2VUMG

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
171
Chain Sequence
b'MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule tags Transferase
total genus 26
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vumG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2vumG01
3EBEA 4DV5L 5LMNL 1HNXL 3HOZH 4HIDA 2Q2TA 3S1NH 2K5NA 4MNOA 3M9BA 1HH2P 1VQKA 4MZ9A 5IT9c 2R92H 4X62Q 3KOJA 1KXLA 2VQFQ 4AQYQ 2B29A 4JI2L 5GAHC 4A3CH 1SE8A 1IYJB 4C3HH 4JV5Q 4ME3A 4LWCA 1WYDA 1N34L 3H3VH 1EQQA 3RNUA 2F3IA 1NTGA 3J7ZC 4O2DA 4AH6A 3G71A 2AMCB 1HR0W 1IBLQ 4B3MQ 1XPUA 3I4NH 4X6AH 1PFSA 3CCQA 2Y0SG 2KHJA 1UE1A 1X56A 1TWFH 1IZ6A 4LF8L 1J5EL 1V1QA 5C3EH 4GOPB 4LF9L 4BBSH 1L2FA 4DV4L 2EQSA 1KQSA 3F2BA 4IOCA 3J81j 4AYBG 5IY0A 1T9HA 3F2CA 2R7ZG 2UXCQ 3CC7A 1Q81C 3K8AA 4A3GG 4JOIC 2PMZE 1BVSA 5ELOA 5C0XG 4JI4L 1CKMA 4TQUS 1D8LA 3GTGH 1EFWA 1PVOA 1VQMA 2VQEQ 2E2HH 4A3BG 3GD7A 4LF4Q 4JBWA 2ATWA 4FDBA 5DLQE 1SRUA 2AHOB 3RLOA 1QZHA 1IBKL 2HT1A 3UDXA 4A3LG 2BA1A 3CPWA 2GN5A 4H02A 4NB3A 1NJIC 1Z47A 3ICEA 3PO2H 2NVYH 5GADC 3BZKA 4R4TA 3M4OH 1HNWQ 5M5WH 5LMNW 2IHFA 4OX9L 3S1MH 3JAMi 3AYHB 1N32L 3BJUA 1I94Q 2Y0SE 1Q1EA 3TS0A 4HJ5A 1GVPA 3CMAA 1YIJA 1XMOQ 1N36L 2B63G 4DR5L 3GTMH 2N49A 1SROA 1VQGA 2QGQA 3A5UA 1PV4A 2R93G 1EOVA 3KLWA 2Z6KC 4P75A 1N8RC 1PH9A 3CC4A 1OTCA 2OTLA 1P16A 2NN6I 2OQ0A 1KIXA 4AYBE 1WI5A 5M3FG 2LXKA 3JC66 4B3SL 5IP7H 5IWAQ 3PO3H 2UU9L 4A3DH 4JV5L 3DM3A 3S17H 1ASYA 1EUJA 1V43A 3PIOA 1JB7A 3HOVH 2K5VA 1A8VA 3UDGA 2VS1A 4GN4B 3U50C 4B3ML 3HOWG 5JEAJ 4DV2L 4DV3L 4DR6L 3CCJA 1Q1BA 2E8GA 2BH8A 4LUVA 1VQIA 5J3BA 4JCVE 4BY1G 4IJHA 3CCVA 4LW1A 3PUZA 1OXVA 4GLVB 4JC0A 4X66Q 2NVTH 4PZ8A 1HNZL 1CKOA 2UXBQ 1AE3A 4X65L 5FJ8H 5IYCG 1AE2A 4DR2L 2UXCL 5C44H 4OWWB 3K7AH 1VQ9A 1EWIA 1R9TH 4GKKQ 1VQAA 4DAYB 5H1SE 4YY3Q 2ZJRA 3OTOQ 3MXNB 1C9OA 3U4ZA 2VNUD 3HOXH 3MEFA 2A19A 1N33Q 4O0AA 5GROA 2NN6G 3S1RH 1K8GA 1JMCA 4IFDI 2ALYB 2PI2A 5AJ3Q 1AH9A 2C35B 2KCTA 4YHHL 4JBMA 1FJGQ 1HNWL 3CCSA 2K50A 3S15H 2PQAA 4GNXA 2IX1A 4B3RQ 1Q46A 3PV0A 1I94L 1QZGA 1ASZA 3I7FA 2JA7G 3M85A 3CMEA 1XPRA 3H15A 4A3MG 2Q2UA 4PG3A 2BH2A 1VCIA 1S72A 1RL2A 3F8TA 3CCMA 4GS3A 3T1YQ 4R4CA 2DUDA 3FHWA 3M4QA 1GO3E 5IWAL 3NBHB 4K0KL 1Y1VH 3RLNA 4HJ9A 4NXNQ 3AQQA 3G4SA 4NXMQ 2UUBQ 5M5XH 3E0EA 4JI7Q 2D0PA 4JI0Q 5IP9H 4DR7Q 3STBC 4LF5Q 2WFWA 4A4IA 2I0QA 3I2ZA 1XJVA 3CCEA 1E3PA 4GOPA 3SGIA 2CQOA 4A3JG 4JYAL 4XIGS 2E5LL 1LYLA 2JA5G 1I3QH 1VQCA 4C3IH 3KF6B 5GAGC 4IFDG 2UXBL 1G51A 4OWTB 1K83H 2CCZA 5GQOA 3RR5A 4A3FG 2F4VQ 2GVAA 2YTYA 4IPCA 1VQFA 2AWNA 3BZCA 1TXYA 1SLJA 3JAMc 1VQPA 1VQEA 1XNQQ 4DV6Q 3H3VI 4DR4L 4L5QA 1JJCB 1W3SA 1FGUA 1QUQB 2QEXA 2EIFA 1VQ4A 2Z0SA 2N78A 2UXDQ 4JI5L 3PUYA 4IO9A 2NVQH 1S3OA 5AJ3L 1VQ6A 2VUMG 1VQHA 3KF8B 2ZM6L 4IPDA 2WP8J 3F1ZA 5BR8Q 4KLKA 3ER0A 2H5XA 5LMUL 2D62A 2UUAQ 2R7ZH 4IPGA 4JG2A 4PZ7A 1BBUA 1EYGA 4A3GH 3HFZB 3EIVA 3ULLA 3D31A 2MO1A 2A1AA 2I5LX 4OXPA 2I5MX 1PH3A 1VQ5A 4WJ3M 2LXJA 4A3IG 4A3BH 4YCUA 3T1YL 1WFQA 3PCOB 2JEAI 1LM0A 3GDEA 2JJQA 4R4IA 1L0WA 1VQDA 4QGUA 3S1QH 4A3LH 3HKSA 1HZBA 3AFQA 1Y1WG 3CQZH 5E7NA 4JI8L 4JBJA 3PSIA 2YU9H 4DV1Q 1EQRA 4BY7G 1GKHA 2XGTA 1OXXK 5K36G 1W2BA 3A0JA 3FP9A 2ZTEA 3S24A 4DUYL 4HJ7A 4LF5L 4DR7L 4X64Q 4BXXG 1GD7A 1PYBA 5EAYA 2JEBI 1YITA 2OWOA 2JK8A 4DV7Q 4IJLA 1PH8A 2K14A 2R93H 1KRSA 4GNXC 1L1OB 4POFA 5C0XJ 4A93H 1KD1C 1J6QA 3W1BA 1PH2A 4NPSA 1XMQL 1WCMG 5M3FH 1FJGL 1X6OA 4DKAC 5IYDG 5IYBG 4DV0L 1IBMQ 1D7QA 1OXUA 3KDFB 1QVGA 3UE1A 4DR3Q 3HKZG 4A93G 4X62L 3AEVA 2VQFL 4AQYL 2ZJQA 1X55A 1JT8A 5JJIA 3OW2A 2VZAA 3E9HA 3UE0A 3HOWH 3CP0A 4GLXA 1Q82C 5C4XG 1UEBA 3L2PA 3TREA 4P71A 2E2JH 1EIYB 4LF7Q 2UXDL 2B63H 4DR1Q 4BY1H 1YI2A 2HHHQ 2JA9A 1IBLL 5M3MG 1YNXA 3PUXA 4BBRH 1PH5A 4GOPC 2RHQB 1K73C 3HOYH 1E1TA 1HR0Q 5IYCH 3A74A 4L5SA 3GTJH 4OONA 1K3RA 3ULPA 1Q8KA 2KCMA 1H95A 2RHSB 4KHZA 4BBRG 3B6YA 2IT1A 3I4OA 3M4PA 1WOCA 4GN5A 1QVCA 2KHIA 4LF6Q 4JI1Q 1E7ZA 1FVIA 1PH7A 3I4MG 2VQEL 3HKZE 3K0XA 4Y52H 4LF4L 4EQ5A 1MKHA 4C3JH 2UUCQ 3NENA 1FL0A 1SFOH 2BA0A 4YCWA 4AIMA 3UDFA 1E22A 1Q86C 3U58A 3TS2A 3HOUG 1YHBA 1PH1A 1MIUA 2JA7H 3CW2C 1YJNA 3NELA 1Q12A 2K5HA 4J15A 4A3MH 3DLLA 1A62A 2Q2HA 3KF6A 3H0GG 1K8AC 4LFAQ 3RN2A 3PF5A 1IL2A 2HIXA 2YYZA 4QJFA 3T1HQ 4LFCQ 1SMXA 1XMOL 1WJJA 3S2HH 2KENA 5LMNQ 4DV5Q 1HNXQ 2PNHA 3W1GA 2VY3A 1NBWA 2QA4A 4DR3L 2LSSA 4JOIA 3ZJYC 2AWOA 1QUQA 2ZJPA 1B8AA 2YV5A 1BBWA 3GTKH 1N34Q 4HJ8A 2RF4A 3I55A 4MTNA 2VW9A 1XNRQ 4A3JH 1OXTA 3BU2A 1PH4A 1B70B 1U5KA 2N3SA 4A3EG 2D0OA 2JA5H 2FXQA 3PIPA 4WJ4A 1JE5A 1MJCA 4A3KG 1VQLA 3M3YH 4YWMA 1TWCH 4YWLA 1J5EQ 2GVBA 1CSPA 4A3FH 4QL5A 1S40A 1YHAA 1QVFA 1KHIA 3S16H 4LF9Q 2XTIA 4X66L 4DV4Q 3KJOA 4B3TQ 4YCVA 4KHPQ 4GN3B 3KYHC 4DAMA 2NZHA 5FLMG 4JI4Q 4LF6L 2IY5B 4GKKL 2WAQE 2YTXA 5FLXc 4QQBX 4YY3L 4TVAB 1TWGH 2IHEA 3OTOL 2JA8H 2VUMH 2R7DA 1IBKQ 1YBYA 3GTOH 1SR3A 3CXCA 4OO1I 3UDIA 4IFDJ 1CKNB 1HZ9A 1N33L 3FKIG 1VS0A 1L1OA 2JE6I 2ZTCA 4RG1A 1X3FA 2L15A 3J80i 2NVXH 3W5OA 1NY4A 3L7ZC 2JA8G 3CCUA 3M7NA 4OX9Q 1YVCA 1NMGA 4R4QA 4A3IH 3CCRA 1X65A 4JI3Q 4ALPA 4B3RL 1KC8C 1B7YB 2NZOA 1N36Q 4DV0Q 1NE3A 3KDFA 4DR5Q 1HJPA 1YJ9A 1Y1WH 4UP9A 1O7IA 1PH6A 4PZ6A 2JA6G 3KJPA 4BY7H 4LUZA 1HZAA 3HOYG 1TWHH 1Y14B 4OWXB 4B3SQ 3RZDH 2UU9Q 3HOZG 5C4JH 2Q2IA 4NXNL 2YTVA 2B3GA 2R92G 4NXML 4LFBQ 2R7FA 1PA6A 1XNRL 2UUBL 2HIVA 4JI7L 4POGA 2JQOA 4JI0L 1UE7A 1C7YA 1CSQA 4A3CG 4DV2Q 1PYSB 4C2MH 4DV3Q 1WCMH 4DR6Q 5IYDH 5IYBH 3GTLH 2F52A 1P8LA 3S2DH 2PI2E 3RLFA 3J81i 4OO1G 2OCEA 3TEHB 4UPAA 3I4NG 4BA2I 1HNZQ 4B3TL 4KHPL 4GLAC 4X65Q 3CC2A 3K80C 4DUZQ 4DR2Q 3CD6A 1VQ8A 5C4XH 2MQHA 3F2DA 2DGYA 4RMFA 2ASBA 2F4VL 5C3EG 4BBSG 1C0AA 4R4OA 2ZTDA 5M3MH 1XNQL 4DV6L 2MNAA 4GKJQ 2CWAA 3GO5A 3OYYA 2CKZB 3RN5A 4P73A 3AFPA 3CF5A 4IPHA 3E9IA 1M1KC 2I5HA 3Q8DA 4YHHQ 4P74A 1KRTA 5BR8L 3NEMA 1YHQA 1LTLA 4LUOA 4JI3L 1TWAH 2UUAL 1RIPA 2AKWB 2IX0A 3K81C 5GAEC 1I5FA 3PO2G 4QIWE 1LUZA 5JJKA 3KFUA 2OTJA 1GM5A 3LGJA 4PMWA 1VQ7A 3I4MH 1XPOA 3PUVA 5JEAG 4LNQA 4QY7A 4HIMA 4DK3C 1V9PA 3L0OA 1Z9FA 3CPFA 1YEZA 4DNIA 1JJGA 3HOUH 4K0KQ 3GTPH 3PF4A 4JI6Q 3PGZA 4LFBL 1A0IA 4DV1L 3ERSX 3G6EA 2K4KA 3H0GH 2N8NA 1EIFA 5IP7G 3PO3G 1L1OC 1UE5A 1MJEA 4A3DG 4X64L 4DK6C 1Q7YC 3GTQH 1G6PA 4Y7NH 4DV7L 1E1OA 4JYAQ 1K0RA 3WWVA 2E5LQ 3HOVG 3RZOH 3CAMA 1X3EA 4HIKA 1I6HH 3K7UC 4DUZL 2KBNA 3ULJA 2WAQG 3PUWA 4HIOA 1IBML 3U4VA 4P72A 1PHJA 4YWKA 4R1JA 3J80c 1YJWA 3S14H 2VL6A 1CUKA 2OQKA 1N9WA 4XTCS 4JI2Q 5FJ8G 4A3EH 4DR4Q 5C44G 1BKBA 1CKNA 4GKJL 1VQOA 4A3KH 1KAWA 1NMFA 3G48A 1VQNA 3IRBA 4JI5Q 4LF7L 2WB1G 1XTDA 4L5RC 2MO0A 3EN2A 4DPGA 4A75A 4DR1L 3CCLA 3TRZA 1JJ2A 2HHHL 2ZM6Q 1SN8A 3HOXG 4UY8C 5LMUQ 1UWVA 5IE8A 4JBKA 2CWPA 1IXRA 1U0LA 1HR0L 4LF8Q 5FLMH 1DGSA 3I56A 2MFIA 4HJAA 3VDYA 1YZ6A 4L5TA 1M90C 2Z6KA 1VQJA 4IOAA 3STBD 4UP8A 1K9MC 2V1CC 2R6GA 2EXDA 4JI1L 1OXSC 3FKIH 4JI6L 4JI8Q 2K75A 5M5YH 3J81c 4KI0A 4BXXH 2UUCL 2K52A 3D0FA 1VQBA 4EX5A 4UP7A 2E2IH 4DUYQ 4A76A 1X54A 1I50H 1Y1VG 3J7A5 5JJLA 2ES2A 2CFMA 1X3GA 1A63A 4APVA 1G291 2HQLA 2WB1E 3A5ZB 1KL9A 5ELNA 4BA1I 5IP9G 1UE6A 5C0XI 4LFAL 1N32Q 1E24A 5HY6A 2JA6H 3TQYA 2RCNA 4LFCL 3T1HL 2ID0A 2PQAB 4GNXB 1XMQQ 1X9NA 2A8VA 1HZCA 5HGQA
chains in the Genus database with same CATH superfamily
1JXLA 4Q0FA 2EY2A 5ELFA 1HNXL 4HIDA 4G7ZC 1LTBD 1FGBD 3M9BA 1STGA 4MZ9A 1B4OA 4C3IG 1KJ9A 4AQYQ 5GAHC 4IR1A 4ME3A 5IOCA 4LWCA 3RV4A 4KTAA 3H3VH 2W9CA 3RNUA 1HPCA 1HR0W 1H9RA 2B2YA 2I46A 4O2DA 4WRDA 1XPUA 2R92B 4B3RH 2Y0SG 2FLPA 4CJ2C 1JORA 1V1QA 1AZPA 1PK8A 3T1YH 2J6UA 1L2FA 3HZXA 1KQSA 3F2BA 3FEWX 3PN1A 1TWAA 3CC7A 1Q81C 5EKLA 3G6VA 1HTPA 3H6MA 4JOIC 4JI4L 1BVSA 2K05A 5C1PA 4ZRZA 4U6PA 2UUBH 1G2TA 2B2VC 1EFWA 2Z9HA 3OWFA 4LF4Q 2W70A 4FDBA 1SRUA 1WD1A 3KLSA 2NU9B 4RAYA 3UDXA 4A3LG 2IP4A 3GTPA 4NB3A 3G6YA 4FXKC 1PZKD 5GADC 1HNWQ 4F87A 4IQZA 2W9CB 3SXHA 2IHFA 4OX9L 3H0GA 1N32L 3TIIA 4G7OC 1I94Q 4A2BA 3TS0A 1TY2A 4L8JA 5FOBB 1XMOQ 5CA0F 1I4XA 1HUMA 3TDQA 4DR5L 4X62H 1VQGA 4J9MA 2XIWA 1E0BA 1PV4A 3CC4A 1QJOA 4FF1A 1PH9A 1XNQH 1BXRA 3M4OB 1UUPA 1OTCA 1RK6A 1JX4A 2K33A 5CMDA 2NN6I 3GIDA 2OQ0A 4CDEC 5AFWA 5IWAQ 3MHBA 3J80W 4JV5L 2B2WA 3K3PA 3I91A 5JEAJ 1UAPA 3JAML 4R9WA 2B63G 4A3DB 1KLGD 4BY1G 4JCVE 3CCVA 3OIQA 2QKIC 2JEJA 3S9WA 4DR2L 2UXCL 2VPQA 3R8BA 2VQEH 1VQ9A 1RJPA 1T94A 4DA2A 4DAYB 5C4HA 2LS01 3OTOQ 3TIGA 4X3TA 4KK7A 3NHHA 4TSSA 3BG5A 3M9OB 3RB3A 1V1OA 5A2QW 4DV7H 1VBHA 1GGOA 3J81W 2B2YC 1R9TB 2ALYB 1BNZA 1TS4A 4YHHL 2EYOA 1EZ6A 3KK7A 5KFOA 2CH4A 4ID6A 4GNXA 1IYVA 4EG0A 1HTLD 4OHJA 4R7RA 3H15A 1VCIA 3CCMA 4R4CA 2DUDA 3PW4A 3K5OA 4RKLA 5D65A 3S15B 1DXMA 3M4QA 3MFGA 2DIKA 3NBHB 4JK1C 4K0KL 3AQQA 4NXMQ 5KNDA 1RJQA 2I8CA 3RIZA 2CW0D 3E0EA 4JI7Q 1E4GT 2C5CA 2L0CA 5IP9H 3VR6A 4LF5Q 2WFWA 5D1PA 4GOPA 2OLSA 3SGIA 2CQOA 2ZDHA 5IT9E 1SJHD 2XWBB 1ZEQX 1VQCA 2XNAC 4QUCA 4IFDG 4OWTB 1K83H 3NK9A 2NU7B 2R7ZA 5GQOA 2K1BA 1TWFA 2SNSA 1EIGA 4IUNA 2IWHA 2HQEA 4IPCA 2YW2A 5JUMA 3BZCA 4QF4A 5EKIA 5DQHA 3JAMc 2PVPA 2B2WC 1W3SA 4MV9A 1FGUA 1QUQB 3WO1A 2EIFA 2Z0SA 3BVZA 4JI5L 3DUZA 3PUYA 4IO9A 5BPHA 2E2HA 5AJ3L 2VUMG 3T1HH 4IPDA 2LMCB 1VF7A 2H5XA 5LMUL 2D62A 1HFNA 4JG2A 3HFZB 2KEEA 2EY6A 2RKSA 3ULLA 2BQRA 2IA6A 2LXJA 1M6VA 3G6XA 3TINA 1DJRD 1LM0A 2Q8TA 1SYGA 4AYBB 2C2DA 3KBXA 1HUNA 2R7ZB 3GTMA 1XNRH 1Y1WG 3CQZH 4JI0H 4JBJA 3PSIA 2J4XA 4KY5A 5EQ0A 2YU9H 4Z9CB 1Y69U 2KUMA 2EJGC 2OF1A 4EFEA 1EEFD 1W2BA 4A3BB 5KFSA 2Q8RE 5CBEE 3IAYA 1Y8PB 3R2IA 4BWGB 2V58A 1GD7A 4G4KA 5EAYA 3N42B 4ETSA 3TQTA 4FM9A 4IJLA 4LSAA 5FO7B 4DV4H 2HVSA 1B53A 1O80A 1L1OB 5C0XJ 2E2DC 4F88A 4GNXC 4DFAA 1KD1C 1A2TA 3PZPA 2X0SA 3W1BA 3K0YA 4RNMA 4IURA 2V9WA 1AW7A 4DKAC 1SEBD 4DV0L 3GTJA 4X3UA 1OXUA 1STEA 1SYEA 1SYBA 1D7QA 3KDFB 3UE1A 3GTLB 3FVQA 2W9BB 1H9JA 2IJ0A 3AEVA 4FNFA 2VQFL 3K5LA 4RUAA 1X55A 3EQLC 1WTHA 5FD5A 2VZAA 4RAZA 4Q8EA 3HOWH 3UE0A 5C4XG 1GOZA 2QDBA 5M3FB 1CE8A 3LP8A 4P71A 4EBDA 5GONF 1EYCA 1MD2D 1S68A 2HHHQ 2UUAH 4JI3H 5KFLA 1S10A 4BBRH 2HVRA 4RAUC 4GOPC 1K73C 5L1JA 3JRWA 2PZWA 4KD3A 5IYCH 1C3OA 1EEID 2E2JB 1Q8KA 1SNQA 1PTOF 2R61A 3I4OA 1IOWA 2R7NA 2KJXA 2UU9H 3DM1A 4GN5A 1QVCA 4LF6Q 3IFTA 4JI1Q 4DV1H 1HA6A 3MZ5A 1PH7A 2NN6H 1TS2A 1EL0A 1ZHSA 4E4TA 5KT2A 3NENA 1SNDA 2BA0A 4YCWA 3UDFA 2C00A 1KNAA 1YHBA 4RCNA 4YJ2F 2JA7H 1Y1VA 3CW2C 2JEGA 3GTKA 3C1FA 1ET9A 1YJNA 4J15A 1K0SA 3KAKA 1B3AA 3KF6A 2W6MA 2JA5A 4C3JB 2MJ8A 2YYZA 4NMZA 4LFCQ 3KLSX 2NTSA 3S2HH 5LMNQ 1CS0A 2PNHA 1NBWA 3I70A 2PZTA 4DR3L 2LSSA 1I7NA 2DN8A 1CK1A 2B8FA 5EJWA 4A3MB 4XT1B 3MR3A 2AWOA 1HQMC 4IUUA 4UDUC 5CBAE 3GQCA 2DY8A 3X3NA 3PMFA 2IX3A 2PQEA 4HJ8A 3I55A 1EFID 1VF5C 1RD9D 4A3JH 1OXTA 1B70B 3SK4A 2XRSD 1RKNA 3BVGA 3PIPA 2XD4A 4OEMB 5JAVA 3Q2OA 4J9NA 1MJCA 4A3KG 2CQYA 2FPIB 1TWCH 4A3KB 1J5EQ 1ENCA 4IUTA 1I4RA 1YHAA 3PW0A 1EQVA 5IGEA 3PW7A 2SEBD 4LF9Q 4X66L 3QR8A 3VA5A 4MV3A 3KJOA 3HXLA 4ED7A 4DXFA 3VR4A 2NZHA 3WDNA 1SYXB 2IY5B 1LABA 4ECQA 4YIJA 4J9RA 2UUCH 2F1MA 4A3FB 3KXYT 4QQBX 3GV8B 2D9UA 1TWGH 3OIPA 3GIPA 3CXCA 4OO1I 4X3SA 3KLRA 1HZ9A 2ZTCA 1TAEA 4QB4A 2L15A 2FPGB 2PO4A 4ECUA 3LWUA 3A56A 2VPSA 2KECA 4R4QA 4LH7A 2NUAB 4B3RL 1KC8C 3D3RA 1N36Q 4EYIB 4TKOB 4F7XA 3BJYA 2E74C 1HJPA 1EU3A 4UP9A 1O7IA 5KFFA 1UNSA 1WTRA 1PH6A 2JA6G 4LK1C 4BY7H 3M9NB 3HOYG 4OWXB 2DNCA 2L1BA 5C4JH 1CQJB 1ESFA 4NXNL 3HOYB 2YTVA 2B3GA 4LFBQ 5HV6A 1PA6A 1E4FT 2UUBL 2CH4W 1DZ1A 2JQOA 2BDNA 2F0VA 1C7YA 5KYLA 4CKBA 1LACA 1WCMH 4HNTA 3RZDB 2JN4A 4DR6Q 3D6WA 1WTVA 1P8LA 3QZ7A 2R87A 3TP7A 2XGQA 4UPAA 2EPBA 1YNJC 4KHPL 4C5AA 4X65Q 3K80C 1U4MA 2K01A 3F2DA 1LTTD 2MQHA 2ASBA 2AGPA 1AP0A 3GV6A 1G8ZD 2F0HA 3HKZB 2WV6D 1XNQL 5M3MH 4DV6L 2FP4B 2PYKA 5I6YA 3R5XA 3WO0A 4RUCA 3CF5A 3LX0A 1M1KC 1ZHQA 1N32H 2VB2X 2F0QA 1FR3A 1B6SA 2BR0A 1KRTA 5BR8L 2M9VA 3NEMA 1I4HA 5BN5A 3MWMA 4DR5H 1TWAH 1RIPA 3T53B 1SSOA 1LUZA 1MSHA 1SMYC 4DF7A 2ASDA 2JYOA 3I4MH 1KDBA 3PUVA 4I7ZC 4QY7A 3VA7A 5JVH3 4JV5H 2FHTA 4L1KA 1L2ZA 3GTPH 2WINB 1S5CD 3M4YA 2WACA 4HEDA 3ORQA 1STHA 3H0GH 4YR3A 5IT9L 1JOQA 1Q7YC 1G6PA 4DV7L 5H80A 4JYAQ 2E5LQ 3DMUA 2L4NA 3CAMA 5HGTA 1PTOC 5KFXA 1X3EA 1A9XA 4Q5VA 3RBDA 2UXCH 2SDFA 3IG0A 3VPCA 2MHVA 1S5DD 1HHVA 2PN1A 4MV8A 2E76C 4DUZL 3MWEA 1F2YA 2AGOA 4IRCA 1A15A 4S3SA 3U4VA 1PHJA 2N88A 3GTQB 4XYLB 2VL6A 2BE5C 2OQKA 3PW5A 1MGSA 1VMCA 1EZ1A 4GKJL 1CKNA 3RTXA 3BDCA 1AN8A 2ZT9C 1B50A 1B33N 3JSLA 4ED8A 1SDFA 3IRBA 1XTDA 3EN2A 4A75A 3CCLA 3TRZA 4N9PA 1WSCA 1UC8A 3NTHA 4A3EB 1M0WA 1I50A 3JSNA 2JP1A 4DGZA 1HR0L 3NP8A 2PZUA 1X3PA 1A2UA 4LMYA 2W6ZA 1VQJA 1FNWA 1K9MC 2HDLA 3K59A 2N55A 5D8DA 2J0TD 5I2XA 3OSNA 3A8JE 2GA4B 4EQNA 5C1OA 2IBKA 1ZKOA 4RZRA 3D0FA 1VQBA 1TWHA 1F9SA 1X54A 3J7A5 1L0XB 3V4ZA 3HEJA 4J9LA 1G291 3MXUA 3FKIB 3URYA 1UEAB 4BA1I 5IP9G 3U9OA 5C0XI 2WTFA 1BQQT 3LWBA 3T1HL 4C2MA 3CKIB 2XCPA 1I50B 1PRTF 3HOZH 3IL8A 4DV5L 4F4ZA 3S1NH 2AQ1B 2K5NA 1VQKA 3OOCA 5IT9c 4NP5A 4X62Q 5KFDA 2B2UA 2B29A 2K32A 5KG4A 4DL2A 2C28A 1N33H 1BGWA 5IIFA 4A3CH 4C3HH 2ATLA 4HCEA 3UFXB 1H9KA 2MP1A 3G71A 5LMUH 3J7ZC 1ZXTA 4KD4A 4AH6A 2A69C 4OO1H 4B3MQ 4I7HA 1PFSA 3A8IE 2AGQA 2KHJA 3KHHA 1X56A 1TWFH 1BF4A 2NVYA 2LFNA 1E4EA 5JH7F 4BBSH 2W9AA 5JVLA 4DV4L 2FINB 4IOCA 3J81j 3I4NB 3VYTA 4Q44A 2JEFA 1G91A 5ELOA 1I6VC 1PVOA 1D8LA 1KJIA 1VQMA 2VQEQ 2E2HH 1SE3A 3GD7A 2ATWA 3Q1KA 5KFBA 2PW5A 5KG1A 3C2PA 1W6KA 1D5ZC 1Y8NB 3H09A 1NJIC 3HP3A 3GTGB 4K8IA 1RTNA 1LTID 3OUZA 5A2QL 3PR4A 1SAPA 5M5WH 5JEAH 3J81L 1JKJB 3BJUA 1Q1EA 4EBEA 4WBNF 1YIJA 3GTMH 2N49A 2VQFH 3GIMA 3SK6A 3K5NA 2HCCA 3S1MB 4AYBE 2WE6A 2LXKA 1BCPD 1DYQA 3JC66 5IP7H 3PO3H 2VR1A 2O4XA 1M8AA 2UU9L 2VA3A 3FRPB 1CT1D 3S17H 2A68C 4K5VA 1EUJA 1V43A 3PIOA 1W93A 1A8VA 4JVZA 4Y8VB 3U50C 4U673 3HOWG 5EPJA 4M7EA 2F0MA 4L6TB 3BQ2A 1JOOA 3CCJA 4CHTB 2BH8A 1STBA 1VQIA 2NYZD 4IJHA 5IYZF 3PUZA 4JUZA 1EY4A 2NVTH 1PX2A 2UXBQ 1WTXA 2QEJC 4ZOLF 5FJ8H 5IYCG 2V4RA 2MCTA 1CZWA 3K7AH 3KHLA 2B2UC 3KHRA 5DG7A 5KG2A 2R6FA 3QZ8A 4X64H 5D1OB 3TBIB 4MTDA 3BDOA 5C44B 4ECVA 3S1RH 2NN6G 1F2MA 2W6OA 3NPPA 4M9UA 2R8HA 3QB3A 2KCTA 1HNWL 2WB1B 4YAJB 2EDGA 3QIAA 2PQAA 2IX1A 1IBMH 1I94L 2JA7G 3HOXB 1QZGA 4DR3H 4HN7A 3CMEA 2RA4A 3BS1A 1XPRA 1TS3A 1EUCB 4ECZA 1KLUD 4CKCA 3Q8SB 2WDTA 1GUTA 3A55A 5IWAL 4J9KA 1Y1VH 3RLNA 4HJ9A 3H40A 2R92A 2AUJD 3KF8A 5M5XH 2D0PA 3D4DA 4JI0Q 4DR7Q 2F0LA 1ULZA 3ORRA 3RB6A 4ZI7F 4X66H 1D1KA 3GQBA 4DK1A 4A3JG 4XIGS 4RU9A 1QWYA 1SBBB 2ENBA 1PZID 2XSCA 5GAGC 1PZJD 1G51A 1O78A 2UVWA 3Q23A 1TWCB 2YTYA 3JZIA 3HB9A 3RFCA 4IWXA 1SLJA 1GUSA 1VQPA 1I3QB 4C3IB 2NZ1D 2WIIB 4L5QA 1JJCB 4QW9A 1ZETA 3MFIA 2N78A 3GP7A 2UXDQ 3FMAA 2NVQH 4HNUA 3RMHA 1S3OA 2GPWA 4LFAH 1B9MA 1JDEA 3V6JA 3TP8A 1VQHA 4HYKA 3KF8B 3F1ZA 3ER0A 5I9OA 1BXTA 2DNEA 4CJ0B 2UUAQ 1KJQA 2ASJA 2Z6BA 1S0OA 2Y0SB 1MSGA 1PRTC 4V190 4A3GH 5C0XH 2I5LX 2F0FA 2I5MX 1UC9A 3BVMA 4HMJA 1FD7D 4CDDC 1WFQA 3PCOB 4NXNH 5J39A 1L0WA 4R4IA 1N34H 3S1QH 4QGUA 1TT2A 3HKSA 4DL7A 3AFQA 3UQ8A 1B3QA 1X32A 4DV1Q 3PVXA 1EQRA 4BY7G 1GKHA 2DWCA 1CQIB 5L9XA 2AQ4A 3FP9A 4LF5L 1PTOH 1TVXA 1PYBA 2UVRA 2JEBI 1YITA 1GLVA 2JK8A 2R93H 1KRSA 4LMQD 4KHPH 3VPDA 5EWGA 5I9PA 3I90A 1J6QA 2D2CC 4YJ3F 3H20A 2A6EC 4NPSA 3X3MA 1WCMG 4C1NI 1X6OA 1JR0D 2O5IC 4DAYA 5KKNB 1QVGA 4A93G 3GV5B 3PW2A 4Q0YA 2X6LA 4OL7A 4DV6H 3GV7B 1IBKH 4J0MA 4A93B 3T51B 2A74C 2ZJTA 1AZQA 3MR5A 2R85A 1Q82C 3A54A 3L2PA 1R9TA 4LF7Q 1C30A 5BR8H 4DR1Q 5CC4A 1YNND 5KFYA 5F9NA 1IBLL 5M3MG 3P75A 1KC7A 1PH5A 2G5DA 2M2LA 4DL4A 4H7BA 1WD0A 2FFKB 1D2BA 3K58A 1LTGD 1U9RA 1K3RA 3BZDB 1SE2A 2B63B 3JRXA 4KHZA 4BY1B 3V05A 2IT1A 3M4PA 4RH6A 4DU9A 4B3SH 5L1KA 3Q22A 3NBHA 1XX8A 5DQGA 4XT3B 1FVIA 3I4MG 3HKZE 3K0XA 4Y52H 1SE4A 4F4WA 4BS9A 2UUCQ 3I4MB 1SFOH 1Q86C 2VUGA 2W8KA 4AIMA 1CHPD 1E22A 4KN4C 4UCOA 4O3SA 1Z2NX 1PH1A 3M4IA 2W8LA 1SNCA 2K5HA 1HNZH 1A62A 2Q2HA 3H0GG 4DUZH 3GLKA 1STNA 2EY1A 1T5XD 1RHPA 1STAA 1WJJA 2KENA 4OIKA 1HNXQ 2VY3A 4ECXA 1ENAA 2R7KA 3FMCA 4IUQA 4GKJH 1K8OA 4K2KA 5IGBA 1QUQA 2ZJPA 2YZNA 1B8AA 3J7YW 5JVG3 3U9SA 3EPGA 5LYJF 2RF4A 3K5HA 2IMWP 4A2AA 2VW9A 5KT6A 1DOKA 2K04A 1UNNC 4ILWA 1GSOA 2N3SA 4RHRA 1HR0H 1B04A 3NGDA 1VQLA 3NQIA 1FYCA 4L63B 1EY9A 2GVBA 3MTSA 1QG7A 1RDPD 2XTIA 1SNPA 3DHQA 4B3TQ 1GUGA 4AYBA 4CDCC 2F0EA 4C56C 4JI4Q 4LF6L 4ED6A 1TR5A 1Z2OX 5DLFA 4GKKL 2CQAA 1BUVT 1WH2A 4YY3L 3S16B 1DCZA 2IHEA 5F2DA 2JA8H 2QK4A 3RUZA 2R7DA 2SOBA 4MV7A 3R5HA 1SR3A 2J6SA 2H1EA 5EBCA 1N33L 3OHBA 1L1OA 5ELEA 3SI8A 1X3FA 2RDGA 2NVXH 3M7NA 4OX9Q 1YVCA 1NMGA 2VUMB 3GILA 2K7VA 4RB3C 4DV5H 1PFBA 1S0NA 3GTOB 5CV9A 1JIHA 5C5LA 3KDFA 4DR5Q 2ASLA 3GTLA 2W9BA 1RK5A 2R8JA 4ME5A 4DR4H 1ML0D 3RD4A 5BN3A 5KG5A 4LUZA 2RGVA 5K36H 1TWHH 3HOZG 2HJWA 2ZM6H 1X3QA 2HIVA 1Y1WB 4POGA 3FDSA 3TMEA 3C1EA 1CSQA 4KMUC 4A3CG 1BNCA 4C3HG 1PYSB 3T13A 4C2MH 2F52A 4K5XA 3P20A 2OCEA 4OO1G 1S4ZA 5HURA 4GLAC 4DR2Q 4JI8H 2GLTA 1F77A 2DGYA 2F4VL 5KFQA 2F0TA 4K5WA 4BBSG 2ZXPA 3S2DB 3C46A 4DUYH 4BBSB 2ZTDA 4RZQA 2MNAA 2CWAA 2IPKD 3OYYA 4H44C 1JWUD 5LHY1 4XZ3B 3AFPA 5C4XB 1F2ZA 3FPUB 4LH6A 5I2YA 4IPHA 3E9IA 2I5HA 4YHHQ 4EQPA 4FO2A 1FJGH 3F8NA 5D14A 1LTLA 2IX0A 3C0FB 5JJKA 3KFUA 2OTJA 3Q6SA 1WTPA 3CRKC 5JEAG 1XPOA 3LNNA 2FMMA 4EEQA 1RCVD 4DK3C 2B8GA 4DNRB 5DGBA 1Z9FA 2YRWA 3CPFA 4DNIA 3HOUH 3K6OA 4K0KQ 2KCCA 5KFWA 4JI6Q 3ZYYX 4LFBL 2ZDGA 1S5ED 1XWEA 3KAJA 3ERSX 3G6EA 4JW0A 3T5LA 2K4KA 2QCPX 2N8NA 5IP7G 3PO3G 5KT4A 1L1OC 4X64L 1GYFA 4ED2A 3ETHA 4DAVA 4IN3A 5COYA 2KEDA 3E5NA 2CHBD 5KG0A 2A73B 1GHKA 4HIKA 1D5XC 3DXJC 4O3OA 2KBNA 3ULJA 2WAQG 1IBML 4FF4A 4LF4H 4MHEA 4O1NA 4KKSA 4R1JA 4Y7NB 1YJWA 2WAQB 3S14H 4OGQC 5FO8B 4JI2Q 5LL6S 2NVTB 1QNKA 4B08A 5FJ8G 1JLLB 3MR6A 1BKBA 2PNRC 1I6HB 1VQNA 1HNWH 4JI5Q 4MIUA 3N44B 2MO0A 3FDTA 1I94H 1JCKB 1PXUA 1SN8A 4MV4A 4UY8C 5LMUQ 1UWVA 3MWYW 5IE8A 5CAEB 3KHGA 5DAUA 5CV4A 3GIJA 4LF8Q 5KFUA 5FLMH 3S1RB 3I56A 2R82A 1EQTA 4HJAA 4WFN3 4ZK9B 4EGVA 4L5TA 5IWAH 1M90C 4QCLA 3SVMA 1ZYRC 1WVLA 4ULLA 1OXSC 5I6WA 4BXXH 2F3WA 4UP7A 5I4DA 1Y1VG 1Z6HA 4CDFC 1RTOA 2O5JC 2WB1E 3A5ZB 2V59A 5M5YB 5ELNA 1B9NA 1JC7A 1UE6A 1WTWA 5M5XB 4LFAL 1KNEA 5KFAA 3DEOA 1U4PA 5HY6A 5EZYF 2RCNA 2E2IB 1X9NA 2V4QA 4DV0Q 1KEEA 1LTSD 2NU8B 4C5BA 4TQSA 2ICEC 3OTOH 1RYRA 2R92H 3HKZA 3BQ0A 1OO9B 3KOJA 4J9OA 2VQFQ 1B6RA 5EPKA 1K28A 5EOYA 2JA6B 3O13A 1IYJB 3VYSA 1WYDA 4KKTA 1N34L 5LXTF 4RB2C 2F3IA 2FLLA 1JICA 4UCSA 2AMCB 3I3CA 3I4LA 2JSOA 1A6XA 1O7YA 2YZMA 4HR7B 2FK3A 1BCPB 1AEXA 4QIWB 5C3EH 2NVQB 4GC7A 1GHJA 5E4WC 5IY0A 3AMUA 2W6QA 3EROA 4IUPA 1LT4D 3K8AA 5EBDA 4A3GG 3HRZC 5C0XG 2E75C 1CKMA 4TQUS 1DV2A 2I80A 4RWSC 3Q8QB 4JBWA 4LF5H 4DN4M 1IBKL 2AHOB 3LWEA 3RLOA 2F0KA 4ZQIA 2BA1A 5ISRA 3GV3A 3CPWA 2GN5A 1IKLA 1Z47A 1XTCD 3PO2H 1C48A 2SNMA 3BZKA 3IFDA 3M4OH 4FBUA 3UI2A 5LMNW 4IZ8A 1VAJA 3AYHB 4RHSA 5CV6A 1V4YA 3RGZA 2Y0SE 4HJ5A 1GVPA 3CMAA 3RAXA 1NAPA 2R93G 3A5UA 1AUVA 2AU0A 2QGQA 5CV7A 3GTQA 5EPLA 2CZGA 3KLWA 1N8RC 1LTRD 2OTLA 3BA9A 1O75A 1KIXA 5BPFA 1WI5A 1FNVA 5CV5A 4B3SL 3MFHA 1XXGA 3BG3A 4A3DH 3DM3A 3SDZA 1IBLH 1ASYA 2EYMA 2Q8IB 2IW3A 2NBFA 3HOVH 4LAAA 3TZDA 4GN4B 4B3ML 4EGQA 2G9DA 1H9SA 4RGOS 4DV2L 1KAAA 3H3VC 1AUXA 4DV3L 2ZXRA 2H4OA 3NTIA 1Q1BA 3Q0AA 4LUVA 1H9MA 5KFRA 3R23A 3U9TA 3T5HA 2RBMA 4X66Q 2L12A 1QNUA 1HNZL 3HBLA 1AE3A 1EY8A 2A6HC 1D5MC 4EGJA 1N56A 4JV2A 2F0JA 1N48A 3V96A 1HFGA 1R9TH 5CA1F 2JEIA 2QILA 4KY6A 5H1SE 3R2TA 5EWEA 4UAIA 1L0YB 3RUPA 2ZJRA 1VKZA 3MXNB 2CW7A 1CA6A 3OMCA 2DZDA 1VBGA 1EU4A 1IW7C 4XQNA 5DG8A 1K8GA 1PDQA 1JMCA 3FKIA 5JPNC 1AH9A 3SK8A 2C35B 3CCSA 4QWAA 3S15H 5LL6b 1EYDA 4B3RQ 1SFOB 5KFGA 3PV0A 1H9SB 3D6CA 4ZUJA 1ASZA 1DOLA 2VB3X 4HTHA 3VR3A 3P1HA 4PG3A 1S72A 3CRLC 1RL2A 4EQOA 3A7LA 3F8TA 2FK1A 3T1YQ 2BOSA 4I50F 4F4XA 3FHWA 4EFBA 4NXNQ 2LY7A 2HHHH 2ZXOA 4DLKA 2UUBQ 2J9GA 5T1IA 2MPMA 1IOVA 1QILA 3STBC 5KFZA 1M4VA 4K8JA 1S5FD 2I0QA 2K5DA 3I2ZA 5KT7A 3HGBA 1XJVA 2EYJA 2CW8A 2TMPA 5KGUA 3CCEA 3G6JB 1E2ZA 5CYUA 3EFXD 1EYZA 2UXBL 4LF6H 1MBYA 1SNOA 4JI1H 4GKKH 2CCZA 5KFTA 3K3VA 2NTTA 4IRKA 2NU6B 1EY5A 4YY3H 2GVAA 2PMZB 2AWNA 4APMA 3J7AF 2K5WA 4ECRA 3R93A 1TXYA 1O7LA 1XNQQ 1VQEA 3H3VI 3SR1A 4DV6Q 4DR4L 4O3PA 1KABA 1Z7TA 4XDXA 1K83B 3GTGA 5IGFA 4RNOA 4NKLA 4O3NA 5KNBA 4N8FA 4LFCH 2ZM6L 2WP8J 5BR8Q 4KLKA 3E6ZX 5EGTA 5LMNH 2R7ZH 4PZ7A 1XDNA 3D31A 2MO1A 2A1AA 4OXPA 4WJ3M 1K3BC 3QO2A 4A3BH 4YCUA 2F3VA 4ABNA 2VOBA 2JEAI 3T5JA 5E3FA 1VQDA 1KBLA 2P5ZX 4JI8L 1DM0B 4R8NA 5IGGA 5IGCA 4GC6A 2XGTA 1OXXK 5K36G 4Q43A 1HQRD 2BQUA 4NDXA 1YNJD 3A0JA 4ZAIA 4DUYL 4DR7L 2F0SA 3L3OC 5EWFA 1J5EH 2OWOA 3K57A 4LF9H 1NR4A 4B9WA 4DV7Q 1PH8A 2K14A 1S0MA 3CQZB 4POFA 5L1IA 1EY6A 3OPOA 2YU9B 3W3AA 2F4VH 1XMQL 5M3FH 1FJGL 1SNMA 2XWJB 1EY0A 2MUYA 1ET6A 4G7HC 4AQYL 1M0TA 5D1OA 2ZJQA 3NXWA 1JT8A 5JJIA 3OW2A 3OHAA 5BN4A 1GXDC 4GLXA 1UEBA 2E2JH 2UXDL 4J9SA 2WB1A 1SMYD 5A35A 1YI2A 2JA9A 2L5TA 1V51A 2PPBC 4ZKBB 3PUXA 3G7LA 3VR2A 1NNXA 2L11A 4FXGC 4EBCA 1HR0Q 3HOWB 3GTJH 2RHSB 4BBRG 3B6YA 5FKAC 1JQYD 4BBRB 4H13C 3RJ0A 2B2TA 1XYIA 2KHIA 4LFBH 3D4WA 4Q45A 4LF4L 1RJRA 2R3ZA 1PTOD 4C3JH 1FL0A 3HOUG 3MVVA 4ZKCB 1MIUA 1Q12A 4A3MH 3DWAA 4XQQA 4U7CA 2BE5D 3RN2A 3PF5A 1ZQ7A 1TQOA 2MGSA 4QJFA 4TRDA 5DEHA 3T1HQ 3QJYA 1SMXA 1XMOL 3CVZA 2FE3A 4DV5Q 1TWCA 2BCOA 2JA7B 3J7AK 3W1GA 1K1SA 2QA4A 2W6NA 5EKKA 4Q8FA 4JOIA 2RVLA 1I3QA 2B2VA 2L9HA 4KKUA 4O2AF 4XQJA 2RCFA 4RB1A 3KBGA 1Q90A 2YV5A 3GTKH 5FLXW 5NUCA 3S2HB 3M9MB 1XNRQ 2BDOA 2M05A 4QMGA 1PH4A 3VMMA 1U5KA 3S14B 4IZOA 1DD2A 2JA5H 4WJ4A 1G2SA 1JE5A 3M3YH 4FBTA 2Y0SA 5IODA 4K14A 4YWMA 2W7PA 4X3KA 4BWSC 4YWLA 1QVFA 4R8UB 4A3FH 3N52A 4QL5A 1CHQD 2BQ3A 2CW0C 3ETJA 3EPIA 4DV4Q 4A3JB 4FF2A 3E5SA 4YCVA 4GN3B 4F50A 1F9QA 3DEPA 4K6LA 3KYHC 3L4KA 5FLMG 2WYOA 2XCAA 2WAQE 1V1PB 2YCHA 2OT2A 3OTOL 1FKAH 4QWDA 3N8DA 4ODGA 4C5CA 4XYQA 3UDIA 2XRQD 4IFDJ 1OWTA 4FS1A 4JYAH 2QYZA 2A5HA 4RG1A 2RGRA 1CI3M 3J80i 4BXXG 3PR5B 3W5OA 3L7ZC 3CCUA 1TWGB 2DJFC 4A3IH 3QWNA 3PIO3 3CCRA 4JI3Q 1RJTA 2NZOA 4O3QA 1NE3A 2HGSA 5C8YF 4J8QA 1YJ9A 3W2DA 4KJNA 2B2TC 2A69D 1TA8A 1B44D 1HZAA 2F0DA 4YQWA 3RZDH 2UU9Q 4IUVA 1QOHA 1LT5D 4J1MA 3AU7A 2R92G 4NXML 4PQXA 3TSSA 4JI7L 2PBZA 4QWEA 5DM73 4ECSA 4BY7B 4RGTA 1C8CA 1LT3D 4N8X1 2FJ2A 2O03A 4K6DA 5C4JB 5IYBH 5IYDH 2B63A 3EA6A 2PI2E 3RLFA 2KHSA 3NTKA 3J81i 4V0BA 3QOJA 5KNCA 4BA2I 1Q8IA 4B3TL 1A3UA 1K8MA 2RDFA 3CC2A 2F0IA 1F9PA 2Z4HA 3CD6A 3OSPA 5JVDF 4RMFA 5CR3A 1WCMB 2JXMB 5C3EG 1SJED 2F0PA 2F0OA 1C0AA 3L4JA 2WKCA 5C3EB 1I4GA 1S97A 4YP3A 1V8QA 4ECTA 3RN5A 2CKZB 1DV1A 5C5MA 2X6GA 4P73A 2CVRA 1PLFA 4ZCKA 3TP5A 3TN2A 1IHZA 3N43B 3Q8DA 5CGKA 1BR9A 4P74A 1F2LA 3RB4A 3SEBA 1YHQA 3RBEA 5M3MB 2EYFA 4ED1A 2AKWB 3K81C 2EVBA 5C3XA 1EOTA 1I5FA 5GAEC 2EY5A 4QIWE 3MC0B 3PO2G 2A68D 1W6JA 3E0JA 1GM5A 3LGJA 4PMWA 1VQ7A 3PO2B 4DL5A 2AQ2B 2XN9C 4HIMA 1V9PA 1Y8OB 1TWAB 2DJGC 4CKEA 4B3MH 4DV2H 5LOVF 4DV3H 1RODA 5F9LA 1G6ZA 1UE5A 1MJEA 4A3DG 3RB0A 3RAQA 2AUKA 4PDBA 3GTQH 4WORA 1E1OA 3GTPB 5DLGA 4MTKA 1I4PA 2RQXA 4RGMA 3WWVA 3HOVG 3RZOH 4IHJF 1BO0A 4O4HF 5KT3A 3HOVB 1CZGA 3M7GA 3H0GB 1DIKA 3BABA 4U68A 4IWYA 1RYSA 3V4SA 3E3XA 4HIOA 3PUWA 4UCTA 3V6HA 4P72A 4YWKA 3BQ1A 1CUKA 1J9OA 1N9WA 2Z1CA 1W96A 2R86A 4A3EH 2TSSA 4HCSA 4J9QA 1VQOA 1NMFA 4IRDA 5BMVF 1KTKA 1QE6A 3CHBD 4FVMA 4L5RC 4DPGA 1NUCA 2VUMA 1JJ2A 2HHHL 2RSOA 2EYHA 3SHLA 3T5KA 4JBKA 1LV9A 3GTOA 5KG7A 5FLXE 5KFMA 2MFIA 3L9AX 1YZ6A 5D3IB 5KFNA 2Z6KA 3DWQA 4CBVA 4IOAA 4UP8A 1I4QA 2R6GA 4JI1L 5KIXA 3FKIH 4JI6L 1Y1WA 2K28A 3MFYA 1EHIA 1R4QB 3H4BA 4F8MA 5FPOA 1I50H 2V5AA 2XVSA 1BBXC 5JJLA 5DNFA 2CFMA 2YYAA 1X3GA 1A63A 3QFFA 2HQLA 2D5DA 2UXBH 5E1FA 1F9RA 1N32Q 1E24A 1Z2PX 4DL6A 3WOFA 4TV8F 2M00A 4LFCL 4RCOA 4GNXB 4UCVA 5HGQA 3EBEA 5LMNL 2Q2TA 4MNOA 2B39A 1HH2P 1KXLA 4FS2A 4RA8A 2PCFB 1A3VA 4OELB 4JI2L 1VMPA 1SE8A 4JV5Q 2FB9A 5CV8A 1PRTD 4CJ1B 3HOZB 1EQQA 1GUOA 3S1NB 1QB5D 1NTGA 1CM9A 1TIID 1IBLQ 4X6AH 4I55F 3I4NH 2EYPA 5KEEA 3CCQA 4H0LC 3K5MA 4MTEA 5DQIA 1UE1A 3EVQA 4C3HB 1IZ6A 4LF8L 1J5EL 2YL2A 2FJZA 3TQ1A 1CQVA 4ZYSA 4GOPB 4TQRA 4LF9L 5KYIA 4OIJA 2EQSA 1TKWB 4AYBG 5IGDA 1T9HA 4WJWA 3F2CA 2R7ZG 2UXCQ 4O3RA 3NWTA 3KALA 1EY7A 2PMZE 3GTGH 2VNUD 1TWFB 4M8AA 3Q8RB 4A3BG 2F0GA 4LJZC 4DR7H 2EZVA 1U4RA 5DLQE 1QZHA 2HT1A 2A6ED 3MA2B 2QF7A 4H02A 3ICEA 2NVYH 3F2UA 4R4TA 1II3A 2K6AA 4ED0A 2E2HB 1XMQH 3S1MH 3JAMi 1BCPF 5HBRB 1N36L 1CFMA 2YS7A 4G3IA 4KJOA 1SROA 2WAQA 5KFJA 3DF7A 1EOVA 3NBIA 2Z6KC 4O42A 2G9HD 4P75A 4AQYH 1JDBB 5T14A 1P16A 4CC5A 3PQIA 1D6EC 5M5WB 1MZBA 5M3FG 3Q8PB 2UXDH 2KOLA 5DG9A 5C3WA 3GTMB 4F4YA 1CQFA 3SE0A 1JB7A 1I7LA 2K5VA 3UDGA 2VS1A 4ZLTF 2W7OA 3PO3B 5G3LD 5JPMC 4DR6L 2E8GA 3ERQA 3EYYA 5J3BA 3J80E 3S17B 5ELDA 4LW1A 4GLVB 1OXVA 4JC0A 2EXZA 4PZ8A 1CKOA 2J6TA 4DAPA 4X65L 1SYFA 1AE2A 5C44H 4OWWB 4WD3A 4EYHB 1EWIA 4ECWA 3H91A 4GKKQ 1VQAA 3GTJB 1TY0A 4YY3Q 4RFBA 1C9OA 2RSNA 4G57A 3WNZA 3P7JA 5KX5F 1PFMA 2KA7A 4KV6A 3U4ZA 3HOXH 3MEFA 3OWEB 1J8IA 2A19A 1WR2A 1N33Q 4O0AA 5GROA 4IFDI 3K7AB 2XCLA 4JV0A 2PI2A 5AJ3Q 4I7AA 4C3JG 4JBMA 2KSWA 4DR6H 4ZHQF 2K50A 1XMOH 2E2IA 3BYYB 1Q46A 3I7FA 2FMAA 4DXGA 5A2QE 3R5FA 3M85A 1JE4A 5M9OA 4A3MG 2Q2UA 2BH2A 3J81E 4YR0A 1SXTA 3OUUA 1LLRD 1TU2B 4GS3A 5J2TF 2JA6A 3GIKA 3T4AC 1Q3LA 4LF7H 1GO3E 1EZ8A 3RV3A 4DR1H 2DY7A 2HD3A 2F03A 2YZGA 4O4IF 3G4SA 2DPIA 1KDCA 2AQ3B 3JAMW 4IALA 5DM63 2HVQA 1T36A 2K5QA 4A4IA 3I8ZA 4HR7A 4QIWA 1E3PA 1Y1VB 3GTKB 4JYAL 2E5LL 1LYLA 2K03A 4MA5A 1SYDA 2JA5G 1I3QH 4C3IH 3KF6B 2KQ3A 2F0UA 4QW8A 3NUCA 2JA5B 1BOSA 3RR5A 5DGAA 3M3YB 4A3FG 2F4VQ 2EOTA 1VQFA 3DWPA 2FPPB 1IKMA 3OSOA 3IN5A 2QEXA 1VQ4A 4P2CB 3TP6A 2VA2A 4JV1A 2QW7A 3SE7A 2RDHA 1VQ6A 4O4LF 2FLNA 2W57A 1HNXH 5FO9B 4IPGA 1JWMD 1BBUA 3HG9A 1EYGA 4ECYA 2HDMA 3EIVA 2R93A 5KFIA 5KG6A 4B9XA 1AN7A 1VQ5A 1PH3A 4HMIA 1CTMA 4A3IG 1GSHA 1I6UA 4FP5D 3T1YL 4DL3A 4A3IB 3GDEA 2JJQA 4NXMH 4PMBA 4EEYA 5LL6X 4A3LH 2SCUB 5FPRA 1HZBA 2DPJA 2UVUA 4A3GB 4JI7H 5E7NA 5K2MA 2EJMA 2ALZA 3CU7A 1HRJA 3VPBA 4ZQ3A 2ZTEA 3BYTB 1O7ZA 3S24A 4HJ7A 4X64Q 3S1QB 1NSNS 4MN3A 2NUCA 1CA5A 4B3TH 4A93H 5CB4F 2DLNA 4JI4H 1PH2A 3T16A 5IYDG 5IYBG 1IBMQ 1PTOB 5L37A 3PIP3 3MAQA 2XGPA 4DR3Q 3HKZG 3MXNA 2R93B 4X62L 1E2VA 3N6XA 5ELBA 3E9HA 3CP0A 4PWQA 1JB3A 3TREA 5KFHA 1EIYB 4OX9H 2B63H 1DOMA 5EDWA 4BY1H 4KHVA 4MV1A 1HXYD 4GZYC 1YNXA 5FLXL 1ICWA 1SFOA 1BCPC 2HCIA 2C9OA 2RHQB 1E1TA 3D4RA 3A74A 2LKVA 4L5SA 1S9FA 2F0NA 4OONA 1C4QA 3ULPA 2KCMA 1H95A 4XYOA 4E6IA 3BAAA 4MV6A 1WOCA 1HCZA 5LA6F 1E7ZA 2YS6A 2FK2A 1NCVA 2VQEL 1KJ8A 1ILQA 1R4PB 3EJIA 4NLGA 1SYCA 1MKHA 4EQ5A 1PYWD 5C5JA 3U58A 3TS2A 1GSAA 4HSPA 2I07B 3I12A 3NELA 2PW7A 3J7AV 4DK0A 3DLLA 4RB0A 1K8AC 4LFAQ 4DR2H 1IL2A 2HIXA 3Q24A 5ELCA 5C6AA 2KCNA 2XC9A 2PMZA 4YR2A 2IL8A 2RDJA 1JOKA 1GUWA 3ZJYC 1EWHA 2KVMA 3RZOB 1K83A 1S03G 3RF2A 1T5EA 1IYUA 1ESRA 3MEHA 1KJJA 2NB0A 2L55A 1BBWA 1B2TA 4UFZA 3MXPA 4YHHH 1N34Q 3ITPA 3NSWA 4MTNA 3BU2A 5JOBA 4ME6A 1MHWC 4A3EG 1SEIA 2D0OA 2FXQA 4KN7C 4IFDH 1BJTA 1ZYRD 4QWCA 4UHVA 1CSPA 1S40A 5FD6A 1KHIA 1PMRA 3S16H 2NVXA 2EYLA 1WTQA 4YBZB 3N41B 3JAME 2C22A 4KHPQ 3VR5A 4K0KH 4QWBA 4DAMA 4HSVA 4JI6H 5KFEA 1D1IA 2YTXA 1HA5A 5J22A 5FLXc 4FXDA 3N40P 4TVAB 2VUMH 1EUDB 2RDIA 4I65A 1IBKQ 1YBYA 5J1ZA 3GTOH 3A7AB 1CKNB 3FKIG 5L1LA 2HUGA 1VS0A 3CQZA 2JE6I 5KFCA 2YU9A 2JA8G 1NY4A 4PNYA 4N9TA 1MI2A 1ENFA 2JA8B 1AFPA 3H94A 1X65A 4ALPA 3OW7A 3VYRA 1B7YB 3G8CA 5KFVA 3FPPA 4J9PA 2C2RA 3MR2A 4JI2H 1Y1WH 4O2BF 2NVXB 4PZ6A 3KJPA 3GIQA 3BA8A 2R8KA 2VXWA 4FF3A 1Y14B 4B3SQ 2R8GA 4JI5H 1A3TA 3OMGA 1EYAA 2Q2IA 4ED3A 2UVVA 2R7FA 3LMLA 3VYUA 1XNRL 1ICFB 4JI0L 3ND8A 1UE7A 4HNVA 3J80L 2OXPA 3NE5B 4DV2Q 4LF8H 4DV3Q 1TWHB 5JQWA 2J7ZA 5KT5A 3GTLH 3S2DH 3V6KA 4PMCA 3TEHB 4I4TF 3A8KE 3I4NG 1HNZQ 4IR9A 5J2UF 4J6HA 1EIHA 4DUZQ 3KTMA 1VQ8A 4RNNA 5C4XH 4MA0A 4C2MB 1ONLA 2OEOA 2Z8LA 3ND9A 2R8IA 3MWDA 4R4OA 2F0WA 2R7LA 2FKLA 4GKJQ 5CORA 1K1QA 3GO5A 4RGNA 2EE1A 3AB9A 5C4ZA 5TSSA 4UCUA 2C2EA 4ZUIA 2ZDQA 4FU0A 1N36H 4M1UB 4DV0H 1B1ZA 4JI3L 4LUOA 4QUFA 2UUAL 4NW2A 1T3NA 4PV1C 2JA7A 5I47A 2W71A 5E4XA 1LT6D 1YNNC 5KRUA 2NVYB 2O2LD 4LNQA 1E4EB 4JPBW 2X69A 1TS5A 3MXGA 2R84A 1STYA 3L0OA 4C1NK 5JJZA 4UCRA 1YEZA 5G3LF 4R8IA 1KDAA 1JJGA 2R7MA 2W6PA 1WTOA 3IKJA 3PF4A 3HS0C 2YRXA 3PGZA 4XYMB 1A0IA 4CC6A 4DV1L 1QCBD 1U4LA 3BDLA 4K2LA 2XIGA 3D8GA 1LTAD 1EIFA 2A6HD 4RKBA 3SK5A 5KG3A 2V4DA 1NR2A 4LSXA 1IL8A 4R8UA 4DK6C 2EJFC 3HOUB 4Y7NH 5T1GA 4FYDA 2GPSA 1K0RA 1GUNA 4TUYF 4YB8B 4X65H 3V2TA 4KY7A 3OHXC 3R3OA 1IW7D 3I72A 1I6HH 3K7UC 5D3DA 1GJXA 2VQDA 1V1PA 1EWCA 3T56B 3J80c 5KFPA 5KFKA 4HQ6A 1FNUA 3GIIA 1JWSD 1M7JA 1E2WA 4XTCS 3TZUA 4DR4Q 5C44G 3KUPA 4A3KH 1KAWA 2ICIA 3G48A 1S5BD 4CGYB 1VDZA 4LF7L 4EVOA 2WB1G 4HAEA 4YAKB 2WKDA 4DR1L 1PFNA 1RF2D 1TWGA 2ZM6Q 3HOXG 4MAMA 2OH2A 2CWPA 1IXRA 1U0LA 3QG1A 2QDLA 3NQTA 3NWSA 5LP6F 1SCUB 3I73A 1ILPA 1DGSA 3N6RA 3VDYA 1PRTB 2Z4IA 2I87A 3STBD 2V1CC 2EXDA 5IT9W 2NWGA 2FMCA 1LO5D 2K75A 4JI8Q 5M5YH 3J81c 4KI0A 4IAJA 2UUCL 3ONAB 2K52A 4EX5A 2E2IH 3H4DA 4DUYQ 2P0AA 4A76A 3K5IA 5K5PA 1BDOA 2F4IA 2ES2A 2E5LH 3RGXA 5FK9C 4APVA 1DONA 4XX0B 4TV9F 1KL9A 1WCMA 4DNTB 3MJFA 3C3LA 2JA6H 3TQYA 3QOLA 1XMQQ 2ID0A 2PQAB 1FJGQ 3HOYH 3WOEA 2A8VA 1HZCA 4XXEA
chains in the Genus database with same CATH topology
3EBEA 4DV5L 5LMNL 1HNXL 3HOZH 4HIDA 2Q2TA 3S1NH 2K5NA 4MNOA 3M9BA 1HH2P 1VQKA 4MZ9A 5IT9c 2R92H 4X62Q 3KOJA 1KXLA 2VQFQ 4AQYQ 2B29A 4JI2L 5GAHC 4A3CH 1SE8A 1IYJB 4C3HH 4JV5Q 4ME3A 4LWCA 1WYDA 1N34L 3H3VH 1EQQA 3RNUA 2F3IA 1NTGA 3J7ZC 4O2DA 4AH6A 3G71A 2AMCB 1HR0W 1IBLQ 4B3MQ 1XPUA 3I4NH 4X6AH 1PFSA 3CCQA 2Y0SG 2KHJA 1UE1A 1X56A 1TWFH 1IZ6A 4LF8L 1J5EL 1V1QA 5C3EH 4GOPB 4LF9L 4BBSH 1L2FA 4DV4L 2EQSA 1KQSA 3F2BA 4IOCA 3J81j 4AYBG 5IY0A 1T9HA 3F2CA 2R7ZG 2UXCQ 3CC7A 1Q81C 3K8AA 4A3GG 4JOIC 2PMZE 1BVSA 5ELOA 5C0XG 4JI4L 1CKMA 4TQUS 1D8LA 3GTGH 1EFWA 1PVOA 1VQMA 2VQEQ 2E2HH 4A3BG 3GD7A 4LF4Q 4JBWA 2ATWA 4FDBA 5DLQE 1SRUA 2AHOB 3RLOA 1QZHA 1IBKL 2HT1A 3UDXA 4A3LG 2BA1A 3CPWA 2GN5A 4H02A 4NB3A 1NJIC 1Z47A 3ICEA 3PO2H 2NVYH 5GADC 3BZKA 4R4TA 3M4OH 1HNWQ 5M5WH 5LMNW 2IHFA 4OX9L 3S1MH 3JAMi 3AYHB 1N32L 3BJUA 1I94Q 2Y0SE 1Q1EA 3TS0A 4HJ5A 1GVPA 3CMAA 1YIJA 1XMOQ 1N36L 2B63G 4DR5L 3GTMH 2N49A 1SROA 1VQGA 2QGQA 3A5UA 1PV4A 2R93G 1EOVA 3KLWA 2Z6KC 4P75A 1N8RC 1PH9A 3CC4A 1OTCA 2OTLA 1P16A 2NN6I 2OQ0A 1KIXA 4AYBE 1WI5A 5M3FG 2LXKA 3JC66 4B3SL 5IP7H 5IWAQ 3PO3H 2UU9L 4A3DH 4JV5L 3DM3A 3S17H 1ASYA 1EUJA 1V43A 3PIOA 1JB7A 3HOVH 2K5VA 1A8VA 3UDGA 2VS1A 4GN4B 3U50C 4B3ML 3HOWG 5JEAJ 4DV2L 4DV3L 4DR6L 3CCJA 1Q1BA 2E8GA 2BH8A 4LUVA 1VQIA 5J3BA 4JCVE 4BY1G 4IJHA 3CCVA 4LW1A 3PUZA 1OXVA 4GLVB 4JC0A 4X66Q 2NVTH 4PZ8A 1HNZL 1CKOA 2UXBQ 1AE3A 4X65L 5FJ8H 5IYCG 1AE2A 4DR2L 2UXCL 5C44H 4OWWB 3K7AH 1VQ9A 1EWIA 1R9TH 4GKKQ 1VQAA 4DAYB 5H1SE 4YY3Q 2ZJRA 3OTOQ 3MXNB 1C9OA 3U4ZA 2VNUD 3HOXH 3MEFA 2A19A 1N33Q 4O0AA 5GROA 2NN6G 3S1RH 1K8GA 1JMCA 4IFDI 2ALYB 2PI2A 5AJ3Q 1AH9A 2C35B 2KCTA 4YHHL 4JBMA 1FJGQ 1HNWL 3CCSA 2K50A 3S15H 2PQAA 4GNXA 2IX1A 4B3RQ 1Q46A 3PV0A 1I94L 1QZGA 1ASZA 3I7FA 2JA7G 3M85A 3CMEA 1XPRA 3H15A 4A3MG 2Q2UA 4PG3A 2BH2A 1VCIA 1S72A 1RL2A 3F8TA 3CCMA 4GS3A 3T1YQ 4R4CA 2DUDA 3FHWA 3M4QA 1GO3E 5IWAL 3NBHB 4K0KL 1Y1VH 3RLNA 4HJ9A 4NXNQ 3AQQA 3G4SA 4NXMQ 2UUBQ 5M5XH 3E0EA 4JI7Q 2D0PA 4JI0Q 5IP9H 4DR7Q 3STBC 4LF5Q 2WFWA 4A4IA 2I0QA 3I2ZA 1XJVA 3CCEA 1E3PA 4GOPA 3SGIA 2CQOA 4A3JG 4JYAL 4XIGS 2E5LL 1LYLA 2JA5G 1I3QH 1VQCA 4C3IH 3KF6B 5GAGC 4IFDG 2UXBL 1G51A 4OWTB 1K83H 2CCZA 5GQOA 3RR5A 4A3FG 2F4VQ 2GVAA 2YTYA 4IPCA 1VQFA 2AWNA 3BZCA 1TXYA 1SLJA 3JAMc 1VQPA 1VQEA 1XNQQ 4DV6Q 3H3VI 4DR4L 4L5QA 1JJCB 1W3SA 1FGUA 1QUQB 2QEXA 2EIFA 1VQ4A 2Z0SA 2N78A 2UXDQ 4JI5L 3PUYA 4IO9A 2NVQH 1S3OA 5AJ3L 1VQ6A 2VUMG 1VQHA 3KF8B 2ZM6L 4IPDA 2WP8J 3F1ZA 5BR8Q 4KLKA 3ER0A 2H5XA 5LMUL 2D62A 2UUAQ 2R7ZH 4IPGA 4JG2A 4PZ7A 1BBUA 1EYGA 4A3GH 3HFZB 3EIVA 3ULLA 3D31A 2MO1A 2A1AA 2I5LX 4OXPA 2I5MX 1PH3A 1VQ5A 4WJ3M 2LXJA 4A3IG 4A3BH 4YCUA 3T1YL 1WFQA 3PCOB 2JEAI 1LM0A 3GDEA 2JJQA 4R4IA 1L0WA 1VQDA 4QGUA 3S1QH 4A3LH 3HKSA 1HZBA 3AFQA 1Y1WG 3CQZH 5E7NA 4JI8L 4JBJA 3PSIA 2YU9H 4DV1Q 1EQRA 4BY7G 1GKHA 2XGTA 1OXXK 5K36G 1W2BA 3A0JA 3FP9A 2ZTEA 3S24A 4DUYL 4HJ7A 4LF5L 4DR7L 4X64Q 4BXXG 1GD7A 1PYBA 5EAYA 2JEBI 1YITA 2OWOA 2JK8A 4DV7Q 4IJLA 1PH8A 2K14A 2R93H 1KRSA 4GNXC 1L1OB 4POFA 5C0XJ 4A93H 1KD1C 1J6QA 3W1BA 1PH2A 4NPSA 1XMQL 1WCMG 5M3FH 1FJGL 1X6OA 4DKAC 5IYDG 5IYBG 4DV0L 1IBMQ 1D7QA 1OXUA 3KDFB 1QVGA 3UE1A 4DR3Q 3HKZG 4A93G 4X62L 3AEVA 2VQFL 4AQYL 2ZJQA 1X55A 1JT8A 5JJIA 3OW2A 2VZAA 3E9HA 3UE0A 3HOWH 3CP0A 4GLXA 1Q82C 5C4XG 1UEBA 3L2PA 3TREA 4P71A 2E2JH 1EIYB 4LF7Q 2UXDL 2B63H 4DR1Q 4BY1H 1YI2A 2HHHQ 2JA9A 1IBLL 5M3MG 1YNXA 3PUXA 4BBRH 1PH5A 4GOPC 2RHQB 1K73C 3HOYH 1E1TA 1HR0Q 5IYCH 3A74A 4L5SA 3GTJH 4OONA 1K3RA 3ULPA 1Q8KA 2KCMA 1H95A 2RHSB 4KHZA 4BBRG 3B6YA 2IT1A 3I4OA 3M4PA 1WOCA 4GN5A 1QVCA 2KHIA 4LF6Q 4JI1Q 1E7ZA 1FVIA 1PH7A 3I4MG 2VQEL 3HKZE 3K0XA 4Y52H 4LF4L 4EQ5A 1MKHA 4C3JH 2UUCQ 3NENA 1FL0A 1SFOH 2BA0A 4YCWA 4AIMA 3UDFA 1E22A 1Q86C 3U58A 3TS2A 3HOUG 1YHBA 1PH1A 1MIUA 2JA7H 3CW2C 1YJNA 3NELA 1Q12A 2K5HA 4J15A 4A3MH 3DLLA 1A62A 2Q2HA 3KF6A 3H0GG 1K8AC 4LFAQ 3RN2A 3PF5A 1IL2A 2HIXA 2YYZA 4QJFA 3T1HQ 4LFCQ 1SMXA 1XMOL 1WJJA 3S2HH 2KENA 5LMNQ 4DV5Q 1HNXQ 2PNHA 3W1GA 2VY3A 1NBWA 2QA4A 4DR3L 2LSSA 4JOIA 3ZJYC 2AWOA 1QUQA 2ZJPA 1B8AA 2YV5A 1BBWA 3GTKH 1N34Q 4HJ8A 2RF4A 3I55A 4MTNA 2VW9A 1XNRQ 4A3JH 1OXTA 3BU2A 1PH4A 1B70B 1U5KA 2N3SA 4A3EG 2D0OA 2JA5H 2FXQA 3PIPA 4WJ4A 1JE5A 1MJCA 4A3KG 1VQLA 3M3YH 4YWMA 1TWCH 4YWLA 1J5EQ 2GVBA 1CSPA 4A3FH 4QL5A 1S40A 1YHAA 1QVFA 1KHIA 3S16H 4LF9Q 2XTIA 4X66L 4DV4Q 3KJOA 4B3TQ 4YCVA 4KHPQ 4GN3B 3KYHC 4DAMA 2NZHA 5FLMG 4JI4Q 4LF6L 2IY5B 4GKKL 2WAQE 2YTXA 5FLXc 4QQBX 4YY3L 4TVAB 1TWGH 2IHEA 3OTOL 2JA8H 2VUMH 2R7DA 1IBKQ 1YBYA 3GTOH 1SR3A 3CXCA 4OO1I 3UDIA 4IFDJ 1CKNB 1HZ9A 1N33L 3FKIG 1VS0A 1L1OA 2JE6I 2ZTCA 4RG1A 1X3FA 2L15A 3J80i 2NVXH 3W5OA 1NY4A 3L7ZC 2JA8G 3CCUA 3M7NA 4OX9Q 1YVCA 1NMGA 4R4QA 4A3IH 3CCRA 1X65A 4JI3Q 4ALPA 4B3RL 1KC8C 1B7YB 2NZOA 1N36Q 4DV0Q 1NE3A 3KDFA 4DR5Q 1HJPA 1YJ9A 1Y1WH 4UP9A 1O7IA 1PH6A 4PZ6A 2JA6G 3KJPA 4BY7H 4LUZA 1HZAA 3HOYG 1TWHH 1Y14B 4OWXB 4B3SQ 3RZDH 2UU9Q 3HOZG 5C4JH 2Q2IA 4NXNL 2YTVA 2B3GA 2R92G 4NXML 4LFBQ 2R7FA 1PA6A 1XNRL 2UUBL 2HIVA 4JI7L 4POGA 2JQOA 4JI0L 1UE7A 1C7YA 1CSQA 4A3CG 4DV2Q 1PYSB 4C2MH 4DV3Q 1WCMH 4DR6Q 5IYDH 5IYBH 3GTLH 2F52A 1P8LA 3S2DH 2PI2E 3RLFA 3J81i 4OO1G 2OCEA 3TEHB 4UPAA 3I4NG 4BA2I 1HNZQ 4B3TL 4KHPL 4GLAC 4X65Q 3CC2A 3K80C 4DUZQ 4DR2Q 3CD6A 1VQ8A 5C4XH 2MQHA 3F2DA 2DGYA 4RMFA 2ASBA 2F4VL 5C3EG 4BBSG 1C0AA 4R4OA 2ZTDA 5M3MH 1XNQL 4DV6L 2MNAA 4GKJQ 2CWAA 3GO5A 3OYYA 2CKZB 3RN5A 4P73A 3AFPA 3CF5A 4IPHA 3E9IA 1M1KC 2I5HA 3Q8DA 4YHHQ 4P74A 1KRTA 5BR8L 3NEMA 1YHQA 1LTLA 4LUOA 4JI3L 1TWAH 2UUAL 1RIPA 2AKWB 2IX0A 3K81C 5GAEC 1I5FA 3PO2G 4QIWE 1LUZA 5JJKA 3KFUA 2OTJA 1GM5A 3LGJA 4PMWA 1VQ7A 3I4MH 1XPOA 3PUVA 5JEAG 4LNQA 4QY7A 4HIMA 4DK3C 1V9PA 3L0OA 1Z9FA 3CPFA 1YEZA 4DNIA 1JJGA 3HOUH 4K0KQ 3GTPH 3PF4A 4JI6Q 3PGZA 4LFBL 1A0IA 4DV1L 3ERSX 3G6EA 2K4KA 3H0GH 2N8NA 1EIFA 5IP7G 3PO3G 1L1OC 1UE5A 1MJEA 4A3DG 4X64L 4DK6C 1Q7YC 3GTQH 1G6PA 4Y7NH 4DV7L 1E1OA 4JYAQ 1K0RA 3WWVA 2E5LQ 3HOVG 3RZOH 3CAMA 1X3EA 4HIKA 1I6HH 3K7UC 4DUZL 2KBNA 3ULJA 2WAQG 3PUWA 4HIOA 1IBML 3U4VA 4P72A 1PHJA 4YWKA 4R1JA 3J80c 1YJWA 3S14H 2VL6A 1CUKA 2OQKA 1N9WA 4XTCS 4JI2Q 5FJ8G 4A3EH 4DR4Q 5C44G 1BKBA 1CKNA 4GKJL 1VQOA 4A3KH 1KAWA 1NMFA 3G48A 1VQNA 3IRBA 4JI5Q 4LF7L 2WB1G 1XTDA 4L5RC 2MO0A 3EN2A 4DPGA 4A75A 4DR1L 3CCLA 3TRZA 1JJ2A 2HHHL 2ZM6Q 1SN8A 3HOXG 4UY8C 5LMUQ 1UWVA 5IE8A 4JBKA 2CWPA 1IXRA 1U0LA 1HR0L 4LF8Q 5FLMH 1DGSA 3I56A 2MFIA 4HJAA 3VDYA 1YZ6A 4L5TA 1M90C 2Z6KA 1VQJA 4IOAA 3STBD 4UP8A 1K9MC 2V1CC 2R6GA 2EXDA 4JI1L 1OXSC 3FKIH 4JI6L 4JI8Q 2K75A 5M5YH 3J81c 4KI0A 4BXXH 2UUCL 2K52A 3D0FA 1VQBA 4EX5A 4UP7A 2E2IH 4DUYQ 4A76A 1X54A 1I50H 1Y1VG 3J7A5 5JJLA 2ES2A 2CFMA 1X3GA 1A63A 4APVA 1G291 2HQLA 2WB1E 3A5ZB 1KL9A 5ELNA 4BA1I 5IP9G 1UE6A 5C0XI 4LFAL 1N32Q 1E24A 5HY6A 2JA6H 3TQYA 2RCNA 4LFCL 3T1HL 2ID0A 2PQAB 4GNXB 1XMQQ 1X9NA 2A8VA 1HZCA 5HGQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EBE A;  4DV5 L;  5LMN L;  1HNX L;  3HOZ H;  4HID A;  2Q2T A;  3S1N H;  2K5N A;  4MNO A;  3M9B A;  1HH2 P;  1VQK A;  4MZ9 A;  5IT9 c;  2R92 H;  4X62 Q;  3KOJ A;  1KXL A;  2VQF Q;  4AQY Q;  2B29 A;  4JI2 L;  5GAH C;  4A3C H;  1SE8 A;  1IYJ B;  4C3H H;  4JV5 Q;  4ME3 A;  4LWC A;  1WYD A;  1N34 L;  3H3V H;  1EQQ A;  3RNU A;  2F3I A;  1NTG A;  3J7Z C;  4O2D A;  4AH6 A;  3G71 A;  2AMC B;  1HR0 W;  1IBL Q;  4B3M Q;  1XPU A;  3I4N H;  4X6A H;  1PFS A;  3CCQ A;  2Y0S G;  2KHJ A;  1UE1 A;  1X56 A;  1TWF H;  1IZ6 A;  4LF8 L;  1J5E L;  1V1Q A;  5C3E H;  4GOP B;  4LF9 L;  4BBS H;  1L2F A;  4DV4 L;  2EQS A;  1KQS A;  3F2B A;  4IOC A;  3J81 j;  4AYB G;  5IY0 A;  1T9H A;  3F2C A;  2R7Z G;  2UXC Q;  3CC7 A;  1Q81 C;  3K8A A;  4A3G G;  4JOI C;  2PMZ E;  1BVS A;  5ELO A;  5C0X G;  4JI4 L;  1CKM A;  4TQU S;  1D8L A;  3GTG H;  1EFW A;  1PVO A;  1VQM A;  2VQE Q;  2E2H H;  4A3B G;  3GD7 A;  4LF4 Q;  4JBW A;  2ATW A;  4FDB A;  5DLQ E;  1SRU A;  2AHO B;  3RLO A;  1QZH A;  1IBK L;  2HT1 A;  3UDX A;  4A3L G;  2BA1 A;  3CPW A;  2GN5 A;  4H02 A;  4NB3 A;  1NJI C;  1Z47 A;  3ICE A;  3PO2 H;  2NVY H;  5GAD C;  3BZK A;  4R4T A;  3M4O H;  1HNW Q;  5M5W H;  5LMN W;  2IHF A;  4OX9 L;  3S1M H;  3JAM i;  3AYH B;  1N32 L;  3BJU A;  1I94 Q;  2Y0S E;  1Q1E A;  3TS0 A;  4HJ5 A;  1GVP A;  3CMA A;  1YIJ A;  1XMO Q;  1N36 L;  2B63 G;  4DR5 L;  3GTM H;  2N49 A;  1SRO A;  1VQG A;  2QGQ A;  3A5U A;  1PV4 A;  2R93 G;  1EOV A;  3KLW A;  2Z6K C;  4P75 A;  1N8R C;  1PH9 A;  3CC4 A;  1OTC A;  2OTL A;  1P16 A;  2NN6 I;  2OQ0 A;  1KIX A;  4AYB E;  1WI5 A;  5M3F G;  2LXK A;  3JC6 6;  4B3S L;  5IP7 H;  5IWA Q;  3PO3 H;  2UU9 L;  4A3D H;  4JV5 L;  3DM3 A;  3S17 H;  1ASY A;  1EUJ A;  1V43 A;  3PIO A;  1JB7 A;  3HOV H;  2K5V A;  1A8V A;  3UDG A;  2VS1 A;  4GN4 B;  3U50 C;  4B3M L;  3HOW G;  5JEA J;  4DV2 L;  4DV3 L;  4DR6 L;  3CCJ A;  1Q1B A;  2E8G A;  2BH8 A;  4LUV A;  1VQI A;  5J3B A;  4JCV E;  4BY1 G;  4IJH A;  3CCV A;  4LW1 A;  3PUZ A;  1OXV A;  4GLV B;  4JC0 A;  4X66 Q;  2NVT H;  4PZ8 A;  1HNZ L;  1CKO A;  2UXB Q;  1AE3 A;  4X65 L;  5FJ8 H;  5IYC G;  1AE2 A;  4DR2 L;  2UXC L;  5C44 H;  4OWW B;  3K7A H;  1VQ9 A;  1EWI A;  1R9T H;  4GKK Q;  1VQA A;  4DAY B;  5H1S E;  4YY3 Q;  2ZJR A;  3OTO Q;  3MXN B;  1C9O A;  3U4Z A;  2VNU D;  3HOX H;  3MEF A;  2A19 A;  1N33 Q;  4O0A A;  5GRO A;  2NN6 G;  3S1R H;  1K8G A;  1JMC A;  4IFD I;  2ALY B;  2PI2 A;  5AJ3 Q;  1AH9 A;  2C35 B;  2KCT A;  4YHH L;  4JBM A;  1FJG Q;  1HNW L;  3CCS A;  2K50 A;  3S15 H;  2PQA A;  4GNX A;  2IX1 A;  4B3R Q;  1Q46 A;  3PV0 A;  1I94 L;  1QZG A;  1ASZ A;  3I7F A;  2JA7 G;  3M85 A;  3CME A;  1XPR A;  3H15 A;  4A3M G;  2Q2U A;  4PG3 A;  2BH2 A;  1VCI A;  1S72 A;  1RL2 A;  3F8T A;  3CCM A;  4GS3 A;  3T1Y Q;  4R4C A;  2DUD A;  3FHW A;  3M4Q A;  1GO3 E;  5IWA L;  3NBH B;  4K0K L;  1Y1V H;  3RLN A;  4HJ9 A;  4NXN Q;  3AQQ A;  3G4S A;  4NXM Q;  2UUB Q;  5M5X H;  3E0E A;  4JI7 Q;  2D0P A;  4JI0 Q;  5IP9 H;  4DR7 Q;  3STB C;  4LF5 Q;  2WFW A;  4A4I A;  2I0Q A;  3I2Z A;  1XJV A;  3CCE A;  1E3P A;  4GOP A;  3SGI A;  2CQO A;  4A3J G;  4JYA L;  4XIG S;  2E5L L;  1LYL A;  2JA5 G;  1I3Q H;  1VQC A;  4C3I H;  3KF6 B;  5GAG C;  4IFD G;  2UXB L;  1G51 A;  4OWT B;  1K83 H;  2CCZ A;  5GQO A;  3RR5 A;  4A3F G;  2F4V Q;  2GVA A;  2YTY A;  4IPC A;  1VQF A;  2AWN A;  3BZC A;  1TXY A;  1SLJ A;  3JAM c;  1VQP A;  1VQE A;  1XNQ Q;  4DV6 Q;  3H3V I;  4DR4 L;  4L5Q A;  1JJC B;  1W3S A;  1FGU A;  1QUQ B;  2QEX A;  2EIF A;  1VQ4 A;  2Z0S A;  2N78 A;  2UXD Q;  4JI5 L;  3PUY A;  4IO9 A;  2NVQ H;  1S3O A;  5AJ3 L;  1VQ6 A;  2VUM G;  1VQH A;  3KF8 B;  2ZM6 L;  4IPD A;  2WP8 J;  3F1Z A;  5BR8 Q;  4KLK A;  3ER0 A;  2H5X A;  5LMU L;  2D62 A;  2UUA Q;  2R7Z H;  4IPG A;  4JG2 A;  4PZ7 A;  1BBU A;  1EYG A;  4A3G H;  3HFZ B;  3EIV A;  3ULL A;  3D31 A;  2MO1 A;  2A1A A;  2I5L X;  4OXP A;  2I5M X;  1PH3 A;  1VQ5 A;  4WJ3 M;  2LXJ A;  4A3I G;  4A3B H;  4YCU A;  3T1Y L;  1WFQ A;  3PCO B;  2JEA I;  1LM0 A;  3GDE A;  2JJQ A;  4R4I A;  1L0W A;  1VQD A;  4QGU A;  3S1Q H;  4A3L H;  3HKS A;  1HZB A;  3AFQ A;  1Y1W G;  3CQZ H;  5E7N A;  4JI8 L;  4JBJ A;  3PSI A;  2YU9 H;  4DV1 Q;  1EQR A;  4BY7 G;  1GKH A;  2XGT A;  1OXX K;  5K36 G;  1W2B A;  3A0J A;  3FP9 A;  2ZTE A;  3S24 A;  4DUY L;  4HJ7 A;  4LF5 L;  4DR7 L;  4X64 Q;  4BXX G;  1GD7 A;  1PYB A;  5EAY A;  2JEB I;  1YIT A;  2OWO A;  2JK8 A;  4DV7 Q;  4IJL A;  1PH8 A;  2K14 A;  2R93 H;  1KRS A;  4GNX C;  1L1O B;  4POF A;  5C0X J;  4A93 H;  1KD1 C;  1J6Q A;  3W1B A;  1PH2 A;  4NPS A;  1XMQ L;  1WCM G;  5M3F H;  1FJG L;  1X6O A;  4DKA C;  5IYD G;  5IYB G;  4DV0 L;  1IBM Q;  1D7Q A;  1OXU A;  3KDF B;  1QVG A;  3UE1 A;  4DR3 Q;  3HKZ G;  4A93 G;  4X62 L;  3AEV A;  2VQF L;  4AQY L;  2ZJQ A;  1X55 A;  1JT8 A;  5JJI A;  3OW2 A;  2VZA A;  3E9H A;  3UE0 A;  3HOW H;  3CP0 A;  4GLX A;  1Q82 C;  5C4X G;  1UEB A;  3L2P A;  3TRE A;  4P71 A;  2E2J H;  1EIY B;  4LF7 Q;  2UXD L;  2B63 H;  4DR1 Q;  4BY1 H;  1YI2 A;  2HHH Q;  2JA9 A;  1IBL L;  5M3M G;  1YNX A;  3PUX A;  4BBR H;  1PH5 A;  4GOP C;  2RHQ B;  1K73 C;  3HOY H;  1E1T A;  1HR0 Q;  5IYC H;  3A74 A;  4L5S A;  3GTJ H;  4OON A;  1K3R A;  3ULP A;  1Q8K A;  2KCM A;  1H95 A;  2RHS B;  4KHZ A;  4BBR G;  3B6Y A;  2IT1 A;  3I4O A;  3M4P A;  1WOC A;  4GN5 A;  1QVC A;  2KHI A;  4LF6 Q;  4JI1 Q;  1E7Z A;  1FVI A;  1PH7 A;  3I4M G;  2VQE L;  3HKZ E;  3K0X A;  4Y52 H;  4LF4 L;  4EQ5 A;  1MKH A;  4C3J H;  2UUC Q;  3NEN A;  1FL0 A;  1SFO H;  2BA0 A;  4YCW A;  4AIM A;  3UDF A;  1E22 A;  1Q86 C;  3U58 A;  3TS2 A;  3HOU G;  1YHB A;  1PH1 A;  1MIU A;  2JA7 H;  3CW2 C;  1YJN A;  3NEL A;  1Q12 A;  2K5H A;  4J15 A;  4A3M H;  3DLL A;  1A62 A;  2Q2H A;  3KF6 A;  3H0G G;  1K8A C;  4LFA Q;  3RN2 A;  3PF5 A;  1IL2 A;  2HIX A;  2YYZ A;  4QJF A;  3T1H Q;  4LFC Q;  1SMX A;  1XMO L;  1WJJ A;  3S2H H;  2KEN A;  5LMN Q;  4DV5 Q;  1HNX Q;  2PNH A;  3W1G A;  2VY3 A;  1NBW A;  2QA4 A;  4DR3 L;  2LSS A;  4JOI A;  3ZJY C;  2AWO A;  1QUQ A;  2ZJP A;  1B8A A;  2YV5 A;  1BBW A;  3GTK H;  1N34 Q;  4HJ8 A;  2RF4 A;  3I55 A;  4MTN A;  2VW9 A;  1XNR Q;  4A3J H;  1OXT A;  3BU2 A;  1PH4 A;  1B70 B;  1U5K A;  2N3S A;  4A3E G;  2D0O A;  2JA5 H;  2FXQ A;  3PIP A;  4WJ4 A;  1JE5 A;  1MJC A;  4A3K G;  1VQL A;  3M3Y H;  4YWM A;  1TWC H;  4YWL A;  1J5E Q;  2GVB A;  1CSP A;  4A3F H;  4QL5 A;  1S40 A;  1YHA A;  1QVF A;  1KHI A;  3S16 H;  4LF9 Q;  2XTI A;  4X66 L;  4DV4 Q;  3KJO A;  4B3T Q;  4YCV A;  4KHP Q;  4GN3 B;  3KYH C;  4DAM A;  2NZH A;  5FLM G;  4JI4 Q;  4LF6 L;  2IY5 B;  4GKK L;  2WAQ E;  2YTX A;  5FLX c;  4QQB X;  4YY3 L;  4TVA B;  1TWG H;  2IHE A;  3OTO L;  2JA8 H;  2VUM H;  2R7D A;  1IBK Q;  1YBY A;  3GTO H;  1SR3 A;  3CXC A;  4OO1 I;  3UDI A;  4IFD J;  1CKN B;  1HZ9 A;  1N33 L;  3FKI G;  1VS0 A;  1L1O A;  2JE6 I;  2ZTC A;  4RG1 A;  1X3F A;  2L15 A;  3J80 i;  2NVX H;  3W5O A;  1NY4 A;  3L7Z C;  2JA8 G;  3CCU A;  3M7N A;  4OX9 Q;  1YVC A;  1NMG A;  4R4Q A;  4A3I H;  3CCR A;  1X65 A;  4JI3 Q;  4ALP A;  4B3R L;  1KC8 C;  1B7Y B;  2NZO A;  1N36 Q;  4DV0 Q;  1NE3 A;  3KDF A;  4DR5 Q;  1HJP A;  1YJ9 A;  1Y1W H;  4UP9 A;  1O7I A;  1PH6 A;  4PZ6 A;  2JA6 G;  3KJP A;  4BY7 H;  4LUZ A;  1HZA A;  3HOY G;  1TWH H;  1Y14 B;  4OWX B;  4B3S Q;  3RZD H;  2UU9 Q;  3HOZ G;  5C4J H;  2Q2I A;  4NXN L;  2YTV A;  2B3G A;  2R92 G;  4NXM L;  4LFB Q;  2R7F A;  1PA6 A;  1XNR L;  2UUB L;  2HIV A;  4JI7 L;  4POG A;  2JQO A;  4JI0 L;  1UE7 A;  1C7Y A;  1CSQ A;  4A3C G;  4DV2 Q;  1PYS B;  4C2M H;  4DV3 Q;  1WCM H;  4DR6 Q;  5IYD H;  5IYB H;  3GTL H;  2F52 A;  1P8L A;  3S2D H;  2PI2 E;  3RLF A;  3J81 i;  4OO1 G;  2OCE A;  3TEH B;  4UPA A;  3I4N G;  4BA2 I;  1HNZ Q;  4B3T L;  4KHP L;  4GLA C;  4X65 Q;  3CC2 A;  3K80 C;  4DUZ Q;  4DR2 Q;  3CD6 A;  1VQ8 A;  5C4X H;  2MQH A;  3F2D A;  2DGY A;  4RMF A;  2ASB A;  2F4V L;  5C3E G;  4BBS G;  1C0A A;  4R4O A;  2ZTD A;  5M3M H;  1XNQ L;  4DV6 L;  2MNA A;  4GKJ Q;  2CWA A;  3GO5 A;  3OYY A;  2CKZ B;  3RN5 A;  4P73 A;  3AFP A;  3CF5 A;  4IPH A;  3E9I A;  1M1K C;  2I5H A;  3Q8D A;  4YHH Q;  4P74 A;  1KRT A;  5BR8 L;  3NEM A;  1YHQ A;  1LTL A;  4LUO A;  4JI3 L;  1TWA H;  2UUA L;  1RIP A;  2AKW B;  2IX0 A;  3K81 C;  5GAE C;  1I5F A;  3PO2 G;  4QIW E;  1LUZ A;  5JJK A;  3KFU A;  2OTJ A;  1GM5 A;  3LGJ A;  4PMW A;  1VQ7 A;  3I4M H;  1XPO A;  3PUV A;  5JEA G;  4LNQ A;  4QY7 A;  4HIM A;  4DK3 C;  1V9P A;  3L0O A;  1Z9F A;  3CPF A;  1YEZ A;  4DNI A;  1JJG A;  3HOU H;  4K0K Q;  3GTP H;  3PF4 A;  4JI6 Q;  3PGZ A;  4LFB L;  1A0I A;  4DV1 L;  3ERS X;  3G6E A;  2K4K A;  3H0G H;  2N8N A;  1EIF A;  5IP7 G;  3PO3 G;  1L1O C;  1UE5 A;  1MJE A;  4A3D G;  4X64 L;  4DK6 C;  1Q7Y C;  3GTQ H;  1G6P A;  4Y7N H;  4DV7 L;  1E1O A;  4JYA Q;  1K0R A;  3WWV A;  2E5L Q;  3HOV G;  3RZO H;  3CAM A;  1X3E A;  4HIK A;  1I6H H;  3K7U C;  4DUZ L;  2KBN A;  3ULJ A;  2WAQ G;  3PUW A;  4HIO A;  1IBM L;  3U4V A;  4P72 A;  1PHJ A;  4YWK A;  4R1J A;  3J80 c;  1YJW A;  3S14 H;  2VL6 A;  1CUK A;  2OQK A;  1N9W A;  4XTC S;  4JI2 Q;  5FJ8 G;  4A3E H;  4DR4 Q;  5C44 G;  1BKB A;  1CKN A;  4GKJ L;  1VQO A;  4A3K H;  1KAW A;  1NMF A;  3G48 A;  1VQN A;  3IRB A;  4JI5 Q;  4LF7 L;  2WB1 G;  1XTD A;  4L5R C;  2MO0 A;  3EN2 A;  4DPG A;  4A75 A;  4DR1 L;  3CCL A;  3TRZ A;  1JJ2 A;  2HHH L;  2ZM6 Q;  1SN8 A;  3HOX G;  4UY8 C;  5LMU Q;  1UWV A;  5IE8 A;  4JBK A;  2CWP A;  1IXR A;  1U0L A;  1HR0 L;  4LF8 Q;  5FLM H;  1DGS A;  3I56 A;  2MFI A;  4HJA A;  3VDY A;  1YZ6 A;  4L5T A;  1M90 C;  2Z6K A;  1VQJ A;  4IOA A;  3STB D;  4UP8 A;  1K9M C;  2V1C C;  2R6G A;  2EXD A;  4JI1 L;  1OXS C;  3FKI H;  4JI6 L;  4JI8 Q;  2K75 A;  5M5Y H;  3J81 c;  4KI0 A;  4BXX H;  2UUC L;  2K52 A;  3D0F A;  1VQB A;  4EX5 A;  4UP7 A;  2E2I H;  4DUY Q;  4A76 A;  1X54 A;  1I50 H;  1Y1V G;  3J7A 5;  5JJL A;  2ES2 A;  2CFM A;  1X3G A;  1A63 A;  4APV A;  1G29 1;  2HQL A;  2WB1 E;  3A5Z B;  1KL9 A;  5ELN A;  4BA1 I;  5IP9 G;  1UE6 A;  5C0X I;  4LFA L;  1N32 Q;  1E24 A;  5HY6 A;  2JA6 H;  3TQY A;  2RCN A;  4LFC L;  3T1H L;  2ID0 A;  2PQA B;  4GNX B;  1XMQ Q;  1X9N A;  2A8V A;  1HZC A;  5HGQ A; 
#chains in the Genus database with same CATH topology
 1JXL A;  4Q0F A;  2EY2 A;  5ELF A;  1HNX L;  4HID A;  4G7Z C;  1LTB D;  1FGB D;  3M9B A;  1STG A;  4MZ9 A;  1B4O A;  4C3I G;  1KJ9 A;  4AQY Q;  5GAH C;  4IR1 A;  4ME3 A;  5IOC A;  4LWC A;  3RV4 A;  4KTA A;  3H3V H;  2W9C A;  3RNU A;  1HPC A;  1HR0 W;  1H9R A;  2B2Y A;  2I46 A;  4O2D A;  4WRD A;  1XPU A;  2R92 B;  4B3R H;  2Y0S G;  2FLP A;  4CJ2 C;  1JOR A;  1V1Q A;  1AZP A;  1PK8 A;  3T1Y H;  2J6U A;  1L2F A;  3HZX A;  1KQS A;  3F2B A;  3FEW X;  3PN1 A;  1TWA A;  3CC7 A;  1Q81 C;  5EKL A;  3G6V A;  1HTP A;  3H6M A;  4JOI C;  4JI4 L;  1BVS A;  2K05 A;  5C1P A;  4ZRZ A;  4U6P A;  2UUB H;  1G2T A;  2B2V C;  1EFW A;  2Z9H A;  3OWF A;  4LF4 Q;  2W70 A;  4FDB A;  1SRU A;  1WD1 A;  3KLS A;  2NU9 B;  4RAY A;  3UDX A;  4A3L G;  2IP4 A;  3GTP A;  4NB3 A;  3G6Y A;  4FXK C;  1PZK D;  5GAD C;  1HNW Q;  4F87 A;  4IQZ A;  2W9C B;  3SXH A;  2IHF A;  4OX9 L;  3H0G A;  1N32 L;  3TII A;  4G7O C;  1I94 Q;  4A2B A;  3TS0 A;  1TY2 A;  4L8J A;  5FOB B;  1XMO Q;  5CA0 F;  1I4X A;  1HUM A;  3TDQ A;  4DR5 L;  4X62 H;  1VQG A;  4J9M A;  2XIW A;  1E0B A;  1PV4 A;  3CC4 A;  1QJO A;  4FF1 A;  1PH9 A;  1XNQ H;  1BXR A;  3M4O B;  1UUP A;  1OTC A;  1RK6 A;  1JX4 A;  2K33 A;  5CMD A;  2NN6 I;  3GID A;  2OQ0 A;  4CDE C;  5AFW A;  5IWA Q;  3MHB A;  3J80 W;  4JV5 L;  2B2W A;  3K3P A;  3I91 A;  5JEA J;  1UAP A;  3JAM L;  4R9W A;  2B63 G;  4A3D B;  1KLG D;  4BY1 G;  4JCV E;  3CCV A;  3OIQ A;  2QKI C;  2JEJ A;  3S9W A;  4DR2 L;  2UXC L;  2VPQ A;  3R8B A;  2VQE H;  1VQ9 A;  1RJP A;  1T94 A;  4DA2 A;  4DAY B;  5C4H A;  2LS0 1;  3OTO Q;  3TIG A;  4X3T A;  4KK7 A;  3NHH A;  4TSS A;  3BG5 A;  3M9O B;  3RB3 A;  1V1O A;  5A2Q W;  4DV7 H;  1VBH A;  1GGO A;  3J81 W;  2B2Y C;  1R9T B;  2ALY B;  1BNZ A;  1TS4 A;  4YHH L;  2EYO A;  1EZ6 A;  3KK7 A;  5KFO A;  2CH4 A;  4ID6 A;  4GNX A;  1IYV A;  4EG0 A;  1HTL D;  4OHJ A;  4R7R A;  3H15 A;  1VCI A;  3CCM A;  4R4C A;  2DUD A;  3PW4 A;  3K5O A;  4RKL A;  5D65 A;  3S15 B;  1DXM A;  3M4Q A;  3MFG A;  2DIK A;  3NBH B;  4JK1 C;  4K0K L;  3AQQ A;  4NXM Q;  5KND A;  1RJQ A;  2I8C A;  3RIZ A;  2CW0 D;  3E0E A;  4JI7 Q;  1E4G T;  2C5C A;  2L0C A;  5IP9 H;  3VR6 A;  4LF5 Q;  2WFW A;  5D1P A;  4GOP A;  2OLS A;  3SGI A;  2CQO A;  2ZDH A;  5IT9 E;  1SJH D;  2XWB B;  1ZEQ X;  1VQC A;  2XNA C;  4QUC A;  4IFD G;  4OWT B;  1K83 H;  3NK9 A;  2NU7 B;  2R7Z A;  5GQO A;  2K1B A;  1TWF A;  2SNS A;  1EIG A;  4IUN A;  2IWH A;  2HQE A;  4IPC A;  2YW2 A;  5JUM A;  3BZC A;  4QF4 A;  5EKI A;  5DQH A;  3JAM c;  2PVP A;  2B2W C;  1W3S A;  4MV9 A;  1FGU A;  1QUQ B;  3WO1 A;  2EIF A;  2Z0S A;  3BVZ A;  4JI5 L;  3DUZ A;  3PUY A;  4IO9 A;  5BPH A;  2E2H A;  5AJ3 L;  2VUM G;  3T1H H;  4IPD A;  2LMC B;  1VF7 A;  2H5X A;  5LMU L;  2D62 A;  1HFN A;  4JG2 A;  3HFZ B;  2KEE A;  2EY6 A;  2RKS A;  3ULL A;  2BQR A;  2IA6 A;  2LXJ A;  1M6V A;  3G6X A;  3TIN A;  1DJR D;  1LM0 A;  2Q8T A;  1SYG A;  4AYB B;  2C2D A;  3KBX A;  1HUN A;  2R7Z B;  3GTM A;  1XNR H;  1Y1W G;  3CQZ H;  4JI0 H;  4JBJ A;  3PSI A;  2J4X A;  4KY5 A;  5EQ0 A;  2YU9 H;  4Z9C B;  1Y69 U;  2KUM A;  2EJG C;  2OF1 A;  4EFE A;  1EEF D;  1W2B A;  4A3B B;  5KFS A;  2Q8R E;  5CBE E;  3IAY A;  1Y8P B;  3R2I A;  4BWG B;  2V58 A;  1GD7 A;  4G4K A;  5EAY A;  3N42 B;  4ETS A;  3TQT A;  4FM9 A;  4IJL A;  4LSA A;  5FO7 B;  4DV4 H;  2HVS A;  1B53 A;  1O80 A;  1L1O B;  5C0X J;  2E2D C;  4F88 A;  4GNX C;  4DFA A;  1KD1 C;  1A2T A;  3PZP A;  2X0S A;  3W1B A;  3K0Y A;  4RNM A;  4IUR A;  2V9W A;  1AW7 A;  4DKA C;  1SEB D;  4DV0 L;  3GTJ A;  4X3U A;  1OXU A;  1STE A;  1SYE A;  1SYB A;  1D7Q A;  3KDF B;  3UE1 A;  3GTL B;  3FVQ A;  2W9B B;  1H9J A;  2IJ0 A;  3AEV A;  4FNF A;  2VQF L;  3K5L A;  4RUA A;  1X55 A;  3EQL C;  1WTH A;  5FD5 A;  2VZA A;  4RAZ A;  4Q8E A;  3HOW H;  3UE0 A;  5C4X G;  1GOZ A;  2QDB A;  5M3F B;  1CE8 A;  3LP8 A;  4P71 A;  4EBD A;  5GON F;  1EYC A;  1MD2 D;  1S68 A;  2HHH Q;  2UUA H;  4JI3 H;  5KFL A;  1S10 A;  4BBR H;  2HVR A;  4RAU C;  4GOP C;  1K73 C;  5L1J A;  3JRW A;  2PZW A;  4KD3 A;  5IYC H;  1C3O A;  1EEI D;  2E2J B;  1Q8K A;  1SNQ A;  1PTO F;  2R61 A;  3I4O A;  1IOW A;  2R7N A;  2KJX A;  2UU9 H;  3DM1 A;  4GN5 A;  1QVC A;  4LF6 Q;  3IFT A;  4JI1 Q;  4DV1 H;  1HA6 A;  3MZ5 A;  1PH7 A;  2NN6 H;  1TS2 A;  1EL0 A;  1ZHS A;  4E4T A;  5KT2 A;  3NEN A;  1SND A;  2BA0 A;  4YCW A;  3UDF A;  2C00 A;  1KNA A;  1YHB A;  4RCN A;  4YJ2 F;  2JA7 H;  1Y1V A;  3CW2 C;  2JEG A;  3GTK A;  3C1F A;  1ET9 A;  1YJN A;  4J15 A;  1K0S A;  3KAK A;  1B3A A;  3KF6 A;  2W6M A;  2JA5 A;  4C3J B;  2MJ8 A;  2YYZ A;  4NMZ A;  4LFC Q;  3KLS X;  2NTS A;  3S2H H;  5LMN Q;  1CS0 A;  2PNH A;  1NBW A;  3I70 A;  2PZT A;  4DR3 L;  2LSS A;  1I7N A;  2DN8 A;  1CK1 A;  2B8F A;  5EJW A;  4A3M B;  4XT1 B;  3MR3 A;  2AWO A;  1HQM C;  4IUU A;  4UDU C;  5CBA E;  3GQC A;  2DY8 A;  3X3N A;  3PMF A;  2IX3 A;  2PQE A;  4HJ8 A;  3I55 A;  1EFI D;  1VF5 C;  1RD9 D;  4A3J H;  1OXT A;  1B70 B;  3SK4 A;  2XRS D;  1RKN A;  3BVG A;  3PIP A;  2XD4 A;  4OEM B;  5JAV A;  3Q2O A;  4J9N A;  1MJC A;  4A3K G;  2CQY A;  2FPI B;  1TWC H;  4A3K B;  1J5E Q;  1ENC A;  4IUT A;  1I4R A;  1YHA A;  3PW0 A;  1EQV A;  5IGE A;  3PW7 A;  2SEB D;  4LF9 Q;  4X66 L;  3QR8 A;  3VA5 A;  4MV3 A;  3KJO A;  3HXL A;  4ED7 A;  4DXF A;  3VR4 A;  2NZH A;  3WDN A;  1SYX B;  2IY5 B;  1LAB A;  4ECQ A;  4YIJ A;  4J9R A;  2UUC H;  2F1M A;  4A3F B;  3KXY T;  4QQB X;  3GV8 B;  2D9U A;  1TWG H;  3OIP A;  3GIP A;  3CXC A;  4OO1 I;  4X3S A;  3KLR A;  1HZ9 A;  2ZTC A;  1TAE A;  4QB4 A;  2L15 A;  2FPG B;  2PO4 A;  4ECU A;  3LWU A;  3A56 A;  2VPS A;  2KEC A;  4R4Q A;  4LH7 A;  2NUA B;  4B3R L;  1KC8 C;  3D3R A;  1N36 Q;  4EYI B;  4TKO B;  4F7X A;  3BJY A;  2E74 C;  1HJP A;  1EU3 A;  4UP9 A;  1O7I A;  5KFF A;  1UNS A;  1WTR A;  1PH6 A;  2JA6 G;  4LK1 C;  4BY7 H;  3M9N B;  3HOY G;  4OWX B;  2DNC A;  2L1B A;  5C4J H;  1CQJ B;  1ESF A;  4NXN L;  3HOY B;  2YTV A;  2B3G A;  4LFB Q;  5HV6 A;  1PA6 A;  1E4F T;  2UUB L;  2CH4 W;  1DZ1 A;  2JQO A;  2BDN A;  2F0V A;  1C7Y A;  5KYL A;  4CKB A;  1LAC A;  1WCM H;  4HNT A;  3RZD B;  2JN4 A;  4DR6 Q;  3D6W A;  1WTV A;  1P8L A;  3QZ7 A;  2R87 A;  3TP7 A;  2XGQ A;  4UPA A;  2EPB A;  1YNJ C;  4KHP L;  4C5A A;  4X65 Q;  3K80 C;  1U4M A;  2K01 A;  3F2D A;  1LTT D;  2MQH A;  2ASB A;  2AGP A;  1AP0 A;  3GV6 A;  1G8Z D;  2F0H A;  3HKZ B;  2WV6 D;  1XNQ L;  5M3M H;  4DV6 L;  2FP4 B;  2PYK A;  5I6Y A;  3R5X A;  3WO0 A;  4RUC A;  3CF5 A;  3LX0 A;  1M1K C;  1ZHQ A;  1N32 H;  2VB2 X;  2F0Q A;  1FR3 A;  1B6S A;  2BR0 A;  1KRT A;  5BR8 L;  2M9V A;  3NEM A;  1I4H A;  5BN5 A;  3MWM A;  4DR5 H;  1TWA H;  1RIP A;  3T53 B;  1SSO A;  1LUZ A;  1MSH A;  1SMY C;  4DF7 A;  2ASD A;  2JYO A;  3I4M H;  1KDB A;  3PUV A;  4I7Z C;  4QY7 A;  3VA7 A;  5JVH 3;  4JV5 H;  2FHT A;  4L1K A;  1L2Z A;  3GTP H;  2WIN B;  1S5C D;  3M4Y A;  2WAC A;  4HED A;  3ORQ A;  1STH A;  3H0G H;  4YR3 A;  5IT9 L;  1JOQ A;  1Q7Y C;  1G6P A;  4DV7 L;  5H80 A;  4JYA Q;  2E5L Q;  3DMU A;  2L4N A;  3CAM A;  5HGT A;  1PTO C;  5KFX A;  1X3E A;  1A9X A;  4Q5V A;  3RBD A;  2UXC H;  2SDF A;  3IG0 A;  3VPC A;  2MHV A;  1S5D D;  1HHV A;  2PN1 A;  4MV8 A;  2E76 C;  4DUZ L;  3MWE A;  1F2Y A;  2AGO A;  4IRC A;  1A15 A;  4S3S A;  3U4V A;  1PHJ A;  2N88 A;  3GTQ B;  4XYL B;  2VL6 A;  2BE5 C;  2OQK A;  3PW5 A;  1MGS A;  1VMC A;  1EZ1 A;  4GKJ L;  1CKN A;  3RTX A;  3BDC A;  1AN8 A;  2ZT9 C;  1B50 A;  1B33 N;  3JSL A;  4ED8 A;  1SDF A;  3IRB A;  1XTD A;  3EN2 A;  4A75 A;  3CCL A;  3TRZ A;  4N9P A;  1WSC A;  1UC8 A;  3NTH A;  4A3E B;  1M0W A;  1I50 A;  3JSN A;  2JP1 A;  4DGZ A;  1HR0 L;  3NP8 A;  2PZU A;  1X3P A;  1A2U A;  4LMY A;  2W6Z A;  1VQJ A;  1FNW A;  1K9M C;  2HDL A;  3K59 A;  2N55 A;  5D8D A;  2J0T D;  5I2X A;  3OSN A;  3A8J E;  2GA4 B;  4EQN A;  5C1O A;  2IBK A;  1ZKO A;  4RZR A;  3D0F A;  1VQB A;  1TWH A;  1F9S A;  1X54 A;  3J7A 5;  1L0X B;  3V4Z A;  3HEJ A;  4J9L A;  1G29 1;  3MXU A;  3FKI B;  3URY A;  1UEA B;  4BA1 I;  5IP9 G;  3U9O A;  5C0X I;  2WTF A;  1BQQ T;  3LWB A;  3T1H L;  4C2M A;  3CKI B;  2XCP A;  1I50 B;  1PRT F;  3HOZ H;  3IL8 A;  4DV5 L;  4F4Z A;  3S1N H;  2AQ1 B;  2K5N A;  1VQK A;  3OOC A;  5IT9 c;  4NP5 A;  4X62 Q;  5KFD A;  2B2U A;  2B29 A;  2K32 A;  5KG4 A;  4DL2 A;  2C28 A;  1N33 H;  1BGW A;  5IIF A;  4A3C H;  4C3H H;  2ATL A;  4HCE A;  3UFX B;  1H9K A;  2MP1 A;  3G71 A;  5LMU H;  3J7Z C;  1ZXT A;  4KD4 A;  4AH6 A;  2A69 C;  4OO1 H;  4B3M Q;  4I7H A;  1PFS A;  3A8I E;  2AGQ A;  2KHJ A;  3KHH A;  1X56 A;  1TWF H;  1BF4 A;  2NVY A;  2LFN A;  1E4E A;  5JH7 F;  4BBS H;  2W9A A;  5JVL A;  4DV4 L;  2FIN B;  4IOC A;  3J81 j;  3I4N B;  3VYT A;  4Q44 A;  2JEF A;  1G91 A;  5ELO A;  1I6V C;  1PVO A;  1D8L A;  1KJI A;  1VQM A;  2VQE Q;  2E2H H;  1SE3 A;  3GD7 A;  2ATW A;  3Q1K A;  5KFB A;  2PW5 A;  5KG1 A;  3C2P A;  1W6K A;  1D5Z C;  1Y8N B;  3H09 A;  1NJI C;  3HP3 A;  3GTG B;  4K8I A;  1RTN A;  1LTI D;  3OUZ A;  5A2Q L;  3PR4 A;  1SAP A;  5M5W H;  5JEA H;  3J81 L;  1JKJ B;  3BJU A;  1Q1E A;  4EBE A;  4WBN F;  1YIJ A;  3GTM H;  2N49 A;  2VQF H;  3GIM A;  3SK6 A;  3K5N A;  2HCC A;  3S1M B;  4AYB E;  2WE6 A;  2LXK A;  1BCP D;  1DYQ A;  3JC6 6;  5IP7 H;  3PO3 H;  2VR1 A;  2O4X A;  1M8A A;  2UU9 L;  2VA3 A;  3FRP B;  1CT1 D;  3S17 H;  2A68 C;  4K5V A;  1EUJ A;  1V43 A;  3PIO A;  1W93 A;  1A8V A;  4JVZ A;  4Y8V B;  3U50 C;  4U67 3;  3HOW G;  5EPJ A;  4M7E A;  2F0M A;  4L6T B;  3BQ2 A;  1JOO A;  3CCJ A;  4CHT B;  2BH8 A;  1STB A;  1VQI A;  2NYZ D;  4IJH A;  5IYZ F;  3PUZ A;  4JUZ A;  1EY4 A;  2NVT H;  1PX2 A;  2UXB Q;  1WTX A;  2QEJ C;  4ZOL F;  5FJ8 H;  5IYC G;  2V4R A;  2MCT A;  1CZW A;  3K7A H;  3KHL A;  2B2U C;  3KHR A;  5DG7 A;  5KG2 A;  2R6F A;  3QZ8 A;  4X64 H;  5D1O B;  3TBI B;  4MTD A;  3BDO A;  5C44 B;  4ECV A;  3S1R H;  2NN6 G;  1F2M A;  2W6O A;  3NPP A;  4M9U A;  2R8H A;  3QB3 A;  2KCT A;  1HNW L;  2WB1 B;  4YAJ B;  2EDG A;  3QIA A;  2PQA A;  2IX1 A;  1IBM H;  1I94 L;  2JA7 G;  3HOX B;  1QZG A;  4DR3 H;  4HN7 A;  3CME A;  2RA4 A;  3BS1 A;  1XPR A;  1TS3 A;  1EUC B;  4ECZ A;  1KLU D;  4CKC A;  3Q8S B;  2WDT A;  1GUT A;  3A55 A;  5IWA L;  4J9K A;  1Y1V H;  3RLN A;  4HJ9 A;  3H40 A;  2R92 A;  2AUJ D;  3KF8 A;  5M5X H;  2D0P A;  3D4D A;  4JI0 Q;  4DR7 Q;  2F0L A;  1ULZ A;  3ORR A;  3RB6 A;  4ZI7 F;  4X66 H;  1D1K A;  3GQB A;  4DK1 A;  4A3J G;  4XIG S;  4RU9 A;  1QWY A;  1SBB B;  2ENB A;  1PZI D;  2XSC A;  5GAG C;  1PZJ D;  1G51 A;  1O78 A;  2UVW A;  3Q23 A;  1TWC B;  2YTY A;  3JZI A;  3HB9 A;  3RFC A;  4IWX A;  1SLJ A;  1GUS A;  1VQP A;  1I3Q B;  4C3I B;  2NZ1 D;  2WII B;  4L5Q A;  1JJC B;  4QW9 A;  1ZET A;  3MFI A;  2N78 A;  3GP7 A;  2UXD Q;  3FMA A;  2NVQ H;  4HNU A;  3RMH A;  1S3O A;  2GPW A;  4LFA H;  1B9M A;  1JDE A;  3V6J A;  3TP8 A;  1VQH A;  4HYK A;  3KF8 B;  3F1Z A;  3ER0 A;  5I9O A;  1BXT A;  2DNE A;  4CJ0 B;  2UUA Q;  1KJQ A;  2ASJ A;  2Z6B A;  1S0O A;  2Y0S B;  1MSG A;  1PRT C;  4V19 0;  4A3G H;  5C0X H;  2I5L X;  2F0F A;  2I5M X;  1UC9 A;  3BVM A;  4HMJ A;  1FD7 D;  4CDD C;  1WFQ A;  3PCO B;  4NXN H;  5J39 A;  1L0W A;  4R4I A;  1N34 H;  3S1Q H;  4QGU A;  1TT2 A;  3HKS A;  4DL7 A;  3AFQ A;  3UQ8 A;  1B3Q A;  1X32 A;  4DV1 Q;  3PVX A;  1EQR A;  4BY7 G;  1GKH A;  2DWC A;  1CQI B;  5L9X A;  2AQ4 A;  3FP9 A;  4LF5 L;  1PTO H;  1TVX A;  1PYB A;  2UVR A;  2JEB I;  1YIT A;  1GLV A;  2JK8 A;  2R93 H;  1KRS A;  4LMQ D;  4KHP H;  3VPD A;  5EWG A;  5I9P A;  3I90 A;  1J6Q A;  2D2C C;  4YJ3 F;  3H20 A;  2A6E C;  4NPS A;  3X3M A;  1WCM G;  4C1N I;  1X6O A;  1JR0 D;  2O5I C;  4DAY A;  5KKN B;  1QVG A;  4A93 G;  3GV5 B;  3PW2 A;  4Q0Y A;  2X6L A;  4OL7 A;  4DV6 H;  3GV7 B;  1IBK H;  4J0M A;  4A93 B;  3T51 B;  2A74 C;  2ZJT A;  1AZQ A;  3MR5 A;  2R85 A;  1Q82 C;  3A54 A;  3L2P A;  1R9T A;  4LF7 Q;  1C30 A;  5BR8 H;  4DR1 Q;  5CC4 A;  1YNN D;  5KFY A;  5F9N A;  1IBL L;  5M3M G;  3P75 A;  1KC7 A;  1PH5 A;  2G5D A;  2M2L A;  4DL4 A;  4H7B A;  1WD0 A;  2FFK B;  1D2B A;  3K58 A;  1LTG D;  1U9R A;  1K3R A;  3BZD B;  1SE2 A;  2B63 B;  3JRX A;  4KHZ A;  4BY1 B;  3V05 A;  2IT1 A;  3M4P A;  4RH6 A;  4DU9 A;  4B3S H;  5L1K A;  3Q22 A;  3NBH A;  1XX8 A;  5DQG A;  4XT3 B;  1FVI A;  3I4M G;  3HKZ E;  3K0X A;  4Y52 H;  1SE4 A;  4F4W A;  4BS9 A;  2UUC Q;  3I4M B;  1SFO H;  1Q86 C;  2VUG A;  2W8K A;  4AIM A;  1CHP D;  1E22 A;  4KN4 C;  4UCO A;  4O3S A;  1Z2N X;  1PH1 A;  3M4I A;  2W8L A;  1SNC A;  2K5H A;  1HNZ H;  1A62 A;  2Q2H A;  3H0G G;  4DUZ H;  3GLK A;  1STN A;  2EY1 A;  1T5X D;  1RHP A;  1STA A;  1WJJ A;  2KEN A;  4OIK A;  1HNX Q;  2VY3 A;  4ECX A;  1ENA A;  2R7K A;  3FMC A;  4IUQ A;  4GKJ H;  1K8O A;  4K2K A;  5IGB A;  1QUQ A;  2ZJP A;  2YZN A;  1B8A A;  3J7Y W;  5JVG 3;  3U9S A;  3EPG A;  5LYJ F;  2RF4 A;  3K5H A;  2IMW P;  4A2A A;  2VW9 A;  5KT6 A;  1DOK A;  2K04 A;  1UNN C;  4ILW A;  1GSO A;  2N3S A;  4RHR A;  1HR0 H;  1B04 A;  3NGD A;  1VQL A;  3NQI A;  1FYC A;  4L63 B;  1EY9 A;  2GVB A;  3MTS A;  1QG7 A;  1RDP D;  2XTI A;  1SNP A;  3DHQ A;  4B3T Q;  1GUG A;  4AYB A;  4CDC C;  2F0E A;  4C56 C;  4JI4 Q;  4LF6 L;  4ED6 A;  1TR5 A;  1Z2O X;  5DLF A;  4GKK L;  2CQA A;  1BUV T;  1WH2 A;  4YY3 L;  3S16 B;  1DCZ A;  2IHE A;  5F2D A;  2JA8 H;  2QK4 A;  3RUZ A;  2R7D A;  2SOB A;  4MV7 A;  3R5H A;  1SR3 A;  2J6S A;  2H1E A;  5EBC A;  1N33 L;  3OHB A;  1L1O A;  5ELE A;  3SI8 A;  1X3F A;  2RDG A;  2NVX H;  3M7N A;  4OX9 Q;  1YVC A;  1NMG A;  2VUM B;  3GIL A;  2K7V A;  4RB3 C;  4DV5 H;  1PFB A;  1S0N A;  3GTO B;  5CV9 A;  1JIH A;  5C5L A;  3KDF A;  4DR5 Q;  2ASL A;  3GTL A;  2W9B A;  1RK5 A;  2R8J A;  4ME5 A;  4DR4 H;  1ML0 D;  3RD4 A;  5BN3 A;  5KG5 A;  4LUZ A;  2RGV A;  5K36 H;  1TWH H;  3HOZ G;  2HJW A;  2ZM6 H;  1X3Q A;  2HIV A;  1Y1W B;  4POG A;  3FDS A;  3TME A;  3C1E A;  1CSQ A;  4KMU C;  4A3C G;  1BNC A;  4C3H G;  1PYS B;  3T13 A;  4C2M H;  2F52 A;  4K5X A;  3P20 A;  2OCE A;  4OO1 G;  1S4Z A;  5HUR A;  4GLA C;  4DR2 Q;  4JI8 H;  2GLT A;  1F77 A;  2DGY A;  2F4V L;  5KFQ A;  2F0T A;  4K5W A;  4BBS G;  2ZXP A;  3S2D B;  3C46 A;  4DUY H;  4BBS B;  2ZTD A;  4RZQ A;  2MNA A;  2CWA A;  2IPK D;  3OYY A;  4H44 C;  1JWU D;  5LHY 1;  4XZ3 B;  3AFP A;  5C4X B;  1F2Z A;  3FPU B;  4LH6 A;  5I2Y A;  4IPH A;  3E9I A;  2I5H A;  4YHH Q;  4EQP A;  4FO2 A;  1FJG H;  3F8N A;  5D14 A;  1LTL A;  2IX0 A;  3C0F B;  5JJK A;  3KFU A;  2OTJ A;  3Q6S A;  1WTP A;  3CRK C;  5JEA G;  1XPO A;  3LNN A;  2FMM A;  4EEQ A;  1RCV D;  4DK3 C;  2B8G A;  4DNR B;  5DGB A;  1Z9F A;  2YRW A;  3CPF A;  4DNI A;  3HOU H;  3K6O A;  4K0K Q;  2KCC A;  5KFW A;  4JI6 Q;  3ZYY X;  4LFB L;  2ZDG A;  1S5E D;  1XWE A;  3KAJ A;  3ERS X;  3G6E A;  4JW0 A;  3T5L A;  2K4K A;  2QCP X;  2N8N A;  5IP7 G;  3PO3 G;  5KT4 A;  1L1O C;  4X64 L;  1GYF A;  4ED2 A;  3ETH A;  4DAV A;  4IN3 A;  5COY A;  2KED A;  3E5N A;  2CHB D;  5KG0 A;  2A73 B;  1GHK A;  4HIK A;  1D5X C;  3DXJ C;  4O3O A;  2KBN A;  3ULJ A;  2WAQ G;  1IBM L;  4FF4 A;  4LF4 H;  4MHE A;  4O1N A;  4KKS A;  4R1J A;  4Y7N B;  1YJW A;  2WAQ B;  3S14 H;  4OGQ C;  5FO8 B;  4JI2 Q;  5LL6 S;  2NVT B;  1QNK A;  4B08 A;  5FJ8 G;  1JLL B;  3MR6 A;  1BKB A;  2PNR C;  1I6H B;  1VQN A;  1HNW H;  4JI5 Q;  4MIU A;  3N44 B;  2MO0 A;  3FDT A;  1I94 H;  1JCK B;  1PXU A;  1SN8 A;  4MV4 A;  4UY8 C;  5LMU Q;  1UWV A;  3MWY W;  5IE8 A;  5CAE B;  3KHG A;  5DAU A;  5CV4 A;  3GIJ A;  4LF8 Q;  5KFU A;  5FLM H;  3S1R B;  3I56 A;  2R82 A;  1EQT A;  4HJA A;  4WFN 3;  4ZK9 B;  4EGV A;  4L5T A;  5IWA H;  1M90 C;  4QCL A;  3SVM A;  1ZYR C;  1WVL A;  4ULL A;  1OXS C;  5I6W A;  4BXX H;  2F3W A;  4UP7 A;  5I4D A;  1Y1V G;  1Z6H A;  4CDF C;  1RTO A;  2O5J C;  2WB1 E;  3A5Z B;  2V59 A;  5M5Y B;  5ELN A;  1B9N A;  1JC7 A;  1UE6 A;  1WTW A;  5M5X B;  4LFA L;  1KNE A;  5KFA A;  3DEO A;  1U4P A;  5HY6 A;  5EZY F;  2RCN A;  2E2I B;  1X9N A;  2V4Q A;  4DV0 Q;  1KEE A;  1LTS D;  2NU8 B;  4C5B A;  4TQS A;  2ICE C;  3OTO H;  1RYR A;  2R92 H;  3HKZ A;  3BQ0 A;  1OO9 B;  3KOJ A;  4J9O A;  2VQF Q;  1B6R A;  5EPK A;  1K28 A;  5EOY A;  2JA6 B;  3O13 A;  1IYJ B;  3VYS A;  1WYD A;  4KKT A;  1N34 L;  5LXT F;  4RB2 C;  2F3I A;  2FLL A;  1JIC A;  4UCS A;  2AMC B;  3I3C A;  3I4L A;  2JSO A;  1A6X A;  1O7Y A;  2YZM A;  4HR7 B;  2FK3 A;  1BCP B;  1AEX A;  4QIW B;  5C3E H;  2NVQ B;  4GC7 A;  1GHJ A;  5E4W C;  5IY0 A;  3AMU A;  2W6Q A;  3ERO A;  4IUP A;  1LT4 D;  3K8A A;  5EBD A;  4A3G G;  3HRZ C;  5C0X G;  2E75 C;  1CKM A;  4TQU S;  1DV2 A;  2I80 A;  4RWS C;  3Q8Q B;  4JBW A;  4LF5 H;  4DN4 M;  1IBK L;  2AHO B;  3LWE A;  3RLO A;  2F0K A;  4ZQI A;  2BA1 A;  5ISR A;  3GV3 A;  3CPW A;  2GN5 A;  1IKL A;  1Z47 A;  1XTC D;  3PO2 H;  1C48 A;  2SNM A;  3BZK A;  3IFD A;  3M4O H;  4FBU A;  3UI2 A;  5LMN W;  4IZ8 A;  1VAJ A;  3AYH B;  4RHS A;  5CV6 A;  1V4Y A;  3RGZ A;  2Y0S E;  4HJ5 A;  1GVP A;  3CMA A;  3RAX A;  1NAP A;  2R93 G;  3A5U A;  1AUV A;  2AU0 A;  2QGQ A;  5CV7 A;  3GTQ A;  5EPL A;  2CZG A;  3KLW A;  1N8R C;  1LTR D;  2OTL A;  3BA9 A;  1O75 A;  1KIX A;  5BPF A;  1WI5 A;  1FNV A;  5CV5 A;  4B3S L;  3MFH A;  1XXG A;  3BG3 A;  4A3D H;  3DM3 A;  3SDZ A;  1IBL H;  1ASY A;  2EYM A;  2Q8I B;  2IW3 A;  2NBF A;  3HOV H;  4LAA A;  3TZD A;  4GN4 B;  4B3M L;  4EGQ A;  2G9D A;  1H9S A;  4RGO S;  4DV2 L;  1KAA A;  3H3V C;  1AUX A;  4DV3 L;  2ZXR A;  2H4O A;  3NTI A;  1Q1B A;  3Q0A A;  4LUV A;  1H9M A;  5KFR A;  3R23 A;  3U9T A;  3T5H A;  2RBM A;  4X66 Q;  2L12 A;  1QNU A;  1HNZ L;  3HBL A;  1AE3 A;  1EY8 A;  2A6H C;  1D5M C;  4EGJ A;  1N56 A;  4JV2 A;  2F0J A;  1N48 A;  3V96 A;  1HFG A;  1R9T H;  5CA1 F;  2JEI A;  2QIL A;  4KY6 A;  5H1S E;  3R2T A;  5EWE A;  4UAI A;  1L0Y B;  3RUP A;  2ZJR A;  1VKZ A;  3MXN B;  2CW7 A;  1CA6 A;  3OMC A;  2DZD A;  1VBG A;  1EU4 A;  1IW7 C;  4XQN A;  5DG8 A;  1K8G A;  1PDQ A;  1JMC A;  3FKI A;  5JPN C;  1AH9 A;  3SK8 A;  2C35 B;  3CCS A;  4QWA A;  3S15 H;  5LL6 b;  1EYD A;  4B3R Q;  1SFO B;  5KFG A;  3PV0 A;  1H9S B;  3D6C A;  4ZUJ A;  1ASZ A;  1DOL A;  2VB3 X;  4HTH A;  3VR3 A;  3P1H A;  4PG3 A;  1S72 A;  3CRL C;  1RL2 A;  4EQO A;  3A7L A;  3F8T A;  2FK1 A;  3T1Y Q;  2BOS A;  4I50 F;  4F4X A;  3FHW A;  4EFB A;  4NXN Q;  2LY7 A;  2HHH H;  2ZXO A;  4DLK A;  2UUB Q;  2J9G A;  5T1I A;  2MPM A;  1IOV A;  1QIL A;  3STB C;  5KFZ A;  1M4V A;  4K8J A;  1S5F D;  2I0Q A;  2K5D A;  3I2Z A;  5KT7 A;  3HGB A;  1XJV A;  2EYJ A;  2CW8 A;  2TMP A;  5KGU A;  3CCE A;  3G6J B;  1E2Z A;  5CYU A;  3EFX D;  1EYZ A;  2UXB L;  4LF6 H;  1MBY A;  1SNO A;  4JI1 H;  4GKK H;  2CCZ A;  5KFT A;  3K3V A;  2NTT A;  4IRK A;  2NU6 B;  1EY5 A;  4YY3 H;  2GVA A;  2PMZ B;  2AWN A;  4APM A;  3J7A F;  2K5W A;  4ECR A;  3R93 A;  1TXY A;  1O7L A;  1XNQ Q;  1VQE A;  3H3V I;  3SR1 A;  4DV6 Q;  4DR4 L;  4O3P A;  1KAB A;  1Z7T A;  4XDX A;  1K83 B;  3GTG A;  5IGF A;  4RNO A;  4NKL A;  4O3N A;  5KNB A;  4N8F A;  4LFC H;  2ZM6 L;  2WP8 J;  5BR8 Q;  4KLK A;  3E6Z X;  5EGT A;  5LMN H;  2R7Z H;  4PZ7 A;  1XDN A;  3D31 A;  2MO1 A;  2A1A A;  4OXP A;  4WJ3 M;  1K3B C;  3QO2 A;  4A3B H;  4YCU A;  2F3V A;  4ABN A;  2VOB A;  2JEA I;  3T5J A;  5E3F A;  1VQD A;  1KBL A;  2P5Z X;  4JI8 L;  1DM0 B;  4R8N A;  5IGG A;  5IGC A;  4GC6 A;  2XGT A;  1OXX K;  5K36 G;  4Q43 A;  1HQR D;  2BQU A;  4NDX A;  1YNJ D;  3A0J A;  4ZAI A;  4DUY L;  4DR7 L;  2F0S A;  3L3O C;  5EWF A;  1J5E H;  2OWO A;  3K57 A;  4LF9 H;  1NR4 A;  4B9W A;  4DV7 Q;  1PH8 A;  2K14 A;  1S0M A;  3CQZ B;  4POF A;  5L1I A;  1EY6 A;  3OPO A;  2YU9 B;  3W3A A;  2F4V H;  1XMQ L;  5M3F H;  1FJG L;  1SNM A;  2XWJ B;  1EY0 A;  2MUY A;  1ET6 A;  4G7H C;  4AQY L;  1M0T A;  5D1O A;  2ZJQ A;  3NXW A;  1JT8 A;  5JJI A;  3OW2 A;  3OHA A;  5BN4 A;  1GXD C;  4GLX A;  1UEB A;  2E2J H;  2UXD L;  4J9S A;  2WB1 A;  1SMY D;  5A35 A;  1YI2 A;  2JA9 A;  2L5T A;  1V51 A;  2PPB C;  4ZKB B;  3PUX A;  3G7L A;  3VR2 A;  1NNX A;  2L11 A;  4FXG C;  4EBC A;  1HR0 Q;  3HOW B;  3GTJ H;  2RHS B;  4BBR G;  3B6Y A;  5FKA C;  1JQY D;  4BBR B;  4H13 C;  3RJ0 A;  2B2T A;  1XYI A;  2KHI A;  4LFB H;  3D4W A;  4Q45 A;  4LF4 L;  1RJR A;  2R3Z A;  1PTO D;  4C3J H;  1FL0 A;  3HOU G;  3MVV A;  4ZKC B;  1MIU A;  1Q12 A;  4A3M H;  3DWA A;  4XQQ A;  4U7C A;  2BE5 D;  3RN2 A;  3PF5 A;  1ZQ7 A;  1TQO A;  2MGS A;  4QJF A;  4TRD A;  5DEH A;  3T1H Q;  3QJY A;  1SMX A;  1XMO L;  3CVZ A;  2FE3 A;  4DV5 Q;  1TWC A;  2BCO A;  2JA7 B;  3J7A K;  3W1G A;  1K1S A;  2QA4 A;  2W6N A;  5EKK A;  4Q8F A;  4JOI A;  2RVL A;  1I3Q A;  2B2V A;  2L9H A;  4KKU A;  4O2A F;  4XQJ A;  2RCF A;  4RB1 A;  3KBG A;  1Q90 A;  2YV5 A;  3GTK H;  5FLX W;  5NUC A;  3S2H B;  3M9M B;  1XNR Q;  2BDO A;  2M05 A;  4QMG A;  1PH4 A;  3VMM A;  1U5K A;  3S14 B;  4IZO A;  1DD2 A;  2JA5 H;  4WJ4 A;  1G2S A;  1JE5 A;  3M3Y H;  4FBT A;  2Y0S A;  5IOD A;  4K14 A;  4YWM A;  2W7P A;  4X3K A;  4BWS C;  4YWL A;  1QVF A;  4R8U B;  4A3F H;  3N52 A;  4QL5 A;  1CHQ D;  2BQ3 A;  2CW0 C;  3ETJ A;  3EPI A;  4DV4 Q;  4A3J B;  4FF2 A;  3E5S A;  4YCV A;  4GN3 B;  4F50 A;  1F9Q A;  3DEP A;  4K6L A;  3KYH C;  3L4K A;  5FLM G;  2WYO A;  2XCA A;  2WAQ E;  1V1P B;  2YCH A;  2OT2 A;  3OTO L;  1FKA H;  4QWD A;  3N8D A;  4ODG A;  4C5C A;  4XYQ A;  3UDI A;  2XRQ D;  4IFD J;  1OWT A;  4FS1 A;  4JYA H;  2QYZ A;  2A5H A;  4RG1 A;  2RGR A;  1CI3 M;  3J80 i;  4BXX G;  3PR5 B;  3W5O A;  3L7Z C;  3CCU A;  1TWG B;  2DJF C;  4A3I H;  3QWN A;  3PIO 3;  3CCR A;  4JI3 Q;  1RJT A;  2NZO A;  4O3Q A;  1NE3 A;  2HGS A;  5C8Y F;  4J8Q A;  1YJ9 A;  3W2D A;  4KJN A;  2B2T C;  2A69 D;  1TA8 A;  1B44 D;  1HZA A;  2F0D A;  4YQW A;  3RZD H;  2UU9 Q;  4IUV A;  1QOH A;  1LT5 D;  4J1M A;  3AU7 A;  2R92 G;  4NXM L;  4PQX A;  3TSS A;  4JI7 L;  2PBZ A;  4QWE A;  5DM7 3;  4ECS A;  4BY7 B;  4RGT A;  1C8C A;  1LT3 D;  4N8X 1;  2FJ2 A;  2O03 A;  4K6D A;  5C4J B;  5IYB H;  5IYD H;  2B63 A;  3EA6 A;  2PI2 E;  3RLF A;  2KHS A;  3NTK A;  3J81 i;  4V0B A;  3QOJ A;  5KNC A;  4BA2 I;  1Q8I A;  4B3T L;  1A3U A;  1K8M A;  2RDF A;  3CC2 A;  2F0I A;  1F9P A;  2Z4H A;  3CD6 A;  3OSP A;  5JVD F;  4RMF A;  5CR3 A;  1WCM B;  2JXM B;  5C3E G;  1SJE D;  2F0P A;  2F0O A;  1C0A A;  3L4J A;  2WKC A;  5C3E B;  1I4G A;  1S97 A;  4YP3 A;  1V8Q A;  4ECT A;  3RN5 A;  2CKZ B;  1DV1 A;  5C5M A;  2X6G A;  4P73 A;  2CVR A;  1PLF A;  4ZCK A;  3TP5 A;  3TN2 A;  1IHZ A;  3N43 B;  3Q8D A;  5CGK A;  1BR9 A;  4P74 A;  1F2L A;  3RB4 A;  3SEB A;  1YHQ A;  3RBE A;  5M3M B;  2EYF A;  4ED1 A;  2AKW B;  3K81 C;  2EVB A;  5C3X A;  1EOT A;  1I5F A;  5GAE C;  2EY5 A;  4QIW E;  3MC0 B;  3PO2 G;  2A68 D;  1W6J A;  3E0J A;  1GM5 A;  3LGJ A;  4PMW A;  1VQ7 A;  3PO2 B;  4DL5 A;  2AQ2 B;  2XN9 C;  4HIM A;  1V9P A;  1Y8O B;  1TWA B;  2DJG C;  4CKE A;  4B3M H;  4DV2 H;  5LOV F;  4DV3 H;  1ROD A;  5F9L A;  1G6Z A;  1UE5 A;  1MJE A;  4A3D G;  3RB0 A;  3RAQ A;  2AUK A;  4PDB A;  3GTQ H;  4WOR A;  1E1O A;  3GTP B;  5DLG A;  4MTK A;  1I4P A;  2RQX A;  4RGM A;  3WWV A;  3HOV G;  3RZO H;  4IHJ F;  1BO0 A;  4O4H F;  5KT3 A;  3HOV B;  1CZG A;  3M7G A;  3H0G B;  1DIK A;  3BAB A;  4U68 A;  4IWY A;  1RYS A;  3V4S A;  3E3X A;  4HIO A;  3PUW A;  4UCT A;  3V6H A;  4P72 A;  4YWK A;  3BQ1 A;  1CUK A;  1J9O A;  1N9W A;  2Z1C A;  1W96 A;  2R86 A;  4A3E H;  2TSS A;  4HCS A;  4J9Q A;  1VQO A;  1NMF A;  4IRD A;  5BMV F;  1KTK A;  1QE6 A;  3CHB D;  4FVM A;  4L5R C;  4DPG A;  1NUC A;  2VUM A;  1JJ2 A;  2HHH L;  2RSO A;  2EYH A;  3SHL A;  3T5K A;  4JBK A;  1LV9 A;  3GTO A;  5KG7 A;  5FLX E;  5KFM A;  2MFI A;  3L9A X;  1YZ6 A;  5D3I B;  5KFN A;  2Z6K A;  3DWQ A;  4CBV A;  4IOA A;  4UP8 A;  1I4Q A;  2R6G A;  4JI1 L;  5KIX A;  3FKI H;  4JI6 L;  1Y1W A;  2K28 A;  3MFY A;  1EHI A;  1R4Q B;  3H4B A;  4F8M A;  5FPO A;  1I50 H;  2V5A A;  2XVS A;  1BBX C;  5JJL A;  5DNF A;  2CFM A;  2YYA A;  1X3G A;  1A63 A;  3QFF A;  2HQL A;  2D5D A;  2UXB H;  5E1F A;  1F9R A;  1N32 Q;  1E24 A;  1Z2P X;  4DL6 A;  3WOF A;  4TV8 F;  2M00 A;  4LFC L;  4RCO A;  4GNX B;  4UCV A;  5HGQ A;  3EBE A;  5LMN L;  2Q2T A;  4MNO A;  2B39 A;  1HH2 P;  1KXL A;  4FS2 A;  4RA8 A;  2PCF B;  1A3V A;  4OEL B;  4JI2 L;  1VMP A;  1SE8 A;  4JV5 Q;  2FB9 A;  5CV8 A;  1PRT D;  4CJ1 B;  3HOZ B;  1EQQ A;  1GUO A;  3S1N B;  1QB5 D;  1NTG A;  1CM9 A;  1TII D;  1IBL Q;  4X6A H;  4I55 F;  3I4N H;  2EYP A;  5KEE A;  3CCQ A;  4H0L C;  3K5M A;  4MTE A;  5DQI A;  1UE1 A;  3EVQ A;  4C3H B;  1IZ6 A;  4LF8 L;  1J5E L;  2YL2 A;  2FJZ A;  3TQ1 A;  1CQV A;  4ZYS A;  4GOP B;  4TQR A;  4LF9 L;  5KYI A;  4OIJ A;  2EQS A;  1TKW B;  4AYB G;  5IGD A;  1T9H A;  4WJW A;  3F2C A;  2R7Z G;  2UXC Q;  4O3R A;  3NWT A;  3KAL A;  1EY7 A;  2PMZ E;  3GTG H;  2VNU D;  1TWF B;  4M8A A;  3Q8R B;  4A3B G;  2F0G A;  4LJZ C;  4DR7 H;  2EZV A;  1U4R A;  5DLQ E;  1QZH A;  2HT1 A;  2A6E D;  3MA2 B;  2QF7 A;  4H02 A;  3ICE A;  2NVY H;  3F2U A;  4R4T A;  1II3 A;  2K6A A;  4ED0 A;  2E2H B;  1XMQ H;  3S1M H;  3JAM i;  1BCP F;  5HBR B;  1N36 L;  1CFM A;  2YS7 A;  4G3I A;  4KJO A;  1SRO A;  2WAQ A;  5KFJ A;  3DF7 A;  1EOV A;  3NBI A;  2Z6K C;  4O42 A;  2G9H D;  4P75 A;  4AQY H;  1JDB B;  5T14 A;  1P16 A;  4CC5 A;  3PQI A;  1D6E C;  5M5W B;  1MZB A;  5M3F G;  3Q8P B;  2UXD H;  2KOL A;  5DG9 A;  5C3W A;  3GTM B;  4F4Y A;  1CQF A;  3SE0 A;  1JB7 A;  1I7L A;  2K5V A;  3UDG A;  2VS1 A;  4ZLT F;  2W7O A;  3PO3 B;  5G3L D;  5JPM C;  4DR6 L;  2E8G A;  3ERQ A;  3EYY A;  5J3B A;  3J80 E;  3S17 B;  5ELD A;  4LW1 A;  4GLV B;  1OXV A;  4JC0 A;  2EXZ A;  4PZ8 A;  1CKO A;  2J6T A;  4DAP A;  4X65 L;  1SYF A;  1AE2 A;  5C44 H;  4OWW B;  4WD3 A;  4EYH B;  1EWI A;  4ECW A;  3H91 A;  4GKK Q;  1VQA A;  3GTJ B;  1TY0 A;  4YY3 Q;  4RFB A;  1C9O A;  2RSN A;  4G57 A;  3WNZ A;  3P7J A;  5KX5 F;  1PFM A;  2KA7 A;  4KV6 A;  3U4Z A;  3HOX H;  3MEF A;  3OWE B;  1J8I A;  2A19 A;  1WR2 A;  1N33 Q;  4O0A A;  5GRO A;  4IFD I;  3K7A B;  2XCL A;  4JV0 A;  2PI2 A;  5AJ3 Q;  4I7A A;  4C3J G;  4JBM A;  2KSW A;  4DR6 H;  4ZHQ F;  2K50 A;  1XMO H;  2E2I A;  3BYY B;  1Q46 A;  3I7F A;  2FMA A;  4DXG A;  5A2Q E;  3R5F A;  3M85 A;  1JE4 A;  5M9O A;  4A3M G;  2Q2U A;  2BH2 A;  3J81 E;  4YR0 A;  1SXT A;  3OUU A;  1LLR D;  1TU2 B;  4GS3 A;  5J2T F;  2JA6 A;  3GIK A;  3T4A C;  1Q3L A;  4LF7 H;  1GO3 E;  1EZ8 A;  3RV3 A;  4DR1 H;  2DY7 A;  2HD3 A;  2F03 A;  2YZG A;  4O4I F;  3G4S A;  2DPI A;  1KDC A;  2AQ3 B;  3JAM W;  4IAL A;  5DM6 3;  2HVQ A;  1T36 A;  2K5Q A;  4A4I A;  3I8Z A;  4HR7 A;  4QIW A;  1E3P A;  1Y1V B;  3GTK B;  4JYA L;  2E5L L;  1LYL A;  2K03 A;  4MA5 A;  1SYD A;  2JA5 G;  1I3Q H;  4C3I H;  3KF6 B;  2KQ3 A;  2F0U A;  4QW8 A;  3NUC A;  2JA5 B;  1BOS A;  3RR5 A;  5DGA A;  3M3Y B;  4A3F G;  2F4V Q;  2EOT A;  1VQF A;  3DWP A;  2FPP B;  1IKM A;  3OSO A;  3IN5 A;  2QEX A;  1VQ4 A;  4P2C B;  3TP6 A;  2VA2 A;  4JV1 A;  2QW7 A;  3SE7 A;  2RDH A;  1VQ6 A;  4O4L F;  2FLN A;  2W57 A;  1HNX H;  5FO9 B;  4IPG A;  1JWM D;  1BBU A;  3HG9 A;  1EYG A;  4ECY A;  2HDM A;  3EIV A;  2R93 A;  5KFI A;  5KG6 A;  4B9X A;  1AN7 A;  1VQ5 A;  1PH3 A;  4HMI A;  1CTM A;  4A3I G;  1GSH A;  1I6U A;  4FP5 D;  3T1Y L;  4DL3 A;  4A3I B;  3GDE A;  2JJQ A;  4NXM H;  4PMB A;  4EEY A;  5LL6 X;  4A3L H;  2SCU B;  5FPR A;  1HZB A;  2DPJ A;  2UVU A;  4A3G B;  4JI7 H;  5E7N A;  5K2M A;  2EJM A;  2ALZ A;  3CU7 A;  1HRJ A;  3VPB A;  4ZQ3 A;  2ZTE A;  3BYT B;  1O7Z A;  3S24 A;  4HJ7 A;  4X64 Q;  3S1Q B;  1NSN S;  4MN3 A;  2NUC A;  1CA5 A;  4B3T H;  4A93 H;  5CB4 F;  2DLN A;  4JI4 H;  1PH2 A;  3T16 A;  5IYD G;  5IYB G;  1IBM Q;  1PTO B;  5L37 A;  3PIP 3;  3MAQ A;  2XGP A;  4DR3 Q;  3HKZ G;  3MXN A;  2R93 B;  4X62 L;  1E2V A;  3N6X A;  5ELB A;  3E9H A;  3CP0 A;  4PWQ A;  1JB3 A;  3TRE A;  5KFH A;  1EIY B;  4OX9 H;  2B63 H;  1DOM A;  5EDW A;  4BY1 H;  4KHV A;  4MV1 A;  1HXY D;  4GZY C;  1YNX A;  5FLX L;  1ICW A;  1SFO A;  1BCP C;  2HCI A;  2C9O A;  2RHQ B;  1E1T A;  3D4R A;  3A74 A;  2LKV A;  4L5S A;  1S9F A;  2F0N A;  4OON A;  1C4Q A;  3ULP A;  2KCM A;  1H95 A;  4XYO A;  4E6I A;  3BAA A;  4MV6 A;  1WOC A;  1HCZ A;  5LA6 F;  1E7Z A;  2YS6 A;  2FK2 A;  1NCV A;  2VQE L;  1KJ8 A;  1ILQ A;  1R4P B;  3EJI A;  4NLG A;  1SYC A;  1MKH A;  4EQ5 A;  1PYW D;  5C5J A;  3U58 A;  3TS2 A;  1GSA A;  4HSP A;  2I07 B;  3I12 A;  3NEL A;  2PW7 A;  3J7A V;  4DK0 A;  3DLL A;  4RB0 A;  1K8A C;  4LFA Q;  4DR2 H;  1IL2 A;  2HIX A;  3Q24 A;  5ELC A;  5C6A A;  2KCN A;  2XC9 A;  2PMZ A;  4YR2 A;  2IL8 A;  2RDJ A;  1JOK A;  1GUW A;  3ZJY C;  1EWH A;  2KVM A;  3RZO B;  1K83 A;  1S03 G;  3RF2 A;  1T5E A;  1IYU A;  1ESR A;  3MEH A;  1KJJ A;  2NB0 A;  2L55 A;  1BBW A;  1B2T A;  4UFZ A;  3MXP A;  4YHH H;  1N34 Q;  3ITP A;  3NSW A;  4MTN A;  3BU2 A;  5JOB A;  4ME6 A;  1MHW C;  4A3E G;  1SEI A;  2D0O A;  2FXQ A;  4KN7 C;  4IFD H;  1BJT A;  1ZYR D;  4QWC A;  4UHV A;  1CSP A;  1S40 A;  5FD6 A;  1KHI A;  1PMR A;  3S16 H;  2NVX A;  2EYL A;  1WTQ A;  4YBZ B;  3N41 B;  3JAM E;  2C22 A;  4KHP Q;  3VR5 A;  4K0K H;  4QWB A;  4DAM A;  4HSV A;  4JI6 H;  5KFE A;  1D1I A;  2YTX A;  1HA5 A;  5J22 A;  5FLX c;  4FXD A;  3N40 P;  4TVA B;  2VUM H;  1EUD B;  2RDI A;  4I65 A;  1IBK Q;  1YBY A;  5J1Z A;  3GTO H;  3A7A B;  1CKN B;  3FKI G;  5L1L A;  2HUG A;  1VS0 A;  3CQZ A;  2JE6 I;  5KFC A;  2YU9 A;  2JA8 G;  1NY4 A;  4PNY A;  4N9T A;  1MI2 A;  1ENF A;  2JA8 B;  1AFP A;  3H94 A;  1X65 A;  4ALP A;  3OW7 A;  3VYR A;  1B7Y B;  3G8C A;  5KFV A;  3FPP A;  4J9P A;  2C2R A;  3MR2 A;  4JI2 H;  1Y1W H;  4O2B F;  2NVX B;  4PZ6 A;  3KJP A;  3GIQ A;  3BA8 A;  2R8K A;  2VXW A;  4FF3 A;  1Y14 B;  4B3S Q;  2R8G A;  4JI5 H;  1A3T A;  3OMG A;  1EYA A;  2Q2I A;  4ED3 A;  2UVV A;  2R7F A;  3LML A;  3VYU A;  1XNR L;  1ICF B;  4JI0 L;  3ND8 A;  1UE7 A;  4HNV A;  3J80 L;  2OXP A;  3NE5 B;  4DV2 Q;  4LF8 H;  4DV3 Q;  1TWH B;  5JQW A;  2J7Z A;  5KT5 A;  3GTL H;  3S2D H;  3V6K A;  4PMC A;  3TEH B;  4I4T F;  3A8K E;  3I4N G;  1HNZ Q;  4IR9 A;  5J2U F;  4J6H A;  1EIH A;  4DUZ Q;  3KTM A;  1VQ8 A;  4RNN A;  5C4X H;  4MA0 A;  4C2M B;  1ONL A;  2OEO A;  2Z8L A;  3ND9 A;  2R8I A;  3MWD A;  4R4O A;  2F0W A;  2R7L A;  2FKL A;  4GKJ Q;  5COR A;  1K1Q A;  3GO5 A;  4RGN A;  2EE1 A;  3AB9 A;  5C4Z A;  5TSS A;  4UCU A;  2C2E A;  4ZUI A;  2ZDQ A;  4FU0 A;  1N36 H;  4M1U B;  4DV0 H;  1B1Z A;  4JI3 L;  4LUO A;  4QUF A;  2UUA L;  4NW2 A;  1T3N A;  4PV1 C;  2JA7 A;  5I47 A;  2W71 A;  5E4X A;  1LT6 D;  1YNN C;  5KRU A;  2NVY B;  2O2L D;  4LNQ A;  1E4E B;  4JPB W;  2X69 A;  1TS5 A;  3MXG A;  2R84 A;  1STY A;  3L0O A;  4C1N K;  5JJZ A;  4UCR A;  1YEZ A;  5G3L F;  4R8I A;  1KDA A;  1JJG A;  2R7M A;  2W6P A;  1WTO A;  3IKJ A;  3PF4 A;  3HS0 C;  2YRX A;  3PGZ A;  4XYM B;  1A0I A;  4CC6 A;  4DV1 L;  1QCB D;  1U4L A;  3BDL A;  4K2L A;  2XIG A;  3D8G A;  1LTA D;  1EIF A;  2A6H D;  4RKB A;  3SK5 A;  5KG3 A;  2V4D A;  1NR2 A;  4LSX A;  1IL8 A;  4R8U A;  4DK6 C;  2EJF C;  3HOU B;  4Y7N H;  5T1G A;  4FYD A;  2GPS A;  1K0R A;  1GUN A;  4TUY F;  4YB8 B;  4X65 H;  3V2T A;  4KY7 A;  3OHX C;  3R3O A;  1IW7 D;  3I72 A;  1I6H H;  3K7U C;  5D3D A;  1GJX A;  2VQD A;  1V1P A;  1EWC A;  3T56 B;  3J80 c;  5KFP A;  5KFK A;  4HQ6 A;  1FNU A;  3GII A;  1JWS D;  1M7J A;  1E2W A;  4XTC S;  3TZU A;  4DR4 Q;  5C44 G;  3KUP A;  4A3K H;  1KAW A;  2ICI A;  3G48 A;  1S5B D;  4CGY B;  1VDZ A;  4LF7 L;  4EVO A;  2WB1 G;  4HAE A;  4YAK B;  2WKD A;  4DR1 L;  1PFN A;  1RF2 D;  1TWG A;  2ZM6 Q;  3HOX G;  4MAM A;  2OH2 A;  2CWP A;  1IXR A;  1U0L A;  3QG1 A;  2QDL A;  3NQT A;  3NWS A;  5LP6 F;  1SCU B;  3I73 A;  1ILP A;  1DGS A;  3N6R A;  3VDY A;  1PRT B;  2Z4I A;  2I87 A;  3STB D;  2V1C C;  2EXD A;  5IT9 W;  2NWG A;  2FMC A;  1LO5 D;  2K75 A;  4JI8 Q;  5M5Y H;  3J81 c;  4KI0 A;  4IAJ A;  2UUC L;  3ONA B;  2K52 A;  4EX5 A;  2E2I H;  3H4D A;  4DUY Q;  2P0A A;  4A76 A;  3K5I A;  5K5P A;  1BDO A;  2F4I A;  2ES2 A;  2E5L H;  3RGX A;  5FK9 C;  4APV A;  1DON A;  4XX0 B;  4TV9 F;  1KL9 A;  1WCM A;  4DNT B;  3MJF A;  3C3L A;  2JA6 H;  3TQY A;  3QOL A;  1XMQ Q;  2ID0 A;  2PQA B;  1FJG Q;  3HOY H;  3WOE A;  2A8V A;  1HZC A;  4XXE A; 
#chains in the Genus database with same CATH homology
 3EBE A;  4DV5 L;  5LMN L;  1HNX L;  3HOZ H;  4HID A;  2Q2T A;  3S1N H;  2K5N A;  4MNO A;  3M9B A;  1HH2 P;  1VQK A;  4MZ9 A;  5IT9 c;  2R92 H;  4X62 Q;  3KOJ A;  1KXL A;  2VQF Q;  4AQY Q;  2B29 A;  4JI2 L;  5GAH C;  4A3C H;  1SE8 A;  1IYJ B;  4C3H H;  4JV5 Q;  4ME3 A;  4LWC A;  1WYD A;  1N34 L;  3H3V H;  1EQQ A;  3RNU A;  2F3I A;  1NTG A;  3J7Z C;  4O2D A;  4AH6 A;  3G71 A;  2AMC B;  1HR0 W;  1IBL Q;  4B3M Q;  1XPU A;  3I4N H;  4X6A H;  1PFS A;  3CCQ A;  2Y0S G;  2KHJ A;  1UE1 A;  1X56 A;  1TWF H;  1IZ6 A;  4LF8 L;  1J5E L;  1V1Q A;  5C3E H;  4GOP B;  4LF9 L;  4BBS H;  1L2F A;  4DV4 L;  2EQS A;  1KQS A;  3F2B A;  4IOC A;  3J81 j;  4AYB G;  5IY0 A;  1T9H A;  3F2C A;  2R7Z G;  2UXC Q;  3CC7 A;  1Q81 C;  3K8A A;  4A3G G;  4JOI C;  2PMZ E;  1BVS A;  5ELO A;  5C0X G;  4JI4 L;  1CKM A;  4TQU S;  1D8L A;  3GTG H;  1EFW A;  1PVO A;  1VQM A;  2VQE Q;  2E2H H;  4A3B G;  3GD7 A;  4LF4 Q;  4JBW A;  2ATW A;  4FDB A;  5DLQ E;  1SRU A;  2AHO B;  3RLO A;  1QZH A;  1IBK L;  2HT1 A;  3UDX A;  4A3L G;  2BA1 A;  3CPW A;  2GN5 A;  4H02 A;  4NB3 A;  1NJI C;  1Z47 A;  3ICE A;  3PO2 H;  2NVY H;  5GAD C;  3BZK A;  4R4T A;  3M4O H;  1HNW Q;  5M5W H;  5LMN W;  2IHF A;  4OX9 L;  3S1M H;  3JAM i;  3AYH B;  1N32 L;  3BJU A;  1I94 Q;  2Y0S E;  1Q1E A;  3TS0 A;  4HJ5 A;  1GVP A;  3CMA A;  1YIJ A;  1XMO Q;  1N36 L;  2B63 G;  4DR5 L;  3GTM H;  2N49 A;  1SRO A;  1VQG A;  2QGQ A;  3A5U A;  1PV4 A;  2R93 G;  1EOV A;  3KLW A;  2Z6K C;  4P75 A;  1N8R C;  1PH9 A;  3CC4 A;  1OTC A;  2OTL A;  1P16 A;  2NN6 I;  2OQ0 A;  1KIX A;  4AYB E;  1WI5 A;  5M3F G;  2LXK A;  3JC6 6;  4B3S L;  5IP7 H;  5IWA Q;  3PO3 H;  2UU9 L;  4A3D H;  4JV5 L;  3DM3 A;  3S17 H;  1ASY A;  1EUJ A;  1V43 A;  3PIO A;  1JB7 A;  3HOV H;  2K5V A;  1A8V A;  3UDG A;  2VS1 A;  4GN4 B;  3U50 C;  4B3M L;  3HOW G;  5JEA J;  4DV2 L;  4DV3 L;  4DR6 L;  3CCJ A;  1Q1B A;  2E8G A;  2BH8 A;  4LUV A;  1VQI A;  5J3B A;  4JCV E;  4BY1 G;  4IJH A;  3CCV A;  4LW1 A;  3PUZ A;  1OXV A;  4GLV B;  4JC0 A;  4X66 Q;  2NVT H;  4PZ8 A;  1HNZ L;  1CKO A;  2UXB Q;  1AE3 A;  4X65 L;  5FJ8 H;  5IYC G;  1AE2 A;  4DR2 L;  2UXC L;  5C44 H;  4OWW B;  3K7A H;  1VQ9 A;  1EWI A;  1R9T H;  4GKK Q;  1VQA A;  4DAY B;  5H1S E;  4YY3 Q;  2ZJR A;  3OTO Q;  3MXN B;  1C9O A;  3U4Z A;  2VNU D;  3HOX H;  3MEF A;  2A19 A;  1N33 Q;  4O0A A;  5GRO A;  2NN6 G;  3S1R H;  1K8G A;  1JMC A;  4IFD I;  2ALY B;  2PI2 A;  5AJ3 Q;  1AH9 A;  2C35 B;  2KCT A;  4YHH L;  4JBM A;  1FJG Q;  1HNW L;  3CCS A;  2K50 A;  3S15 H;  2PQA A;  4GNX A;  2IX1 A;  4B3R Q;  1Q46 A;  3PV0 A;  1I94 L;  1QZG A;  1ASZ A;  3I7F A;  2JA7 G;  3M85 A;  3CME A;  1XPR A;  3H15 A;  4A3M G;  2Q2U A;  4PG3 A;  2BH2 A;  1VCI A;  1S72 A;  1RL2 A;  3F8T A;  3CCM A;  4GS3 A;  3T1Y Q;  4R4C A;  2DUD A;  3FHW A;  3M4Q A;  1GO3 E;  5IWA L;  3NBH B;  4K0K L;  1Y1V H;  3RLN A;  4HJ9 A;  4NXN Q;  3AQQ A;  3G4S A;  4NXM Q;  2UUB Q;  5M5X H;  3E0E A;  4JI7 Q;  2D0P A;  4JI0 Q;  5IP9 H;  4DR7 Q;  3STB C;  4LF5 Q;  2WFW A;  4A4I A;  2I0Q A;  3I2Z A;  1XJV A;  3CCE A;  1E3P A;  4GOP A;  3SGI A;  2CQO A;  4A3J G;  4JYA L;  4XIG S;  2E5L L;  1LYL A;  2JA5 G;  1I3Q H;  1VQC A;  4C3I H;  3KF6 B;  5GAG C;  4IFD G;  2UXB L;  1G51 A;  4OWT B;  1K83 H;  2CCZ A;  5GQO A;  3RR5 A;  4A3F G;  2F4V Q;  2GVA A;  2YTY A;  4IPC A;  1VQF A;  2AWN A;  3BZC A;  1TXY A;  1SLJ A;  3JAM c;  1VQP A;  1VQE A;  1XNQ Q;  4DV6 Q;  3H3V I;  4DR4 L;  4L5Q A;  1JJC B;  1W3S A;  1FGU A;  1QUQ B;  2QEX A;  2EIF A;  1VQ4 A;  2Z0S A;  2N78 A;  2UXD Q;  4JI5 L;  3PUY A;  4IO9 A;  2NVQ H;  1S3O A;  5AJ3 L;  1VQ6 A;  2VUM G;  1VQH A;  3KF8 B;  2ZM6 L;  4IPD A;  2WP8 J;  3F1Z A;  5BR8 Q;  4KLK A;  3ER0 A;  2H5X A;  5LMU L;  2D62 A;  2UUA Q;  2R7Z H;  4IPG A;  4JG2 A;  4PZ7 A;  1BBU A;  1EYG A;  4A3G H;  3HFZ B;  3EIV A;  3ULL A;  3D31 A;  2MO1 A;  2A1A A;  2I5L X;  4OXP A;  2I5M X;  1PH3 A;  1VQ5 A;  4WJ3 M;  2LXJ A;  4A3I G;  4A3B H;  4YCU A;  3T1Y L;  1WFQ A;  3PCO B;  2JEA I;  1LM0 A;  3GDE A;  2JJQ A;  4R4I A;  1L0W A;  1VQD A;  4QGU A;  3S1Q H;  4A3L H;  3HKS A;  1HZB A;  3AFQ A;  1Y1W G;  3CQZ H;  5E7N A;  4JI8 L;  4JBJ A;  3PSI A;  2YU9 H;  4DV1 Q;  1EQR A;  4BY7 G;  1GKH A;  2XGT A;  1OXX K;  5K36 G;  1W2B A;  3A0J A;  3FP9 A;  2ZTE A;  3S24 A;  4DUY L;  4HJ7 A;  4LF5 L;  4DR7 L;  4X64 Q;  4BXX G;  1GD7 A;  1PYB A;  5EAY A;  2JEB I;  1YIT A;  2OWO A;  2JK8 A;  4DV7 Q;  4IJL A;  1PH8 A;  2K14 A;  2R93 H;  1KRS A;  4GNX C;  1L1O B;  4POF A;  5C0X J;  4A93 H;  1KD1 C;  1J6Q A;  3W1B A;  1PH2 A;  4NPS A;  1XMQ L;  1WCM G;  5M3F H;  1FJG L;  1X6O A;  4DKA C;  5IYD G;  5IYB G;  4DV0 L;  1IBM Q;  1D7Q A;  1OXU A;  3KDF B;  1QVG A;  3UE1 A;  4DR3 Q;  3HKZ G;  4A93 G;  4X62 L;  3AEV A;  2VQF L;  4AQY L;  2ZJQ A;  1X55 A;  1JT8 A;  5JJI A;  3OW2 A;  2VZA A;  3E9H A;  3UE0 A;  3HOW H;  3CP0 A;  4GLX A;  1Q82 C;  5C4X G;  1UEB A;  3L2P A;  3TRE A;  4P71 A;  2E2J H;  1EIY B;  4LF7 Q;  2UXD L;  2B63 H;  4DR1 Q;  4BY1 H;  1YI2 A;  2HHH Q;  2JA9 A;  1IBL L;  5M3M G;  1YNX A;  3PUX A;  4BBR H;  1PH5 A;  4GOP C;  2RHQ B;  1K73 C;  3HOY H;  1E1T A;  1HR0 Q;  5IYC H;  3A74 A;  4L5S A;  3GTJ H;  4OON A;  1K3R A;  3ULP A;  1Q8K A;  2KCM A;  1H95 A;  2RHS B;  4KHZ A;  4BBR G;  3B6Y A;  2IT1 A;  3I4O A;  3M4P A;  1WOC A;  4GN5 A;  1QVC A;  2KHI A;  4LF6 Q;  4JI1 Q;  1E7Z A;  1FVI A;  1PH7 A;  3I4M G;  2VQE L;  3HKZ E;  3K0X A;  4Y52 H;  4LF4 L;  4EQ5 A;  1MKH A;  4C3J H;  2UUC Q;  3NEN A;  1FL0 A;  1SFO H;  2BA0 A;  4YCW A;  4AIM A;  3UDF A;  1E22 A;  1Q86 C;  3U58 A;  3TS2 A;  3HOU G;  1YHB A;  1PH1 A;  1MIU A;  2JA7 H;  3CW2 C;  1YJN A;  3NEL A;  1Q12 A;  2K5H A;  4J15 A;  4A3M H;  3DLL A;  1A62 A;  2Q2H A;  3KF6 A;  3H0G G;  1K8A C;  4LFA Q;  3RN2 A;  3PF5 A;  1IL2 A;  2HIX A;  2YYZ A;  4QJF A;  3T1H Q;  4LFC Q;  1SMX A;  1XMO L;  1WJJ A;  3S2H H;  2KEN A;  5LMN Q;  4DV5 Q;  1HNX Q;  2PNH A;  3W1G A;  2VY3 A;  1NBW A;  2QA4 A;  4DR3 L;  2LSS A;  4JOI A;  3ZJY C;  2AWO A;  1QUQ A;  2ZJP A;  1B8A A;  2YV5 A;  1BBW A;  3GTK H;  1N34 Q;  4HJ8 A;  2RF4 A;  3I55 A;  4MTN A;  2VW9 A;  1XNR Q;  4A3J H;  1OXT A;  3BU2 A;  1PH4 A;  1B70 B;  1U5K A;  2N3S A;  4A3E G;  2D0O A;  2JA5 H;  2FXQ A;  3PIP A;  4WJ4 A;  1JE5 A;  1MJC A;  4A3K G;  1VQL A;  3M3Y H;  4YWM A;  1TWC H;  4YWL A;  1J5E Q;  2GVB A;  1CSP A;  4A3F H;  4QL5 A;  1S40 A;  1YHA A;  1QVF A;  1KHI A;  3S16 H;  4LF9 Q;  2XTI A;  4X66 L;  4DV4 Q;  3KJO A;  4B3T Q;  4YCV A;  4KHP Q;  4GN3 B;  3KYH C;  4DAM A;  2NZH A;  5FLM G;  4JI4 Q;  4LF6 L;  2IY5 B;  4GKK L;  2WAQ E;  2YTX A;  5FLX c;  4QQB X;  4YY3 L;  4TVA B;  1TWG H;  2IHE A;  3OTO L;  2JA8 H;  2VUM H;  2R7D A;  1IBK Q;  1YBY A;  3GTO H;  1SR3 A;  3CXC A;  4OO1 I;  3UDI A;  4IFD J;  1CKN B;  1HZ9 A;  1N33 L;  3FKI G;  1VS0 A;  1L1O A;  2JE6 I;  2ZTC A;  4RG1 A;  1X3F A;  2L15 A;  3J80 i;  2NVX H;  3W5O A;  1NY4 A;  3L7Z C;  2JA8 G;  3CCU A;  3M7N A;  4OX9 Q;  1YVC A;  1NMG A;  4R4Q A;  4A3I H;  3CCR A;  1X65 A;  4JI3 Q;  4ALP A;  4B3R L;  1KC8 C;  1B7Y B;  2NZO A;  1N36 Q;  4DV0 Q;  1NE3 A;  3KDF A;  4DR5 Q;  1HJP A;  1YJ9 A;  1Y1W H;  4UP9 A;  1O7I A;  1PH6 A;  4PZ6 A;  2JA6 G;  3KJP A;  4BY7 H;  4LUZ A;  1HZA A;  3HOY G;  1TWH H;  1Y14 B;  4OWX B;  4B3S Q;  3RZD H;  2UU9 Q;  3HOZ G;  5C4J H;  2Q2I A;  4NXN L;  2YTV A;  2B3G A;  2R92 G;  4NXM L;  4LFB Q;  2R7F A;  1PA6 A;  1XNR L;  2UUB L;  2HIV A;  4JI7 L;  4POG A;  2JQO A;  4JI0 L;  1UE7 A;  1C7Y A;  1CSQ A;  4A3C G;  4DV2 Q;  1PYS B;  4C2M H;  4DV3 Q;  1WCM H;  4DR6 Q;  5IYD H;  5IYB H;  3GTL H;  2F52 A;  1P8L A;  3S2D H;  2PI2 E;  3RLF A;  3J81 i;  4OO1 G;  2OCE A;  3TEH B;  4UPA A;  3I4N G;  4BA2 I;  1HNZ Q;  4B3T L;  4KHP L;  4GLA C;  4X65 Q;  3CC2 A;  3K80 C;  4DUZ Q;  4DR2 Q;  3CD6 A;  1VQ8 A;  5C4X H;  2MQH A;  3F2D A;  2DGY A;  4RMF A;  2ASB A;  2F4V L;  5C3E G;  4BBS G;  1C0A A;  4R4O A;  2ZTD A;  5M3M H;  1XNQ L;  4DV6 L;  2MNA A;  4GKJ Q;  2CWA A;  3GO5 A;  3OYY A;  2CKZ B;  3RN5 A;  4P73 A;  3AFP A;  3CF5 A;  4IPH A;  3E9I A;  1M1K C;  2I5H A;  3Q8D A;  4YHH Q;  4P74 A;  1KRT A;  5BR8 L;  3NEM A;  1YHQ A;  1LTL A;  4LUO A;  4JI3 L;  1TWA H;  2UUA L;  1RIP A;  2AKW B;  2IX0 A;  3K81 C;  5GAE C;  1I5F A;  3PO2 G;  4QIW E;  1LUZ A;  5JJK A;  3KFU A;  2OTJ A;  1GM5 A;  3LGJ A;  4PMW A;  1VQ7 A;  3I4M H;  1XPO A;  3PUV A;  5JEA G;  4LNQ A;  4QY7 A;  4HIM A;  4DK3 C;  1V9P A;  3L0O A;  1Z9F A;  3CPF A;  1YEZ A;  4DNI A;  1JJG A;  3HOU H;  4K0K Q;  3GTP H;  3PF4 A;  4JI6 Q;  3PGZ A;  4LFB L;  1A0I A;  4DV1 L;  3ERS X;  3G6E A;  2K4K A;  3H0G H;  2N8N A;  1EIF A;  5IP7 G;  3PO3 G;  1L1O C;  1UE5 A;  1MJE A;  4A3D G;  4X64 L;  4DK6 C;  1Q7Y C;  3GTQ H;  1G6P A;  4Y7N H;  4DV7 L;  1E1O A;  4JYA Q;  1K0R A;  3WWV A;  2E5L Q;  3HOV G;  3RZO H;  3CAM A;  1X3E A;  4HIK A;  1I6H H;  3K7U C;  4DUZ L;  2KBN A;  3ULJ A;  2WAQ G;  3PUW A;  4HIO A;  1IBM L;  3U4V A;  4P72 A;  1PHJ A;  4YWK A;  4R1J A;  3J80 c;  1YJW A;  3S14 H;  2VL6 A;  1CUK A;  2OQK A;  1N9W A;  4XTC S;  4JI2 Q;  5FJ8 G;  4A3E H;  4DR4 Q;  5C44 G;  1BKB A;  1CKN A;  4GKJ L;  1VQO A;  4A3K H;  1KAW A;  1NMF A;  3G48 A;  1VQN A;  3IRB A;  4JI5 Q;  4LF7 L;  2WB1 G;  1XTD A;  4L5R C;  2MO0 A;  3EN2 A;  4DPG A;  4A75 A;  4DR1 L;  3CCL A;  3TRZ A;  1JJ2 A;  2HHH L;  2ZM6 Q;  1SN8 A;  3HOX G;  4UY8 C;  5LMU Q;  1UWV A;  5IE8 A;  4JBK A;  2CWP A;  1IXR A;  1U0L A;  1HR0 L;  4LF8 Q;  5FLM H;  1DGS A;  3I56 A;  2MFI A;  4HJA A;  3VDY A;  1YZ6 A;  4L5T A;  1M90 C;  2Z6K A;  1VQJ A;  4IOA A;  3STB D;  4UP8 A;  1K9M C;  2V1C C;  2R6G A;  2EXD A;  4JI1 L;  1OXS C;  3FKI H;  4JI6 L;  4JI8 Q;  2K75 A;  5M5Y H;  3J81 c;  4KI0 A;  4BXX H;  2UUC L;  2K52 A;  3D0F A;  1VQB A;  4EX5 A;  4UP7 A;  2E2I H;  4DUY Q;  4A76 A;  1X54 A;  1I50 H;  1Y1V G;  3J7A 5;  5JJL A;  2ES2 A;  2CFM A;  1X3G A;  1A63 A;  4APV A;  1G29 1;  2HQL A;  2WB1 E;  3A5Z B;  1KL9 A;  5ELN A;  4BA1 I;  5IP9 G;  1UE6 A;  5C0X I;  4LFA L;  1N32 Q;  1E24 A;  5HY6 A;  2JA6 H;  3TQY A;  2RCN A;  4LFC L;  3T1H L;  2ID0 A;  2PQA B;  4GNX B;  1XMQ Q;  1X9N A;  2A8V A;  1HZC A;  5HGQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...