2VTVA

Phaz7 depolymerase from paucimonas lemoignei
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
340
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of poly(3-hydroxybutyrate) hydrolysis by PhaZ7 depolymerase from Paucimonas lemoignei.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PHB depolymerase PhaZ7
total genus 126
structure length 340
sequence length 342
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vtvA00
1IZ7A 3KOOA 3PUIA 1LLFA 1X2BA 4EBBA 1QIHA 2PSFA 4QWWA 5AKXA 4H18A 5JALA 3V1KA 1LGYA 5AIAA 1UWCA 2J3QA 1UOOA 4Q05A 4BRSA 4E15A 4X6XA 1QIEA 4OB7A 4EA6A 4UBIA 3B3QA 3WI7A 3C87A 1CUDA 4UBNA 5FPQA 3K2IA 5ALJA 3CXUA 4DGQA 3QH4A 2WJ4A 2HA5A 4J0JA 1M33A 1BRTA 2HU8A 1E8NA 5J3JA 4W1QA 1JKMA 1R9NA 4ARAA 2RIPA 1LNSA 3KSRA 1HQDA 1AC5A 1T4MA 3UUEA 1ZD3A 2XB6A 2RI6A 4U2BA 3T52A 4HRXA 2HL6A 1QONA 5AM1A 3BIWA 3VJKA 1HPLA 2FJ0A 2VSQA 2XUPA 4MQMA 4WY8A 4J3JA 2HA3A 4BC0A 5FRDA 5AK6A 3G0BA 5HQ3B 5JADA 4QDXA 1MAHA 1HL7A 5HQ3A 4BBZA 4B7ZA 1U2EA 2I03A 2J3DA 4Q82A 5JZSA 4LXIA 1BN7A 4B9AA 4RPCA 1E8MA 1Q0ZA 4PQEA 4LYDA 5AM2A 1IUNA 4J0IA 4WFJA 2C5GA 4KR0A 4Q3OA 3R3XA 5CT5A 2GBIA 4IH9A 1XZFA 5AKEA 4MJ3A 1ZGCA 3KWFA 1KEZA 2GBFA 5AK5A 1C4XA 2OCIA 3WK9A 1YCDA 3NGMA 2QM0A 4W1SA 3UUFA 3SWWA 3OC0A 1AURA 3GBSA 1UK8A 2ZYIA 3DJYA 3DDUA 5C7YA 5EFZA 4Q34A 3DKRA 1F0NA 3NWOA 1BU8A 2OQVA 5E4TA 2ZJFA 2XUIA 2OAGA 3FAKA 4CIAA 1CUVA 1QLWA 1E3QA 2EEPA 1ORWA 1U65A 2B4KA 5AI9A 2V98A 5HKBA 3H19A 5IVIA 1BCRA 2K2QB 2VJDA 1TCCA 1MN6A 1K63A 2BUCA 2QTBA 2BGRA 4DMFA 2WTMA 3T4UA 2CZQA 4C89A 2PSHA 3DCNA 3QM1A 3RARA 3IUMA 3R0VA 4DNPA 4J0DA 1CUWA 5D3ZA 1QTIA 4AQDA 3AJAA 2BKLA 2XMGA 5AOAA 3PF8A 1YS1X 3O4JA 1ZI8A 2XE4A 5LYYA 5BWCA 1I6WA 3JW8A 4JH0A 3R3VA 3C6BA 5DJ5A 4Y2TA 4AMZA 4OB8A 1AUOA 3O4GA 3E4DA 4OU5A 3FBWA 5DYTA 4G9EA 4AXBA 1XZHA 2AJDA 4NMWA 4K6GA 2WIDA 2PBLA 1EDEA 3VJMA 1LBTA 2WHPA 4IO0A 4S0XA 1YA8A 1MX9A 4P92A 2XUDA 2VEOA 2AJ8A 3TRDA 1AGYA 1XZCA 4FLMA 2QJWA 5A7HA 3WKDA 1MJ5A 2BUBA 1EI9A 3O4IA 2IX9A 2CKMA 4X92A 1E89A 1L7QA 4W1RA 3I28A 3VDXA 4Q3KA 3A2NA 4EHBA 3WIOA 1ISPA 1LPSA 2JEZA 2Z8XA 1CLEA 4FHZA 2CEKA 2QUBA 5HK8A 4ETWA 1TKRA 2D5LA 4XIIA 3D4LA 3IURA 3X3HA 5KREA 3CN9A 2VTVA 2WQZA 2HHAA 3WQHA 4UHCA 2Z3ZA 3D3NA 4GI1A 4JNCA 3KD2A 4BATA 4EZIA 5ALXA 2QOEA 3WJ2A 4YASA 3VJLA 4UUQA 2H7XA 2WIFA 3BJMA 4DNOA 1ORVA 4QDTA 4DMCA 3OG9A 5ALRA 1EXWA 2XT0A 1XZLA 4L9AA 5AKIA 1JMYA 1L7AA 2JGLA 5AOCA 1UFOA 1EHYA 3O9VA 3WKBA 2RHTA 5EHQA 1VZ3A 1U8EA 3LLCA 3IULA 5DNWA 1AX9A 2WJ6A 4KAFA 3KWJA 2G5PA 1PFQA 3H0CA 3QMWA 4MEBA 1QFMA 4BTLA 3BF8A 1LZLA 3RKSA 1J1IA 2XMCA 4J0HA 3MUNA 2YYSA 4MYSA 5D7BA 1DT3A 4H0CA 3IB3A 4BZZA 1SFRA 5CT9A 4C88A 3W2TA 2BCEA 2OGSA 1Z68A 5K3EA 3DNMA 3D5EA 1WPXA 4G8DA 2YH2A 1PV1A 3DD5A 4J7AA 2GZSA 5CT8A 2OXEA 4BAUA 3WKAA 2C4HA 3QZUA 3DL7A 3W9BA 4CG3A 5AP9A 1LZKA 3V48A 4WY5A 1A8UA 5EIEA 3WA7A 1T2NA 2WFLA 3STUA 1WPRA 1FFCA 5ALSA 2HFJA 4DMKA 3AFIA 5F4ZA 1DQZA 1KU6A 4K6HA 5ALNA 5IVHA 2QRUA 5FUMA 1AQLA 3MUOA 3I2IA 1WOMA 5C8XA 4BVJA 4BVKA 2PKYX 2HDWA 1HKHA 1TIBA 1CUUA 3MGAA 1ZJ5A 2HM7A 1CQZA 4LHEA 1FJ2A 2VT6A 3OOSA 3AIKA 2HRQA 2ONCA 4EB0A 3E1GA 4B81A 4IH4A 3V1MA 1N1MA 5CT6A 3G9ZA 5AI6A 2QKYA 1PJAA 1C7JA 1XRNA 4M0MA 3ILSA 2Z8ZA 1XZDA 3FVTA 1LPPA 1FSSA 1CUXA 5DTIA 3WKCA 2J4FA 2QXTA 2PM8A 3RK4A 5AK3A 4HXFB 1FFDA 5JD5A 3HRHA 1Y7HA 5CBKA 2XUAA 4PNZA 1CUGA 4H7IA 4DMHA 1N8SA 2PX6A 4KEAA 5AI0A 5JD6A 5CT4A 3C6ZA 2OCGA 3FYUA 5AKHA 4ZRDA 3G0CA 3G0GA 5K3AA 1QIIA 4W1PA 2Z5GA 2R8BA 3D59A 2O2HA 4H7FA 4C4ZA 4ITVA 3NOXA 1VE6A 2BGNA 3PF9A 5LZ7A 2CMFA 5I7UA 3SX4A 4Y7DA 1ZD2P 3ICVA 4QE3A 3P2MA 1VXRA 4QA9A 1EDDA 1VA5A 4AB1A 4AO7A 3PICA 1F0PA 2Y2UA 5LKAA 4LXGA 3R41A 2YASA 3DQZA 1DT5A 4Y2SA 1SCIA 5SYMA 4GHWA 5ALOA 1VA4A 1XRRA 3F96A 3U0VA 1CUHA 4IQ4A 4C87A 5AM5A 1CRLA 3N0TA 3WK7A 4NVRA 4U2DA 2WUFA 4BDSA 3DEAA 1XLUA 3M81A 4WJLA 2ZYRA 4LIPD 1MAAA 1FFAA 2OG1A 5CW2A 5DNUA 1ODCA 1QZ3A 3F9CA 3H2GA 5EGNA 3Q8WA 3E3AA 2D0DA 1S8OA 5KBYA 4WFIA 2WU3A 4UBOA 3I2KA 4C4XA 3HJUA 2Z3WA 1R4ZA 3BF7A 3H1AA 5ESRA 5K3DA 4GEGA 3GFFA 4X71A 2PU7A 4C01A 1P0IA 4IH1A 2E3JA 3I6ZA 1EVQA 2OQIA 1ODSA 3CCBA 3I2JA 1HBJA 2V97A 4Z49A 5CTAA 1MT3A 4Q3LA 3GZJA 4B83A 1BROA 1QO7A 5CXUA 3G8YA 2JGKA 1A8QA 3EQ7A 1UOQA 1AZWA 4HVTA 5ALEA 4XVCA 3WK8A 4KRXA 2WKWA 2QMQA 3IDAA 1CUFA 1XQXA 1Q84A 2WILA 3LIIA 1VZ2A 5C8ZA 1J06A 3D2CA 4N8EA 4F0JA 5AI8A 4A23A 5AICA 1CUZA 2OGTA 5FXMA 3DOIA 1WB5A 4B0PA 3PFBA 2JGFA 3I6MA 5JYCA 1XLWA 1P0PA 5JANA 2HU5A 3WWCA 3F67A 4KAAA 5T4FA 4FDMA 1ACJA 4X94A 5FV4A 1D07A 3DLTA 3HC7A 4UBMA 4FLFA 1W1IA 2WHQA 2WTNA 3W04A 1DTEA 1ZIXA 4ZV9A 3V1LA 3VVMA 4GBGA 3FYTA 2WG1A 4QLOA 3R3ZA 1OCEA 2GBGA 3FWHA 2C0PA 1MTZA 4L72A 5CMLA 3PE6A 5FP0A 1ODTC 4ZI5A 3RM3A 1W76A 4Q1VA 4CCYB 2H7YA 4LKOA 1DQYA 1MU0A 5A71A 2HA2A 1A88A 4EY6A 2XQJA 4H77A 4H7JA 2C7BA 4X3CA 3KXPA 4B9EA 1DWQA 1VJ5A 5ISMA 5IKXA 1XQYA 4OUKX 5AK4A 1UK6A 5K3BA 4MWTA 2JGIA 5JAHA 3HACA 3JYHA 3GELA 2JGMA 3STVA 3FLBA 1IUOA 1UT6A 3IUNA 2WUEA 5D6OA 1UK9A 2XLBA 1G66A 3D2AA 5JIBA 1QIFA 1MNQA 3EQ8A 2VF2A 3QPDA 4X6YA 3H18A 5DYYA 5I9IA 5A6VA 1DX4A 3L1JA 4FLEA 3UMJA 1GGVA 2C0QA 5ALFA 2QXUA 3C5VA 4BP8A 4UBKA 5JZBA 2CB9A 2C58A 4EY8A 1BE0A 3QYJA 5LIPA 5FDFA 2RHWA 2XUFA 3IUJA 3I1YA 2BUAA 3N2ZB 3TJMA 4UHEA 3AUKA 4ZREA 4YX9A 2FUKA 3R3UA 4G5XA 1H2YA 5AJHA 3ESAA 1BN6A 1YS2X 4PV7A 4I19A 3HSSA 4KJXA 3W9UA 3VXKA 4G4GA 3C70A 2DR0A 1SC9A 2RONA 3G9XA 2VAVA 2AJCA 2VAXA 4H7DA 5ALTA 2JF0A 2XMQA 1YAHA 3FYUB 3DYVA 4N8DA 2WU4A 5JZ9A 1IZ8A 4KE6A 4BTVA 1H2WA 2JGJA 3HABA 4QNNA 4BCCA 5HF9A 1JT2A 4A5SA 3F98A 4MYDA 2W6CX 4A16A 1YR2A 1H2ZA 2WM2A 4AX4A 5CRIA 1GKKA 4AMYA 5CH3A 1VOTA 2EDCA 1XZBA 2VATA 2WIKA 5AI5A 1CQWA 5EI5A 1LPNA 4B82A 1JJBA 5JASA 4W9RA 1CR6A 5ALHA 4J0CA 4BDTA 4FKBA 3FLEA 3H2JA 4OU4A 3PUHA 5ALMA 4G9GA 1E8DA 4AO6A 3FLAA 1THTA 1TAHA 1VKHA 3WIBA 2H7CA 1QIMA 2XMRA 2RGUA 3H2HA 1KU0A 3C8DA 1B41A 1THGA 3FSGA 3RLIA 3AZQA 5A7FA 2XDWA 3STXA 1ZI9A 2PPLA 5LLSA 5AM3A 1LBSA 2VJAA 2CJPA 2WUDA 4K5QA 3WYDA 4UHBA 1XRPA 1MX1A 1QTRA 1U4NA 3PDCA 4DLNA 4FBLA 4I3FA 1FFEA 2XLCA 1DWPA 5K5EA 1R88A 3F97A 1QFSA 4TVKA 2BAGA 3WL7A 1USWA 5IH7A 1H23A 2ZVDA 4RNCA 5AKYA 1X70A 1O6FA 5JAOA 1UXOA 4JEIA 5HCUA 4CG1A 1UKAA 3O95A 2DQZA 4BP9A 4MEAA 3EIOA 2V9ZA 1F8UA 1XZAA 4M0FA 3WK5A 5DTJA 2DQYA 2OAEA 4DIUA 1JI3A 1UK7A 3AINA 3U1TA 1E66A 3ED1A 4CCWA 5LZ9A 2VQ6A 4X7BA 5E2IA 2CBGA 3R3WA 4HXEB 4Y2UA 3M82A 4KE7A 4KAJA 2ORYA 5K3CA 5EHNA 1G4HA 5FPPA 4PO3X 4H7HA 1EK2A 1Q0RA 1EINA 1BEEA 1MX5A 4UFOA 1Y37A 5DYWA 4P93A 1LPOA 4HAIA 2AJLI 3BXPA 5AO9A 4X00A 2FJPA 2QT9A 2HIHA 4AZ0A 4AN1A 1CUSA 4UHHA 1CUBA 4YPVA 2QR5A 3S2ZA 4X93A 1IUPA 4KYVA 4E14A 1GPLA 1L7RA 4BAZA 3LCRA 2X8BA 4BCDA 5T4BA 3WK4A 3GUUA 4JYPA 3L1IA 4GLBA 3G9UA 4WFKA 2QJRA 2WHRA 1TRHA 4U2GA 1QIKA 3B5EA 3G7NA 3A6ZA 1AMNA 4DM7A 2XUOA 3S8YA 1GQSA 1GPKA 4CIBA 4X90A 4F60A 3WYNA 4C4YA 5AH0A 3QPAA 1SOMA 3WWEA 2O2IA 3QVMA 1DX6A 1QE3A 4N5IX 4HXGA 2OLEA 5ALUA 2OCKA 2JEYA 3IA2A 2AJBA 3FOBA 1G5FA 5JATA 3GA7A 1K8QA 2GYVA 4TGLA 3LS2A 3D7RA 4PW0A 3ICWA 5FLKA 3I6YA 2XQIA 4JUIA 2ACEA 3I2GA 3A70A 5AI4A 1TQHA 4F5ZA 2WUGA 3FCYA 5ALZA 3HEAA 1RWQA 4UFNA 2B20A 4L0CA 5LZ2A 2OCLA 1CUAA 4INZA 4BAGA 5HF6A 1YB7A 3VKFA 1Q83A 4Y2JA 5T4EA 3WL8A 3Q0TA 4U2CA 1ACLA 2PUHA 2VT7A 3HLKA 3WWOA 4U2FA 3LIPA 1EB9A 3JWEA 1R50A 4NS4A 3ZV7A 1W52X 3STTA 3BL8A 3A2LA 1GQRA 1XFDA 1C7IA 4EY4A 4B0OA 5EIHA 4P9NA 2DHEA 5FOQA 3FSGD 2PVSA 1CVLA 2WG0A 3G9TA 3BIXA 2GYWA 5A62A 2XQKA 4WCVA 4Y2XA 4HZGA 2G5TA 4QLAA 2UZ0A 5C8VA 4QEKA 1XZJA 4K6KA 1ZIYA 4B6GA 4BCBA 3WLAA 3DS8A 3L1HA 2JBWA 1VLQA 3HZOA 1OILA 1EX9A 2XI4A 4I4CA 4FNMA 4UHDA 3H2KA 1YB6A 3AZOA 1BCSA 1EK1A 3O0DA 1QJ4A 4BZWA 1VXOA 1GKLA 4DSZA 1P0QA 2VA9A 4QWMA 2WFLB 4X95A 3R40A 2ROQA 1UKCA 1LPBB 5ALYA 4G4JA 5H3HA 2HA6A 3C45A 3ESDA 2WIJA 3H17A 3WMRA 4DYHA 1JU3A 2C5FA 2JGEA 3ZPXA 3B12A 2GBCA 4RE6A 4G8CA 4XX1A 3ZWQA 4OSEA 2XUHA 4JYMA 4BE9A 5A2GA 6YASA 4FBMA 5C81A 2NW6A 1LPAB 1ETHA 4G1FA 2H9YA 3AILA 4MXDA 2XUGA 5DNVA 2GYUA 1XZEA 3ANTA 1G42A 4HS9A 1YAJA 5ALLA 5AIBA 5FKJA 3WK6A 4D9JA 3R3YA 4GWLA 5BV7A 4Y9SA 2B9VA 2XUJA 2R11A 1H22A 4E11A 3IBTA 5IVKA 1BS9A 2WG2A 4QZVA 5JARA 4K2AA 1R3DA 4QDUA 1YASA 1XZKA 4LXHA 1E5TA 2DCMA 2QVBA 3DOHA 4NZZA 4BC1A 3GROA 2PSJA 5AKZA 5HK9A 2XUKA 4AN0A 2WIGA 2HA4A 1XLVA 2WJ3A 3OM8A 2WFZA 2Y6UA 1XZMA 1DU4A 3BDVA 2WSLA 1MO2A 4X91A 3ZLVA 4BYMA 2I3ZA 5E4JA 1O6GA 1ZOIA 3F8SA 3D0KA 5EIAA 3I2HA 5AM0A 4B80A 3TEJA 3NUZA 1RYYA 1JFRA 3WZMA 4OD0A 2CUTA 4Y2QA 2HA7A 5AKGA 3C8HA 3H2IA 3ZLTA 3BE8A 5T4HA 2VJBA 4FNGA 1WB4A 4HRYA 3DL4A 4LYEA 3ZI7A 2ZJ6A 2Q0XA 4IHAA 2QUAA 3FCXA 2ES4A 2GZRA 5K3FB 3FYUC 5YASA 5D3KA 4WDRA 3WL6A 3WKEA 3QMVA 1XKLA 2XMBA 1P0MA 3ANSA 1K4YA 1XQWA 1CUIA 4OPMA 4FTWA 1CEXA 2OGZA 3PI6A 4DNQA 1XRQA 3O4HA 3QBJA 3M3DA 1AKNA 3WJ1A 1WM1A 5I8PA 2FX5A 2BFNA 3STWA 2Y6VA 5EHZA 4QDZA 3C6YA 4H35A 2O2GA 1TCBA 1JU4A 5ALVA 4FFWA 3C43A 5LZ5A 1R9MA 5HFNA 3HXKA 3QITA 4O08A 5BWBA 3HI4A 1QGED 2VJCA 4H7EA 1GPNA 3C6XA 4UBLA 1XROA 5K3FA 4KE9A 3WL5A 1ZICA 3EQ9A 4OB6A 3K9BA 1FFBA 4BVLA 1W75A 4X97A 2BJHA 2IITA 5JAPA 3VVLA 2ZYHA 4U2EA 4AO8A 4P08A 5LZ8A 3IUQA 5JAUA 1WB6A 7YASA 4J03A 1JJFA 3QMMA 1XQVA 1SCQA 5LP1A 4DNFA 5LKRA 3V9AA 1CUEA 1K6EA 5AOBA 4PSCA 4C6HA 3WWPA 4B84A 2YXPX 2XMDA 2I3DA 4FMPA 1H2XA 2HA0A 4PSUA 2Y1KA 5KWIA 1YSCA 3VISA 2ZYSA 1BEZA 2I78A 2G63A 2IIVA 5AHXA 1XRMA 4J0GA 4E46A 4EUSA 1CIJA 3G0DA 2X76A 3BDIA 3O9MA 1EVEA 4OYLA 3EBLA 2H1IA 4XJVA 5IVDA 4HTAA 4WDQA 4V2IA 1IMJA 3W05A 1TK3A 1TCAA 1NU6A 4GDMA 4DTCA 3H1BA 4CCYA 1N5RA 2B61A 4CFSA 4GECA 3AIOA 3SK0A 3CN7A 1IVYA 4RGYA 1CUCA 1XRLA 2WHPB 4YK7A 3STYA 4KRYA 1QIJA 2QZPA 1ZD4A 4PSDA 4RE5A 3OPMA 5ALDA 2PUJA 5ALKA 4UHFA 1ZI6A 1GT6A 4GW3A 1EB8A 2XMSA 5SYNA 1NX9A 1B6GA 2OPHA 2XQGA 2ZSIA 3C5WP 4GXNA 1ZJ4A 1EH5A 4DSAA 1XKTA 5ALPA 1MNAA 3DKKA 4CI9A 4M0EA 1JJIA 2ACKA 4FFVA 5LZ4A 1QIGA 3WZLA 5HKAA 2DHCA 3YASA 3PFCA 3OURA 1CV2A 3EF3A 3KDAA 3ZLUA 5BOVA 5ALGA 3ESBA 2XMZA 4B85A 2WFMA 4Y2PA 3H04A 2ZJ7A 1X2EA 5JD4A 5KWJA 1RP1A 4BE4A 3I1IA 4ARBA 3I2FA 4Y2VA 4AZ3A 1EA5A 4ZGBA 5DLPA 2XUQA 3WWDA 1XZIA 3IIIA 1N5MA 1WHTA 2X5XA 3D2BA 1UOPA 1EDBA 2DSNA 4N5HX 5EHXA 1A8SA 2G4LA 4XWGA 5CH8A 5HFAA 2HU7A 4N8SA 2EDAA 4UFPA 2W22A 1YA4A 3LP5A 2LIPA 2J4CA 4ZV7A 4X85A 1ZGBA 5HZGA 4BRZA 3WA6A 1CUYA 1A7UA 3V1NA 3SC2A 2HFKA 3M83A 2Y2VA 5CURA 1OXMA 4H7KA 4L3WA 1WHSA 2O7VA 5A7GA 4Y2YA 2P8SA 1QOZA 5ALQA 4J0KA 5ALWA 3TGLA 5HF8A 1LPMA 5ALIA 2WLSA 1NU8A 1DWOA 4ZWNA 4KE8A 2RAUA 1SCKA 1F6WA 4FOLA 3BWXA 3QPCA 1W4LA 4G4IA 4ZXFA 1CPYA 1CUJA 2AXEA 4BB0A 1J07A 1HLGA 3BJRA 4CG2A 2JIDA 3AZPA 1CFJA 5AKKA 1GXSA 1VE7A 3OTQA 4TPKA 4ROTA 2PSDA 2HRRA 4EY5A 5AM4A 2HADA 5E4YA 2XQFA 4W63A 5DWDA 5AKLA 2PSEA 4QDOA 3DYIA 1UKBA 2ECFA 3CCCA 2V96A 1ZD5A 1JMKC 3W06A 3IVMA 3G0IA 3HYSA 3E0XA 4EY7A 1DINA 4FWBA 1UZAA 4KACA 2QS9A 3G02A 1Y7IA 4PF1A 3A2MA 4Y2RA 1R1DA 1MPXA 3FNBA 1WCYA 4F21A 4MWSA 1K5PA 2DHDA 3FVRA 3ESCA 4G8BA 2ZSHA 4UPDA 1GZ7A 2PL5A 4UBJA 5CH5A 3K6KA 5AKJA 4MQLA 1W6RA 1HDEA 2O7RA 3AIMA 2DFPA 4X6UA 1XZGA 3MVEA 5HF5A 1QO9A 1J2EA 5CXXA 4OYYA 2PU5A 1QIDA 4OCZA
chains in the Genus database with same CATH superfamily
4FFSA 2IHYA 3AKEA 4YV1A 1LNZA 1GN9A 3H99A 1X2BA 4CVNA 2DBYA 1RRPA 1T5DX 2FF7A 2IGBA 4JLDA 1UMBB 3A6KA 4H18A 4JQZA 2FKAA 3GMSA 3A4NA 4FQ5A 4N0MA 1TUGA 1CJKC 4QHYA 1E2JA 3V34A 2J3QA 3PFIA 1OYYA 2YXEA 2G83A 3UZUA 2FFQA 3CJRA 4HYYA 4LTNA 1F12A 2WZCA 4KQ6A 4M46A 1T8PA 3UWSA 2YMQA 2ZU0C 1XCOA 1FTWA 3BILA 4O4HB 5ICCA 4NARA 3IPRA 3WI7A 5GM2A 1MZVA 4GI3A 3CTMA 4M3NA 4UBNA 4ZDKA 2Z08A 2A9JA 4RJJA 4W9NA 5IC4A 1JG4A 2YHIB 4QQ8A 3ZJVA 3C7DB 1EWKA 4QOJA 1GLNA 2C3YA 3F47A 1U2SA 2BWJA 2XZTA 4E51A 2CKDA 1KO5A 3BTUA 5DNCA 4CMBA 1TZMA 3H9GA 4F6LA 2J09A 4PC3A 1CRPA 4ZAWA 1EVZA 1BRTA 3J81k 2FPPB 3TZEA 1RQXA 1TQ8A 4ID9A 5FOUA 4UUOA 2HNBA 2IT1A 1SC3A 1AV7A 2J9GA 2QTTA 3DLPX 5FTKA 3U5TA 1EA7A 3LX5A 4FIDA 1D4AA 3X1XA 5J3JA 1OV4A 1Z7WA 4U9IS 3TRKA 1H4QA 3NHKA 4ARAA 2Y1LA 3DE0X 3JQGA 3LDAA 5EKSA 2AOUB 2NT4A 1LNSA 3PEFA 4P4SA 3CUSA 3R76A 4JJ6A 1L7EA 1JBKA 4YCMA 1R6DA 2VUUA 2PUCA 1T4MA 3UUEA 2IYQA 1ZD3A 3ESQA 3RC3A 3VYSB 2IYVA 1XJ5A 4QDKA 4V39A 1A9ZA 1F8FA 3G8AA 4AG6A 1E94E 1WUKS 2Y93A 3HH8A 3OETA 4D74A 4IOMA 1D09A 2QRLA 2RK3A 4PLFA 1VB5A 3G23A 2ZM5A 4CR7A 1QAMA 2IDZA 5EE1A 4FS3A 1SXHA 4N3NA 4FZRA 1QQBA 3JVVA 4J1QA 1WXIA 1WCXA 2V65A 4K9QA 2ZRGA 2R5WA 3E7DA 1NGSA 3JPYA 1OW3B 5EWJA 3I2YX 4YP1A 3B3AA 1R0SA 4NBRA 3GHHA 3LBYA 4RQAA 5TMDA 4B31A 3CUYA 2WFAA 1M6HA 2AK2A 2H4XA 4L28A 1VMIA 4ZQEA 4EM6A 2PXHA 1R74A 4F92B 3DV0A 1Z6YA 4A8HA 1U3GA 4EI7A 4YPFA 3OEYA 3DXFA 3ZWKA 2J3DA 3BGWA 4UAGA 1NBEA 5H4HA 4HT3B 4DYDA 4I50F 4LXIA 2PL3A 2ZUCA 4KIFA 2IIBA 4RPCA 4YRTA 2FYTA 3S1SA 2ZIWB 5A4KA 1D1PA 4MO9A 1LRLA 1HDZA 1VIVA 3U3DA 3QVJA 2IEDA 2H1VA 2UYCA 1N2CB 2HPVA 3RANA 4PLVA 4XCQA 2XBMA 4X8LA 1W2HA 4Z9XA 4J7XA 4UOEA 1YQUA 4QUJA 5K8VA 4KR0A 4Q3OA 1YGYA 5KDDA 2B0JA 1YB2A 3LX4A 4NCIA 5LQMA 1KEZA 2JGRA 3TNFA 3RUPA 3R9XA 5DX1A 2WQ7A 4CFYA 2HMVA 4BEVA 4PONA 3WK9A 1YCDA 1IEVA 2AMJA 4G85A 2H5IA 2V7UA 3KTOA 1F9EA 1NBWB 3QKSB 1NF8A 4MUKA 4N9WA 5LOVB 3SWWA 3ERCA 3GEEA 3GNSA 4DR6B 2NUAA 3OC0A 2H54A 3GBSA 1NR1A 1UK8A 2WJWA 3E48A 4GT1A 4Q4AB 4BNFA 4ED9A 5LOVA 4E5UA 5GMOA 3ESRA 2BIFA 3A6EA 1Y3AA 4O2BF 1KYWA 3SKYA 3DDUA 4KQHA 1X1CA 5EFZA 1CIVA 4P84A 3WLPA 3BMNA 4I4IA 2GBPA 3THXA 1IN6A 2C96A 3GJZA 4U5QA 4YUVA 5JHGB 2INGX 4EH1A 3IVCA 4ID3A 2UUAB 4HTFA 3L7NA 1BU8A 3FYCA 1FE8A 1P1IA 2YDXA 3IAM1 3B6ZA 1K97A 1O94C 1JW9B 2EW2A 2Q3LA 4E5PA 5I9SA 3DMFA 4LYFA 1PLJA 1T4CB 4E13A 1QLWA 3KSDO 1CZRA 3HDTA 1ORWA 3D6UA 3JZIA 3PNKA 4WBNA 4QIHA 1YHYA 3E7PA 1M72A 1G18A 2B4KA 4M1SA 3HHPA 5AI9A 4ZAZA 1UUFA 4E88A 2WOJA 3B13B 3R7AA 3WP1B 1SU6A 3AGPA 5LVAA 2O2EA 3AT1A 2XVAA 4CMEA 1NZJA 2QTBA 4I4TB 4B4WA 3NEAA 2BGRA 1QYRA 1RQRA 2H3HA 3GZTB 1QBKC 2YOHA 3QXSA 3RIYA 4DMFA 1A96A 3CUKA 1GZDA 1I10A 5ESXA 3T0FA 5KC9A 2Q9AA 2R8EA 5JDIC 2XF8A 2PSHA 4F8EA 5TARA 3P9SA 3WLHA 1C3JA 4Q7JB 4DL9A 3DCNA 4JA2A 3L9WA 4GPIB 2QRVA 1BNCA 5HUJA 2D0PB 2QA5A 5TPWA 3RARA 1NVWQ 3IUMA 3SIPA 2HEGA 3T3EA 1OGIA 4BGVA 1PSZA 1XJ0A 2QRVB 1L5HB 3E9MA 4DF3A 4O63O 2Q2WA 2P1DA 2ERCA 2IDKA 1QTIA 2XEDA 2IYOA 2XTMA 1L5HA 1O0CA 1UDRA 3OX4A 4FFPA 3AJAA 3CZRA 3EEBA 2XECA 5B4VA 1AK2A 2FPSA 2X7XA 3K1YA 2JHFA 3HFJA 2GRUA 1K66A 4FFMA 1C81A 4S12A 1JA9A 1Y7LA 2H85A 3MRSA 4MQ4A 2HJHA 3A1DA 5LYYA 3DJFA 3PLAE 3EXG2 2IJGX 1JG3A 3C6BA 3CC8A 4GP6A 4HEQA 5ED0A 4Y2TA 1GKYA 5B53A 4I8XA 3S68A 2ZYVX 3WLFA 4D3ZA 4PWYA 4R7TA 3O4GA 3UTDA 3ROKA 5JJKA 3EVBA 4OU5A 1ZGZA 3V4OA 3WRWA 1NOIA 5DYTA 4ZCTA 1OC4A 1X38A 3MF4A 4G9EA 3PRKE 4QECA 4AXBA 3LUDA 1SXIA 1GPDG 2I4RA 4KXQA 4NHEA 4RA9B 1LWOA 1IDN1 1U1DA 2AJDA 2A1IA 2VJOA 4HNGA 3HDJA 1XXLA 1Z0AA 4LYJA 4N7RA 1G9TA 1JPJA 3OWXA 4KLZA 1ISRA 2JJYA 2WIDA 4IIJB 5EE5B 4XI9A 3U26A 4IDPA 2XCRB 4EHKA 2FSHA 1EDEA 2MR6A 1G291 1YMVA 3GLHB 3IHLA 4KUGA 4PC2A 4RFSA 3WMFA 2CJWB 2FSGA 4YLEA 1T9CA 1E9CA 4U9UA 4WKNA 3G2KA 3AV0B 5HE9A 1E9DA 1E9EA 4QBGB 2F9MA 4R2LA 3PL5A 2ODAA 1LNQA 3AW9A 1MAUA 2BFBA 3IDOA 4BUJA 1EXDA 4JI7B 3TAHA 3GH1A 2PAAA 2XUDA 2NZVG 4P4GA 1IPHA 5D01A 2OORA 1U3CA 3NVAA 1FU8A 1TMGE 2AJ8A 1O6CA 2ORED 1NVAA 2OV1A 4J43A 1PFVA 5IUNC 5K8CA 3LOUA 3TRDA 2E4YA 1YC5A 2BFCB 3N0VA 5D85A 5E9JA 4YRAA 2J0QA 2RC6A 4P83A 3Q9LA 2IIQA 3UJDA 4DADA 1QPGA 1GV0A 1MJ5A 3UIEA 2O57A 3L7AA 2HWYA 4RZHA 5DK6A 5K6RA 1DTWA 3MT0A 1RLUA 3EMVA 4ITUA 3AEKA 4IVNA 4MP3A 2AC4A 3T15A 1EJ2A 1ZUNA 5LD2B 2YDYA 4E94A 2IX9A 2PGOA 2GZ3A 5HKKD 1H0HA 1QHIA 1G5RA 3ASZA 2JLXA 2AIRA 3OLXA 2BFDA 4Q5IA 2Q6VA 4W1RA 4CEHA 1ILEA 3B1VA 3N53A 2OB1A 1C14A 1QHHB 5KSOA 3PQ4A 3D4BA 4Y6PA 3C3PA 3WB2A 3WIOA 1B00A 3MAAC 2JEZA 1DELA 5K7SA 4KPYA 1ENYA 1T13A 3E0QA 1ZO8A 4C0WA 1D9XA 1GAQA 1UMDA 3DHEA 2C8VA 1G8AA 1TKRA 4DIFA 2D5LA 3PG5A 4RXMA 1TM7E 2XDQA 4ARIA 4XIIA 4C03A 4YRCA 1KH3A 2XVYA 1ZCFA 2ZQYA 3D4LA 5K99A 3FBTA 9GPBA 4O4JA 3GIDA 2B98A 5AW6A 3TM5A 1JH9A 1CBUA 2CLKB 3Q3HA 3VKWA 2VTVA 2WQZA 2M6LA 2GO1A 5KNLA 4MGYR 2ALJA 5JMTA 4KMMA 1DAMA 1JHVA 3UG6A 2HJVA 3GD5A 1A69A 3DBVO 1OI7A 1QNLA 3D3NA 3LW7A 4G1VA 2JFGA 3TOCA 3R7NA 4BATA 2P91A 2XDAA 1TYAE 4OXIA 4E32A 1WZUA 1YUMA 3WJ2A 1HTWA 1KDTA 4PN7A 4RCVA 3U6KA 1ZLYA 3C3MA 1KI8A 4UUQA 2CVQA 3EB9A 3O91A 1KO4A 1H4VB 1ZSYA 1WVIA 2IEAA 3EEQA 3DMTC 3KYDB 3QFTA 1MB0A 2WABA 3BJMA 4DNOA 1V71A 1IIRA 2X8WA 1ADYA 3UGQA 3UQYS 2ZSAA 3WQSB 4QJ3A 2O23A 4FJ1A 4HAYA 4QUBA 1X1QA 2AF3C 4FK8A 4WBXC 4DMCA 1Q11A 4N9QA 1BD3A 5J9FA 3QELB 4RHTA 1KP3A 4JLBA 1XZLA 2AQ8A 4D3YA 2ONKA 2V59A 2XYPA 3TTVA 4IGIA 2FXIA 2JGLA 5J5CA 1GG8A 3GNLA 5JCOA 3BKXA 3UXHA 5CLFA 2ZB3A 4H6XA 1U3VA 1EHYA 1ZVMA 1XIVA 4XFDA 1MJFA 1V1MA 1JIXA 3RO7A 2UXDB 3Q41A 2Y0BA 3C1OA 4MA4A 4URXR 2XNCA 1UBCA 1J09A 3CRMA 1EBUA 1N6HA 4Z6KA 4BO3A 2YWRA 4N7BA 1CQIA 1JFVA 1U2RA 3E3LA 3B1KA 2ZB7A 2H2AA 3EXAA 4AMUA 1CZNA 2H1RA 5BVHA 3JY6A 4Q3BA 3NT5A 1VIYA 1XL1A 3K6JA 1YE5A 3RWOA 2HREA 2FWRA 1P1RA 1G8PA 1NN0A 3CH7A 4HAVA 4RSGA 5M5BA 1CJTC 3PXXA 3UBMA 4RIIA 5D84A 4P5PA 1KJZA 2G5PA 1PFQA 2GNOA 4L16A 4L6AA 1AF7A 2VPYA 2XT6A 5CITA 5C8DA 4X3OA 3RNOA 2FWBA 2YNMC 2H4YA 4MVJA 5HJ7A 3BF8A 1K8RA 2XB4A 5BT9A 4G41A 5BN1A 1SVNA 4JX8A 4YJ3F 4EYSA 3OFJA 1J1IA 5J4LA 1I1HA 2WSSD 3U7QB 1FFHA 1CVRA 3DTNA 1Q16A 3MWDB 1H6BA 2YYSA 1W59A 2NUPB 5FAKA 4IMPA 1UOEA 3VZQA 2AN1A 2P2NA 2DY0A 4Z0NA 1IXYA 3VPBA 4P22A 2VDWB 1S9DA 1SFRA 4WZAA 4BJ1A 1GRQA 3UBTA 1T0UA 2PO7A 4C88A 4WLOA 1ZXLA 4R54A 2JFQA 4PGFA 5I7HA 1VQ1A 5JAQA 1J8DA 4L50A 3O8DA 4PRLA 3LE8A 3R5FA 2DKNA 1E79A 1S2OA 3BUSA 1THMA 3DNMA 3KHTA 5DBEX 3F6EX 1R8SA 2ZEJA 3G2HA 1YS4A 4KTTE 1WY5A 2HD4A 2XCSB 3FGNA 4NICA 1E6CA 2NAFA 1L8OA 2BRUC 5IJZA 4GZ5A 1QMGA 3DB2A 2QX8A 2EAUA 4N4AA 1ONBA 1I5EA 2W6NA 4UCXA 5D1NA 5KYXA 5FNVB 2LTAA 3UCFA 1PUIA 3OJ0A 4X1YA 5C32A 3TAUA 2A5YB 3PC6A 5IT4A 1A7AA 3DBOB 1T1GA 3KLNA 4V3BA 4ZQIA 3W9BA 4CG3A 4EJ6A 3UJCA 3BT7A 5SYAA 1FY2A 1I1NA 3IEMA 3AVXA 1Y0BA 4LC9A 4QJIA 3DVSX 3Q15C 2O0JA 5LBIA 1ZU5A 5C9ZA 4W5JA 4S1NA 5EE9A 4CR6A 4BE7B 3KEQA 3IYLW 1GFWA 1WEKA 3DP9A 1SA0A 1ZSNA 3NHRA 1FFWA 3T9DA 3PQ5A 1IZYA 3CZPA 4LJ5A 3WGTA 1R6UA 3E5RA 4TQAA 1EWVA 4QODA 4Z0TA 4HWKA 2X0JA 1P2GA 3WX0A 4D9MA 1SKBA 3AOGA 2VZ8A 2GKOA 4TZTA 1PR4A 1T3TA 1CJSA 2W7TA 3CNOA 4ZD6A 4B5KA 1PUJA 2YZGA 3T9AA 5CEEA 1DQZA 2QDXA 5MFZA 3JQAB 2N1MA 4GRIA 1A3CA 4ZANA 3BGSA 7ADHA 1YJAA 2HF9A 1WDTA 1IMOA 4FHEA 3TEFA 5FUMA 2QBYA 1EFVA 5ICFA 3O47A 5TY0A 3TW4A 5J40A 1AQLA 3W5JA 4F2HA 4DLPA 4MWOA 2W93A 5DLQC 1I5RA 3H9EO 3VHXB 1WOMA 4UUNA 5I01A 4N1AA 2VCEA 4DLLA 3KQQA 1JECA 2FFAA 2VDNB 2ZR8A 3ZK9A 2QLMA 3P2EA 4KR9A 1PVVA 3L04A 2G77B 5BSKA 3HUDA 3NH6A 3QNWA 2VUIB 1LU9A 5AW1A 5FBHA 3P2JA 1M1NB 4EFLA 3QWHA 1ZKDA 4OQEA 4BV3A 3K70D 3KFLA 1YIAA 1JQJC 3R1IA 1ZJ5A 2HM7A 1P5HA 4HNAA 4Q4HA 4ZAYA 4D41A 2VT6A 3GIWA 3AIKA 4U4AA 4DQDA 5JZOA 1TUEA 1AA6A 2ONCA 4WN9A 3RVMA 3UF0A 2OFWA 3E1GA 3NKLA 4F1WA 4C1NA 2Q3DA 1EFPB 1JG7A 4B81A 2C3OA 2FZLA 3IS3A 3LAWA 1RC0A 3U7RA 1XVVA 2ZYDA 3M9WA 1N1MA 4XLLA 1PD1A 3G9ZA 4LMBA 5CT6A 4YHBA 2G7MC 2NV2B 4ZQFA 5E0KB 1C7JA 4M0MA 4C0HA 4BMVA 3ZDZB 1DKUA 1MX3A 3ILSA 1BJRE 4C2AA 4EB3A 2QROA 1KFJB 3URMA 1Z74A 4DMRA 1O4VA 3MJVA 1XEFA 3ETGA 3NV9A 4DM3A 3P2OA 5KOIA 4O1HA 3U09A 4PFKA 3UJ7A 1V3QE 1YZ3A 4MUXA 1GUBA 1NATA 1MV5A 3VU8A 1SHTX 1UJBA 4N6OA 3A0UA 1T3HA 4OQXA 3CSSA 4MO2A 3DZKA 4GUAA 3RC1A 4FR0A 3RGWS 2FW8A 1E0KA 1U9CA 2BM1A 1UC4B 1JEOA 2QL9A 3M6MD 5THQA 3ETJA 3QG1A 3NGLA 3ZQUA 4YDHB 1SKMA 4I6JA 2QPAA 3B85A 2QLTA 1IN8A 1EGQA 1VDMA 1Y7HA 2F59A 4V38A 4MIYA 3ZE7A 5DTMA 4JA0A 1OVMA 1HGXA 1YR8A 2IOFK 3DBHA 5LD2C 4H7IA 1T4CA 2B36A 4ZHQA 4I8DA 1EWTA 1GQQA 3F4LA 2PX6A 3TS1A 4AJHA 4ARVA 5AI0A 3V4SA 4HX9A 2A78A 1ODJA 3JWHA 1KJ8A 3K2BA 1O57A 5CT4A 4UHJA 2C1ZA 2OCGA 3CNBA 1MLDA 2O2ZA 3FYUA 2XVMA 3L7JA 4LSWA 1ONOA 2A1TS 3DO8A 2REOA 1Q2XA 2UZIR 5DH9A 3DEYX 5BV1A 1Y81A 3I5XA 4J9UE 1B7GO 4JQOA 1X6VA 4UM8B 3T3GA 2Q1WA 3AQ4A 3ZK7A 3E9NA 3N58A 3VR4A 2Z5GA 3E2PA 4EKDA 1N34B 1SWVA 4R1UA 3D59A 4Q9KA 4E3ZA 1KDPA 3KOYA 4FCTA 1M7HA 1E2EA 3EXG1 1CK4A 3L7DA 1KK1A 3F9IA 3P4UA 4ITVA 4FM9A 4DA4A 4M83A 2J87A 1ZH4A 3LL7A 4QBFA 1HDIA 4LJLA 5FULA 5LZ7A 2GK3A 2HYDA 3AR6A 3DPUA 3QENA 1J9ZA 1FFXB 1NFFA 3FFTA 4H1UA 3W8EA 5HJ5A 5I7UA 4NYMQ 2PBRA 3A1EA 3ICVA 3RFTA 4D4JA 1MB2A 3EYWA 4LZJA 3WNCA 1VJ1A 4RH0A 3L46A 3DCIA 3V2UA 3SI7A 4MIOA 5BR4A 2OHJA 4WLEA 3WFJA 4BLVA 4EEXA 2GD1O 4QA9A 1JNXX 4AB1A 4MVJM 4AO7A 2I4TA 1U0EA 1ES9A 2AX3A 2V7EA 1KOGA 3PICA 1YS9A 3D4PA 3T5PA 3ELDA 1AVTA 4EUKA 2Y2UA 5C80A 5LKAA 1U4OA 4MULA 3WE7A 3WWYA 4C06A 3GVHA 2AN5A 2YASA 3R41A 5KHAA 4DT1B 1AH2A 1YB5A 1DT5A 1P1BA 4RD4A 4D9FA 2WE7A 2JH3A 3NJ4A 5L3QB 1IVSA 4FR2A 3AYZB 3C3CA 4JKYA 4E6EA 1QP0A 2C4NA 4QM7A 3LWDA 2ZBQA 3U48A 1JPVA 5E6UA 1E0JA 1GO2A 2V6IA 1ZUWA 5KJCA 4EYQA 1PS8A 3K9QO 3SSAA 2GZDA 2B3TA 3EHEA 4BJHB 1H93A 5ED4A 1E1CB 3F96A 4TT3D 5IS2A 3RVDA 3QBTA 4ENQA 1DDIA 1ND5A 2AJTA 4JQSA 3WMXA 4BJ5A 4DAOA 4CN8A 4CDMA 4BQFA 3CX7A 2KM1A 5JFGA 3JRWA 4DMLA 1OWOA 3UYLA 2GA8A 2Q5IA 1Z12A 1KJJA 3KLMX 5AM5A 2KLBA 2CJWA 4H16A 4CJXA 4DJFC 1GTMA 4KK4A 4B8ZA 4GR4A 4NVRA 1OAKA 1JUDA 1USKA 1DAOA 1B15A 2C8KA 2ZVPX 2OENG 3BCSA 3EGVA 3PZBA 5K3OA 2QRHA 2VN8A 2ATXA 1KQNA 2A1UB 3PX2A 3M81A 2QGFA 4LCBA 3D1JA 1MAAA 3KETA 1QHEA 2Z2JA 1FFAA 5BSEA 3IV9A 4EZEA 4Q4JA 3KQWA 3GDOA 2RGXA 5CW2A 1JTFA 4IILA 4RWZA 4WL0A 1WL8A 1V26A 4MS4A 1X1AA 4PX3A 1AV6A 5JSQA 5HOEA 5KNBA 2PGDA 5L9AA 4PO9A 2ECKA 4I9FA 2BGWA 2D0DA 2QJOA 1UDXA 3K9NA 2VJLA 4IJUA 3RFUA 3CLTC 3V80A 2H18A 4EB8A 5JHHB 1CY0A 4J0FA 3T3PB 3UEOA 1M6NA 3PVSA 1RXIA 2IUTA 4TKUB 3BDAA 1U2DC 3DLCA 4B3XA 4TTTS 3WGKA 2AE1A 2VHZA 3B36A 4H1TA 3MFYA 3DBRA 4PTLA 5AVRA 3NYIA 3JQ9A 4MVWA 1Z35A 1WHTB 3KJEA 1UKVY 5ADHA 2YV5A 3RHTA 3NXKA 3ZWYA 5G0TA 2H5LA 2PKWA 3L8ZA 4EG8A 2BRUA 1SKUA 3S55A 1BIFA 1OFGA 1QK3A 1XCJA 2FN7A 3KJFA 3QF4B 3C1AA 3DBIA 1DJNA 1QG0A 2D2EA 3DF7A 1K7CA 1ZVJA 2QTCA 3QYFA 5KYNA 2C2ZA 1TF5A 4LSZA 1TA9A 3CRQA 3H2YA 3IQEA 4GWKA 2OQIA 4IH1A 4F4IA 3IAXA 4BO4A 4AK9A 4M1QA 3UENA 2UYGA 4PXSA 2Q21A 4J4BA 3D6NB 4KLCA 1ULSA 3PXAA 5HIMA 1FU7A 5ILGA 3Q1LA 2V4UA 3NTVA 2V97A 4FXOA 5F7JA 1KRHA 3W2FA 4AZTA 3ZH2A 2ZYGA 1LK5A 3GZJA 4Q3LA 4MHSA 3TJRA 4BLOA 1JIVA 1KARA 3EIXA 5BP7A 1YTLA 3ABZA 1E2MA 4W5WA 4BRWA 5CXUA 4LRUA 4AYWA 2JGKA 3D1LA 3C3WA 1BXKA 2A9PA 5IMSA 3SF8A 3BTVA 1AZWA 1BVYF 2A9QA 4YVFA 5D1HA 3NH9A 2FE4A 5DCYA 4JP8A 1GTSA 2EC5A 2ZAGA 3ZNNA 1H9CA 3DM9B 5T3UA 2DUJA 4PRZA 1E5LA 4K26A 1TQ6A 4BNUA 1Q0TA 3KQTA 4PAQA 4QOEA 1KY5A 1UDBA 4K6OA 4PTYA 1ADBA 3IHKA 4ZVOA 3OM9A 3GL9A 1ZCZA 4IV0A 5HBGA 3T35A 3WYAA 3LZDA 5BR7A 5MGBA 2GPWA 4IRXA 2IYSA 1U2DA 5IF9A 1OHHA 1ZCBA 4X1OA 3S6JA 1RLJA 1T6XA 4L5IA 3IX7A 4B73A 2F1JA 3WSTA 5DGDA 1SVIA 2CLOB 2V8OA 3PS9A 4B17A 3GFTA 2ILVA 2PXCA 4XDHA 4PHTA 2HNKA 3KO8A 4CKBB 4TTIA 3LIIA 1KGSA 4UU7A 2FSSA 1LW6E 1CB0A 1SOVA 2VAMA 3GUYA 3NASA 4KODA 1JG6A 4R6XA 2LWIA 4YRZA 1QQAA 1J06A 3O94A 2VDKB 2VO1A 2M2IA 3BWVA 4RVHA 4YUYA 1N9GA 5ES4B 1Q7GA 3ABOB 4TLBA 4FZJA 2DH5A 2J0SA 4F0JA 3WYBA 2E5LB 5AICA 4DABA 1P7WA 3GNQA 3DPIA 2XRFA 1C9YA 3DNFA 4M99A 3N3BC 1PL6A 4BKMA 1WB5A 2CNWD 4NFYA 1RXUA 1U11A 4GNKA 4MPJA 4B6PA 4L8GA 5KKAA 2IOFA 1PBNA 1DIHA 4YRRA 3TQRA 1CETA 2F00A 3TVDA 3V4LA 4AVYA 3A10A 2QRQA 1Z4MA 1XDBA 1BOOA 3G5TA 4D02A 1TM5E 2VPTA 3QV2A 3S0JA 3M8KA 3W5UA 2AVNA 4JZKA 2ONYA 4QRIA 2X5JO 4X94A 3DLTA 3SG0A 5BXQC 1RM4A 1W36D 3HC7A 2PZEA 4UBMA 3MJDA 4J1SA 5KIAA 3KUUA 3VTKA 3TSCA 2NUPA 2ZR7A 2I1WA 1H5NA 7ABPA 1AHIA 1W1IA 2IW3A 4AQYB 1ZJWA 1OJLA 1P5FA 2N0SA 1YD7A 5CLHA 2WKRA 3DO6A 2JB9A 3M5WA 1W30A 3VVMA 2GEFA 3AR9A 4GBGA 4QLOA 3R3ZA 4EYKA 3ANYB 1UMBA 3UUWA 2CJFA 1JDNA 2R1VB 4QXAA 3FWHA 4CQLA 2CVPA 2IYTA 4HNVA 3NU1A 2VUHB 5JH7A 4L73A 2Q8PA 3MWLA 3PE6A 4HS4A 4OEHA 3I37X 4QASA 3QY0A 1LQTA 5KYXB 1J20A 4G63A 5CVVA 2WWVD 5AHRA 2CMHA 4YEDA 4QOGA 2BSQA 1CQPA 1TNDA 1GITA 2HA2A 2HSJA 4LKOA 5AXAA 4RU1A 4R84A 3NATA 2LDBA 2EWWA 4H7JA 4H77A 3R7SA 1X77A 2Q4DA 1SRRA 1QQ5A 1V3UA 2QX4A 4O4IF 2LZ0A 1LW7A 2I34A 3AOEA 3ZV3A 4GKJB 2IZ6A 1UBUS 5I4CA 3CEHA 3LP8A 2VDUE 1FFGA 1W85A 2Q8NA 4XPIB 3BWBA 4K46A 2YN2A 1WD7A 1CS4C 4U7WA 1TEVA 3R6GA 4H1VA 4L75A 4CDNA 5CBPB 2WV9A 5D3MB 1KEEA 4AD8A 4C21A 1GA1A 2LDXA 4FMDF 3D3WB 1ITZA 1D2RA 1EESA 3KL2A 1CY7A 5ECWA 3ZV6A 3VNQA 1KQFA 2Z2KA 3T3MB 1A7JA 4HNQA 1F6DA 1CE8A 1S01A 2AX4A 3TLCA 1NV8A 2X4IA 3IOEA 5BSHA 3FLBA 1R12A 1I8TA 3DEJA 3HNPA 1L5FA 1XCPA 1NNLA 1EK0A 3SHQA 2QVXX 2O7QA 2WM3A 1NW8A 2YJGA 3MBOA 4FMBB 1AHPA 1V5GA 3KXIA 1RMQA 1UK9A 4RV5A 4UMEA 5I9NA 2O8CB 1MRSA 3RRXA 2J3MA 5I9MA 4QSHA 3KK0A 1J0EA 4O33A 5JIBA 4DB4A 3F8TA 4K1XA 2YV4A 3EQ8A 3ZWPA 3CNEA 2YR0A 2VF2A 1PR1A 1FMCA 3RAGA 5DIZA 1Y8AA 3PWZA 3ELYA 3HY6A 3QPDA 3H18A 1EG2A 2J3IA 2OG2A 2WYUA 4FLEA 1T15A 1JVBA 4JLNA 1H2AS 4WV3A 2C0QA 3ELWA 5GGXA 4IW3B 4ZOLF 4JJKA 1NA5A 1M6VB 2IHJA 2ZULA 1OBCA 3NM6B 4ARZA 2OOKA 4MVJD 3ONVA 4DOMA 2HX1A 1BE0A 2OGWA 4ARZB 3OQJA 4BLQA 2NO6A 4GL2A 4F7WA 1AS3A 1GAWA 721PA 1EUCB 1CYEA 1J8YF 2JKZA 2IS4A 2OAP1 2IP4A 2V55B 1RYMA 1XA4A 3HCAA 2W2XA 3OD1A 4G0PA 5FI3A 3R74A 3G3EA 2R79A 4C4RA 1H0KA 3TJMA 3F6RA 3OZRA 4NZNA 4RQBA 5A0VA 2FCRA 5DLYA 1DOAA 4ETIA 8GPBA 1JXOA 2ZDQA 4G5HA 1SEVA 4E7PA 4YX9A 2R84A 3GN1A 3HU3A 4ND8B 2DWQA 3OESA 4G5XA 4UDYX 1H2YA 1QTNA 3EZYA 3ESAA 3MOGA 4RW0A 1T5LA 5GONA 4ZO9A 1WAMA 3AO0B 4QYTA 5JDCC 2AWNA 2JJ1D 4C14A 1SXGA 1ZMRA 3ZEIA 3W9UA 1N6RA 4I36A 3ITEA 3T0IA 4BFYA 2D7DA 2J07A 1SBTA 2DR0A 3CWCA 4YPOA 4IXMA 4U2KA 2GFHA 3GQBA 1TUBB 2A9RA 2O19A 3BMCB 3G9XA 1SBIA 4EFDA 1RYFA 1BW9A 4G5FA 5EZQA 2CSUA 4H7DA 4HWRA 3NUQA 5FWXB 3F3SA 5ALTA 4DFDA 3LW8A 4CL8A 4YRIA 2C94A 3FYUB 4NU5A 3PGJA 5JH7F 3FPCA 5ILQA 4L5YA 4XGQA 5JYEA 4TL8A 4KE6A 3I61A 3I5MA 4HMOA 3ZDRA 5DEIA 3C3DA 1H2WA 4DREA 1T4GA 4R2JA 2D2IA 3SY8A 2G5GX 3F98A 3I0NA 2OO7A 2RCYA 2JFOA 4IICA 3WLKX 4DLWA 1I2DA 3K2EA 1DO2A 1ESZA 4CKCB 1LCIA 1YBVA 2ECOA 2HY7A 3NHPA 4A16A 2WF7A 4PGHA 1H2ZA 3NIDB 2H52A 2C9YA 1BZYA 2WM2A 4GE3A 4MUFA 1C41A 5HKOA 5CRIA 3PHJA 3U60B 2NOAA 3I62A 4KPUB 5A3RA 4JXKA 2FK8A 1FMFA 1VOTA 1T24A 5DHPA 1XNRB 3L41A 1H05A 1C7QA 4D0NA 1JEAA 2BR5A 4YFVA 4AG5A 2Z5LA 5AUOB 4M1ZA 3M6AA 4UUPA 4KYUA 1GYRA 5EI5A 4F86A 1LPNA 4B47A 3ADCA 3F78A 4CEIA 4N76A 4OHBA 5ALHA 4JI0B 3EMKA 1VE5A 3E03A 1OIXA 4I6EA 1MORA 1OWPA 4CZ2A 1PV4A 3IFSA 4HSGA 1KK3A 2C8JA 3DYBA 3KKLA 2PZGA 3NJRA 3OM1A 2OBLA 5TMPA 3AESB 1W4CA 3P9YA 4QPCA 1HDRA 2Q0QA 4G09A 3D3EA 4AF8A 5DM4A 2Q27A 3FLAA 1U7DA 3C5CA 3RC8A 1TAHA 5I7FA 2GN1A 5G02A 3TG8A 1V9LA 3L6BA 1LJ8A 3GEIA 3TQIA 1FNNA 2H7CA 4URUR 1QIMA 3CVVA 3AP1A 3ET4A 5C8YA 4G26A 4PIPA 1VGVA 2RGUA 1W49A 2RBGA 1BGWA 2MINA 2XTJA 3H2HA 4LBYA 1ESCA 2YQ4A 3CO5A 4ML3A 3C8DA 1BC5A 5EHIA 4EMBA 4PRKA 1G98A 3LY7A 1J0AA 1M8GA 5L3ZA 3R5SA 4FBGA 3N8GA 2Q49A 4ASUD 4CG0A 3I58A 2F1IA 1OXTA 3H11A 3WLIA 2BZSA 3AERB 4GZMA 3LPLA 1NBIA 3STXA 5JI2E 3EOBI 5KTTA 5LDHA 1VIMA 2A4KA 3H11B 3PDUA 4KV9A 1GQYA 3O5AA 1CZHA 4OQYA 4OTZA 4BQPA 2J3JA 1YDMA 1K89A 5LPNA 3CLUC 1U9JA 1Q57A 1U2PA 1ZM4A 2V3WA 3OZCA 4HUJA 1LBSA 2VJAA 4YFYA 5ER6A 1BQ4A 3UICA 4DARA 2NV6A 1EUDA 2IPNA 4UHBA 4XYBA 3IP9A 3C7KA 1U4NA 4P81A 5AJTA 4U7JA 4Q7LA 4I3FA 1RCTE 1FFEA 5B6PA 1BQ3A 1NE2A 2O3QA 3LPDA 2QRZA 4W5TA 3J7AC 3O8CA 3NW9A 1MOSA 5K0BA 1D1SA 4DQXA 1VHQA 1ZK4A 3F97A 2QJFA 2WJHA 3GFSA 1EVKA 2A7XA 3LYAA 4HADA 4L78A 4TVKA 4CEJB 1USWA 2ZTSA 1HNZB 3Q72A 1XYYA 4DQKA 2X5KO 1K7FB 1X70A 5DHQA 2C54A 3NWJA 4X5OA 1T8TA 1G7TA 2I33A 1E2QA 3QEAZ 1U0FA 1CXZA 3DMGA 4I14A 3A3PA 2AZXA 5HCUA 3E8MA 4CG1A 1AG9A 3CY6A 4IDNA 4KPFC 1YI0A 3LOQA 4Y67A 3ZWVA 4BGEA 3NEYA 2V9ZA 3HDHA 2C82A 3TLAA 4H15A 3TNDA 2XDYA 3NRJA 5DTJA 3FDJA 3NANA 1CB7A 1EX1A 2M98A 3OI7A 1QP7A 4DLAA 4KSCA 1QDLB 3LF1A 4ZC1A 4S35A 2DY1A 1L7PA 1ZESA 4DWWA 1UBGA 3Q3IA 3N39C 3NHMA 3T5CA 5DISB 4C08A 4BNGA 4FC7A 3EAGA 1KDZA 1EEHA 5FH9A 2AFVA 2A14A 3B8HA 3H8JA 4CCWA 4AY2A 4A0FA 3JZMA 5LZ9A 2FUG1 2G06A 3CLSC 3LRTA 3RRZA 1P9NA 2ESRA 3KX2A 2EBHX 4Q24A 4X7BA 4TLCA 5E2IA 4COKA 2HWKA 1MC4A 3G5LA 3N2LA 4MYUA 4P34A 4N47A 3L8HA 4HXEB 4MUMA 5AJZA 3UN1A 4IIFA 2K87A 1ESMA 3HVUA 5KX5B 2Q99A 5KWVA 4HQKA 4MLDA 1KIMA 1GPAA 2R87A 4ZVVA 2C7QA 5HQJA 1HK7A 3N75A 2XSZD 4KNVA 4U6NA 4A2WA 2H11A 3BORA 2YBDA 5F2NA 3FR7A 1XDWA 4WEOA 1EK2A 3HYLA 3RLFA 3B38A 1Q0RA 1IEXA 2YV1A 1IWOA 1BEEA 1MX5A 3EC7A 4Q3NA 5M2QA 3VNBA 2VLIA 1XDUA 2XRMA 4NBLA 2ZVJA 1N0UA 2X3UA 2J45A 3HCCA 4P93A 4RTRA 1Q0UA 1W19A 4KNWA 4D9IA 2X9LA 1RZRD 1O0SA 3WBFA 2G0NA 4K9RA 4PG7A 1V6AA 3ROQA 3V8MA 1LPOA 1DCFA 1SGWA 3HUTA 1M0TA 4Y98A 5JY1A 5AESA 1OX5A 4KQXA 5IAJA 1E1DA 1KPHA 3ZCTA 1EFDN 4EIWA 4INPA 2Q62A 5AO9A 4X00A 4X6LA 4R1MA 3RYCB 4QYIB 4E4TA 4AY6A 3QBEA 1NL3A 5DTRA 2ZB2A 1GD1O 3L05A 4XIJA 4YAKA 2EF0A 2HIHA 1RC1A 1SIUA 3V33A 5HRUA 5K8UA 5LYJB 3LQYA 2AHOA 2NU8B 1RI3A 4HDOB 2G0TA 4QSMA 5DMXA 1L3IA 4PYJA 3WBKA 1C4WA 2WICA 4C6TA 4ZMSA 4MW9A 5B3JC 2CL6X 1SXJD 1XHLA 1VYVA 3Q2IA 4UVIA 2E4AA 4NYJR 1W5BA 5B2FA 5I4KA 5HBRA 4WXYB 5LP6C 4CUJA 2ZBRA 3PJEA 3N59A 5KYKA 1NX6A 4GZ3A 5MFPA 2X4LA 2RHJA 1N8KA 1X14A 1E2IA 2LW7A 3IC5A 2RGDA 4L6CA 1G1AA 4X93A 1HFJA 3S2ZA 4B76A 2PX4A 3PKJA 5WRFA 4E14A 3IAHA 3OCZA 3NHUA 4Z54A 3LCRA 1VBFA 2BMFA 1KJQA 5IC5A 1SCBA 3N5CA 5EIBD 4CMAA 5T4BA 2A33A 4JMPA 1EIZA 1UMKA 2H1CA 4TMWA 5EXTA 3TFQA 1WCIB 1MEJA 5HRCA 3R4CA 1YHZA 3WY9A 4MVJF 1F3OA 4E1BA 4QGAA 1HA3A 2QJRA 4ZI7A 3ZN2A 2IP1A 3B2QA 5BN5B 4N12A 4WASA 4CF7A 3KAJA 3M1YA 3MTIA 4LY0A 3FCUB 5CM2Z 4OOEA 1NYTA 1T2UA 1TT7A 2F4VB 4AJLA 1QG4A 2FPUA 3F0TA 4IMRA 4CU5A 1SOAA 1Q7CA 1SEPA 1QIKA 4GXRA 4LY9A 2Z95A 4DCCA 4M86A 1XR3A 3DTVA 1N3BA 1PJQA 2EWMA 2FKNA 5J2TA 2NUBA 2VP4A 4ER0A 1EU1A 2UYQA 3I34X 2P4EA 2HQOA 3HBJA 4DM7A 3SR0A 4C7XA 1GQSA 1J8QA 2I22A 1UODA 1KC1A 1TLTA 1XZ8A 3UB2A 4LHZA 1KNXA 4Z9YA 1E98A 4AROA 1N6KA 4DGSA 2J9FA 3I5AA 4LVOA 2YWDA 3VZCA 2H8GA 5AH0A 3TWOA 3QPAA 5EG5A 1FQOA 4ONEA 5EJMA 3V8RA 1ABBA 1P4AA 2J9FB 4Q21A 1P9LA 2B4QA 3I6IA 3RFCA 1QE3A 3D8HA 4UZSA 3UAXA 3X1JA 4HLUC 4PXAA 3GLFA 1H3EA 1LDYA 2TS1A 3O93A 4RHCA 4TMXA 1OXXK 3K20A 4Y1FA 3R9KA 4D46A 1WIWA 3UWOA 2DE0X 1RFGE 4QXOA 5ESDA 2AJBA 1V8BA 2VK1A 3OFND 1E0DA 2Q3EA 3C16C 4XX0B 1WU7A 3FOBA 4R1NA 1AQJA 1DBIA 1G5FA 1Z5GA 4JEMA 4RLHA 2GZAA 3K8ZA 4TGLA 3UOWA 13PKA 4Q1DA 2I5PO 2FZEA 4PIMA 2HCBA 2PA0A 5J63A 4EHNA 2QMOA 5HTKA 2HBZA 4YJ2F 3I6YA 1T9ZA 1E2UA 2JJ2D 3E05A 4MUAA 2YY6A 3LBNA 1KPGA 1ICIA 1ZXBA 5EKXA 2ENWA 1IAVA 4W5QA 5K4HA 3ETNA 5H82A 5AI4A 2PA3A 3WRYA 3QE2A 4TVBA 2EZ8A 1B14A 3PGA1 4YQEA 1A4XA 1UPFA 2JLYA 2GJKA 4ZI7F 1C0PA 3EFBA 4F5ZA 4N65A 2YWJA 3SDZA 4X1IA 2NU6B 1ABFA 2X0FA 3RJZA 1Y3CE 4M0DA 4MGIR 1PX0A 4N54A 5AVZA 3MB8A 1KEWA 3E18A 1Z36A 2V0NA 4KSYA 1RWQA 3WGLA 4XUCA 1NDQA 2PNJA 2B20A 5C5DA 5MN4A 3A0RB 4UCWA 1W581 1QMPA 1PQPA 1IY8A 1Y3IA 1HWYA 1RWBA 2O5VA 5LZ2A 2OCLA 2Q1XA 5E3IA 4E5NA 4BO1A 2H57A 3RSGA 3QELA 1Z4NA 2HQBA 4Y18A 4XWTA 3L3BA 3DKPA 3VKFA 1XV5A 1DAKA 4JI4B 4IEFB 2DF8A 4IEEA 1DSSG 1HEUA 2F55A 1Q83A 3KPJA 4Q9AA 1UPAA 5DSTA 3UMGA 2HI0A 4D0GA 3OKFA 4IHJB 1JLKA 2DUMA 3N28A 2P0YA 4RWEA 1J7JA 1KZ4A 2PUHA 2VT7A 4U2FA 3MA0A 2VBCA 4IHJA 3MTQA 1EB9A 1WTAA 2VXCA 5EXSA 3ONWA 3FMIA 4G4SP 5FO0A 3MPUA 1Y98A 1DXOA 4UNIA 4BO2A 1NN3A 1IK4A 3BL8A 2YWGA 1GQRA 3RYFA 5AUPB 4L9SA 2EKZA 3TVYA 3VZPA 4EY4A 4FE7A 2AV6A 3IIJA 1DG3A 5G3ZA 1C9JA 3CMMA 3FG9A 5FOQA 1JF8A 3S8MA 2PWZA 2AT1A 4US1R 1CVLA 2CJYA 2ZWAA 1OXKB 4MUNA 4D6PA 2WG0A 2HB6A 2KJQA 2FVYA 3G9TA 3K0CA 4U1RA 4ENWA 5A5EA 3INGA 3LBIA 1P6QA 1VC2A 2QMEA 4NU6A 1WDLA 4ZO6A 4L6IA 3WC4A 3UK6A 3UJHA 1KR2A 1RLTA 4PGMA 1NXSA 1TMOA 3L8DA 2Y0EA 4OH7A 4LZOA 4CIDA 3V2HA 2XRZA 3S70A 2ZZNA 1OZ0A 3W8NA 2HSGA 2IBSA 4FJ0A 2JD1A 4QLAA 4C3VA 3QP9A 2UZ0A 3ENWA 4WJZA 4EG5A 5DCWA 4BNLA 1XZJA 2OC9A 1O96A 3RBZA 3NORA 3T7AA 5F3RA 5KTNA 1RU3A 1X1BA 5JSZA 3D31A 3RV3A 3UHAA 1NWCA 2JBWA 4IIGA 1V5FA 1BFUA 4F46A 1EX9A 4O4HF 2JLZA 3GLVA 3VPFA 4OAQA 2QVYX 4MZDA 2ORVA 1TB4A 5IG2A 3PC7A 4WVFA 1CNMA 1YB6A 2P62A 3DOCA 2XWSA 4OQLA 2Q0HA 2GM4A 2VHXA 2KLHA 3ICCA 1B8PA 4HZUA 4K7JA 2P5UA 4MA5A 1OREA 1UC5B 5KKNB 1GAJA 2FHSA 1C9EA 1CF9A 1Y7PA 1DOHA 4R7GA 2I6TA 3CSUA 1H1LA 3AUSA 1DKOA 3E7FA 3ZHZA 1YZHA 1YACA 2VA9A 1BH6A 4X7RA 3OLQA 1QYXA 3BWEA 3IHWA 5DBGA 1N2EA 5TDHA 2W2MA 2YTZA 1WLYA 2BL4A 1UT8A 1ECGA 3AUYA 1USUA 1M6WA 3QX3A 3R40A 3MBIA 5F1OA 1OAAA 3CRRA 4M9ZA 2GYYA 4ECAA 2YHBA 4LQLA 4U3JA 3N8IA 1IJKA 4R2MA 1RYNA 1H94A 5H3HA 2QHXA 1NBMA 2VK2A 5D3QA 3PPVA 3VC7A 4BNNA 1J2TA 3C45A 4K9MA 4MV0A 2WKSA 2WJAA 2DHQA 4IFBA 5H16A 1BWPA 2BYTA 2P7HA 3KQLA 4L2IA 3BXGA 2IE8A 3ZDYB 2HXGA 3V5NA 1WMBA 2PEYA 1RWKA 1ZMXA 3RVSA 1TMYA 4Z7QB 2VTBA 1JU3A 3KPVA 4LRSB 4Q0MA 3UV7A 1K3TA 3ZPXA 4YV0A 4XQ0A 1RHQA 1QX3A 4KBGA 2WQ6A 3AB3A 1NUPA 1V8DA 5BRAA 1U7OA 3NUGA 2QK4A 4IY1A 3PQ2A 4KZKA 4RVDA 4M87A 3KQSA 4OSEA 4HFRA 2QN8A 2XUHA 2XMPA 3ND9A 5GADl 3HVJA 2ON6A 4HK4A 1T5TA 4NY1A 3OZ7A 1YS6A 4WECA 4HLUA 3FPFA 2YW2A 3EZLA 3Q7TA 5I51A 1JGTA 1QM5A 3JAKB 3KXDA 2BBOA 1E77A 4CKXA 3LY5A 3WLSA 1BCRB 2NW6A 5ENVA 1TTHA 2FB9A 1R0LA 4ZAGA 3MNFA 4HNAB 4Q4HB 1AK9A 3W2GA 1IN7A 2QPTA 2P9EA 4KH1A 5DHFA 1GDDA 1RHMA 4FE3A 2W2PA 3H1PA 1POWA 1PGPA 2H9YA 4XGKA 3AILA 3CG4A 2GO7A 3NTLA 4NBUA 1NHWA 2GYUA 2P9FA 1W4AA 2E5FA 1G42A 4B6OA 3UKJA 2IBTA 1YAJA 5ALLA 1GTVA 5LBUA 4DCOA 4DQUA 4CM5A 3NALA 1WUIS 4P1ZA 3WGQA 5KOJB 4D9JA 1M6YA 2X19A 1EX6A 3P27A 1TEHA 1WZCA 2PZBA 1QC5B 4ZT3A 2VNKA 2B9VA 1V8FA 2C57A 3PJDA 4GOOD 2H63A 3OCYA 3CT6A 1X8JA 1RI1A 2IK8A 1H22A 4DIDA 4E11A 1FDIA 4WA7A 1FP6A 4GU5A 3GCWA 2Q5LA 1BS9A 2WG2A 3EEOA 2JCGA 1KC3A 4HP8A 3OJWA 1JX6A 5IAAA 2IYNA 2X40A 1IY0A 1TVEA 4K2AA 2Q4TA 2VPZA 3I73A 1CP3A 1LLUA 2NZ2A 4I4TF 4H60A 4JELA 1RXWA 3DFKA 1Z4JA 3ER9A 4QDUA 3FB4A 3WDMA 1S8FA 1M8PA 2A4MA 2NGRA 1H4SA 2DCMA 1FMTA 4NZZA 5BWNA 3IV6A 4EHAA 1XEXB 3GROA 3O73A 2PSJA 3KOMA 5KVSA 1U28C 2XUKA 4EHHA 3WGIA 3RFXA 3S2UA 3UJPA 4MVCA 4QU5A 3ICEA 1XEXA 2ZI5A 2VF8A 3K9GA 2W0SA 1ONSA 3I92A 4KFUA 1Q91A 1P18A 1T8SA 2SNIE 3IALA 1XLVA 2BD0A 4OJNA 1JYFA 3OP1A 3NYWA 2CFRA 1PSDA 3JZDA 3OM8A 1Z6GA 4JS0A 3PEUA 1YCGA 2ZSFA 1S02A 2OCAA 1XZMA 2YWFA 3BWYA 4B6RA 3WGVA 4MP8A 5KTKA 1G2IA 3UCEA 5K0LA 1K8YB 2Z56A 1D5WA 3BDVA 3HO8A 3H5OA 3JARA 1YK1A 4LF4B 1WNTA 1G8FA 3WFZA 1YZTA 3U4QA 3KT3A 5AVWA 1V11B 2HMTA 4U7DA 3ZLVA 2QN2A 1WXHA 3M4YA 1S9HA 1VE1A 4FGWA 4A27A 1T9GS 2GA9A 4D96A 4RF4A 4HSEA 4ZJPA 4Q6WA 2AC2A 3L6UA 2RBEA 1WVGA 4WK6A 4MCJA 2IS6A 5EIAA 4F85A 1X92A 1COWD 2VKQA 3M1IA 3OP4A 2IHTA 3TEJA 4J8PA 2G71A 2PLNA 5FL7D 4MS3B 2I6UA 3KOWA 5LNK6 1ZH0A 4QICA 2ZW9A 3IJEB 3CRNA 1TD9A 1XN1A 1L4YA 4Y2QA 1Z0KA 1ZIPA 2E55A 4XLZA 3IP7A 4PBRA 2QP3A 4JLKA 3F71A 1I6MA 3PKIA 4FYWA 1UINA 1Z0ZA 3PNMA 1QOQB 4JOQA 3UK0A 2UXBB 1FLAA 3AHCA 3HADA 1E2KA 1G6Q1 3GPIA 2CL7X 1V4BA 2KBFA 1JAYA 1JQ3A 3BE8A 3P2IA 1WLSA 4J0EA 4JR1A 4FNGA 5EJFA 5JJ5A 4QDJA 2QAJA 2C2OA 2G7ZA 1DOZA 3UPUA 5L6MB 4HRYA 4H6PA 4LOJA 5E1DA 1PJZA 2XAAA 4NRDA 3K5IA 4OH1A 2W58A 3OFVA 4R81A 5H1YA 4II7A 4TYPA 5LCXA 4NBTA 1UPTA 4EECA 4ZYLA 3PBKA 1U9ZA 4FYXA 2H2GA 1T2CA 2DPHA 3DTYA 3QVGB 1DI0A 4KDRA 3E8XA 3KJZA 3OZEA 2OK8A 4JC8A 3FKSD 3G2LA 1W4RA 3ECCA 4FOTA 4GOND 3FYDA 4EQZA 4IQGA 4DV6B 1HG1A 2J7PA 2R6HA 3RRNA 1PJRA 1RZUA 3O2JA 2B82A 4IRMA 5AVYA 3WL6A 2JFNA 4WXMA 4LWPA 3NOOA 4MRNA 1CLUA 4ZU3A 4QPDA 2P40A 1MW8X 2ZIXB 2E6UX 3MLAA 2XB2A 4IX1A 1H6CA 2ZU6A 1P0MA 5J2TF 1MDBA 4B3CA 1TTPB 2ZT6A 4HGRA 4WZAB 3QU5A 1ODIA 2NN3C 5IJWA 2PRYA 3HDVA 4OPMA 1EEXB 2R1VA 3PI6A 1WUHS 4JIGA 3L8FA 1XRQA 3VKVA 3W5SA 4RHFA 2Q46A 2XGJA 2YICA 3T7EA 1ZH8A 1U04A 1Z5ZA 2PS1A 1UJMA 2EX0A 3ETHA 1L5GB 3M3DA 3WJ1A 3F5MA 3FPKA 3VR2A 3T41A 3FFAA 1HETA 3GRAA 4RGBA 3S4YA 3RU9A 3IDFA 3C6YA 1NJ6A 5KQLA 3C4JA 4IDGA 4DQVA 1PKEA 3W8RA 2X6TA 2O2GA 4M76B 4O2AA 1HUQA 1GTRA 3GVIA 1GSOA 4AAYA 1JKFA 2A84A 3C43A 3H4VA 3I05A 4YAUA 3KSZO 3PV0A 4YV7A 3C1TA 3D4NA 5JEEA 2R66A 1KKLA 4IQ0A 2VF5X 3U1VA 1MVOA 1Y6GA 4DIKA 2GVZC 5FQNA 5JNWA 4NDAA 1H8EA 1QWOA 1QGED 4H7EA 4TXHA 2J3HA 2Q3BA 4C7KA 4DR4B 5CG1A 2YWHA 3IAEA 1EE9A 4TYNA 1TYZA 1JKJB 1UBJS 4OB6A 2Q9UA 3ANLA 3K9BA 1FFBA 1G0NA 1GILA 2FUEA 2AFRA 2BJHA 3BZBA 2DPLA 3JPWA 4OQ4A 4X97A 2A35A 5ERXA 5CIWA 2L17A 2Q3FA 3V4FA 5JAPA 5C35A 4IDAA 4B3JA 3I9FA 1W93A 4AO8A 2R8ZA 3EEFA 4Z4FA 1RE1A 3JU3A 3TLKA 1I3CA 3TPFA 1LK0A 1XLTC 4J03A 4DE5A 1ZNXA 3PQ7A 4MRAA 4F2PA 2D2FA 5BMOA 1LX6A 2CXHA 4GMDA 4YAGA 2PXXA 5KTMA 1JJFA 3I42A 3KPUA 3MWKA 2VP6A 1RYEA 2BCGY 3EUEA 3ZUGA 3PX7A 1AGPA 1K88A 5C7IO 5GINE 4ZODA 2C3UA 4IIDA 1H1TA 2GZ2A 3GLUA 3ICOA 4EVIA 5MDHA 1EDZA 5FEUA 5EKUA 1MG0A 2PPVA 4PG8A 2H0RA 3C15C 1TJ3A 1EFTA 1Q95A 3FXAA 3ENQA 4OBWA 4EEKA 5FWAA 1N2SA 4TV8B 3SM3A 3SYNA 4QFBA 4GIBA 4A73A 2WPDD 2YJ5A 4H3SA 1L7MA 2ZKIA 1L2TA 3S27A 4QUEA 1XMPA 2AKYA 1JFLA 4KX5A 3RVRA 2XMDA 1TMKA 4RULA 3L40A 1XWFA 4FMPA 1VMKA 3WZ2A 1RXYA 4A91A 1LTQA 2ZRQA 4QQKA 2I62A 3R75A 5PGMA 4B4KA 3PT5A 3GVCA 1YSCA 5E7MA 1OPXA 1XA3A 2I78A 2CMDA 4DQ0A 3T1YB 2XGOA 1DP4A 1YMUA 5ESWA 3LQRA 1WR8A 4E46A 3IESA 4R9RA 3FPGA 1CIJA 3G0DA 2W2NA 3CLSD 5EIOA 3UV6A 3IEIA 1PTJA 2BH9A 4FX5A 4WY2A 1EVEA 1Y4SA 1KO7A 1KPIA 2FA9A 2YFHA 3BQNB 4ILKA 4KB5A 4X84A 5A3SA 2HLHA 2BKAA 4J1TA 1PVDA 2H1IA 1GYQA 2UZAA 3IXQA 1I80A 1SZPA 2UVDA 2C7RA 3DZGA 3C3JA 4KQEA 4WOPA 5FBZA 3KBBA 2OBXA 1HE5A 4R41A 5CNJA 4JL5A 4RTOA 5CCEA 3QJGA 3S7ZA 4A8JA 4AULA 4V2IA 1IMJA 2FJUA 2NO4A 3H9CA 4XB6B 2GF0A 2V7BA 4PVDA 4DTCA 3OZFA 1C30B 1SQSA 3QUCA 3H1BA 3F5SA 1FDOA 5CP8A 4CCYA 4C6RA 4CKWA 4MS1B 1Z37A 5FTNA 1JXAA 5EFOA 1P77A 1R2QA 4PC6A 4CHTA 3E3MA 3UMSA 4CKWB 1X39A 4NP6A 2J3EA 2OHXA 3ZY5A 1U7ZA 5EERA 1XRLA 1DXHA 1XF9A 1TGYA 2HDHA 2XE6A 2YZ7A 1U2TA 3E70C 1T29A 3I4LA 2NXNA 2R1TB 4NH4A 4X63A 1XNJA 4QVGA 1T2FA 3EC1A 4V03A 3L7CA 1GV1A 3ZXYA 3ZCQA 4RSHA 3OPMA 2O4CA 2VHTA 3V7YA 3WGGA 3HJHA 1R6TA 1OI4A 5ALDA 5CG2A 4UVDA 5FFFA 5ALKA 1F06A 5AVOA 1GT6A 4GW3A 1P7PA 1SCJA 3K05A 2XMSA 4YJHB 5SYNA 3ZDCA 3RUCA 1B6GA 4PBTA 3X43A 1JDJA 1DAHA 1FXUA 1HDOA 1UZLA 2M1XA 4H2DA 4XARA 3IEUA 2JANA 2RFLA 3ZH9B 5A7FA 2HRDA 5EVJA 2QXYA 2NTYC 2XQGA 4UJ3A 3RAFC 3NPAA 4UREA 1SXJC 1TC2A 5TSDA 5BYKA 4KQIA 5LSAA 1PEAA 3IQHX 4I2NA 1K08A 3CGWA 2OD7A 3GEPA 1JR4A 1GSAA 1X87A 2OY0A 1FB5A 2ZSIA 3D3JA 2IYFA 4GXNA 3ZD9A 4GI7A 2GN0A 1KOFA 1PW5A 1FEZA 2RB4A 4ZT2A 4B44A 3G0OA 4PO8A 3L7BA 4C4SA 2NTEA 3HXQA 4DSAA 1GZ3A 5TXGA 4RJLA 2NPOA 1FX0A 3IE1A 3SSMA 2CK3A 1O5OA 2PGAA 3GZNB 5EJGA 2JI9A 3VMMA 5AMXA 1NDHA 3LDUA 4ZCMA 1SR8A 1UQUA 4FYYA 4NE2A 4BS9A 1SCAA 2O5CA 1ISIA 1XUOA 4OXKA 1A5BB 4R9SA 5C8YB 5TQ0B 2O8FB 1D6SA 1QVZA 3HRIA 3FNRA 5CNKA 4RPGA 4B75A 4Q9LA 4IGAA 3T9CA 3KKEA 5BN4B 3NHSA 4M0EA 1Q44A 2V7XA 1B0ZA 2SHKA 4OGWA 2VP3A 4FFVA 4UXHA 3WYGA 1CJUC 1A95A 1VL6A 1QIGA 3EGOA 3QFSA 4G0ZA 4MGEA 1VKJA 2P9CA 2VP2A 3HO6A 3VFDA 4C5AA 1SJ9A 5LOVF 5JCJD 1J5PA 2Y1XA 4UTZA 3FDZA 2P2GA 4XZ3A 4M1WA 1EUCA 1U5CA 3KDAA 4YO7A 2BC9A 4NHOA 4MR7A 3O26A 4QREA 2OHOA 4TSKA 1FIUA 2WWWA 4G0WA 1Z8NA 4I50B 3NAZA 5IU6A 2BR4A 5KSWB 3GBVA 1L6RA 2Z5FA 2JIQA 2WWYA 3T7TA 1C7EA 3CZ9A 4J75A 1G20A 3A7DA 3D8NA 2FZGA 3M7IA 1EFHA 4RA6B 2A9VA 3HGQA 1NIPA 4UKDA 1A1SA 4HDMB 5TQVA 3VR6A 4CMIB 4Y1EA 4ECEA 2Q41A 4UHFA 4QHTA 3WYCA 2JIZD 3CH5A 3WSWA 5HPYB 2LVBA 2CVZA 1N5IA 3L0OA 4BE4A 3U7IA 3I1IA 1ZK0A 5KVAA 3I2FA 3V1TC 1MPTA 1F2UB 4E4RA 3DM5A 1E4EA 3WWDA 2WT8A 2XB9A 1N0WA 1JN0A 2H16A 3REQB 1KIAA 4UCQA 3U4GA 4DBVO 3CZ4A 1WHTA 3WR5A 3FW1A 2WVJA 1ML3A 1B4DA 4MQEA 1GTJ1 4N5HX 4PCLA 2QN3A 4C3ZA 1PGOA 2G3YA 3OSZA 3H6KA 3EODA 3QXHA 3ZDBA 2BI7A 4L5AA 5TGDA 3L8YA 2V74B 4Z8XA 2XYGA 4TWJA 1QCCA 4MK4A 4XWGA 2E4UA 3LLVA 1SBZA 4MRSA 4BZXA 5F2KA 1U8TA 4D5GA 3FRHA 3I9JA 2Z4TA 1W25A 3LP5A 2VH1A 2PZJA 1BKDR 3TUIC 3HCWA 4AURA 1HXHA 3KSMA 3O92A 3OUUA 3E5HA 2PANA 1O6ZA 3H4IA 4P0TA 5E6RB 4WUTA 3GLGA 4Z1OA 1Y9JA 3BWDD 2BE9A 3C7CB 2LR0A 1AE1A 2GLXA 2GCOB 2PRJA 1TZ2A 3GRFA 4R2HA 2HFKA 1J99A 5EQJB 3TZCA 1TTTA 1CJMA 5HILA 1A4UA 1UZMA 2V5VA 2YOGA 2YC2C 1D6NA 2QUHA 4NYJQ 1MQ9A 4Z2YA 4EI8A 2C5EA 4FHFA 4JHLA 2ZSBA 2RB5A 2C03A 1PEKE 3LC1O 1JSLA 4Y1RB 5ARDA 1M1ZA 4AF6A 3NLLA 1XU4A 4XA8A 3RF7A 4Y2YA 1U0NA 5CU7A 3II6X 1RAHA 5HF8A 1H66A 3GDFA 1LPMA 3LPAA 4JODA 2RGNC 3VPGA 1SD1A 1NVTA 4RTQA 2E87A 3TL6A 3HVKA 3KBOA 3H2ZA 3AKZA 1SN7A 2WLSA 1TGVA 2ZSUA 2UZ1A 3CZAA 5EP3A 4ZWNA 3E35A 4FYHA 1CFZA 5TIIA 1N77A 4RY9A 4Z0PA 3MGBA 2W2TA 5HCIA 5BR1A 2IDJA 3FTQA 4DR3B 3DV9A 3WAKA 4JGBA 3CGGA 2FY8A 4A5OA 3OY2A 3QQ5A 3EQ6A 2DLCX 1A9OA 1ULBA 3E9YA 1M2FA 4W5HA 4IAOA 3GEGA 2RBKA 5CVCA 2G1PA 3NPMA 3RSOA 2EIXA 4KIWA 4KWEA 5JLAA 4FN5A 3A4LA 1WKCA 1CUJA 3OJCA 4B6JA 5M7EA 2A5FA 2AXEA 2QGZA 3NMUF 3S99A 1HLGA 4LGMA 3EVNA 3PYMA 3CTPA 3UWDA 1QS0A 1OYVA 1XBTA 1YZGA 4M6WB 2Q6LA 3HG7A 4JP3A 3ZWNA 3RSLA 1MP0A 2BFEB 8ATCA 4C6TB 3ZG6A 3D0RA 3AF5A 2AN9A 2QZJA 5JE8A 1N33B 4ROTA 1V7CA 2Q5HA 5B12A 3PFGA 2BM8A 1B0AA 1Q15A 4EY5A 5EJ7A 5GWXA 3V7NA 1YZQA 3K4HA 3O4RA 4GLLA 1WD5A 3WAGA 3ZHSA 4GOJA 1EUDB 1FXSA 2PX0A 5AKLA 3GWGA 3VQTA 3GLIA 1LRKA 1QRRA 1NUQA 1DPGA 1YVEI 3PXDA 4KRGA 2QG6A 1F4LA 1RPNA 2JFVA 3KKKA 2PH3A 1O54A 3QBDA 5G41A 4POOA 4G0VA 3V55A 1ZD5A 5BW4A 1JMKC 3BRWA 3T54A 3IVMA 3U13A 1B0UA 4UTNA 3OE1A 5BNIA 3E0XA 4EY7A 1FF9A 3AKCA 3N9IA 1XQ1A 3PJGA 3PXEA 4P31A 3WLOA 1UZAA 2WZDA 1E63A 3JAWB 1T5IA 2EL9A