2VTVA

Phaz7 depolymerase from paucimonas lemoignei
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
342
structure length
340
Chain Sequence
LTCGTNSGFVCKGTQTQYAGGFAPGVGYGGFGGGSCTATKTPVIFIHGNGDNAISFDMPPGNVSGYGTPARSVYAELKARGYNDCEIFGVTYLSSSEQGSAQYNYHSSTKYAIIKTFIDKVKAYTGKSQVDIVAHSMGVSMSLATLQYYNNWTSVRKFINLAGGIRGLYSCYYTGYANAAAPTCGSQNYYNSYTFGFFPEGWYYGVWVSNPWTGSGSTNSMRDMPAKRTAVSFYTLSAGFKDQVGCATASFWAGCDSAAKFASTTSNVKAQINVGAGSNATQADYDWADGMPAGGGDTTNGVGHFRTKTNTGAIIQRMLLTTCTGLDCAAEYTTGPKAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of poly(3-hydroxybutyrate) hydrolysis by PhaZ7 depolymerase from Paucimonas lemoignei.
pubmed doi rcsb
molecule tags Hydrolase
molecule keywords PHB depolymerase PhaZ7
total genus 126
structure length 340
sequence length 342
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01674 Lipase_2 Lipase (class 2)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2vtvA00
1UXOA 4YK7A 4Y2SA 1UKBA 4UHDA 5JYCA 4BRSA 1XZGA 3B12A 3C6YA 3QPAA 3G9ZA 3BXPA 4N8DA 1TKRA 5HF5A 5AM0A 1R3DA 2Z8XA 3WMRA 4F60A 5E2IA 3MUNA 4CG2A 2QXTA 4OSEA 4X97A 4BC1A 1MU0A 4H7EA 1XQXA 4J03A 1UOPA 3W9BA 4WJLA 4EZIA 3IUJA 1LPPA 4K5QA 1EVEA 3H2JA 3AZOA 5JARA 2I03A 4AXBA 1GXSA 5HF8A 2QS9A 4NMWA 4IH1A 1LBTA 2Z8ZA 1DT3A 2WUDA 3STYA 2PSEA 1Y7IA 1UKCA 3ESCA 3H17A 2WU4A 4G9EA 1P0MA 4DGQA 3H2GA 3WQHA 3UUEA 1CPYA 1M33A 3IB3A 3FYUA 1MX5A 1GQRA 5HK9A 4U2CA 3SK0A 5AO9A 3DYVA 1ZOIA 3CXUA 2UZ0A 2JEYA 1WM1A 1S8OA 1LPNA 4BTLA 2WHPA 2HA2A 5CTAA 1FFDA 5HF9A 1JKMA 5ALUA 1DX6A 1MX1A 4UPDA 5FDFA 3UMJA 1MNQA 3WK6A 3ESDA 1E8DA 3T52A 1L7QA 1P0QA 4IH4A 3RLIA 1LGYA 3HEAA 4J0HA 5SYMA 4ZV9A 3ANSA 3R0VA 5AK4A 4MEBA 3H2KA 3WL7A 1HQDA 4K2AA 5BWBA 2ZJ6A 3NUZA 2PL5A 5DNUA 2ACEA 1ORWA 1CUYA 3I2KA 3CCBA 2I78A 1GPKA 6YASA 1VZ3A 2PUHA 4LYEA 1XZBA 4FBMA 4HXEB 2ZJ7A 4AX4A 3VJMA 1B6GA 5ALRA 5AKLA 1FSSA 3FSGA 5LKRA 3STTA 5JD4A 1O6FA 5JATA 1UFOA 2ZYHA 1E66A 3PE6A 3QZUA 2PSHA 1CUCA 5AKIA 3V1KA 4CG3A 3EQ8A 2CKMA 4CI9A 4INZA 4J7AA 4OPMA 1A7UA 1WB4A 4HVTA 4UUQA 4ZWNA 1BCSA 2C58A 4QE3A 4YPVA 5T4HA 2BAGA 5HF6A 2ACKA 4GECA 4J0IA 1K6EA 1AGYA 5JAOA 2OCIA 1PFQA 1XQVA 2WFZA 4FNGA 1R88A 4LXHA 1QZ3A 2XUJA 5EIEA 2OQVA 4BC0A 1ZD4A 1AMNA 3IUMA 2OPHA 5HKBA 2HFJA 1CUSA 4E15A 1CUDA 5D3ZA 5K5EA 2XUQA 4X92A 2W22A 3VXKA 4BAZA 5JAPA 4H7KA 4U2DA 2GBFA 1FFCA 1YR2A 2V97A 5CT9A 5I7UA 4OUKX 4AO8A 2OAEA 1FJ2A 4WFKA 4FFWA 3N0TA 1L7RA 1P0IA 3F8SA 1IUOA 3BL8A 4DNOA 3QITA 2XUPA 3G0DA 2VJDA 1JMKC 2QZPA 1FFAA 3T4UA 5AKZA 2DR0A 2OGSA 3FYUB 5HQ3A 1I6WA 3A2NA 4OB7A 4QDTA 1MNAA 1AKNA 4DNQA 3QMVA 4UBNA 2OAGA 4DIUA 2AJBA 4EY4A 4X3CA 2PX6A 3D4LA 1O6GA 4C01A 3I6YA 2C7BA 2H7YA 2HA3A 4KJXA 1ODCA 2AJ8A 2Y2VA 1WB6A 1VJ5A 4EA6A 1XZEA 4IO0A 1E5TA 1H23A 3G0GA 1UK6A 2OGZA 2HFKA 1W4LA 1CIJA 4J0KA 1CQZA 2EDAA 3WL5A 2H1IA 1Q83A 1AC5A 4MYDA 4MWSA 1UZAA 3LP5A 5BOVA 3FBWA 2JGMA 4KAJA 1VA4A 1XRNA 1U8EA 3G0IA 1XRLA 1K63A 2OGTA 1QTIA 4FLMA 2WIFA 2XMBA 5FV4A 4DMHA 3W05A 2WJ3A 3V1LA 5EIHA 2NW6A 1ZD3A 3KD2A 3PFCA 5AP9A 4ZGBA 2ORYA 2WHQA 4JYPA 3HXKA 1NU8A 3L1IA 4X94A 3O4IA 1IUPA 4IQ4A 3QM1A 1ZD5A 3BJMA 1GQSA 3IIIA 4GBGA 4UFOA 1OCEA 1EHYA 4H7DA 3AIMA 2DFPA 4DMFA 1CUGA 4KAAA 5HCUA 3WKEA 5LZ8A 1R1DA 3EQ9A 1A8UA 2PSFA 4Y2UA 2XMQA 3ED1A 3ZLTA 2WJ4A 4GEGA 2JBWA 1FFEA 3DKKA 1C7IA 3LCRA 2VATA 4U2BA 4Y2VA 5CH3A 1RWQA 3DD5A 4BE9A 1K8QA 1IUNA 2DCMA 5KWJA 5AI4A 5DYWA 5FKJA 1W6RA 4FLFA 1QIHA 2FUKA 2RGUA 7YASA 5LLSA 4BVKA 3G0CA 4HAIA 1ZJ5A 1DWOA 4HXGA 3AINA 2FX5A 4Y2QA 1AUOA 3HACA 4L72A 5ALWA 5JADA 3I2FA 4UHEA 4RE6A 4ZRDA 1SOMA 3AZPA 3WKCA 3Q8WA 3M3DA 4QNNA 3PDCA 2CZQA 2WFLA 2JGJA 1QOZA 4Y2PA 4JYMA 5A7FA 1IVYA 5K3CA 2WTNA 5HQ3B 1R50A 1GZ7A 1HBJA 3HRHA 2WKWA 4X6XA 3ILSA 1BCRA 1XQWA 1EDDA 3VJKA 4I4CA 4G8BA 1UK8A 1VLQA 3AILA 4Y2TA 2E3JA 3PF8A 4A16A 4H7FA 4KYVA 1ZD2P 5ALTA 4U2EA 4EHBA 2C5FA 4ARAA 1ODSA 1VZ2A 5K3BA 4A5SA 3F98A 1VE6A 5AICA 5ALPA 1KU6A 4OU5A 1Y7HA 4FOLA 4BP8A 2CBGA 4EB0A 4CCWA 5AI0A 1G66A 4QDXA 3OPMA 4PF1A 5D7BA 1LLFA 2YH2A 5I8PA 2HA6A 3VJLA 2PU7A 3W06A 3A2MA 3K9BA 1QIDA 2HRQA 3QMWA 1CUXA 4XWGA 2RHTA 5EI5A 1PV1A 1QLWA 3M82A 4PSCA 2JGIA 1E8MA 4Q82A 3C6XA 3MGAA 5EIAA 3E1GA 2HM7A 4KE9A 3C43A 1UOQA 5F4ZA 4HRXA 1QONA 1C7JA 3VVLA 2JEZA 1Q84A 3DL4A 3WI7A 2RHWA 3QVMA 4KE7A 1EINA 4WY8A 2CMFA 5AKHA 2K2QB 4BYMA 3K2IA 2ZJFA 4CCYB 3H04A 4B9EA 5K3FA 2VEOA 3WK5A 3D3NA 4AZ3A 1XKLA 4KRYA 3FOBA 4AB1A 2BGNA 5AJHA 3HJUA 2JGFA 1EA5A 3U1TA 5DNWA 3B5EA 1DWQA 1XZIA 4G4JA 4OB8A 1CVLA 1QIGA 3PF9A 3WWDA 3QPDA 2XMCA 5AI8A 5JASA 4FWBA 1RP1A 3SWWA 2DHDA 3O0DA 4V2IA 4M0MA 2JF0A 3BWXA 4PSUA 4UBIA 2BUAA 1GPNA 4QA9A 1CQWA 1TCBA 3D7RA 3V1NA 2QR5A 3QYJA 3H1AA 1GPLA 2WILA 2PM8A 3Q0TA 1KEZA 4GXNA 2JGEA 3R3WA 2PSDA 4FLEA 4FMPA 2X76A 4J0DA 4ZREA 1N5MA 1VKHA 1J07A 3WWEA 3IA2A 5DYTA 4RNCA 1BN6A 1MAHA 2XQFA 4QWWA 3G7NA 3X3HA 1XZDA 3G9UA 4H77A 3U0VA 3WK4A 2HIHA 3M81A 4LIPD 5ALSA 2VT6A 4I3FA 1EK1A 2D5LA 4AN1A 1CUJA 2HU8A 5AKXA 3DJYA 3R3ZA 1EH5A 5AKKA 3FCXA 4FFVA 3V9AA 1EX9A 3KSRA 4WCVA 4MXDA 4HXFB 1PJAA 5IVHA 5CH8A 1HDEA 3FSGD 4AQDA 3WJ2A 5ALVA 4F0JA 1ISPA 2DQZA 2XUDA 3BIWA 1CUVA 2IIVA 4N5IX 3AJAA 3C8DA 2Z5GA 5AI6A 5IVIA 1YS2X 1SFRA 2W6CX 1WCYA 1WPXA 5DYYA 4HTAA 1OILA 1X2BA 3UUFA 3H1BA 3R41A 3G8YA 5JAHA 4B81A 2Z3WA 1XLVA 1F6WA 3BIXA 4AO6A 4BAUA 5ALGA 5CT5A 1QIEA 1QIFA 4WDRA 3IUQA 5FP0A 4W1QA 4PQEA 4IHAA 1IZ8A 1C4XA 2YXPX 1H2WA 3TRDA 3G02A 5IKXA 5JD5A 1GGVA 2DQYA 2WU3A 3AUKA 2XMGA 1XZHA 4QDUA 4UBMA 3FLBA 4NVRA 2WIDA 1SCIA 3I28A 3IULA 4B80A 5E4TA 1L7AA 3JWEA 5D3KA 1F8UA 1XFDA 2RAUA 3BDIA 5T4EA 4OYLA 2G5PA 2GYUA 5A71A 4EUSA 4BCCA 4EBBA 5IVDA 3FLEA 3PUHA 4BAGA 2ONCA 2DHEA 2XE4A 4X7BA 3SC2A 3WIOA 4X95A 4GDMA 3WYDA 5J3JA 2I3ZA 3IVMA 2HADA 1QIMA 4BB0A 1YCDA 4DM7A 2J4CA 3VDXA 4E14A 5ALLA 5AOBA 4AN0A 1W1IA 1Y37A 2HA4A 3AFIA 3LIIA 3A2LA 5CXXA 1W76A 3KDAA 1QE3A 4LHEA 5AK3A 2VSQA 4EY6A 2BKLA 5DNVA 3LLCA 2Y1KA 2ES4A 4Q1VA 1EVQA 3SX4A 4TPKA 2Y6UA 4AMYA 5K3AA 2WFMA 2C0QA 4O08A 1TCAA 4C4XA 4OB6A 2AJCA 2HL6A 3F9CA 2HA7A 4C6HA 4X6YA 1CUUA 2HDWA 3I2IA 3WK7A 2HU5A 2QXUA 1F0PA 2ZYSA 3H19A 1WOMA 3K6KA 4HZGA 5AOAA 3E0XA 3GFFA 4BRZA 4DYHA 2PSJA 4ZI5A 4Q05A 1QIIA 5C8XA 1XLWA 3KXPA 1XQYA 5C7YA 4KE8A 1F0NA 3F96A 4Z49A 5AI9A 4YX9A 4BATA 5KBYA 1GKKA 2WIKA 5EHQA 5EFZA 1G42A 5FRDA 3JYHA 3FVRA 2HRRA 1K4YA 4DMKA 1OXMA 2WQZA 4FHZA 3D5EA 3I6MA 4X85A 3WWOA 2XQJA 4JH0A 1MX9A 1U65A 1ZJ4A 4PSDA 1Q0RA 5AIBA 1YS1X 4NZZA 4OU4A 3W04A 1QJ4A 4C87A 4C89A 5LIPA 2BUBA 3WKDA 2Z3ZA 5T4FA 5JD6A 3FCYA 4LXGA 3R3XA 4B7ZA 1SC9A 4QDZA 2WUFA 4DNPA 1D07A 2BJHA 1TAHA 4BTVA 4J3JA 2IITA 3ZPXA 2B4KA 3RK4A 1WPRA 1QGED 3GROA 3ESBA 1XZCA 2G4LA 1XKTA 2XUGA 3CCCA 5AKJA 3FVTA 4FTWA 3QPCA 1GKLA 4EY8A 4X90A 2GYWA 5LZ7A 3E4DA 3ZV7A 2OG1A 3I2GA 2JGKA 2QKYA 2AJLI 4PNZA 2C4HA 1WHSA 5DWDA 1CRLA 1MTZA 5LYYA 4IH9A 4ETWA 4LKOA 4MJ3A 5CT6A 3WK8A 4E46A 2XQKA 2PVSA 3TEJA 3IDAA 4Y2JA 2XUHA 4GLBA 5C8VA 3YASA 1LBSA 4P93A 2XDWA 5CMLA 3WK9A 3HABA 3I6ZA 1H22A 3AIKA 1B41A 5CW2A 1U4NA 4XVCA 1E8NA 1MT3A 1W75A 4Y7DA 5EHZA 2H9YA 3QMMA 4DNFA 3PI6A 3V48A 4P9NA 4RE5A 5FOQA 4DTCA 4G5XA 1H2ZA 1USWA 2B61A 4MQMA 1TQHA 4KRXA 3STWA 4KAFA 1ODTC 2B20A 2WM2A 2C5GA 1UOOA 4TGLA 2PPLA 5LZ2A 4KACA 2XLBA 1EI9A 3DYIA 5HK8A 5A2GA 4OD0A 5BWCA 3F67A 4W1SA 1ZI9A 2OLEA 4BP9A 3ANTA 1N8SA 1NX9A 2XB6A 4W9RA 2VT7A 2Y2UA 2OCGA 1EB9A 5AK6A 1N1MA 2XUFA 4CFSA 1QO7A 3FNBA 3H2IA 4U2GA 1CR6A 1TCCA 2XQIA 3EIOA 3G9TA 1CUHA 5AI5A 4N5HX 3R40A 3C70A 3O4JA 4JNCA 1YSCA 4ZXFA 1G5FA 5A7HA 5AH0A 3O4HA 1X70A 4J0GA 3DQZA 1HPLA 3O4GA 2XMRA 1LZKA 2OQIA 1GT6A 2O2HA 5HFAA 4B82A 4DSAA 2QTBA 3H18A 3G9XA 5K3FB 4Q3OA 4BDTA 2HA0A 1BS9A 4OYYA 1T2NA 4F5ZA 1EDEA 4ROTA 3H2HA 4FBLA 4B83A 1UWCA 4H7JA 3EQ7A 2GYVA 2B9VA 1U2EA 4QLAA 3EF3A 2Y6VA 2J3QA 1Q0ZA 5LKAA 3WZLA 5AK5A 2XT0A 3GUUA 4UHHA 4ARBA 2CEKA 2ZSHA 3OG9A 3ICVA 3PFBA 3RARA 5AM2A 4XIIA 5LZ9A 5EHNA 5AM5A 3N2ZB 2CJPA 3HC7A 3I2HA 4KR0A 1EB8A 1J2EA 4G8DA 5ALXA 3BE8A 4B84A 5DJ5A 1K5PA 4PW0A 5DLPA 5HKAA 2GBCA 2WJ6A 4BVLA 3H0CA 2WHPB 4UBOA 3W9UA 3IURA 1XZMA 2XMSA 5ALNA 4UFPA 1TK3A 3C45A 1P0PA 4GWLA 2PUJA 3I1IA 3STVA 5KREA 5EGNA 5FPQA 2VJAA 2ZYIA 2V98A 3BF8A 2P8SA 4CIBA 5AKEA 4TVKA 5CRIA 1NU6A 2RONA 3VISA 5AHXA 1VXRA 2VQ6A 5ALJA 4B9AA 1DT5A 3DOIA 5AM4A 2QRUA 2XQGA 4QDOA 5ISMA 4N8EA 2QUAA 1LNSA 1LPAB 2J3DA 1XRRA 2VJCA 2GZSA 4NS4A 2WG1A 2J4FA 4YASA 1LZLA 4Y2XA 5JZSA 3STUA 1DTEA 3NGMA 4UFNA 2ECFA 5FXMA 5ALYA 2YYSA 3WA7A 1JU4A 4L9AA 3W2TA 1DU4A 3TGLA 4OCZA 1ACJA 4M0FA 4A23A 1XZLA 2XUAA 1YASA 3FYTA 4JEIA 2XUKA 1JFRA 4X71A 5SYNA 2QUBA 4X91A 4CIAA 5AOCA 3OM8A 5AIAA 1XRPA 1DINA 1QTRA 2OCLA 1YA8A 1YA4A 5CXUA 2VTVA 4C88A 1DQZA 2VA9A 2DHCA 4QWMA 1H2YA 5A7GA 4UBLA 1SCQA 1XROA 3DEAA 4Q34A 2HA5A 5KWIA 3C6BA 1XRQA 3WLAA 1CFJA 5ALKA 3MVEA 1RYYA 1CLEA 1ZIXA 2GZRA 4UBKA 4DMCA 4HRYA 2QMQA 4H18A 1CEXA 4XX1A 3IBTA 3HZOA 1Z68A 4G4IA 2YASA 4DLNA 4UHBA 1MPXA 5HZGA 3ZWQA 2R8BA 5ALOA 1THGA 3WWCA 3WIBA 2QM0A 4RGYA 1YAJA 3L1HA 3DOHA 5ALDA 4X93A 1AQLA 4BCBA 3O9MA 3R3YA 3PUIA 3E3AA 2G5TA 4WY5A 4K6KA 1ETHA 1YB6A 4K6HA 1DQYA 4MEAA 3BJRA 4H35A 3WZMA 5AM3A 1EDBA 1YAHA 4W63A 5JZ9A 2XUIA 2RIPA 2WLSA 1CUEA 2GBGA 4BZWA 1XZAA 3C5VA 5H3HA 4H0CA 2D0DA 1QO9A 4WFIA 3D2CA 4H7IA 4J0CA 5ESRA 1J1IA 5CURA 4Y9SA 3ZLVA 3DCNA 1BROA 1AZWA 2ROQA 5JALA 3S2ZA 4F21A 4QEKA 5D6OA 1ORVA 3MUOA 3IUNA 2WIJA 4UBJA 2AXEA 1VXOA 4MWTA 3G0BA 3GA7A 4L0CA 3EBLA 1AX9A 3LS2A 3BF7A 5JANA 3FAKA 2XMZA 1IMJA 2C0PA 3KWFA 3KOOA 2H7CA 1UK9A 3FYUC 4FNMA 1JMYA 1JT2A 4KE6A 4BE4A 3C5WP 2JIDA 5C81A 2VAVA 2G63A 2O2GA 1W52X 3R3UA 3JW8A 3PICA 2WTMA 3CN9A 1E3QA 1H2XA 4J0JA 4N8SA 3V1MA 1QIKA 3DLTA 4E11A 2LIPA 4GW3A 3FLAA 3NWOA 2RI6A 4Y2YA 2FJPA 3WKBA 2WG0A 3LIPA 1XZFA 3GELA 4AMZA 2R11A 1A88A 2BCEA 1A8SA 1VA5A 2X5XA 3TJMA 3C6ZA 5AM1A 1FFBA 1BE0A 2CB9A 3RM3A 1HLGA 5CT4A 4AZ0A 2WIGA 4WFJA 2QJRA 5C8ZA 5JZBA 3VVMA 2QJWA 3QH4A 4BZZA 5ALMA 5ALQA 1CUIA 1UKAA 5ALFA 5AKGA 4P92A 3GZJA 4FKBA 3WYNA 3D2AA 2I3DA 1HKHA 3ZI7A 4EY5A 5JIBA 3M83A 2EDCA 5LZ5A 2QVBA 4W1RA 2ZVDA 3R3VA 1CV2A 2XLCA 5HFNA 2V9ZA 2ZSIA 3KWJA 2VAXA 1LPMA 2IX9A 1ZIYA 1TIBA 3ESAA 3NOXA 5FLKA 3HSSA 1QIJA 1THTA 4H7HA 2WUEA 4ZV7A 4X6UA 3L1JA 5ALHA 4L3WA 1J06A 3S8YA 1MO2A 4QLOA 1CUWA 4GI1A 2XI4A 2VJBA 4Q3LA 4I19A 2CUTA 2WHRA 3O9VA 2WG2A 2O2IA 1WB5A 4Y2RA 5LP1A 4PO3X 1ZI6A 4GHWA 4DSZA 3DDUA 1E89A 3I2JA 4BCDA 4Q3KA 1LPSA 1JU3A 3ZLUA 5ALZA 2OCKA 2WUGA 2GBIA 2Q0XA 4X00A 1BEZA 1QFSA 5ALEA 4PV7A 3AIOA 1CUAA 2AJDA 4G9GA 2BGRA 5IH7A 5CT8A 1ZI8A 4FDMA 1CUZA 2PKYX 5BV7A 4LYDA 1XZJA 4BVJA 5I9IA 4AO7A 3F97A 4JUIA 4RPCA 1BN7A 1ZGBA 1KU0A 1MJ5A 2V96A 1JJIA 3C87A 1CUFA 5T4BA 4BDSA 4W1PA 2QT9A 4G4GA 2JGLA 5IVKA 3FWHA 2BUCA 5E4JA 5K3EA 4G8CA 1VOTA 1SCKA 1N5RA 3ICWA 3O95A 1HL7A 1DX4A 1X2EA 1R4ZA 3DNMA 4KEAA 2PBLA 3WL6A 1YB7A 3WJ1A 4B85A 2BFNA 3CN7A 4UHFA 4HS9A 2HU7A 1MAAA 3DS8A 3WL8A 3DKRA 1BRTA 4ITVA 1WHTA 3D0KA 4B0OA 2QOEA 3WWPA 3RKSA 4B6GA 1A8QA 1R9NA 3BDVA 3OTQA 5FPPA 3I1YA 4K6GA 5JAUA 2VF2A 2H7XA 4CCYA 5A6VA 3HYSA 3P2MA 1JJFA 4D9JA 2O7VA 2FJ0A 1EXWA 1UK7A 2X8BA 3VKFA 4BBZA 3WKAA 3DL7A 5LZ4A 5DTJA 3C8HA 4U2FA 3OC0A 5ALIA 4S0XA 2WFLB 4MQLA 1CUBA 3STXA 3D59A 3OURA 3WA6A 4EY7A 5YASA 2OXEA 4C4ZA 3QBJA 2EEPA 2WSLA 4M0EA 5EHXA 4XJVA 1BEEA 4P08A 4G1FA 1R9MA 3AZQA 1TRHA 5FUMA 1XLUA 2XUOA 1MN6A 4C4YA 2PU5A 1BU8A 5K3DA 2HHAA 5CBKA 1AURA 3A6ZA 4QZVA 5E4YA 3OOSA 5A62A 1ZICA 1LPBB 1UT6A 3HI4A 5DTIA 1T4MA 3A70A 1G4HA 3HLKA 1XRMA 1VE7A 2XMDA 4B0PA 4UHCA 4MYSA 1ACLA 1ZGCA 1EK2A 5CH5A 1XZKA 4WDQA 2ZYRA 4LXIA 1JJBA 1JI3A 1IZ7A 3D2BA 1QFMA 2DSNA 5AKYA 4CG1A 3B3QA 2O7RA 1LPOA 1DWPA 3GBSA
chains in the Genus database with same CATH superfamily
4O3FA 1GQFA 1EK0A 3LKBA 4TKUA 5ENVA 4YP1A 5TX7A 3ZZTA 4YK7A 5K1ZA 5JYCA 1UKBA 2WK1A 3AXTA 3GJTA 1FSZA 3WNZA 5REQB 4I5EA 1EUDA 2Z2XA 5B64A 4QVGA 1OJ7A 2QMEA 3U4HA 3MRVA 3O9ZA 4UD2A 3BUSA 3EXAA 4D8XA 5CNIA 5L3VA 1TO6A 2BPOA 2HXSA 2R8XA 4DA0A 1IUKA 2PT9A 4R5MA 1ZBQA 2X2OA 2Q21A 1GZVA 2XZOA 2BBTA 1FS5A 2AEFA 3GJ8A 5FOTA 1JPJA 1R15A 2WD7B 4MQEB 4CG2A 1XL0A 5BSWA 2QXTA 2A5GA 2FEWB 4X97A 2AUTA 3SYTA 4BC1A 1MU0A 1XTPA 3RNOA 3EDMA 4V1CB 1WRBA 1N3BA 1SPXA 2HCJB 3FE2A 4F3TA 1ZVJA 3IT0A 3FTQA 3T7RA 2FV8A 1D2AA 3ZU2A 2B2NA 2X0KA 4QUEA 4AYXA 2YCLA 4MVJI 3W9BA 3EMVA 4OJNA 2AI1A 4QSHA 2PGOA 4PTZA 3NO4A 4EZIA 2CSXA 2WM9B 4JKOA 4YAFA 3COSA 3BRSA 1YB5A 5CW1A 1JSCA 4RF2A 2HSZA 5JRZA 3ADOA 1T4BA 2HBQA 3P2EA 4JL8A 1AUQA 4RTRA 1E3WB 2VRNA 1QFJA 3ZEIA 3J7AC 3BZBA 1LX7A 3A8TA 3GRCA 3S28A 5LU9A 1XWFA 3UKDA 2UYHA 3BGDA 4JODA 2D0OB 4ZU6X 4O2AF 4MUGA 2JZOA 5CB4A 4HVAA 4ZOLB 4YCSA 3OLYA 2O59A 4P8RA 5CYFA 4NE2A 5I7VA 1P1IA 3CNEA 3GP3A 2JJ1A 3VDNB 3PT5A 3UQYS 4IH1A 1NZDA 3MGCA 4D6XA 1SULA 3AUUA 2WUDA 3STYA 3F3SA 3JVEA 3N5KA 4IG4A 3ZHVA 1UKCA 1SHTX 4IXNA 5LQMA 2NZYA 2D54A 4L7QA 3CINA 4FOPA 4UVHA 4DGQA 1FLVA 3LYLA 4LSGA 3OEHD 1OGYA 3SQDA 3WQHA 4XWTA 2D1YA 2ZAIA 5G3YA 1K4MA 1L7EA 3ELWA 3IJRA 4UKDA 2W90A 4ZYUA 4AY2A 4G65A 1QP4A 2Q5CA 2VF4X 2QWXA 3B9QA 1NONA 3JZIA 3QU9A 3SK0A 4MJLA 1T3LA 1UBEA 4R2MA 2RHGB 3RWMB 2E6KA 3VHRA 2REOA 2JEYA 2AZDA 3LCJA 1JDZA 1B6SA 1WM1A 1XNGA 3DHEA 1S8OA 3OKPA 3OY2A 4QLBA 1M2OB 4Z1OA 3KC2A 4CKEA 3EG5A 3ZD7A 1HNWB 1C5KA 5A4KA 2ZWIA 2RC6A 3NHRA 3OZTA 1R5NA 2EATA 2WHPA 4MVJA 1TGYA 1Z7GA 2HA2A 1XTTA 1U4OA 1HE1C 4L22A 1WVIA 4FS3A 5L95A 1W9HA 1FFDA 1XXLA 4NJEB 3W3AD 4R4JA 4DDKA 1WNFA 2NU7A 4KIJA 4XFJA 4I81A 1OX4A 2NNLD 2PH3A 4X0EA 1V16B 1Z8DA 1MC8A 1N3LA 4JX8A 4JFRA 5HF9A 5BSVA 1FLAA 4RORA 1OUMA 4UMEA 3BQ9A 4IJ5A 3N58A 5IC5A 4UM9D 2YICA 1DUVG 4Y9UA 5AK0A 3C97A 3OEEA 3HEMA 5JH7B 5TS3A 3BC1A 2P4HX 3RYIA 3UMJA 2PDAA 4S1WA 1BGWA 4TSKA 4DLXA 3BAFA 3RC8A 3ZHUA 1AM4D 3L8DA 4KFSA 1DEAA 2QZZA 1A5TA 3T3DA 2H2AA 3II6X 4MMYB 3RLIA 2WU8A 4MVJH 2P9FA 4KWCA 4WLOA 1R9GA 3S99A 3U7GA 3CX6A 1IHDA 4J0HA 1UM9A 5BYBA 4C7BA 2ORIA 4KO3S 3HCWA 2QW0X 4B76A 2HLDA 5BWBA 4K2AA 2A4MA 3CYFA 3O8OB 3NUZA 3DLPX 2ZTHA 3VI4B 3V8EA 4CM1A 4GNKA 1QVWA 2PL5A 3SSNA 5LQDA 1A5AB 1OFTA 1XRSB 2FPRA 3FNHA 3K2BA 4LMBA 1RAIA 2GLUA 1NRXA 4MR7A 4ZO9A 3N86A 3KYDA 3QXHA 1E5XA 3IV6A 1PR9A 2IZOA 2I78A 2KW5A 2NXCA 3AEQB 2IIPA 3KEQA 3SKXA 4F8JA 4PN7A 3PQ5A 1GPKA 1WUTA 6YASA 4A0HA 2E4VA 4LYEA 2Y0DA 4Q7JB 4FBMA 3V8PA 2QTHA 2IXGA 2NZJA 4NMXB 4HXEB 1T2AA 1LEHA 3DE1X 1T8UA 2BMJA 1M2VB 1WQ4A 2CL0X 2R48A 1E92A 3OX1A 5LBTA 4B3MB 3L9WA 2FZKA 1JDPA 2APJA 5AKLA 1FSSA 1IHUA 1SELA 2D5IA 2RK3A 3DBRA 3IJEB 4F6LA 1CF4A 5C51B 1FZTA 4ECEA 3AEUB 3Q7IA 1ZNYA 1Z5UA 1ZWKA 3QFSA 4GR9A 4F6CA 1IULA 3PVZA 3A37A 1O58A 2NT3A 2H2DA 4G2NA 1E2PA 2A5FA 1RVV1 4MYTA 4HQOA 4YJFB 5FWNA 1JYFA 1CRQA 4GBMA 5FX2A 5DGXA 4RMJA 1M1ZA 5DXJA 3PTAA 2DULA 4XVRA 2ZYHA 1TRKA 1BQEA 4DQKA 2PSHA 4RK0A 5CYGA 3C5CA 4F1KA 4OGLA 2QYOA 1MW9X 1QGDA 3PDJA 4YPOA 4JXZA 3T3GA 2EFHB 4ZVLA 1E3TA 3NT4A 4YRJA 2YV2A 2H85A 1BQ3A 1X14A 2ZJ8A 2R8YA 3EQ8A 2CKMA 3KKQA 3QEMA 3X1MA 3UMYA 5E3IA 1L5HB 3H4TA 1EWQA 1BHJA 2CNDA 3QKIA 2OZEA 3M4XA 1FVOA 4KLCA 2C58A 2Q5QA 4CEHB 1Y1PA 3F74A 4QE3A 3FG9A 4AJLA 3KYCA 5C80A 4DR3B 5T4HA 3S2GA 2BAGA 1I9CA 1P5JA 1VYHA 2VJNA 3OOYA 3SM9A 1K6EA 3PCXA 2QJFA 1FU4A 3CEMA 3ZBQA 1AGYA 3ONDA 4EFMA 3D1LA 5BVGA 4DR6B 1W29A 2G1JA 1SBCA 2OCIA 3GBPA 1PFQA 3QLJA 5C1PA 1TM7E 3D0OA 1XQVA 2EFJA 2PRSA 4RVCA 4C0AC 2W2QA 5B4VA 4OA8A 4GMDA 1R88A 1TQ8A 1ZLXA 4W9NA 3MT0A 2H4YA 2BKAA 1NR1A 3IP9A 1XPJA 2WIBA 4BVBA 3U48A 4X65B 3WWYA 4IP0A 5DVZA 2YWCA 3HKDA 3IEVA 3FDZB 2CN1A 3N76A 5GZ1A 5F52A 1GTZA 1SQ0A 3S5JA 1AUVA 1H2HA 1AMNA 3HHEA 4HI0E 1M7GA 4UULA 4EGJA 2Z56A 2BMVA 1QLHA 2QQEA 4GPD1 4ZHQF 2CDNA 1EWRA 4MUAA 3AETA 4FIDA 5IANA 5JNWA 5JZOA 3H2YA 5C32A 4BAZA 1FUYB 1Z47A 2GDZA 5JAPA 4GI3A 4BQOA 4R5HA 2UVPB 1KFEB 1FFCA 1L4YA 2QTAA 2XPCA 3HBMA 3K0CA 2V97A 2ZIUB 3WHIA 4G25A 4F3CA 3CVVA 4LVUA 4I9NA 2GT1A 2OAEA 3LLSA 2SCUA 4O2BB 4MIOA 4DCUA 4WFKA 1G21A 1D2MA 2AVNA 4FFWA 4RXTA 3EUWA 3WICA 4BBAA 4ZI3A 2H92A 1W44A 1P3JA 4Z9FA 1MC5A 4ND6A 1VMKA 1S1CA 4R9UC 5EHIA 4YREA 1X1SA 3TXXA 2ZRFA 2NGRA 2FHSA 3UOGA 1HGXA 1GD1O 2QTNA 3C7DB 3T1OA 2RH8A 3I83A 4N5NA 2X9VA 4RPGA 5DWVA 4KPFC 3M6XA 3MJVA 1IUOA 2AC7A 2H8GA 2C97A 1L4EA 2H29A 1M67A 4OATA 5EQJB 3SXJA 2ZSEA 4EYEA 4YUWA 1NYTA 2IVFA 1OH8A 3WNBA 3T3OA 2XUPA 3G0DA 1O95A 3I23A 1SBHA 2YYZA 3ACDA 3TUIC 2AOUB 2JJQA 5P8WA 1X1QA 2RBKA 1G291 1TVKA 2B5VA 1Z7WA 2Q5IA 3LT0A 5JI3E 1KGSA 1TUGA 2Q29A 2R66A 2FRXA 1BSVA 3HO8A 1NXVA 2DR0A 2V7WA 1V1RA 2NO4A 4N5MA 5BSHA 2QN3A 1XUOA 1A9XA 1I0ZA 4CL0A 4R3NA 1K92A 4BMCA 3KLBA 2EKBA 4JUCA 3QF4A 2QRZA 3A2NA 3RFUA 4B4WA 2IF2A 4QDTA 4A2QA 1H1LB 1OASA 2I71A 5A3RA 3QX3A 5EXSA 3MRSA 4DZTA 1U5BA 4OGGA 4PG5A 1JQEA 4RKYA 4DIUA 3CNHA 3K6SB 3M7IA 2V8BA 3NBUA 3OVMA 1GFIA 3T99A 1V71A 2PX6A 1TB4A 5JYBA 3D4LA 4YAJA 1IJFA 1VTKA 3EXHC 1KYXA 3L6EA 1QQ7A 3ABQB 4GX0A 2N47A 5J5AA 4C21A 2BTQB 2C3YA 4KIUA 4RU1A 1I6LA 1WB6A 4KNYA 3AU9A 4F2PA 1DC3A 2ZB7A 1LQUA 3VPFA 2WLTA 2Z3VA 1X38A 1E5TA 3BWYA 3SX0A 4L4ZA 1DG9A 3CQ9A 3UICA 4BO2A 3IR7A 3H16A 1SXHA 1J97A 2VN8A 3DE6X 3ODPA 5JG7A 1H6DA 1I3MA 4MRSA 2WWRA 4NPCA 5TARA 3ROTA 4XE5A 2PZLA 1UJBA 4PLHA 3I0ZA 1NT2A 3HVJA 4FHFA 4TZTA 1WVMA 2OGZA 1W4LA 4Q7LA 4ZPXA 3WXMA 1SEVA 3KAKA 3RTGA 1CQZA 4IM7A 1UOEA 3AU8A 3K1AA 1NY5A 1AC5A 4Q1EA 2VDLB 4MWSA 7MHTA 3LP5A 1U2QA 4BB5A 2HMWA 2GHQA 1H6AA 1JI0A 2QIOA 2Z4TA 3T7DA 2QLJA 4MLPA 1ZVMA 1KYVA 3HY3A 2IZ5A 2JGMA 4Q1BA 4QFCA 3TR5A 3RSZA 5I48A 3OCYA 5DBHX 1VA4A 1B1CA 3EEQA 3GIDA 1LS1A 3RSSA 1XRNA 3BHNA 3ICOA 1G3QA 2RGWA 4P6VF 4WZBE 3W79A 3I61A 5LA6F 4MDEA 2POQX 4B7CA 1U8EA 1XEXB 1PG0A 3BKWA 1X94A 2HSDA 3JQ8B 4NEHB 2FE1A 2IHTA 1NT4A 1N6KA 4R8KA 3AOEC 1A9RA 3B1JA 1NBME 1HYQA 2NVWA 3L4BA 1I7PA 5F7ZA 2IIQA 4F4HA 1K63A 1V8PA 1QTIA 5EXXA 1QF6A 2J32A 1EVYA 4UJ3A 1VCIA 4YCAA 5E6UA 4C7OA 4E70A 4D4JA 5A3VA 1D2CA 3RSCA 3R6LA 4HDAA 4BQNA 1PEKE 4DMHA 1W36B 2VSNA 1JIIA 4YC7A 4O29A 4RHTA 1W2WB 3AL2A 2R8ZA 2EGGA 2NW6A 2GN4A 2GPNA 4ZAYA 2DERA 3U3OA 4CL3A 1MO3A 3QQ5A 5AJTA 4XB2A 2BISA 3ND5A 6ADHA 5EWJA 2IYAA 1ABFA 2AZTA 3G1WA 3FMFA 4F7DA 1CQXA 1IPFA 4L1KA 2MYPA 4OMCA 1EXVA 4BXOA 1ZD1A 2IPAB 4C0SA 4TMFA 5IYZB 3O4IA 3MMXA 3V7UA 4A2WA 3BJMA 1KJJA 2AX4A 1LU9A 3D6VA 4LNHA 4R1QA 3OQMA 3HWX1 5H8WA 1E7QA 3OAAD 4OQPA 1WW2A 3PFNA 1EJ6A 3EVNA 4P7JA 4XEHA 4P31A 4UFOA 4QVIA 1F2TB 1WB9A 2I55A 3VZPA 4AWXA 1Y5IA 5KYVA 4DMFA 4AJKA 3C3EA 3KKKA 3SYLA 4D9MA 3WNQA 2XBMA 5EG5A 2CLKB 3REQA 1GL6A 5CJ2A 1P4GA 4BLTA 4G0UA 1YDHA 3QW4B 5BWLA 4C7JA 2C2GA 5AVKA 2WZDA 2FYTA 4RPHA 5LZ8A 1R1DA 2P5YA 2REQB 1A8HA 2VZ9A 5FCDA 4CGYA 1A8UA 1CIVA 2CXUA 3QEAZ 3UMCA 4OHVA 1N8KA 1KSGA 4HT3B 4N49A 4Z4HA 2FG5A 1KO4A 2BKVA 2PMBA 3B9PA 1XJQA 4LRXA 5DHTA 5K51A 1Y1QA 3DMRA 1BJTA 2V45A 3GVCA 3L0YA 4M2LA 3A7EA 4M8SA 4RVGA 1H4SA 3DKKA 5L9AA 3ZD8A 4KMRA 3LCRA 1PGNA 1E9BA 4OJMX 4U2BA 2CVQA 3VYTB 4CMBA 4TTJA 4JQCA 3DZJA 1BGVA 2YMLA 2PLNA 3IEPA 3IHLA 4KQJA 4DMMA 3RJ5A 4JLAA 4PYLA 4AULA 2XYVA 4BE9A 4PC3A 4NPAA 2NV2B 5B5SA 1BJRE 3ZE6A 3NEYA 4G0MA 4QUJA 4BLWA 1T6YA 3JVDA 1EZ4A 1YJXA 4ISBA 4UM7A 1DBVO 3IAS6 3HU3A 1W0JA 4JHLA 4CQMB 4PYJA 1NNSA 4IRMA 4JYBA 4BMVA 4CG0A 1GRNA 5LNK1 4B6OA 1BVRA 2NUAA 1N33B 2BFAA 3BDAA 2HNBA 5CM8B 4EO9A 5GIOE 3B5JA 3BBLA 3MJTA 4JCOA 1ODJA 4QBGB 2VJOA 1Q3HA 2NV6A 1IHXA 2PX3A 4GI5A 4INJA 5LLSA 2WJWA 4BVKA 3KXDA 3WY9A 4EVSA 1IQUA 4Y1GA 4V0OA 1EFKA 3R7SA 3MUEA 5GMOA 2QVLA 4X1IA 1XSEA 2G6BA 4JXKA 3W77A 3ON5A 5HCNA 4QOHA 5BQ5A 3PD0A 5EZ6B 4XFKA 3PRYA 3C4QA 4BQFA 3TOXA 2PGAA 1AUOA 3D6UA 1LTHR 4Y2QA 1SJ9A 1XGKA 2OD9A 4HD8A 5ALWA 3S70A 5CFNA 2WTAA 4L6AA 4K8RB 4O0MA 3ER9A 4RD4A 4BNHA 4EPWA 2O5RA 3NWEA 3H1EA 3Q9UA 1GA6A 3ZU4A 1NBHA 4ZOEA 4AY3A 4ZRDA 4YJ3B 2XTJA 4U39A 4CCSA 2IP4A 4WGGA 4TVOA 2MR5A 1ID8A 2JVIA 4MW9A 2RHOA 4FUTA 3Q8WA 4OBWA 3L4KA 3BQMB 1NULA 1O94C 2CZQA 2FUG6 2AHOA 3L7DA 4L8GA 2B8NA 5D85A 5K0EA 2IHKA 3JRXA 5FWDA 3WFIA 4BO8A 2JGJA 1E99A 1CDZA 1ZUNB 1E0DA 1RQ7A 4IFIA 1KI7A 3GLFA 4MV8A 5KTMA 3ICQB 4JYMA 5BNFA 5A7FA 3FOCA 4K6MA 4XYBA 3U49A 3TI9A 5HQ3B 2D3TA 2XRFA 3HRHA 5EMJA 2WKWA 2QW8A 4I9UA 3PX7A 1D0SA 1NYQA 2DZDA 4X6XA 2JB9A 2OBYA 1SXJD 1QHIA 1XQWA 3BYZA 1Q7TA 3VJKA 3FZEA 1XL1A 2NUBA 1PK8A 3T5CA 3ZWNA 4ALNA 2YWBA 1XCMA 4AY6A 2IY7A 4MAMA 4HOYA 1EVZA 4H4DA 4GPIB 2OENG 1DEHA 4KXNA 3N8NA 2Q6LA 2ETXA 1VB3A 3CX4A 3QOYA 2X58A 4GMKA 2GSDA 3CSSA 1NQTA 1KEWA 1OWLA 2FWPA 5TLSA 2WD8A 4GPTA 2Q5JA 1YDMA 1WQ1R 4LRQA 1BDIA 2VHQA 5DBIA 1WR8A 1U0GA 1Y34E 1NJFA 2V74B 3IVXA 5BRJA 5HIAA 2YY6A 1FQKA 1G8MA 4CM9A 2ID7A 2PUTA 4U2EA 2EKLA 1C3OB 3C0KA 1XELA 3CS3A 4R2IA 5ERXA 5BV8A 4RYLA 5K3BA 1RHUA 3PQCA 3MIIA 4ZZIA 1XD9A 1LBIA 3OESA 2ACVA 2HLDD 4Y2TA 4MX8A 1MOSA 3S40A 3SJZA 5JVDF 1W36D 2G07A 2VKTA 1W94A 2WVAA 4RGVA 4E6PA 4YDHB 2Q3BA 1Q5PA 4WPGA 3UF0A 1PI3A 3V8NA 2OBBA 2DWUA 3TMYA 3RJMA 4D96A 2PMDA 4J1TA 1ORRA 4QFDA 2YFKA 5HFJA 1ZAYA 2YOGA 3UJPA 3K94A 3R8CA 2DKOA 4TV9F 4OHBA 3CF0A 2VDQB 3L4SO 3BTOA 2HIGA 5AI0A 4Q47A 5E2AA 1G66A 1ZD8A 2GWHA 2CT8A 1LDYA 4QBTA 1WW3A 1TM3E 4PF1A 5D7BA 2BFPA 5AT1A 5KPDA 5I8PA 2Z5VA 4UOEA 2HA6A 2GK3A 2PU7A 3SEZA 3K9BA 5AFSA 3R0QA 2G9ZA 1UDXA 3DC7A 1L9KA 1P91A 3H2ZA 5EJFA 4JEMA 3I45A 1WCIB 3OT4A 1VHWA 4TVBA 3IMGA 4KR6A 4IYRA 4JVNA 3PNMA 2VNHA 4LMPA 2QORA 2IYWA 4XWGA 2GUGA 1GILA 1VCNA 4MV7A 2W98A 1I32A 1ADFA 1RHRA 2PY6A 3EB9A 2ZS9A 3M82A 2QGFA 3E22B 1YQ9A 3C6XA 4XIFA 3SC6A 2ZLBA 1X1RA 1I6KA 3FIJA 4IJUA 5KYYA 1N36B 4DBLE 2DECA 4FT2A 4RHXA 3OJCA 2F1HA 3QIAA 5IJAA 3SIPA 3MSCA 4NQRA 4D4LA 3F49S 1UOQA 2YC2C 3FNRA 4IINA 1CQPA 5F4ZA 1U1IA 4N5LA 3ZJTA 1C7JA 4F5DA 4YMGA 1S6YA 3EEOA 2UUAB 1HZZA 3EMBA 1Q77A 2JEZA 3CLHA 3W4KA 4K9PA 2NZWA 1WKVA 4MS4B 3UPTA 5D84A 1A82A 3HM9A 3NTVA 1C7RA 2QUJA 5FUYA 1T6XA 3WI7A 2ZE7A 4F9GA 2P77A 1QHGA 2OORA 3A9UA 3DDSA 1EINA 3AHIA 4KGXA 4UDNA 4WY8A 2WJVA 3RVRA 2CV2A 5BN4A 5I9TA 3R7DA 3TW8B 1L5FA 2NO7A 3GRZA 3NTRA 4YH1A 2K2QB 2HRZA 3UAWA 1GCAA 5EMNA 1YBHA 5TQ2B 4MQBA 4KQIA 3GRUA 5BW8A 3PUJA 2HHJA 2ZJFA 2O2ZA 2GEJA 3NHMA 1V96A 4JBYA 1XK6A 1LQ2A 4K6FA 4RHEA 5AJUA 4CCYB 4JP3A 2VEOA 1E3MA 3DDWA 3EAFA 2JLCA 4DMRA 2REQA 4BKUA 1B8OA 2PL3A 3D5TA 3KK0A 2R7AA 2VYVA 2BMEA 3BK2A 3SQOA 4DIFA 4JLNA 1JX6A 3P9CA 3ZWAA 2EP5A 2JGFA 4OQFA 5TRTA 3Q3CA 1ZQ1A 3TD2A 1REQB 1XEWX 3T3HA 3U1TA 1CR1A 2WPDD 5EHGA 1KDPA 5TQVA 1Y81A 2I1WA 3B5EA 5DNWA 1XZIA 3ZCTA 3GJSA 1SVKA 3N6VA 1BYUA 1EP9A 2CDBA 4QYSA 3PIRA 5TPWA 3EOBI 1CVLA 4R8SA 1ZRSA 3B3GA 3RGGA 1GTMA 4KFCA 4A73A 3FNIA 4PPNA 5FNZA 3WWDA 3ZW8A 4IDNA 3FCUB 4D98A 2RGNC 3DBIA 3VKHA 1RYNA 2VCYA 4HGQA 3WJAA 3DHYA 3D3WB 4H15A 2V6FA 3CX7A 2FMIA 1F38A 1PJQA 3PDIB 4D9EA 1GPAA 2GXSA 1JHYA 4BFWA 1KEEB 2HW8A 2W4IA 2V7XA 2DWPA 3LGAA 4MGKR 3C1AA 4PC7A 5F9MA 1E7SA 3QVTA 2PHZA 3DVAA 1KKUA 3E53A 2J7PA 3QMPA 4QG7A 4QQNA 5CR9A 3L5KA 1BW9A 3KETA 1BH6A 1UADA 1ESMA 1PLJA 1VJDA 3IT3A 4OLAA 4F04A 4UBIA 2HJVA 2BHRA 5KQRA 1KQFA 1TCUA 2FSSA 4ZARA 4KQ6A 3OLVA 2BUAA 5F2KA 4YMLA 3GG2A 1CQWA 1TCBA 3U3ZA 1XPUA 5LQCA 2RG7A 5JJ5A 5F98A 2Q3CA 4NV1A 1CS4C 2IU6A 1D8AA 1RYFA 1H05A 2FPKA 2WT8A 4ILKA 3VKUA 3NRCA 4HDNA 1S2IA 3RJ9A 3S1LA 1L5SA 3SNKA 3UQZA 4BU0A 1GPLA 1Y7PA 1OZFA 3GLHA 5JYDA 2HSWA 2PM8A 3KV1A 1KEZA 3Q0TA 4XSVA 2GFIA 4G0YA 2PYZA 2GJAA 3GLGB 3ETNA 5EC8A 4FLEA 2IEZA 5HR5A 1YZNA 1OYOA 4BNLA 1TKAA 4QNMA 3C7AA 1GG5A 5FYDA 4UTVA 3F9RA 2C5SA 3TDNA 1J07A 2GUWA 3RIGA 1DAEA 3WWEA 3IA2A 5DYTA 1OREA 2WW8A 2EFYA 2XT6A 3B78A 4CE6A 3HXMA 5JVDA 2Q45A 3OETA 2IUUA 5DF1A 4LJRA 5ICCA 3GCWA 5DYGA 2EHDA 2FQ1A 3UMVA 3G9UA 1CNEA 3ETLA 3NB0A 5FTNA 4B73A 3QU2A 3KAJA 3CX3A 4ZQFA 2Z4RA 4DADA 4HNGA 2BD0A 3Q7SA 3ZGLA 8ABPA 1X7ZB 5C3MA 2VT6A 2FCAA 4PPFA 2WYWA 1MGOA 1LLDA 2ZJOA 1VJRA 5DM0A 3T5DA 3OLXA 4QHSA 5FUVA 3VBCA 4FDUA 3I9V1 3RAJA 1EFHA 1EK1A 4MR7B 3ZNOA 1ST3A 3OI7A 2D1FA 3EXG1 2HT6A 5FLEX 1QNFA 1VHQA 1NQVA 2HC9A 3LLVA 4UXHA 5L3SB 1CUJA 4ITRC 1UZUA 2HU8A 3E5MA 4H1UA 4W5JA 2K7FA 4D80A 3ESYA 2VHUA 5FADA 1PLLA 1EH5A 2EOAA 3OCCA 3PV0A 1O9GA 4OM8A 4W5NA 1KRHA 1JHQA 3KSRA 4PANA 1TZBA 3ZYZA 1EUQA 4RTLA 3S2SA 1MJGA 2VPYA 1S0UA 2ZBRA 2HIMA 2JKVA 1PL0A 4HKTA 1ZK0A 2G28A 5IVHA 1R64A 5CH8A 4C0WA 3TZ6A 3A14A 3WJ2A 3AONB 1LNQA 1NURA 5ALVA 1OU4A 2JHPA 4JUBA 3EXIA 4IBOA 3L0DA 1A2QA 5LYJF 2D6FA 3A27A 2N46A 1IY2A 2FA9A 1YE3A 1GAJA 4N5IX 4D45A 3C8DA 4YECA 5FBQB 1OBVA 1SUDA 3NIBA 4ND4A 5SICE 4ASUA 1SOWA 3AHHA 3JAKA 4JP8A 1JF8A 1NVTA 1OWOA 3RR2A 3VISA 2X2FA 3AB7A 1YS2X 3TAXA 4ZMRA 1RZVA 1C9MA 2EFGA 3F5SA 3RKUA 1EM8A 3LD9A 1YFLA 4P1ZA 3TINA 4CNBA 3GRKA 3GPDG 2X2EA 1W5EA 1ESZA 3KBBA 3F1KA 3U09A 5G1PA 3Q5GA 4CF7A 2P69A 3AESA 1N2EA 1WZUA 4FS8A 4I1RA 4QPCA 3SU8A 3LBNA 4RCVA 4E5SA 2CHQA 4ETMA 4HVCA 1DMRA 2ZS7A 2UZIR 3KALA 1Z39A 4L6IA 4ZEWA 4EKNB 1B8UA 4I1PA 3LFTA 3R41A 3BWMA 4FDLA 1PZEA 4C3ZA 4LHZA 2BIFA 5JAHA 3K8QA 2Z3WA 4B81A 2H5EA 2AYYA 2JIZD 2XE6A 4ZT7A 5HCIA 2KQUA 4FKMA 4Q9JA 2EL7A 3BIXA 3HQ4O 1IE3A 5CT5A 3HVHA 4HDKB 4N9QA 4YRQA 2OWEA 1QIEA 1YJQA 4OG2A 5DM1A 2ZI3A 4BJ5A 4EFLA 4WAUA 2WWIA 2XZTA 4I50B 3VDMA 4H3SA 4BN4A 5FP0A 3BA1A 5BRNA 2CNOA 5HWSA 1BWRA 3FW1A 4F4CA 3P2YA 3CO5A 3WLNA 5K03A 1GUAA 2BFMA 5KJEA 5EEGA 1D4FA 4F2GA 1EMDA 1O95C 3OLWA 1N9GB 3AR2A 1V0JA 3G02A 1NUPA 5IKXA 5JD5A 1GTG1 1OR8A 2KSQA 3AUKA 2JS7A 4UBMA 2LCFA 1VIYA 4QDUA 5EZYA 4E21A 4EF6A 1M2EA 4G86A 3DMYA 3BMOB 3EFBA 2C7GA 1L1FA 4QOSA 3DJFA 1A4UA 2BR3A 2MSWA 2YDYA 3DTYA 2ZQZA 3W2IA 5CITA 4V1CA 5JV5A 4A9AA 1ZONA 3I28A 3IULA 3NAQA 1JSZA 3GJ3A 2BCJQ 2HLPA 3DAFA 3WYFA 2ODPA 3LHDA 4OJYA 3STWA 4ZCRA 1Z4JA 1F8UA 4QGFA 5D3QA 1LDMA 2R1TA 3SXUA 3WQSB 2EQ5A 5DSTA 2RAPA 2Z95A 2Z6QA 2G5PA 2PZAA 5I4CA 1DKRA 4CDNA 4NBSA 1KZ1A 1SHKA 4RSHA 3VOAA 4CLEA 1J33A 3C5HA 4BPBA 4DJJA 4EUSA 3TFOA 4BCCA 3MB5A 4C2BA 2I1VB 2E5WA 4YAGA 1OWPA 2QUIA 5IVDA 3CWQA 3IKLA 1K0UA 1A1VA 3A4YA 1QCYA 2ONCA 3PB3A 4GXRA 4REMA 4HAZA 1E9FA 2Z08A 3SC2A 4JXJA 1P1FA 2MYNA 2ERCA 1VSTA 2NLOA 3K96A 1M5UA 4AICA 3IVMA 3U9TA 4BQRA 2FSVA 3GPLA 1E2FA 2HADA 3ZY3A 3P9YA 2VTBA 2XJ9A 4B47A 1JXMA 4GPBA 4IXWA 4B6EA 1LK7A 3HB1A 3CKMA 4QJ3A 4NCJA 1K08A 1O3YA 4PAGA 4DM7A 3C16C 1CHDA 2O1SA 1ZINA 2YVKA 4UQOA 2WJGA 3A1EA 2C98A 4XD2A 2QLTA 1KNXA 4AN0A 3TKLA 2FG7C 3AKCA 4EHAA 5F21A 4C07A 1E2JA 5LDHA 1OD6A 4BKOA 4B4DA 1ZK4A 3KYDB 2QB5A 1L3IA 3CZ9A 4L6CA 5CXXA 4FXOA 1W76A 2W6NA 1WMSA 3FROA 2QA5A 1EWTA 1T9DA 3M5DA 3DQPA 4ZDKA 3TLCA 3TZHA 3OZXA 4CRWB 1ULAA 1QE3A 4UTRA 3B20A 1WWKA 1TJ5A 3ENVA 4LI0A 1QH0A 3E23A 3OZFA 3IOYA 3JQQA 3ZOZA 3B1KA 5KC9A 1QV9A 3FXAA 2VSQA 4XWKA 2ZTVA 4TV9A 4EY6A 2BR4A 2MR6A 2BKLA 2IY8A 5J2TA 1QU3A 4M86A 2PQ0A 3A1NA 4WMLA 3CV3A 1W48A 1LRKA 1U0TA 3QVGB 5AJXA 3G0HA 3VVBA 3LA6A 4WZZA 3ZE8A 1P9OA 1QG4A 3HYRA 2D5AA 2KS6A 4Q1VA 2QR2A 2ZCUA 1Q57A 2WWVD 3P8ZA 1VC2A 4ESVA 3PCTA 2JW5A 4JWKA 3OJXA 3ECCA 4CHGA 1IQPA 2X0NA 2C0QA 2ZWOA 5IC6A 1TCAA 2W6JA 5DHQA 3AKYA 3R5HA 2R6GA 3CRMA 3EMDA 3WGHA 3WRVA 3FD8A 3AJRA 3KL4A 4K0KB 4AJJA 1DJNA 3QV1A 1PUJA 4HQNA 3N87A 1L1RA 3UB4A 1UBOS 1MXHA 4AYWA 1SXPA 1W36C 1NW9B 1Z0ZA 2FW7A 1K89A 3GAZA 1OSNA 2HU5A 3LQQA 1Q1NA 1R0ZA 2FZGA 3PWTA 4AJEA 2Z5FA 4EPYA 3H19A 2AK3A 2H2WA 2PS3A 3Q7QA 1GDTA 4B3SB 1B2RA 3JQ8A 4RVFA 1E9RA 2PO5A 1ZUIA 3H4MA 1MCZA 2AK2A 4HZGA 2FMFA 4R05A 5AOAA 4FPXA 5EGSA 3GFFA 1U2GA 4Q3BA 1R5BA 4XX0A 4BRZA 2IYEA 2GPYA 3SZ3A 1K06A 1SNYA 2VZ8A 4O4LA 1YNSA 4RIHA 1PZGA 3QE2A 4XARA 4CU2A 1NVMB 2Q2VA 1M9NA 2WYHA 3LDAA 4Q05A 5LNK6 1V26A 1WBJB 1XLWA 2C2HA 4WNIA 3CT6A 2EFEB 2GPSA 3FVWA 3Q5EA 2Z9CA 2ZJAA 3JQCA 4UEQA 1ADGA 2ZAYA 3MRTA 2HCBA 2CYCA 3I3OA 4YX9A 5CB0A 2W5UA 2O8FA 2WIKA 3O90A 5ER9A 5CDFA 5IEBA 1RZUA 3TECE 3IESA 1LBQA 1PFWA 2X9GA 3FVRA 3JYHA 3V6LA 3K70C 4YLEA 1T34A 2TMKA 2JJ2D 4FHZA 1T9BA 5I9BA 4JLVA 4X85A 1FXWF 4NCNA 2RJ3A 2B8TA 5KOIA 4ABTA 2WJIA 3GZTB 1R00A 5IAOA 5L40A 4EKIA 4EQ6B 1MX9A 4HLCA 4O59O 2HNAA 1A77A 1R5OA 4MUKA 1PYDA 1VI6A 2AB0A 4CBVA 4DN6A 2EIXA 4QAJA 4XWOA 3NW9A 2ZKIA 3A4MA 5DBOA 2V5AA 2D00A 3BA6A 3EXG2 1RLUA 2CMKA 4CMCA 3RVDA 1CXZA 1YS1X 4NZZA 4DREA 5F2NA 3T15A 3EVAA 4WY2A 1N57A 1TO1E 3W04A 4BQEA 4H17A 3T8YA 4C89A 2BUBA 4G1UC 5LIPA 3AY3A 2A7QA 3CLUD 4FFSA 4H27A 3WKDA 3GQBB 5JD6A 2P6MA 3RI3A 4NTZA 4FONA 4ISCA 3WDSA 1JG4A 4LXGA 1YT5A 3R3XA 1IXSB 3OSUA 4IDEA 2IBTA 2BLNA 4QQRA 4MLCA 4PGFA 2RG1A 4Q4CA 2CK3A 2HD4A 2HYDA 3M6WA 2MINA 2ORVA 1QTQA 3RH0A 4NCKA 1YCHA 2QYHA 3M49A 3QXXA 2J85A 4II7A 2YVLA 5K8CA 1WPRA 1L7BA 5IBRA 2GFQA 4RVUA 2BGKA 2G4LA 1PQWA 3CWCA 2J3MA 4P4NA 5HZHA 3U26A 3GYGA 2HWXA 2IBMA 1AXEA 4MVJD 3LT5A 3OP4A 1IK6A 1VG1A 1JHRA 3TOVA 3U62A 3ET4A 4FTWA 3E1KA 3IV7A 3O7MA 1EFRA 5CD1A 4EF4A 2ZAMA 4Z0PA 1K7FB 2A0UA 4RIFA 4A36A 3R5FA 1HK7A 3RS9A 4DY6A 4I50A 5BVGB 4B3BA 1GZ4A 3DM9B 1TTPB 2SHKA 2WWGA 3VOTA 2HDNB 4XJSA 3ROGA 2FSIA 1Z6TA 4L9SA 4AL4A 5EIFA 2DBRA 1YONA 1IY1A 1U7WA 3GEPA 5T7BA 1Y1LA 5KAMA 2WAOA 2IOYA 4R98A 1CB0A 3BGVA 2L17A 2NSLA 3WYGA 2JGKA 1D1TA 1GNPA 4KQCA 5CEEA 3OQPA 3MCAA 3CF4A 1MQAA 4M7PA 3AR6A 5KTNA 4NYMR 2OQRA 3NT2A 1AS0A 3FTEA 4ZVQA 1M6VA 4FSDA 1Z06A 2W6ZA 3GW8A 3KWLA 1WHSA 4WKCA 5FBHA 1MTZA 5IMBA 2CEAA 2WWFA 1OX5A 2EX1A 4NV3A 3LUBA 2ATIA 1JHPA 4MJ3A 2C9MA 3WK8A 1OC2A 3ZD6A 1C0KA 2EFDB 2PVSA 1J25A 3AHCA 3DWFA 3D4PA 2OO7A 3ECSA 4PX2A 4K28A 3TM5A 5IM4A 1G6OA 3DMFA 3KQPA 2EFCB 1E3JA 3ONEA 4XD7A 1VHJA 3OO1A 4IIBA 4O1MA 4BO1A 3MA0A 3UW1A 4BFTA 3SP1A 3QHPA 3E82A 5ITZB 3EF1A 2DT5A 1UAYA 2JFNA 3ABRB 4GLBA 1YK1A 2PWAA 4Y6SA 2FQYA 5H59A 3VOBA 1RXEA 1II8B 1G8AA 2B21A 1IN6A 1E1NA 2PJUA 4R68A 3JPWA 2PV7A 1E5DA 1VJCA 3UHPA 2G4VA 4WEQA 3SLGA 2VC2B 4RQTA 2WF5A 3WK9A 2R6DA 1B41A 1DHRA 4S2UA 3FPCA 5CW2A 4D6PA 3FBGA 5CEFA 3JVUA 1FTWA 1U4NA 2I29A 2H9AA 2IP2A 4JN6B 3JCZA 4DB2A 4A82A 1XOIA 1YHNA 1ZH4A 4PLCA 5A5EA 5DNCA 2BCGY 1XD8A 2BY4A 2J0EA 2P6UA 2Q3FA 1E60A 2P1RA 2R87A 2DSTA 1XZQA 2R8OA 1W75A 1P3Y1 2P2SA 3BIOA 3P0JA 2C2BA 2H9YA 4I4TA 5L4NA 1ISHA 3PI6A 4C20A 2IFTA 4ZU3A 5TNXA 4P38A 2JLXA 4RE5A 2G4CA 1NW4A 4D74A 4HLUC 1USWA 2LWIA 5EJ5A 1U2ZA 4QJIA 2QV7A 3M8KA 4O25A 2P7IA 2B61A 2JD0A 1PL7A 3AB8A 1LA2A 2XR1A 4FDAA 5E6SB 3ZVNA 2YHSA 1Q11A 5ILQA 4OLBA 1TQHA 4KRXA 2H2GA 3JV7A 3ZDZB 1NNUA 1U2RA 4MVJM 3FCAA 4MP6A 1ZFNA 2DU8A 1YK0A 2FRDA 1CJMA 4KAFA 1GOTA 4ZODA 3UB2A 4DZZA 4EW1A 1VKOA 3BXOA 1BHSA 5CFQA 1OH5A 3O92A 2BMFA 2Y1WA 4LJ8A 3WGMA 3L7OA 5JFOA 4TWAA 5T57A 3FHTA 1MB4A 2ZK7A 1SC3A 5NLLA 4QT0A 1YA6A 1R27A 2PZ8A 1QHXA 3VNVA 3ABZA 2B83A 4FCWA 3TQTA 1H42A 3FDIA 3GUVA 5LZ2A 4XLZA 2FFBA 5F4BA 2RHCA 1XVTA 4LZZA 1PJTA 1MGPA 1CQJB 1FDUA 4RKRA 4BTEA 5BV1A 5LWHA 2G67A 3C15C 1LDEA 2F59A 1D9XA 4AY5A 4D79A 1BDBA 3AFHA 1DCTA 3L04A 3ZTTA 2OLEA 3NATA 5T3UA 2AG6A 5FYQA 4KPUA 3VC1A 3IPAA 1ISGA 4TM7A 5HZKA 3VR6D 5F5LA 1ZJWA 4WGFA 1OH6A 3TR0A 4GGPA 3LUHA 1Z4IA 1P17A 3FKJA 5CP8A 2PKWA 3NIFB 1TO2E 3IPLA 5AK6A 1OXVA 2XXBA 3WOVA 3I34X 2AV6A 4YMIA 1PT7A 2AZMA 5F9HA 3WAJA 2JARA 4M0UA 3OCXA 1TCCA 3X1XA 1Q19A 2PJZA 2XQIA 3EIQA 4ME6A 3BE6A 3REGA 4J3FA 5KQSA 4TKLA 3A7DA 3QSGA 2I6UA 6ABPA 1TK2A 3R40A 4LSZA 3ADKA 2A9VA 2ZEJA 3C70A 2AR0A 4LE1A 2D74A 1MP0A 4HDQB 4HO1X 1GGHA 3DDHA 4LWPA 3CLSC 4CLDA 5JXGA 1VDMA 2IPXA 2EZ8A 2J9GA 2HSEA 3ILVA 4QPPA 3VA7A 3UOAB 4FYMA 4TL7A 5FPTA 3O75A 1SXGA 4DC0A 4ZXFA 1SUWA 1T0BA 2H1HA 1LV8A 3N1UA 4J7UA 4U7PB 5BVHB 3JYOA 1USVA 4URWR 5A7HA 4EJ2A 2VR1A 4C06A 2Y0EA 1X70A 3CNQS 3MWYW 2PKCA 3ZXIA 2PJDA 4GYKA 1GZ3A 4IGAA 2FFQA 2C57A 2R1VB 4K3VA 4Z53A 2OQIA 4ER5A 4Q7EA 4F9TA 3A9SA 4L76A 3GO4A 3SHVA 2L42A 3F6CA 5TDHA 1GT6A 1M1YB 2O2HA 3QYPA 4JXXA 3H5AA 4MI3A 3BFKA 4MHSA 4DSAA 2ZANA 3G9XA 1H5NA 3V32A 3INGA 3VMMA 4RH0A 3W5VA 4PLWA 3SZGA 1BS9A 2JKYA 1NW3A 1W30A 4O2AA 4F5ZA 1R6AA 1XHEA 5T3YA 3QBEA 4E33A 3B82A 1TL7C 5LDDC 3H2HA 2ZUBA 1AD2A 2C3OA 1XVLA 1YJBA 3CLTC 4TT8A 4DMLA 4GZ5A 4GSKA 5LQSA 1Q1EA 1KYIA 1W0JD 3GUYA 5IZCA 4BWVA 2GYVA 2YNMA 3JYNA 2HV9A 1UAAA 1U2EA 4AXXA 4KTTE 1BOOA 3C4VA 2XIQA 2Y6VA 2ZWAA 3EF3A 3EZ7A 4UPVA 3PX3A 5LKAA 1AKEA 1PS9A 2EL9A 4X5OA 5TPZD 3QYFA 3WZLA 4Y1RB 4BNXA 3QXSA 2R62A 1WKCA 3NBMA 4CKCA 1G4UR 2F43A 1XNRB 2C77A 4PCLA 1K3TA 1KP2A 2XUZA 3IDQA 3TSCA 2CNNA 2H63A 3A36A 3EVEA 4N7BA 3GRFA 5CHEA 4ARBA 2O5CA 3BRQA 4L0MA 2XB9A 4JJFA 3W2FA 3P5BA 1XHLA 3KYIB 3GA5A 3H97A 2G5GX 3OG9A 4YRGA 1E1CA 4XIIA 4KYUA 4OEHA 5AUPB 4DJ5X 1W7AA 2QQGA 1JQ3A 3I2HA 1EGAA 1ZLYA 4FYYA 4JU9A 3TJRA 2XNSA 3ZCXA 4ITUA 1H66A 2VQEB 2BKEA 2IUTA 4Q18A 3G2NA 2P4QA 1XTQA 4O4HF 3BTSA 4PFSA 5LD2C 4PM4A 3D8SA 5KJ6A 2Y66A 3IMEA 1JEQB 3QKTA 1GUBA 3RVPA 2RGYA 1BX1A 2I7XA 4HHEA 4JOSA 1ULBA 3PNYA 3QJGA 4NATA 1TC1A 3ROZA 2P2NA 2FPPA 5DLPA 2FKNA 5HKAA 3UXHA 1NVVR 2C5EA 2WJ6A 1W2HA 1RTKA 3USCS 3OY7A 4IHKA 1RWNA 4ARIA 5E0KB 3A6EA 3MMSA 3OKAA 1Q3TA 3LQ4A 3PTLA 2EVWX 1XZMA 1K8YB 3WHKA 2QG9A 2XMSA 3GFSA 3O8DA 3QJ5A 4YMTA 4ACBA 2C99A 2OHOA 2OQ2A 1MIOB 4O1IA 3RFFA 4UFPA 1P0PA 4GWLA 4G56A 3STVA 2ODAA 1HT1E 2GTPA 3VX4A 1JHZA 4H3HB 4DWJA 2QBYB 4BMNA 4FP9A 5KU1A 2VWGA 2WPNA 3BF8A 3NNNA 4O4LF 1CEEA 3KQUA 4CQLB 2BH2A 2HSGA 4TWJA 3MD9A 1SUIA 2OGWA 3HKCA 3HDQA 3JSAA 5FQOA 4XVQA 3M1LA 4TN1A 2C4UA 2XYRA 3LOPA 2F00A 3NHLA 5A02A 5CIYA 2FSVC 2PEZA 3SN6A 5AHXA 2VQ6A 4UREA 3GGJA 5ALJA 3GT3A 1VMIA 4B9AA 1KPHA 3K72B 3DNPA 1B3BA 3RV3A 4D0SA 3DOIA 2I6QA 3KKZA 2I34A 3LUFA 3N3BC 1RWBA 3QELA 4RXMA 4US0R 3ZLJA 2XDYA 3AP1A 1MPTA 1JFFB 1FJXA 3VNRA 3IE2A 2C9ZA 1QCZA 1RBZA 5DGHA 3SG0A 4DIEA 3HLYA 4PZAA 2Q9CA 3AYXB 5BR7A 5K0BA 4YDQA 2AMLA 1UXHA 3ZE2B 1UQTA 2YZGA 3SMQA 2FN4A 3DWGA 3N2NA 4HH1A 4S0ZA 3FGZA 4YGYA 1MORA 1NVKA 1T24A 2ZULA 1TVEA 2RBEA 3RB8A 3A6HA 1ZP6A 2IV7A 1W4BA 1LPAB 1VIAA 2ZZKA 4NE7A 3SDSA 1XRRA 4HGNA 1WXIA 1FP2A 1XPRA 4Z5XA 2GEFA 5EP3A 4D44A 2WG1A 4RKWA 4B4KA 4EWLA 3TKAA 1SIUA 3I64A 4MVWA 1LZLA 2CWWA 5EMLA 4DLPA 1W88A 1IAVA 2GARA 2MTBA 1UDWA 1C50A 2EJWA 4S3MA 4CI0B 5JZSA 1S2MA 4M1WA 3WGJA 1DTEA 3NGMA 3LBHA 4II2A 4UFNA 2R68A 2Y27A 2I3AA 5ICFA 4L27A 3CVWA 1PNRA 4BRUA 1T5BA 2IYVA 4Y2HA 5EL0A 1NQUA 3LECA 2I6TA 2QQFA 1WD5A 2ZATA 4LYFA 4JLSA 1JLRA 1N32B 1Z4MA 2GX6A 3EVGA 2EG5A 1IY8A 1X7WA 1BMTA 2XCIA 2XWPA 1JZTA 1MX3A 3M1IA 4L9AA 2NO6A 1DU4A 1GUZA 1JEAA 3VAYA 2M6RA 1LXCA 3QGMA 1VE1A 1NJ1A 2HF9A 2CC2A 2PX8A 2PSSA 4JGIA 3ZUPA 4MIYA 3PNKA 1I4LD 4M0FA 2HV8A 2XB4A 5ES3A 2B6NA 5BW5A 1O5IA 1XZLA 3V7FA 5IPFA 4WCFA 1U2DA 5ITSA 2J5QA 2P1DA 4KXYA 4D4IA 2GA8A 3TSYA 3PVSA 3ZQ6A 2XUAA 2CNWA 1YASA 1SCDA 3WNCA 4RTKA 1EBUA 2P4SA 1KYQA 2YNMD 3L07A 3CNNA 3O91A 4JK3A 1P7CA 4JOBA 1I10A 2HK9A 2X19A 5AJVB 3FYHA 4ZZ1A 4MV9A 1U0BB 4KZKA 2ZIWB 1YR3A 4PVDA 2ZXEA 4BU1A 3QENA 5BSFA 1H8EA 4ZVSA 3DG9A 4L9WA 3G79A 4AUKA 4Z54A 1XCPA 4CIAA 1KAGA 2GCGA 5G0VA 1C8LA 1IAQA 1NXQA 2DMRA 3DW3X 4IFBA 2WP0A 4LWZA 4A26A 2WTUA 1YA8A 1YA4A 1Z9BA 2GZ1A 5CXUA 2KPOA 2VTVA 3OQVA 4Q9DA 5KJFA 5JROA 4PG7A 2JCGA 4UUOA 1EE2A 1UBGA 1I2BA 3RU2A 3Q9LA 5TSDA 2VSOA 4C88A 5C8YB 3HJBA 1WX1A 4MCJA 3AIIA 4QREA 5BMOA 2O07A 3NXKA 5IM4F 4OSPA 4QWMA 4IZOA 4PNHA 3C8MA 5E1MA 5EPEA 3RU7A 5ICEA 3RTBA 3TB6A 1H2YA 5AW2A 1W85B 4DSOA 5F1PA 3TBHA 1NQOA 4LBWA 4QBIA 5KPJA 1JR3E 1SCQA 3WYCA 1RLOA 4OOFA 1V5GA 3ZN2A 3P26A 4EKEA 4IIJA 2O2DA 1UQRA 4GX1A 5KWIA 1LC0A 4PLYA 3VI3B 1E7YA 4O2AB 4HAWA 3KSUA 4KXQA 3OIDA 3VHLB 3G17A 4FGZA 3IP8A 2J9ZB 2O3JA 5EP2A 1RQPA 2FETA 2IC5A 5G4KB 1UPAA 1K7SN 5B4UA 1RQGA 1T1IA 2G7MC 1R4MA 1RYYA 2J8ZA 3H05A 4IIEA 4TLMB 3M1AA 4ZT3A 1CLEA 4XYGA 4YRSA 2RI0A 2GZRA 2JLRA 3DYBA 4JUFA 4QGHA 4AG3A 4H18A 2BR5A 5JECA 1GNLA 3IBTA 4LV6A 5TJHA 3C3AA 3ZCRA 4OLFA 1DC6A 1ZY2A 3QPVA 1R8SA 3QP9A 4DLNA 1UBTS 4X66B 4CMGA 1QE0A 2R84A 4ON9A 1KVTA 2R8BA 3A9VA 1KQ3A 1NM5A 1V6CA 3B1VA 1ZZGA 2QR3A 1ILEA 1X1BA 1WXEA 2O2YA 2QM0A 1B8PA 1NASA 1SCAA 4Q12A 1I2DA 1YAJA 1VYTA 1UANA 2O1WA 5IJZA 2G9QA 2BM0A 4DEXA 4AS2A 1GL3A 1X9HA 2ZE6A 1AQLA 3KSBC 1CF2O 4DT1B 3E7XA 1WZIA 2CBZA 2AR7A 1F2UB 1OZHA 2A9QA 2WF7A 3KQVA 4E22A 5ICMA 4WY5A 4K6KA 5DTEA 1ETHA 3Q88A 2GPBA 5AVUA 1XIVA 4HMPA 2J45A 3LLMA 4LJ9A 4LRSB 1NE2A 3TB4A 5JQGB 1T36B 4H35A 1E7WA 5FTMA 4IUDS 3ZJ5A 1V95A 3D8TA 3ZG6A 4TTRA 1ES9A 1QKKA 4W63A 5C31A 3U6KA 2FZLA 5JAQA 4TXMA 4RIEA 2RIPA 2X4GA 1J23A 1ETUA 3LPDA 3GUZA 3N8IA 4BZWA 1QS0A 3DL2A 4OSOA 3ZIUA 1XVUA 3GA0A 5FJIA 1KERA 5H3HA 1GUYA 4PG4A 4YXFA 4X45A 4JQSA 3FTDA 3AT1A 1DEXA 2VT2A 4FZJA 4G09A 1UODA 2D0DA 4FE7A 4GX2A 3R5XA 4YQYA 2FEPA 3OZIA 2PX2A 1FMJA 3HL0A 4EENA 5KVCA 3LGXA 2XD4A 3E1SA 1NUHA 4HDCA 4J0CA 8OHMA 3TCNA 3EPRA 3KVNA 1KKMA 5HMLA 2VP3A 5K0TA 1PQUA 4PCUA 4Y9SA 4D41A 1P44A 2W2LA 3V7YA 2DFLA 4L16A 3ZLVA 1K6MA 1V4BA 2AE1A 5GJWC 3PNOA 1AZWA 1S2GA 2ROQA 1QC5A 2IXTA 4GR4A 5B1HA 3S2ZA 4F21A 1M10A 4QEKA 2EAUA 3UAXA 2QIPA 3MUOA 1TK9A 2WNIA 3IUNA 2FLKA 2WIJA 4RJKA 5JLAA 1SEPA 4FHEA 1VXOA 4IV8A 1FX0A 1WKBA 5M3BA 1KEVA 5CLLA 1AX9A 4DXAA 5KTOA 5FR2A 2IOFK 5GY7A 5BQPA 5HUHA 4DA9A 3AVVA 4L78A 4I14A 1MABA 2EX0A 2IHNA 1AN9A 1HT3A 3KJHA 3MINA 4JITA 4UNQA 2A84A 1YBMA 2FR0A 2VDPB 5B3KA 1TYCA 4F72A 2H7CA 2VZEA 3NC1C 4CMJA 2XZLA 1N6NA 2HPZA 5E7QA 1U3CA 4GMFA 3OFJA 3H8JA 1VPLA 1GDHA 5CDTA 2C07A 2G63A 3PYXA 3V4VB 4LGCA 2IL1A 2VYVD 5FI1B 1CJUC 3PICA 2D0PB 2WTMA 1JG6A 3B85A 4G0ZA 2ZBGA 3O3OB 2B98A 4LS3A 2EWVA 3DAHA 1E3QA 1H2XA 2NADA 3W6NA 3UY4A 1Z6ZA 2QJOA 2A88A 4I7EA 2NUAB 3O4FA 3R7BA 4EJSC 1EFCA 3P0FA 1MG5A 2R96A 4MR8B 3S27A 4BZXA 5BYAA 1VSVA 4R9SA 1B43A 3AM1A 2H08A 3SEFA 5A5VA 1VBFA 1OOEA 1Z56C 3FLAA 5HUJA 5L51A 3D8NA 1PEAA 5EY5B 1NVAA 3OEHA 1Q95A 1SK9A 2O6LA 3LZDA 2NWQA 1P9WA 2ZSUA 5TV2A 5H9VA 1Y5NA 1EUCB 1K86A 2QAGA 4B32A 3FDZA 3GL9A 1RIIA 3OCVA 3R6DA 5D5HA 2R11A 3X1DA 3UK7A 1DOHA 4GLOA 4PEVA 3K9CA 4NI5A 2BBSA 2SECE 3CCFA 2VSFA 1E6CA 1WVGA 3DFZA 1PCXA 3DR5A 3EDRA 1OQAA 2O0LA 3AETB 1Y3FE 2YN2A 2D3WA 2B69A 2ZE5A 1VHLA 4PYQA 5CLIA 1L5QA 1U99A 4O2RA 1DBPA 1E2EA 3C6ZA 1RKXA 2FOXA 3BG5A 4HVLA 5AW9A 5FL7D 1GPWB 3QVSA 5IUNC 4RC9A 2W37A 3FFWA 4C0HA 5K0FA 1M1UA 3GDWA 1BE0A 1UJ5A 5IS2A 5H68A 3SGLA 2QLLA 3Q6MA 2HN9A 4DRZA 3SYNA 1P5HA 2K7ZA 1XA4A 3O1HB 2F9FA 4BMXA 1WLSA 4Q1DA 4F5YA 1O95D 1KOLA 4WFJA 2GAOA 2QJRA 3PG5A 4PIPA 3F8WA 3W5AA 4KK3A 4R6WA 3PA6A 1H85A 1OKKA 1GTVA 1E20A 2EERA 4NOJA 5J2UB 2O3QA 5IJ9A 3DBHB 3HG7A 3I39X 3KSMA 1UKAA 3I72A 2H65A 3VYWA 3L4EA 2Z1MA 4CM5A 1XCBA 4I5FA 2JI9A 3OFNA 4P92A 1I13A 2B25A 4J4HA 3FYSA 3TPFA 4V0SA 3OQHA 4GI2A 2I3DA 5JIBA 1PQ4A 3M83A 1TFUA 2EDCA 3ESRA 1CP3A 3ZHQA 3Q9SA 5M34A 3LXUX 4JB8A 2XD9A 1FP4A 4MWOA 1VFPA 2IHJA 5EKSA 3OWXA 4LF9B 3L0PA 5DI3B 3E81A 4D4HA 3B6EA 5BN1A 3CUWA 1S01A 2V54A 2XLCA 3TD9A 3TDMA 3C74A 3IIJA 5CG2A 1MEJA 3G6WA 3D8RA 3NC4A 3T3NA 3FKSD 2I4MA 2YQZA 2P27A 5JY1A 1NNEA 3ZU3A 3LXRA 3P0EA 1ZIYA 4Z0TA 3UUGA 1KEKA 3DFIA 3BD7A 3L7CA 3COWA 3EZLA 2HGZA 3GRAA 1UMDA 2YJ5A 4IEFB 1POXA 4F4FA 3NOXA 1O5TA 2FEAA 3JWHA 2OT3B 4WQMA 3GLGE 4JJ6A 1THTA 5EJ9A 3AY0A 1RZ3A 2O3UA 5DIZA 3R44A 4EKGA 3CSUA 1T0IA 3P20A 3ASZA 3H8SA 4GSYA 1N5JA 1PUIA 4P83A 4II3A 5AVOA 4LOJA 3K1AB 1J06A 3LX8A 4RDHA 1KQNA 3GZNA 3UXEA 4JLWA 5G53C 4CMAA 3S8YA 4YP7A 1MIHA 3FTCA 1N9KA 2D2IA 3Q7RA 4GI1A 3AERA 4N3NA 2G5CA 4DLAA 4MKIA 1PR6A 2BBOA 1UPTA 3Q5DA 2A14A 4Q3LA 1QVRA 2F3PA 1G38A 2CUTA 1NSFA 1PK9A 1VP9A 5AW5A 1JQKA 2NUTB 1EM6A 2O2IA 4IMIB 1WB5A 4Y2RA 2DXIA 1G5IA 2XCTB 2MSDB 5H0IA 1L5WA 1ZI6A 1S3GA 1S9DA 1XCOA 1EYZA 1N2BA 5JQGA 2JIPA 1Z7YA 1NP6A 2AN4A 3AF2A 4HQKA 1NWHA 4DSZA 5DOVA 2AC2A 5B4TA 2CJWA 4IVRA 5D01A 1E89A 3I2JA 4XWWA 4J2OA 3THWA 3WC4A 2JKZA 3RC2A 2CLCX 3K0BA 1K8ZB 1LPSA 1JU3A 4G84A 2FQXA 4ILEA 1EFVB 3PYLA 2OCKA 1U6JA 1VJGA 2WUGA 3JD2A 3BCSA 3AUSA 4LWOA 4S35A 4E0BA 2IOFA 1RCUA 2DEUA 3G2LA 5IT0A 2HJRA 4JROA 2Q0XA 2J6BA 3FUUA 3QLVA 4RO0A 4N7MA 2I2DA 3MJHA 1M2VA 2C8KA 5LP6B 4PV7A 3AIOA 4JIGA 1AZSC 1MV5A 1ZC3A 1TGVA 2W2OA 1NKSA 2X5OA 3KVYA 3VBEA 4F86A 2RH9B 2TMDA 3T12A 3FSRA 5IH7A 1Q74A 2NZVG 4IDAA 4EUHA 1EFUA 3JRWA 5CT8A 1JN0A 1ORTA 3HP1A 2XF2A 1NSYA 1V8BA 2AG0A 1Y9EA 1A7KA 2XECA 4EYOA 3WZ2A 4DG5A 4MYUA 1BFKA 1P2FA 4PQYA 4DABA 1ENYA 4GXQA 4YJFA 1VECA 3U3DA 1OTXA 1SKBA 4G8JA 4U63A 3KAQA 2DFNA 2NO5A 4OHOA 2ASVA 4BVJA 4DUGA 3WTCA 1FX0B 2YUTA 2Z98A 3I01M 3L7KA 4LYAA 1FXSA 1WOYA 1Z2PX 1E2KA 1UFRA 5SV2A 1YXMA 1R6BX 2ZU6A 3LPCA 4H31A 3ZUGA 4AJNA 4AUNA 4UUNA 3UMMA 1NVGA 3FKQA 1U6KA 2HJ9A 5ECDA 5HKLA 4JGGA 1SQGA 4W1PA 4BDSA 1U9ZA 5E6RA 1CY4A 2W6JD 2QT9A 4LRTB 1C9DB 2F9LA 2JGLA 121PA 1DCMA 1FS6A 1NYRA 4AZ0B 4M1OA 2BUCA 5IVKA 5JMPA 2ZVJA 3U9SA 1CCWA 3T54A 1S89A 2XH8A 4CIVA 2ALJA 2HB6A 5CU7A 1N75A 1Z0JA 1ZCZA 8ADHA 1DAMA 3ICWA 9ABPA 3P0RA 4NOLA 1K8RA 1RHQA 4ONEA 5B1IA 1HL7A 4Z4FA 4K6CA 4QUHA 2EKDA 3N0VA 3OFSA 1X2EA 1R4ZA 1FSGA 4WNYA 1OXSC 1RACA 4EOGA 3QVVA 2QTLA 1GNTA 2TRSB 3KKLA 4M53A 1PR4A 1H0HA 2PBLA 1YI0A 2Z30A 5EP1A 2F1OA 1U7HA 1YB7A 3L46A 3NYWA 3W78A 3QVWA 3WJ1A 4B85A 1KPGA 3KOMA 4GQIA 1ICEA 2A9FA 3QUAA 3FJOA 4ER0A 4DWVA 5HYVA 2EZTA 4B6PA 1W49A 3SZOA 2QAGB 1I0IA 3K05A 2NV0A 2UVQA 3B7GA 3PQ2A 4FINA 1NPYA 3GHHA 4ER3A 2ID4A 1OI2A 4ZOCA 4DBZA 2BV3A 3RG2A 4FMCB 2O0KA 1WF3A 3K0FB 2QE7D 1P19A 2P7HA 1YD7A 3S1AB 2QOEA 4E5MA 3ZCVA 3WWPA 1DEKA 3THXA 3O8LA 2WD9A 3DLCA 4HS4A 4ZRNA 1ENZA 1BOFA 5K05A 5LR6A 2R44A 4RESA 4REOA 1OLOA 1I2AA 1OWNA 4X1IB 5CX4A 3DF9A 1HWYA 3HBFA 1T3ZA 3H9UA 4DFDA 3QWIA 4K6GA 1ZMRA 2ZTLA 1YBAA 5THXA 3SIWA 1II8A 2AW5A 3RS4A 1CX9B 1KOFA 4AZWA 4YRRA 1I7SB 3IR5A 4G0XA 3K9QO 3WLSA 1KK3A 2J67A 4BX2A 3KQSA 5IN4A 2O7VA 3MJRA 2QPTA 3U16A 1BXKA 3G59A 1NXSA 2OOKA 4U7WA 2I8LA 3L4BC 1O8BA 4IGKA 3UZUA 5ARBA 4L0DA 4Q48A 3PQFA 1XTIA 3OC6A 4FI3F 2P2ZA 3QWHA 3WMXA 3WQBA 5BQ3A 5LZ4A 1ECBA 3PL1A 5DTJA 5CDHA 2ZXFA 1XE3A 1EAYA 4S0XA 3QFTA 4Q0MA 1LJ8A 4NH4A 2WZQA 4UZEA 4IIGA 1CUBA 3R0JA 1P7YA 4NMMA 1PL6A 1T25A 4QOEA 5CNMA 2NU9B 3TTWA 2WDZA 5YASA 3WA6A 1E1CB 1T26A 4EY7A 2A67A 1JB9A 2OXEA 2ZUFA 4O4JF 3COZA 4RTPA 2OB1A 1VIVA 3MS4A 1Q0UA 1Q50A 2WSLA 5EZQA 4ERXA 1D7OA 4PY2A 4M0EA 2F7SA 2AOTA 2BTEA 2OK7A 3AG5A 3U81A 2FW8A 2R1ZA 3EDYA 1G9SA 1BEEA 1S02A 1UM9B 2CL7X 2O23A 3AZQA 4G9BA 4NMHA 3JQAA 4P08A