ELS A;  3KTH A;  1Q51 A;  3IBB A;  5JBX A;  2ZL0 A;  3LKE A;  3Q7H A;  1WDM A;  4JCR A;  4KPK A;  1WDL A;  2ZL3 A;  2Q34 A;  3I47 A;  1UYT A;  3OME A;  4G2R A;  3TT6 A;  1TYF A;  4Z0M A;  3R6H A;  4ZDB A;  1EF8 A;  1WZ8 A;  4U0H A;  3G64 A;  3R0O A;  3PGQ A;  4JWV A;  4WCZ A;  2J5S A;  3H0S A;  3FDU A;  3QKA A;  3H02 A;  4FNB A;  4FND A;  3QRE A;  3R9Q A;  5INF A;  3DOR A;  4QII A;  2X24 A;  4EML A;  3JU1 A;  4EMP A;  3IAV A;  4B3I A;  5INI A;  4FZW A;  4NNQ A;  3ZWB A;  4IZC A;  4IZD A;  4JYJ A;  4ASI A;  1DCI A;  4JSB A;  4L8K A;  4EMM A;  1FC9 A;  2ZL4 A;  5DZK H;  3H0U A;  1X0U A;  2WTB A;  4F47 A;  3OT6 A;  3KTK A;  3RST A;  2PG8 A;  4FZW C;  3R9T A;  1N6D A;  3TVU A;  3HIN A;  3QXZ A;  3V5I A;  1JXZ A;  2A7S A;  2Q2X A;  4K3W A;  4OMR A;  4JJT A;  5DTP A;  4KWB A;  2CE3 A;  4Q1I A;  5IKL B;  2ZQR A;  3QYR A;  4JVT A;  4HC8 A;  2F9I B;  5KDR B;  2F9Y B;  2C8T A;  5KJP A;  2UZF A;  2J5G D;  2HW5 A;  3Q0G A;  1RJM A;  3KTG A;  1HNU A;  2FW2 A;  3NJB A;  4ZDE A;  1TG6 A;  4QIJ A;  4RYF H;  3ISA A;  2F6I A;  2F6Q A;  5C90 A;  3HE2 A;  3TRR A;  3K8X A;  1K32 A;  4FN8 A;  4FJW D;  5DUF A;  2A81 A;  1MJ3 A;  1XNW A;  3H0J A;  5G1R A;  1HZD A;  1YG8 A;  3L3S A;  3T8A A;  5DKP A;  1PIX A;  5E0S H;  4I4Z A;  3WG5 A;  5CTB A;  5G1Q A;  3V5E A;  3BF0 A;  4DI1 A;  2PPY A;  3PE8 A;  5DUC A;  3M6M A;  2FZS A;  4JCS A;  1OD4 A;  3TDC A;  4U1A A;  3IB9 A;  4U18 A;  3N6R B;  5E0S A;  2EJ5 A;  3KQF A;  1EY3 A;  4JOT A;  3RSI A;  2CBY A;  3ZWA A;  2VSU F;  5FIF A;  1WDK A;  4ELW A;  1OD2 A;  4K29 A;  3PZK A;  1XNY A;  3TZ3 A;  3LAO A;  1O8U A;  3OC7 A;  3Q0J A;  3QMJ A;  4JFC A;  4LK5 A;  1W2X A;  4U0G H;  3H0Q A;  5JBW A;  2J5I I;  2J5I B;  1XX4 A;  4NEK A;  4IZB A;  3MYB A;  2NP9 A;  5DZK A;  2VSU C;  2PBP A;  5CTC A;  3H81 A;  4OLQ A;  4ZDC A;  4OG1 A;  2Q35 A;  4MOU A;  3K50 A;  4KD6 A;  5G1S A;  3KTJ A;  1UIY A;  4U0G A;  3GLM A;  5DU6 A;  4JCT A;  5DL1 A;  2VSS F;  3GF7 A;  4MI2 A;  5E0N X;  3BEZ A;  4YLH A;  3TT7 A;  1DUB A;  1NZY B;  1RJN A;  4Q0G A;  1J7X A;  2W3P A;  2F9I A;  5KDR A;  4JYL A;  4GHN A; 
#chains in the Genus database with same CATH topology
 3BPP A;  3RRV A;  3T89 A;  5DTW A;  4JCQ A;  4J2U A;  2BZR A;  3U9S B;  1HNO A;  3U9R B;  3ZWC A;  2DEO A;  1Q52 A;  4U19 A;  4RCN A;  3T8B A;  2IEX A;  1FC6 A;  4MXI A;  1VRG A;  5C9G A;  1ON3 A;  3TVW A;  2DUB A;  1EF9 A;  3SWX A;  5MGB A;  3PEA A;  5FUS A;  4I52 A;  3R9S A;  4RYF A;  4ZDF A;  1FCF A;  4I42 A;  2QQ3 A;  3Q1T A;  2VSU E;  2ZQQ A;  1Y7O A;  3TV5 A;  3BPT A;  1YG6 A;  1ON9 A;  3U9T B;  2D3T A;  4WYO B;  3ST9 A;  3ZW9 A;  3T3W A;  3HP0 A;  3P2L A;  3MT6 A;  1FC7 A;  4ZDD A;  2VRE A;  3FF6 A;  1XNV A;  2VSU A;  1UYV A;  1UYR A;  2ZL2 A;  3P5M A;  3P85 A;  4HDT A;  3QK8 A;  2J5G A;  2FBM A;  2VSS E;  3DJA A;  4QFE A;  1PJH A;  4WZ8 B;  4ZU2 A;  3T88 A;  4KNP A;  5DU8 A;  4FN7 A;  3MFM A;  3HRX A;  3VIV A;  2J5I A;  3NJD A;  4ELX A;  3HLN 1;  3ZW8 A;  3SLL A;  3QXI A;  2A7K A;  4HNK A;  2VSS A;  3MOY A;  1N6F A;  3STA A;  1UYS A;  2GTR A;  3QWD A;  1XO6 A;  2F9Y A;  4K2N A;  3GF3 A;  4FB8 A;  5HUQ A;  5DU4 A;  1N6E A;  4L6W A;  3TLF A;  1NZY A;  1K39 A;  1SZO A;  3KTI A;  2VX2 A;  4B3H A;  2X58 A;  3M6N A;  1SG4 A;  5ING A;  4GM2 A;  4B3J A;  3GKB A;  3GMA A;  4ELS A;  3KTH A;  1Q51 A;  3IBB A;  5JBX A;  2ZL0 A;  3LKE A;  3Q7H A;  1WDM A;  4JCR A;  4KPK A;  1WDL A;  2ZL3 A;  2Q34 A;  3I47 A;  1UYT A;  3OME A;  4G2R A;  3TT6 A;  1TYF A;  4Z0M A;  3R6H A;  4ZDB A;  1EF8 A;  1WZ8 A;  4U0H A;  3G64 A;  3R0O A;  3PGQ A;  4JWV A;  4WCZ A;  2J5S A;  3H0S A;  3FDU A;  3QKA A;  3H02 A;  4FNB A;  4FND A;  3QRE A;  3R9Q A;  5INF A;  3DOR A;  4QII A;  2X24 A;  4EML A;  3JU1 A;  4EMP A;  3IAV A;  4B3I A;  5INI A;  4FZW A;  4NNQ A;  3ZWB A;  4IZC A;  2YJG A;  4IZD A;  4JYJ A;  4ASI A;  1DCI A;  4JSB A;  4L8K A;  4EMM A;  1FC9 A;  2ZL4 A;  5DZK H;  3H0U A;  1X0U A;  2WTB A;  4F47 A;  3OT6 A;  3KTK A;  3RST A;  2PG8 A;  4FZW C;  3R9T A;  1N6D A;  3TVU A;  3HIN A;  3QXZ A;  3V5I A;  1JXZ A;  2A7S A;  2Q2X A;  4K3W A;  4OMR A;  4JJT A;  5DTP A;  4KWB A;  2CE3 A;  4Q1I A;  5IKL B;  2ZQR A;  3QYR A;  4JVT A;  4HC8 A;  2F9I B;  5KDR B;  2F9Y B;  2C8T A;  5KJP A;  2UZF A;  2J5G D;  2HW5 A;  3Q0G A;  1RJM A;  3KTG A;  1HNU A;  2FW2 A;  3NJB A;  4ZDE A;  1TG6 A;  4QIJ A;  4RYF H;  3ISA A;  2F6I A;  2F6Q A;  5C90 A;  3HE2 A;  3TRR A;  3K8X A;  1K32 A;  4FN8 A;  4FJW D;  5DUF A;  2A81 A;  1MJ3 A;  1XNW A;  3H0J A;  5G1R A;  1HZD A;  1YG8 A;  3L3S A;  3T8A A;  5DKP A;  1PIX A;  5E0S H;  4I4Z A;  3WG5 A;  5CTB A;  5G1Q A;  3V5E A;  3BF0 A;  4DI1 A;  2PPY A;  3PE8 A;  5DUC A;  3M6M A;  2FZS A;  4JCS A;  1OD4 A;  3TDC A;  4U1A A;  3IB9 A;  4U18 A;  3N6R B;  5E0S A;  2EJ5 A;  3KQF A;  1EY3 A;  4JOT A;  3RSI A;  2CBY A;  3ZWA A;  2VSU F;  5FIF A;  1WDK A;  4ELW A;  1OD2 A;  4K29 A;  3PZK A;  1XNY A;  3TZ3 A;  3LAO A;  1O8U A;  3OC7 A;  3Q0J A;  3QMJ A;  4JFC A;  4LK5 A;  1W2X A;  4U0G H;  3H0Q A;  5JBW A;  2J5I I;  2J5I B;  1XX4 A;  4NEK A;  4IZB A;  3MYB A;  2NP9 A;  5DZK A;  2VSU C;  2PBP A;  5CTC A;  3H81 A;  4OLQ A;  4ZDC A;  4OG1 A;  2Q35 A;  4MOU A;  3K50 A;  4KD6 A;  5G1S A;  3KTJ A;  1UIY A;  4U0G A;  3GLM A;  5DU6 A;  4JCT A;  5DL1 A;  2VSS F;  3GF7 A;  4MI2 A;  5E0N X;  3BEZ A;  4YLH A;  3TT7 A;  1DUB A;  1NZY B;  1RJN A;  4NAR A;  4Q0G A;  1J7X A;  2W3P A;  2F9I A;  5KDR A;  4JYL A;  4GHN A; 
#chains in the Genus database with same CATH homology
 3BPP A;  3RRV A;  3T89 A;  5DTW A;  4JCQ A;  4J2U A;  2BZR A;  3U9S B;  1HNO A;  3U9R B;  3ZWC A;  2DEO A;  1Q52 A;  4U19 A;  4RCN A;  3T8B A;  2IEX A;  1FC6 A;  4MXI A;  1VRG A;  5C9G A;  1ON3 A;  3TVW A;  2DUB A;  1EF9 A;  3SWX A;  5MGB A;  3PEA A;  5FUS A;  4I52 A;  3R9S A;  4RYF A;  4ZDF A;  1FCF A;  4I42 A;  2QQ3 A;  3Q1T A;  2VSU E;  2ZQQ A;  1Y7O A;  3TV5 A;  3BPT A;  1YG6 A;  1ON9 A;  3U9T B;  2D3T A;  4WYO B;  3ST9 A;  3ZW9 A;  3T3W A;  3HP0 A;  3P2L A;  3MT6 A;  1FC7 A;  4ZDD A;  2VRE A;  3FF6 A;  1XNV A;  2VSU A;  1UYV A;  1UYR A;  2ZL2 A;  3P5M A;  3P85 A;  4HDT A;  3QK8 A;  2J5G A;  2FBM A;  2VSS E;  3DJA A;  4QFE A;  1PJH A;  4WZ8 B;  4ZU2 A;  3T88 A;  4KNP A;  5DU8 A;  4FN7 A;  3MFM A;  3HRX A;  3VIV A;  2J5I A;  3NJD A;  4ELX A;  3HLN 1;  3ZW8 A;  3SLL A;  3QXI A;  2A7K A;  4HNK A;  2VSS A;  3MOY A;  1N6F A;  3STA A;  1UYS A;  2GTR A;  3QWD A;  1XO6 A;  2F9Y A;  4K2N A;  3GF3 A;  4FB8 A;  5HUQ A;  5DU4 A;  1N6E A;  4L6W A;  3TLF A;  1NZY A;  1K39 A;  1SZO A;  3KTI A;  2VX2 A;  4B3H A;  2X58 A;  3M6N A;  1SG4 A;  5ING A;  4GM2 A;  4B3J A;  3GKB A;  3GMA A;  4ELS A;  3KTH A;  1Q51 A;  3IBB A;  5JBX A;  2ZL0 A;  3LKE A;  3Q7H A;  1WDM A;  4JCR A;  4KPK A;  1WDL A;  2ZL3 A;  2Q34 A;  3I47 A;  1UYT A;  3OME A;  4G2R A;  3TT6 A;  1TYF A;  4Z0M A;  3R6H A;  4ZDB A;  1EF8 A;  1WZ8 A;  4U0H A;  3G64 A;  3R0O A;  3PGQ A;  4JWV A;  4WCZ A;  2J5S A;  3H0S A;  3FDU A;  3QKA A;  3H02 A;  4FNB A;  4FND A;  3QRE A;  3R9Q A;  5INF A;  3DOR A;  4QII A;  2X24 A;  4EML A;  3JU1 A;  4EMP A;  3IAV A;  4B3I A;  5INI A;  4FZW A;  4NNQ A;  3ZWB A;  4IZC A;  2YJG A;  4IZD A;  4JYJ A;  4ASI A;  1DCI A;  4JSB A;  4L8K A;  4EMM A;  1FC9 A;  2ZL4 A;  5DZK H;  3H0U A;  1X0U A;  2WTB A;  4F47 A;  3OT6 A;  3KTK A;  3RST A;  2PG8 A;  4FZW C;  3R9T A;  1N6D A;  3TVU A;  3HIN A;  3QXZ A;  3V5I A;  1JXZ A;  2A7S A;  2Q2X A;  4K3W A;  4OMR A;  4JJT A;  5DTP A;  4KWB A;  2CE3 A;  4Q1I A;  5IKL B;  2ZQR A;  3QYR A;  4JVT A;  4HC8 A;  2F9I B;  5KDR B;  2F9Y B;  2C8T A;  5KJP A;  2UZF A;  2J5G D;  2HW5 A;  3Q0G A;  1RJM A;  3KTG A;  1HNU A;  2FW2 A;  3NJB A;  4ZDE A;  1TG6 A;  4QIJ A;  4RYF H;  3ISA A;  2F6I A;  2F6Q A;  5C90 A;  3HE2 A;  3TRR A;  3K8X A;  1K32 A;  4FN8 A;  4FJW D;  5DUF A;  2A81 A;  1MJ3 A;  1XNW A;  3H0J A;  5G1R A;  1HZD A;  1YG8 A;  3L3S A;  3T8A A;  5DKP A;  1PIX A;  5E0S H;  4I4Z A;  3WG5 A;  5CTB A;  5G1Q A;  3V5E A;  3BF0 A;  4DI1 A;  2PPY A;  3PE8 A;  5DUC A;  3M6M A;  2FZS A;  4JCS A;  1OD4 A;  3TDC A;  4U1A A;  3IB9 A;  4U18 A;  3N6R B;  5E0S A;  2EJ5 A;  3KQF A;  1EY3 A;  4JOT A;  3RSI A;  2CBY A;  3ZWA A;  2VSU F;  5FIF A;  1WDK A;  4ELW A;  1OD2 A;  4K29 A;  3PZK A;  1XNY A;  3TZ3 A;  3LAO A;  1O8U A;  3OC7 A;  3Q0J A;  3QMJ A;  4JFC A;  4LK5 A;  1W2X A;  4U0G H;  3H0Q A;  5JBW A;  2J5I I;  2J5I B;  1XX4 A;  4NEK A;  4IZB A;  3MYB A;  2NP9 A;  5DZK A;  2VSU C;  2PBP A;  5CTC A;  3H81 A;  4OLQ A;  4ZDC A;  4OG1 A;  2Q35 A;  4MOU A;  3K50 A;  4KD6 A;  5G1S A;  3KTJ A;  1UIY A;  4U0G A;  3GLM A;  5DU6 A;  4JCT A;  5DL1 A;  2VSS F;  3GF7 A;  4MI2 A;  5E0N X;  3BEZ A;  4YLH A;  3TT7 A;  1DUB A;  1NZY B;  1RJN A;  4NAR A;  4Q0G A;  1J7X A;  2W3P A;  2F9I A;  5KDR A;  4JYL A;  4GHN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...