2VUMG

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
molecule tags Transferase
total genus 26
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vumG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2vumG01
4H02A 1GVPA 3CPWA 4XIGS 2JE6I 3MXNB 1OXXK 1IXRA 2VY3A 3W1BA 1S40A 4HJAA 5IE8A 3KF6A 2OQKA 1D8LA 5IP9G 2HT1A 1A8VA 4IOAA 4IFDI 1NMGA 5IWAQ 2F4VL 1JJ2A 4BXXG 3M7NA 5IYCG 1TWHH 2UUCQ 1YITA 4YHHL 2KCMA 1I50H 2K52A 4YWMA 4OX9Q 1VQPA 4A3LG 2IX1A 4DR3L 3I4OA 1M1KC 1YNXA 4YWKA 2BA0A 4LF7Q 1EOVA 1EQRA 2ZTCA 1N33L 3IRBA 2Z6KC 4A3CH 5M5XH 4DV4L 4LFCQ 4BBSH 1ASZA 4A3GH 1Q12A 1X55A 1X54A 3E0EA 1AE2A 4HIDA 1VCIA 4A3KH 1OTCA 4JI3Q 2R93H 1G6PA 4LUVA 3PF5A 2I5HA 1KIXA 4GN5A 2RCNA 4R4CA 1GKHA 3I4MH 3JAMc 2Y0SE 1PH4A 1E1TA 5FLMH 4MTNA 3HKZE 3GDEA 3KOJA 5JJLA 4BY7G 3WWVA 1OXSC 3M4PA 3SGIA 4DV3Q 4KHPQ 4LUZA 1C7YA 5IWAL 4IPDA 4R4TA 3JC66 1QZGA 1PH7A 3NENA 1EYGA 1VQ9A 2UUCL 1IBKQ 1N33Q 5C3EH 4OX9L 1VQHA 2JEBI 5IY0A 1XNRQ 2PQAB 2ZTEA 2UUBQ 1XNQQ 2YV5A 4DAMA 1K73C 3FKIG 2DGYA 3KJPA 4C3HH 1UE1A 4LFCL 2B63H 1EQQA 2KCTA 2PMZE 5LMNW 1N36Q 1BKBA 5GROA 1VQKA 3T1HQ 4JI7Q 3NELA 4LFAQ 2R7DA 1QVGA 2VQEQ 2K5NA 3KLWA 2E2HH 1SMXA 5C0XI 1WYDA 1PHJA 4JOIC 5ELNA 1NY4A 1HZBA 1N8RC 3KYHC 5IYBH 2HHHL 3TEHB 5LMUQ 4P73A 4QIWE 1KHIA 4PZ7A 4B3MQ 1HR0W 1BVSA 1S72A 3EBEA 2CWAA 4PZ8A 1MKHA 5C44H 1PV4A 3HKSA 1Z9FA 3FP9A 4DV3L 2Q2UA 4KHPL 3CQZH 1KAWA 4JBJA 5IP7H 1BBUA 3MEFA 2Q2IA 2YYZA 3NEMA 2QEXA 3F2BA 1IBKL 1XNRL 2UUBL 2NZOA 3G48A 3J80i 3CCQA 2PQAA 2NZHA 1MIUA 3JAMi 4X6AH 4DV7L 4JI8Q 3HOVH 1Q86C 1NE3A 3HOXG 3HOYH 1GD7A 1N36L 2A8VA 3AEVA 2EIFA 2D0PA 2BH2A 4DKAC 2UXBL 3T1HL 4JI7L 3S2HH 3TREA 1VQ8A 4LF8Q 4LFAL 2JA7H 2WP8J 4DK3C 3RNUA 4IFDG 1CKNB 2Z6KA 4P72A 5JEAG 2CKZB 2GN5A 2NVQH 4AH6A 1HNXL 3GD7A 4OXPA 1ASYA 5LMUL 2D62A 1C0AA 1I94Q 1TWGH 2CWPA 3GTGH 2OWOA 4A93H 1HZCA 4BBSG 3G6EA 4A3GG 1XPRA 4L5SA 4A3KG 3UDFA 3I56A 4A3MH 2WAQE 4GN3B 3I4MG 2PI2E 2MNAA 2YTVA 3UDIA 3CCUA 3S1NH 1OXUA 4LF4Q 5J3BA 1QZHA 3I7FA 2EXDA 4JI8L 5FLMG 1VQMA 2E5LQ 3BU2A 1SROA 3GTJH 3RN5A 2ATWA 2N49A 3H0GH 4JG2A 1QUQB 3PIOA 5FLXc 3S1RH 1DGSA 2CCZA 4LF8L 3KDFB 3M3YH 2NVTH 1KXLA 1IZ6A 5IT9c 4BBRH 1Q1BA 4YCVA 3E9IA 2ZJQA 1CKNA 1Y1VH 4GNXC 4DV0Q 1VQ5A 1KRTA 4UPAA 1NBWA 2JA6H 1CUKA 1TWAH 2RHSB 2DUDA 2HIXA 1K8AC 1I94L 2NN6I 3ULJA 4X62Q 2QA4A 1E22A 3STBC 5M3MH 1RIPA 4NXMQ 2UXCQ 3AQQA 4ALPA 4OONA 3I4NG 4JOIA 4UP9A 2ZM6Q 3PIPA 5FJ8H 1PH8A 2WFWA 4QL5A 3G4SA 2LXJA 2JA9A 3L0OA 3J80c 1K8GA 4O0AA 2Z0SA 1YJNA 3HOZH 4HIOA 2JEAI 1KL9A 3B6YA 1E24A 4DR4Q 1K0RA 5C0XG 2VL6A 1HZ9A 2ZTDA 3DM3A 4LF4L 4NB3A 5GAGC 5C4XH 1UE6A 3M4OH 5LMNQ 4DK6C 2HHHQ 2EQSA 2I5LX 2E5LL 1PFSA 1IL2A 4A3JH 2KBNA 1L0WA 1PH5A 2AWNA 3S15H 2Y0SG 1Q1EA 1I5FA 5DLQE 3RLOA 1XJVA 5C44G 1TWCH 1XMOQ 5IP7G 4XTCS 2K14A 3UE1A 1JJGA 4BY1H 4DV0L 4OO1I 1HR0Q 3K81C 2CQOA 3KFUA 4X62L 2ALYB 4LNQA 2UXCL 4NXML 4UP7A 2YTXA 1NMFA 2VW9A 3A5ZB 4DV7Q 3HOVG 4IJHA 4GNXB 4APVA 2OTJA 3HOYG 3J81j 4B3TQ 2A19A 2UXBQ 2ZM6L 4JI4Q 4TQUS 5IYDH 1VQGA 2JJQA 4A3BH 2KHJA 2JA7G 2FXQA 2K5HA 3F1ZA 4NPSA 2ZJRA 4A3EH 3RN2A 1L1OB 4QY7A 2UU9Q 2JA8G 3GTOH 1KRSA 4GKKQ 4DR4L 3PUYA 2R7FA 3T1YQ 1HNXQ 4UY8C 1UE7A 5LMNL 1K83H 2MFIA 4MNOA 1VQIA 3CXCA 4IPCA 3GTKH 1S3OA 3DLLA 3UDXA 3L7ZC 3HOWH 3EIVA 3CC4A 1SE8A 2KHIA 5M3FH 4P74A 3I55A 1XMOL 2C35B 2F52A 3AFPA 1U0LA 1N32Q 2AKWB 3CCSA 4DV5L 4A3MG 2AHOB 3CMEA 2OTLA 4LFBQ 1MJEA 1YZ6A 4GKJQ 3HOUG 2ES2A 1HNWQ 1HR0L 2IHFA 3GTMH 1VQOA 1WCMH 2CFMA 1W3SA 2IHEA 1UE5A 3CCJA 2YU9H 4POGA 3STBD 3F2CA 2VZAA 4L5RC 1JJCB 3PUXA 2HQLA 3H0GG 1HH2P 4R4OA 4B3TL 1IYJB 1Q81C 4JI4L 4BY7H 4JI5Q 3I2ZA 1P8LA 2WB1E 1HNZQ 3OYYA 1VS0A 4DR6Q 4GKKL 2YTYA 1EWIA 2UU9L 3ER0A 4BBRG 4EQ5A 4GOPC 1Y1VG 1LTLA 1VQBA 4RG1A 2Q2TA 2XTIA 4HJ7A 4A3FH 4L5TA 1FL0A 3T1YL 1N34Q 1E1OA 4QGUA 3PO2H 2ASBA 4BXXH 2JA6G 2E2IH 1X3EA 1XMQQ 1G51A 3PF4A 2HIVA 2NN6G 3FKIH 3VDYA 1BBWA 4A3IH 3CP0A 2N8NA 4A3CG 3CF5A 1Y1WH 4OWXB 4HIKA 1YEZA 3J7ZC 2B3GA 4NXNL 3M85A 1N9WA 3K0XA 4AYBG 1X9NA 2NVXH 2R92H 2R93G 1N32L 1C9OA 3F8TA 1QVCA 2OCEA 4YWLA 5GAEC 2V1CC 3RZOH 1YBYA 3AFQA 3J7A5 4GKJL 4LFBL 1UEBA 1YI2A 2GVAA 1HNWL 3GO5A 4HJ8A 4QQBX 4WJ3M 1FJGQ 3U4VA 1OXTA 1XPOA 3CCLA 4KHZA 1V9PA 2A1AA 1KQSA 5C4XG 1E7ZA 2VUMH 1SFOH 4DUZQ 5E7NA 2N78A 4A3JG 2LSSA 3FHWA 4R1JA 4JCVE 3M4QA 1Q7YC 4C3JH 4JI5L 4POFA 1V43A 1K9MC 1HNZL 4LF5Q 3PO3H 4DR6L 1K3RA 1JT8A 4WJ4A 3F2DA 1EUJA 4BY1G 4P71A 1PYSB 5GQOA 4JI2Q 4EX5A 5C3EG 4DV2Q 3RZDH 1N34L 4OO1G 2JA5H 4JI1L 3NBHB 4LF9Q 4A3DH 1XMQL 1KC8C 1VQFA 4IJLA 3H15A 3S14H 1Z47A 1L1OC 4TVAB 1IBLQ 1V1QA 2JK8A 3CPFA 4GOPB 3GTPH 3HOXH 2B63G 3E9HA 1WFQA 3TRZA 2I0QA 4DNIA 4GN4B 3G71A 5IYDG 5JJKA 1FGUA 2ZJPA 4A3BG 1PA6A 1B7YB 1QVFA 4LF6Q 4A3EG 4IOCA 5JJIA 4QJFA 4R4IA 1VQCA 3CCRA 3GTLH 1TXYA 2E8GA 1FJGL 5BR8Q 4DR2Q 3TS0A 1P16A 2D0OA 1VQAA 2R7ZH 4C2MH 4PMWA 5IYBG 1A63A 1YHQA 1CKOA 1OXVA 1VQEA 4MZ9A 4DUZL 1PH6A 4DR7Q 1EFWA 4IFDJ 3CMAA 4O2DA 2RHQB 4P75A 4YCUA 2UXDQ 1L2FA 1QUQA 5JEAJ 3S1QH 1NTGA 2BH8A 4OWTB 4LF5L 5HGQA 3U58A 2MQHA 4DV6Q 5M3FG 3KDFA 1VQ7A 3HOWG 5M5WH 3ULPA 3HKZG 2VQFQ 1A0IA 4B3RQ 4HIMA 4DV5Q 4JI2L 1PH1A 1Q8KA 4DV2L 3UDGA 3S2DH 5AJ3Q 4YY3Q 4JBKA 1J6QA 2PI2A 4LF9L 1CSPA 4BA2I 1Y14B 4DR1Q 4JC0A 1WCMG 4FDBA 1W2BA 1IBLL 1YHAA 3U4ZA 4DAYB 1A62A 2NVYH 1VQNA 2JQOA 2VS1A 2GVBA 4GOPA 4UP8A 3ZJYC 2MO1A 3HFZB 3D0FA 2H5XA 2OQ0A 3K8AA 3Q8DA 4ME3A 4X66Q 1AH9A 3BZKA 5IP9H 1FVIA 1AE3A 1VQLA 4JI6Q 4LF6L 1XPUA 4LUOA 1HZAA 3ERSX 1WJJA 4GS3A 1YIJA 1E3PA 2K4KA 5IYCH 5BR8L 4A76A 4DR2L 3A74A 4A3FG 4NXNQ 1RL2A 3TQYA 4A3LH 3PO2G 1LM0A 4LW1A 4AIMA 4DR7L 2IX0A 3J81i 4LF7L 3BZCA 5ELOA 3D31A 4A3IG 4OWWB 3GTQH 4JV5Q 1LUZA 3RR5A 4A93G 1U5KA 4RMFA 3KF8B 1Y1WG 1PYBA 2UXDL 1CSQA 1PH3A 1LYLA 1PVOA 3I4NH 1VQ6A 3AYHB 3K7UC 4DV6L 1IBMQ 1X65A 1SR3A 3CAMA 4IPGA 2AWOA 5EAYA 4JI3L 2VQFL 4B3SQ 2R92G 4JYAQ 4GLVB 4B3RL 3H3VH 2K75A 1PH9A 3H3VI 1X56A 3PUVA 1PH2A 1JE5A 5AJ3L 1YVCA 3W5OA 4YY3L 3U50C 4AQYQ 2AMCB 3UE0A 4DR1L 4J15A 1J5EQ 1TWFH 3CCEA 3CCVA 3CD6A 3PGZA 3BJUA 4X64Q 2LXKA 2VUMG 1T9HA 4DV1Q 1WOCA 4Y7NH 4DUYQ 3RLFA 4GNXA 1R9TH 4A4IA 2UUAQ 4JI0Q 3S1MH 5C0XJ 1B70B 4X66L 5M5YH 3M9BA 1GM5A 1UWVA 4K0KQ 4JI6L 1GO3E 2N3SA 5H1SE 1YJ9A 3PO3G 4DR5Q 4X65Q 3OTOQ 1L1OA 4HJ9A 2Q2HA 3S16H 1I6HH 3A0JA 1SRUA 3A5UA 2QGQA 4R4QA 2R6GA 1EIYB 4JI1Q 2WB1G 2JA5G 4A3DG 1YHBA 1XNQL 1JB7A 4YCWA 1VQ4A 4JV5L 2K5VA 5M3MG 4C3IH 2VNUD 1CKMA 1MJCA 3PUZA 3EN2A 1HJPA 3ICEA 2IT1A 3TS2A 1IBML 1Q46A 2MO0A 3PV0A 2KENA 4GLAC 4B3SL 1VQJA 5FJ8G 4JYAL 2RF4A 3KF6B 1M90C 5HY6A 2E2JH 1WI5A 3CC7A 3HOZG 2VQEL 3S17H 4IO9A 4AQYL 2JA8H 2BA1A 3CW2C 5K36G 1EIFA 1VQDA 3PUWA 2F4VQ 1J5EL 3RLNA 3ULLA 4BA1I 1SN8A 2XGTA 2PNHA 3PCOB 4YHHQ 4DPGA 4L5QA 4X64L 3OW2A 2F3IA 3CCMA 4DR3Q 2WAQG 4KI0A 4AYBE 1YJWA 1NJIC 2R7ZG 4DV1L 4Y52H 4KLKA 4DUYL 1XTDA 4A75A 3LGJA 3CC2A 4B3ML 3KJOA 3K80C 5GADC 2UUAL 4JI0L 4JBWA 4PZ6A 4DV4Q 2ID0A 4K0KL 1X6OA 1G291 2L15A 3PSIA 4PG3A 4DR5L 4X65L 3OTOL 3W1GA 2IY5B 3S24A 4JBMA 3J81c 1X3GA 1SLJA 1KD1C 1H95A 3HOUH 1B8AA 2B29A 3K7AH 2K50A 1I3QH 4LWCA 4HJ5A 5GAHC 1X3FA 2I5MX 1O7IA 1JMCA 4GLXA 4IPHA 3L2PA 1D7QA 5C4JH 1Q82C
chains in the Genus database with same CATH superfamily
5E3FA 4A3KB 1IYUA 2JE6I 3MXNB 1ML0D 2AQ4A 3W1BA 4Q0YA 1HCZA 1IYVA 5IP9G 2XN9C 2WB1A 5FO8B 1QWYA 5IWAQ 4LF8H 2IW3A 3TINA 5IYCG 1QNUA 3R2TA 1B53A 3EPGA 1STGA 2NVYB 5FK9C 2H1EA 1EOVA 1EQRA 3V05A 4ABNA 1M6VA 5EWFA 3IRBA 2Z6KC 3KLSA 1QNKA 4A3CH 4LFCQ 2LFNA 3OHXC 5IGCA 2NWGA 2N55A 1X54A 5KG0A 1OTCA 2YRXA 2CZGA 2I5HA 2K04A 2C9OA 3G8CA 2R7ZA 4R4CA 3A7AB 4C2MA 3RGXA 2Y0SE 4DAVA 3M9OB 3VR2A 5KT3A 3A8KE 4RGMA 5FLMH 5CV5A 2R86A 1VF5C 3KK7A 1C30A 3WWVA 1IL8A 4U68A 2R3ZA 1HFNA 2DJFC 4N9TA 4O3NA 2V4DA 2D5DA 1TWFB 2B2UC 4EGJA 1QZGA 1PH7A 1VQ9A 2K01A 1KLGD 4OIJA 5IY0A 1R9TB 2NVYA 3LMLA 2ZTEA 2UUBQ 2DWCA 1BDOA 5AFWA 5M5YB 2DGYA 1WTHA 3KJPA 4C3HH 2F3WA 1H9KA 4C56C 5DAUA 2B63H 2UXCH 4NXMH 3C1FA 5GROA 1VQKA 2X69A 4I4TF 5KNCA 4J0MA 1U4PA 1DD2A 3KLWA 1SMXA 5F2DA 2FMMA 4JOIC 1IW7D 2RSOA 4ZKCB 1NY4A 1DZ1A 2ASLA 4DR4H 1EQTA 5LMUQ 4O3PA 2XIGA 4B3MQ 2JA7B 5LMNH 5BPHA 2JA8B 3K5HA 1PV4A 2PMZB 5F9NA 1LO5D 5HURA 4KHPL 1M4VA 4MV1A 1KNAA 1TWFA 3TDQA 3MEFA 2EYPA 2L55A 1IBKL 1ILPA 3J80i 4DV5H 1R9TA 2NZHA 1MIUA 4FXDA 2R84A 3SK4A 2QDLA 4DV7L 1B6RA 3HOVH 4UCRA 3K5NA 3HOXG 1TT2A 2MJ8A 3AEVA 3TQTA 2BH2A 4DKAC 4ZUJA 3T1HL 1JB3A 4QW9A 1CHPD 3TREA 4LFAL 2WP8J 4MA0A 1I3QB 4B3TH 3NTHA 3RNUA 3NQTA 2Z6KA 2PW7A 5C4JB 4ME5A 1TS2A 2Z4IA 1LTID 2GN5A 4H13C 2NVQH 2JEFA 1R4QB 3H0GB 4K14A 2HVRA 2M9VA 3RV3A 3GTGH 1PFBA 2NVTB 3G6YA 4UDUC 2NYZD 1EY0A 4BBRB 3G6EA 3BA9A 4MIUA 1RYSA 1I50B 4XDXA 5HBRB 2M05A 3A8JE 4A3MH 2WAQE 4UCSA 3NXWA 5I6WA 1SYFA 1T3NA 2PI2E 4R8UA 1RKNA 3UDIA 5M5XB 3TP5A 1LTTD 1PTOH 5C4HA 4BBSB 2EXDA 5FLMG 4YAJB 2B2UA 2R93B 2E5LQ 2ATWA 3JAML 1AFPA 1TS4A 4O4LF 3S1RH 1DGSA 4LF8L 3T4AC 3TSSA 5KYLA 1Z2NX 1E2ZA 1IZ6A 2RVLA 3KAJA 3TMEA 1I3QA 1JIHA 2W6ZA 3H4BA 3E9IA 3WNZA 1HNZH 4ED6A 2L9HA 4DV0Q 1GUWA 3N43B 4DR6H 4UPAA 1G2SA 5C4ZA 4DL5A 4B9WA 4RB3C 1TWAH 3RMHA 1DXMA 2NN6I 2QA4A 2FJZA 1E4FT 3RB4A 4C3HG 1IKMA 4OONA 5DEHA 4DLKA 4ETSA 3I4NG 5EWEA 3PW2A 4JOIA 1E4EA 2E75C 3MZ5A 5E4XA 5FJ8H 2WFWA 4QL5A 1K8GA 1I50A 4LMYA 2Z0SA 1YJNA 1SYGA 1Y8NB 3HG9A 4IZ8A 3B6YA 3BQ1A 3P1HA 5C0XG 1LT3D 1HZ9A 2ZTDA 1JWMD 3SI8A 1UE6A 2B2TC 2I5LX 1PFSA 2R93A 2AGPA 5H80A 2Y0SG 1C8CA 5E4WC 1M0WA 4IRDA 4IALA 2F0IA 2A68D 4F87A 1QCBD 2NUCA 1XMOQ 1JJGA 1K83B 1RTNA 5D14A 5EWGA 4CGYB 2L5TA 1S9FA 3MHBA 1HR0Q 2BE5D 1JC7A 5C44B 2UXCL 4NXML 4UP7A 4U673 5KFLA 4RFBA 3DM1A 3HOVG 3HB9A 3KALA 2O4XA 1SE3A 2YW2A 5A2QW 4TQUS 3Q8PB 2P5ZX 2FXQA 2K5HA 3F1ZA 5EPLA 4DR4L 1I4GA 3PUYA 4K5XA 5L1LA 3CU7A 1U9RA 1UE7A 2MFIA 5LMNL 2CQAA 4YQWA 3LX0A 2ZDQA 2LS01 1K8MA 4IPCA 5HV6A 3DLLA 3Q24A 2W70A 2K6AA 4TSSA 1AN7A 3R5HA 5DM73 4LF7H 2BDNA 2GLTA 1ICWA 3RFCA 2F52A 1MHWC 1U0LA 5IOCA 1N32Q 3Q1KA 4U7CA 4A3MG 4K6LA 4DV5L 4J9OA 3CMEA 3HRZC 4OGQC 1YZ6A 1MJEA 4GKJQ 3GTMH 2KECA 3V4ZA 1WCMH 4RZRA 5CYUA 4FNFA 1HTPA 4LSXA 3STBD 4QIWB 3F2CA 2VZAA 1WTXA 2QEJC 4QWDA 4B3TL 4BY7H 1HH2P 5L1KA 1IYJB 2EYJA 1P8LA 3T56B 2WB1E 3OYYA 3K5LA 2EVBA 2VA3A 2B8GA 4X66H 4HMIA 4GOPC 4QWAA 1W93A 3SE0A 2Q2TA 2XTIA 4HJ7A 1N34Q 1KJJA 2RDHA 2J6UA 1JLLB 1XMQQ 2FINB 4I65A 3PF4A 3GLKA 3FKIH 3VDYA 2EDGA 5CA0F 3CP0A 3SEBA 1WTRA 1JWUD 1O7ZA 3CF5A 2PVPA 4OWXB 4HIKA 2EZVA 1YEZA 2CQYA 4O3SA 1Y1VB 2B3GA 1X9NA 2NUAB 3K0XA 1RD9D 4QUCA 2ASJA 1QVCA 1D5XC 2OCEA 3EFXD 4YWLA 2AUJD 2B2TA 1YBYA 3RZOH 3OHBA 2OT2A 5T1IA 3AFQA 3FDSA 4MA5A 2WDTA 4ED8A 4DL4A 1JX4A 4RNNA 1OXTA 1XPOA 1BQQT 4KHZA 2W9BA 1KQSA 1G91A 1E7ZA 1WVLA 1SFOH 5E7NA 1PTOD 2N78A 3N8DA 3MTSA 4QIWA 5DG8A 4JCVE 3HOZB 2F0PA 3GTLB 3NPPA 1K9MC 1HNZL 4LF5Q 1FNUA 4DR6L 2MPMA 4JI0H 2L1BA 1DOKA 2VPSA 5C4XB 3JAMW 3RGZA 2W6QA 3BQ0A 4XQJA 4EX5A 5C3EG 4M1UB 3NHHA 1WTPA 4IUUA 3GTJA 3NBHB 4LF9Q 3T13A 4A3DH 3U9TA 2KQ3A 1Z47A 1L1OC 3MXUA 4TVAB 1M0TA 2XCLA 1TWCB 1YNND 1V1QA 2RDFA 4WD3A 4GOPB 4MV3A 4IUQA 1WFQA 4J9SA 2I0QA 4KKTA 1Y1VA 4N9PA 1PA6A 1B7YB 4B08A 2Z8LA 1VMPA 4QJFA 3CCRA 1KLUD 5FD5A 3PQIA 1GGOA 1I6VC 2VA2A 1GOZA 5BR8Q 3PW4A 5L1IA 2AU0A 1ICFB 1TS3A 2JXMB 2R7ZH 4C2MH 4PMWA 4ECWA 1CKOA 1OXVA 1VQEA 4DR7Q 2Q8IB 2YL2A 4YHHH 4IFDJ 4A3BB 2R7KA 3IL8A 2RHQB 4A3EB 4YCUA 3GTOB 1QUQA 1CHQD 3U58A 2MQHA 2C2EA 2DZDA 1F2LA 3RB3A 1BR9A 3QZ7A 4UCTA 1HRJA 5C8YF 1A0IA 2XSCA 1IOVA 2EY6A 3VA5A 4EG0A 4HCSA 5IGDA 4ECYA 3NBHA 2WACA 1QG7A 3N6RA 1WCMG 4FDBA 1CQJB 2C00A 2XVSA 2W6OA 2IJ0A 3IKJA 5EGTA 4NMZA 1TWCA 4C5AA 2NVYH 2DLNA 2VB2X 4GOPA 3ZJYC 4EBCA 3Q8DA 3HFZB 2H5XA 4ME3A 2I46A 2CW0C 3BZKA 1FVIA 1AE3A 3WOFA 4YR0A 4QB4A 4FS2A 1HZAA 3ERSX 1NR4A 4GS3A 2YU9B 3PIO3 2VPQA 3DMUA 4A76A 2BR0A 3A74A 3TQYA 2XNAC 5JVG3 1D6EC 1NSNS 4GC6A 2D9UA 2IX0A 4LF7L 1ZKOA 1X32A 4JV5Q 2F4IA 4A93G 3KF8B 3QOLA 3E6ZX 1IOWA 3I3CA 3EVQA 1VQ6A 3GTOA 4DXFA 1SR3A 2MCTA 4B3SQ 5EAYA 3E5NA 3DUZA 3N6XA 2F0TA 4H44C 1PH2A 4A3IB 4FP5D 5EQ0A 3PIP3 1TWFH 3CCEA 2FK3A 3CD6A 4X64Q 3RTXA 4TV8F 4ZOLF 2R92B 4DV1Q 1GXDC 1WOCA 4Y7NH 3RLFA 1R9TH 2UUAQ 2HHHH 5NUCA 4X66L 5M5YH 3R3OA 4BWSC 3F2UA 3MWEA 1K8OA 3N42B 1CQVA 5D65A 1L1OA 4H0LC 1QILA 4DV3H 1MI2A 5I47A 3A0JA 2YU9A 1SRUA 3N40P 2QGQA 4R4QA 2R6GA 1EIYB 2WB1G 4A3DG 1YHBA 2F0KA 1XNRH 1XNQH 4IWYA 3KF8A 3VPBA 1BGWA 4GLAC 3PV0A 2FMAA 3O13A 4C1NK 2PZUA 3KF6B 3L4KA 2JA5B 1CM9A 1N36H 3CC7A 3MEHA 1PFMA 1HA6A 3PR4A 2JA8H 3UQ8A 4JI7H 4K2KA 1FKAH 4QWCA 2V4RA 2SOBA 4MHEA 1VBHA 2WYOA 2XCAA 1KDCA 3X3MA 1X3PA 2R7ZG 2F0HA 4KLKA 3CC2A 2R92A 3K80C 4JI0L 5LYJF 4JBWA 4PZ6A 4EYIB 2ID0A 1A3VA 1G291 2A6HC 4F50A 1F9RA 4RKLA 5LA6F 5DQHA 5KNBA 3S24A 4PNYA 1X3GA 1KD1C 1EY8A 2IWHA 1Q3LA 1MGSA 4PMCA 3FRPB 1I3QH 4ZCKA 4L8JA 1JMCA 1O7IA 2EY1A 2F3VA 1D7QA 2WTFA 5C4JH 3Q8RB 1ZYRD 2HCCA 1IXRA 4JI8H 3D3RA 1S40A 1BUVT 3S2DB 2XWBB 3KF6A 2Z4HA 2JA5A 4IOAA 4IFDI 1HXYD 1TY0A 4R8IA 1JJ2A 1RF2D 5C1PA 4YHHL 2KCMA 1I50H 3MJFA 1VQPA 2F0GA 2IX1A 5KFZA 1J9OA 1HQRD 2BA0A 2ZDGA 1ENFA 3J7AV 1MZBA 4O3OA 1V51A 5M5XH 3F8NA 2PPBC 4BBSH 3VR3A 2GA4B 4ZUIA 1X55A 3G6JB 4HIDA 1G6PA 1AE2A 3BDCA 2R93H 4HAEA 2R8GA 1R4PB 3ITPA 5ELEA 5D3IB 3PF5A 3BAAA 1GKHA 1L0XB 3I4MH 3R2IA 2LKVA 4RGTA 2E2IB 2F0VA 4X3UA 1KDAA 5KFTA 1LTAD 2J0TD 3GDEA 4EFEA 2KHSA 2ZT9C 1OXSC 2V5AA 3M4PA 1JOKA 4PDBA 3NK9A 2FB9A 4KHPQ 1Z6HA 3VYUA 2CHBD 5C5LA 4R4TA 3NENA 4RKBA 5FO7B 2YYAA 1IBKQ 3C3LA 1ESFA 1VQHA 4EBDA 2JEBI 2JEGA 1NAPA 2YV5A 2HDLA 3GV7B 1G8ZD 2NB0A 4L63B 2EE1A 3CQZB 5J2UF 4X62H 1EQQA 4B9XA 3L9AX 1BKBA 4IWXA 5KIXA 3S16B 3T1HQ 1EZ1A 4R7RA 1XXGA 4JW0A 4LFAQ 1S0NA 2PZTA 1QVGA 3K3VA 5DGAA 2B2VC 3K5OA 3D4DA 4YB8B 1HZBA 3KYHC 2F0SA 2HHHL 2W9CB 1I4QA 2E2IA 4QIWE 4PZ7A 5IODA 1HR0W 1KABA 2CWAA 4RAYA 5C44H 1TA8A 4G7ZC 4DV3L 5DNFA 2FKLA 1KAWA 4JBJA 2EYOA 1JOQA 1BBUA 4RNMA 3NEMA 1QOHA 2YYZA 2FPPB 3S9WA 1SNCA 2QEXA 1TWGB 1XNRL 4IRCA 2NZOA 1I7LA 4FF2A 4TQRA 3R93A 2QILA 3HOYH 3BZDB 3OW7A 1N36L 2A8VA 4MV9A 5FLXW 4RU9A 4KKUA 2UXBL 3D6WA 4JI7L 3HOUB 1VQ8A 4LF8Q 3K7AB 2DN8A 1SCUB 1CKNB 4P72A 1LTBD 1B1ZA 3MWYW 4GKKH 4RCOA 2UU9H 5DQIA 2HUGA 1EWHA 2D62A 4OEMB 4G7OC 2JEIA 2W9CA 1SMYC 2CWPA 3FEWX 2W6PA 5FPRA 5KFWA 4ED3A 1HZCA 4BBSG 4CKCA 3MR6A 2B39A 1TWHB 5JVH3 3UDFA 3I56A 4IR9A 4X3SA 3I4MG 3ND8A 4EEQA 2K5QA 5DG7A 4YR2A 1M7JA 4LFBH 5J3BA 3I7FA 3GQBA 4NDXA 4JI8L 1VQMA 3Q0AA 3BU2A 1SROA 3EROA 5BN4A 3GTJH 2N49A 4HN7A 1WSCA 4JV2A 4JG2A 5FLXc 1ZHSA 1KBLA 5ISRA 2CCZA 3NTIA 1SNPA 3KDFB 1VF7A 2EXZA 4JV1A 5IT9c 1GUNA 1Q1BA 4EEYA 1Z7TA 1CKNA 1Y1VH 3MFGA 4GNXC 4CHTB 1KRTA 3E3XA 1SEIA 2FFKB 1NBWA 3S15B 4Q43A 4MTKA 2HIXA 1K8AC 2NN6H 3P75A 2UXCQ 4LMQD 4NXMQ 4JI1H 2ATLA 2B2VA 5D1PA 1Y8PB 4UP9A 1PH8A 3NE5B 1TWHA 1WTWA 3BG5A 3H94A 2LXJA 3KHLA 3J80c 4O0AA 4WFN3 5F9LA 5EZYF 3HOZH 4HIOA 4J9LA 1KL9A 4DR4Q 1PK8A 1ZHQA 1RYRA 2R8HA 4NB3A 5GAGC 5C4XH 2QDBA 5LMNQ 3P7JA 4DK6C 1RJRA 1BNZA 2JN4A 3MR3A 1IL2A 3BA8A 1FJGH 2FLPA 4PWQA 3MXNA 1I5FA 5DLQE 5C44G 1EEID 1G6ZA 5LL6S 4XQNA 1S5ED 1TWCH 1SYXB 2HVQA 1EYCA 3ND9A 2ALZA 1SNQA 4BY1H 4ME6A 2Q8TA 3G7LA 2L0CA 4HNTA 2JEJA 2CQOA 3V6JA 4X62L 2ALYB 4DV2H 4ZQ3A 1LTSD 2VW9A 2EYHA 3HKZB 4GNXB 4APVA 3HOYG 2FK1A 4K2LA 4B3TQ 5IYDH 1H9RA 3K3PA 1GHJA 2FHTA 1VQGA 4A3BH 4NPSA 4A3EH 3GTOH 1LT5D 1KRSA 4LF6H 3N52A 1HNXQ 4KK7A 5KFVA 5CORA 4MNOA 1KAAA 4DR2H 3GIIA 1VQIA 1S3OA 4RZQA 5KFJA 4EQNA 3L7ZC 5I4DA 2VR1A 3MWMA 3BQ2A 4QWEA 4O4HF 1SSOA 4P74A 1LT6D 3AFPA 2AKWB 3Q8QB 4ILWA 3CCSA 4DV6H 1KTKA 3FPPA 2VQFH 3PW7A 2KJXA 5C3WA 3QO2A 2IHFA 2EYMA 3CHBD 2CFMA 4YY3H 2YU9H 4RGOS 1EZ6A 1S0MA 4DR1H 1TIID 2R7LA 5KFKA 3PUXA 2HQLA 1HPCA 1Q81C 2PN1A 3RD4A 1SJHD 1CQFA 2SNMA 1HNZQ 2YS7A 1VS0A 4DR6Q 3S1NB 4GKKL 1EWIA 3DF7A 2UU9L 3ER0A 4RAZA 1DV1A 5BPFA 3J81W 1Y1VG 4RG1A 4POGA 2Z6BA 3RBDA 3EA6A 1KC7A 4JI6H 1FL0A 4CKEA 3N41B 2DPIA 1B44D 2TSSA 2YZMA 1PZJD 4K6DA 2NN6G 4A3IH 3QZ8A 1SYCA 4A3CG 3M3YB 3PO3B 2JA7A 5J1ZA 2RQXA 1V1PB 1HUMA 3J7ZC 3M85A 1N9WA 4AYBG 2PMZA 3MA2B 2R92H 4JV0A 3VR6A 5CA1F 5GAEC 3UI2A 4UHVA 1IBMH 3JZIA 4OL7A 4I55F 5K5PA 4LFBL 1K0SA 4L1KA 4XQQA 4DL2A 5M3MB 3T5JA 4KJNA 2BQ3A 4AQYH 1ET6A 1T5XD 5C4XG 5EJWA 4IR1A 1J5EH 5EDWA 1AEXA 1V4YA 3FHWA 1D5MC 3JRXA 3OSNA 4C3JH 1Y69U 1FD7D 1V43A 4DUYH 1T36A 4ECXA 3CVZA 4U6PA 4B3MH 2OLSA 3LWUA 4K0KH 2A5HA 2KVMA 2WKDA 3F2DA 1EUJA 4BY1G 1PYSB 1EIGA 1U4MA 4DR5H 4X65H 3OTOH 3BDLA 4JI1L 2JA5H 1DOMA 3QB3A 3H0GA 3V4SA 4I7AA 4IJLA 3H15A 4KKSA 1SNDA 4CDFC 2O03A 3CPFA 2B63G 1B6SA 3GV8B 2Z9HA 4JUZA 2WKCA 5IYDG 2YZNA 2RDJA 2CH4W 4KY6A 1I4PA 1B9NA 2ZJPA 4A3BG 1K3BC 5L1JA 2F0LA 2J6TA 1UC9A 4A3EG 5KFDA 5DG9A 3G6XA 5JH7F 1CTMA 5JEAH 1FJGL 3TS0A 3DWQA 1H9SB 1I4RA 1SYBA 3RUPA 4TQSA 1A15A 3AMUA 4FS1A 1A63A 1SE4A 2XGPA 4DR3H 4P75A 2A69C 1L2FA 5JEAJ 2Q8RE 1N33H 5HGQA 1VQ7A 1EY5A 5KG7A 5JUMA 3HGBA 2Z1CA 4DV2L 3UDGA 4O3RA 1STNA 3S2DH 3GTKB 4CC6A 3EJIA 4F4XA 1Y14B 4K8JA 2W9AA 3OIPA 1OO9B 3Q2OA 1JXLA 1GJXA 3NTKA 2QKIC 5KFQA 5KFRA 3U4ZA 2HQEA 4DAYB 3E5SA 5KG3A 1GUOA 2F0EA 4QWBA 2OQ0A 4X66Q 1AH9A 2YRWA 4KN7C 4CDEC 2XC9A 4LF6L 3OSPA 3NWTA 3BABA 5DLGA 2DY8A 1XPUA 3CRKC 3TBIB 4DR2L 1CA6A 4X3KA 1RL2A 5EBDA 3BYTB 1H9SA 4LW1A 4F4WA 2M2LA 3J81i 2UUCH 3BZCA 5ELOA 4A3IG 3BS1A 4OX9H 1F2YA 1LUZA 4ZAIA 3RR5A 3GILA 1GYFA 1NUCA 1SJED 4NLGA 1CSQA 1PH3A 1LYLA 3A56A 3AYHB 3K7UC 4DV6L 2E2IH 1X65A 3IN5A 2VQFL 2R92G 4GLVB 2K75A 1PH9A 1X56A 5DLFA 1K83A 2CVRA 3KBXA 3LWEA 5C3XA 4A2AA 1YVCA 4YY3L 1CE8A 4FBUA 1GUGA 4DR1L 1Y1WB 4FF4A 3GTKA 1LTRD 3BVZA 3V2TA 5IT9E 4JVZA 4NKLA 4DU9A 3CRLC 2R8KA 4DAYA 5KFSA 4JI0Q 1B70B 4C3JG 4O4IF 3S17B 5KFAA 1GM5A 1UWVA 5EOYA 4EBEA 4JI6L 1EWCA 1DOLA 1E4GT 2RBMA 3FMCA 4HNVA 3T51B 2F0QA 4ID6A 4HJ9A 2VUMB 1LLRD 4DN4M 3S16H 4ECTA 3NP8A 3D4WA 4XYQA 5J22A 2JA5G 3JRWA 3I70A 1V8QA 2EYFA 3RBEA 1JB7A 3J80E 1VQ4A 3MVVA 1MJCA 1EUDB 4M7EA 2NTTA 3EN2A 2MGSA 3ICEA 3TS2A 1IBML 1Q46A 2KENA 2L4NA 5FJ8G 3TP8A 3A55A 2RF4A 3RZDB 4WORA 2E2JH 4EFBA 4AQYL 2BA1A 3DWPA 1J5EL 1ESRA 1SN8A 3PCOB 4YHHQ 3HOXB 3OHAA 1Y1WA 2O2LD 4TRDA 2F3IA 3CCMA 2WAQG 2XRSD 1BF4A 4FXGC 4DUYL 1XTDA 4A75A 4B3ML 2F0FA 1S5FD 4DF7A 4HSPA 4EYHB 1SYEA 4CDCC 4J9MA 4LJZC 2VQDA 4K0KL 1SDFA 4DR5L 1PXUA 2CW0D 4PV1C 3W1GA 2F0UA 4X65L 3OTOL 4HQ6A 3GP7A 1O7YA 4FBTA 1C4QA 2KOLA 2VUMA 3HOUH 1MSHA 3K7AH 5KFBA 2AQ1B 1ENAA 1DCZA 4HJ5A 1X3FA 4H7BA 3S1QB 3IG0A 4GLXA 1BBXC 4IPHA 2C2DA 2JP1A 1S68A 3MR5A 4H02A 5M5WB 1STYA 3CPWA 2SCUB 1OXXK 2VY3A 5K2MA 4HJAA 1CT1D 2OQKA 1D8LA 4RH6A 2HT1A 4IFDH 4QCLA 4APMA 1NMGA 4XYLB 3NWSA 3BVGA 1O78A 1TWHH 5CBAE 4DR3L 3I4OA 4KMUC 1M1KC 4YJ2F 4YWKA 2AUKA 1N33L 2ZTCA 3MXGA 3DXJC 1I94H 4K5WA 1ASZA 1XWEA 4A3GH 4TV9F 2IBKA 3D6CA 3GTLA 3H4DA 1K1SA 4A3KH 4JI3Q 1PFNA 1Z2PX 1DIKA 3QOJA 4LUVA 1KIXA 4F7XA 3JAMc 5G3LF 2R85A 4FM9A 4C3HB 4CKBA 2NU6B 2OF1A 3ORRA 3I4NB 5FO9B 4MTNA 1PZID 3HKZE 4HNUA 4LF4H 1L0YB 4FF1A 1FGBD 3ZYYX 4BY7G 2BQUA 1F9QA 1PRTC 3SK6A 3Q22A 2RGVA 4DV3Q 2D2CC 4LUZA 2VUGA 3KTMA 3URYA 3QR8A 3JC66 1EYGA 3H91A 2UUCL 1JQYD 3SDZA 4OX9L 1EEFD 4LK1C 2E74C 1XNRQ 2FPGB 3S1MB 2KCCA 4R9WA 1B9MA 1XNQQ 1K73C 3FKIG 1BOSA 2HDMA 1UE1A 2F0MA 2KCTA 2PMZE 5LMNW 1N36Q 4K5VA 3GIPA 4MN3A 4JI7Q 3NELA 2A6HD 4ZKBB 2BOSA 1E0BA 2R7DA 2IMWP 1I4HA 2VQEQ 2ZM6H 1VAJA 4C3IB 1WYDA 1PHJA 5ELNA 2K03A 1ZQ7A 5L37A 1N8RC 5IYBH 2EY2A 1D1KA 3TEHB 5D1OB 1KHIA 1BVSA 1S72A 3WDNA 5BN3A 5ELBA 4HCEA 2DIKA 4G4KA 3HKSA 3FP9A 1UC8A 2Q2UA 5JQWA 1JR0D 5IP7H 3AB9A 2NVQB 1NNXA 2R82A 2Q2IA 2FLNA 1N48A 1L2ZA 2EPBA 1JICA 2UVUA 3GTGB 4GC7A 1PRTB 1TS5A 1AUVA 3HXLA 1SBBB 5KFHA 2XIWA 5I2XA 3BVMA 3JAMi 1JKJB 2QW7A 5TSSA 5JPNC 4JI8Q 1Q86C 2C22A 2DPJA 3M9MB 2EIFA 1XDNA 4HSVA 1AP0A 4R8NA 1HUNA 2JA7H 4RA8A 2A6EC 1Y8OB 3TQ1A 2UXBH 4JI4H 4IFDG 2L11A 4FYDA 1JDEA 4HR7B 2CKZB 2HJWA 4AH6A 5BMVF 3GD7A 2UVRA 4OXPA 1BCPC 1C0AA 5D1OA 3S1RB 3T1YH 2CW8A 5GONF 4IUNA 2OWOA 2KEEA 3HZXA 4A3GG 1GUSA 4A3KG 2NU7B 4NXNH 3R5XA 4HTHA 4GN3B 4RNOA 1A9XA 3S1NH 5KG4A 1OXUA 1TAEA 3PR5B 1QZHA 1NCVA 1HNWH 5DGBA 5IGFA 4I7ZC 1XTCD 3H0GH 2H4OA 5KG1A 1ONLA 4C1NI 1EYZA 4LSAA 3X3NA 1ILQA 3M3YH 2NVTH 2F1MA 3OMCA 4BBRH 4JI5H 3MC0B 4KN4C 4OHJA 1BXTA 1VQ5A 2X6LA 2FP4B 1CQIB 1VBGA 5IGGA 4ED2A 2F0OA 2RHSB 2HGSA 1I94L 4KD3A 4X62Q 1MD2D 3KUPA 1E22A 5IYZF 4IUPA 1RIPA 5M3MH 1CA5A 3AQQA 3A7LA 4J9RA 4IQZA 3MFHA 4XT3B 3VYTA 3I91A 1UNSA 2ICEC 5ELFA 5C3EB 4XZ3B 1RDPD 1BCPB 2E2DC 2JA9A 5HGTA 1EY6A 2JEAI 3FPUB 4Y8VB 4IUTA 1E24A 1K0RA 3DM3A 4Z9CB 5A2QE 4V0BA 1F77A 1F9PA 4YIJA 3TZDA 4LF4L 3GIKA 4CJ1B 2KA7A 1PRTF 1AZQA 1N56A 1JWSD 2KBNA 1CFMA 2AWNA 1PH5A 1WR2A 2WIIB 4FF3A 1EOTA 1SXTA 3RLOA 4DUZH 1XJVA 2E2HB 2FPIB 5DQGA 1PYWD 5EKIA 5IP7G 5KFIA 4XTCS 2K14A 3UE1A 5M9OA 1I7NA 1CK1A 5C5MA 5KFCA 4OO1I 2PNRC 4JI2H 1W96A 3KFUA 4N8X1 2I87A 2ENBA 1NMFA 2XWJB 4DV7Q 5KRUA 1SMYD 1EY7A 2G9HD 2OTJA 1IBLH 2A19A 1RODA 2ZM6L 2NTSA 2JA7G 1DJRD 1WD0A 3GTMB 1AN8A 4GKKQ 3RN2A 4QY7A 2DY7A 2UU9Q 2JA8G 4FU0A 2N88A 1JCKB 2R7FA 1AW7A 3GQCA 1TQOA 1K83H 4K8IA 3OUZA 1PZKD 1EY4A 1S5CD 3S2HB 3CXCA 3GTKH 1D2BA 4ULLA 2ZJTA 1YNJC 5JPMC 2J7ZA 2E2HA 1SE8A 2KHIA 1S5BD 3I55A 1K28A 2C35B 2UXDH 1GHKA 5CV4A 2AHOB 2KEDA 4LFBQ 1B33N 1ZXTA 4B3RH 4A93B 1VQOA 1U4LA 2TMPA 2QF7A 1UE5A 3CCJA 2O5JC 3CQZA 1JJCB 3H0GG 2JYOA 4JI4L 1STEA 5CV9A 1SNMA 4UCUA 3PW0A 2ICIA 4KTAA 2YTYA 4YP3A 1BCPF 4BBRG 3KXYT 1KNEA 1RK5A 1TY2A 4HMJA 1VQBA 1LABA 1SFOB 3T1YL 3C2PA 1E1OA 4QGUA 2ASBA 1PX2A 4CJ0B 3GIQA 3RV4A 2HIVA 1S97A 1BBWA 4JPBW 5KT6A 5LHY1 4RHSA 1Y1WH 2IA6A 5FKAC 4A2BA 5I2YA 1EY9A 4NXNL 1OWTA 2EOTA 2UVVA 2R93G 2B2WC 3A54A 2JA6B 1U4RA 2WB1B 2V1CC 3JSNA 1DYQA 3Q23A 3PN1A 1UEAB 3J7A5 2P0AA 1TWGA 1HNWL 4LH7A 4JYAH 4HJ8A 4QQBX 4WJ3M 1FJGQ 5C5JA 2W7OA 3CCLA 3K0YA 1V9PA 2A1AA 2VUMH 1JDBB 3E0JA 1AZPA 3KHRA 4UFZA 4JI5L 1SEBD 1E2WA 3M4OB 5KKNB 3KBGA 4O2AF 1MSGA 4WJ4A 4P71A 5GQOA 5LXTF 4DV2Q 3L3OC 3QWNA 3RZDH 4A3JB 4MV7A 3OWFA 1VQFA 3MR2A 3PZPA 3CKIB 5JJZA 1RTOA 3HOXH 2KSWA 2AQ3B 2C5CA 4GN4B 2QK4A 5JJKA 1FGUA 2VXWA 2I80A 3KHHA 2AGOA 1QVFA 2JA6A 4LF6Q 1V1OA 5JJIA 3GTLH 4UCVA 1TXYA 1GSHA 4DR2Q 1HQMC 2F0DA 1P16A 2D0OA 2PO4A 2F4VH 2PQEA 4DUZL 1YHQA 4MZ9A 5CC4A 1F9SA 1EFWA 4ECUA 3CMAA 3U9OA 1LV9A 4ECZA 4G7HC 2B8FA 3S1QH 5CBEE 2BH8A 4DV6Q 3KDFA 1X3QA 5M5WH 4DV4H 2VQFQ 1DONA 4CC5A 1ULZA 4HIMA 4DV5Q 4JI2L 5KFUA 4YY3Q 3H6MA 1J6QA 3TIGA 3I8ZA 3VA7A 4BA2I 4DR1Q 4RB1A 5KT5A 3HOWB 5KEEA 4KY5A 5M3FB 1IBLL 2BQRA 1B4OA 5J39A 2GVBA 1BJTA 2MO1A 1CZGA 2IL8A 3D0FA 2FJ2A 3K8AA 3J7YW 3RB0A 4JI6Q 1VQLA 3D8GA 2AGQA 3RJ0A 3KAKA 4LUOA 2J4XA 4BXXH 2K4KA 3OSOA 1BNCA 1T94A 2BCOA 3P20A 4RAUC 4Y7NB 4A3LH 1LM0A 3OPOA 4M8AA 5LP6F 5IWAH 2RA4A 2B2WA 4AIMA 5A2QL 4EQOA 3D31A 1ENCA 4DK1A 1U5KA 3FVQA 4RMFA 1Y1WG 2UXDL 3FDTA 2CW7A 3SE7A 3I4NH 4QUFA 1IBMQ 3RUZA 3CAMA 4ZLTF 4A3FB 4J9NA 4LFCH 3PO2B 4B3RL 2LY7A 3H3VI 1PMRA 3PUVA 1TU2B 4OELB 3W5OA 5AJ3L 4AQYQ 3U50C 2ZDHA 2AMCB 5JVLA 5COYA 5C0XH 1ZETA 1J5EQ 5CGKA 3CCVA 2K5WA 4QF4A 2RDIA 2LXKA 2NVXB 5KG2A 2VUMG 5KNDA 4IRKA 1T9HA 1XYIA 2RCFA 5CB4F 3HKZA 4GNXA 4DUYQ 2K33A 3RAXA 5IGEA 3S1MH 4NW2A 5C0XJ 3ORQA 1LTGD 3M9BA 4K0KQ 4E6IA 4DAPA 1YJ9A 5KT7A 4DR5Q 4WBNF 4X65Q 3OTOQ 5KFOA 4DL3A 4R8UB 3A5UA 3M9NB 4P2CB 5I6YA 3I90A 3M4YA 4TUYF 4C3IH 2DNCA 3PUZA 3VPCA 4RCNA 2SDFA 3VR5A 2UUBH 1RCVD 1HJPA 1RJPA 3KHGA 4DL6A 2V58A 2A69D 1TVXA 3H09A 1VQJA 4JYAL 3MFIA 2J6SA 4ZK9B 4KY7A 3HOZG 3S14B 1VMCA 3CW2C 1VQDA 2B2YC 3PUWA 2W7PA 1O7LA 3GTPB 2XGTA 2W8KA 2PNHA 2KCNA 4DPGA 3OW2A 4DR3Q 2LMCB 4Y52H 2NVXA 5LL6b 1N33Q 1HNXH 3MAQA 3LGJA 5G3LD 1PLFA 5LMUH 2RGRA 2KUMA 2O5IC 1E4EB 5CV7A 4X3TA 2L15A 2XD4A 1HTLD 4NP5A 4PG3A 3UFXB 3J81c 3RAQA 1SLJA 3H3VC 1H95A 1IW7C 1D1IA 3KLSX 1B8AA 2B29A 1WTQA 2K50A 3RIZA 5GAHC 2BDOA 2I5MX 1EYDA 3NQIA 3L2PA 3SHLA 1H9JA 1GVPA 4XIGS 1V1PA 3I4MB 1WTVA 5IE8A 4DK0A 3SK8A 3L4JA 1A8VA 1W6JA 3WO0A 4C5BA 5DM63 2VB3X 2F4VL 4RB2C 4BXXG 3M7NA 3VMMA 2UUCQ 1YITA 4YWMA 4V190 2K52A 4OX9Q 4MV8A 3GV5B 4A3LG 1NR2A 3GTPA 4FXKC 1YNXA 4LF7Q 2OEOA 1EZ8A 4DV4L 3J7AK 3MXPA 1Q12A 2PBZA 2R7NA 1QJOA 3E0EA 2C2RA 1VCIA 2I07B 4ODGA 1EU4A 1M8AA 3R23A 3NGDA 4GN5A 2RCNA 4XT1B 2QYZA 1Q90A 2FE3A 2G9DA 2ZXRA 3GTQB 4XX0B 1STAA 1PH4A 3K5IA 2YCHA 3BJYA 4O3QA 1SNOA 5KFEA 1S4ZA 1E1TA 2CH4A 4TKOB 3SR1A 2EYLA 4J9KA 2ZXPA 4ED1A 1JE4A 5JJLA 3KOJA 2FLLA 2E5LH 3R8BA 3SGIA 5EPJA 2XGQA 3RB6A 1C7YA 4ED0A 4DL7A 5IWAL 2M00A 4IPDA 5CV6A 5C3EH 4J8QA 2PQAB 3ETHA 1HFGA 3KLRA 4DAMA 4DNTB 4DV0H 2HVSA 3NUCA 4C3IG 4XXEA 3C1EA 4LFCL 1F2ZA 1TR5A 2B2YA 5BN5A 2W8LA 1WH2A 1I6HB 2K1BA 2NZ1D 4QW8A 5JVDF 5A35A 1A2TA 5I9OA 2K5NA 2W57A 2E2HH 5FLXE 5C0XI 3GTQA 3WOEA 1PDQA 3HOYB 1Q8IA 2G5DA 1EIHA 1S03G 3K57A 4P73A 5IGBA 4J9QA 3EBEA 4PZ8A 1MKHA 3GIJA 2EJMA 1G2TA 1Z9FA 3GV6A 3TIIA 1BO0A 3CQZH 1MBYA 5EPKA 4EGVA 5CAEB 2XCPA 2PW5A 3DEOA 2HD3A 2WV6D 1UUPA 4G57A 3F2BA 1XMOH 2JSOA 4CDDC 2R8JA 4J9PA 2UUBL 3G48A 3CCQA 2W6NA 2PQAA 1C3OA 5KFYA 2W9BB 4X6AH 4RB0A 3WO1A 1HR0H 1NE3A 5L9XA 4CJ2C 1II3A 1GD7A 4FVMA 2D0PA 3BDOA 4S3SA 2A68C 5D3DA 3S2HH 3BYYB 2V59A 1S10A 4DK3C 4CBVA 4I50F 4ZI7F 2WINB 4Q44A 4I7HA 3T16A 5JEAG 2BE5C 1KJQA 1HNXL 3GTJB 1ASYA 5LMUL 5FD6A 1I94Q 1TWGH 4F8MA 4PMBA 2NU9B 4A93H 5C1OA 4PQXA 4LAAA 3M4IA 4Q8EA 1PRTD 1XPRA 1S5DD 4L5SA 5EBCA 2R7MA 4ED7A 2OH2A 1N32H 2MNAA 2YTVA 3ERQA 5IIFA 3VYSA 4OIKA 3CCUA 3OIQA 4GKJH 4LF4Q 3AU7A 1J8IA 4AYBB 3RN5A 5T14A 1S0OA 1QUQB 3PIOA 4L6TB 1QE6A 3H20A 3I73A 3LNNA 1KXLA 1D5ZC 4O42A 4YCVA 2ZJQA 2RKSA 3VR4A 2JA6H 1UNNC 1CUKA 2XRQD 2DUDA 1N34H 4WJWA 3ULJA 3H40A 3STBC 4ALPA 1XMQH 4ECRA 4KHVA 1GUTA 5KT4A 2NU8B 4BY1B 4RUAA 4DGZA 2ZM6Q 3PIPA 1EUCB 3G4SA 3L0OA 1BXRA 3DHQA 2X6GA 4HYKA 2VL6A 3K58A 3QIAA 2K5DA 2B63B 2DNEA 4FO2A 3N44B 3M4OH 1FYCA 2HHHQ 3MFYA 3TP7A 4ZHQF 2EQSA 4DNRB 2E5LL 4AYBA 4A3JH 1L0WA 3T5HA 3S15H 2ASDA 1Q1EA 2EJFC 3ETJA 4J6HA 2K28A 2RSNA 3Q8SB 1FR3A 2A6ED 4LF5H 4DV0L 1KJ8A 1B3QA 4OO1H 1E2VA 2Y0SB 2YZGA 1C48A 3K81C 3V6HA 3RF2A 4LNQA 2V9WA 3OUUA 2YTXA 1BCPD 1PTOC 3A5ZB 1B2TA 4LF9H 1B04A 4XYMB 4IJHA 3R5FA 2ZXOA 3J81j 2UXBQ 4JI4Q 3V96A 4ZYSA 3T5LA 3T53B 2JJQA 2KHJA 5ELDA 2ZJRA 1L1OB 4DXGA 1RJTA 3NSWA 1ET9A 4J1MA 3HOVB 3T1YQ 4UY8C 2B63A 3W2DA 5FOBB 1RK6A 4ZQIA 5BR8H 1YNNC 5ELCA 3J81E 1SAPA 2PCFB 1F2MA 3UDXA 4DR7H 3HOWH 3EIVA 3EPIA 3CC4A 5M3FH 4NXNQ 1XMOL 3G6VA 1KJ9A 4Q8FA 1IHZA 3HBLA 3SXHA 3GV3A 3V6KA 3K5MA 2OTLA 4KD4A 3LP8A 4JI3H 3HOUG 4KV6A 2ES2A 3OMGA 1HR0L 1HNWQ 3GIMA 2Y0SA 2YS6A 3TZUA 4IHJF 1W3SA 2IHEA 2F0WA 2UVWA 1EL0A 4A3MB 3FMAA 1LACA 4R4OA 4IAJA 1UAPA 4JI5Q 3I2ZA 1T5EA 3K6OA 3PMFA 1PTOB 4EQ5A 2IPKD 3W3AA 1LTLA 3HS0C 3I4LA 4A3FH 4L5TA 5EKKA 3PO2H 5FLXL 2JA6G 3J7AF 1X3EA 1STHA 1G51A 4JK1C 1FNVA 4C3JB 3DWAA 5IT9L 1LT4D 2N8NA 1STBA 4WRDA 4YR3A 4JV5H 1KJIA 2NVXH 3IFDA 4UCOA 2GPWA 4ZRZA 1C9OA 3HP3A 3F8TA 1N32L 1I4XA 1TWAB 2HCIA 5I9PA 4GKJL 4B3SH 1H9MA 1DM0B 1UEBA 2GVAA 3GO5A 3HEJA 1YI2A 3MWDA 2E76C 5LOVF 4Q45A 3OWEB 2IX3A 3GTGA 5KFFA 3U4VA 1IKLA 2VQEH 1CS0A 3C0FB 4BS9A 3EQLC 3J80L 4MAMA 4DUZQ 4A3JG 2LSSA 4X64H 4ECQA 4R1JA 2W6MA 3M4QA 1Q7YC 4DV1H 4POFA 3TN2A 3PO3H 2UUAH 5JOBA 1K3RA 1FNWA 1SE2A 1JT8A 3T5KA 4G3IA 2AQ2B 2WAQB 4L5RC 4JI2Q 1N34L 4HR7A 4MTDA 1A6XA 4OO1G 5KYIA 1HA5A 1XMQL 1KC8C 3S14H 2X0SA 2C28A 3IAYA 1IBLQ 2JK8A 3GTPH 3TRZA 3E9HA 4QMGA 1YNJD 4IUVA 1CZWA 4DNIA 3G71A 3IFTA 3K59A 1I6UA 1QB5D 4E4TA 4RUCA 1TWAA 5LL6X 4IOCA 5K36H 4R4IA 5KT2A 1VQCA 2PYKA 2E8GA 3BG3A 4MTEA 3ONAB 2RDGA 1HHVA 1VQAA 2MP1A 4LH6A 3DEPA 5IYBG 5KFXA 1PH6A 2EJGC 4O2DA 4Q5VA 4F88A 4YJ3F 5KG5A 4M9UA 2UXDQ 4IN3A 2V4QA 2R61A 1KDBA 1NTGA 4OWTB 4LF5L 3HOWG 2DJGC 5M3FG 2L12A 3ULPA 2K05A 3HKZG 4ECSA 5T1GA 4KJOA 2R8IA 4B3RQ 2WE6A 1PH1A 1Q8KA 1PTOF 1CI3M 5CV8A 3NBIA 5JAVA 5AJ3Q 2WAQA 4F4YA 4JBKA 2PI2A 4LF9L 4EGQA 1CSPA 3C46A 2OXPA 4JC0A 2F0NA 1JOOA 1W2BA 1YHAA 1JORA 5C6AA 1VQNA 1A62A 1K1QA 2JQOA 2VS1A 4UP8A 4O2BF 5IP9H 1EQVA 2GPSA 1WCMB 1EFID 1WJJA 2I8CA 1YIJA 1E3PA 5IYCH 5BR8L 2FK2A 1EU3A 3TP6A 5D8DA 4A3FG 4EVOA 1A3TA 1EYAA 2EY5A 3PO2G 4BY7B 4DR7L 2F03A 1WD1A 4OWWB 3OOCA 1ZYRC 4XYOA 3GTQH 2IP4A 2R87A 1TKWB 1PYBA 1B3AA 1PVOA 1SYDA 2PZWA 4DFAA 3QFFA 5KFNA 3QJYA 4DA2A 4IPGA 1AUXA 2AWOA 4JI3L 4BWGB 2R6FA 1GSAA 2QCPX 4JYAQ 5J2TF 3H3VH 1VDZA 3PVXA 1JE5A 3FKIB 2F0JA 5KX5F 1GSOA 3UE0A 4J15A 3I12A 3Q6SA 3PGZA 2SNSA 3BJUA 2NBFA 5E1FA 3VYRA 1EHIA 4GZYC 3RZOB 4MV4A 4A4IA 2E2JB 1WTOA 5KFMA 1O80A 4N8FA 1GO3E 2N3SA 5H1SE 3PO3G 4IZOA 1RHPA 3GTMA 2FMCA 4F4ZA 1WCMA 4ECVA 2Q2HA 4KHPH 1I6HH 5FPOA 2J9GA 1Z2OX 2W71A 4JI1Q 1GLVA 3VPDA 1XNQL 1IBKH 4YCWA 4Q0FA 4JV5L 2K5VA 5M3MG 2VNUD 1CKMA 3JAME 5KG6A 3J81L 2IT1A 5CMDA 3GIDA 3PW5A 1W6KA 2MO0A 3I72A 3SK5A 3U9SA 3EYYA 4B3SL 1B50A 4DV7H 4MV6A 3D4RA 5KFPA 4O1NA 1M90C 4RGNA 5HY6A 1DV2A 4A3DB 5IT9W 1WI5A 3SVMA 1O75A 2VQEL 3S17H 4IO9A 3QG1A 5K36G 3T1HH 4C5CA 1EIFA 2F4VQ 3FKIA 4LFAH 4RHRA 3RLNA 3ULLA 4BA1I 1VKZA 2A73B 1A2UA 4L5QA 4X64L 4HEDA 4RWSC 2SEBD 1NJIC 4YBZB 4AYBE 4KI0A 1YJWA 4DV1L 4UAIA 5KFGA 5KGUA 3KJOA 5GADC 2UUAL 1ZEQX 4DV4Q 1XX8A 1KEEA 3LWBA 4EQPA 1X6OA 3PSIA 3J80W 2IY5B 2MHVA 3A8IE 3JSLA 4JBMA 4C2MB 5CR3A 2R7ZB 4YAKB 1A3UA 2MUYA 3M7GA 1RJQA 2VOBA 1SFOA 2A74C 2K32A 5EKLA 4IURA 4LWCA 4A3GB 2K7VA 1Q82C
chains in the Genus database with same CATH topology
4H02A 1GVPA 3CPWA 4XIGS 2JE6I 3MXNB 1OXXK 1IXRA 2VY3A 3W1BA 1S40A 4HJAA 5IE8A 3KF6A 2OQKA 1D8LA 5IP9G 2HT1A 1A8VA 4IOAA 4IFDI 1NMGA 5IWAQ 2F4VL 1JJ2A 4BXXG 3M7NA 5IYCG 1TWHH 2UUCQ 1YITA 4YHHL 2KCMA 1I50H 2K52A 4YWMA 4OX9Q 1VQPA 4A3LG 2IX1A 4DR3L 3I4OA 1M1KC 1YNXA 4YWKA 2BA0A 4LF7Q 1EOVA 1EQRA 2ZTCA 1N33L 3IRBA 2Z6KC 4A3CH 5M5XH 4DV4L 4LFCQ 4BBSH 1ASZA 4A3GH 1Q12A 1X55A 1X54A 3E0EA 1AE2A 4HIDA 1VCIA 4A3KH 1OTCA 4JI3Q 2R93H 1G6PA 4LUVA 3PF5A 2I5HA 1KIXA 4GN5A 2RCNA 4R4CA 1GKHA 3I4MH 3JAMc 2Y0SE 1PH4A 1E1TA 5FLMH 4MTNA 3HKZE 3GDEA 3KOJA 5JJLA 4BY7G 3WWVA 1OXSC 3M4PA 3SGIA 4DV3Q 4KHPQ 4LUZA 1C7YA 5IWAL 4IPDA 4R4TA 3JC66 1QZGA 1PH7A 3NENA 1EYGA 1VQ9A 2UUCL 1IBKQ 1N33Q 5C3EH 4OX9L 1VQHA 2JEBI 5IY0A 1XNRQ 2PQAB 2ZTEA 2UUBQ 1XNQQ 2YV5A 4DAMA 1K73C 3FKIG 2DGYA 3KJPA 4C3HH 1UE1A 4LFCL 2B63H 1EQQA 2KCTA 2PMZE 5LMNW 1N36Q 1BKBA 5GROA 1VQKA 3T1HQ 4JI7Q 3NELA 4LFAQ 2R7DA 1QVGA 2VQEQ 2K5NA 3KLWA 2E2HH 1SMXA 5C0XI 1WYDA 1PHJA 4JOIC 5ELNA 1NY4A 1HZBA 1N8RC 3KYHC 5IYBH 2HHHL 3TEHB 5LMUQ 4P73A 4QIWE 1KHIA 4PZ7A 4B3MQ 1HR0W 1BVSA 1S72A 3EBEA 2CWAA 4PZ8A 1MKHA 5C44H 1PV4A 3HKSA 1Z9FA 3FP9A 4DV3L 2Q2UA 4KHPL 3CQZH 1KAWA 4JBJA 5IP7H 1BBUA 3MEFA 2Q2IA 2YYZA 3NEMA 2QEXA 3F2BA 1IBKL 1XNRL 2UUBL 2NZOA 3G48A 3J80i 3CCQA 2PQAA 2NZHA 1MIUA 3JAMi 4X6AH 4DV7L 4JI8Q 3HOVH 1Q86C 1NE3A 3HOXG 3HOYH 1GD7A 1N36L 2A8VA 3AEVA 2EIFA 2D0PA 2BH2A 4DKAC 2UXBL 3T1HL 4JI7L 3S2HH 3TREA 1VQ8A 4LF8Q 4LFAL 2JA7H 2WP8J 4DK3C 3RNUA 4IFDG 1CKNB 2Z6KA 4P72A 5JEAG 2CKZB 2GN5A 2NVQH 4AH6A 1HNXL 3GD7A 4OXPA 1ASYA 5LMUL 2D62A 1C0AA 1I94Q 1TWGH 2CWPA 3GTGH 2OWOA 4A93H 1HZCA 4BBSG 3G6EA 4A3GG 1XPRA 4L5SA 4A3KG 3UDFA 3I56A 4A3MH 2WAQE 4GN3B 3I4MG 2PI2E 2MNAA 2YTVA 3UDIA 3CCUA 3S1NH 1OXUA 4LF4Q 5J3BA 1QZHA 3I7FA 2EXDA 4JI8L 5FLMG 1VQMA 2E5LQ 3BU2A 1SROA 3GTJH 3RN5A 2ATWA 2N49A 3H0GH 4JG2A 1QUQB 3PIOA 5FLXc 3S1RH 1DGSA 2CCZA 4LF8L 3KDFB 3M3YH 2NVTH 1KXLA 1IZ6A 5IT9c 4BBRH 1Q1BA 4YCVA 3E9IA 2ZJQA 1CKNA 1Y1VH 4GNXC 4DV0Q 1VQ5A 1KRTA 4UPAA 1NBWA 2JA6H 1CUKA 1TWAH 2RHSB 2DUDA 2HIXA 1K8AC 1I94L 2NN6I 3ULJA 4X62Q 2QA4A 1E22A 3STBC 5M3MH 1RIPA 4NXMQ 2UXCQ 3AQQA 4ALPA 4OONA 3I4NG 4JOIA 4UP9A 2ZM6Q 3PIPA 5FJ8H 1PH8A 2WFWA 4QL5A 3G4SA 2LXJA 2JA9A 3L0OA 3J80c 1K8GA 4O0AA 2Z0SA 1YJNA 3HOZH 4HIOA 2JEAI 1KL9A 3B6YA 1E24A 4DR4Q 1K0RA 5C0XG 2VL6A 1HZ9A 2ZTDA 3DM3A 4LF4L 4NB3A 5GAGC 5C4XH 1UE6A 3M4OH 5LMNQ 4DK6C 2HHHQ 2EQSA 2I5LX 2E5LL 1PFSA 1IL2A 4A3JH 2KBNA 1L0WA 1PH5A 2AWNA 3S15H 2Y0SG 1Q1EA 1I5FA 5DLQE 3RLOA 1XJVA 5C44G 1TWCH 1XMOQ 5IP7G 4XTCS 2K14A 3UE1A 1JJGA 4BY1H 4DV0L 4OO1I 1HR0Q 3K81C 2CQOA 3KFUA 4X62L 2ALYB 4LNQA 2UXCL 4NXML 4UP7A 2YTXA 1NMFA 2VW9A 3A5ZB 4DV7Q 3HOVG 4IJHA 4GNXB 4APVA 2OTJA 3HOYG 3J81j 4B3TQ 2A19A 2UXBQ 2ZM6L 4JI4Q 4TQUS 5IYDH 1VQGA 2JJQA 4A3BH 2KHJA 2JA7G 2FXQA 2K5HA 3F1ZA 4NPSA 2ZJRA 4A3EH 3RN2A 1L1OB 4QY7A 2UU9Q 2JA8G 3GTOH 1KRSA 4GKKQ 4DR4L 3PUYA 2R7FA 3T1YQ 1HNXQ 4UY8C 1UE7A 5LMNL 1K83H 2MFIA 4MNOA 1VQIA 3CXCA 4IPCA 3GTKH 1S3OA 3DLLA 3UDXA 3L7ZC 3HOWH 3EIVA 3CC4A 1SE8A 2KHIA 5M3FH 4P74A 3I55A 1XMOL 2C35B 2F52A 3AFPA 1U0LA 1N32Q 2AKWB 3CCSA 4DV5L 4A3MG 2AHOB 3CMEA 2OTLA 4LFBQ 1MJEA 1YZ6A 4GKJQ 3HOUG 2ES2A 1HNWQ 1HR0L 2IHFA 3GTMH 1VQOA 1WCMH 2CFMA 1W3SA 2IHEA 1UE5A 3CCJA 2YU9H 4POGA 3STBD 3F2CA 2VZAA 4L5RC 1JJCB 3PUXA 2HQLA 3H0GG 1HH2P 4R4OA 4B3TL 1IYJB 1Q81C 4JI4L 4BY7H 4JI5Q 3I2ZA 1P8LA 2WB1E 1HNZQ 3OYYA 1VS0A 4DR6Q 4GKKL 2YTYA 1EWIA 2UU9L 3ER0A 4BBRG 4EQ5A 4GOPC 1Y1VG 1LTLA 1VQBA 4RG1A 2Q2TA 2XTIA 4HJ7A 4A3FH 4L5TA 1FL0A 3T1YL 1N34Q 1E1OA 4QGUA 3PO2H 2ASBA 4BXXH 2JA6G 2E2IH 1X3EA 1XMQQ 1G51A 3PF4A 2HIVA 2NN6G 3FKIH 3VDYA 1BBWA 4A3IH 3CP0A 2N8NA 4A3CG 3CF5A 1Y1WH 4OWXB 4HIKA 1YEZA 3J7ZC 2B3GA 4NXNL 3M85A 1N9WA 3K0XA 4AYBG 1X9NA 2NVXH 2R92H 2R93G 1N32L 1C9OA 3F8TA 1QVCA 2OCEA 4YWLA 5GAEC 2V1CC 3RZOH 1YBYA 3AFQA 3J7A5 4GKJL 4LFBL 1UEBA 1YI2A 2GVAA 1HNWL 3GO5A 4HJ8A 4QQBX 4WJ3M 1FJGQ 3U4VA 1OXTA 1XPOA 3CCLA 4KHZA 1V9PA 2A1AA 1KQSA 5C4XG 1E7ZA 2VUMH 1SFOH 4DUZQ 5E7NA 2N78A 4A3JG 2LSSA 3FHWA 4R1JA 4JCVE 3M4QA 1Q7YC 4C3JH 4JI5L 4POFA 1V43A 1K9MC 1HNZL 4LF5Q 3PO3H 4DR6L 1K3RA 1JT8A 4WJ4A 3F2DA 1EUJA 4BY1G 4P71A 1PYSB 5GQOA 4JI2Q 4EX5A 5C3EG 4DV2Q 3RZDH 1N34L 4OO1G 2JA5H 4JI1L 3NBHB 4LF9Q 4A3DH 1XMQL 1KC8C 1VQFA 4IJLA 3H15A 3S14H 1Z47A 1L1OC 4TVAB 1IBLQ 1V1QA 2JK8A 3CPFA 4GOPB 3GTPH 3HOXH 2B63G 3E9HA 1WFQA 3TRZA 2I0QA 4DNIA 4GN4B 3G71A 5IYDG 5JJKA 1FGUA 2ZJPA 4A3BG 1PA6A 1B7YB 1QVFA 4LF6Q 4A3EG 4IOCA 5JJIA 4QJFA 4R4IA 1VQCA 3CCRA 3GTLH 1TXYA 2E8GA 1FJGL 5BR8Q 4DR2Q 3TS0A 1P16A 2D0OA 1VQAA 2R7ZH 4C2MH 4PMWA 5IYBG 1A63A 1YHQA 1CKOA 1OXVA 1VQEA 4MZ9A 4DUZL 1PH6A 4DR7Q 1EFWA 4IFDJ 3CMAA 4O2DA 2RHQB 4P75A 4YCUA 2UXDQ 1L2FA 1QUQA 5JEAJ 3S1QH 1NTGA 2BH8A 4OWTB 4LF5L 5HGQA 3U58A 2MQHA 4DV6Q 5M3FG 3KDFA 1VQ7A 3HOWG 5M5WH 3ULPA 3HKZG 2VQFQ 1A0IA 4B3RQ 4HIMA 4DV5Q 4JI2L 1PH1A 1Q8KA 4DV2L 3UDGA 3S2DH 5AJ3Q 4YY3Q 4JBKA 1J6QA 2PI2A 4LF9L 1CSPA 4BA2I 1Y14B 4DR1Q 4JC0A 1WCMG 4FDBA 1W2BA 1IBLL 1YHAA 3U4ZA 4DAYB 1A62A 2NVYH 1VQNA 2JQOA 2VS1A 2GVBA 4GOPA 4UP8A 3ZJYC 2MO1A 3HFZB 3D0FA 2H5XA 2OQ0A 3K8AA 3Q8DA 4ME3A 4X66Q 1AH9A 3BZKA 5IP9H 1FVIA 1AE3A 1VQLA 4JI6Q 4LF6L 1XPUA 4LUOA 1HZAA 3ERSX 1WJJA 4GS3A 1YIJA 1E3PA 2K4KA 5IYCH 5BR8L 4A76A 4DR2L 3A74A 4A3FG 4NXNQ 1RL2A 3TQYA 4A3LH 3PO2G 1LM0A 4LW1A 4AIMA 4DR7L 2IX0A 3J81i 4LF7L 3BZCA 5ELOA 3D31A 4A3IG 4OWWB 3GTQH 4JV5Q 1LUZA 3RR5A 4A93G 1U5KA 4RMFA 3KF8B 1Y1WG 1PYBA 2UXDL 1CSQA 1PH3A 1LYLA 1PVOA 3I4NH 1VQ6A 3AYHB 3K7UC 4DV6L 1IBMQ 1X65A 1SR3A 3CAMA 4IPGA 2AWOA 5EAYA 4JI3L 2VQFL 4B3SQ 2R92G 4JYAQ 4GLVB 4B3RL 3H3VH 2K75A 1PH9A 3H3VI 1X56A 3PUVA 1PH2A 1JE5A 5AJ3L 1YVCA 3W5OA 4YY3L 3U50C 4AQYQ 2AMCB 3UE0A 4DR1L 4J15A 1J5EQ 1TWFH 3CCEA 3CCVA 3CD6A 3PGZA 3BJUA 4X64Q 2LXKA 2VUMG 1T9HA 4DV1Q 1WOCA 4Y7NH 4DUYQ 3RLFA 4GNXA 1R9TH 4A4IA 2UUAQ 4JI0Q 3S1MH 5C0XJ 1B70B 4X66L 5M5YH 3M9BA 1GM5A 1UWVA 4K0KQ 4JI6L 1GO3E 2N3SA 5H1SE 1YJ9A 3PO3G 4DR5Q 4X65Q 3OTOQ 1L1OA 4HJ9A 2Q2HA 3S16H 1I6HH 3A0JA 1SRUA 3A5UA 2QGQA 4R4QA 2R6GA 1EIYB 4JI1Q 2WB1G 2JA5G 4A3DG 1YHBA 1XNQL 1JB7A 4YCWA 1VQ4A 4JV5L 2K5VA 5M3MG 4C3IH 2VNUD 1CKMA 1MJCA 3PUZA 3EN2A 1HJPA 3ICEA 2IT1A 3TS2A 1IBML 1Q46A 2MO0A 3PV0A 2KENA 4GLAC 4B3SL 1VQJA 5FJ8G 4JYAL 2RF4A 3KF6B 1M90C 5HY6A 2E2JH 1WI5A 3CC7A 3HOZG 2VQEL 3S17H 4IO9A 4AQYL 2JA8H 2BA1A 3CW2C 5K36G 1EIFA 1VQDA 3PUWA 2F4VQ 1J5EL 3RLNA 3ULLA 4BA1I 1SN8A 2XGTA 2PNHA 3PCOB 4YHHQ 4DPGA 4L5QA 4X64L 3OW2A 2F3IA 3CCMA 4DR3Q 2WAQG 4KI0A 4AYBE 1YJWA 1NJIC 2R7ZG 4DV1L 4Y52H 4KLKA 4DUYL 1XTDA 4A75A 3LGJA 3CC2A 4B3ML 3KJOA 3K80C 5GADC 2UUAL 4JI0L 4JBWA 4PZ6A 4DV4Q 2ID0A 4K0KL 1X6OA 1G291 2L15A 3PSIA 4PG3A 4DR5L 4X65L 3OTOL 3W1GA 2IY5B 3S24A 4JBMA 3J81c 1X3GA 1SLJA 1KD1C 1H95A 3HOUH 1B8AA 2B29A 3K7AH 2K50A 1I3QH 4LWCA 4HJ5A 5GAHC 1X3FA 2I5MX 1O7IA 1JMCA 4GLXA 4IPHA 3L2PA 1D7QA 5C4JH 1Q82C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H02 A;  1GVP A;  3CPW A;  4XIG S;  2JE6 I;  3MXN B;  1OXX K;  1IXR A;  2VY3 A;  3W1B A;  1S40 A;  4HJA A;  5IE8 A;  3KF6 A;  2OQK A;  1D8L A;  5IP9 G;  2HT1 A;  1A8V A;  4IOA A;  4IFD I;  1NMG A;  5IWA Q;  2F4V L;  1JJ2 A;  4BXX G;  3M7N A;  5IYC G;  1TWH H;  2UUC Q;  1YIT A;  4YHH L;  2KCM A;  1I50 H;  2K52 A;  4YWM A;  4OX9 Q;  1VQP A;  4A3L G;  2IX1 A;  4DR3 L;  3I4O A;  1M1K C;  1YNX A;  4YWK A;  2BA0 A;  4LF7 Q;  1EOV A;  1EQR A;  2ZTC A;  1N33 L;  3IRB A;  2Z6K C;  4A3C H;  5M5X H;  4DV4 L;  4LFC Q;  4BBS H;  1ASZ A;  4A3G H;  1Q12 A;  1X55 A;  1X54 A;  3E0E A;  1AE2 A;  4HID A;  1VCI A;  4A3K H;  1OTC A;  4JI3 Q;  2R93 H;  1G6P A;  4LUV A;  3PF5 A;  2I5H A;  1KIX A;  4GN5 A;  2RCN A;  4R4C A;  1GKH A;  3I4M H;  3JAM c;  2Y0S E;  1PH4 A;  1E1T A;  5FLM H;  4MTN A;  3HKZ E;  3GDE A;  3KOJ A;  5JJL A;  4BY7 G;  3WWV A;  1OXS C;  3M4P A;  3SGI A;  4DV3 Q;  4KHP Q;  4LUZ A;  1C7Y A;  5IWA L;  4IPD A;  4R4T A;  3JC6 6;  1QZG A;  1PH7 A;  3NEN A;  1EYG A;  1VQ9 A;  2UUC L;  1IBK Q;  1N33 Q;  5C3E H;  4OX9 L;  1VQH A;  2JEB I;  5IY0 A;  1XNR Q;  2PQA B;  2ZTE A;  2UUB Q;  1XNQ Q;  2YV5 A;  4DAM A;  1K73 C;  3FKI G;  2DGY A;  3KJP A;  4C3H H;  1UE1 A;  4LFC L;  2B63 H;  1EQQ A;  2KCT A;  2PMZ E;  5LMN W;  1N36 Q;  1BKB A;  5GRO A;  1VQK A;  3T1H Q;  4JI7 Q;  3NEL A;  4LFA Q;  2R7D A;  1QVG A;  2VQE Q;  2K5N A;  3KLW A;  2E2H H;  1SMX A;  5C0X I;  1WYD A;  1PHJ A;  4JOI C;  5ELN A;  1NY4 A;  1HZB A;  1N8R C;  3KYH C;  5IYB H;  2HHH L;  3TEH B;  5LMU Q;  4P73 A;  4QIW E;  1KHI A;  4PZ7 A;  4B3M Q;  1HR0 W;  1BVS A;  1S72 A;  3EBE A;  2CWA A;  4PZ8 A;  1MKH A;  5C44 H;  1PV4 A;  3HKS A;  1Z9F A;  3FP9 A;  4DV3 L;  2Q2U A;  4KHP L;  3CQZ H;  1KAW A;  4JBJ A;  5IP7 H;  1BBU A;  3MEF A;  2Q2I A;  2YYZ A;  3NEM A;  2QEX A;  3F2B A;  1IBK L;  1XNR L;  2UUB L;  2NZO A;  3G48 A;  3J80 i;  3CCQ A;  2PQA A;  2NZH A;  1MIU A;  3JAM i;  4X6A H;  4DV7 L;  4JI8 Q;  3HOV H;  1Q86 C;  1NE3 A;  3HOX G;  3HOY H;  1GD7 A;  1N36 L;  2A8V A;  3AEV A;  2EIF A;  2D0P A;  2BH2 A;  4DKA C;  2UXB L;  3T1H L;  4JI7 L;  3S2H H;  3TRE A;  1VQ8 A;  4LF8 Q;  4LFA L;  2JA7 H;  2WP8 J;  4DK3 C;  3RNU A;  4IFD G;  1CKN B;  2Z6K A;  4P72 A;  5JEA G;  2CKZ B;  2GN5 A;  2NVQ H;  4AH6 A;  1HNX L;  3GD7 A;  4OXP A;  1ASY A;  5LMU L;  2D62 A;  1C0A A;  1I94 Q;  1TWG H;  2CWP A;  3GTG H;  2OWO A;  4A93 H;  1HZC A;  4BBS G;  3G6E A;  4A3G G;  1XPR A;  4L5S A;  4A3K G;  3UDF A;  3I56 A;  4A3M H;  2WAQ E;  4GN3 B;  3I4M G;  2PI2 E;  2MNA A;  2YTV A;  3UDI A;  3CCU A;  3S1N H;  1OXU A;  4LF4 Q;  5J3B A;  1QZH A;  3I7F A;  2EXD A;  4JI8 L;  5FLM G;  1VQM A;  2E5L Q;  3BU2 A;  1SRO A;  3GTJ H;  3RN5 A;  2ATW A;  2N49 A;  3H0G H;  4JG2 A;  1QUQ B;  3PIO A;  5FLX c;  3S1R H;  1DGS A;  2CCZ A;  4LF8 L;  3KDF B;  3M3Y H;  2NVT H;  1KXL A;  1IZ6 A;  5IT9 c;  4BBR H;  1Q1B A;  4YCV A;  3E9I A;  2ZJQ A;  1CKN A;  1Y1V H;  4GNX C;  4DV0 Q;  1VQ5 A;  1KRT A;  4UPA A;  1NBW A;  2JA6 H;  1CUK A;  1TWA H;  2RHS B;  2DUD A;  2HIX A;  1K8A C;  1I94 L;  2NN6 I;  3ULJ A;  4X62 Q;  2QA4 A;  1E22 A;  3STB C;  5M3M H;  1RIP A;  4NXM Q;  2UXC Q;  3AQQ A;  4ALP A;  4OON A;  3I4N G;  4JOI A;  4UP9 A;  2ZM6 Q;  3PIP A;  5FJ8 H;  1PH8 A;  2WFW A;  4QL5 A;  3G4S A;  2LXJ A;  2JA9 A;  3L0O A;  3J80 c;  1K8G A;  4O0A A;  2Z0S A;  1YJN A;  3HOZ H;  4HIO A;  2JEA I;  1KL9 A;  3B6Y A;  1E24 A;  4DR4 Q;  1K0R A;  5C0X G;  2VL6 A;  1HZ9 A;  2ZTD A;  3DM3 A;  4LF4 L;  4NB3 A;  5GAG C;  5C4X H;  1UE6 A;  3M4O H;  5LMN Q;  4DK6 C;  2HHH Q;  2EQS A;  2I5L X;  2E5L L;  1PFS A;  1IL2 A;  4A3J H;  2KBN A;  1L0W A;  1PH5 A;  2AWN A;  3S15 H;  2Y0S G;  1Q1E A;  1I5F A;  5DLQ E;  3RLO A;  1XJV A;  5C44 G;  1TWC H;  1XMO Q;  5IP7 G;  4XTC S;  2K14 A;  3UE1 A;  1JJG A;  4BY1 H;  4DV0 L;  4OO1 I;  1HR0 Q;  3K81 C;  2CQO A;  3KFU A;  4X62 L;  2ALY B;  4LNQ A;  2UXC L;  4NXM L;  4UP7 A;  2YTX A;  1NMF A;  2VW9 A;  3A5Z B;  4DV7 Q;  3HOV G;  4IJH A;  4GNX B;  4APV A;  2OTJ A;  3HOY G;  3J81 j;  4B3T Q;  2A19 A;  2UXB Q;  2ZM6 L;  4JI4 Q;  4TQU S;  5IYD H;  1VQG A;  2JJQ A;  4A3B H;  2KHJ A;  2JA7 G;  2FXQ A;  2K5H A;  3F1Z A;  4NPS A;  2ZJR A;  4A3E H;  3RN2 A;  1L1O B;  4QY7 A;  2UU9 Q;  2JA8 G;  3GTO H;  1KRS A;  4GKK Q;  4DR4 L;  3PUY A;  2R7F A;  3T1Y Q;  1HNX Q;  4UY8 C;  1UE7 A;  5LMN L;  1K83 H;  2MFI A;  4MNO A;  1VQI A;  3CXC A;  4IPC A;  3GTK H;  1S3O A;  3DLL A;  3UDX A;  3L7Z C;  3HOW H;  3EIV A;  3CC4 A;  1SE8 A;  2KHI A;  5M3F H;  4P74 A;  3I55 A;  1XMO L;  2C35 B;  2F52 A;  3AFP A;  1U0L A;  1N32 Q;  2AKW B;  3CCS A;  4DV5 L;  4A3M G;  2AHO B;  3CME A;  2OTL A;  4LFB Q;  1MJE A;  1YZ6 A;  4GKJ Q;  3HOU G;  2ES2 A;  1HNW Q;  1HR0 L;  2IHF A;  3GTM H;  1VQO A;  1WCM H;  2CFM A;  1W3S A;  2IHE A;  1UE5 A;  3CCJ A;  2YU9 H;  4POG A;  3STB D;  3F2C A;  2VZA A;  4L5R C;  1JJC B;  3PUX A;  2HQL A;  3H0G G;  1HH2 P;  4R4O A;  4B3T L;  1IYJ B;  1Q81 C;  4JI4 L;  4BY7 H;  4JI5 Q;  3I2Z A;  1P8L A;  2WB1 E;  1HNZ Q;  3OYY A;  1VS0 A;  4DR6 Q;  4GKK L;  2YTY A;  1EWI A;  2UU9 L;  3ER0 A;  4BBR G;  4EQ5 A;  4GOP C;  1Y1V G;  1LTL A;  1VQB A;  4RG1 A;  2Q2T A;  2XTI A;  4HJ7 A;  4A3F H;  4L5T A;  1FL0 A;  3T1Y L;  1N34 Q;  1E1O A;  4QGU A;  3PO2 H;  2ASB A;  4BXX H;  2JA6 G;  2E2I H;  1X3E A;  1XMQ Q;  1G51 A;  3PF4 A;  2HIV A;  2NN6 G;  3FKI H;  3VDY A;  1BBW A;  4A3I H;  3CP0 A;  2N8N A;  4A3C G;  3CF5 A;  1Y1W H;  4OWX B;  4HIK A;  1YEZ A;  3J7Z C;  2B3G A;  4NXN L;  3M85 A;  1N9W A;  3K0X A;  4AYB G;  1X9N A;  2NVX H;  2R92 H;  2R93 G;  1N32 L;  1C9O A;  3F8T A;  1QVC A;  2OCE A;  4YWL A;  5GAE C;  2V1C C;  3RZO H;  1YBY A;  3AFQ A;  3J7A 5;  4GKJ L;  4LFB L;  1UEB A;  1YI2 A;  2GVA A;  1HNW L;  3GO5 A;  4HJ8 A;  4QQB X;  4WJ3 M;  1FJG Q;  3U4V A;  1OXT A;  1XPO A;  3CCL A;  4KHZ A;  1V9P A;  2A1A A;  1KQS A;  5C4X G;  1E7Z A;  2VUM H;  1SFO H;  4DUZ Q;  5E7N A;  2N78 A;  4A3J G;  2LSS A;  3FHW A;  4R1J A;  4JCV E;  3M4Q A;  1Q7Y C;  4C3J H;  4JI5 L;  4POF A;  1V43 A;  1K9M C;  1HNZ L;  4LF5 Q;  3PO3 H;  4DR6 L;  1K3R A;  1JT8 A;  4WJ4 A;  3F2D A;  1EUJ A;  4BY1 G;  4P71 A;  1PYS B;  5GQO A;  4JI2 Q;  4EX5 A;  5C3E G;  4DV2 Q;  3RZD H;  1N34 L;  4OO1 G;  2JA5 H;  4JI1 L;  3NBH B;  4LF9 Q;  4A3D H;  1XMQ L;  1KC8 C;  1VQF A;  4IJL A;  3H15 A;  3S14 H;  1Z47 A;  1L1O C;  4TVA B;  1IBL Q;  1V1Q A;  2JK8 A;  3CPF A;  4GOP B;  3GTP H;  3HOX H;  2B63 G;  3E9H A;  1WFQ A;  3TRZ A;  2I0Q A;  4DNI A;  4GN4 B;  3G71 A;  5IYD G;  5JJK A;  1FGU A;  2ZJP A;  4A3B G;  1PA6 A;  1B7Y B;  1QVF A;  4LF6 Q;  4A3E G;  4IOC A;  5JJI A;  4QJF A;  4R4I A;  1VQC A;  3CCR A;  3GTL H;  1TXY A;  2E8G A;  1FJG L;  5BR8 Q;  4DR2 Q;  3TS0 A;  1P16 A;  2D0O A;  1VQA A;  2R7Z H;  4C2M H;  4PMW A;  5IYB G;  1A63 A;  1YHQ A;  1CKO A;  1OXV A;  1VQE A;  4MZ9 A;  4DUZ L;  1PH6 A;  4DR7 Q;  1EFW A;  4IFD J;  3CMA A;  4O2D A;  2RHQ B;  4P75 A;  4YCU A;  2UXD Q;  1L2F A;  1QUQ A;  5JEA J;  3S1Q H;  1NTG A;  2BH8 A;  4OWT B;  4LF5 L;  5HGQ A;  3U58 A;  2MQH A;  4DV6 Q;  5M3F G;  3KDF A;  1VQ7 A;  3HOW G;  5M5W H;  3ULP A;  3HKZ G;  2VQF Q;  1A0I A;  4B3R Q;  4HIM A;  4DV5 Q;  4JI2 L;  1PH1 A;  1Q8K A;  4DV2 L;  3UDG A;  3S2D H;  5AJ3 Q;  4YY3 Q;  4JBK A;  1J6Q A;  2PI2 A;  4LF9 L;  1CSP A;  4BA2 I;  1Y14 B;  4DR1 Q;  4JC0 A;  1WCM G;  4FDB A;  1W2B A;  1IBL L;  1YHA A;  3U4Z A;  4DAY B;  1A62 A;  2NVY H;  1VQN A;  2JQO A;  2VS1 A;  2GVB A;  4GOP A;  4UP8 A;  3ZJY C;  2MO1 A;  3HFZ B;  3D0F A;  2H5X A;  2OQ0 A;  3K8A A;  3Q8D A;  4ME3 A;  4X66 Q;  1AH9 A;  3BZK A;  5IP9 H;  1FVI A;  1AE3 A;  1VQL A;  4JI6 Q;  4LF6 L;  1XPU A;  4LUO A;  1HZA A;  3ERS X;  1WJJ A;  4GS3 A;  1YIJ A;  1E3P A;  2K4K A;  5IYC H;  5BR8 L;  4A76 A;  4DR2 L;  3A74 A;  4A3F G;  4NXN Q;  1RL2 A;  3TQY A;  4A3L H;  3PO2 G;  1LM0 A;  4LW1 A;  4AIM A;  4DR7 L;  2IX0 A;  3J81 i;  4LF7 L;  3BZC A;  5ELO A;  3D31 A;  4A3I G;  4OWW B;  3GTQ H;  4JV5 Q;  1LUZ A;  3RR5 A;  4A93 G;  1U5K A;  4RMF A;  3KF8 B;  1Y1W G;  1PYB A;  2UXD L;  1CSQ A;  1PH3 A;  1LYL A;  1PVO A;  3I4N H;  1VQ6 A;  3AYH B;  3K7U C;  4DV6 L;  1IBM Q;  1X65 A;  1SR3 A;  3CAM A;  4IPG A;  2AWO A;  5EAY A;  4JI3 L;  2VQF L;  4B3S Q;  2R92 G;  4JYA Q;  4GLV B;  4B3R L;  3H3V H;  2K75 A;  1PH9 A;  3H3V I;  1X56 A;  3PUV A;  1PH2 A;  1JE5 A;  5AJ3 L;  1YVC A;  3W5O A;  4YY3 L;  3U50 C;  4AQY Q;  2AMC B;  3UE0 A;  4DR1 L;  4J15 A;  1J5E Q;  1TWF H;  3CCE A;  3CCV A;  3CD6 A;  3PGZ A;  3BJU A;  4X64 Q;  2LXK A;  2VUM G;  1T9H A;  4DV1 Q;  1WOC A;  4Y7N H;  4DUY Q;  3RLF A;  4GNX A;  1R9T H;  4A4I A;  2UUA Q;  4JI0 Q;  3S1M H;  5C0X J;  1B70 B;  4X66 L;  5M5Y H;  3M9B A;  1GM5 A;  1UWV A;  4K0K Q;  4JI6 L;  1GO3 E;  2N3S A;  5H1S E;  1YJ9 A;  3PO3 G;  4DR5 Q;  4X65 Q;  3OTO Q;  1L1O A;  4HJ9 A;  2Q2H A;  3S16 H;  1I6H H;  3A0J A;  1SRU A;  3A5U A;  2QGQ A;  4R4Q A;  2R6G A;  1EIY B;  4JI1 Q;  2WB1 G;  2JA5 G;  4A3D G;  1YHB A;  1XNQ L;  1JB7 A;  4YCW A;  1VQ4 A;  4JV5 L;  2K5V A;  5M3M G;  4C3I H;  2VNU D;  1CKM A;  1MJC A;  3PUZ A;  3EN2 A;  1HJP A;  3ICE A;  2IT1 A;  3TS2 A;  1IBM L;  1Q46 A;  2MO0 A;  3PV0 A;  2KEN A;  4GLA C;  4B3S L;  1VQJ A;  5FJ8 G;  4JYA L;  2RF4 A;  3KF6 B;  1M90 C;  5HY6 A;  2E2J H;  1WI5 A;  3CC7 A;  3HOZ G;  2VQE L;  3S17 H;  4IO9 A;  4AQY L;  2JA8 H;  2BA1 A;  3CW2 C;  5K36 G;  1EIF A;  1VQD A;  3PUW A;  2F4V Q;  1J5E L;  3RLN A;  3ULL A;  4BA1 I;  1SN8 A;  2XGT A;  2PNH A;  3PCO B;  4YHH Q;  4DPG A;  4L5Q A;  4X64 L;  3OW2 A;  2F3I A;  3CCM A;  4DR3 Q;  2WAQ G;  4KI0 A;  4AYB E;  1YJW A;  1NJI C;  2R7Z G;  4DV1 L;  4Y52 H;  4KLK A;  4DUY L;  1XTD A;  4A75 A;  3LGJ A;  3CC2 A;  4B3M L;  3KJO A;  3K80 C;  5GAD C;  2UUA L;  4JI0 L;  4JBW A;  4PZ6 A;  4DV4 Q;  2ID0 A;  4K0K L;  1X6O A;  1G29 1;  2L15 A;  3PSI A;  4PG3 A;  4DR5 L;  4X65 L;  3OTO L;  3W1G A;  2IY5 B;  3S24 A;  4JBM A;  3J81 c;  1X3G A;  1SLJ A;  1KD1 C;  1H95 A;  3HOU H;  1B8A A;  2B29 A;  3K7A H;  2K50 A;  1I3Q H;  4LWC A;  4HJ5 A;  5GAH C;  1X3F A;  2I5M X;  1O7I A;  1JMC A;  4GLX A;  4IPH A;  3L2P A;  1D7Q A;  5C4J H;  1Q82 C; 
#chains in the Genus database with same CATH topology
 5E3F A;  4A3K B;  1IYU A;  2JE6 I;  3MXN B;  1ML0 D;  2AQ4 A;  3W1B A;  4Q0Y A;  1HCZ A;  1IYV A;  5IP9 G;  2XN9 C;  2WB1 A;  5FO8 B;  1QWY A;  5IWA Q;  4LF8 H;  2IW3 A;  3TIN A;  5IYC G;  1QNU A;  3R2T A;  1B53 A;  3EPG A;  1STG A;  2NVY B;  5FK9 C;  2H1E A;  1EOV A;  1EQR A;  3V05 A;  4ABN A;  1M6V A;  5EWF A;  3IRB A;  2Z6K C;  3KLS A;  1QNK A;  4A3C H;  4LFC Q;  2LFN A;  3OHX C;  5IGC A;  2NWG A;  2N55 A;  1X54 A;  5KG0 A;  1OTC A;  2YRX A;  2CZG A;  2I5H A;  2K04 A;  2C9O A;  3G8C A;  2R7Z A;  4R4C A;  3A7A B;  4C2M A;  3RGX A;  2Y0S E;  4DAV A;  3M9O B;  3VR2 A;  5KT3 A;  3A8K E;  4RGM A;  5FLM H;  5CV5 A;  2R86 A;  1VF5 C;  3KK7 A;  1C30 A;  3WWV A;  1IL8 A;  4U68 A;  2R3Z A;  1HFN A;  2DJF C;  4N9T A;  4O3N A;  2V4D A;  2D5D A;  1TWF B;  2B2U C;  4EGJ A;  1QZG A;  1PH7 A;  1VQ9 A;  2K01 A;  1KLG D;  4OIJ A;  5IY0 A;  1R9T B;  2NVY A;  3LML A;  2ZTE A;  2UUB Q;  2DWC A;  1BDO A;  5AFW A;  5M5Y B;  2DGY A;  1WTH A;  3KJP A;  4C3H H;  2F3W A;  1H9K A;  4C56 C;  5DAU A;  2B63 H;  2UXC H;  4NXM H;  3C1F A;  5GRO A;  1VQK A;  2X69 A;  4I4T F;  5KNC A;  4J0M A;  1U4P A;  1DD2 A;  3KLW A;  1SMX A;  5F2D A;  2FMM A;  4JOI C;  1IW7 D;  2RSO A;  4ZKC B;  1NY4 A;  1DZ1 A;  2ASL A;  4DR4 H;  1EQT A;  5LMU Q;  4O3P A;  2XIG A;  4B3M Q;  2JA7 B;  5LMN H;  5BPH A;  2JA8 B;  3K5H A;  1PV4 A;  2PMZ B;  5F9N A;  1LO5 D;  5HUR A;  4KHP L;  1M4V A;  4MV1 A;  1KNA A;  1TWF A;  3TDQ A;  3MEF A;  2EYP A;  2L55 A;  1IBK L;  1ILP A;  3J80 i;  4DV5 H;  1R9T A;  2NZH A;  1MIU A;  4FXD A;  2R84 A;  3SK4 A;  2QDL A;  4DV7 L;  1B6R A;  3HOV H;  4UCR A;  3K5N A;  3HOX G;  1TT2 A;  2MJ8 A;  3AEV A;  3TQT A;  2BH2 A;  4DKA C;  4ZUJ A;  3T1H L;  1JB3 A;  4QW9 A;  1CHP D;  3TRE A;  4LFA L;  2WP8 J;  4MA0 A;  1I3Q B;  4B3T H;  3NTH A;  3RNU A;  3NQT A;  2Z6K A;  2PW7 A;  5C4J B;  4ME5 A;  1TS2 A;  2Z4I A;  1LTI D;  2GN5 A;  4H13 C;  2NVQ H;  2JEF A;  1R4Q B;  3H0G B;  4K14 A;  2HVR A;  2M9V A;  3RV3 A;  3GTG H;  1PFB A;  2NVT B;  3G6Y A;  4UDU C;  2NYZ D;  1EY0 A;  4BBR B;  3G6E A;  3BA9 A;  4MIU A;  1RYS A;  1I50 B;  4XDX A;  5HBR B;  2M05 A;  3A8J E;  4A3M H;  2WAQ E;  4UCS A;  3NXW A;  5I6W A;  1SYF A;  1T3N A;  2PI2 E;  4R8U A;  1RKN A;  3UDI A;  5M5X B;  3TP5 A;  1LTT D;  1PTO H;  5C4H A;  4BBS B;  2EXD A;  5FLM G;  4YAJ B;  2B2U A;  2R93 B;  2E5L Q;  2ATW A;  3JAM L;  1AFP A;  1TS4 A;  4O4L F;  3S1R H;  1DGS A;  4LF8 L;  3T4A C;  3TSS A;  5KYL A;  1Z2N X;  1E2Z A;  1IZ6 A;  2RVL A;  3KAJ A;  3TME A;  1I3Q A;  1JIH A;  2W6Z A;  3H4B A;  3E9I A;  3WNZ A;  1HNZ H;  4ED6 A;  2L9H A;  4DV0 Q;  1GUW A;  3N43 B;  4DR6 H;  4UPA A;  1G2S A;  5C4Z A;  4DL5 A;  4B9W A;  4RB3 C;  1TWA H;  3RMH A;  1DXM A;  2NN6 I;  2QA4 A;  2FJZ A;  1E4F T;  3RB4 A;  4C3H G;  1IKM A;  4OON A;  5DEH A;  4DLK A;  4ETS A;  3I4N G;  5EWE A;  3PW2 A;  4JOI A;  1E4E A;  2E75 C;  3MZ5 A;  5E4X A;  5FJ8 H;  2WFW A;  4QL5 A;  1K8G A;  1I50 A;  4LMY A;  2Z0S A;  1YJN A;  1SYG A;  1Y8N B;  3HG9 A;  4IZ8 A;  3B6Y A;  3BQ1 A;  3P1H A;  5C0X G;  1LT3 D;  1HZ9 A;  2ZTD A;  1JWM D;  3SI8 A;  1UE6 A;  2B2T C;  2I5L X;  1PFS A;  2R93 A;  2AGP A;  5H80 A;  2Y0S G;  1C8C A;  5E4W C;  1M0W A;  4IRD A;  4IAL A;  2F0I A;  2A68 D;  4F87 A;  1QCB D;  2NUC A;  1XMO Q;  1JJG A;  1K83 B;  1RTN A;  5D14 A;  5EWG A;  4CGY B;  2L5T A;  1S9F A;  3MHB A;  1HR0 Q;  2BE5 D;  1JC7 A;  5C44 B;  2UXC L;  4NXM L;  4UP7 A;  4U67 3;  5KFL A;  4RFB A;  3DM1 A;  3HOV G;  3HB9 A;  3KAL A;  2O4X A;  1SE3 A;  2YW2 A;  5A2Q W;  4TQU S;  3Q8P B;  2P5Z X;  2FXQ A;  2K5H A;  3F1Z A;  5EPL A;  4DR4 L;  1I4G A;  3PUY A;  4K5X A;  5L1L A;  3CU7 A;  1U9R A;  1UE7 A;  2MFI A;  5LMN L;  2CQA A;  4YQW A;  3LX0 A;  2ZDQ A;  2LS0 1;  1K8M A;  4IPC A;  5HV6 A;  3DLL A;  3Q24 A;  2W70 A;  2K6A A;  4TSS A;  1AN7 A;  3R5H A;  5DM7 3;  4LF7 H;  2BDN A;  2GLT A;  1ICW A;  3RFC A;  2F52 A;  1MHW C;  1U0L A;  5IOC A;  1N32 Q;  3Q1K A;  4U7C A;  4A3M G;  4K6L A;  4DV5 L;  4J9O A;  3CME A;  3HRZ C;  4OGQ C;  1YZ6 A;  1MJE A;  4GKJ Q;  3GTM H;  2KEC A;  3V4Z A;  1WCM H;  4RZR A;  5CYU A;  4FNF A;  1HTP A;  4LSX A;  3STB D;  4QIW B;  3F2C A;  2VZA A;  1WTX A;  2QEJ C;  4QWD A;  4B3T L;  4BY7 H;  1HH2 P;  5L1K A;  1IYJ B;  2EYJ A;  1P8L A;  3T56 B;  2WB1 E;  3OYY A;  3K5L A;  2EVB A;  2VA3 A;  2B8G A;  4X66 H;  4HMI A;  4GOP C;  4QWA A;  1W93 A;  3SE0 A;  2Q2T A;  2XTI A;  4HJ7 A;  1N34 Q;  1KJJ A;  2RDH A;  2J6U A;  1JLL B;  1XMQ Q;  2FIN B;  4I65 A;  3PF4 A;  3GLK A;  3FKI H;  3VDY A;  2EDG A;  5CA0 F;  3CP0 A;  3SEB A;  1WTR A;  1JWU D;  1O7Z A;  3CF5 A;  2PVP A;  4OWX B;  4HIK A;  2EZV A;  1YEZ A;  2CQY A;  4O3S A;  1Y1V B;  2B3G A;  1X9N A;  2NUA B;  3K0X A;  1RD9 D;  4QUC A;  2ASJ A;  1QVC A;  1D5X C;  2OCE A;  3EFX D;  4YWL A;  2AUJ D;  2B2T A;  1YBY A;  3RZO H;  3OHB A;  2OT2 A;  5T1I A;  3AFQ A;  3FDS A;  4MA5 A;  2WDT A;  4ED8 A;  4DL4 A;  1JX4 A;  4RNN A;  1OXT A;  1XPO A;  1BQQ T;  4KHZ A;  2W9B A;  1KQS A;  1G91 A;  1E7Z A;  1WVL A;  1SFO H;  5E7N A;  1PTO D;  2N78 A;  3N8D A;  3MTS A;  4QIW A;  5DG8 A;  4JCV E;  3HOZ B;  2F0P A;  3GTL B;  3NPP A;  1K9M C;  1HNZ L;  4LF5 Q;  1FNU A;  4DR6 L;  2MPM A;  4JI0 H;  2L1B A;  1DOK A;  2VPS A;  5C4X B;  3JAM W;  3RGZ A;  2W6Q A;  3BQ0 A;  4XQJ A;  4EX5 A;  5C3E G;  4M1U B;  3NHH A;  1WTP A;  4IUU A;  3GTJ A;  3NBH B;  4LF9 Q;  3T13 A;  4A3D H;  3U9T A;  2KQ3 A;  1Z47 A;  1L1O C;  3MXU A;  4TVA B;  1M0T A;  2XCL A;  1TWC B;  1YNN D;  1V1Q A;  2RDF A;  4WD3 A;  4GOP B;  4MV3 A;  4IUQ A;  1WFQ A;  4J9S A;  2I0Q A;  4KKT A;  1Y1V A;  4N9P A;  1PA6 A;  1B7Y B;  4B08 A;  2Z8L A;  1VMP A;  4QJF A;  3CCR A;  1KLU D;  5FD5 A;  3PQI A;  1GGO A;  1I6V C;  2VA2 A;  1GOZ A;  5BR8 Q;  3PW4 A;  5L1I A;  2AU0 A;  1ICF B;  1TS3 A;  2JXM B;  2R7Z H;  4C2M H;  4PMW A;  4ECW A;  1CKO A;  1OXV A;  1VQE A;  4DR7 Q;  2Q8I B;  2YL2 A;  4YHH H;  4IFD J;  4A3B B;  2R7K A;  3IL8 A;  2RHQ B;  4A3E B;  4YCU A;  3GTO B;  1QUQ A;  1CHQ D;  3U58 A;  2MQH A;  2C2E A;  2DZD A;  1F2L A;  3RB3 A;  1BR9 A;  3QZ7 A;  4UCT A;  1HRJ A;  5C8Y F;  1A0I A;  2XSC A;  1IOV A;  2EY6 A;  3VA5 A;  4EG0 A;  4HCS A;  5IGD A;  4ECY A;  3NBH A;  2WAC A;  1QG7 A;  3N6R A;  1WCM G;  4FDB A;  1CQJ B;  2C00 A;  2XVS A;  2W6O A;  2IJ0 A;  3IKJ A;  5EGT A;  4NMZ A;  1TWC A;  4C5A A;  2NVY H;  2DLN A;  2VB2 X;  4GOP A;  3ZJY C;  4EBC A;  3Q8D A;  3HFZ B;  2H5X A;  4ME3 A;  2I46 A;  2CW0 C;  3BZK A;  1FVI A;  1AE3 A;  3WOF A;  4YR0 A;  4QB4 A;  4FS2 A;  1HZA A;  3ERS X;  1NR4 A;  4GS3 A;  2YU9 B;  3PIO 3;  2VPQ A;  3DMU A;  4A76 A;  2BR0 A;  3A74 A;  3TQY A;  2XNA C;  5JVG 3;  1D6E C;  1NSN S;  4GC6 A;  2D9U A;  2IX0 A;  4LF7 L;  1ZKO A;  1X32 A;  4JV5 Q;  2F4I A;  4A93 G;  3KF8 B;  3QOL A;  3E6Z X;  1IOW A;  3I3C A;  3EVQ A;  1VQ6 A;  3GTO A;  4DXF A;  1SR3 A;  2MCT A;  4B3S Q;  5EAY A;  3E5N A;  3DUZ A;  3N6X A;  2F0T A;  4H44 C;  1PH2 A;  4A3I B;  4FP5 D;  5EQ0 A;  3PIP 3;  1TWF H;  3CCE A;  2FK3 A;  3CD6 A;  4X64 Q;  3RTX A;  4TV8 F;  4ZOL F;  2R92 B;  4DV1 Q;  1GXD C;  1WOC A;  4Y7N H;  3RLF A;  1R9T H;  2UUA Q;  2HHH H;  5NUC A;  4X66 L;  5M5Y H;  3R3O A;  4BWS C;  3F2U A;  3MWE A;  1K8O A;  3N42 B;  1CQV A;  5D65 A;  1L1O A;  4H0L C;  1QIL A;  4DV3 H;  1MI2 A;  5I47 A;  3A0J A;  2YU9 A;  1SRU A;  3N40 P;  2QGQ A;  4R4Q A;  2R6G A;  1EIY B;  2WB1 G;  4A3D G;  1YHB A;  2F0K A;  1XNR H;  1XNQ H;  4IWY A;  3KF8 A;  3VPB A;  1BGW A;  4GLA C;  3PV0 A;  2FMA A;  3O13 A;  4C1N K;  2PZU A;  3KF6 B;  3L4K A;  2JA5 B;  1CM9 A;  1N36 H;  3CC7 A;  3MEH A;  1PFM A;  1HA6 A;  3PR4 A;  2JA8 H;  3UQ8 A;  4JI7 H;  4K2K A;  1FKA H;  4QWC A;  2V4R A;  2SOB A;  4MHE A;  1VBH A;  2WYO A;  2XCA A;  1KDC A;  3X3M A;  1X3P A;  2R7Z G;  2F0H A;  4KLK A;  3CC2 A;  2R92 A;  3K80 C;  4JI0 L;  5LYJ F;  4JBW A;  4PZ6 A;  4EYI B;  2ID0 A;  1A3V A;  1G29 1;  2A6H C;  4F50 A;  1F9R A;  4RKL A;  5LA6 F;  5DQH A;  5KNB A;  3S24 A;  4PNY A;  1X3G A;  1KD1 C;  1EY8 A;  2IWH A;  1Q3L A;  1MGS A;  4PMC A;  3FRP B;  1I3Q H;  4ZCK A;  4L8J A;  1JMC A;  1O7I A;  2EY1 A;  2F3V A;  1D7Q A;  2WTF A;  5C4J H;  3Q8R B;  1ZYR D;  2HCC A;  1IXR A;  4JI8 H;  3D3R A;  1S40 A;  1BUV T;  3S2D B;  2XWB B;  3KF6 A;  2Z4H A;  2JA5 A;  4IOA A;  4IFD I;  1HXY D;  1TY0 A;  4R8I A;  1JJ2 A;  1RF2 D;  5C1P A;  4YHH L;  2KCM A;  1I50 H;  3MJF A;  1VQP A;  2F0G A;  2IX1 A;  5KFZ A;  1J9O A;  1HQR D;  2BA0 A;  2ZDG A;  1ENF A;  3J7A V;  1MZB A;  4O3O A;  1V51 A;  5M5X H;  3F8N A;  2PPB C;  4BBS H;  3VR3 A;  2GA4 B;  4ZUI A;  1X55 A;  3G6J B;  4HID A;  1G6P A;  1AE2 A;  3BDC A;  2R93 H;  4HAE A;  2R8G A;  1R4P B;  3ITP A;  5ELE A;  5D3I B;  3PF5 A;  3BAA A;  1GKH A;  1L0X B;  3I4M H;  3R2I A;  2LKV A;  4RGT A;  2E2I B;  2F0V A;  4X3U A;  1KDA A;  5KFT A;  1LTA D;  2J0T D;  3GDE A;  4EFE A;  2KHS A;  2ZT9 C;  1OXS C;  2V5A A;  3M4P A;  1JOK A;  4PDB A;  3NK9 A;  2FB9 A;  4KHP Q;  1Z6H A;  3VYU A;  2CHB D;  5C5L A;  4R4T A;  3NEN A;  4RKB A;  5FO7 B;  2YYA A;  1IBK Q;  3C3L A;  1ESF A;  1VQH A;  4EBD A;  2JEB I;  2JEG A;  1NAP A;  2YV5 A;  2HDL A;  3GV7 B;  1G8Z D;  2NB0 A;  4L63 B;  2EE1 A;  3CQZ B;  5J2U F;  4X62 H;  1EQQ A;  4B9X A;  3L9A X;  1BKB A;  4IWX A;  5KIX A;  3S16 B;  3T1H Q;  1EZ1 A;  4R7R A;  1XXG A;  4JW0 A;  4LFA Q;  1S0N A;  2PZT A;  1QVG A;  3K3V A;  5DGA A;  2B2V C;  3K5O A;  3D4D A;  4YB8 B;  1HZB A;  3KYH C;  2F0S A;  2HHH L;  2W9C B;  1I4Q A;  2E2I A;  4QIW E;  4PZ7 A;  5IOD A;  1HR0 W;  1KAB A;  2CWA A;  4RAY A;  5C44 H;  1TA8 A;  4G7Z C;  4DV3 L;  5DNF A;  2FKL A;  1KAW A;  4JBJ A;  2EYO A;  1JOQ A;  1BBU A;  4RNM A;  3NEM A;  1QOH A;  2YYZ A;  2FPP B;  3S9W A;  1SNC A;  2QEX A;  1TWG B;  1XNR L;  4IRC A;  2NZO A;  1I7L A;  4FF2 A;  4TQR A;  3R93 A;  2QIL A;  3HOY H;  3BZD B;  3OW7 A;  1N36 L;  2A8V A;  4MV9 A;  5FLX W;  4RU9 A;  4KKU A;  2UXB L;  3D6W A;  4JI7 L;  3HOU B;  1VQ8 A;  4LF8 Q;  3K7A B;  2DN8 A;  1SCU B;  1CKN B;  4P72 A;  1LTB D;  1B1Z A;  3MWY W;  4GKK H;  4RCO A;  2UU9 H;  5DQI A;  2HUG A;  1EWH A;  2D62 A;  4OEM B;  4G7O C;  2JEI A;  2W9C A;  1SMY C;  2CWP A;  3FEW X;  2W6P A;  5FPR A;  5KFW A;  4ED3 A;  1HZC A;  4BBS G;  4CKC A;  3MR6 A;  2B39 A;  1TWH B;  5JVH 3;  3UDF A;  3I56 A;  4IR9 A;  4X3S A;  3I4M G;  3ND8 A;  4EEQ A;  2K5Q A;  5DG7 A;  4YR2 A;  1M7J A;  4LFB H;  5J3B A;  3I7F A;  3GQB A;  4NDX A;  4JI8 L;  1VQM A;  3Q0A A;  3BU2 A;  1SRO A;  3ERO A;  5BN4 A;  3GTJ H;  2N49 A;  4HN7 A;  1WSC A;  4JV2 A;  4JG2 A;  5FLX c;  1ZHS A;  1KBL A;  5ISR A;  2CCZ A;  3NTI A;  1SNP A;  3KDF B;  1VF7 A;  2EXZ A;  4JV1 A;  5IT9 c;  1GUN A;  1Q1B A;  4EEY A;  1Z7T A;  1CKN A;  1Y1V H;  3MFG A;  4GNX C;  4CHT B;  1KRT A;  3E3X A;  1SEI A;  2FFK B;  1NBW A;  3S15 B;  4Q43 A;  4MTK A;  2HIX A;  1K8A C;  2NN6 H;  3P75 A;  2UXC Q;  4LMQ D;  4NXM Q;  4JI1 H;  2ATL A;  2B2V A;  5D1P A;  1Y8P B;  4UP9 A;  1PH8 A;  3NE5 B;  1TWH A;  1WTW A;  3BG5 A;  3H94 A;  2LXJ A;  3KHL A;  3J80 c;  4O0A A;  4WFN 3;  5F9L A;  5EZY F;  3HOZ H;  4HIO A;  4J9L A;  1KL9 A;  4DR4 Q;  1PK8 A;  1ZHQ A;  1RYR A;  2R8H A;  4NB3 A;  5GAG C;  5C4X H;  2QDB A;  5LMN Q;  3P7J A;  4DK6 C;  1RJR A;  1BNZ A;  2JN4 A;  3MR3 A;  1IL2 A;  3BA8 A;  1FJG H;  2FLP A;  4PWQ A;  3MXN A;  1I5F A;  5DLQ E;  5C44 G;  1EEI D;  1G6Z A;  5LL6 S;  4XQN A;  1S5E D;  1TWC H;  1SYX B;  2HVQ A;  1EYC A;  3ND9 A;  2ALZ A;  1SNQ A;  4BY1 H;  4ME6 A;  2Q8T A;  3G7L A;  2L0C A;  4HNT A;  2JEJ A;  2CQO A;  3V6J A;  4X62 L;  2ALY B;  4DV2 H;  4ZQ3 A;  1LTS D;  2VW9 A;  2EYH A;  3HKZ B;  4GNX B;  4APV A;  3HOY G;  2FK1 A;  4K2L A;  4B3T Q;  5IYD H;  1H9R A;  3K3P A;  1GHJ A;  2FHT A;  1VQG A;  4A3B H;  4NPS A;  4A3E H;  3GTO H;  1LT5 D;  1KRS A;  4LF6 H;  3N52 A;  1HNX Q;  4KK7 A;  5KFV A;  5COR A;  4MNO A;  1KAA A;  4DR2 H;  3GII A;  1VQI A;  1S3O A;  4RZQ A;  5KFJ A;  4EQN A;  3L7Z C;  5I4D A;  2VR1 A;  3MWM A;  3BQ2 A;  4QWE A;  4O4H F;  1SSO A;  4P74 A;  1LT6 D;  3AFP A;  2AKW B;  3Q8Q B;  4ILW A;  3CCS A;  4DV6 H;  1KTK A;  3FPP A;  2VQF H;  3PW7 A;  2KJX A;  5C3W A;  3QO2 A;  2IHF A;  2EYM A;  3CHB D;  2CFM A;  4YY3 H;  2YU9 H;  4RGO S;  1EZ6 A;  1S0M A;  4DR1 H;  1TII D;  2R7L A;  5KFK A;  3PUX A;  2HQL A;  1HPC A;  1Q81 C;  2PN1 A;  3RD4 A;  1SJH D;  1CQF A;  2SNM A;  1HNZ Q;  2YS7 A;  1VS0 A;  4DR6 Q;  3S1N B;  4GKK L;  1EWI A;  3DF7 A;  2UU9 L;  3ER0 A;  4RAZ A;  1DV1 A;  5BPF A;  3J81 W;  1Y1V G;  4RG1 A;  4POG A;  2Z6B A;  3RBD A;  3EA6 A;  1KC7 A;  4JI6 H;  1FL0 A;  4CKE A;  3N41 B;  2DPI A;  1B44 D;  2TSS A;  2YZM A;  1PZJ D;  4K6D A;  2NN6 G;  4A3I H;  3QZ8 A;  1SYC A;  4A3C G;  3M3Y B;  3PO3 B;  2JA7 A;  5J1Z A;  2RQX A;  1V1P B;  1HUM A;  3J7Z C;  3M85 A;  1N9W A;  4AYB G;  2PMZ A;  3MA2 B;  2R92 H;  4JV0 A;  3VR6 A;  5CA1 F;  5GAE C;  3UI2 A;  4UHV A;  1IBM H;  3JZI A;  4OL7 A;  4I55 F;  5K5P A;  4LFB L;  1K0S A;  4L1K A;  4XQQ A;  4DL2 A;  5M3M B;  3T5J A;  4KJN A;  2BQ3 A;  4AQY H;  1ET6 A;  1T5X D;  5C4X G;  5EJW A;  4IR1 A;  1J5E H;  5EDW A;  1AEX A;  1V4Y A;  3FHW A;  1D5M C;  3JRX A;  3OSN A;  4C3J H;  1Y69 U;  1FD7 D;  1V43 A;  4DUY H;  1T36 A;  4ECX A;  3CVZ A;  4U6P A;  4B3M H;  2OLS A;  3LWU A;  4K0K H;  2A5H A;  2KVM A;  2WKD A;  3F2D A;  1EUJ A;  4BY1 G;  1PYS B;  1EIG A;  1U4M A;  4DR5 H;  4X65 H;  3OTO H;  3BDL A;  4JI1 L;  2JA5 H;  1DOM A;  3QB3 A;  3H0G A;  3V4S A;  4I7A A;  4IJL A;  3H15 A;  4KKS A;  1SND A;  4CDF C;  2O03 A;  3CPF A;  2B63 G;  1B6S A;  3GV8 B;  2Z9H A;  4JUZ A;  2WKC A;  5IYD G;  2YZN A;  2RDJ A;  2CH4 W;  4KY6 A;  1I4P A;  1B9N A;  2ZJP A;  4A3B G;  1K3B C;  5L1J A;  2F0L A;  2J6T A;  1UC9 A;  4A3E G;  5KFD A;  5DG9 A;  3G6X A;  5JH7 F;  1CTM A;  5JEA H;  1FJG L;  3TS0 A;  3DWQ A;  1H9S B;  1I4R A;  1SYB A;  3RUP A;  4TQS A;  1A15 A;  3AMU A;  4FS1 A;  1A63 A;  1SE4 A;  2XGP A;  4DR3 H;  4P75 A;  2A69 C;  1L2F A;  5JEA J;  2Q8R E;  1N33 H;  5HGQ A;  1VQ7 A;  1EY5 A;  5KG7 A;  5JUM A;  3HGB A;  2Z1C A;  4DV2 L;  3UDG A;  4O3R A;  1STN A;  3S2D H;  3GTK B;  4CC6 A;  3EJI A;  4F4X A;  1Y14 B;  4K8J A;  2W9A A;  3OIP A;  1OO9 B;  3Q2O A;  1JXL A;  1GJX A;  3NTK A;  2QKI C;  5KFQ A;  5KFR A;  3U4Z A;  2HQE A;  4DAY B;  3E5S A;  5KG3 A;  1GUO A;  2F0E A;  4QWB A;  2OQ0 A;  4X66 Q;  1AH9 A;  2YRW A;  4KN7 C;  4CDE C;  2XC9 A;  4LF6 L;  3OSP A;  3NWT A;  3BAB A;  5DLG A;  2DY8 A;  1XPU A;  3CRK C;  3TBI B;  4DR2 L;  1CA6 A;  4X3K A;  1RL2 A;  5EBD A;  3BYT B;  1H9S A;  4LW1 A;  4F4W A;  2M2L A;  3J81 i;  2UUC H;  3BZC A;  5ELO A;  4A3I G;  3BS1 A;  4OX9 H;  1F2Y A;  1LUZ A;  4ZAI A;  3RR5 A;  3GIL A;  1GYF A;  1NUC A;  1SJE D;  4NLG A;  1CSQ A;  1PH3 A;  1LYL A;  3A56 A;  3AYH B;  3K7U C;  4DV6 L;  2E2I H;  1X65 A;  3IN5 A;  2VQF L;  2R92 G;  4GLV B;  2K75 A;  1PH9 A;  1X56 A;  5DLF A;  1K83 A;  2CVR A;  3KBX A;  3LWE A;  5C3X A;  4A2A A;  1YVC A;  4YY3 L;  1CE8 A;  4FBU A;  1GUG A;  4DR1 L;  1Y1W B;  4FF4 A;  3GTK A;  1LTR D;  3BVZ A;  3V2T A;  5IT9 E;  4JVZ A;  4NKL A;  4DU9 A;  3CRL C;  2R8K A;  4DAY A;  5KFS A;  4JI0 Q;  1B70 B;  4C3J G;  4O4I F;  3S17 B;  5KFA A;  1GM5 A;  1UWV A;  5EOY A;  4EBE A;  4JI6 L;  1EWC A;  1DOL A;  1E4G T;  2RBM A;  3FMC A;  4HNV A;  3T51 B;  2F0Q A;  4ID6 A;  4HJ9 A;  2VUM B;  1LLR D;  4DN4 M;  3S16 H;  4ECT A;  3NP8 A;  3D4W A;  4XYQ A;  5J22 A;  2JA5 G;  3JRW A;  3I70 A;  1V8Q A;  2EYF A;  3RBE A;  1JB7 A;  3J80 E;  1VQ4 A;  3MVV A;  1MJC A;  1EUD B;  4M7E A;  2NTT A;  3EN2 A;  2MGS A;  3ICE A;  3TS2 A;  1IBM L;  1Q46 A;  2KEN A;  2L4N A;  5FJ8 G;  3TP8 A;  3A55 A;  2RF4 A;  3RZD B;  4WOR A;  2E2J H;  4EFB A;  4AQY L;  2BA1 A;  3DWP A;  1J5E L;  1ESR A;  1SN8 A;  3PCO B;  4YHH Q;  3HOX B;  3OHA A;  1Y1W A;  2O2L D;  4TRD A;  2F3I A;  3CCM A;  2WAQ G;  2XRS D;  1BF4 A;  4FXG C;  4DUY L;  1XTD A;  4A75 A;  4B3M L;  2F0F A;  1S5F D;  4DF7 A;  4HSP A;  4EYH B;  1SYE A;  4CDC C;  4J9M A;  4LJZ C;  2VQD A;  4K0K L;  1SDF A;  4DR5 L;  1PXU A;  2CW0 D;  4PV1 C;  3W1G A;  2F0U A;  4X65 L;  3OTO L;  4HQ6 A;  3GP7 A;  1O7Y A;  4FBT A;  1C4Q A;  2KOL A;  2VUM A;  3HOU H;  1MSH A;  3K7A H;  5KFB A;  2AQ1 B;  1ENA A;  1DCZ A;  4HJ5 A;  1X3F A;  4H7B A;  3S1Q B;  3IG0 A;  4GLX A;  1BBX C;  4IPH A;  2C2D A;  2JP1 A;  1S68 A;  3MR5 A;  4H02 A;  5M5W B;  1STY A;  3CPW A;  2SCU B;  1OXX K;  2VY3 A;  5K2M A;  4HJA A;  1CT1 D;  2OQK A;  1D8L A;  4RH6 A;  2HT1 A;  4IFD H;  4QCL A;  4APM A;  1NMG A;  4XYL B;  3NWS A;  3BVG A;  1O78 A;  1TWH H;  5CBA E;  4DR3 L;  3I4O A;  4KMU C;  1M1K C;  4YJ2 F;  4YWK A;  2AUK A;  1N33 L;  2ZTC A;  3MXG A;  3DXJ C;  1I94 H;  4K5W A;  1ASZ A;  1XWE A;  4A3G H;  4TV9 F;  2IBK A;  3D6C A;  3GTL A;  3H4D A;  1K1S A;  4A3K H;  4JI3 Q;  1PFN A;  1Z2P X;  1DIK A;  3QOJ A;  4LUV A;  1KIX A;  4F7X A;  3JAM c;  5G3L F;  2R85 A;  4FM9 A;  4C3H B;  4CKB A;  2NU6 B;  2OF1 A;  3ORR A;  3I4N B;  5FO9 B;  4MTN A;  1PZI D;  3HKZ E;  4HNU A;  4LF4 H;  1L0Y B;  4FF1 A;  1FGB D;  3ZYY X;  4BY7 G;  2BQU A;  1F9Q A;  1PRT C;  3SK6 A;  3Q22 A;  2RGV A;  4DV3 Q;  2D2C C;  4LUZ A;  2VUG A;  3KTM A;  3URY A;  3QR8 A;  3JC6 6;  1EYG A;  3H91 A;  2UUC L;  1JQY D;  3SDZ A;  4OX9 L;  1EEF D;  4LK1 C;  2E74 C;  1XNR Q;  2FPG B;  3S1M B;  2KCC A;  4R9W A;  1B9M A;  1XNQ Q;  1K73 C;  3FKI G;  1BOS A;  2HDM A;  1UE1 A;  2F0M A;  2KCT A;  2PMZ E;  5LMN W;  1N36 Q;  4K5V A;  3GIP A;  4MN3 A;  4JI7 Q;  3NEL A;  2A6H D;  4ZKB B;  2BOS A;  1E0B A;  2R7D A;  2IMW P;  1I4H A;  2VQE Q;  2ZM6 H;  1VAJ A;  4C3I B;  1WYD A;  1PHJ A;  5ELN A;  2K03 A;  1ZQ7 A;  5L37 A;  1N8R C;  5IYB H;  2EY2 A;  1D1K A;  3TEH B;  5D1O B;  1KHI A;  1BVS A;  1S72 A;  3WDN A;  5BN3 A;  5ELB A;  4HCE A;  2DIK A;  4G4K A;  3HKS A;  3FP9 A;  1UC8 A;  2Q2U A;  5JQW A;  1JR0 D;  5IP7 H;  3AB9 A;  2NVQ B;  1NNX A;  2R82 A;  2Q2I A;  2FLN A;  1N48 A;  1L2Z A;  2EPB A;  1JIC A;  2UVU A;  3GTG B;  4GC7 A;  1PRT B;  1TS5 A;  1AUV A;  3HXL A;  1SBB B;  5KFH A;  2XIW A;  5I2X A;  3BVM A;  3JAM i;  1JKJ B;  2QW7 A;  5TSS A;  5JPN C;  4JI8 Q;  1Q86 C;  2C22 A;  2DPJ A;  3M9M B;  2EIF A;  1XDN A;  4HSV A;  1AP0 A;  4R8N A;  1HUN A;  2JA7 H;  4RA8 A;  2A6E C;  1Y8O B;  3TQ1 A;  2UXB H;  4JI4 H;  4IFD G;  2L11 A;  4FYD A;  1JDE A;  4HR7 B;  2CKZ B;  2HJW A;  4AH6 A;  5BMV F;  3GD7 A;  2UVR A;  4OXP A;  1BCP C;  1C0A A;  5D1O A;  3S1R B;  3T1Y H;  2CW8 A;  5GON F;  4IUN A;  2OWO A;  2KEE A;  3HZX A;  4A3G G;  1GUS A;  4A3K G;  2NU7 B;  4NXN H;  3R5X A;  4HTH A;  4GN3 B;  4RNO A;  1A9X A;  3S1N H;  5KG4 A;  1OXU A;  1TAE A;  3PR5 B;  1QZH A;  1NCV A;  1HNW H;  5DGB A;  5IGF A;  4I7Z C;  1XTC D;  3H0G H;  2H4O A;  5KG1 A;  1ONL A;  4C1N I;  1EYZ A;  4LSA A;  3X3N A;  1ILQ A;  3M3Y H;  2NVT H;  2F1M A;  3OMC A;  4BBR H;  4JI5 H;  3MC0 B;  4KN4 C;  4OHJ A;  1BXT A;  1VQ5 A;  2X6L A;  2FP4 B;  1CQI B;  1VBG A;  5IGG A;  4ED2 A;  2F0O A;  2RHS B;  2HGS A;  1I94 L;  4KD3 A;  4X62 Q;  1MD2 D;  3KUP A;  1E22 A;  5IYZ F;  4IUP A;  1RIP A;  5M3M H;  1CA5 A;  3AQQ A;  3A7L A;  4J9R A;  4IQZ A;  3MFH A;  4XT3 B;  3VYT A;  3I91 A;  1UNS A;  2ICE C;  5ELF A;  5C3E B;  4XZ3 B;  1RDP D;  1BCP B;  2E2D C;  2JA9 A;  5HGT A;  1EY6 A;  2JEA I;  3FPU B;  4Y8V B;  4IUT A;  1E24 A;  1K0R A;  3DM3 A;  4Z9C B;  5A2Q E;  4V0B A;  1F77 A;  1F9P A;  4YIJ A;  3TZD A;  4LF4 L;  3GIK A;  4CJ1 B;  2KA7 A;  1PRT F;  1AZQ A;  1N56 A;  1JWS D;  2KBN A;  1CFM A;  2AWN A;  1PH5 A;  1WR2 A;  2WII B;  4FF3 A;  1EOT A;  1SXT A;  3RLO A;  4DUZ H;  1XJV A;  2E2H B;  2FPI B;  5DQG A;  1PYW D;  5EKI A;  5IP7 G;  5KFI A;  4XTC S;  2K14 A;  3UE1 A;  5M9O A;  1I7N A;  1CK1 A;  5C5M A;  5KFC A;  4OO1 I;  2PNR C;  4JI2 H;  1W96 A;  3KFU A;  4N8X 1;  2I87 A;  2ENB A;  1NMF A;  2XWJ B;  4DV7 Q;  5KRU A;  1SMY D;  1EY7 A;  2G9H D;  2OTJ A;  1IBL H;  2A19 A;  1ROD A;  2ZM6 L;  2NTS A;  2JA7 G;  1DJR D;  1WD0 A;  3GTM B;  1AN8 A;  4GKK Q;  3RN2 A;  4QY7 A;  2DY7 A;  2UU9 Q;  2JA8 G;  4FU0 A;  2N88 A;  1JCK B;  2R7F A;  1AW7 A;  3GQC A;  1TQO A;  1K83 H;  4K8I A;  3OUZ A;  1PZK D;  1EY4 A;  1S5C D;  3S2H B;  3CXC A;  3GTK H;  1D2B A;  4ULL A;  2ZJT A;  1YNJ C;  5JPM C;  2J7Z A;  2E2H A;  1SE8 A;  2KHI A;  1S5B D;  3I55 A;  1K28 A;  2C35 B;  2UXD H;  1GHK A;  5CV4 A;  2AHO B;  2KED A;  4LFB Q;  1B33 N;  1ZXT A;  4B3R H;  4A93 B;  1VQO A;  1U4L A;  2TMP A;  2QF7 A;  1UE5 A;  3CCJ A;  2O5J C;  3CQZ A;  1JJC B;  3H0G G;  2JYO A;  4JI4 L;  1STE A;  5CV9 A;  1SNM A;  4UCU A;  3PW0 A;  2ICI A;  4KTA A;  2YTY A;  4YP3 A;  1BCP F;  4BBR G;  3KXY T;  1KNE A;  1RK5 A;  1TY2 A;  4HMJ A;  1VQB A;  1LAB A;  1SFO B;  3T1Y L;  3C2P A;  1E1O A;  4QGU A;  2ASB A;  1PX2 A;  4CJ0 B;  3GIQ A;  3RV4 A;  2HIV A;  1S97 A;  1BBW A;  4JPB W;  5KT6 A;  5LHY 1;  4RHS A;  1Y1W H;  2IA6 A;  5FKA C;  4A2B A;  5I2Y A;  1EY9 A;  4NXN L;  1OWT A;  2EOT A;  2UVV A;  2R93 G;  2B2W C;  3A54 A;  2JA6 B;  1U4R A;  2WB1 B;  2V1C C;  3JSN A;  1DYQ A;  3Q23 A;  3PN1 A;  1UEA B;  3J7A 5;  2P0A A;  1TWG A;  1HNW L;  4LH7 A;  4JYA H;  4HJ8 A;  4QQB X;  4WJ3 M;  1FJG Q;  5C5J A;  2W7O A;  3CCL A;  3K0Y A;  1V9P A;  2A1A A;  2VUM H;  1JDB B;  3E0J A;  1AZP A;  3KHR A;  4UFZ A;  4JI5 L;  1SEB D;  1E2W A;  3M4O B;  5KKN B;  3KBG A;  4O2A F;  1MSG A;  4WJ4 A;  4P71 A;  5GQO A;  5LXT F;  4DV2 Q;  3L3O C;  3QWN A;  3RZD H;  4A3J B;  4MV7 A;  3OWF A;  1VQF A;  3MR2 A;  3PZP A;  3CKI B;  5JJZ A;  1RTO A;  3HOX H;  2KSW A;  2AQ3 B;  2C5C A;  4GN4 B;  2QK4 A;  5JJK A;  1FGU A;  2VXW A;  2I80 A;  3KHH A;  2AGO A;  1QVF A;  2JA6 A;  4LF6 Q;  1V1O A;  5JJI A;  3GTL H;  4UCV A;  1TXY A;  1GSH A;  4DR2 Q;  1HQM C;  2F0D A;  1P16 A;  2D0O A;  2PO4 A;  2F4V H;  2PQE A;  4DUZ L;  1YHQ A;  4MZ9 A;  5CC4 A;  1F9S A;  1EFW A;  4ECU A;  3CMA A;  3U9O A;  1LV9 A;  4ECZ A;  4G7H C;  2B8F A;  3S1Q H;  5CBE E;  2BH8 A;  4DV6 Q;  3KDF A;  1X3Q A;  5M5W H;  4DV4 H;  2VQF Q;  1DON A;  4CC5 A;  1ULZ A;  4HIM A;  4DV5 Q;  4JI2 L;  5KFU A;  4YY3 Q;  3H6M A;  1J6Q A;  3TIG A;  3I8Z A;  3VA7 A;  4BA2 I;  4DR1 Q;  4RB1 A;  5KT5 A;  3HOW B;  5KEE A;  4KY5 A;  5M3F B;  1IBL L;  2BQR A;  1B4O A;  5J39 A;  2GVB A;  1BJT A;  2MO1 A;  1CZG A;  2IL8 A;  3D0F A;  2FJ2 A;  3K8A A;  3J7Y W;  3RB0 A;  4JI6 Q;  1VQL A;  3D8G A;  2AGQ A;  3RJ0 A;  3KAK A;  4LUO A;  2J4X A;  4BXX H;  2K4K A;  3OSO A;  1BNC A;  1T94 A;  2BCO A;  3P20 A;  4RAU C;  4Y7N B;  4A3L H;  1LM0 A;  3OPO A;  4M8A A;  5LP6 F;  5IWA H;  2RA4 A;  2B2W A;  4AIM A;  5A2Q L;  4EQO A;  3D31 A;  1ENC A;  4DK1 A;  1U5K A;  3FVQ A;  4RMF A;  1Y1W G;  2UXD L;  3FDT A;  2CW7 A;  3SE7 A;  3I4N H;  4QUF A;  1IBM Q;  3RUZ A;  3CAM A;  4ZLT F;  4A3F B;  4J9N A;  4LFC H;  3PO2 B;  4B3R L;  2LY7 A;  3H3V I;  1PMR A;  3PUV A;  1TU2 B;  4OEL B;  3W5O A;  5AJ3 L;  4AQY Q;  3U50 C;  2ZDH A;  2AMC B;  5JVL A;  5COY A;  5C0X H;  1ZET A;  1J5E Q;  5CGK A;  3CCV A;  2K5W A;  4QF4 A;  2RDI A;  2LXK A;  2NVX B;  5KG2 A;  2VUM G;  5KND A;  4IRK A;  1T9H A;  1XYI A;  2RCF A;  5CB4 F;  3HKZ A;  4GNX A;  4DUY Q;  2K33 A;  3RAX A;  5IGE A;  3S1M H;  4NW2 A;  5C0X J;  3ORQ A;  1LTG D;  3M9B A;  4K0K Q;  4E6I A;  4DAP A;  1YJ9 A;  5KT7 A;  4DR5 Q;  4WBN F;  4X65 Q;  3OTO Q;  5KFO A;  4DL3 A;  4R8U B;  3A5U A;  3M9N B;  4P2C B;  5I6Y A;  3I90 A;  3M4Y A;  4TUY F;  4C3I H;  2DNC A;  3PUZ A;  3VPC A;  4RCN A;  2SDF A;  3VR5 A;  2UUB H;  1RCV D;  1HJP A;  1RJP A;  3KHG A;  4DL6 A;  2V58 A;  2A69 D;  1TVX A;  3H09 A;  1VQJ A;  4JYA L;  3MFI A;  2J6S A;  4ZK9 B;  4KY7 A;  3HOZ G;  3S14 B;  1VMC A;  3CW2 C;  1VQD A;  2B2Y C;  3PUW A;  2W7P A;  1O7L A;  3GTP B;  2XGT A;  2W8K A;  2PNH A;  2KCN A;  4DPG A;  3OW2 A;  4DR3 Q;  2LMC B;  4Y52 H;  2NVX A;  5LL6 b;  1N33 Q;  1HNX H;  3MAQ A;  3LGJ A;  5G3L D;  1PLF A;  5LMU H;  2RGR A;  2KUM A;  2O5I C;  1E4E B;  5CV7 A;  4X3T A;  2L15 A;  2XD4 A;  1HTL D;  4NP5 A;  4PG3 A;  3UFX B;  3J81 c;  3RAQ A;  1SLJ A;  3H3V C;  1H95 A;  1IW7 C;  1D1I A;  3KLS X;  1B8A A;  2B29 A;  1WTQ A;  2K50 A;  3RIZ A;  5GAH C;  2BDO A;  2I5M X;  1EYD A;  3NQI A;  3L2P A;  3SHL A;  1H9J A;  1GVP A;  4XIG S;  1V1P A;  3I4M B;  1WTV A;  5IE8 A;  4DK0 A;  3SK8 A;  3L4J A;  1A8V A;  1W6J A;  3WO0 A;  4C5B A;  5DM6 3;  2VB3 X;  2F4V L;  4RB2 C;  4BXX G;  3M7N A;  3VMM A;  2UUC Q;  1YIT A;  4YWM A;  4V19 0;  2K52 A;  4OX9 Q;  4MV8 A;  3GV5 B;  4A3L G;  1NR2 A;  3GTP A;  4FXK C;  1YNX A;  4LF7 Q;  2OEO A;  1EZ8 A;  4DV4 L;  3J7A K;  3MXP A;  1Q12 A;  2PBZ A;  2R7N A;  1QJO A;  3E0E A;  2C2R A;  1VCI A;  2I07 B;  4ODG A;  1EU4 A;  1M8A A;  3R23 A;  3NGD A;  4GN5 A;  2RCN A;  4XT1 B;  2QYZ A;  1Q90 A;  2FE3 A;  2G9D A;  2ZXR A;  3GTQ B;  4XX0 B;  1STA A;  1PH4 A;  3K5I A;  2YCH A;  3BJY A;  4O3Q A;  1SNO A;  5KFE A;  1S4Z A;  1E1T A;  2CH4 A;  4TKO B;  3SR1 A;  2EYL A;  4J9K A;  2ZXP A;  4ED1 A;  1JE4 A;  5JJL A;  3KOJ A;  2FLL A;  2E5L H;  3R8B A;  3SGI A;  5EPJ A;  2XGQ A;  3RB6 A;  1C7Y A;  4ED0 A;  4DL7 A;  5IWA L;  2M00 A;  4IPD A;  5CV6 A;  5C3E H;  4J8Q A;  2PQA B;  3ETH A;  1HFG A;  3KLR A;  4DAM A;  4DNT B;  4DV0 H;  2HVS A;  3NUC A;  4C3I G;  4XXE A;  3C1E A;  4LFC L;  1F2Z A;  1TR5 A;  2B2Y A;  5BN5 A;  2W8L A;  1WH2 A;  1I6H B;  2K1B A;  2NZ1 D;  4QW8 A;  5JVD F;  5A35 A;  1A2T A;  5I9O A;  2K5N A;  2W57 A;  2E2H H;  5FLX E;  5C0X I;  3GTQ A;  3WOE A;  1PDQ A;  3HOY B;  1Q8I A;  2G5D A;  1EIH A;  1S03 G;  3K57 A;  4P73 A;  5IGB A;  4J9Q A;  3EBE A;  4PZ8 A;  1MKH A;  3GIJ A;  2EJM A;  1G2T A;  1Z9F A;  3GV6 A;  3TII A;  1BO0 A;  3CQZ H;  1MBY A;  5EPK A;  4EGV A;  5CAE B;  2XCP A;  2PW5 A;  3DEO A;  2HD3 A;  2WV6 D;  1UUP A;  4G57 A;  3F2B A;  1XMO H;  2JSO A;  4CDD C;  2R8J A;  4J9P A;  2UUB L;  3G48 A;  3CCQ A;  2W6N A;  2PQA A;  1C3O A;  5KFY A;  2W9B B;  4X6A H;  4RB0 A;  3WO1 A;  1HR0 H;  1NE3 A;  5L9X A;  4CJ2 C;  1II3 A;  1GD7 A;  4FVM A;  2D0P A;  3BDO A;  4S3S A;  2A68 C;  5D3D A;  3S2H H;  3BYY B;  2V59 A;  1S10 A;  4DK3 C;  4CBV A;  4I50 F;  4ZI7 F;  2WIN B;  4Q44 A;  4I7H A;  3T16 A;  5JEA G;  2BE5 C;  1KJQ A;  1HNX L;  3GTJ B;  1ASY A;  5LMU L;  5FD6 A;  1I94 Q;  1TWG H;  4F8M A;  4PMB A;  2NU9 B;  4A93 H;  5C1O A;  4PQX A;  4LAA A;  3M4I A;  4Q8E A;  1PRT D;  1XPR A;  1S5D D;  4L5S A;  5EBC A;  2R7M A;  4ED7 A;  2OH2 A;  1N32 H;  2MNA A;  2YTV A;  3ERQ A;  5IIF A;  3VYS A;  4OIK A;  3CCU A;  3OIQ A;  4GKJ H;  4LF4 Q;  3AU7 A;  1J8I A;  4AYB B;  3RN5 A;  5T14 A;  1S0O A;  1QUQ B;  3PIO A;  4L6T B;  1QE6 A;  3H20 A;  3I73 A;  3LNN A;  1KXL A;  1D5Z C;  4O42 A;  4YCV A;  2ZJQ A;  2RKS A;  3VR4 A;  2JA6 H;  1UNN C;  1CUK A;  2XRQ D;  2DUD A;  1N34 H;  4WJW A;  3ULJ A;  3H40 A;  3STB C;  4ALP A;  1XMQ H;  4ECR A;  4KHV A;  1GUT A;  5KT4 A;  2NU8 B;  4BY1 B;  4RUA A;  4DGZ A;  2ZM6 Q;  3PIP A;  1EUC B;  3G4S A;  3L0O A;  1BXR A;  3DHQ A;  2X6G A;  4HYK A;  2VL6 A;  3K58 A;  3QIA A;  2K5D A;  2B63 B;  2DNE A;  4FO2 A;  3N44 B;  3M4O H;  1FYC A;  2HHH Q;  3MFY A;  3TP7 A;  4ZHQ F;  2EQS A;  4DNR B;  2E5L L;  4AYB A;  4A3J H;  1L0W A;  3T5H A;  3S15 H;  2ASD A;  1Q1E A;  2EJF C;  3ETJ A;  4J6H A;  2K28 A;  2RSN A;  3Q8S B;  1FR3 A;  2A6E D;  4LF5 H;  4DV0 L;  1KJ8 A;  1B3Q A;  4OO1 H;  1E2V A;  2Y0S B;  2YZG A;  1C48 A;  3K81 C;  3V6H A;  3RF2 A;  4LNQ A;  2V9W A;  3OUU A;  2YTX A;  1BCP D;  1PTO C;  3A5Z B;  1B2T A;  4LF9 H;  1B04 A;  4XYM B;  4IJH A;  3R5F A;  2ZXO A;  3J81 j;  2UXB Q;  4JI4 Q;  3V96 A;  4ZYS A;  3T5L A;  3T53 B;  2JJQ A;  2KHJ A;  5ELD A;  2ZJR A;  1L1O B;  4DXG A;  1RJT A;  3NSW A;  1ET9 A;  4J1M A;  3HOV B;  3T1Y Q;  4UY8 C;  2B63 A;  3W2D A;  5FOB B;  1RK6 A;  4ZQI A;  5BR8 H;  1YNN C;  5ELC A;  3J81 E;  1SAP A;  2PCF B;  1F2M A;  3UDX A;  4DR7 H;  3HOW H;  3EIV A;  3EPI A;  3CC4 A;  5M3F H;  4NXN Q;  1XMO L;  3G6V A;  1KJ9 A;  4Q8F A;  1IHZ A;  3HBL A;  3SXH A;  3GV3 A;  3V6K A;  3K5M A;  2OTL A;  4KD4 A;  3LP8 A;  4JI3 H;  3HOU G;  4KV6 A;  2ES2 A;  3OMG A;  1HR0 L;  1HNW Q;  3GIM A;  2Y0S A;  2YS6 A;  3TZU A;  4IHJ F;  1W3S A;  2IHE A;  2F0W A;  2UVW A;  1EL0 A;  4A3M B;  3FMA A;  1LAC A;  4R4O A;  4IAJ A;  1UAP A;  4JI5 Q;  3I2Z A;  1T5E A;  3K6O A;  3PMF A;  1PTO B;  4EQ5 A;  2IPK D;  3W3A A;  1LTL A;  3HS0 C;  3I4L A;  4A3F H;  4L5T A;  5EKK A;  3PO2 H;  5FLX L;  2JA6 G;  3J7A F;  1X3E A;  1STH A;  1G51 A;  4JK1 C;  1FNV A;  4C3J B;  3DWA A;  5IT9 L;  1LT4 D;  2N8N A;  1STB A;  4WRD A;  4YR3 A;  4JV5 H;  1KJI A;  2NVX H;  3IFD A;  4UCO A;  2GPW A;  4ZRZ A;  1C9O A;  3HP3 A;  3F8T A;  1N32 L;  1I4X A;  1TWA B;  2HCI A;  5I9P A;  4GKJ L;  4B3S H;  1H9M A;  1DM0 B;  1UEB A;  2GVA A;  3GO5 A;  3HEJ A;  1YI2 A;  3MWD A;  2E76 C;  5LOV F;  4Q45 A;  3OWE B;  2IX3 A;  3GTG A;  5KFF A;  3U4V A;  1IKL A;  2VQE H;  1CS0 A;  3C0F B;  4BS9 A;  3EQL C;  3J80 L;  4MAM A;  4DUZ Q;  4A3J G;  2LSS A;  4X64 H;  4ECQ A;  4R1J A;  2W6M A;  3M4Q A;  1Q7Y C;  4DV1 H;  4POF A;  3TN2 A;  3PO3 H;  2UUA H;  5JOB A;  1K3R A;  1FNW A;  1SE2 A;  1JT8 A;  3T5K A;  4G3I A;  2AQ2 B;  2WAQ B;  4L5R C;  4JI2 Q;  1N34 L;  4HR7 A;  4MTD A;  1A6X A;  4OO1 G;  5KYI A;  1HA5 A;  1XMQ L;  1KC8 C;  3S14 H;  2X0S A;  2C28 A;  3IAY A;  1IBL Q;  2JK8 A;  3GTP H;  3TRZ A;  3E9H A;  4QMG A;  1YNJ D;  4IUV A;  1CZW A;  4DNI A;  3G71 A;  3IFT A;  3K59 A;  1I6U A;  1QB5 D;  4E4T A;  4RUC A;  1TWA A;  5LL6 X;  4IOC A;  5K36 H;  4R4I A;  5KT2 A;  1VQC A;  2PYK A;  2E8G A;  3BG3 A;  4MTE A;  3ONA B;  2RDG A;  1HHV A;  1VQA A;  2MP1 A;  4LH6 A;  3DEP A;  5IYB G;  5KFX A;  1PH6 A;  2EJG C;  4O2D A;  4Q5V A;  4F88 A;  4YJ3 F;  5KG5 A;  4M9U A;  2UXD Q;  4IN3 A;  2V4Q A;  2R61 A;  1KDB A;  1NTG A;  4OWT B;  4LF5 L;  3HOW G;  2DJG C;  5M3F G;  2L12 A;  3ULP A;  2K05 A;  3HKZ G;  4ECS A;  5T1G A;  4KJO A;  2R8I A;  4B3R Q;  2WE6 A;  1PH1 A;  1Q8K A;  1PTO F;  1CI3 M;  5CV8 A;  3NBI A;  5JAV A;  5AJ3 Q;  2WAQ A;  4F4Y A;  4JBK A;  2PI2 A;  4LF9 L;  4EGQ A;  1CSP A;  3C46 A;  2OXP A;  4JC0 A;  2F0N A;  1JOO A;  1W2B A;  1YHA A;  1JOR A;  5C6A A;  1VQN A;  1A62 A;  1K1Q A;  2JQO A;  2VS1 A;  4UP8 A;  4O2B F;  5IP9 H;  1EQV A;  2GPS A;  1WCM B;  1EFI D;  1WJJ A;  2I8C A;  1YIJ A;  1E3P A;  5IYC H;  5BR8 L;  2FK2 A;  1EU3 A;  3TP6 A;  5D8D A;  4A3F G;  4EVO A;  1A3T A;  1EYA A;  2EY5 A;  3PO2 G;  4BY7 B;  4DR7 L;  2F03 A;  1WD1 A;  4OWW B;  3OOC A;  1ZYR C;  4XYO A;  3GTQ H;  2IP4 A;  2R87 A;  1TKW B;  1PYB A;  1B3A A;  1PVO A;  1SYD A;  2PZW A;  4DFA A;  3QFF A;  5KFN A;  3QJY A;  4DA2 A;  4IPG A;  1AUX A;  2AWO A;  4JI3 L;  4BWG B;  2R6F A;  1GSA A;  2QCP X;  4JYA Q;  5J2T F;  3H3V H;  1VDZ A;  3PVX A;  1JE5 A;  3FKI B;  2F0J A;  5KX5 F;  1GSO A;  3UE0 A;  4J15 A;  3I12 A;  3Q6S A;  3PGZ A;  2SNS A;  3BJU A;  2NBF A;  5E1F A;  3VYR A;  1EHI A;  4GZY C;  3RZO B;  4MV4 A;  4A4I A;  2E2J B;  1WTO A;  5KFM A;  1O80 A;  4N8F A;  1GO3 E;  2N3S A;  5H1S E;  3PO3 G;  4IZO A;  1RHP A;  3GTM A;  2FMC A;  4F4Z A;  1WCM A;  4ECV A;  2Q2H A;  4KHP H;  1I6H H;  5FPO A;  2J9G A;  1Z2O X;  2W71 A;  4JI1 Q;  1GLV A;  3VPD A;  1XNQ L;  1IBK H;  4YCW A;  4Q0F A;  4JV5 L;  2K5V A;  5M3M G;  2VNU D;  1CKM A;  3JAM E;  5KG6 A;  3J81 L;  2IT1 A;  5CMD A;  3GID A;  3PW5 A;  1W6K A;  2MO0 A;  3I72 A;  3SK5 A;  3U9S A;  3EYY A;  4B3S L;  1B50 A;  4DV7 H;  4MV6 A;  3D4R A;  5KFP A;  4O1N A;  1M90 C;  4RGN A;  5HY6 A;  1DV2 A;  4A3D B;  5IT9 W;  1WI5 A;  3SVM A;  1O75 A;  2VQE L;  3S17 H;  4IO9 A;  3QG1 A;  5K36 G;  3T1H H;  4C5C A;  1EIF A;  2F4V Q;  3FKI A;  4LFA H;  4RHR A;  3RLN A;  3ULL A;  4BA1 I;  1VKZ A;  2A73 B;  1A2U A;  4L5Q A;  4X64 L;  4HED A;  4RWS C;  2SEB D;  1NJI C;  4YBZ B;  4AYB E;  4KI0 A;  1YJW A;  4DV1 L;  4UAI A;  5KFG A;  5KGU A;  3KJO A;  5GAD C;  2UUA L;  1ZEQ X;  4DV4 Q;  1XX8 A;  1KEE A;  3LWB A;  4EQP A;  1X6O A;  3PSI A;  3J80 W;  2IY5 B;  2MHV A;  3A8I E;  3JSL A;  4JBM A;  4C2M B;  5CR3 A;  2R7Z B;  4YAK B;  1A3U A;  2MUY A;  3M7G A;  1RJQ A;  2VOB A;  1SFO A;  2A74 C;  2K32 A;  5EKL A;  4IUR A;  4LWC A;  4A3G B;  2K7V A;  1Q82 C; 
#chains in the Genus database with same CATH homology
 4H02 A;  1GVP A;  3CPW A;  4XIG S;  2JE6 I;  3MXN B;  1OXX K;  1IXR A;  2VY3 A;  3W1B A;  1S40 A;  4HJA A;  5IE8 A;  3KF6 A;  2OQK A;  1D8L A;  5IP9 G;  2HT1 A;  1A8V A;  4IOA A;  4IFD I;  1NMG A;  5IWA Q;  2F4V L;  1JJ2 A;  4BXX G;  3M7N A;  5IYC G;  1TWH H;  2UUC Q;  1YIT A;  4YHH L;  2KCM A;  1I50 H;  2K52 A;  4YWM A;  4OX9 Q;  1VQP A;  4A3L G;  2IX1 A;  4DR3 L;  3I4O A;  1M1K C;  1YNX A;  4YWK A;  2BA0 A;  4LF7 Q;  1EOV A;  1EQR A;  2ZTC A;  1N33 L;  3IRB A;  2Z6K C;  4A3C H;  5M5X H;  4DV4 L;  4LFC Q;  4BBS H;  1ASZ A;  4A3G H;  1Q12 A;  1X55 A;  1X54 A;  3E0E A;  1AE2 A;  4HID A;  1VCI A;  4A3K H;  1OTC A;  4JI3 Q;  2R93 H;  1G6P A;  4LUV A;  3PF5 A;  2I5H A;  1KIX A;  4GN5 A;  2RCN A;  4R4C A;  1GKH A;  3I4M H;  3JAM c;  2Y0S E;  1PH4 A;  1E1T A;  5FLM H;  4MTN A;  3HKZ E;  3GDE A;  3KOJ A;  5JJL A;  4BY7 G;  3WWV A;  1OXS C;  3M4P A;  3SGI A;  4DV3 Q;  4KHP Q;  4LUZ A;  1C7Y A;  5IWA L;  4IPD A;  4R4T A;  3JC6 6;  1QZG A;  1PH7 A;  3NEN A;  1EYG A;  1VQ9 A;  2UUC L;  1IBK Q;  1N33 Q;  5C3E H;  4OX9 L;  1VQH A;  2JEB I;  5IY0 A;  1XNR Q;  2PQA B;  2ZTE A;  2UUB Q;  1XNQ Q;  2YV5 A;  4DAM A;  1K73 C;  3FKI G;  2DGY A;  3KJP A;  4C3H H;  1UE1 A;  4LFC L;  2B63 H;  1EQQ A;  2KCT A;  2PMZ E;  5LMN W;  1N36 Q;  1BKB A;  5GRO A;  1VQK A;  3T1H Q;  4JI7 Q;  3NEL A;  4LFA Q;  2R7D A;  1QVG A;  2VQE Q;  2K5N A;  3KLW A;  2E2H H;  1SMX A;  5C0X I;  1WYD A;  1PHJ A;  4JOI C;  5ELN A;  1NY4 A;  1HZB A;  1N8R C;  3KYH C;  5IYB H;  2HHH L;  3TEH B;  5LMU Q;  4P73 A;  4QIW E;  1KHI A;  4PZ7 A;  4B3M Q;  1HR0 W;  1BVS A;  1S72 A;  3EBE A;  2CWA A;  4PZ8 A;  1MKH A;  5C44 H;  1PV4 A;  3HKS A;  1Z9F A;  3FP9 A;  4DV3 L;  2Q2U A;  4KHP L;  3CQZ H;  1KAW A;  4JBJ A;  5IP7 H;  1BBU A;  3MEF A;  2Q2I A;  2YYZ A;  3NEM A;  2QEX A;  3F2B A;  1IBK L;  1XNR L;  2UUB L;  2NZO A;  3G48 A;  3J80 i;  3CCQ A;  2PQA A;  2NZH A;  1MIU A;  3JAM i;  4X6A H;  4DV7 L;  4JI8 Q;  3HOV H;  1Q86 C;  1NE3 A;  3HOX G;  3HOY H;  1GD7 A;  1N36 L;  2A8V A;  3AEV A;  2EIF A;  2D0P A;  2BH2 A;  4DKA C;  2UXB L;  3T1H L;  4JI7 L;  3S2H H;  3TRE A;  1VQ8 A;  4LF8 Q;  4LFA L;  2JA7 H;  2WP8 J;  4DK3 C;  3RNU A;  4IFD G;  1CKN B;  2Z6K A;  4P72 A;  5JEA G;  2CKZ B;  2GN5 A;  2NVQ H;  4AH6 A;  1HNX L;  3GD7 A;  4OXP A;  1ASY A;  5LMU L;  2D62 A;  1C0A A;  1I94 Q;  1TWG H;  2CWP A;  3GTG H;  2OWO A;  4A93 H;  1HZC A;  4BBS G;  3G6E A;  4A3G G;  1XPR A;  4L5S A;  4A3K G;  3UDF A;  3I56 A;  4A3M H;  2WAQ E;  4GN3 B;  3I4M G;  2PI2 E;  2MNA A;  2YTV A;  3UDI A;  3CCU A;  3S1N H;  1OXU A;  4LF4 Q;  5J3B A;  1QZH A;  3I7F A;  2EXD A;  4JI8 L;  5FLM G;  1VQM A;  2E5L Q;  3BU2 A;  1SRO A;  3GTJ H;  3RN5 A;  2ATW A;  2N49 A;  3H0G H;  4JG2 A;  1QUQ B;  3PIO A;  5FLX c;  3S1R H;  1DGS A;  2CCZ A;  4LF8 L;  3KDF B;  3M3Y H;  2NVT H;  1KXL A;  1IZ6 A;  5IT9 c;  4BBR H;  1Q1B A;  4YCV A;  3E9I A;  2ZJQ A;  1CKN A;  1Y1V H;  4GNX C;  4DV0 Q;  1VQ5 A;  1KRT A;  4UPA A;  1NBW A;  2JA6 H;  1CUK A;  1TWA H;  2RHS B;  2DUD A;  2HIX A;  1K8A C;  1I94 L;  2NN6 I;  3ULJ A;  4X62 Q;  2QA4 A;  1E22 A;  3STB C;  5M3M H;  1RIP A;  4NXM Q;  2UXC Q;  3AQQ A;  4ALP A;  4OON A;  3I4N G;  4JOI A;  4UP9 A;  2ZM6 Q;  3PIP A;  5FJ8 H;  1PH8 A;  2WFW A;  4QL5 A;  3G4S A;  2LXJ A;  2JA9 A;  3L0O A;  3J80 c;  1K8G A;  4O0A A;  2Z0S A;  1YJN A;  3HOZ H;  4HIO A;  2JEA I;  1KL9 A;  3B6Y A;  1E24 A;  4DR4 Q;  1K0R A;  5C0X G;  2VL6 A;  1HZ9 A;  2ZTD A;  3DM3 A;  4LF4 L;  4NB3 A;  5GAG C;  5C4X H;  1UE6 A;  3M4O H;  5LMN Q;  4DK6 C;  2HHH Q;  2EQS A;  2I5L X;  2E5L L;  1PFS A;  1IL2 A;  4A3J H;  2KBN A;  1L0W A;  1PH5 A;  2AWN A;  3S15 H;  2Y0S G;  1Q1E A;  1I5F A;  5DLQ E;  3RLO A;  1XJV A;  5C44 G;  1TWC H;  1XMO Q;  5IP7 G;  4XTC S;  2K14 A;  3UE1 A;  1JJG A;  4BY1 H;  4DV0 L;  4OO1 I;  1HR0 Q;  3K81 C;  2CQO A;  3KFU A;  4X62 L;  2ALY B;  4LNQ A;  2UXC L;  4NXM L;  4UP7 A;  2YTX A;  1NMF A;  2VW9 A;  3A5Z B;  4DV7 Q;  3HOV G;  4IJH A;  4GNX B;  4APV A;  2OTJ A;  3HOY G;  3J81 j;  4B3T Q;  2A19 A;  2UXB Q;  2ZM6 L;  4JI4 Q;  4TQU S;  5IYD H;  1VQG A;  2JJQ A;  4A3B H;  2KHJ A;  2JA7 G;  2FXQ A;  2K5H A;  3F1Z A;  4NPS A;  2ZJR A;  4A3E H;  3RN2 A;  1L1O B;  4QY7 A;  2UU9 Q;  2JA8 G;  3GTO H;  1KRS A;  4GKK Q;  4DR4 L;  3PUY A;  2R7F A;  3T1Y Q;  1HNX Q;  4UY8 C;  1UE7 A;  5LMN L;  1K83 H;  2MFI A;  4MNO A;  1VQI A;  3CXC A;  4IPC A;  3GTK H;  1S3O A;  3DLL A;  3UDX A;  3L7Z C;  3HOW H;  3EIV A;  3CC4 A;  1SE8 A;  2KHI A;  5M3F H;  4P74 A;  3I55 A;  1XMO L;  2C35 B;  2F52 A;  3AFP A;  1U0L A;  1N32 Q;  2AKW B;  3CCS A;  4DV5 L;  4A3M G;  2AHO B;  3CME A;  2OTL A;  4LFB Q;  1MJE A;  1YZ6 A;  4GKJ Q;  3HOU G;  2ES2 A;  1HNW Q;  1HR0 L;  2IHF A;  3GTM H;  1VQO A;  1WCM H;  2CFM A;  1W3S A;  2IHE A;  1UE5 A;  3CCJ A;  2YU9 H;  4POG A;  3STB D;  3F2C A;  2VZA A;  4L5R C;  1JJC B;  3PUX A;  2HQL A;  3H0G G;  1HH2 P;  4R4O A;  4B3T L;  1IYJ B;  1Q81 C;  4JI4 L;  4BY7 H;  4JI5 Q;  3I2Z A;  1P8L A;  2WB1 E;  1HNZ Q;  3OYY A;  1VS0 A;  4DR6 Q;  4GKK L;  2YTY A;  1EWI A;  2UU9 L;  3ER0 A;  4BBR G;  4EQ5 A;  4GOP C;  1Y1V G;  1LTL A;  1VQB A;  4RG1 A;  2Q2T A;  2XTI A;  4HJ7 A;  4A3F H;  4L5T A;  1FL0 A;  3T1Y L;  1N34 Q;  1E1O A;  4QGU A;  3PO2 H;  2ASB A;  4BXX H;  2JA6 G;  2E2I H;  1X3E A;  1XMQ Q;  1G51 A;  3PF4 A;  2HIV A;  2NN6 G;  3FKI H;  3VDY A;  1BBW A;  4A3I H;  3CP0 A;  2N8N A;  4A3C G;  3CF5 A;  1Y1W H;  4OWX B;  4HIK A;  1YEZ A;  3J7Z C;  2B3G A;  4NXN L;  3M85 A;  1N9W A;  3K0X A;  4AYB G;  1X9N A;  2NVX H;  2R92 H;  2R93 G;  1N32 L;  1C9O A;  3F8T A;  1QVC A;  2OCE A;  4YWL A;  5GAE C;  2V1C C;  3RZO H;  1YBY A;  3AFQ A;  3J7A 5;  4GKJ L;  4LFB L;  1UEB A;  1YI2 A;  2GVA A;  1HNW L;  3GO5 A;  4HJ8 A;  4QQB X;  4WJ3 M;  1FJG Q;  3U4V A;  1OXT A;  1XPO A;  3CCL A;  4KHZ A;  1V9P A;  2A1A A;  1KQS A;  5C4X G;  1E7Z A;  2VUM H;  1SFO H;  4DUZ Q;  5E7N A;  2N78 A;  4A3J G;  2LSS A;  3FHW A;  4R1J A;  4JCV E;  3M4Q A;  1Q7Y C;  4C3J H;  4JI5 L;  4POF A;  1V43 A;  1K9M C;  1HNZ L;  4LF5 Q;  3PO3 H;  4DR6 L;  1K3R A;  1JT8 A;  4WJ4 A;  3F2D A;  1EUJ A;  4BY1 G;  4P71 A;  1PYS B;  5GQO A;  4JI2 Q;  4EX5 A;  5C3E G;  4DV2 Q;  3RZD H;  1N34 L;  4OO1 G;  2JA5 H;  4JI1 L;  3NBH B;  4LF9 Q;  4A3D H;  1XMQ L;  1KC8 C;  1VQF A;  4IJL A;  3H15 A;  3S14 H;  1Z47 A;  1L1O C;  4TVA B;  1IBL Q;  1V1Q A;  2JK8 A;  3CPF A;  4GOP B;  3GTP H;  3HOX H;  2B63 G;  3E9H A;  1WFQ A;  3TRZ A;  2I0Q A;  4DNI A;  4GN4 B;  3G71 A;  5IYD G;  5JJK A;  1FGU A;  2ZJP A;  4A3B G;  1PA6 A;  1B7Y B;  1QVF A;  4LF6 Q;  4A3E G;  4IOC A;  5JJI A;  4QJF A;  4R4I A;  1VQC A;  3CCR A;  3GTL H;  1TXY A;  2E8G A;  1FJG L;  5BR8 Q;  4DR2 Q;  3TS0 A;  1P16 A;  2D0O A;  1VQA A;  2R7Z H;  4C2M H;  4PMW A;  5IYB G;  1A63 A;  1YHQ A;  1CKO A;  1OXV A;  1VQE A;  4MZ9 A;  4DUZ L;  1PH6 A;  4DR7 Q;  1EFW A;  4IFD J;  3CMA A;  4O2D A;  2RHQ B;  4P75 A;  4YCU A;  2UXD Q;  1L2F A;  1QUQ A;  5JEA J;  3S1Q H;  1NTG A;  2BH8 A;  4OWT B;  4LF5 L;  5HGQ A;  3U58 A;  2MQH A;  4DV6 Q;  5M3F G;  3KDF A;  1VQ7 A;  3HOW G;  5M5W H;  3ULP A;  3HKZ G;  2VQF Q;  1A0I A;  4B3R Q;  4HIM A;  4DV5 Q;  4JI2 L;  1PH1 A;  1Q8K A;  4DV2 L;  3UDG A;  3S2D H;  5AJ3 Q;  4YY3 Q;  4JBK A;  1J6Q A;  2PI2 A;  4LF9 L;  1CSP A;  4BA2 I;  1Y14 B;  4DR1 Q;  4JC0 A;  1WCM G;  4FDB A;  1W2B A;  1IBL L;  1YHA A;  3U4Z A;  4DAY B;  1A62 A;  2NVY H;  1VQN A;  2JQO A;  2VS1 A;  2GVB A;  4GOP A;  4UP8 A;  3ZJY C;  2MO1 A;  3HFZ B;  3D0F A;  2H5X A;  2OQ0 A;  3K8A A;  3Q8D A;  4ME3 A;  4X66 Q;  1AH9 A;  3BZK A;  5IP9 H;  1FVI A;  1AE3 A;  1VQL A;  4JI6 Q;  4LF6 L;  1XPU A;  4LUO A;  1HZA A;  3ERS X;  1WJJ A;  4GS3 A;  1YIJ A;  1E3P A;  2K4K A;  5IYC H;  5BR8 L;  4A76 A;  4DR2 L;  3A74 A;  4A3F G;  4NXN Q;  1RL2 A;  3TQY A;  4A3L H;  3PO2 G;  1LM0 A;  4LW1 A;  4AIM A;  4DR7 L;  2IX0 A;  3J81 i;  4LF7 L;  3BZC A;  5ELO A;  3D31 A;  4A3I G;  4OWW B;  3GTQ H;  4JV5 Q;  1LUZ A;  3RR5 A;  4A93 G;  1U5K A;  4RMF A;  3KF8 B;  1Y1W G;  1PYB A;  2UXD L;  1CSQ A;  1PH3 A;  1LYL A;  1PVO A;  3I4N H;  1VQ6 A;  3AYH B;  3K7U C;  4DV6 L;  1IBM Q;  1X65 A;  1SR3 A;  3CAM A;  4IPG A;  2AWO A;  5EAY A;  4JI3 L;  2VQF L;  4B3S Q;  2R92 G;  4JYA Q;  4GLV B;  4B3R L;  3H3V H;  2K75 A;  1PH9 A;  3H3V I;  1X56 A;  3PUV A;  1PH2 A;  1JE5 A;  5AJ3 L;  1YVC A;  3W5O A;  4YY3 L;  3U50 C;  4AQY Q;  2AMC B;  3UE0 A;  4DR1 L;  4J15 A;  1J5E Q;  1TWF H;  3CCE A;  3CCV A;  3CD6 A;  3PGZ A;  3BJU A;  4X64 Q;  2LXK A;  2VUM G;  1T9H A;  4DV1 Q;  1WOC A;  4Y7N H;  4DUY Q;  3RLF A;  4GNX A;  1R9T H;  4A4I A;  2UUA Q;  4JI0 Q;  3S1M H;  5C0X J;  1B70 B;  4X66 L;  5M5Y H;  3M9B A;  1GM5 A;  1UWV A;  4K0K Q;  4JI6 L;  1GO3 E;  2N3S A;  5H1S E;  1YJ9 A;  3PO3 G;  4DR5 Q;  4X65 Q;  3OTO Q;  1L1O A;  4HJ9 A;  2Q2H A;  3S16 H;  1I6H H;  3A0J A;  1SRU A;  3A5U A;  2QGQ A;  4R4Q A;  2R6G A;  1EIY B;  4JI1 Q;  2WB1 G;  2JA5 G;  4A3D G;  1YHB A;  1XNQ L;  1JB7 A;  4YCW A;  1VQ4 A;  4JV5 L;  2K5V A;  5M3M G;  4C3I H;  2VNU D;  1CKM A;  1MJC A;  3PUZ A;  3EN2 A;  1HJP A;  3ICE A;  2IT1 A;  3TS2 A;  1IBM L;  1Q46 A;  2MO0 A;  3PV0 A;  2KEN A;  4GLA C;  4B3S L;  1VQJ A;  5FJ8 G;  4JYA L;  2RF4 A;  3KF6 B;  1M90 C;  5HY6 A;  2E2J H;  1WI5 A;  3CC7 A;  3HOZ G;  2VQE L;  3S17 H;  4IO9 A;  4AQY L;  2JA8 H;  2BA1 A;  3CW2 C;  5K36 G;  1EIF A;  1VQD A;  3PUW A;  2F4V Q;  1J5E L;  3RLN A;  3ULL A;  4BA1 I;  1SN8 A;  2XGT A;  2PNH A;  3PCO B;  4YHH Q;  4DPG A;  4L5Q A;  4X64 L;  3OW2 A;  2F3I A;  3CCM A;  4DR3 Q;  2WAQ G;  4KI0 A;  4AYB E;  1YJW A;  1NJI C;  2R7Z G;  4DV1 L;  4Y52 H;  4KLK A;  4DUY L;  1XTD A;  4A75 A;  3LGJ A;  3CC2 A;  4B3M L;  3KJO A;  3K80 C;  5GAD C;  2UUA L;  4JI0 L;  4JBW A;  4PZ6 A;  4DV4 Q;  2ID0 A;  4K0K L;  1X6O A;  1G29 1;  2L15 A;  3PSI A;  4PG3 A;  4DR5 L;  4X65 L;  3OTO L;  3W1G A;  2IY5 B;  3S24 A;  4JBM A;  3J81 c;  1X3G A;  1SLJ A;  1KD1 C;  1H95 A;  3HOU H;  1B8A A;  2B29 A;  3K7A H;  2K50 A;  1I3Q H;  4LWC A;  4HJ5 A;  5GAH C;  1X3F A;  2I5M X;  1O7I A;  1JMC A;  4GLX A;  4IPH A;  3L2P A;  1D7Q A;  5C4J H;  1Q82 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...