2VUBA

Ccdb, a topoisomerase poison from e. coli
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
101
structure length
101
Chain Sequence
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CCDB
publication title Crystal structure of CcdB, a topoisomerase poison from E. coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Ccdb
total genus 27
structure length 101
sequence length 101
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 1998-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01845 CcdB CcdB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.110 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vubA00
4MDXA 4ELYC 1VUBA 4VUBA 5HKCA 3G7ZA 4MZTA 5DLOA 2MF2A 5CKFA 5CKHA 4ELZC 4ME7A 5HK0A 2C06A 5CQYA 1UB4A 4MZMA 5CKEA 5CQXA 5CCAA 5CKBA 1NE8A 4HKEA 3TCJA 1X75C 4MZPA 5CO7A 2KMTA 3HPWA 3VUBA 5CK9A 3JSCA 3JRZA 5CR2A 2VUBA 5HK3A 1M1FA 3NFCA 4OF1A 5CKDA
chains in the Genus database with same CATH superfamily
4LXCA 3EG9B 1M3AA 3QG1A 1Z9QA 2FG0A 2QQ9A 5C6SA 2MIOA 2PVOB 2ENMA 4M7DG 2GQIA 3JB9G 2QGGA 3MP6A 2QQSA 2ED1A 1QCFA 3H8ZA 4A4EA 2RF0A 4XTWA 3TCJA 1ZSZB 4JJBA 2MCNA 4LUEA 3GP8A 3JCMW 2RQRA 1PNJA 3GIBA 3HSBA 1VQ9Q 1I07A 1WHGA 3VYHB 3E9GA 3EFSA 3UPUA 2DJQA 4B6MA 4PJOE 1RAHB 3X24B 1VQ5T 5IN1A 5GMKh 2P0PA 1DJ7B 1G5VA 2I0NA 3CCUT 2K5IA 4M75C 3PGGA 2DYIA 2H3EB 3I56Q 1ARKA 1X6BA 1CSKA 3OS1A 3NTHA 3OW2S 3M4YA 4F17A 3BDUA 3CCLT 2OJ2A 1YIJQ 2ECZA 1N9SA 2AKLA 1YCSB 4M7AB 4FYWB 2JUFA 2XDDA 1GFCA 2LQKA 2CP0A 5GJWB 1MNEA 2XICA 4IUVA 3ZBDA 2XU8A 1WQ7A 1UGQB 3OYLA 3EFOA 3S3OA 4EMHA 1BK2A 4JJDA 5AYFA 4F16A 1WXUA 4QVZA 3VS3A 1OU8A 3CBMA 3OSSC 3VS0A 1U3OA 4OGCA 2DL5A 1QVFP 1MHNA 3CPFA 4P5NA 2BTTA 1MUZA 3EGDA 2A37A 3QXEB 5DM7R 1AWXA 3G7ZA 2DL4A 2GFAA 4M78E 2QK0A 4O5VA 2F5KA 2RMOA 5A0LA 1QKXA 3HHTB 5GAOm 1BIAA 2M16A 5LJ5f 5FROA 5CR2A 3HP9A 4PJOG 4J9IA 4JRIA 1SRMA 3OBYA 2QGFB 1QVGP 3VS5A 5A0DA 1QWEA 1NEBA 4M7AF 3A8HB 2PUOB 4X34A 3CC2A 2XG8D 4F04B 1NJIC 3OYIA 1D0YA 4X9DA 3VS4A 1PM3A 2NUTA 3KFVA 3ZFJA 1K0XA 1JRIA 2MMPA 1WXBA 4ZGDB 1KFZA 2HQXA 1N27A 1IXDA 2CREA 1N8RR 1IHVA 3CXCP 2D8JA 3FJPA 2YUPA 1VIFA 3VV0A 5IAYA 1Q86C 2M0OA 1AHJB 4PFOA 1V76A 2E5QA 3CPWS 3RIRA 1WJRA 3X28B 2LVMA 2ZPIB 4RTTA 4LDWA 3TEEA 2FPFA 3DB3A 3OYNA 4QQDA 4BDZA 1K0SA 4HXJA 1OPLA 1Q82U 4RTYA 4X1VA 4EIKA 1WFWA 1M2OA 1RAIB 2QYZA 1K76A 1PG5B 2RQVA 3RMSA 1TG0A 1VQMA 1I5OB 1QCOA 1Q82C 1EZZB 1X2QA 2VC8A 5D6WA 1E6GA 5GAOl 1K8AU 1LNXA 1BI0A 1VQMQ 2DYBA 4OMQA 6AT1B 1YHQQ 1VQ7T 4M7AD 5LJ5j 3OYDA 4PJLA 3CMEA 1WZOA 2OTLT 3I55T 2QEXQ 1C1AA 2XMFA 2R5MA 2CT3A 3NTIA 3THKA 4OMFB 2MF2A 1AD5A 2EGEA 2KXCA 3CMEQ 4M7DB 1S72T 2AK5A 4OB2B 1AT1B 1JB0E 4J5YA 1WHHA 4PNOA 2COYA 2YUOA 4HKEA 1S1NA 3BDLA 3CCQT 2RQUA 1K73R 1CKBA 2CGHA 2EW3A 2DEQA 5KH6A 4OF1A 1OV3A 2EYXA 3PVQA 1QVFS 2YXYA 3OYMA 1RLQC 2QTXA 4A4FA 3CC7T 2K2VA 2LCCA 1X2KA 3M4GA 3CCVA 3CC4T 2HAXA 3PMIA 1YWOA 2LP5A 1YJWT 2QG9B 4J9HA 2QDYB 4M4ZA 2A3LA 1FMWA 1G3SA 1TUGB 5KYXB 4DBQA 1ZBXA 3M59A 1BI3A 3OYGA 4M7DF 1ZSZC 1QVGS 2JTMA 4LDUA 2F2XA 2NYSA 3GLXA 1LVKA 2FYKA 2JOYA 1D3BB 1OZ3A 2C0IA 3ZL7C 1MMNA 2H8HA 1Y0MA 1TUDA 4J9BA 5FU7B 2EQIA 3BW1A 1VOMA 3QIIA 4HVUA 1YN8A 2JT4A 1D09B 4JRKA 4E7IA 3EG2A 4M77B 3CXCS 1VQOA 1YBYA 3UATA 2JS2A 1B34B 1V1CA 5FLXE 5M9OA 4HVWA 2M9UA 2XIDA 2W10A 4E7JA 3V8KA 3H0IA 4F7UB 1T3SA 2DIQA 2F2VA 1O9SA 2A0FB 2X3XD 4NS5A 4JPBW 2CP7A 1AWWA 2EYWA 2DXCA 3G6EA 4M7AE 1RL2A 5HY6A 5IXFA 2DPPB 4GLKA 4M75B 4RCCA 3G6EQ 3CMAT 5HKCA 2XHCA 1R0BG 2O4XB 1YI2A 2RK1A 4QKUA 3WVEB 3OMGA 4ELZC 2YWWA 1VQNA 3PMTA 3NHNA 2RQWA 1IGUA 1QVGA 3UA7A 3LLRA 4FYXB 3LX7A 3AHUA 2FRWA 3S3NA 1X27A 3CEYA 4M7DD 4M77F 4LNPA 1M1FA 5HCKA 1C6VX 1KK7A 1VQNQ 1GRIA 5FWCA 4J9FA 1M9SA 4J7IA 2FO0A 3I5SA 5GMKl 4UC4A 4AFQC 5GAOn 4F7UF 3QBYA 2J6KA 3LH5A 3RMQA 2CZ7B 4IIOA 2DTHA 3CXCA 1Q81U 4C92E 1K1ZA 2DL7A 3HRTA 3SDZA 4NL2A 2MWPA 3META 4M75F 4FCYA 1YP5A 4JS5A 1M4ZA 3UF4A 4M7AG 1YNZA 2K9GA 1WJQA 3UA6A 2V8KA 1LOJA 3SWNA 1D1CA 1UGPB 3KXTA 4MZPA 3REAB 5KCHA 2JS0A 2EGAA 3CCEQ 4BB7A 5GAMf 1N5ZA 3O8VA 3CCRA 2BE7D 2LMJA 3EFOB 2EVRA 1XTDA 3CD6A 1O75A 4XAXB 2KNBB 1NG2A 1RLPC 3FLGA 4XU1A 3CCRQ 3SB2A 4XTUA 1JQQA 3FJ5A 3OS0A 2KMTA 4ZN3A 1VQKT 1GBQA 4RUGA 4FYVB 3EFRA 2L3PA 1VQLA 4IUQA 1VQ6A 3CD6Q 1VQ8Q 1OULA 4FU6A 2PVGB 4M77D 4ANJA 1NYGA 2BZYA 2EBPA 5LJ3g 4C0ZA 1BKBA 4FYYB 1YJ9A 1VQLQ 5GANh 3HRSA 2COWA 1XQHA 4C0FA 4PJMA 5I2SA 2LJ3A 2V8JA 1UE9A 3NPFA 1JJ2P 4OB0B 4C0DB 3RKXA 1EFNA 2L8DA 4EMGA 4II1A 1TH7A 1UUEA 2JM8A 3M0RA 2JMCA 2Y4YA 2KXDA 2LJ0A 4M75D 2DM1A 1EIFA 2D9TA 4ESRA 1WJSA 2LNVA 1IRXA 2MPXC 4M7DE 3PVLA 1SHGA 2VB6A 4KH0B 3JSCA 2RI2A 2ESWA 4BY6B 1WNLA 2KROA 1VYUA 3L2QA 2EYYA 1AWOA 4AFZC 2Y90A 4RTWA 4JRPA 4ZTFA 4IUTA 5GMKe 2DVEA 1U5SA 2HSEB 2RHUA 3CC2T 3M0PA 2EYZA 4ZGJB 5GAMj 1QLYA 4KBMB 2R58A 2X4JA 4C8QB 3EHRA 2F5TX 1VQPA 1FWZA 3LWIA 2G6FX 3I9QA 2DTIA 3CBOA 1UHCA 2FPEA 2NUZA 4FW2A 1OZ2A 4PJOA 5IH2A 1ACMB 1VQPQ 2BE9B 2QXFA 1TS9A 2J05A 4KRTA 2X4YA 1NEGA 3I5RA 4OB3B 1KIKA 5LJ3d 3VU3C 2RJCA 5LL6S 4EMKC 1ZUKA 2FPDA 2AKKA 2JZ2A 1Q7YR 1Y7XA 4CI0C 5FU7C 3CCMA 2QA4A 4XTZA 2V1QA 4MZTA 2L2PA 3M9QA 3SHWA 2K3XA 3FB9A 4FT4A 5CKHA 4QVDA 4QVCA 1M1GA 5HK0A 1D1AA 4WF2A 4PJJA 4M77C 4DEXA 2HSPA 2K79A 5GAOq 1VQ9A 3LH0A 3CCMQ 2QA4Q 2LZ6B 3DKMA 1QP3A 4PL6A 3CCJQ 2OX7A 2KDSA 1TSFA 4C8QF 3G4ST 2FZKB 4DBRA 1KQ1A 2M1HA 4MDXA 1ABQA 1VQMT 2E65A 2DXTA 3LGLA 2HBPA 4C5GA 2L3RA 4GBQA 1OU9A 2OAWA 3SFMA 2XI9A 3I56A 3CBPA 5AT1B 4M78A 3REBB 4HT9A 1YIJA 3QJYA 3U23A 1H3ZA 1BCOA 2QQRA 2K6DA 1UHFA 3ASKA 2EYQA 1CKAA 3L2WA 1I4K1 2KT1A 3VJPA 2EFIA 2EGCA 4M75E 2RHIA 2YLCA 2EIFA 2ATCB 2XDBA 1UGVA 2V1RA 5LJ3e 1I81A 1T0JA 2KQWA 1JJ2S 2DJZA 2CS7A 4BI3A 2ZPGB 2XD0A 1E6HA 1V29B 1FXXA 1N8RC 2P4RA 3TSWA 3OYFA 4DOVA 1G2BA 4ZGEB 2WSFE 4OP0A 1ABOA 3HFOA 2OTJA 4QW2A 3V7RA 2ZPEB 3MP8A 1M8VA 3CCSQ 4M77G 2F69A 1YITQ 1RAGB 3CCVT 1BIBA 1WIEA 5HK3A 4V2SA 1B07A 2PQWA 2DO3A 3C4SA 2OTJQ 1NLPC 3HL8A 1NJIU 1VYVA 4C8QD 2E5KA 1U1SA 1Y96A 4CC2A 4F7UG 5GAN4 5KYUB 1J3TA 1K4US 3HKSA 3URGA 2K3BA 1ZA2B 5CQXA 1BI1A 4GY5A 3OYCA 1HJDA 3H9NA 1QWFA 4LDXA 4M75G 3OW2A 2HNIA 3HFNA 3LW5E 2ROLA 4BE0A 2DXUA 2KT8A 2AHJB 1KHIA 3J80E 1Q86U 2JVVA 3H6ZA 3H0FA 4JLGA 2QQBA 1MV0B 3L2RA 1VQOT 5LJ3h 4RG2A 2DEUA 2E1HA 2L3SA 4XU0A 3UDCA 1K73U 2MYSA 5IHKA 2RQTA 3S6WA 3E19A 2Y4XA 4CC3A 2LNHB 2P84A 4C0DC 1G3WA 4QQGA 1K73C 2V26A 2YRVA 3N5BB 2O31A 1ZSGA 3R6NA 3TVTA 2EQMA 2AZSA 2E3IA 1KQ2A 2LDMA 1YHQA 4R55A 3JCMg 1YI2T 2WACA 1VQNT 2P0QA 1YJNA 1RI0A 2QEXA 1SG5A 2RJDA 2LTOA 4J7FA 4BY6C 2E3HA 5FU6B 3TSZA 3S3MA 3NTKA 3IQLA 5GANg 1YJNQ 2EQUA 3SWNB 1OYXA 3OYBA 2K2MA 3P8BB 1QCNA 4KH1B 2RB6A 2DRKA 5DLOA 3NMZC 4N0AA 1VQ5A 2CZ6B 2MAMA 1IO6A 1WYXA 4ZN1A 2V8IA 1UGSB 3FC3A 4C8QC 3JB9J 5KYWA 3VRYA 5DLQE 1D0ZA 1GCQA 2R5AA 5CIUA 3M0QA 2E70A 2LX7A 1VQ5Q 1M2VB 3M53A 2FB7A 3CPWA 1M90C 2LQ8A 4DA4A 4EDUA 3EH2A 2FEIA 2DZCA 2ZZDA 3TQ7P 4DOWA 3RKYA 1PD0A 2EJFA 3FEOA 3CCLQ 3EHQA 3FDRA 3A98A 4XU3A 4RG8A 1OOTA 1WGSA 2IG0A 2SRCA 2XDPA 1K9AA 3CCRT 2KVQG 1JEGA 3JV3A 2X9HA 2CH4A 1MMAA 4VUBA 4GLMA 3OA6A 1I5LA 3QZ9B 4J8OA 4DQ2A 3JCMX 1D1BA 1K9MR 2CUBA 2HZYA 1ZBJA 1TWBA 4AFUC 5ECAA 1MMDA 2EAYA 4OMNA 1H3HA 3JCMd 4M7AA 3H41A 1RUWA 1VQ6T 3ME9A 2DBKA 3NFCA 2RO0A 1TU0B 2J6OA 5KYYA 3PNWC 2D1XA 4QQ6A 1ZX6A 1IZ6A 3AT1B 4EMKB 1XOVA 2XK0A 1G3TA 1YJ9T 1M90R 1RADB 4C5IA 5GANd 3UT1A 1UECA 4FSSA 4PKCC 1B3QA 2HD0A 2ROTA 3HPWA 3M57A 4C8QG 2K7AA 4RCBA 2A28A 2NUPB 5LJ5h 4TVRA 3QDRB 4XQ3A 1R77A 4J9GA 1OPKA 1PWTA 1QKWA 2QASA 4JZ4A 3KBGA 2VGNA 2PVDB 1QVFA 3M5AA 1W2BP 5I11A 5CO7A 2I2LA 3VUBA 4A4GA 4FSXA 1PRMC 3OQ5A 2DA9A 4C92A 2K57A 1N6AA 1KC8C 4D8KA 2A7YA 4Y91A 4MDWA 3CQTA 2YRDA 2QTVA 2CP2A 4LUDA 3BY7A 5CKEA 3JCMe 1BBZA 1NPRA 1X6GA 2RK2A 1KQSP 1TXQA 1VQPT 5CAIA 1SSHA 2YUQA 4BI4A 3PE0A 3PIOA 2FZGB 2KEAA 2PZ1A 2ZPHB 2KYMA 5GANe 1G8XA 3A8LB 3X20B 4LDYA 2VGMA 2BZXA 2Z0WA 2RHYA 4FT2A 4KGVB 3I55A 4E7SA 3OBWA 4M78B 2DETA 1NM7A 3EG1A 5I22A 3CCMT 2QA4T 2XKOC 1VQ7Q 3JCMc 3OYAA 3CCEA 1VQ4A 1KC8R 1S72A 1WXTA 2OTLQ 3I55Q 2BUDA 4XU2A 4A54A 1VQ9T 1JO8A 1RAFB 3CCQA 2YRCA 4JJNK 1VQ4Q 1S72Q 1M8MA 1MV3A 2MK5A 2DFUA 2PU9B 3MP1A 4KULA 2COZA 2LX9A 3CCQQ 3LYIA 5IHNA 3I56T 1SPKA 4HVVA 4J6YA 3WVDB 1I1JA 1Q95G 1QQJA 4BACA 3L2VA 2VXEA 1VQ8A 3R6OA 1YIJT 3E1SA 3EGDB 2DXBA 3JCMh 3GBQA 4A53A 4M7DA 1OX8A 3MCAB 4M78F 5KE2A 3VRZA 4CRIA 1AWJA 2BKDN 3GNFB 2PTKA 4BDYA 3CC7Q 2CZ1B 3V8LA 4OGEA 1C0MA 4IUPA 4FIBA 4HCBA 1YJWQ 2NWMA 2VKNA 1FMKA 1XNIA 2C0TA 1Y71A 4MZMA 5FU6C 1KD1R 5FRNA 5CCAA 2ZPFB 1X75C 3SWNC 3VS6A 2DMOA 4RMOA 2CUDA 4KGXB 2DAQA 1AOJA 2M51A 2ZPBB 2GCXA 5GAN2 3JCMP 2NUTB 2DIGA 2KSSA 4WCIA 2OTJT 3ER0A 2J7IA 5CKBA 4OMOA 1Q7YC 3GNGA 1A0NB 4F14A 4A63B 4HCCA 2X4XA 1W2BS 3QZ5B 3M56A 3QO3A 1MMGA 5GMKj 1MGQA 2DRMA 2RI3A 4JUVA 2X4WA 3HRUA 1UEBA 1E7OA 2CP5A 4AMCA 4L59A 1WDXA 5LJ3f 3SEMA 2KR3A 1D3BA 2BIVA 1HD3A 2L5QA 1PHTA 3QUIA 3DLMA 1H8KA 1WA7A 5GAN3 5KE3A 2YUNA 2RH2A 5GAN8 1P92A 3QPHA 2HCKA 3OMCA 4M77A 1KQSS 3M0UA 3DB4A 1LCKA 2LCLA 3M54A 4M78D 1ZA1B 2VVKA 1B34A 1UG1A 5GAN5 4OVAA 1PKTA 3JAME 1M1KR 3LGFA 3J7AF 1WPYA 1F1BB 1WI7A 3M58A 3TU4K 4E7HA 4R0KA 2LC4A 3D7SB 1W4SA 3CCJA 4Y92A 4N4IA 2RD1A 3C0CA 2LT1A 2SEMA 2WSCE 2QAZA 2PNIA 4M75A 5L8RE 4JLIA 2DL8A 2VXFA 2O4XA 1M5Q1 3RNJA 1AEYA 2VUBA 1W2BA 4JRQA 4AG2C 5KYWB 1YHQT 4M77E 1B7TA 1VIEA 2AZVA 2CSIA 2HL3A 5EC7A 4AT1B 4HT8A 2JN0A 2R57A 3MPUB 2VYTA 1YJNT 2QEXT 4J9CA 2GGRA 4N4GA 1H641 1W6XA 1R0CB 4PJOC 2KK4A 2DF6A 3E9FA 3GF5A 1IREB 2L3QA 4F7UE 3PTAA 3E2UA 5J26A 3CMET 2FL7A 1WX6A 4B9XA 5CKDA 3EH1A 1WLPB 2HEQA 3EG0A 4XTYA 1W1FA 1PSEA 1NYFA 4IUUA 2W0ZA 1KQSA 4PLLA 3OYHA 3M55A 2J06A 3GPLA 2M02A 2ZCFB 2JM9A 3MHXA 5LJ5g 4L6V5 1TTHB 3PFSA 5LJ3j 2DX1A 1N8RU 4C0GA 3VUZA 1VQKA 2RJFA 2EQJA 4IIMA 4PFZA 1QP2A 4LDVA 5GAMh 2KAFA 5EG2A 2RI5A 2X3WD 3CCSA 2DILA 2O88A 1VQKQ 3G71A 1YITA 3C94A 2EJGA 5IHIA 1U06A 2LRQA 4WTOB 5GAOr 2YT6A 2EKOA 1WHLA 5KYYB 1U1TA 2DD5A 2RN8A 9ATCB 2EPDA 5D6XA 4M78C 3G71Q 3RESA 4E2FB 1GCPA 3OS2A 3FRNA 3V8JA 1W70A 4J6XA 1TUCA 2MOXA 2E64A 4D8DA 2O2OA 1PCXA 4A4KA 3QSUA 2LJ1A 2DERA 4XTVA 3VS1A 2DL3A 1AZEA 3JCMV 5KYNA 2JXBA 1Z9ZA 2RHZA 4JJCA 3RDVA 1BI2A 3RERA 4BD3A 3QDFA 4NL3A 4J9DA 4JDSA 2CH4W 4BI8B 1KSWA 4C92B 2YHTA 3Q1JA 4NOYA 3GOXA 2X35A 1BYMA 2HL5C 4BUGA 1N9RA 4E7ZA 4HCKA 1WHJA 4PJNA 3CC2Q 1JJ2A 4C5HA 5LJ5d 4L5GA 2GFUA 2H3JA 5GAN6 3JCMb 5GAN7 4Y28E 1BCMA 3OSVA 2GBQA 3PIPA 1X01A 4BE1A 3G6ET 3VS2A 3INZA 3M0TA 4KT0E 4M78G 1OI1A 1UGRB 1GBRA 3OS5A 4A4HA 1EX4A 3OYJA 3I35A 2M0YA 5DY9A 2K5LA 4MMLA 3JCMQ 4C8QA 1SF9A 4ME7A 1OEBA 5CQYA 2O01E 4C92F 2OAUA 2L0AA 1VA7A 1K9MU 3EGXA 2RNAA 3OY9A 4PFPA 1X6OA 2CDTA 3G4SA 2HMAA 2RM4A 1NJIR 2LCSA 3A5ZB 1K9MC 2KI7A 1HK9A 3JB9H 4KUDK 2A36A 2DZ9A 4IKFA 2EQKA 3G4SQ 2CT4A 4X9CA 2IVWA 1M90U 3CCUA 2JW4A 2E4HA 1SKUB 3EG9A 4ZTJA 2GTJA 1PC0A 2E10A 2KYBA 5FWBA 2C0OA 1GXIE 2F1LA 2QQAA 1M30A 2D0NA 1K8AC 3C12A 1D0XA 5LJ5e 1Q86R 4ZNXA 4N4HA 3CCUQ 2HKNA 3CCLA 3JB9I 1ZSZA 3CCET 4J83A 4RTUA 4C8QE 1VQ4T 2DTOA 1IGQA 4Z8AA 3OYKA 3MJXA 3JCMf 1IHWA 1KHCA 3UWNA 1YCYA 2AT1B 1HSQA 1FYNA 3VKIA 4LN2A 5GANf 3QYGB 5FW9A 2AIRB 2CKKA 3CD6T 4KGZB 3RUXA 1VQ8T 1Q82R 4N0AC 1LPLA 2CP6A 1NE8A 1QW1A 4C92D 4CC4B 1UFFA 1RACB 5D6YA 4OMPA 1VQLT 1GCQC 2RJEA 4ELYC 2KBTA 1UDLA 1FX7A 4AG1C 3MEVA 3CCVQ 3MEWA 1K8AR 1NLOC 5GAOp 2EKHA 5GMKm 4ATOA 3JB9F 2RHXA 2D0QB 3WXMB 3A8GB 3EG3A 4D6WA 4AFSC 2E6NA 4FL6A 1PSFA 1HXDA 1PRLC 3X26B 4FW1A 1HYOA 3NGPA 5L23A 2JMAA 1ZQ1A 5A2QE 3EAEA 3VYGA 1TOVA 2DD4A 4B9WA 2ABLA 2RPNA 3SD4A 2VASA 1Y07A 2K5FA 2A08A 1Y57A 4OB1B 2HKQB 1QMCA 2D8HA 3KUFA 1GFDA 1RAEB 2CZ0B 1KC8U 4RTVA 1RI9A 1ZUUA 1OX9A 5KYUA 4DBHA 5CK9A 2HQHA 1YWPA 5KCOA 3RR6A 4PJOB 3T9NA 2F2WA 4M7AC 1LJOA 3ZEHA 3L42A 1VQOQ 2FZCB 2KE9A 1UB4A 1T0HA 4Z89A 2JJ9A 2KY9A 3OB9A 2D6FA 3QYHB 3C95A 2E12A 2YSQA 2K3YA 3MEUA 3V7SA 3P8HA 1ZLMA 5GANj 1UJ0A 2RA2A 2VWFA 2IPOB 4CC7A 4FM4B 1ZUYA 2QI2A 4RTZA 1QVPA 5CVIA 3RKWA 3O5ZA 5GAMg 2WSEE 5GMKi 2CYZB 2DK3A 1VQ7A 1YI2Q 1KD1U 2FVUA 2ZAEA 3JB9D 2NLUA 2HBWA 4LE9A 7AT1B 2OTLA 4PJOF 1NZ9A 2FHDA 2X51A 1T3LA 4DEYA 4C92C 3CCJT 1KD1C 2DVJA 2JTEA 3BE3A 5CKFA 3ULRB 2KRNA 3H0HA 3DLLA 4MMKA 2ZGWA 4LD9K 1M3BA 2PUKB 3J81E 3MKDA 4IURA 2QDLA 8ATCB 2OI3A 2G3RA 2CP3A 2DLPA 1VUBA 4JZ3A 1I0CA 2HQEA 3FIFA 2P0KA 1Q81C 4LD6A 2DBMA 2BZ8A 2B86A 2ED0A 3EGUA 4HCZA 2GTOA 1U8RA 4K11A 4Q5WA 3CC7A 1WHMA 4EPCA 2EWNA 4E47A 5C0MA 1JXOA 3CC4A 2E6ZA 1YJWA 1JU5C 4E6RA 2YLBA 1WHKA 2L89A 2KGTA 1MNDA 3HTRA 4ORZA 4XTXA 2LQNA 3L2UA 4E7KA 3CC4Q 1M2VA 5D7UA 1PKSA 2YDLA 4PK4A 1SRLA 5J3BA 3OW2P 4DBFA 3A8MB 1GL5A 1R8OB 1Y96B 4J9EA 5J39A 3P8DA 3VS7A 5GAMd 3LWHA 3MEAA 3V7CA 2HDAA 3CCST 1M1KU 3OYEA 1SEMA 2IIMA 3G71T 1YITT 1NPPA 3L1AA 1Q7YU 2J6FA 4RKUE 4PJOD 4C92G 1VQ6Q 2EJ9A 2JTFA 2DKGA 2B8AA 1SSFA 1H92A 3A8OB 1Q81R 4Z88A 1KJWA 1VYTA 1SHFA 1M1KC 2MWOA 1X43A 1G3YA 4XK8E 5KYXA 1YJ9Q 3A1PA 3QWXX 4OMLA 1XJWB 3X25B 4RTXA 4M7DC 1PD1A 1UJYA 1BB9A 2JNGA 3L2ZA 4J6WA 4PLIA 2P4TA 1JXMA 2O9VA 4R56A 2DE0X 3JCMJ 1JBMA 5GJVB 3QJ6A 2GF7A 4QT7A 4EMKA 1FMVA 1G83A 1M3CA 1AVZC 1OQKA 1ZHIA 2K4YA 4YTLA 4BE2A 3QWYA 4OMMA 1I8FA 1UTIA 2VV5A 5IT9E 1RAAB 3CMAA 4KUIA 5FRMA 4HA8A 2KRMA 2CSQA 2KRSA 1WQWA 2NUPA 2FRYA 4E7LA 3M0SA 3OYYA 1BU1A 3QHSA 4JS4A 1YFNA 2LT4A 3CMAQ 4Z02A 1NBEB 4F7UA 3PT9A 2GNCA 5GAMe 1IB8A 3MO8A 3EGXB 1M27C 3RBBB 8AT1B 5I2MA 5A0GA 1X69A 3QKJA 2GQVA 2DNUA 2C06A 2O9SA 3G1JA 3CPWP 1AZGB 1KG1A 5I21A 4C5EA 3BFMA 2MI6A 3JRZA 3F70A 4O6JA 3TREA 2E41A 2LQWA 5IXBA 1RABB
chains in the Genus database with same CATH topology
4QQ6A 3CCRA 1IZ6A 4L5GA 3QG1A 2GFUA 2QQ9A 4EMKB 2H3JA 1XOVA 5GAN6 2XK0A 5C6SA 3JCMb 1G3TA 2PVOB 4M7DG 5GAN7 3JB9G 1YJ9T 3MP6A 1XTDA 4Y28E 2QQSA 3CD6A 4C5IA 1O75A 4XAXB 5GANd 3OSVA 3UT1A 3PIPA 3FLGA 4XU1A 1X01A 3H8ZA 4A4EA 4PKCC 4BE1A 3SB2A 4XTWA 4XTUA 3TCJA 3OS0A 3G6ET 2HD0A 2KMTA 3HPWA 3M57A 4ZN3A 1VQKT 3INZA 4C8QG 3EFRA 3GP8A 4KT0E 4RCBA 1VQLA 4M78G 4IUQA 1VQ6A 1OI1A 1UGRB 5LJ5h 3JCMW 4TVRA 3OS5A 4A4HA 3OYJA 3GIBA 3HSBA 4FU6A 1YITT 2PVGB 3QDRB 3VYHB 3E9GA 4M77D 4XQ3A 5DY9A 2K5LA 3EFSA 4MMLA 3JCMQ 1JJ2A 5LJ3g 4C0ZA 1BKBA 3UPUA 3KBGA 1YJ9A 4C8QA 4PJOE 3X24B 2VGNA 1VQ5T 2PVDB 4ME7A 5IN1A 1QVFA 5GMKh 5GANh 3HRSA 2P0PA 2O01E 5CQYA 1DJ7B 1XQHA 3M5AA 2OAUA 4C0FA 4C92F 1G5VA 3CCUT 5I2SA 2V8JA 1K9MU 4OB0B 5CO7A 4C0DB 2I2LA 2K5IA 3PGGA 4M75C 3VUBA 4A4GA 4FSXA 3OQ5A 3OY9A 3RKXA 1X6OA 3OS1A 3NTHA 3G4SA 3OW2S 2RM4A 4C92A 2L8DA 3M4YA 4EMGA 2K57A 1N6AA 1KC8C 3A5ZB 1K9MC 3BDUA 3CCLT 2A7YA 1YI2T 4II1A 1TH7A 1HK9A 3JB9H 4KUDK 2DZ9A 4Y91A 4IKFA 4MDWA 1N9SA 4M7AB 2Y4YA 2JUFA 2XDDA 2EQKA 4M75D 2LQKA 4X9CA 1EIFA 2IVWA 2D9TA 2XICA 4IUVA 3ZBDA 1M90U 2XU8A 3BY7A 5CKEA 3CCUA 1WJSA 4ZTJA 2LNVA 1WQ7A 1UGQB 2E10A 3OYLA 3JCMe 4EMHA 3S3OA 4M7DE 5AYFA 3JSCA 2RI2A 1NPRA 1GXIE 2QQAA 2RK2A 4QVZA 3CBMA 4BY6B 1K8AC 3C12A 3OSSC 5LJ5e 1VQPT 4OGCA 1WNLA 5CAIA 1MHNA 3CPFA 4N4HA 4P5NA 3L2QA 1Q7YU 3CCLA 4BI4A 3QXEB 5DM7R 3JB9I 3PIOA 3G7ZA 2Y90A 3CCET 4J83A 4C8QE 1VQ4T 2ZPHB 2DTOA 2GFAA 4JRPA 4ZTFA 4IUTA 4M78E 5GANe 5GMKe 2DVEA 4O5VA 2RHUA 3OYKA 3CC2T 2F5KA 5A0LA 3JCMf 3A8LB 3HHTB 3X20B 4LDYA 1KHCA 2VGMA 5GAOm 1BIAA 2M16A 3UWNA 2RHYA 4ZGJB 5LJ5f 5GAMj 4KBMB 5FROA 2R58A 2X4JA 5CR2A 3HP9A 4FT2A 4C8QB 3I55A 4PJOG 1YCYA 2F5TX 4JRIA 1VQPA 1FWZA 3OBWA 4M78B 3VKIA 3LWIA 3CCMT 2QA4T 3OBYA 2XKOC 2DTIA 3JCMc 3CBOA 5GANf 3OYAA 5A0DA 3CCEA 1VQ4A 3QYGB 4M7AF 1S72A 3A8HB 2CKKA 2PUOB 4X34A 1OZ2A 2BUDA 3CD6T 4PJOA 3RUXA 1VQ8T 3CC2A 2XG8D 4XU2A 4A54A 1VQ9T 4N0AC 2QXFA 1NE8A 1NJIC 3OYIA 2X4YA 3CCQA 4OB3B 4X9DA 1QW1A 5LJ3d 3VU3C 4JJNK 2RJCA 5LL6S 4C92D 4EMKC 5D6YA 1VQLT 2JZ2A 3ZFJA 1Y7XA 2PU9B 3MP1A 4CI0C 5FU7C 2RJEA 4KULA 4ELYC 3CCMA 2QA4A 1JRIA 2MMPA 1FX7A 4XTZA 2LX9A 3MEVA 4MZTA 3MEWA 4ZGDB 2HQXA 1N27A 3LYIA 3M9QA 2K3XA 3FB9A 5GMKm 5GAOp 3I56T 4ATOA 4FT4A 5CKHA 4QVDA 4QVCA 1M1GA 4J6YA 2RHXA 2D0QB 3FJPA 3WVDB 4WF2A 3WXMB 3A8GB 5HK0A 3L2VA 2VXEA 4BACA 4M77C 1VIFA 1VQ8A 4D6WA 5GAOq 1VQ9A 3R6OA 2E6NA 3LH0A 4FL6A 1PSFA 1HXDA 3VV0A 3DKMA 3X26B 3E1SA 5IAYA 1QP3A 1YIJT 4PL6A 1Q86C 2DXBA 2M0OA 1AHJB 1ZQ1A 3JCMh 2KDSA 5A2QE 3EAEA 4A53A 4M7DA 3VYGA 2E5QA 4C8QF 3CPWS 3G4ST 3RIRA 3MCAB 2DD4A 4B9WA 1WJRA 4M78F 3X28B 1KQ1A 2LVMA 2M1HA 2ZPIB 4CRIA 2BKDN 5KE2A 3GNFB 4BDYA 1VQMT 3SD4A 2E65A 2DXTA 3LGLA 2CZ1B 2HBPA 3V8LA 4C5GA 4OGEA 1Y07A 2K5FA 2L3RA 4LDWA 4OB1B 4IUPA 3SFMA 2XI9A 4FIBA 3I56A 4HCBA 3TEEA 3CBPA 3KUFA 1XNIA 4M78A 4MZMA 1Y71A 5FU6C 2CZ0B 3DB3A 1KC8U 5FRNA 5CCAA 3JB9F 4HT9A 2ZPFB 4QQDA 3OYNA 1X75C 4BDZA 1YIJA 3QJYA 1H3ZA 2QQRA 3SWNC 1Q82U 5CK9A 4RMOA 5KCOA 4PJOB 3T9NA 4M7AC 2DAQA 3ASKA 3G71T 3RMSA 2EYQA 1LJOA 3ZEHA 1VQMA 3L2WA 1I4K1 3L42A 1Q82C 2ZPBB 2GCXA 5GAN2 3VJPA 2EFIA 3JCMP 4M75E 2DIGA 2RHIA 2VC8A 2YLCA 5D6WA 2EIFA 2KSSA 1UB4A 5GAOl 3ER0A 1K8AU 2XDBA 2OTJT 1LNXA 1BI0A 5CKBA 1VQ7T 1Q7YC 3GNGA 4M7AD 5LJ3e 5LJ5j 1I81A 4HCCA 2X4XA 2KY9A 3OB9A 3OYDA 3CMEA 2KQWA 1W2BS 2D6FA 3QYHB 2DJZA 1JJ2S 2OTLT 3C95A 2CS7A 3QZ5B 3I55T 2E12A 2R5MA 4BI3A 2ZPGB 2K3YA 2XD0A 3M56A 1V29B 3NTIA 1FXXA 3MEUA 3P8HA 3QO3A 3V7SA 1N8RC 3OYFA 4DOVA 4OMFB 5GMKj 5GANj 2RA2A 4ZGEB 1MGQA 2WSFE 4FM4B 2RI3A 2MF2A 2QI2A 4JUVA 4OP0A 2X4WA 3HRUA 4M7DB 1QVPA 1S72T 4OB2B 1UEBA 5CVIA 3RKWA 3HFOA 4L59A 1JB0E 4J5YA 5GAMg 2OTJA 4PNOA 4QW2A 5LJ3f 2WSEE 1D3BA 2BIVA 3V7RA 2ZPEB 3MP8A 1M8VA 5GMKi 2CYZB 2DK3A 4HKEA 3BDLA 2L5QA 4M77G 1VQ7A 2F69A 3CCVT 3QUIA 2FVUA 1BIBA 3DLMA 3CCQT 3JB9D 2NLUA 1KD1U 5GAN3 2CGHA 5HK3A 4V2SA 2PQWA 2DEQA 2DO3A 5KH6A 2OTLA 4OF1A 3C4SA 5KE3A 4PJOF 2RH2A 1NZ9A 2FHDA 5GAN8 1P92A 3QPHA 3OMCA 4M77A 3HL8A 4C92C 3CCJT 1NJIU 1KD1C 4C8QD 3DB4A 1KQSS 4F7UG 1U1SA 1Y96A 5GAN4 2LCLA 5CKFA 1QVFS 3HKSA 3M54A 4M78D 3URGA 3DLLA 4MMKA 2ZGWA 3OYMA 1B34A 5CQXA 2QTXA 4LD9K 1BI1A 4A4FA 4GY5A 3OYCA 3CC7T 2K2VA 2LCCA 3M4GA 2PUKB 3CCVA 3J81E 3CC4T 4IURA 2HAXA 5GAN5 4OVAA 4LDXA 3PMIA 3JAME 4M75G 1YJWT 3LGFA 3OW2A 3J7AF 2HNIA 1WPYA 2G3RA 3HFNA 3LW5E 4BE0A 2QDYB 3M58A 1VUBA 2A3LA 2DXUA 4E7HA 3TU4K 1G3SA 2AHJB 2HQEA 3FIFA 2LC4A 2P0KA 1KHIA 1W4SA 3J80E 3CCJA 1Q86U 1Q81C 2JVVA 4LD6A 4N4IA 1ZBXA 3H6ZA 2RD1A 3M59A 1BI3A 3OYGA 4M7DF 2LT1A 4JLGA 2QQBA 2WSCE 4HCZA 4M75A 1QVGS 5L8RE 2JTMA 1U8RA 4JLIA 2VXFA 3L2RA 4Q5WA 4LDUA 3CC7A 4EPCA 2EWNA 1M5Q1 2O4XA 4E47A 5C0MA 1VQOT 5LJ3h 4RG2A 3CC4A 2VUBA 1W2BA 3GLXA 2E1HA 2E6ZA 2FYKA 1YJWA 2YLBA 4XU0A 2JOYA 2L89A 3UDCA 4JRQA 1K73U 1D3BB 1OZ3A 1YHQT 4M77E 1VIEA 3S6WA 3E19A 4XTXA 5FU7B 2Y4XA 5LJ5d 2JN0A 3L2UA 4E7KA 4HT8A 2R57A 3BW1A 2VYTA 1YJNT 3QIIA 2QEXT 4C0DC 1G3WA 4N4GA 4JRKA 4QQGA 1H641 5J3BA 4E7IA 1K73C 4PJOC 2KK4A 2YRVA 3E9FA 3N5BB 4M77B 3GF5A 1IREB 4F7UE 3A8MB 3PTAA 3CXCS 1VQOA 1R8OB 1Y96B 1YBYA 5J26A 3CMET 2FL7A 2EQMA 5J39A 3P8DA 5CKDA 4B9XA 5GAMd 4XTYA 3LWHA 1KQ2A 3MEAA 1B34B 3V7CA 1PSEA 2LDMA 5FLXE 3CCST 1YHQA 1M1KU 5M9OA 4IUUA 4R55A 3OYEA 1KQSA 2M9UA 2XIDA 1NPPA 3L1AA 4PLLA 3JCMg 3M55A 2WACA 3V8KA 3OYHA 3GPLA 4E7JA 4RKUE 2ZCFB 4F7UB 4PJOD 4C92G 1VQNT 2DIQA 2P0QA 2EJ9A 2JTFA 3MHXA 1RI0A 1O9SA 5LJ5g 2QEXA 1YJNA 4NS5A 3PFSA 4L6V5 2DKGA 2RJDA 2B8AA 1SSFA 5LJ3j 2LTOA 3A8OB 2DXCA 4J7FA 3G6EA 1N8RU 1M1KC 1RL2A 5HY6A 3VUZA 4BY6C 4C0GA 4M7AE 1VQKA 2MWOA 2RJFA 1G3YA 2EQJA 4XK8E 5FU6B 4MDXA 3S3MA 2DPPB 1QP2A 3NTKA 5GANg 4LDVA 2EQUA 3SWNB 5GAMh 1OYXA 4GLKA 4M75B 3X25B 3OYBA 2KAFA 4M7DC 5EG2A 3P8BB 4RCCA 2RI5A 3CMAT 3CCSA 2JNGA 3L2ZA 5HKCA 2XHCA 2RB6A 2O4XB 4J6WA 3G71A 2RK1A 1YI2A 3WVEB 3C94A 5DLOA 2EJGA 4N0AA 1YITA 1VQ5A 2CZ6B 2LRQA 2MAMA 3OMGA 2P4TA 4PLIA 4ELZC 4ZN1A 3PMTA 4R56A 5GAOr 1VQNA 3JCMJ 1JBMA 2EKOA 2V8IA 1QVGA 1U1TA 2DD5A 3QJ6A 1UGSB 2GF7A 3FC3A 4EMKA 3LLRA 4C8QC 3JB9J 5D6XA 3LX7A 5DLQE 3S3NA 3AHUA 2R5AA 3CEYA 4M78C 4M7DD 4M77F 5CIUA 3RESA 2E70A 1ZHIA 2K4YA 4YTLA 4BE2A 3M53A 1M1FA 2FB7A 3CPWA 1M90C 1I8FA 2LQ8A 2VV5A 4DA4A 4EDUA 3OS2A 5IT9E 1M9SA 3FRNA 4J7IA 4KUIA 3V8JA 3CMAA 4HA8A 5FRMA 5GMKl 4UC4A 4J6XA 5GAOn 2DZCA 4F7UF 1WQWA 2ZZDA 3QBYA 4E7LA 2E64A 3OYYA 3RKYA 4DOWA 2EJFA 3FEOA 3QHSA 4A4KA 3RMQA 4JS4A 2CZ7B 3QSUA 2LT4A 4XTVA 4Z02A 2DTHA 3FDRA 3CXCA 1Q81U 4XU3A 3JCMV 4C92E 4F7UA 4RG8A 1WGSA 2IG0A 2XDPA 3HRTA 3PT9A 3SDZA 4NL2A 5GAMe 2MWPA 3CCRT 2KVQG 3META 3MO8A 4M75F 5I2MA 4VUBA 4JS5A 2RHZA 1M4ZA 5A0GA 3OA6A 1BI2A 1I5LA 3RERA 3QKJA 2GQVA 3QZ9B 4J8OA 4BD3A 4DQ2A 4M7AG 3JCMX 4NL3A 4JDSA 1WJQA 4BI8B 2V8KA 2C06A 4C92B 2YHTA 1LOJA 3SWNA 3Q1JA 2EAYA 1UGPB 4NOYA 3GOXA 3KXTA 2X35A 4MZPA 5KCHA 1BYMA 5I21A 4C5EA 4BUGA 1N9RA 1KG1A 3BFMA 4BB7A 3JCMd 4M7AA 5GAMf 2MI6A 3JRZA 3F70A 3O8VA 4O6JA 3TREA 1VQ6T 2E41A 3ME9A 3NFCA 2RO0A 4C5HA 3PNWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MDX A;  4ELY C;  1VUB A;  4VUB A;  5HKC A;  3G7Z A;  4MZT A;  5DLO A;  2MF2 A;  5CKF A;  5CKH A;  4ELZ C;  4ME7 A;  5HK0 A;  2C06 A;  5CQY A;  1UB4 A;  4MZM A;  5CKE A;  5CQX A;  5CCA A;  5CKB A;  1NE8 A;  4HKE A;  3TCJ A;  1X75 C;  4MZP A;  5CO7 A;  2KMT A;  3HPW A;  3VUB A;  5CK9 A;  3JSC A;  3JRZ A;  5CR2 A;  2VUB A;  5HK3 A;  1M1F A;  3NFC A;  4OF1 A;  5CKD A; 
#chains in the Genus database with same CATH topology
 4LXC A;  3EG9 B;  1M3A A;  3QG1 A;  1Z9Q A;  2FG0 A;  2QQ9 A;  5C6S A;  2MIO A;  2PVO B;  2ENM A;  4M7D G;  2GQI A;  3JB9 G;  2QGG A;  3MP6 A;  2QQS A;  2ED1 A;  1QCF A;  3H8Z A;  4A4E A;  2RF0 A;  4XTW A;  3TCJ A;  1ZSZ B;  4JJB A;  2MCN A;  4LUE A;  3GP8 A;  3JCM W;  2RQR A;  1PNJ A;  3GIB A;  3HSB A;  1VQ9 Q;  1I07 A;  1WHG A;  3VYH B;  3E9G A;  3EFS A;  3UPU A;  2DJQ A;  4B6M A;  4PJO E;  1RAH B;  3X24 B;  1VQ5 T;  5IN1 A;  5GMK h;  2P0P A;  1DJ7 B;  1G5V A;  2I0N A;  3CCU T;  2K5I A;  4M75 C;  3PGG A;  2DYI A;  2H3E B;  3I56 Q;  1ARK A;  1X6B A;  1CSK A;  3OS1 A;  3NTH A;  3OW2 S;  3M4Y A;  4F17 A;  3BDU A;  3CCL T;  2OJ2 A;  1YIJ Q;  2ECZ A;  1N9S A;  2AKL A;  1YCS B;  4M7A B;  4FYW B;  2JUF A;  2XDD A;  1GFC A;  2LQK A;  2CP0 A;  5GJW B;  1MNE A;  2XIC A;  4IUV A;  3ZBD A;  2XU8 A;  1WQ7 A;  1UGQ B;  3OYL A;  3EFO A;  3S3O A;  4EMH A;  1BK2 A;  4JJD A;  5AYF A;  4F16 A;  1WXU A;  4QVZ A;  3VS3 A;  1OU8 A;  3CBM A;  3OSS C;  3VS0 A;  1U3O A;  4OGC A;  2DL5 A;  1QVF P;  1MHN A;  3CPF A;  4P5N A;  2BTT A;  1MUZ A;  3EGD A;  2A37 A;  3QXE B;  5DM7 R;  1AWX A;  3G7Z A;  2DL4 A;  2GFA A;  4M78 E;  2QK0 A;  4O5V A;  2F5K A;  2RMO A;  5A0L A;  1QKX A;  3HHT B;  5GAO m;  1BIA A;  2M16 A;  5LJ5 f;  5FRO A;  5CR2 A;  3HP9 A;  4PJO G;  4J9I A;  4JRI A;  1SRM A;  3OBY A;  2QGF B;  1QVG P;  3VS5 A;  5A0D A;  1QWE A;  1NEB A;  4M7A F;  3A8H B;  2PUO B;  4X34 A;  3CC2 A;  2XG8 D;  4F04 B;  1NJI C;  3OYI A;  1D0Y A;  4X9D A;  3VS4 A;  1PM3 A;  2NUT A;  3KFV A;  3ZFJ A;  1K0X A;  1JRI A;  2MMP A;  1WXB A;  4ZGD B;  1KFZ A;  2HQX A;  1N27 A;  1IXD A;  2CRE A;  1N8R R;  1IHV A;  3CXC P;  2D8J A;  3FJP A;  2YUP A;  1VIF A;  3VV0 A;  5IAY A;  1Q86 C;  2M0O A;  1AHJ B;  4PFO A;  1V76 A;  2E5Q A;  3CPW S;  3RIR A;  1WJR A;  3X28 B;  2LVM A;  2ZPI B;  4RTT A;  4LDW A;  3TEE A;  2FPF A;  3DB3 A;  3OYN A;  4QQD A;  4BDZ A;  1K0S A;  4HXJ A;  1OPL A;  1Q82 U;  4RTY A;  4X1V A;  4EIK A;  1WFW A;  1M2O A;  1RAI B;  2QYZ A;  1K76 A;  1PG5 B;  2RQV A;  3RMS A;  1TG0 A;  1VQM A;  1I5O B;  1QCO A;  1Q82 C;  1EZZ B;  1X2Q A;  2VC8 A;  5D6W A;  1E6G A;  5GAO l;  1K8A U;  1LNX A;  1BI0 A;  1VQM Q;  2DYB A;  4OMQ A;  6AT1 B;  1YHQ Q;  1VQ7 T;  4M7A D;  5LJ5 j;  3OYD A;  4PJL A;  3CME A;  1WZO A;  2OTL T;  3I55 T;  2QEX Q;  1C1A A;  2XMF A;  2R5M A;  2CT3 A;  3NTI A;  3THK A;  4OMF B;  2MF2 A;  1AD5 A;  2EGE A;  2KXC A;  3CME Q;  4M7D B;  1S72 T;  2AK5 A;  4OB2 B;  1AT1 B;  1JB0 E;  4J5Y A;  1WHH A;  4PNO A;  2COY A;  2YUO A;  4HKE A;  1S1N A;  3BDL A;  3CCQ T;  2RQU A;  1K73 R;  1CKB A;  2CGH A;  2EW3 A;  2DEQ A;  5KH6 A;  4OF1 A;  1OV3 A;  2EYX A;  3PVQ A;  1QVF S;  2YXY A;  3OYM A;  1RLQ C;  2QTX A;  4A4F A;  3CC7 T;  2K2V A;  2LCC A;  1X2K A;  3M4G A;  3CCV A;  3CC4 T;  2HAX A;  3PMI A;  1YWO A;  2LP5 A;  1YJW T;  2QG9 B;  4J9H A;  2QDY B;  4M4Z A;  2A3L A;  1FMW A;  1G3S A;  1TUG B;  5KYX B;  4DBQ A;  1ZBX A;  3M59 A;  1BI3 A;  3OYG A;  4M7D F;  1ZSZ C;  1QVG S;  2JTM A;  4LDU A;  2F2X A;  2NYS A;  3GLX A;  1LVK A;  2FYK A;  2JOY A;  1D3B B;  1OZ3 A;  2C0I A;  3ZL7 C;  1MMN A;  2H8H A;  1Y0M A;  1TUD A;  4J9B A;  5FU7 B;  2EQI A;  3BW1 A;  1VOM A;  3QII A;  4HVU A;  1YN8 A;  2JT4 A;  1D09 B;  4JRK A;  4E7I A;  3EG2 A;  4M77 B;  3CXC S;  1VQO A;  1YBY A;  3UAT A;  2JS2 A;  1B34 B;  1V1C A;  5FLX E;  5M9O A;  4HVW A;  2M9U A;  2XID A;  2W10 A;  4E7J A;  3V8K A;  3H0I A;  4F7U B;  1T3S A;  2DIQ A;  2F2V A;  1O9S A;  2A0F B;  2X3X D;  4NS5 A;  4JPB W;  2CP7 A;  1AWW A;  2EYW A;  2DXC A;  3G6E A;  4M7A E;  1RL2 A;  5HY6 A;  5IXF A;  2DPP B;  4GLK A;  4M75 B;  4RCC A;  3G6E Q;  3CMA T;  5HKC A;  2XHC A;  1R0B G;  2O4X B;  1YI2 A;  2RK1 A;  4QKU A;  3WVE B;  3OMG A;  4ELZ C;  2YWW A;  1VQN A;  3PMT A;  3NHN A;  2RQW A;  1IGU A;  1QVG A;  3UA7 A;  3LLR A;  4FYX B;  3LX7 A;  3AHU A;  2FRW A;  3S3N A;  1X27 A;  3CEY A;  4M7D D;  4M77 F;  4LNP A;  1M1F A;  5HCK A;  1C6V X;  1KK7 A;  1VQN Q;  1GRI A;  5FWC A;  4J9F A;  1M9S A;  4J7I A;  2FO0 A;  3I5S A;  5GMK l;  4UC4 A;  4AFQ C;  5GAO n;  4F7U F;  3QBY A;  2J6K A;  3LH5 A;  3RMQ A;  2CZ7 B;  4IIO A;  2DTH A;  3CXC A;  1Q81 U;  4C92 E;  1K1Z A;  2DL7 A;  3HRT A;  3SDZ A;  4NL2 A;  2MWP A;  3MET A;  4M75 F;  4FCY A;  1YP5 A;  4JS5 A;  1M4Z A;  3UF4 A;  4M7A G;  1YNZ A;  2K9G A;  1WJQ A;  3UA6 A;  2V8K A;  1LOJ A;  3SWN A;  1D1C A;  1UGP B;  3KXT A;  4MZP A;  3REA B;  5KCH A;  2JS0 A;  2EGA A;  3CCE Q;  4BB7 A;  5GAM f;  1N5Z A;  3O8V A;  3CCR A;  2BE7 D;  2LMJ A;  3EFO B;  2EVR A;  1XTD A;  3CD6 A;  1O75 A;  4XAX B;  2KNB B;  1NG2 A;  1RLP C;  3FLG A;  4XU1 A;  3CCR Q;  3SB2 A;  4XTU A;  1JQQ A;  3FJ5 A;  3OS0 A;  2KMT A;  4ZN3 A;  1VQK T;  1GBQ A;  4RUG A;  4FYV B;  3EFR A;  2L3P A;  1VQL A;  4IUQ A;  1VQ6 A;  3CD6 Q;  1VQ8 Q;  1OUL A;  4FU6 A;  2PVG B;  4M77 D;  4ANJ A;  1NYG A;  2BZY A;  2EBP A;  5LJ3 g;  4C0Z A;  1BKB A;  4FYY B;  1YJ9 A;  1VQL Q;  5GAN h;  3HRS A;  2COW A;  1XQH A;  4C0F A;  4PJM A;  5I2S A;  2LJ3 A;  2V8J A;  1UE9 A;  3NPF A;  1JJ2 P;  4OB0 B;  4C0D B;  3RKX A;  1EFN A;  2L8D A;  4EMG A;  4II1 A;  1TH7 A;  1UUE A;  2JM8 A;  3M0R A;  2JMC A;  2Y4Y A;  2KXD A;  2LJ0 A;  4M75 D;  2DM1 A;  1EIF A;  2D9T A;  4ESR A;  1WJS A;  2LNV A;  1IRX A;  2MPX C;  4M7D E;  3PVL A;  1SHG A;  2VB6 A;  4KH0 B;  3JSC A;  2RI2 A;  2ESW A;  4BY6 B;  1WNL A;  2KRO A;  1VYU A;  3L2Q A;  2EYY A;  1AWO A;  4AFZ C;  2Y90 A;  4RTW A;  4JRP A;  4ZTF A;  4IUT A;  5GMK e;  2DVE A;  1U5S A;  2HSE B;  2RHU A;  3CC2 T;  3M0P A;  2EYZ A;  4ZGJ B;  5GAM j;  1QLY A;  4KBM B;  2R58 A;  2X4J A;  4C8Q B;  3EHR A;  2F5T X;  1VQP A;  1FWZ A;  3LWI A;  2G6F X;  3I9Q A;  2DTI A;  3CBO A;  1UHC A;  2FPE A;  2NUZ A;  4FW2 A;  1OZ2 A;  4PJO A;  5IH2 A;  1ACM B;  1VQP Q;  2BE9 B;  2QXF A;  1TS9 A;  2J05 A;  4KRT A;  2X4Y A;  1NEG A;  3I5R A;  4OB3 B;  1KIK A;  5LJ3 d;  3VU3 C;  2RJC A;  5LL6 S;  4EMK C;  1ZUK A;  2FPD A;  2AKK A;  2JZ2 A;  1Q7Y R;  1Y7X A;  4CI0 C;  5FU7 C;  3CCM A;  2QA4 A;  4XTZ A;  2V1Q A;  4MZT A;  2L2P A;  3M9Q A;  3SHW A;  2K3X A;  3FB9 A;  4FT4 A;  5CKH A;  4QVD A;  4QVC A;  1M1G A;  5HK0 A;  1D1A A;  4WF2 A;  4PJJ A;  4M77 C;  4DEX A;  2HSP A;  2K79 A;  5GAO q;  1VQ9 A;  3LH0 A;  3CCM Q;  2QA4 Q;  2LZ6 B;  3DKM A;  1QP3 A;  4PL6 A;  3CCJ Q;  2OX7 A;  2KDS A;  1TSF A;  4C8Q F;  3G4S T;  2FZK B;  4DBR A;  1KQ1 A;  2M1H A;  4MDX A;  1ABQ A;  1VQM T;  2E65 A;  2DXT A;  3LGL A;  2HBP A;  4C5G A;  2L3R A;  4GBQ A;  1OU9 A;  2OAW A;  3SFM A;  2XI9 A;  3I56 A;  3CBP A;  5AT1 B;  4M78 A;  3REB B;  4HT9 A;  1YIJ A;  3QJY A;  3U23 A;  1H3Z A;  1BCO A;  2QQR A;  2K6D A;  1UHF A;  3ASK A;  2EYQ A;  1CKA A;  3L2W A;  1I4K 1;  2KT1 A;  3VJP A;  2EFI A;  2EGC A;  4M75 E;  2RHI A;  2YLC A;  2EIF A;  2ATC B;  2XDB A;  1UGV A;  2V1R A;  5LJ3 e;  1I81 A;  1T0J A;  2KQW A;  1JJ2 S;  2DJZ A;  2CS7 A;  4BI3 A;  2ZPG B;  2XD0 A;  1E6H A;  1V29 B;  1FXX A;  1N8R C;  2P4R A;  3TSW A;  3OYF A;  4DOV A;  1G2B A;  4ZGE B;  2WSF E;  4OP0 A;  1ABO A;  3HFO A;  2OTJ A;  4QW2 A;  3V7R A;  2ZPE B;  3MP8 A;  1M8V A;  3CCS Q;  4M77 G;  2F69 A;  1YIT Q;  1RAG B;  3CCV T;  1BIB A;  1WIE A;  5HK3 A;  4V2S A;  1B07 A;  2PQW A;  2DO3 A;  3C4S A;  2OTJ Q;  1NLP C;  3HL8 A;  1NJI U;  1VYV A;  4C8Q D;  2E5K A;  1U1S A;  1Y96 A;  4CC2 A;  4F7U G;  5GAN 4;  5KYU B;  1J3T A;  1K4U S;  3HKS A;  3URG A;  2K3B A;  1ZA2 B;  5CQX A;  1BI1 A;  4GY5 A;  3OYC A;  1HJD A;  3H9N A;  1QWF A;  4LDX A;  4M75 G;  3OW2 A;  2HNI A;  3HFN A;  3LW5 E;  2ROL A;  4BE0 A;  2DXU A;  2KT8 A;  2AHJ B;  1KHI A;  3J80 E;  1Q86 U;  2JVV A;  3H6Z A;  3H0F A;  4JLG A;  2QQB A;  1MV0 B;  3L2R A;  1VQO T;  5LJ3 h;  4RG2 A;  2DEU A;  2E1H A;  2L3S A;  4XU0 A;  3UDC A;  1K73 U;  2MYS A;  5IHK A;  2RQT A;  3S6W A;  3E19 A;  2Y4X A;  4CC3 A;  2LNH B;  2P84 A;  4C0D C;  1G3W A;  4QQG A;  1K73 C;  2V26 A;  2YRV A;  3N5B B;  2O31 A;  1ZSG A;  3R6N A;  3TVT A;  2EQM A;  2AZS A;  2E3I A;  1KQ2 A;  2LDM A;  1YHQ A;  4R55 A;  3JCM g;  1YI2 T;  2WAC A;  1VQN T;  2P0Q A;  1YJN A;  1RI0 A;  2QEX A;  1SG5 A;  2RJD A;  2LTO A;  4J7F A;  4BY6 C;  2E3H A;  5FU6 B;  3TSZ A;  3S3M A;  3NTK A;  3IQL A;  5GAN g;  1YJN Q;  2EQU A;  3SWN B;  1OYX A;  3OYB A;  2K2M A;  3P8B B;  1QCN A;  4KH1 B;  2RB6 A;  2DRK A;  5DLO A;  3NMZ C;  4N0A A;  1VQ5 A;  2CZ6 B;  2MAM A;  1IO6 A;  1WYX A;  4ZN1 A;  2V8I A;  1UGS B;  3FC3 A;  4C8Q C;  3JB9 J;  5KYW A;  3VRY A;  5DLQ E;  1D0Z A;  1GCQ A;  2R5A A;  5CIU A;  3M0Q A;  2E70 A;  2LX7 A;  1VQ5 Q;  1M2V B;  3M53 A;  2FB7 A;  3CPW A;  1M90 C;  2LQ8 A;  4DA4 A;  4EDU A;  3EH2 A;  2FEI A;  2DZC A;  2ZZD A;  3TQ7 P;  4DOW A;  3RKY A;  1PD0 A;  2EJF A;  3FEO A;  3CCL Q;  3EHQ A;  3FDR A;  3A98 A;  4XU3 A;  4RG8 A;  1OOT A;  1WGS A;  2IG0 A;  2SRC A;  2XDP A;  1K9A A;  3CCR T;  2KVQ G;  1JEG A;  3JV3 A;  2X9H A;  2CH4 A;  1MMA A;  4VUB A;  4GLM A;  3OA6 A;  1I5L A;  3QZ9 B;  4J8O A;  4DQ2 A;  3JCM X;  1D1B A;  1K9M R;  2CUB A;  2HZY A;  1ZBJ A;  1TWB A;  4AFU C;  5ECA A;  1MMD A;  2EAY A;  4OMN A;  1H3H A;  3JCM d;  4M7A A;  3H41 A;  1RUW A;  1VQ6 T;  3ME9 A;  2DBK A;  3NFC A;  2RO0 A;  1TU0 B;  2J6O A;  5KYY A;  3PNW C;  2D1X A;  4QQ6 A;  1ZX6 A;  1IZ6 A;  3AT1 B;  4EMK B;  1XOV A;  2XK0 A;  1G3T A;  1YJ9 T;  1M90 R;  1RAD B;  4C5I A;  5GAN d;  3UT1 A;  1UEC A;  4FSS A;  4PKC C;  1B3Q A;  2HD0 A;  2ROT A;  3HPW A;  3M57 A;  4C8Q G;  2K7A A;  4RCB A;  2A28 A;  2NUP B;  5LJ5 h;  4TVR A;  3QDR B;  4XQ3 A;  1R77 A;  4J9G A;  1OPK A;  1PWT A;  1QKW A;  2QAS A;  4JZ4 A;  3KBG A;  2VGN A;  2PVD B;  1QVF A;  3M5A A;  1W2B P;  5I11 A;  5CO7 A;  2I2L A;  3VUB A;  4A4G A;  4FSX A;  1PRM C;  3OQ5 A;  2DA9 A;  4C92 A;  2K57 A;  1N6A A;  1KC8 C;  4D8K A;  2A7Y A;  4Y91 A;  4MDW A;  3CQT A;  2YRD A;  2QTV A;  2CP2 A;  4LUD A;  3BY7 A;  5CKE A;  3JCM e;  1BBZ A;  1NPR A;  1X6G A;  2RK2 A;  1KQS P;  1TXQ A;  1VQP T;  5CAI A;  1SSH A;  2YUQ A;  4BI4 A;  3PE0 A;  3PIO A;  2FZG B;  2KEA A;  2PZ1 A;  2ZPH B;  2KYM A;  5GAN e;  1G8X A;  3A8L B;  3X20 B;  4LDY A;  2VGM A;  2BZX A;  2Z0W A;  2RHY A;  4FT2 A;  4KGV B;  3I55 A;  4E7S A;  3OBW A;  4M78 B;  2DET A;  1NM7 A;  3EG1 A;  5I22 A;  3CCM T;  2QA4 T;  2XKO C;  1VQ7 Q;  3JCM c;  3OYA A;  3CCE A;  1VQ4 A;  1KC8 R;  1S72 A;  1WXT A;  2OTL Q;  3I55 Q;  2BUD A;  4XU2 A;  4A54 A;  1VQ9 T;  1JO8 A;  1RAF B;  3CCQ A;  2YRC A;  4JJN K;  1VQ4 Q;  1S72 Q;  1M8M A;  1MV3 A;  2MK5 A;  2DFU A;  2PU9 B;  3MP1 A;  4KUL A;  2COZ A;  2LX9 A;  3CCQ Q;  3LYI A;  5IHN A;  3I56 T;  1SPK A;  4HVV A;  4J6Y A;  3WVD B;  1I1J A;  1Q95 G;  1QQJ A;  4BAC A;  3L2V A;  2VXE A;  1VQ8 A;  3R6O A;  1YIJ T;  3E1S A;  3EGD B;  2DXB A;  3JCM h;  3GBQ A;  4A53 A;  4M7D A;  1OX8 A;  3MCA B;  4M78 F;  5KE2 A;  3VRZ A;  4CRI A;  1AWJ A;  2BKD N;  3GNF B;  2PTK A;  4BDY A;  3CC7 Q;  2CZ1 B;  3V8L A;  4OGE A;  1C0M A;  4IUP A;  4FIB A;  4HCB A;  1YJW Q;  2NWM A;  2VKN A;  1FMK A;  1XNI A;  2C0T A;  1Y71 A;  4MZM A;  5FU6 C;  1KD1 R;  5FRN A;  5CCA A;  2ZPF B;  1X75 C;  3SWN C;  3VS6 A;  2DMO A;  4RMO A;  2CUD A;  4KGX B;  2DAQ A;  1AOJ A;  2M51 A;  2ZPB B;  2GCX A;  5GAN 2;  3JCM P;  2NUT B;  2DIG A;  2KSS A;  4WCI A;  2OTJ T;  3ER0 A;  2J7I A;  5CKB A;  4OMO A;  1Q7Y C;  3GNG A;  1A0N B;  4F14 A;  4A63 B;  4HCC A;  2X4X A;  1W2B S;  3QZ5 B;  3M56 A;  3QO3 A;  1MMG A;  5GMK j;  1MGQ A;  2DRM A;  2RI3 A;  4JUV A;  2X4W A;  3HRU A;  1UEB A;  1E7O A;  2CP5 A;  4AMC A;  4L59 A;  1WDX A;  5LJ3 f;  3SEM A;  2KR3 A;  1D3B A;  2BIV A;  1HD3 A;  2L5Q A;  1PHT A;  3QUI A;  3DLM A;  1H8K A;  1WA7 A;  5GAN 3;  5KE3 A;  2YUN A;  2RH2 A;  5GAN 8;  1P92 A;  3QPH A;  2HCK A;  3OMC A;  4M77 A;  1KQS S;  3M0U A;  3DB4 A;  1LCK A;  2LCL A;  3M54 A;  4M78 D;  1ZA1 B;  2VVK A;  1B34 A;  1UG1 A;  5GAN 5;  4OVA A;  1PKT A;  3JAM E;  1M1K R;  3LGF A;  3J7A F;  1WPY A;  1F1B B;  1WI7 A;  3M58 A;  3TU4 K;  4E7H A;  4R0K A;  2LC4 A;  3D7S B;  1W4S A;  3CCJ A;  4Y92 A;  4N4I A;  2RD1 A;  3C0C A;  2LT1 A;  2SEM A;  2WSC E;  2QAZ A;  2PNI A;  4M75 A;  5L8R E;  4JLI A;  2DL8 A;  2VXF A;  2O4X A;  1M5Q 1;  3RNJ A;  1AEY A;  2VUB A;  1W2B A;  4JRQ A;  4AG2 C;  5KYW B;  1YHQ T;  4M77 E;  1B7T A;  1VIE A;  2AZV A;  2CSI A;  2HL3 A;  5EC7 A;  4AT1 B;  4HT8 A;  2JN0 A;  2R57 A;  3MPU B;  2VYT A;  1YJN T;  2QEX T;  4J9C A;  2GGR A;  4N4G A;  1H64 1;  1W6X A;  1R0C B;  4PJO C;  2KK4 A;  2DF6 A;  3E9F A;  3GF5 A;  1IRE B;  2L3Q A;  4F7U E;  3PTA A;  3E2U A;  5J26 A;  3CME T;  2FL7 A;  1WX6 A;  4B9X A;  5CKD A;  3EH1 A;  1WLP B;  2HEQ A;  3EG0 A;  4XTY A;  1W1F A;  1PSE A;  1NYF A;  4IUU A;  2W0Z A;  1KQS A;  4PLL A;  3OYH A;  3M55 A;  2J06 A;  3GPL A;  2M02 A;  2ZCF B;  2JM9 A;  3MHX A;  5LJ5 g;  4L6V 5;  1TTH B;  3PFS A;  5LJ3 j;  2DX1 A;  1N8R U;  4C0G A;  3VUZ A;  1VQK A;  2RJF A;  2EQJ A;  4IIM A;  4PFZ A;  1QP2 A;  4LDV A;  5GAM h;  2KAF A;  5EG2 A;  2RI5 A;  2X3W D;  3CCS A;  2DIL A;  2O88 A;  1VQK Q;  3G71 A;  1YIT A;  3C94 A;  2EJG A;  5IHI A;  1U06 A;  2LRQ A;  4WTO B;  5GAO r;  2YT6 A;  2EKO A;  1WHL A;  5KYY B;  1U1T A;  2DD5 A;  2RN8 A;  9ATC B;  2EPD A;  5D6X A;  4M78 C;  3G71 Q;  3RES A;  4E2F B;  1GCP A;  3OS2 A;  3FRN A;  3V8J A;  1W70 A;  4J6X A;  1TUC A;  2MOX A;  2E64 A;  4D8D A;  2O2O A;  1PCX A;  4A4K A;  3QSU A;  2LJ1 A;  2DER A;  4XTV A;  3VS1 A;  2DL3 A;  1AZE A;  3JCM V;  5KYN A;  2JXB A;  1Z9Z A;  2RHZ A;  4JJC A;  3RDV A;  1BI2 A;  3RER A;  4BD3 A;  3QDF A;  4NL3 A;  4J9D A;  4JDS A;  2CH4 W;  4BI8 B;  1KSW A;  4C92 B;  2YHT A;  3Q1J A;  4NOY A;  3GOX A;  2X35 A;  1BYM A;  2HL5 C;  4BUG A;  1N9R A;  4E7Z A;  4HCK A;  1WHJ A;  4PJN A;  3CC2 Q;  1JJ2 A;  4C5H A;  5LJ5 d;  4L5G A;  2GFU A;  2H3J A;  5GAN 6;  3JCM b;  5GAN 7;  4Y28 E;  1BCM A;  3OSV A;  2GBQ A;  3PIP A;  1X01 A;  4BE1 A;  3G6E T;  3VS2 A;  3INZ A;  3M0T A;  4KT0 E;  4M78 G;  1OI1 A;  1UGR B;  1GBR A;  3OS5 A;  4A4H A;  1EX4 A;  3OYJ A;  3I35 A;  2M0Y A;  5DY9 A;  2K5L A;  4MML A;  3JCM Q;  4C8Q A;  1SF9 A;  4ME7 A;  1OEB A;  5CQY A;  2O01 E;  4C92 F;  2OAU A;  2L0A A;  1VA7 A;  1K9M U;  3EGX A;  2RNA A;  3OY9 A;  4PFP A;  1X6O A;  2CDT A;  3G4S A;  2HMA A;  2RM4 A;  1NJI R;  2LCS A;  3A5Z B;  1K9M C;  2KI7 A;  1HK9 A;  3JB9 H;  4KUD K;  2A36 A;  2DZ9 A;  4IKF A;  2EQK A;  3G4S Q;  2CT4 A;  4X9C A;  2IVW A;  1M90 U;  3CCU A;  2JW4 A;  2E4H A;  1SKU B;  3EG9 A;  4ZTJ A;  2GTJ A;  1PC0 A;  2E10 A;  2KYB A;  5FWB A;  2C0O A;  1GXI E;  2F1L A;  2QQA A;  1M30 A;  2D0N A;  1K8A C;  3C12 A;  1D0X A;  5LJ5 e;  1Q86 R;  4ZNX A;  4N4H A;  3CCU Q;  2HKN A;  3CCL A;  3JB9 I;  1ZSZ A;  3CCE T;  4J83 A;  4RTU A;  4C8Q E;  1VQ4 T;  2DTO A;  1IGQ A;  4Z8A A;  3OYK A;  3MJX A;  3JCM f;  1IHW A;  1KHC A;  3UWN A;  1YCY A;  2AT1 B;  1HSQ A;  1FYN A;  3VKI A;  4LN2 A;  5GAN f;  3QYG B;  5FW9 A;  2AIR B;  2CKK A;  3CD6 T;  4KGZ B;  3RUX A;  1VQ8 T;  1Q82 R;  4N0A C;  1LPL A;  2CP6 A;  1NE8 A;  1QW1 A;  4C92 D;  4CC4 B;  1UFF A;  1RAC B;  5D6Y A;  4OMP A;  1VQL T;  1GCQ C;  2RJE A;  4ELY C;  2KBT A;  1UDL A;  1FX7 A;  4AG1 C;  3MEV A;  3CCV Q;  3MEW A;  1K8A R;  1NLO C;  5GAO p;  2EKH A;  5GMK m;  4ATO A;  3JB9 F;  2RHX A;  2D0Q B;  3WXM B;  3A8G B;  3EG3 A;  4D6W A;  4AFS C;  2E6N A;  4FL6 A;  1PSF A;  1HXD A;  1PRL C;  3X26 B;  4FW1 A;  1HYO A;  3NGP A;  5L23 A;  2JMA A;  1ZQ1 A;  5A2Q E;  3EAE A;  3VYG A;  1TOV A;  2DD4 A;  4B9W A;  2ABL A;  2RPN A;  3SD4 A;  2VAS A;  1Y07 A;  2K5F A;  2A08 A;  1Y57 A;  4OB1 B;  2HKQ B;  1QMC A;  2D8H A;  3KUF A;  1GFD A;  1RAE B;  2CZ0 B;  1KC8 U;  4RTV A;  1RI9 A;  1ZUU A;  1OX9 A;  5KYU A;  4DBH A;  5CK9 A;  2HQH A;  1YWP A;  5KCO A;  3RR6 A;  4PJO B;  3T9N A;  2F2W A;  4M7A C;  1LJO A;  3ZEH A;  3L42 A;  1VQO Q;  2FZC B;  2KE9 A;  1UB4 A;  1T0H A;  4Z89 A;  2JJ9 A;  2KY9 A;  3OB9 A;  2D6F A;  3QYH B;  3C95 A;  2E12 A;  2YSQ A;  2K3Y A;  3MEU A;  3V7S A;  3P8H A;  1ZLM A;  5GAN j;  1UJ0 A;  2RA2 A;  2VWF A;  2IPO B;  4CC7 A;  4FM4 B;  1ZUY A;  2QI2 A;  4RTZ A;  1QVP A;  5CVI A;  3RKW A;  3O5Z A;  5GAM g;  2WSE E;  5GMK i;  2CYZ B;  2DK3 A;  1VQ7 A;  1YI2 Q;  1KD1 U;  2FVU A;  2ZAE A;  3JB9 D;  2NLU A;  2HBW A;  4LE9 A;  7AT1 B;  2OTL A;  4PJO F;  1NZ9 A;  2FHD A;  2X51 A;  1T3L A;  4DEY A;  4C92 C;  3CCJ T;  1KD1 C;  2DVJ A;  2JTE A;  3BE3 A;  5CKF A;  3ULR B;  2KRN A;  3H0H A;  3DLL A;  4MMK A;  2ZGW A;  4LD9 K;  1M3B A;  2PUK B;  3J81 E;  3MKD A;  4IUR A;  2QDL A;  8ATC B;  2OI3 A;  2G3R A;  2CP3 A;  2DLP A;  1VUB A;  4JZ3 A;  1I0C A;  2HQE A;  3FIF A;  2P0K A;  1Q81 C;  4LD6 A;  2DBM A;  2BZ8 A;  2B86 A;  2ED0 A;  3EGU A;  4HCZ A;  2GTO A;  1U8R A;  4K11 A;  4Q5W A;  3CC7 A;  1WHM A;  4EPC A;  2EWN A;  4E47 A;  5C0M A;  1JXO A;  3CC4 A;  2E6Z A;  1YJW A;  1JU5 C;  4E6R A;  2YLB A;  1WHK A;  2L89 A;  2KGT A;  1MND A;  3HTR A;  4ORZ A;  4XTX A;  2LQN A;  3L2U A;  4E7K A;  3CC4 Q;  1M2V A;  5D7U A;  1PKS A;  2YDL A;  4PK4 A;  1SRL A;  5J3B A;  3OW2 P;  4DBF A;  3A8M B;  1GL5 A;  1R8O B;  1Y96 B;  4J9E A;  5J39 A;  3P8D A;  3VS7 A;  5GAM d;  3LWH A;  3MEA A;  3V7C A;  2HDA A;  3CCS T;  1M1K U;  3OYE A;  1SEM A;  2IIM A;  3G71 T;  1YIT T;  1NPP A;  3L1A A;  1Q7Y U;  2J6F A;  4RKU E;  4PJO D;  4C92 G;  1VQ6 Q;  2EJ9 A;  2JTF A;  2DKG A;  2B8A A;  1SSF A;  1H92 A;  3A8O B;  1Q81 R;  4Z88 A;  1KJW A;  1VYT A;  1SHF A;  1M1K C;  2MWO A;  1X43 A;  1G3Y A;  4XK8 E;  5KYX A;  1YJ9 Q;  3A1P A;  3QWX X;  4OML A;  1XJW B;  3X25 B;  4RTX A;  4M7D C;  1PD1 A;  1UJY A;  1BB9 A;  2JNG A;  3L2Z A;  4J6W A;  4PLI A;  2P4T A;  1JXM A;  2O9V A;  4R56 A;  2DE0 X;  3JCM J;  1JBM A;  5GJV B;  3QJ6 A;  2GF7 A;  4QT7 A;  4EMK A;  1FMV A;  1G83 A;  1M3C A;  1AVZ C;  1OQK A;  1ZHI A;  2K4Y A;  4YTL A;  4BE2 A;  3QWY A;  4OMM A;  1I8F A;  1UTI A;  2VV5 A;  5IT9 E;  1RAA B;  3CMA A;  4KUI A;  5FRM A;  4HA8 A;  2KRM A;  2CSQ A;  2KRS A;  1WQW A;  2NUP A;  2FRY A;  4E7L A;  3M0S A;  3OYY A;  1BU1 A;  3QHS A;  4JS4 A;  1YFN A;  2LT4 A;  3CMA Q;  4Z02 A;  1NBE B;  4F7U A;  3PT9 A;  2GNC A;  5GAM e;  1IB8 A;  3MO8 A;  3EGX B;  1M27 C;  3RBB B;  8AT1 B;  5I2M A;  5A0G A;  1X69 A;  3QKJ A;  2GQV A;  2DNU A;  2C06 A;  2O9S A;  3G1J A;  3CPW P;  1AZG B;  1KG1 A;  5I21 A;  4C5E A;  3BFM A;  2MI6 A;  3JRZ A;  3F70 A;  4O6J A;  3TRE A;  2E41 A;  2LQW A;  5IXB A;  1RAB B; 
#chains in the Genus database with same CATH homology
 4QQ6 A;  3CCR A;  1IZ6 A;  4L5G A;  3QG1 A;  2GFU A;  2QQ9 A;  4EMK B;  2H3J A;  1XOV A;  5GAN 6;  2XK0 A;  5C6S A;  3JCM b;  1G3T A;  2PVO B;  4M7D G;  5GAN 7;  3JB9 G;  1YJ9 T;  3MP6 A;  1XTD A;  4Y28 E;  2QQS A;  3CD6 A;  4C5I A;  1O75 A;  4XAX B;  5GAN d;  3OSV A;  3UT1 A;  3PIP A;  3FLG A;  4XU1 A;  1X01 A;  3H8Z A;  4A4E A;  4PKC C;  4BE1 A;  3SB2 A;  4XTW A;  4XTU A;  3TCJ A;  3OS0 A;  3G6E T;  2HD0 A;  2KMT A;  3HPW A;  3M57 A;  4ZN3 A;  1VQK T;  3INZ A;  4C8Q G;  3EFR A;  3GP8 A;  4KT0 E;  4RCB A;  1VQL A;  4M78 G;  4IUQ A;  1VQ6 A;  1OI1 A;  1UGR B;  5LJ5 h;  3JCM W;  4TVR A;  3OS5 A;  4A4H A;  3OYJ A;  3GIB A;  3HSB A;  4FU6 A;  1YIT T;  2PVG B;  3QDR B;  3VYH B;  3E9G A;  4M77 D;  4XQ3 A;  5DY9 A;  2K5L A;  3EFS A;  4MML A;  3JCM Q;  1JJ2 A;  5LJ3 g;  4C0Z A;  1BKB A;  3UPU A;  3KBG A;  1YJ9 A;  4C8Q A;  4PJO E;  3X24 B;  2VGN A;  1VQ5 T;  2PVD B;  4ME7 A;  5IN1 A;  1QVF A;  5GMK h;  5GAN h;  3HRS A;  2P0P A;  2O01 E;  5CQY A;  1DJ7 B;  1XQH A;  3M5A A;  2OAU A;  4C0F A;  4C92 F;  1G5V A;  3CCU T;  5I2S A;  2V8J A;  1K9M U;  4OB0 B;  5CO7 A;  4C0D B;  2I2L A;  2K5I A;  3PGG A;  4M75 C;  3VUB A;  4A4G A;  4FSX A;  3OQ5 A;  3OY9 A;  3RKX A;  1X6O A;  3OS1 A;  3NTH A;  3G4S A;  3OW2 S;  2RM4 A;  4C92 A;  2L8D A;  3M4Y A;  4EMG A;  2K57 A;  1N6A A;  1KC8 C;  3A5Z B;  1K9M C;  3BDU A;  3CCL T;  2A7Y A;  1YI2 T;  4II1 A;  1TH7 A;  1HK9 A;  3JB9 H;  4KUD K;  2DZ9 A;  4Y91 A;  4IKF A;  4MDW A;  1N9S A;  4M7A B;  2Y4Y A;  2JUF A;  2XDD A;  2EQK A;  4M75 D;  2LQK A;  4X9C A;  1EIF A;  2IVW A;  2D9T A;  2XIC A;  4IUV A;  3ZBD A;  1M90 U;  2XU8 A;  3BY7 A;  5CKE A;  3CCU A;  1WJS A;  4ZTJ A;  2LNV A;  1WQ7 A;  1UGQ B;  2E10 A;  3OYL A;  3JCM e;  4EMH A;  3S3O A;  4M7D E;  5AYF A;  3JSC A;  2RI2 A;  1NPR A;  1GXI E;  2QQA A;  2RK2 A;  4QVZ A;  3CBM A;  4BY6 B;  1K8A C;  3C12 A;  3OSS C;  5LJ5 e;  1VQP T;  4OGC A;  1WNL A;  5CAI A;  1MHN A;  3CPF A;  4N4H A;  4P5N A;  3L2Q A;  1Q7Y U;  3CCL A;  4BI4 A;  3QXE B;  5DM7 R;  3JB9 I;  3PIO A;  3G7Z A;  2Y90 A;  3CCE T;  4J83 A;  4C8Q E;  1VQ4 T;  2ZPH B;  2DTO A;  2GFA A;  4JRP A;  4ZTF A;  4IUT A;  4M78 E;  5GAN e;  5GMK e;  2DVE A;  4O5V A;  2RHU A;  3OYK A;  3CC2 T;  2F5K A;  5A0L A;  3JCM f;  3A8L B;  3HHT B;  3X20 B;  4LDY A;  1KHC A;  2VGM A;  5GAO m;  1BIA A;  2M16 A;  3UWN A;  2RHY A;  4ZGJ B;  5LJ5 f;  5GAM j;  4KBM B;  5FRO A;  2R58 A;  2X4J A;  5CR2 A;  3HP9 A;  4FT2 A;  4C8Q B;  3I55 A;  4PJO G;  1YCY A;  2F5T X;  4JRI A;  1VQP A;  1FWZ A;  3OBW A;  4M78 B;  3VKI A;  3LWI A;  3CCM T;  2QA4 T;  3OBY A;  2XKO C;  2DTI A;  3JCM c;  3CBO A;  5GAN f;  3OYA A;  5A0D A;  3CCE A;  1VQ4 A;  3QYG B;  4M7A F;  1S72 A;  3A8H B;  2CKK A;  2PUO B;  4X34 A;  1OZ2 A;  2BUD A;  3CD6 T;  4PJO A;  3RUX A;  1VQ8 T;  3CC2 A;  2XG8 D;  4XU2 A;  4A54 A;  1VQ9 T;  4N0A C;  2QXF A;  1NE8 A;  1NJI C;  3OYI A;  2X4Y A;  3CCQ A;  4OB3 B;  4X9D A;  1QW1 A;  5LJ3 d;  3VU3 C;  4JJN K;  2RJC A;  5LL6 S;  4C92 D;  4EMK C;  5D6Y A;  1VQL T;  2JZ2 A;  3ZFJ A;  1Y7X A;  2PU9 B;  3MP1 A;  4CI0 C;  5FU7 C;  2RJE A;  4KUL A;  4ELY C;  3CCM A;  2QA4 A;  1JRI A;  2MMP A;  1FX7 A;  4XTZ A;  2LX9 A;  3MEV A;  4MZT A;  3MEW A;  4ZGD B;  2HQX A;  1N27 A;  3LYI A;  3M9Q A;  2K3X A;  3FB9 A;  5GMK m;  5GAO p;  3I56 T;  4ATO A;  4FT4 A;  5CKH A;  4QVD A;  4QVC A;  1M1G A;  4J6Y A;  2RHX A;  2D0Q B;  3FJP A;  3WVD B;  4WF2 A;  3WXM B;  3A8G B;  5HK0 A;  3L2V A;  2VXE A;  4BAC A;  4M77 C;  1VIF A;  1VQ8 A;  4D6W A;  5GAO q;  1VQ9 A;  3R6O A;  2E6N A;  3LH0 A;  4FL6 A;  1PSF A;  1HXD A;  3VV0 A;  3DKM A;  3X26 B;  3E1S A;  5IAY A;  1QP3 A;  1YIJ T;  4PL6 A;  1Q86 C;  2DXB A;  2M0O A;  1AHJ B;  1ZQ1 A;  3JCM h;  2KDS A;  5A2Q E;  3EAE A;  4A53 A;  4M7D A;  3VYG A;  2E5Q A;  4C8Q F;  3CPW S;  3G4S T;  3RIR A;  3MCA B;  2DD4 A;  4B9W A;  1WJR A;  4M78 F;  3X28 B;  1KQ1 A;  2LVM A;  2M1H A;  2ZPI B;  4CRI A;  2BKD N;  5KE2 A;  3GNF B;  4BDY A;  1VQM T;  3SD4 A;  2E65 A;  2DXT A;  3LGL A;  2CZ1 B;  2HBP A;  3V8L A;  4C5G A;  4OGE A;  1Y07 A;  2K5F A;  2L3R A;  4LDW A;  4OB1 B;  4IUP A;  3SFM A;  2XI9 A;  4FIB A;  3I56 A;  4HCB A;  3TEE A;  3CBP A;  3KUF A;  1XNI A;  4M78 A;  4MZM A;  1Y71 A;  5FU6 C;  2CZ0 B;  3DB3 A;  1KC8 U;  5FRN A;  5CCA A;  3JB9 F;  4HT9 A;  2ZPF B;  4QQD A;  3OYN A;  1X75 C;  4BDZ A;  1YIJ A;  3QJY A;  1H3Z A;  2QQR A;  3SWN C;  1Q82 U;  5CK9 A;  4RMO A;  5KCO A;  4PJO B;  3T9N A;  4M7A C;  2DAQ A;  3ASK A;  3G71 T;  3RMS A;  2EYQ A;  1LJO A;  3ZEH A;  1VQM A;  3L2W A;  1I4K 1;  3L42 A;  1Q82 C;  2ZPB B;  2GCX A;  5GAN 2;  3VJP A;  2EFI A;  3JCM P;  4M75 E;  2DIG A;  2RHI A;  2VC8 A;  2YLC A;  5D6W A;  2EIF A;  2KSS A;  1UB4 A;  5GAO l;  3ER0 A;  1K8A U;  2XDB A;  2OTJ T;  1LNX A;  1BI0 A;  5CKB A;  1VQ7 T;  1Q7Y C;  3GNG A;  4M7A D;  5LJ3 e;  5LJ5 j;  1I81 A;  4HCC A;  2X4X A;  2KY9 A;  3OB9 A;  3OYD A;  3CME A;  2KQW A;  1W2B S;  2D6F A;  3QYH B;  2DJZ A;  1JJ2 S;  2OTL T;  3C95 A;  2CS7 A;  3QZ5 B;  3I55 T;  2E12 A;  2R5M A;  4BI3 A;  2ZPG B;  2K3Y A;  2XD0 A;  3M56 A;  1V29 B;  3NTI A;  1FXX A;  3MEU A;  3P8H A;  3QO3 A;  3V7S A;  1N8R C;  3OYF A;  4DOV A;  4OMF B;  5GMK j;  5GAN j;  2RA2 A;  4ZGE B;  1MGQ A;  2WSF E;  4FM4 B;  2RI3 A;  2MF2 A;  2QI2 A;  4JUV A;  4OP0 A;  2X4W A;  3HRU A;  4M7D B;  1QVP A;  1S72 T;  4OB2 B;  1UEB A;  5CVI A;  3RKW A;  3HFO A;  4L59 A;  1JB0 E;  4J5Y A;  5GAM g;  2OTJ A;  4PNO A;  4QW2 A;  5LJ3 f;  2WSE E;  1D3B A;  2BIV A;  3V7R A;  2ZPE B;  3MP8 A;  1M8V A;  5GMK i;  2CYZ B;  2DK3 A;  4HKE A;  3BDL A;  2L5Q A;  4M77 G;  1VQ7 A;  2F69 A;  3CCV T;  3QUI A;  2FVU A;  1BIB A;  3DLM A;  3CCQ T;  3JB9 D;  2NLU A;  1KD1 U;  5GAN 3;  2CGH A;  5HK3 A;  4V2S A;  2PQW A;  2DEQ A;  2DO3 A;  5KH6 A;  2OTL A;  4OF1 A;  3C4S A;  5KE3 A;  4PJO F;  2RH2 A;  1NZ9 A;  2FHD A;  5GAN 8;  1P92 A;  3QPH A;  3OMC A;  4M77 A;  3HL8 A;  4C92 C;  3CCJ T;  1NJI U;  1KD1 C;  4C8Q D;  3DB4 A;  1KQS S;  4F7U G;  1U1S A;  1Y96 A;  5GAN 4;  2LCL A;  5CKF A;  1QVF S;  3HKS A;  3M54 A;  4M78 D;  3URG A;  3DLL A;  4MMK A;  2ZGW A;  3OYM A;  1B34 A;  5CQX A;  2QTX A;  4LD9 K;  1BI1 A;  4A4F A;  4GY5 A;  3OYC A;  3CC7 T;  2K2V A;  2LCC A;  3M4G A;  2PUK B;  3CCV A;  3J81 E;  3CC4 T;  4IUR A;  2HAX A;  5GAN 5;  4OVA A;  4LDX A;  3PMI A;  3JAM E;  4M75 G;  1YJW T;  3LGF A;  3OW2 A;  3J7A F;  2HNI A;  1WPY A;  2G3R A;  3HFN A;  3LW5 E;  4BE0 A;  2QDY B;  3M58 A;  1VUB A;  2A3L A;  2DXU A;  4E7H A;  3TU4 K;  1G3S A;  2AHJ B;  2HQE A;  3FIF A;  2LC4 A;  2P0K A;  1KHI A;  1W4S A;  3J80 E;  3CCJ A;  1Q86 U;  1Q81 C;  2JVV A;  4LD6 A;  4N4I A;  1ZBX A;  3H6Z A;  2RD1 A;  3M59 A;  1BI3 A;  3OYG A;  4M7D F;  2LT1 A;  4JLG A;  2QQB A;  2WSC E;  4HCZ A;  4M75 A;  1QVG S;  5L8R E;  2JTM A;  1U8R A;  4JLI A;  2VXF A;  3L2R A;  4Q5W A;  4LDU A;  3CC7 A;  4EPC A;  2EWN A;  1M5Q 1;  2O4X A;  4E47 A;  5C0M A;  1VQO T;  5LJ3 h;  4RG2 A;  3CC4 A;  2VUB A;  1W2B A;  3GLX A;  2E1H A;  2E6Z A;  2FYK A;  1YJW A;  2YLB A;  4XU0 A;  2JOY A;  2L89 A;  3UDC A;  4JRQ A;  1K73 U;  1D3B B;  1OZ3 A;  1YHQ T;  4M77 E;  1VIE A;  3S6W A;  3E19 A;  4XTX A;  5FU7 B;  2Y4X A;  5LJ5 d;  2JN0 A;  3L2U A;  4E7K A;  4HT8 A;  2R57 A;  3BW1 A;  2VYT A;  1YJN T;  3QII A;  2QEX T;  4C0D C;  1G3W A;  4N4G A;  4JRK A;  4QQG A;  1H64 1;  5J3B A;  4E7I A;  1K73 C;  4PJO C;  2KK4 A;  2YRV A;  3E9F A;  3N5B B;  4M77 B;  3GF5 A;  1IRE B;  4F7U E;  3A8M B;  3PTA A;  3CXC S;  1VQO A;  1R8O B;  1Y96 B;  1YBY A;  5J26 A;  3CME T;  2FL7 A;  2EQM A;  5J39 A;  3P8D A;  5CKD A;  4B9X A;  5GAM d;  4XTY A;  3LWH A;  1KQ2 A;  3MEA A;  1B34 B;  3V7C A;  1PSE A;  2LDM A;  5FLX E;  3CCS T;  1YHQ A;  1M1K U;  5M9O A;  4IUU A;  4R55 A;  3OYE A;  1KQS A;  2M9U A;  2XID A;  1NPP A;  3L1A A;  4PLL A;  3JCM g;  3M55 A;  2WAC A;  3V8K A;  3OYH A;  3GPL A;  4E7J A;  4RKU E;  2ZCF B;  4F7U B;  4PJO D;  4C92 G;  1VQN T;  2DIQ A;  2P0Q A;  2EJ9 A;  2JTF A;  3MHX A;  1RI0 A;  1O9S A;  5LJ5 g;  2QEX A;  1YJN A;  4NS5 A;  3PFS A;  4L6V 5;  2DKG A;  2RJD A;  2B8A A;  1SSF A;  5LJ3 j;  2LTO A;  3A8O B;  2DXC A;  4J7F A;  3G6E A;  1N8R U;  1M1K C;  1RL2 A;  5HY6 A;  3VUZ A;  4BY6 C;  4C0G A;  4M7A E;  1VQK A;  2MWO A;  2RJF A;  1G3Y A;  2EQJ A;  4XK8 E;  5FU6 B;  4MDX A;  3S3M A;  2DPP B;  1QP2 A;  3NTK A;  5GAN g;  4LDV A;  2EQU A;  3SWN B;  5GAM h;  1OYX A;  4GLK A;  4M75 B;  3X25 B;  3OYB A;  2KAF A;  4M7D C;  5EG2 A;  3P8B B;  4RCC A;  2RI5 A;  3CMA T;  3CCS A;  2JNG A;  3L2Z A;  5HKC A;  2XHC A;  2RB6 A;  2O4X B;  4J6W A;  3G71 A;  2RK1 A;  1YI2 A;  3WVE B;  3C94 A;  5DLO A;  2EJG A;  4N0A A;  1YIT A;  1VQ5 A;  2CZ6 B;  2LRQ A;  2MAM A;  3OMG A;  2P4T A;  4PLI A;  4ELZ C;  4ZN1 A;  3PMT A;  4R56 A;  5GAO r;  1VQN A;  3JCM J;  1JBM A;  2EKO A;  2V8I A;  1QVG A;  1U1T A;  2DD5 A;  3QJ6 A;  1UGS B;  2GF7 A;  3FC3 A;  4EMK A;  3LLR A;  4C8Q C;  3JB9 J;  5D6X A;  3LX7 A;  5DLQ E;  3S3N A;  3AHU A;  2R5A A;  3CEY A;  4M78 C;  4M7D D;  4M77 F;  5CIU A;  3RES A;  2E70 A;  1ZHI A;  2K4Y A;  4YTL A;  4BE2 A;  3M53 A;  1M1F A;  2FB7 A;  3CPW A;  1M90 C;  1I8F A;  2LQ8 A;  2VV5 A;  4DA4 A;  4EDU A;  3OS2 A;  5IT9 E;  1M9S A;  3FRN A;  4J7I A;  4KUI A;  3V8J A;  3CMA A;  4HA8 A;  5FRM A;  5GMK l;  4UC4 A;  4J6X A;  5GAO n;  2DZC A;  4F7U F;  1WQW A;  2ZZD A;  3QBY A;  4E7L A;  2E64 A;  3OYY A;  3RKY A;  4DOW A;  2EJF A;  3FEO A;  3QHS A;  4A4K A;  3RMQ A;  4JS4 A;  2CZ7 B;  3QSU A;  2LT4 A;  4XTV A;  4Z02 A;  2DTH A;  3FDR A;  3CXC A;  1Q81 U;  4XU3 A;  3JCM V;  4C92 E;  4F7U A;  4RG8 A;  1WGS A;  2IG0 A;  2XDP A;  3HRT A;  3PT9 A;  3SDZ A;  4NL2 A;  5GAM e;  2MWP A;  3CCR T;  2KVQ G;  3MET A;  3MO8 A;  4M75 F;  5I2M A;  4VUB A;  4JS5 A;  2RHZ A;  1M4Z A;  5A0G A;  3OA6 A;  1BI2 A;  1I5L A;  3RER A;  3QKJ A;  2GQV A;  3QZ9 B;  4J8O A;  4BD3 A;  4DQ2 A;  4M7A G;  3JCM X;  4NL3 A;  4JDS A;  1WJQ A;  4BI8 B;  2V8K A;  2C06 A;  4C92 B;  2YHT A;  1LOJ A;  3SWN A;  3Q1J A;  2EAY A;  1UGP B;  4NOY A;  3GOX A;  3KXT A;  2X35 A;  4MZP A;  5KCH A;  1BYM A;  5I21 A;  4C5E A;  4BUG A;  1N9R A;  1KG1 A;  3BFM A;  4BB7 A;  3JCM d;  4M7A A;  5GAM f;  2MI6 A;  3JRZ A;  3F70 A;  3O8V A;  4O6J A;  3TRE A;  1VQ6 T;  2E41 A;  3ME9 A;  3NFC A;  2RO0 A;  4C5H A;  3PNW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...