2VUMG

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 26
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vumG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2vumG01
1GM5A 3L0OA 5IYBH 2K14A 3A5ZB 2UUAL 4A3GH 4MZ9A 2IX1A 3I4NG 1QVFA 3H15A 3F2DA 4DV5Q 5JEAG 5FJ8G 1M90C 2JA6H 3OTOQ 4NXNL 4DUYQ 2JJQA 3CXCA 3H0GH 1FGUA 3HKSA 2HHHQ 4B3ML 4KHZA 2GN5A 2ASBA 3KJOA 2AKWB 5C0XG 1SFOH 1HH2P 3CQZH 4GN5A 4TQUS 4RG1A 5IP7G 4DV0L 1Z9FA 3VDYA 1CKNB 1Y14B 3Q8DA 3PSIA 4DR2Q 1N36L 4A3GG 1X56A 2R93H 4JBMA 1E24A 4JBJA 2K5NA 3STBC 3J80c 1S40A 1LUZA 1IBML 1WI5A 4LF5Q 1TWHH 1M1KC 1X55A 4DR7Q 1A0IA 1CSQA 3RLOA 4BA1I 4AIMA 2UU9L 5M3MH 4DV7L 1XMQQ 2R7ZH 4DR3Q 4HJ9A 4A93G 3BU2A 1X6OA 1B8AA 3UDXA 1A63A 1WOCA 2JK8A 3H3VH 1EIYB 4X64L 2GVBA 3NEMA 1VQ4A 2HT1A 3HOYH 5JJIA 2BH8A 1YJ9A 4L5RC 1XNQQ 4A3LG 4QY7A 4P71A 1YHBA 4DR5Q 2UUCQ 1VQFA 4KHPQ 2CQOA 3M7NA 2FXQA 4AYBG 4MNOA 1OXSC 1JJCB 1GO3E 4IO9A 3S15H 1TWCH 4A3IG 2A1AA 3S1QH 4A3DG 4IFDI 5K36G 3GD7A 4BY1G 4JI5Q 1VQAA 5M3FH 2NZHA 4DR6Q 3S2DH 4LFBL 1JJGA 4BA2I 3GO5A 4HIDA 2PQAB 2ZM6L 1I5FA 3BZKA 3DM3A 4GS3A 4YHHL 1C7YA 1VQNA 2ZTDA 4X66L 1SN8A 1UWVA 1PA6A 3K7AH 2R92H 4AH6A 3S16H 4LUOA 3NBHB 3HOWG 1YZ6A 5GQOA 1YITA 1Y1WH 4JI6L 1SRUA 5LMUQ 4JI7Q 2A19A 3KF6B 3PIOA 3GTJH 3ICEA 2JEAI 1O7IA 2CFMA 4WJ3M 1LM0A 1A62A 3I56A 3RLFA 2WB1E 2RF4A 4A3FH 2UXCQ 4LNQA 2RHSB 1PYSB 4LFBQ 4BXXH 1GKHA 4GOPA 5M5WH 3PO2G 4GKJL 1KRTA 4OX9L 3K80C 1PH7A 1FVIA 4HIOA 3S24A 3K81C 1BKBA 2B63G 3MEFA 2I5MX 2IHFA 1N34Q 2JE6I 2VUMH 1CKNA 1L2FA 4ME3A 4A4IA 1N32L 3A0JA 1PH9A 4JV5Q 1BVSA 4C2MH 1RIPA 3T1YQ 2R7DA 3F8TA 2UU9Q 3J7A5 1PV4A 5C4XH 2ZM6Q 4PMWA 1B7YB 2HIVA 4DV4Q 1Q7YC 5C44H 3PUXA 5E7NA 4JI8L 2D0OA 4H02A 2KBNA 2K75A 1EIFA 5BR8L 4IPHA 4KHPL 4LF7L 1YJWA 2HHHL 5IT9c 3G71A 1YVCA 5C4JH 2MFIA 4LF8L 1VS0A 2YTXA 3S1MH 2VL6A 5IYCH 3F1ZA 3CCUA 2AHOB 1JE5A 4C3IH 3M4QA 4JI0L 1Q1BA 1P16A 3E9HA 1G6PA 1J6QA 2VY3A 4JI2Q 3KF6A 4J15A 2XGTA 1VQOA 1NJIC 1HZ9A 3CCEA 2OTLA 1NMFA 2JEBI 3FP9A 5BR8Q 3PV0A 1X3GA 4QIWE 1VCIA 1ASZA 4LF7Q 3PUVA 4OONA 1VQDA 5FLXc 3HOXG 3H0GG 2F4VL 2E2HH 1V43A 2NVTH 3CCJA 3K0XA 4A3JH 4R4OA 3AQQA 1PH1A 3CCLA 3I4NH 2UXDL 3CF5A 1G51A 4Y52H 4RMFA 1V9PA 2JA5G 3HOUH 2KCMA 1VQHA 3L7ZC 4GN4B 4LF4L 1HNZL 4A3BG 4A93H 4BBSG 2R7ZG 3CD6A 4A3CG 3HFZB 1KHIA 2KCTA 3EN2A 4A76A 1EUJA 4PZ7A 1Q81C 4OO1I 5JJLA 4HJ8A 4L5SA 2JA9A 5C0XJ 2OTJA 3J80i 1PH3A 1L1OC 2OQ0A 3AEVA 2UXDQ 1OXXK 1V1QA 2NN6G 2CCZA 1OXTA 4GLAC 4X62L 4JBKA 2WAQE 2B3GA 3ERSX 3W1BA 1B70B 5HY6A 1E7ZA 1NBWA 4LFCQ 3PUZA 3U4ZA 4GLXA 1HR0W 2JA7H 1YHAA 3CAMA 3PF5A 1X65A 4AQYQ 2D62A 2JA8G 4DR7L 4WJ4A 1OXUA 2YYZA 2RCNA 1UE7A 5ELOA 3RN5A 1PH4A 4JI6Q 2AMCB 3E0EA 4DV1L 4IPDA 1K9MC 2BH2A 2R92G 2Y0SG 4DR2L 4JOIA 4DK3C 3F2BA 1D8LA 1Q1EA 3IRBA 1VQ8A 4IFDJ 1KC8C 3RLNA 3EIVA 4HIMA 1H95A 4X65Q 4LW1A 4O2DA 4K0KL 4ALPA 4JI5L 4DR5L 4KI0A 2Z0SA 4UP9A 4GNXC 1K73C 1PH2A 5FLMH 3GTMH 4EX5A 4TVAB 3I55A 4A3MG 4GLVB 1RL2A 4X64Q 2C35B 1N33Q 3I4MH 4BY7G 3NELA 2MQHA 5IYBG 1T9HA 2N8NA 5C0XI 3M85A 5ELNA 2BA1A 2CWAA 4DAYB 5IYDG 4DR3L 1K8AC 2EIFA 3PUYA 1TWAH 1P8LA 3I7FA 1EYGA 1E3PA 3DLLA 3CCMA 3U50C 1VQPA 1X9NA 3H3VI 1UEBA 4LF8Q 3S14H 3PO3H 4YCWA 4LUZA 3CMAA 1K3RA 1QUQB 1VQ6A 2R93G 4LF9L 4YHHQ 1HNWL 3M4PA 3K8AA 4JYAQ 3FKIH 4JI8Q 1YI2A 1YBYA 3I4OA 2DGYA 4DR6L 2HIXA 3CCSA 4DV2Q 5JEAJ 5C4XG 2OCEA 3PIPA 1HZCA 1MIUA 3OTOL 3GTPH 2JQOA 4B3TL 2LXJA 3W5OA 3GTGH 2KHJA 4DR4L 1SROA 1KXLA 4QJFA 1Q82C 2HQLA 2ZJRA 2E2IH 3S1RH 4JI4L 2Z6KA 3RN2A 4C3JH 1X3EA 1JJ2A 3K7UC 3UDFA 1G291 3EBEA 5M5YH 4X6AH 2IHEA 4JI3L 1IXRA 2AWNA 2YTYA 3D31A 3PGZA 4A3JG 1J5EQ 4GNXB 3BJUA 3CP0A 4YCUA 1ASYA 1TWGH 5AJ3Q 4PG3A 4YCVA 1XMOL 1EFWA 2NVQH 1W2BA 3TS2A 4C3HH 2K50A 2E8GA 1QVCA 4OWTB 3HKZE 3CCVA 1VQMA 3WWVA 4HJ5A 3FKIG 2IY5B 1KD1C 4L5QA 4XIGS 5H1SE 2VQEQ 5EAYA 4YWKA 3GTQH 3J81c 4JI0Q 4AYBE 4IPGA 4A3KG 1L1OB 1NE3A 4UPAA 3UDIA 4JYAL 3HOWH 1E1OA 5IY0A 1BBWA 3HOZH 3T1YL 1LTLA 1MJEA 1HJPA 2AWOA 1Q86C 2JA5H 3HOUG 1KRSA 1VQLA 2VW9A 1L0WA 1HZBA 1WCMG 5LMNQ 4BY1H 2ZJQA 3U58A 3L2PA 4A3IH 2ZTCA 3CC7A 2VNUD 1U5KA 4A3MH 1YJNA 2PI2E 4PZ8A 1VQ9A 3PF4A 1K0RA 3PO2H 4X62Q 1SR3A 4YY3L 1CKOA 2F4VQ 3E9IA 2KHIA 5HGQA 4A3LH 4LWCA 1UE1A 2UXCL 1IYJB 3KOJA 3TREA 1YIJA 3U4VA 1D7QA 2VS1A 2K4KA 1PHJA 1IBLQ 4POFA 3CPWA 1I94L 4HIKA 2PMZE 3BZCA 1XNRL 3G4SA 2MNAA 1OXVA 5LMNL 4DR4Q 1WJJA 1YNXA 1PYBA 1I50H 4IOCA 1E1TA 5LMNW 5IYDH 2PI2A 2Y0SE 3ER0A 2NN6I 3CW2C 3UE1A 1N32Q 4EQ5A 4MTNA 1KQSA 4R4TA 4YY3Q 4LF5L 4DR1L 1TWFH 2WB1G 4A3DH 4QQBX 4DK6C 1MJCA 2QGQA 3FHWA 4LFCL 3SGIA 2I5LX 1QZGA 2E5LQ 4LF9Q 2PQAA 1UE5A 1HR0L 1VQIA 1VQ5A 4YWMA 1VQGA 1SMXA 3CMEA 4JI2L 2WAQG 1XTDA 2RHQB 4DUYL 4NXNQ 2L15A 4DKAC 3HKZG 2KENA 4R4CA 1HNZQ 4DV1Q 4DUZL 1EQQA 1Q12A 4UP8A 2YTVA 1XPUA 2VQFL 4DV6Q 3J81j 4BBSH 4AQYL 3ZJYC 3CCRA 4OXPA 2Z6KC 3ULJA 4B3TQ 4O0AA 2YU9H 1TXYA 2Q2IA 4DPGA 1XPOA 1Q46A 1WYDA 2UUBL 3KF8B 2VQEL 5M3FG 3A5UA 1EWIA 2E5LL 4JI4Q 3B6YA 1IZ6A 5GAHC 3TQYA 4P74A 5IWAQ 4DV3L 1HNXQ 3G6EA 4K0KQ 2CKZB 3AYHB 3STBD 3KFUA 4OO1G 2K52A 3UDGA 1X3FA 3F2CA 1J5EL 3AFQA 2A8VA 2OQKA 3OYYA 3GTOH 1EOVA 1MKHA 2BA0A 3HOYG 2N78A 4NPSA 1WCMH 4X65L 3M4OH 4HJAA 5IP9G 1PFSA 4JG2A 4A3CH 1FL0A 3CCQA 1FJGQ 1I6HH 1YEZA 4A3BH 4IJHA 1IBMQ 4R4QA 3T1HL 1UE6A 3HOZG 4OX9Q 1N9WA 1VQBA 1XJVA 2E2JH 2OWOA 4YWLA 2K5VA 1XMQL 4BBRH 2B63H 1BBUA 3MXNB 4DV2L 1XPRA 1AE2A 1X54A 1QUQA 2UXBQ 2N3SA 3PCOB 3KJPA 2UUCL 4GKKQ 5C3EG 4DV5L 5GROA 5GAEC 1GD7A 2WP8J 3RR5A 2IT1A 2MO0A 2ES2A 1XNQL 3S1NH 4A3FG 1JT8A 2UUBQ 2YV5A 2R6GA 3GTKH 3KDFA 1VQCA 1GVPA 2I5HA 2NVXH 4B3SQ 4LF6Q 4APVA 4IJLA 1Z47A 2EXDA 4JI1L 4R4IA 5M3MG 4A3EH 1IBKL 2UUAQ 3M3YH 1PH8A 1PH5A 1IBLL 1CUKA 4DUZQ 4LFAQ 4NXML 1KL9A 2Q2TA 3CC4A 2VUMG 3S2HH 4IOAA 3A74A 1C9OA 3GDEA 1N33L 5IP9H 4JC0A 3S17H 3G48A 3I4MG 4BY7H 3J81i 4FDBA 2ID0A 1AH9A 3J7ZC 1U0LA 4DAMA 1PVOA 2Q2UA 4DR1Q 5FJ8H 5C44G 2JA6G 1HR0Q 3TS0A 1L1OA 1S72A 2NZOA 1Q8KA 3PUWA 2ZTEA 2EQSA 3JC66 4LUVA 3JAMc 1YHQA 3RZOH 4BBRG 4QGUA 2GVAA 4P73A 4LFAL 1Y1VG 2LSSA 4NXMQ 1HNWQ 5AJ3L 1XMOQ 2I0QA 2UXBL 5IWAL 1SLJA 4OWXB 1HZAA 2IX0A 3AFPA 1WFQA 1OTCA 2R7FA 4P72A 4QL5A 4GOPC 3KYHC 4JI3Q 4OWWB 4B3RQ 4GNXA 5LMUL 2QA4A 4DV0Q 4A3EG 2ZJPA 1R9TH 2Q2HA 3CPFA 5IYCG 1QVGA 1N36Q 1NTGA 1AE3A 4A3KH 1CKMA 1Y1VH 3W1GA 5GADC 1JMCA 1EQRA 5DLQE 4KLKA 2PNHA 1CSPA 5IP7H 4UY8C 1QZHA 4BXXG 4A75A 1K83H 1A8VA 4DV3Q 1HNXL 2MO1A 1LYLA 5C3EH 4JBWA 2LXKA 4JCVE 1VQEA 4GKKL 4DV7Q 1XNRQ 5GAGC 4B3RL 1N34L 2DUDA 5JJKA 3I2ZA 4GN3B 3D0FA 4X66Q 3GTLH 5IE8A 2VQFQ 4DV6L 3HOVG 2F3IA 4PZ6A 2WFWA 2XTIA 5M5XH 4IFDG 4JV5L 1SE8A 1E22A 2K5HA 4HJ7A 4XTCS 3T1HQ 1JB7A 1VQ7A 2JA8H 3JAMi 3UE0A 1VQJA 2NVYH 4NB3A 2JA7G 4LF4Q 4P75A 1KAWA 4JOIC 1IL2A 3ULPA 1I94Q 1NY4A 4POGA 2H5XA 4DV4L 3HOXH 2D0PA 3KLWA 3RZDH 1W3SA 2VZAA 1DGSA 1C0AA 3TEHB 4L5TA 4IPCA 5FLMG 4GKJQ 3LGJA 3OW2A 3KDFB 1K8GA 1NMGA 1S3OA 1VQKA 2CWPA 5J3BA 2V1CC 1I3QH 4B3MQ 3M9BA 2ALYB 3CC2A 4GOPB 1FJGL 1KIXA 3PO3G 2N49A 4UP7A 3NENA 4JI1Q 3RNUA 4DNIA 1Y1WG 4R1JA 1IBKQ 4JI7L 2QEXA 4B3SL 4LF6L 3TRZA 1N8RC 3HOVH 2F52A 1PH6A 2ATWA 4Y7NH 2B29A 3ULLA
chains in the Genus database with same CATH superfamily
1GM5A 3RAQA 5CGKA 1C3OA 3L0OA 1RODA 4A3GH 2UUAL 1RYRA 1HRJA 1TS2A 3PW7A 3OTOQ 1C4QA 3BDLA 2B63B 4K2KA 4F4YA 4ZQIA 1HH2P 4GN5A 2ZDQA 2GPSA 5DQIA 4DV0L 1WSCA 1CA6A 4XT3B 4MV7A 4JBJA 2K5NA 4CGYB 5KG7A 1LUZA 3T51B 1M1KC 4DR7Q 1A0IA 3BQ1A 4AQYH 1DXMA 2E74C 2R7ZH 4A93G 4HJ9A 1X6OA 2W9BB 2UVUA 1WOCA 2JK8A 1TKWB 2AGQA 3HOYH 1LTBD 2GVBA 2GPWA 5JJIA 4O3OA 1XNQQ 4QY7A 3NP8A 3GTMA 1VQFA 2CQOA 5KG5A 3M7NA 4YQWA 3S17B 4ECSA 1NR2A 4MNOA 4IO9A 2I87A 5LMNH 4A3IG 5KFXA 4BY1G 5KFMA 1VQAA 3S2DH 3GO5A 5FOBB 3WNZA 4R8NA 3K5IA 3BZKA 3J81E 4YHHL 1C7YA 4NLGA 4DU9A 1SN8A 1PA6A 2H4OA 2R92H 2W6OA 1ENCA 2K04A 3NBHB 3I91A 4DR3H 1YZ6A 1IOVA 4LFCH 1PTOC 4JI7Q 2A19A 1NAPA 1STNA 3Q6SA 5KFKA 1O7IA 2CFMA 5DAUA 1GSHA 4R8UB 5KFHA 1OO9B 1B6RA 4JI0H 4LNQA 2R7KA 5EPLA 3VYRA 4J9MA 3I72A 2NN6H 2Z9HA 3N44B 2K5DA 1KRTA 3N43B 3K80C 4FU0A 5KT4A 4PMCA 1VBHA 3K81C 5A2QE 5CV5A 2EJGC 5KFVA 1K28A 3MEFA 2I5MX 3H91A 5BPFA 2AQ4A 2K33A 4ME3A 1IKMA 2XNAC 4JV5Q 3Q1KA 3QJYA 5KFIA 3CHBD 2R7DA 2UU9Q 3NHHA 1Y8PB 4X3UA 4PMWA 4DV4Q 4FBTA 3PUXA 2D0OA 2KBNA 1O7ZA 1EIFA 1M4VA 4IPHA 3N8DA 3KAKA 1ESRA 4XYOA 3MWDA 3V96A 4KHPL 2UXCH 2QDLA 1JWUD 1EY4A 5C4JH 2YTXA 1X32A 2VL6A 5IYCH 3H20A 3OUUA 4CKEA 4MAMA 2W9CA 1M8AA 2EVBA 1JE5A 1STGA 1Q1BA 3H6MA 2VUGA 5KIXA 1D6EC 4LK1C 3K5MA 3DWPA 2OTLA 4J9KA 3RUZA 1NMFA 1LO5D 3PV0A 3GIMA 1ASZA 1DV2A 1AZPA 1AFPA 2QW7A 4MV6A 3MR2A 2R8JA 2ZM6H 4YHHH 1I4QA 2A69D 2J4XA 3K0XA 1XYIA 3OSNA 4R4OA 3EQLC 3CCLA 3D8GA 1WD1A 4I4TF 2E2HA 5G3LD 3MWMA 1BCPD 2EYPA 3VYTA 2KEEA 3MVVA 1ENFA 3HOUH 4Q45A 5JPMC 4A3BG 2WIIB 2Z1CA 3HFZB 4EGQA 1TQOA 3EN2A 4AYBB 4A76A 1EUJA 1TAEA 4MHEA 4EGJA 3OSOA 4PZ7A 2FFKB 4OO1I 2EPBA 5FLXL 5C0XJ 3J80i 3NWSA 2OQ0A 2SEBD 4O4IF 3AEVA 5FPRA 2CCZA 5BN4A 2KCCA 4GLAC 4UCRA 2WAQE 2B3GA 4DF7A 3RF2A 1KBLA 4LF7H 1HFGA 2W9CB 3MFIA 1NBWA 4ODGA 3U4ZA 3K5NA 3TP7A 1U4LA 2C2EA 1L0YB 2VR1A 1YHAA 3CAMA 5NUCA 1X65A 2DJGC 3U9TA 1K9MC 4DR2L 2NBFA 5HBRB 2SNSA 1D8LA 4ECYA 1VQ8A 4OHJA 4KKUA 4IFDJ 4RAYA 2F0JA 3RLNA 1KEEA 1S5BD 2Z0SA 4RB2C 3GTMH 4EX5A 4TVAB 4BY1B 3V6JA 4GLVB 4CKBA 4DL5A 4H44C 5JVDF 1ILPA 2N8NA 5C0XI 2CWAA 4OELB 2BR0A 5KT3A 5KFPA 4JV0A 5FLXE 3HOYB 5EWGA 3U50C 4Q0FA 5J2UF 1KAAA 5IOCA 3S14H 3CMAA 2AUJD 1K83B 2W57A 2K7VA 4ZK9B 4LF9L 4HTHA 5GONF 1HNWL 1M7JA 1F9QA 5D1PA 3K8AA 1XWEA 4C1NI 1JORA 2BE5D 2DPIA 3NQTA 3C0FB 5M3FB 4JI8H 1WTOA 2WE6A 4JI4H 1A2UA 1HZCA 2RDGA 3OTOL 1B1ZA 2JQOA 1KNEA 4B3TL 3AB9A 1I4RA 2KHJA 4J6HA 3TBIB 3GTGH 2W71A 4X65H 3SHLA 4RUCA 3PN1A 3J81L 2UU9H 3E6ZX 2J6TA 4JI4L 4J9PA 2Z6KA 3RGZA 3ORRA 3SE0A 4BS9A 4B3MH 3PW5A 4Q0YA 2IHEA 2ALZA 1IXRA 2AWNA 4RWSC 4Q5VA 3BJUA 1O7LA 3CP0A 1ASYA 3OUZA 5E3FA 2C28A 1LTRD 2A6HD 2ENBA 4DV4H 1S5ED 3SR1A 4HJ5A 3FKIG 3IN5A 1Z2PX 2D5DA 4IALA 5H1SE 4LFBH 2VQEQ 5EAYA 1PTOF 1ET9A 4JI0Q 4UPAA 3T1HH 3UDIA 5CV9A 1U4RA 5IY0A 2W6ZA 4ECRA 1O75A 2JA5H 1KRSA 1Y1WA 3RUPA 2EJFC 2B2WA 3N52A 4KTAA 2B2TC 1JLLB 2UUAH 4LSXA 1YNND 1L0WA 1CA5A 2F03A 3GTLB 5BMVF 2XSCA 1WCMG 4BY1H 2ZJQA 1KDBA 3GV3A 3M9OB 4DR2H 1YJNA 3PF4A 5JUMA 1EZ8A 5KFOA 1I7LA 1WCMA 3NTIA 5IGEA 1F2ZA 4KKSA 1KDAA 3KOJA 3TREA 4EVOA 1YIJA 2JXMB 4RZQA 3R5HA 3BABA 1I94L 4A3KB 3G8CA 4IN3A 1V1PA 3RD4A 1JC7A 1OXVA 3X3NA 4ED2A 2NVXB 1LT6D 1GOZA 3DM1A 1XXGA 5LMNW 2PI2A 2G5DA 5J39A 5IYDH 4UCSA 3GQCA 4J9OA 2OXPA 4IAJA 4UAIA 1ZQ7A 2WAQA 1TWFH 5C5MA 2R93A 2ZDGA 4DK6C 2JA6A 2HQEA 4OEMB 3SGIA 1QZGA 1RDPD 3U9OA 4YWMA 1SMXA 1JOOA 1EUDB 2X6GA 3S16B 1CZWA 1Q12A 1XPUA 2VQFL 4DV6Q 3J81j 4BBSH 3A8JE 3TINA 2YZGA 2VPSA 2IW3A 2Z6KC 2HVSA 5KT6A 4KJNA 3DEPA 1B2TA 1Q46A 2Q8RE 1I3QA 1NR4A 2VQEL 5KNDA 1W96A 1AUXA 3VYUA 2F0EA 1MGSA 4DV3L 5IWAQ 2HHHH 3OPOA 2CKZB 3KFUA 2PO4A 1AW7A 2O03A 4GKKH 2F3WA 3UDGA 1X3FA 2A8VA 3BVGA 3FKIB 2OQKA 3K3VA 2EY2A 3GIQA 3G6VA 1HQRD 2R86A 2PYKA 5LL6S 4NPSA 1RJTA 3M4OH 4HJAA 1EQVA 5J1ZA 1FL0A 4A3CH 5L9XA 1SE2A 1V1OA 1ZETA 1YEZA 4A3BH 4K5WA 2K28A 1HHVA 1VAJA 2XRSD 2VQDA 2WAQB 5D65A 2XD4A 1VQBA 2E2JH 2OWOA 4YWLA 2TMPA 2B63H 4BBRH 1BBUA 1I50A 3ETJA 2B2YA 1AE2A 1X54A 5DEHA 1QUQA 2N3SA 3GTOB 3KJPA 2NVYB 5C3EG 1JX4A 2K1BA 4Y8VB 4RNMA 4IRDA 4PDBA 1GD7A 1XNQL 2IT1A 2ES2A 4MV4A 4DXGA 2R6GA 1GVPA 4B3RH 1QE6A 4APVA 2PZWA 3RFCA 4ECWA 3M3YH 1FD7D 3IFDA 1AN7A 2Y0SA 4RZRA 3A74A 1PRTD 3GDEA 5IP9H 2B39A 3S17H 3I4MG 2WV6D 4BY7H 1KJJA 4EG0A 5D1OB 1JWMD 4HCEA 1PVOA 2X69A 1LTAD 5FJ8H 2RVLA 4EBCA 1JDBB 4ECZA 4LUVA 1Q8KA 2NZOA 2SNMA 2ZTEA 3RZOH 4BBSB 1KTKA 2PVPA 3GTPA 5I6YA 5KFCA 4LH6A 1S0MA 2XRQD 2UXBL 5EBCA 3ND9A 1SLJA 4OWXB 1HZAA 5M5YB 3NE5B 3D6CA 1PX2A 1CHPD 5HURA 4QL5A 4GOPC 4JI3Q 1Z2OX 4CDCC 1N36Q 1TWHB 1IW7D 3CPFA 1NTGA 4L6TB 3KBGA 1RK5A 1FJGH 1Y1VH 2DY8A 3W1GA 5GADC 1EQRA 2JEJA 1HTLD 4LF5H 4JW0A 2F4IA 4J0MA 2UVVA 1CS0A 5E1FA 4C56C 4ZOLF 1PFNA 1QZHA 2L55A 1QB5D 2OF1A 3T16A 4DV3Q 3FDTA 3M4OB 4UHVA 1O7YA 1A3TA 2QDBA 4F87A 4GKKL 1PDQA 3RIZA 3QZ8A 1XNRQ 3T13A 4IUNA 1GUGA 3EVQA 3I2ZA 4GN3B 3D0FA 4KD4A 2VQFQ 1NCVA 4DV6L 5DQHA 5L1JA 2F3IA 1PYWD 4MA5A 1TY2A 3C3LA 5C4XB 1RJPA 4HJ7A 3T1HQ 4HNVA 4XTCS 3NUCA 5ELBA 3GTLA 4NB3A 4LF4Q 3RV4A 3ULPA 1NY4A 3I73A 4OO1H 5KFGA 1BXRA 2KVMA 2VZAA 1C0AA 4YIJA 1YNJD 4GKJQ 2RGVA 3OW2A 5ELEA 5EWEA 5I9PA 1OWTA 3G6YA 2PNRC 2R7MA 4WRDA 4U68A 3M3YB 2V1CC 1G91A 2JN4A 3BA8A 3J80E 3RNUA 2J7ZA 1Y1WG 3J80L 2QEXA 1SYBA 3HOVH 2F52A 2EYLA 3M7GA 3HG9A 4Y7NH 4DV7H 4DR4H 4EBEA 1E2VA 1ZYRD 2K14A 4MZ9A 3DF7A 2YZNA 4DV2H 3JAMW 2IX1A 4NXMH 1QVFA 3F2DA 1H9JA 1I4GA 4DR6H 1B4OA 1M90C 5EJWA 5FJ8G 1G2SA 4Q8FA 3CXCA 2HHHQ 5J2TF 4KHZA 1TIID 2GN5A 1CFMA 5C0XG 3CQZH 4TQUS 3PW0A 1Z9FA 1Y14B 4A3GG 3PSIA 4EEYA 1JKJB 4C3JB 1IBML 1S40A 2FJ2A 1TWHH 4HMJA 3LWEA 1HUNA 1CSQA 1X3QA 3GLKA 5ELFA 4DFAA 2DLNA 3P75A 5IT9W 1D5MC 1K83A 2HT1A 1PTOH 1B9NA 2ICEC 4C3IB 4JPBW 4P71A 4TRDA 4KY5A 1YHBA 4DR5Q 3DUZA 2F0FA 2IWHA 3JAML 1LLRD 4IFDI 4FM9A 4KK7A 3N6RA 3SK5A 3S1QH 1SYDA 3GD7A 2UUCH 2Q8TA 4JI5Q 1JJGA 4DR6Q 3BDOA 2JA5B 2JYOA 4K6DA 4HYKA 4BA2I 2ZM6L 4GS3A 2W7OA 1SYEA 4X66L 4IFDH 4DR7H 3Q0AA 1B9MA 4ED8A 3H09A 3KUPA 3OW7A 3EPGA 4AH6A 2BQ3A 2FK3A 2AGPA 3I90A 3LX0A 3GIDA 5LMUQ 4L63B 4QWBA 1A62A 2WB1E 2RF4A 4FXGC 4JK1C 2UXCQ 3GILA 1KNAA 2RHSB 4IRKA 4LFBQ 4BXXH 1GKHA 3PO2G 4NW2A 5F9LA 3FRPB 5KG6A 4R8IA 4HIOA 5JVLA 4RA8A 2HJWA 1HA5A 2LY7A 4Y7NB 3TDQA 1CKNA 3T1YH 1L2FA 4A4IA 1SSOA 2AGOA 4JV5H 1QG7A 5T14A 1S5FD 1BVSA 3VR5A 5KFTA 3T1YQ 1EL0A 5CA0F 3F8TA 3J7A5 2F0DA 2B2VC 1HTPA 2ZM6Q 4DV1H 4ETSA 1DOLA 5C44H 3HXLA 3ONAB 3D3RA 1I4PA 5E7NA 1LACA 3Q22A 4RNOA 5BR8L 4FF3A 3EPIA 3OHXC 5ELDA 5KFAA 4LF7L 1VMPA 3UI2A 4OX9H 4N8X1 4LF8L 2PBZA 1YNNC 3Q24A 1PRTC 4I7HA 1VS0A 1R9TB 5DG8A 1PFMA 4RB0A 3F1ZA 1ICWA 1Y1VB 4C3IH 3E9HA 1G6PA 2VY3A 1FGBD 4J15A 2XGTA 1VQOA 1EWHA 4RGOS 2DZDA 3EFXD 2JEBI 2ZXOA 5KYIA 3S15B 2E5LH 1SE4A 4RFBA 4NXNH 2W6QA 4OONA 4ED1A 4MV1A 1SDFA 3HOXG 4J9SA 2F4VL 3EROA 5JAVA 3I12A 5EDWA 3CCJA 1PH1A 2UXDL 4Y52H 3MA2B 1LV9A 4RMFA 1V9PA 1JXLA 1VQHA 3L7ZC 4NMZA 4BBRB 4A93H 3FMCA 4XQQA 1MHWC 2CH4W 1A6XA 4RAZA 2A68D 4RB3C 4CDEC 1KHIA 3SXHA 3TN2A 3C2PA 3VMMA 3HGBA 3MWEA 4L5SA 2JA9A 2ZXPA 2OTJA 5EZYF 4FF2A 1V51A 1PH3A 3LP8A 1OXXK 3K5LA 2VA3A 4ZUIA 4ME6A 3W1BA 2VUMB 1B70B 1F9SA 4KN4C 2V9WA 2Z4HA 3CQZA 4LFCQ 3OMCA 3QB3A 4WD3A 4AQYQ 2D62A 2J9GA 2X6LA 1PH4A 4JI6Q 2BH2A 2J6SA 2AMCB 3E0EA 4DV1L 4IPDA 2F0VA 1TA8A 2WKDA 1I6HB 5IGDA 3F2BA 2FLNA 1Q1EA 3QZ7A 5LA6F 3T4AC 3EIVA 3NBHA 3AU7A 5ELCA 5D3DA 4GNXC 1K73C 2KEDA 1HXYD 3I55A 4A3MG 4A3IB 1CQIB 4ZLTF 4A3FB 2XIWA 4RKBA 1MD2D 4LAAA 4A2BA 2R8KA 3M85A 5ELNA 4DR3L 5BR8H 2RDIA 1J5EH 2EIFA 5KFYA 1TWAH 1II3A 1KJ9A 3MFHA 2ICIA 4HN7A 5I6WA 2YU9A 3MFYA 1WTVA 2CW8A 4LF8Q 3VR4A 5ISRA 3PO3H 2EDGA 5D14A 4LUZA 1GUSA 1K3RA 4B08A 3K3PA 2R93G 4YHHQ 5LYJF 3VR6A 2O5JC 3MC0B 2EY5A 1YNJC 5K36H 1EFID 2IPKD 4RGTA 4DR6L 1EQTA 2QCPX 4IURA 5IWAH 2I46A 4DV2Q 2QEJC 3EA6A 5EPKA 1VBGA 4ZHQF 2HDMA 1FNVA 3ND8A 4CHTB 5IGFA 2LXJA 3T5JA 2JA8B 4APMA 5IGCA 2F0IA 3S1RH 3KHGA 2R93B 3K7UC 2V4QA 1RTNA 2R7LA 4RHRA 4TSSA 2FLPA 2YTYA 2GLTA 3D31A 3PGZA 4A3JG 2W6NA 1LT3D 3OMGA 4O3SA 2WB1B 1DONA 3H94A 1XMOL 4YCVA 3F8NA 2W9AA 4ZI7F 2IY5B 4DV3H 1KD1C 4L5QA 3DMUA 2CW0C 4XIGS 1S4ZA 1CE8A 4JV2A 3J81c 4I55F 4A3KG 1TS4A 1NE3A 5K2MA 4JYAL 3HOWH 1E1OA 1JR0D 3A8KE 1BBWA 4FXDA 1MJEA 2AWOA 1Q86C 3GIKA 5JVH3 4NP5A 1B6SA 2R92A 2IJ0A 2NU6B 3K7AB 2F1MA 2R87A 5M5XB 1TWFA 2HUGA 1L2ZA 5F9NA 3U58A 3R93A 4MN3A 3CC7A 3RZOB 2XCPA 4A3MH 1TY0A 3GV8B 3PO2H 4YY3L 4UFZA 5KFQA 4OIJA 4A3LH 4CDDC 3GTQA 4O4HF 1EZ6A 2KHSA 2L12A 5M3MB 1D7QA 1IBLQ 1FNUA 2B2TA 3CPWA 1XNQH 4RH6A 5CV4A 3Q8SB 3G4SA 2MNAA 3KHRA 1WJJA 2A74C 4ZCKA 2V5AA 1I50H 4DNTB 2FKLA 2KECA 3ER0A 4CC5A 1EY5A 3CW2C 2IP4A 5EKKA 4IUUA 3MEHA 4DR1L 4QQBX 1JICA 1MJCA 2QGQA 4LF9Q 3N42B 3WO0A 3P7JA 5JEAH 2RDJA 4C5CA 1EY6A 1VQ5A 3ETHA 4JI2L 1XTDA 2IA6A 2L15A 3HKZG 3H0GB 1HNZQ 4DV1Q 4J9NA 3PZPA 1SYCA 2RQXA 3E5NA 2NU9B 4RKLA 2EYFA 2P5ZX 2D2CC 3I4MB 4AQYL 3PQIA 5A2QW 4DXFA 5C8YF 3UQ8A 1QJOA 2EZVA 3CVZA 4ED3A 1TXYA 4DPGA 3QG1A 1SBBB 4G3IA 2NU8B 1QNKA 3A5UA 5CAEB 4JI4Q 5GAHC 3G6EA 1ZHQA 5KX5F 3T53B 1JOKA 3W3AA 3F2CA 1C30A 4QCLA 5DG9A 1J5EL 3AFQA 3PIP3 1X3PA 3OYYA 2BOSA 2NU7B 2A6HC 2BA0A 3HOYG 4JI2H 4YR0A 2N78A 4X65L 2VB3X 4ECUA 1AEXA 2W6MA 2M9VA 4DAVA 2FHTA 3GTOA 3NXWA 1ZYRC 4H0LC 4TUYF 3T1HL 2WTFA 1UE6A 3ITPA 3HOZG 1SNMA 1N9WA 4OX9Q 3KBXA 4MTDA 1ESFA 2K5VA 4RCNA 1E4FT 4XDXA 3DHQA 4RAUC 5C6AA 1XPRA 1SFOB 3PCOB 4Q8EA 4O2BF 2UUCL 4GKKQ 4DV5L 3O13A 1JOQA 2WINB 5CV6A 1HNXH 1JT8A 3RR5A 4F88A 2MO0A 3S1NH 3QFFA 1BO0A 5LXTF 4A3FG 1N32H 2UUBQ 4H7BA 3LNNA 3GTKH 1B50A 1C8CA 5CB4F 4YY3H 4B3SQ 3PVXA 1JE4A 2EXDA 4V0BA 4JI1L 1IBKL 2N88A 2UUAQ 1TWGA 1PH8A 1IBLL 2R7NA 1CUKA 4DUZQ 4FBUA 1H9SB 1KL9A 2Q2TA 3S2HH 4IOAA 1JDEA 3ZYYX 4DAPA 2MHVA 1GSOA 5A2QL 1N33L 1DIKA 5HV6A 1S97A 4JC0A 5KFWA 1V8QA 2B2UC 3G48A 3V6KA 4K8JA 4FDBA 3J81i 1HR0H 2ID0A 3PR4A 3J7ZC 1U0LA 4QW8A 4DAMA 1K1SA 2M2LA 4J8QA 2Q2UA 1MBYA 3MXGA 1HR0Q 4HNUA 1L1OA 3L4JA 4DR1H 3PUWA 3BAAA 4QWCA 2EQSA 1J9OA 2PQEA 4YB8B 5CV8A 4M1UB 5KG4A 4WORA 2KA7A 4G57A 4F4WA 1Y1VG 1HNWQ 1SMYD 5AJ3L 3KHLA 5F2DA 5E4WC 2I0QA 5IWAL 3AFPA 2JSOA 1OTCA 1WFQA 5IIFA 2BQUA 4OWWB 3KYHC 2RKSA 1GLVA 4B3SH 4A3EG 2ZJPA 1Y8OB 5IYCG 2R7ZA 1UUPA 3T5LA 4FP5D 1AE3A 1LT5D 2NTTA 1BNZA 5H80A 2NVXA 1HA6A 2PNHA 1BDOA 1CQFA 2W8LA 5IP7H 3OWEB 4V190 4A75A 1K83H 1A8VA 1HNXL 5CORA 4GKJH 3K5HA 1SNQA 1AN8A 2LXKA 4F4ZA 4O1NA 1M0TA 3DWQA 2YW2A 2ZXRA 1I4XA 3IL8A 2DUDA 5JJKA 4ME5A 4X66Q 2V4DA 2E2IA 4KMUC 1AZQA 5M5XH 1BOSA 1SE8A 1E22A 1KDCA 5C5JA 1VQ7A 2FK1A 1BCPC 4X66H 3HOUB 2JA7G 4UDUC 4P75A 5IGGA 4JOIC 4M7EA 4DL3A 1Y1WB 1I94Q 1I7NA 2OEOA 4POGA 1DOMA 3HOXH 1ICFB 2D0PA 3GTJB 1W3SA 1DGSA 3TEHB 4L5TA 5BN5A 5E4XA 1BXTA 3R8BA 4KY6A 5KFRA 1UNSA 5KRUA 3BVZA 4DL7A 1NMGA 2DIKA 4LF9H 1VQKA 5J22A 2VA2A 5I47A 4C5AA 4B3MQ 1F2LA 3ORQA 3CC2A 2CQYA 1DOKA 2A6EC 4UP7A 4IUQA 1A3VA 4JI1Q 1IBKQ 4ED0A 3I8ZA 4B3SL 1S68A 1ULZA 1N8RC 1PH6A 1JB3A 3QR8A 3BU2A 2B29A 3ULLA 3R5XA 3L3OC 2SOBA 3A5ZB 3I4NG 3H15A 4ECXA 5EQ0A 4DV5Q 2EJMA 2JA6H 3OOCA 4B3ML 3H0GH 1FGUA 4CKCA 4MIUA 2Y0SB 2AKWB 1U4PA 3VDYA 5IP7G 4RG1A 1YHQA 3GTOH 1WR2A 5DG7A 1X56A 3N6XA 2R93H 3HEJA 3STBC 3J80c 1WI5A 3KXYT 3FEWX 2XC9A 3RLOA 4MA0A 4BA1I 4AIMA 4E4TA 4DV7L 4LSAA 1IBLH 2FK2A 4G7HC 1A63A 4O2AF 4A3EB 1EIYB 4X64L 3NEMA 2BH8A 1YJ9A 1HNWH 3G6JB 3OIQA 1RD9D 2RDFA 1D5XC 3GTKA 4KHPQ 5KG1A 1DV1A 4XX0B 3R2IA 1W6JA 3VPBA 1OXSC 1JJCB 1GO3E 1BUVT 2G9DA 5L1IA 3HOZB 1EIHA 5M3FH 2NZHA 5EBDA 4LFBL 1N36H 4LH7A 2PQAB 1VF5C 3DM3A 3FPPA 4I50F 4TQRA 1GUWA 4JI3H 1VQNA 2ZTDA 3K7AH 4U6PA 3S16H 1AP0A 4DK1A 3HOWG 1GUNA 1YITA 1Y1WH 1CI3M 3HOXB 3GV6A 3KF6B 3GTJH 2JEAI 2LS01 3C1EA 3MXPA 4WJ3M 3I56A 4X62H 3RLFA 2A5HA 2CVRA 2F0QA 1F2YA 4A3FH 1WD0A 3G6XA 4DR5H 1PYSB 3AMUA 4GOPA 1PMRA 2KCNA 4X3SA 1IKLA 4OX9L 1DZ1A 1K3BC 2FMMA 3S24A 4ED7A 4QB4A 4G7ZC 3PO3B 2SDFA 2L5TA 1N32L 3GIPA 1PH9A 2W70A 2R8IA 4Q43A 2KOLA 4A3BB 4PQXA 3RJ0A 3RB4A 1PV4A 2CQAA 1SFOA 5C4XH 4R9WA 4KN7C 2HIVA 1Q7YC 2KUMA 4H02A 4JVZA 1UC8A 1I4HA 1FKAH 1PXUA 3OHBA 1DYQA 1BBXC 4IR1A 2A73B 2B2VA 2X0SA 3S1RB 1YJWA 2EY1A 5IT9c 2HHHL 3G71A 1YVCA 3KLRA 3A55A 1PZKD 4KY7A 3S1MH 1EY7A 4EYIB 5FD5A 2C2RA 2Z8LA 2VUMA 1Z6HA 2F0NA 1H9MA 4JI0L 5C4ZA 4ED6A 1J6QA 4EEQA 4JI2Q 3KF6A 2B2YC 2NUCA 3JSNA 4IWYA 3CCEA 4EYHB 5FPOA 3URYA 2YS7A 4IRCA 4YR2A 4QIWE 1SJED 5FD6A 3PUVA 1VQDA 5FK9C 2HDLA 3H0GG 3HKZB 3TSSA 4ZYSA 2E2HH 2NVTH 4O3NA 5KFBA 3K59A 1LTGD 3K58A 3AQQA 3I4NH 3IAYA 3CF5A 4X3TA 1UAPA 2PMZA 5IODA 1PRTF 5KKNB 4IQZA 2JA5G 2KCMA 4YJ2F 4LF4L 5CA1F 3HP3A 3K5OA 2R7ZG 1D2BA 2C9OA 4ZRZA 3OHAA 1D1KA 5LHY1 3A7AB 1LTSD 4UCOA 4KV6A 3JRWA 4E6IA 4X64H 4M8AA 5CMDA 5KFDA 4R7RA 1Q81C 5KFUA 5EKIA 2ZDHA 1PLFA 3PW2A 2PW5A 2UXDQ 1V1QA 2UVWA 1EY0A 2VB2X 4JBKA 3OWFA 3ERSX 5EOYA 5HY6A 5CR3A 1E7ZA 1AUVA 3PUZA 4F8MA 1HR0W 1N56A 2JA7H 1XMQH 1TWCB 4XYLB 3MAQA 4WJ4A 2JA8G 1OXUA 2C22A 2YYZA 3VA7A 2RCNA 1UE7A 2TSSA 3OIPA 2R92G 2QYZA 3A8IE 2Y0SG 4JOIA 1D1IA 4DK3C 5D1OA 3IRBA 1SEBD 4IUTA 2NB0A 1KC8C 4X65Q 4LW1A 3GTGA 4K0KL 2JEIA 4KJOA 1J8IA 2F0PA 1PH2A 3WDNA 1WTRA 3NGDA 3S1MB 4X64Q 3I4MH 4BY7G 1PZID 2M05A 2IMWP 2MQHA 5IYBG 3CRLC 3VR2A 2YZMA 1E4EB 2BA1A 1K8AC 3BZDB 1G8ZD 3I7FA 5FO8B 3SVMA 1EYGA 2K05A 4MV9A 1E3PA 2DNCA 3CCMA 4XYQA 2ATLA 3J7AK 3H3VI 1UEBA 1A3UA 4Z9CB 5KFEA 4YCWA 1RTOA 2VQEH 4KD3A 3W2DA 1VQ6A 4BWSC 4JYAQ 4EFEA 4C2MB 1YI2A 1A15A 1BGWA 1SYGA 3CCSA 5C4HA 1PK8A 1EHIA 5C4XG 2RGRA 2AQ1B 3W5OA 2OH2A 2OLSA 2HQLA 3K57A 2NWGA 2ZJRA 2E2IH 3MZ5A 3U9SA 3IKJA 1FR3A 4C5BA 3RN2A 2EYHA 4C3JH 1QWYA 1V4YA 3UDFA 1G291 3D6WA 5C3XA 1ZHSA 4IR9A 2EYJA 1F9RA 3EBEA 5M5YH 4X6AH 3KAJA 2J6UA 1K8MA 1QNUA 2RDHA 2FE3A 3LMLA 3N41B 2QILA 3Q23A 4GNXB 4X3KA 1JCKB 1O80A 2XWJB 4YCUA 2W7PA 2Q8IB 3GV5B 3G7LA 4PG3A 5AJ3Q 1EFWA 3TS2A 2VXWA 1W2BA 3RTXA 1BJTA 4C3HH 1EWCA 4YR3A 2K50A 2E8GA 1QVCA 4OWTB 3VA5A 4HNTA 3CCVA 1VQMA 3WWVA 3J81W 1K1QA 4MV3A 2F4VH 3KLSX 2NUAB 2LKVA 2C2DA 4YAJB 4FF4A 2V59A 1EUCB 1S5CD 2YCHA 4K5VA 3BVMA 2Z4IA 2DY7A 5I4DA 3T1YL 3HOUG 2UVRA 3TZDA 2VW9A 2HCCA 1CQJB 4QWEA 4HSPA 2JA6B 2F0UA 5JVG3 1LT4D 1HZBA 2XCAA 2ASJA 2R8HA 3L2PA 1IYUA 2L9HA 2ZTCA 1K0RA 1VMCA 2NYZD 5C4JB 4X62Q 1SR3A 1HUMA 2KHIA 5HGQA 1Y1VA 1U4MA 4LWCA 4IHJF 2UXCL 2DJFC 2J0TD 4O3PA 2DWCA 2JA7A 2VS1A 1PHJA 4FS2A 1WH2A 4POFA 3J7AV 1Q3LA 1GJXA 2PMZE 2JP1A 1XNRL 5LMNL 4DR4Q 2XGPA 3WO1A 1PYBA 3JRXA 4IOCA 2AQ3B 5TSSA 4F7XA 2M00A 1N48A 4G7OC 3UE1A 4EQ5A 1KQSA 4YJ3F 1KABA 2WB1G 3TZUA 5DNFA 2PZTA 5DGAA 4LFCL 4DV5H 1LTTD 2E5LQ 1SYFA 3NQIA 2QF7A 2PQAA 1HR0L 3CMEA 4WBNF 1T3NA 2WAQG 4KHVA 1WVLA 1QILA 1SNOA 2RHQB 4CJ0B 4HQ6A 4DKAC 1HQMC 2XVSA 2HGSA 4R4CA 3V4SA 4YAKB 4DUZL 3HBLA 5C3WA 2KSWA 4UP8A 2YTVA 3GP7A 3RB0A 4YP3A 2FP4B 3NWTA 1IBKH 4JI1H 3CCRA 2BDNA 4B3TQ 3SE7A 1TT2A 4O0AA 2Q2IA 5KT5A 1XPOA 1EYZA 2UUBL 3BA9A 1SE3A 5M3FG 1MSGA 2E5LL 1EY9A 2R85A 3TQYA 4P74A 2FMAA 3AYHB 3STBD 1Q90A 1F9PA 3SDZA 2K52A 3RMHA 1I94H 1H9KA 2H1EA 1MZBA 4I7AA 3IG0A 4UCVA 1EOVA 5EPJA 1MKHA 2F0OA 2K03A 4QUCA 1PFSA 4JG2A 4A3JB 1FJGQ 3GTPB 2RBMA 1IBMQ 4R4QA 1KC7A 1R4QB 1IL8A 1XJVA 2Z6BA 1Z2NX 1XMQL 4J9QA 2F0MA 4HCSA 5KG3A 3GTMB 3MXNB 4DLKA 2UXBQ 4GC7A 3Q8PB 5FO7B 4I65A 4N9TA 1TWCA 4ECVA 1EYDA 5GROA 1EU4A 2K01A 2WP8J 5L37A 5EWFA 2YV5A 3QIAA 4QWAA 3KDFA 4HSVA 1VQCA 2NVXH 4IJLA 1Z47A 3GTJA 4A3EH 5M3MG 1LABA 4EBDA 5LMUH 4CJ2C 1K8OA 4C3JG 1PH5A 2VOBA 3CRKC 1WTXA 2XN9C 1WTPA 5M9OA 1C9OA 1S0OA 2YRXA 2B63A 2L4NA 2HCIA 1FYCA 2O2LD 2NVTB 3GIIA 1R4PB 3BYTB 4QWDA 1STYA 4DR1Q 1GSAA 1EU3A 3JC66 1FNWA 4MV8A 1ZEQX 4BBRG 4QGUA 3A56A 2GVAA 3QWNA 4LFAL 4NXMQ 4TV8F 3H3VC 1MI2A 1XMOQ 2B2WC 2L11A 3CQZB 2XGQA 5JPNC 2IX0A 2R7FA 1CTMA 4GNXA 4DUZH 5LMUL 2FPPB 1R9TH 4DGZA 4J1MA 2Q2HA 1D5ZC 5CV7A 2I8CA 1KLUD 1SNPA 2YL2A 3D4RA 5DLQE 4KLKA 1H9RA 2F0HA 1B44D 4UY8C 4BXXG 2MO1A 2JA7B 4DL4A 5KT2A 3DXJC 3HRZC 1VQEA 2WACA 2FPGB 3MR5A 5FLXW 4DV7Q 2MP1A 2UXBH 3HS0C 3N40P 3ERQA 1N34L 1S0NA 1PTOD 2F0SA 1A9XA 3P20A 5D3IB 5CBEE 5IE8A 3GTLH 3HOVG 2WFWA 2XTIA 4IFDG 3X3MA 3J7YW 2K5HA 2JA8H 3PMFA 2B8FA 2NVYH 3BG3A 1BR9A 4HEDA 2CZGA 4DL6A 1N34H 2F0TA 3M9MB 1IL2A 4UCTA 2FJZA 4HAEA 2RA4A 4DV4L 1RF2D 4P2CB 3RZDH 4N8FA 3GV7B 5FLMG 1UNNC 1S5DD 3LGJA 3KDFB 1V1PB 2EYOA 2KQ3A 5J3BA 1I3QH 4JYAH 2MUYA 4LF8H 2ALYB 1FJGL 2N49A 3NENA 2L0CA 4DNIA 1Y69U 3GTQB 1M6VA 4DK0A 3PR5B 2BQRA 4BY7B 3RAXA 3MXNA 1VQ9A 4FF1A 1OXTA 1BF4A 1EZ1A 3Q8QB 2VQFH 3RV3A 5IYBH 1MSHA 1SXTA 3GIJA 3T56B 2W6PA 1KJIA 5JEAG 4NXNL 4DUYQ 2JJQA 3HKSA 2IX3A 2ASBA 3KJOA 1SFOH 1N36L 2E2IB 2O4XA 1CKNB 3RB3A 3Q8DA 4DR2Q 5IYZF 3PO2B 4JBMA 1E24A 4EFBA 3E5SA 1T5XD 4I7ZC 4LF5Q 3S1NB 2RSNA 3NTHA 4ZQ3A 4G4KA 2YYAA 1T36A 1A2TA 1X55A 4K8IA 2I80A 1ZXTA 3GTKB 1JWSD 2MPMA 4ZKBB 5M3MH 2UU9L 1XMQQ 1HFNA 2ZJTA 4EQPA 4DR3Q 1ILQA 1B8AA 3UDXA 4PNYA 2GA4B 3TP5A 3TIIA 1XNRH 2R3ZA 3H3VH 3A54A 5CC4A 2MGSA 1VQ4A 3L4KA 1CM9A 4L5RC 1W93A 4A3LG 1I50B 2A69C 1SYXB 2IBKA 5C5LA 2UUCQ 1GUOA 3M4IA 4DL2A 2FXQA 1DM0B 2PMZB 4AYBG 1E0BA 2I07B 3S15H 1EY8A 1TWCH 2A1AA 4HMIA 4NKLA 4A3DG 4A3DB 5K36G 3OTOH 1NSNS 3KLSA 2ZT9C 4DV0H 4GC6A 4HIDA 4LFAH 1I5FA 1CK1A 1ET6A 1GGOA 2JA5A 3NSWA 4TQSA 1UWVA 3BQ0A 4LUOA 4LMQD 5GQOA 4JI6L 3BS1A 1SRUA 3Q8RB 3PIOA 2WKCA 3ICEA 4A93B 1EYCA 1LM0A 1CHQD 3NTKA 4TV9F 4U673 2QK4A 3KF8A 1BQQT 1I3QB 2P0AA 2W9BA 5M5WH 4GKJL 1SJHD 1B3QA 1TWGB 3I3CA 5CBAE 1PH7A 1FVIA 2R82A 1Y8NB 4O3RA 3HOVB 4XZ3B 1BKBA 3SK8A 2RCFA 4KKTA 1TR5A 2IHFA 5C3EB 2B63G 3TMEA 3S14B 1N34Q 2JE6I 2VUMH 3FMAA 3A0JA 1SNCA 5HGTA 2CH4A 3NBIA 3TQ1A 1TWFB 1RJQA 3MR3A 3IFTA 2FMCA 2NVYA 4C2MH 1RIPA 4RNNA 1GHKA 3TIGA 5CYUA 4TKOB 1SAPA 3TQTA 3HZXA 2F0KA 1RYSA 1B7YB 4XQNA 3KTMA 1SNDA 3RBDA 4PV1C 4JI8L 2EYMA 1G2TA 3VYSA 2K75A 3R23A 4ULLA 1BCPF 1JIHA 2PZUA 1CT1D 4FVMA 3V2TA 2K5WA 2MFIA 4L1KA 3HKZA 1ONLA 4LF4H 3CCUA 1VKZA 3MR6A 2AHOB 2HD3A 1TWAA 3M4QA 3SK4A 1P16A 5C1PA 4Q44A 5DLFA 3BYYB 2NZ1D 4C3HB 1NJIC 1HZ9A 5BR8Q 3FP9A 3KHHA 5KFLA 1X3GA 1VCIA 5I9OA 4LF7Q 5LP6F 1B3AA 5FLXc 4HR7A 5IT9L 1V43A 4A3JH 1E2ZA 4CBVA 3SI8A 1SCUB 1G51A 4O3QA 4JI6H 5KGUA 4F50A 4GN4B 4DV6H 1Q8IA 1HNZL 4BBSG 4WJWA 3CD6A 4A3CG 1EIGA 3M9NB 1STHA 2KCTA 3R5FA 3RZDB 1JQYD 4RGNA 1GUTA 5JJLA 4HJ8A 2PCFB 2YU9B 2DNEA 3PIO3 1S10A 1L1OC 1XTCD 5LOVF 1TWHA 3A7LA 2NN6G 1PFBA 3J7AF 4X62L 1E4EA 4IZOA 2UXDH 2R61A 4GLXA 2BCOA 1QCBD 4RU9A 3PF5A 3NPPA 2RSOA 4DR7L 2YS6A 4QW9A 3VPCA 4S3SA 2K6AA 3BQ2A 3S2DB 4XT1B 5ELOA 1WCMB 3RN5A 1CZGA 2QKIC 1IBMH 3HOWB 1WTQA 1TU2B 3KK7A 5DGBA 3V6HA 3OSPA 5KEEA 5T1IA 4HIMA 1H95A 4O2DA 4ALPA 1E2WA 3E0JA 4JI5L 4DR5L 4KI0A 4KHPH 4UP9A 5FLMH 1S9FA 3BG5A 5KFSA 3J80W 3K6OA 5G3LF 1RL2A 2R84A 2C35B 1RKNA 1N33Q 3NELA 4ILWA 4K0KH 1T9HA 1O78A 1VF7A 4DAYB 5IYDG 2R6FA 3PUYA 2A68C 3QOLA 1P8LA 5KNBA 4C3IG 1SMYC 3DLLA 5BPHA 1VQPA 4DNRB 1RCVD 1X9NA 2DN8A 2FINB 5KFFA 1GXDC 1EEFD 2HVQA 1STEA 1QUQB 2WB1A 5K5PA 3M4PA 3FKIH 4JI8Q 1HCZA 3S1QB 4FXKC 1YBYA 3I4OA 2DGYA 4A3GB 2HIXA 2PPBC 4CC6A 4K14A 5JEAJ 4NDXA 3C46A 2OCEA 3PIPA 1MIUA 4CDFC 5IT9E 3GTPH 4FNFA 3Q2OA 1I6UA 4CJ1B 4DR4L 4OGQC 1KXLA 1SROA 1EOTA 1RK6A 5FKAC 2F0GA 4K2LA 4L8JA 1F2MA 1WTHA 4QJFA 5COYA 1Q82C 2E2JB 3VPDA 5EKLA 5LL6b 1X3EA 4U7CA 1JJ2A 4XYMB 3JAME 2SCUB 4JI3L 5IGBA 2V58A 1B53A 2EOTA 1J5EQ 3QOJA 1M0WA 5M5WB 1LTID 5JH7F 1TWGH 2PW7A 3D4WA 2NVQH 2R8GA 1B04A 3MTSA 1BCPB 3HKZE 4QMGA 4ZKCB 4LJZC 3DWAA 4YWKA 2KJXA 3SK6A 3GTQH 5LL6X 4AYBE 4IPGA 1L1OB 3RB6A 4B3TH 4ECQA 1TVXA 3I70A 3L9AX 3HOZH 3UFXB 4OL7A 5JOBA 1LTLA 1HJPA 4B9XA 3CU7A 1QOHA 1VQLA 1VDZA 4JI5H 5C44B 1N33H 4K6LA 5LMNQ 2R92B 4QF4A 5JJZA 4JUZA 4A3IH 1ML0D 5KT7A 2VNUD 1U5KA 2PI2E 2LFNA 4PZ8A 1XX8A 4GZYC 1STBA 4PWQA 1CKOA 2F4VQ 1T5EA 3E9IA 4N9PA 1UE1A 2B2UA 2E2DC 1IYJB 4K5XA 4M9UA 2ASDA 3U4VA 1IOWA 4FS1A 3RBEA 2K4KA 5L1LA 1STAA 1Z7TA 4HIKA 1PZJD 3BZCA 4FYDA 2JEGA 1PTOB 3BDCA 2CW7A 1XMOH 1YNXA 5FO9B 1E1TA 2K32A 4B9WA 2Y0SE 2G9HD 2NN6I 1N32Q 3LWBA 4MTNA 1HPCA 4R4TA 4YY3Q 4LF5L 3S2HB 2IL8A 4RGMA 3KALA 4IWXA 2MCTA 2CW0D 4A3DH 3FDSA 2C5CA 1WTWA 1EEID 4XXEA 3FHWA 2AU0A 2I5LX 3JSLA 1UE5A 1VQIA 4A2AA 1VQGA 4LMYA 4DUYL 1DCZA 4NXNQ 1IYVA 2KENA 1C48A 5T1GA 2AUKA 1EQQA 4RB1A 1IW7C 4OIKA 4C2MA 5DLGA 2D9UA 3ZJYC 4J9LA 2HVRA 4OXPA 2V4RA 3ULJA 3S9WA 4O4LF 1E4GT 2YU9H 1WYDA 3T5HA 3KF8B 4EGVA 4UCUA 4R8UA 1EWIA 1EYAA 3B6YA 1IZ6A 1HNXQ 2PN1A 3MHBA 4IZ8A 4K0KQ 5KFJA 2XWBB 3FVQA 3MXUA 4OO1G 5C1OA 1TS5A 2N55A 2L1BA 1KJQA 2JEFA 3H4BA 1WCMH 4BWGB 5IP9G 3GQBA 1RHPA 3HB9A 3CCQA 1I6HH 4RUAA 4JI7H 4IJHA 3H4DA 4FO2A 3T5KA 2W8KA 3GTGB 2BDOA 4O42A 1DD2A 5KNCA 4YBZB 2DPJA 1HNZH 4A3MB 3SEBA 1I6VC 4WFN3 2E76C 3R2TA 4DV2L 2YRWA 4ZAIA 2E75C 2F0LA 5DM73 2CHBD 4ABNA 5GAEC 1IHZA 1KJ8A 4RHSA 4ECTA 3R3OA 1KLGD 2EY6A 2I5HA 4DAYA 4MTEA 3BJYA 4LF6Q 1T94A 4IUVA 3EJIA 4R4IA 2MJ8A 2EXZA 3H40A 1XDNA 2VUMG 3MWYW 2B8GA 4LFAQ 3TP6A 4EQOA 3CC4A 4NXML 2FB9A 2XCLA 1U9RA 1SEIA 2VPQA 1S03G 3C1FA 1ZKOA 1BNCA 4F4XA 2F3VA 3NK9A 3FPUB 5D8DA 4C1NK 4XQJA 1K0SA 4IUPA 1AH9A 3RGXA 5KG0A 2JA6G 5C44G 3TS0A 4C3HG 1S72A 5JQWA 2C00A 2EE1A 4QUFA 5I2YA 3JAMc 3H0GA 5I2XA 2ASLA 3M4YA 4P73A 2AQ2B 2LSSA 4JV1A 1CQVA 3E3XA 3DEOA 5KFZA 3FKIA 4P72A 5DQGA 4EQNA 4LF6H 4B3RQ 1GYFA 3P1HA 2QA4A 4DV0Q 5L1KA 2A6ED 1TS3A 1QVGA 2NVQB 3JZIA 4A3KH 3I4LA 2WDTA 1CKMA 2R7ZB 1JMCA 3MJFA 2FLLA 1NUCA 1CSPA 1ENAA 1PRTB 1F77A 4QIWB 2NTSA 5C0XH 3V4ZA 4AYBA 5BN3A 1R9TA 3WOFA 5KYLA 1LYLA 5C3EH 4RCOA 3QO2A 4JBWA 4JCVE 2WYOA 1RJRA 3TP8A 2O5IC 5GAGC 1NNXA 3F2UA 1GHJA 4B3RL 1W6KA 2E2HB 3LWUA 5KFNA 4MTKA 2OT2A 3I4NB 4DA2A 4PZ6A 4H13C 4JV5L 1UC9A 5A35A 1JB7A 4HR7B 1L0XB 3JAMi 4PMBA 3UE0A 5KG2A 4QIWA 1VQJA 2UUBH 3K0YA 2F0WA 1UEAB 1KAWA 3EYYA 1H9SA 3WOEA 2H5XA 5EGTA 4DUYH 3KLWA 4ZUJA 2FPIB 3VR3A 4J9RA 4IPCA 5DM63 1G6ZA 2BE5C 1DJRD 1TWAB 1K8GA 1S3OA 2CWPA 3PW4A 3M9BA 3D4DA 2LMCB 3MFGA 4GOPB 3PO3G 1KIXA 5AFWA 2XIGA 4ID6A 4JI7L 4R1JA 3V05A 3CKIB 4DN4M 4LF6L 3TRZA 1B33N 2ATWA 2K5QA
chains in the Genus database with same CATH topology
1GM5A 3L0OA 5IYBH 2K14A 3A5ZB 2UUAL 4A3GH 4MZ9A 2IX1A 3I4NG 1QVFA 3H15A 3F2DA 4DV5Q 5JEAG 5FJ8G 1M90C 2JA6H 3OTOQ 4NXNL 4DUYQ 2JJQA 3CXCA 3H0GH 1FGUA 3HKSA 2HHHQ 4B3ML 4KHZA 2GN5A 2ASBA 3KJOA 2AKWB 5C0XG 1SFOH 1HH2P 3CQZH 4GN5A 4TQUS 4RG1A 5IP7G 4DV0L 1Z9FA 3VDYA 1CKNB 1Y14B 3Q8DA 3PSIA 4DR2Q 1N36L 4A3GG 1X56A 2R93H 4JBMA 1E24A 4JBJA 2K5NA 3STBC 3J80c 1S40A 1LUZA 1IBML 1WI5A 4LF5Q 1TWHH 1M1KC 1X55A 4DR7Q 1A0IA 1CSQA 3RLOA 4BA1I 4AIMA 2UU9L 5M3MH 4DV7L 1XMQQ 2R7ZH 4DR3Q 4HJ9A 4A93G 3BU2A 1X6OA 1B8AA 3UDXA 1A63A 1WOCA 2JK8A 3H3VH 1EIYB 4X64L 2GVBA 3NEMA 1VQ4A 2HT1A 3HOYH 5JJIA 2BH8A 1YJ9A 4L5RC 1XNQQ 4A3LG 4QY7A 4P71A 1YHBA 4DR5Q 2UUCQ 1VQFA 4KHPQ 2CQOA 3M7NA 2FXQA 4AYBG 4MNOA 1OXSC 1JJCB 1GO3E 4IO9A 3S15H 1TWCH 4A3IG 2A1AA 3S1QH 4A3DG 4IFDI 5K36G 3GD7A 4BY1G 4JI5Q 1VQAA 5M3FH 2NZHA 4DR6Q 3S2DH 4LFBL 1JJGA 4BA2I 3GO5A 4HIDA 2PQAB 2ZM6L 1I5FA 3BZKA 3DM3A 4GS3A 4YHHL 1C7YA 1VQNA 2ZTDA 4X66L 1SN8A 1UWVA 1PA6A 3K7AH 2R92H 4AH6A 3S16H 4LUOA 3NBHB 3HOWG 1YZ6A 5GQOA 1YITA 1Y1WH 4JI6L 1SRUA 5LMUQ 4JI7Q 2A19A 3KF6B 3PIOA 3GTJH 3ICEA 2JEAI 1O7IA 2CFMA 4WJ3M 1LM0A 1A62A 3I56A 3RLFA 2WB1E 2RF4A 4A3FH 2UXCQ 4LNQA 2RHSB 1PYSB 4LFBQ 4BXXH 1GKHA 4GOPA 5M5WH 3PO2G 4GKJL 1KRTA 4OX9L 3K80C 1PH7A 1FVIA 4HIOA 3S24A 3K81C 1BKBA 2B63G 3MEFA 2I5MX 2IHFA 1N34Q 2JE6I 2VUMH 1CKNA 1L2FA 4ME3A 4A4IA 1N32L 3A0JA 1PH9A 4JV5Q 1BVSA 4C2MH 1RIPA 3T1YQ 2R7DA 3F8TA 2UU9Q 3J7A5 1PV4A 5C4XH 2ZM6Q 4PMWA 1B7YB 2HIVA 4DV4Q 1Q7YC 5C44H 3PUXA 5E7NA 4JI8L 2D0OA 4H02A 2KBNA 2K75A 1EIFA 5BR8L 4IPHA 4KHPL 4LF7L 1YJWA 2HHHL 5IT9c 3G71A 1YVCA 5C4JH 2MFIA 4LF8L 1VS0A 2YTXA 3S1MH 2VL6A 5IYCH 3F1ZA 3CCUA 2AHOB 1JE5A 4C3IH 3M4QA 4JI0L 1Q1BA 1P16A 3E9HA 1G6PA 1J6QA 2VY3A 4JI2Q 3KF6A 4J15A 2XGTA 1VQOA 1NJIC 1HZ9A 3CCEA 2OTLA 1NMFA 2JEBI 3FP9A 5BR8Q 3PV0A 1X3GA 4QIWE 1VCIA 1ASZA 4LF7Q 3PUVA 4OONA 1VQDA 5FLXc 3HOXG 3H0GG 2F4VL 2E2HH 1V43A 2NVTH 3CCJA 3K0XA 4A3JH 4R4OA 3AQQA 1PH1A 3CCLA 3I4NH 2UXDL 3CF5A 1G51A 4Y52H 4RMFA 1V9PA 2JA5G 3HOUH 2KCMA 1VQHA 3L7ZC 4GN4B 4LF4L 1HNZL 4A3BG 4A93H 4BBSG 2R7ZG 3CD6A 4A3CG 3HFZB 1KHIA 2KCTA 3EN2A 4A76A 1EUJA 4PZ7A 1Q81C 4OO1I 5JJLA 4HJ8A 4L5SA 2JA9A 5C0XJ 2OTJA 3J80i 1PH3A 1L1OC 2OQ0A 3AEVA 2UXDQ 1OXXK 1V1QA 2NN6G 2CCZA 1OXTA 4GLAC 4X62L 4JBKA 2WAQE 2B3GA 3ERSX 3W1BA 1B70B 5HY6A 1E7ZA 1NBWA 4LFCQ 3PUZA 3U4ZA 4GLXA 1HR0W 2JA7H 1YHAA 3CAMA 3PF5A 1X65A 4AQYQ 2D62A 2JA8G 4DR7L 4WJ4A 1OXUA 2YYZA 2RCNA 1UE7A 5ELOA 3RN5A 1PH4A 4JI6Q 2AMCB 3E0EA 4DV1L 4IPDA 1K9MC 2BH2A 2R92G 2Y0SG 4DR2L 4JOIA 4DK3C 3F2BA 1D8LA 1Q1EA 3IRBA 1VQ8A 4IFDJ 1KC8C 3RLNA 3EIVA 4HIMA 1H95A 4X65Q 4LW1A 4O2DA 4K0KL 4ALPA 4JI5L 4DR5L 4KI0A 2Z0SA 4UP9A 4GNXC 1K73C 1PH2A 5FLMH 3GTMH 4EX5A 4TVAB 3I55A 4A3MG 4GLVB 1RL2A 4X64Q 2C35B 1N33Q 3I4MH 4BY7G 3NELA 2MQHA 5IYBG 1T9HA 2N8NA 5C0XI 3M85A 5ELNA 2BA1A 2CWAA 4DAYB 5IYDG 4DR3L 1K8AC 2EIFA 3PUYA 1TWAH 1P8LA 3I7FA 1EYGA 1E3PA 3DLLA 3CCMA 3U50C 1VQPA 1X9NA 3H3VI 1UEBA 4LF8Q 3S14H 3PO3H 4YCWA 4LUZA 3CMAA 1K3RA 1QUQB 1VQ6A 2R93G 4LF9L 4YHHQ 1HNWL 3M4PA 3K8AA 4JYAQ 3FKIH 4JI8Q 1YI2A 1YBYA 3I4OA 2DGYA 4DR6L 2HIXA 3CCSA 4DV2Q 5JEAJ 5C4XG 2OCEA 3PIPA 1HZCA 1MIUA 3OTOL 3GTPH 2JQOA 4B3TL 2LXJA 3W5OA 3GTGH 2KHJA 4DR4L 1SROA 1KXLA 4QJFA 1Q82C 2HQLA 2ZJRA 2E2IH 3S1RH 4JI4L 2Z6KA 3RN2A 4C3JH 1X3EA 1JJ2A 3K7UC 3UDFA 1G291 3EBEA 5M5YH 4X6AH 2IHEA 4JI3L 1IXRA 2AWNA 2YTYA 3D31A 3PGZA 4A3JG 1J5EQ 4GNXB 3BJUA 3CP0A 4YCUA 1ASYA 1TWGH 5AJ3Q 4PG3A 4YCVA 1XMOL 1EFWA 2NVQH 1W2BA 3TS2A 4C3HH 2K50A 2E8GA 1QVCA 4OWTB 3HKZE 3CCVA 1VQMA 3WWVA 4HJ5A 3FKIG 2IY5B 1KD1C 4L5QA 4XIGS 5H1SE 2VQEQ 5EAYA 4YWKA 3GTQH 3J81c 4JI0Q 4AYBE 4IPGA 4A3KG 1L1OB 1NE3A 4UPAA 3UDIA 4JYAL 3HOWH 1E1OA 5IY0A 1BBWA 3HOZH 3T1YL 1LTLA 1MJEA 1HJPA 2AWOA 1Q86C 2JA5H 3HOUG 1KRSA 1VQLA 2VW9A 1L0WA 1HZBA 1WCMG 5LMNQ 4BY1H 2ZJQA 3U58A 3L2PA 4A3IH 2ZTCA 3CC7A 2VNUD 1U5KA 4A3MH 1YJNA 2PI2E 4PZ8A 1VQ9A 3PF4A 1K0RA 3PO2H 4X62Q 1SR3A 4YY3L 1CKOA 2F4VQ 3E9IA 2KHIA 5HGQA 4A3LH 4LWCA 1UE1A 2UXCL 1IYJB 3KOJA 3TREA 1YIJA 3U4VA 1D7QA 2VS1A 2K4KA 1PHJA 1IBLQ 4POFA 3CPWA 1I94L 4HIKA 2PMZE 3BZCA 1XNRL 3G4SA 2MNAA 1OXVA 5LMNL 4DR4Q 1WJJA 1YNXA 1PYBA 1I50H 4IOCA 1E1TA 5LMNW 5IYDH 2PI2A 2Y0SE 3ER0A 2NN6I 3CW2C 3UE1A 1N32Q 4EQ5A 4MTNA 1KQSA 4R4TA 4YY3Q 4LF5L 4DR1L 1TWFH 2WB1G 4A3DH 4QQBX 4DK6C 1MJCA 2QGQA 3FHWA 4LFCL 3SGIA 2I5LX 1QZGA 2E5LQ 4LF9Q 2PQAA 1UE5A 1HR0L 1VQIA 1VQ5A 4YWMA 1VQGA 1SMXA 3CMEA 4JI2L 2WAQG 1XTDA 2RHQB 4DUYL 4NXNQ 2L15A 4DKAC 3HKZG 2KENA 4R4CA 1HNZQ 4DV1Q 4DUZL 1EQQA 1Q12A 4UP8A 2YTVA 1XPUA 2VQFL 4DV6Q 3J81j 4BBSH 4AQYL 3ZJYC 3CCRA 4OXPA 2Z6KC 3ULJA 4B3TQ 4O0AA 2YU9H 1TXYA 2Q2IA 4DPGA 1XPOA 1Q46A 1WYDA 2UUBL 3KF8B 2VQEL 5M3FG 3A5UA 1EWIA 2E5LL 4JI4Q 3B6YA 1IZ6A 5GAHC 3TQYA 4P74A 5IWAQ 4DV3L 1HNXQ 3G6EA 4K0KQ 2CKZB 3AYHB 3STBD 3KFUA 4OO1G 2K52A 3UDGA 1X3FA 3F2CA 1J5EL 3AFQA 2A8VA 2OQKA 3OYYA 3GTOH 1EOVA 1MKHA 2BA0A 3HOYG 2N78A 4NPSA 1WCMH 4X65L 3M4OH 4HJAA 5IP9G 1PFSA 4JG2A 4A3CH 1FL0A 3CCQA 1FJGQ 1I6HH 1YEZA 4A3BH 4IJHA 1IBMQ 4R4QA 3T1HL 1UE6A 3HOZG 4OX9Q 1N9WA 1VQBA 1XJVA 2E2JH 2OWOA 4YWLA 2K5VA 1XMQL 4BBRH 2B63H 1BBUA 3MXNB 4DV2L 1XPRA 1AE2A 1X54A 1QUQA 2UXBQ 2N3SA 3PCOB 3KJPA 2UUCL 4GKKQ 5C3EG 4DV5L 5GROA 5GAEC 1GD7A 2WP8J 3RR5A 2IT1A 2MO0A 2ES2A 1XNQL 3S1NH 4A3FG 1JT8A 2UUBQ 2YV5A 2R6GA 3GTKH 3KDFA 1VQCA 1GVPA 2I5HA 2NVXH 4B3SQ 4LF6Q 4APVA 4IJLA 1Z47A 2EXDA 4JI1L 4R4IA 5M3MG 4A3EH 1IBKL 2UUAQ 3M3YH 1PH8A 1PH5A 1IBLL 1CUKA 4DUZQ 4LFAQ 4NXML 1KL9A 2Q2TA 3CC4A 2VUMG 3S2HH 4IOAA 3A74A 1C9OA 3GDEA 1N33L 5IP9H 4JC0A 3S17H 3G48A 3I4MG 4BY7H 3J81i 4FDBA 2ID0A 1AH9A 3J7ZC 1U0LA 4DAMA 1PVOA 2Q2UA 4DR1Q 5FJ8H 5C44G 2JA6G 1HR0Q 3TS0A 1L1OA 1S72A 2NZOA 1Q8KA 3PUWA 2ZTEA 2EQSA 3JC66 4LUVA 3JAMc 1YHQA 3RZOH 4BBRG 4QGUA 2GVAA 4P73A 4LFAL 1Y1VG 2LSSA 4NXMQ 1HNWQ 5AJ3L 1XMOQ 2I0QA 2UXBL 5IWAL 1SLJA 4OWXB 1HZAA 2IX0A 3AFPA 1WFQA 1OTCA 2R7FA 4P72A 4QL5A 4GOPC 3KYHC 4JI3Q 4OWWB 4B3RQ 4GNXA 5LMUL 2QA4A 4DV0Q 4A3EG 2ZJPA 1R9TH 2Q2HA 3CPFA 5IYCG 1QVGA 1N36Q 1NTGA 1AE3A 4A3KH 1CKMA 1Y1VH 3W1GA 5GADC 1JMCA 1EQRA 5DLQE 4KLKA 2PNHA 1CSPA 5IP7H 4UY8C 1QZHA 4BXXG 4A75A 1K83H 1A8VA 4DV3Q 1HNXL 2MO1A 1LYLA 5C3EH 4JBWA 2LXKA 4JCVE 1VQEA 4GKKL 4DV7Q 1XNRQ 5GAGC 4B3RL 1N34L 2DUDA 5JJKA 3I2ZA 4GN3B 3D0FA 4X66Q 3GTLH 5IE8A 2VQFQ 4DV6L 3HOVG 2F3IA 4PZ6A 2WFWA 2XTIA 5M5XH 4IFDG 4JV5L 1SE8A 1E22A 2K5HA 4HJ7A 4XTCS 3T1HQ 1JB7A 1VQ7A 2JA8H 3JAMi 3UE0A 1VQJA 2NVYH 4NB3A 2JA7G 4LF4Q 4P75A 1KAWA 4JOIC 1IL2A 3ULPA 1I94Q 1NY4A 4POGA 2H5XA 4DV4L 3HOXH 2D0PA 3KLWA 3RZDH 1W3SA 2VZAA 1DGSA 1C0AA 3TEHB 4L5TA 4IPCA 5FLMG 4GKJQ 3LGJA 3OW2A 3KDFB 1K8GA 1NMGA 1S3OA 1VQKA 2CWPA 5J3BA 2V1CC 1I3QH 4B3MQ 3M9BA 2ALYB 3CC2A 4GOPB 1FJGL 1KIXA 3PO3G 2N49A 4UP7A 3NENA 4JI1Q 3RNUA 4DNIA 1Y1WG 4R1JA 1IBKQ 4JI7L 2QEXA 4B3SL 4LF6L 3TRZA 1N8RC 3HOVH 2F52A 1PH6A 2ATWA 4Y7NH 2B29A 3ULLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GM5 A;  3L0O A;  5IYB H;  2K14 A;  3A5Z B;  2UUA L;  4A3G H;  4MZ9 A;  2IX1 A;  3I4N G;  1QVF A;  3H15 A;  3F2D A;  4DV5 Q;  5JEA G;  5FJ8 G;  1M90 C;  2JA6 H;  3OTO Q;  4NXN L;  4DUY Q;  2JJQ A;  3CXC A;  3H0G H;  1FGU A;  3HKS A;  2HHH Q;  4B3M L;  4KHZ A;  2GN5 A;  2ASB A;  3KJO A;  2AKW B;  5C0X G;  1SFO H;  1HH2 P;  3CQZ H;  4GN5 A;  4TQU S;  4RG1 A;  5IP7 G;  4DV0 L;  1Z9F A;  3VDY A;  1CKN B;  1Y14 B;  3Q8D A;  3PSI A;  4DR2 Q;  1N36 L;  4A3G G;  1X56 A;  2R93 H;  4JBM A;  1E24 A;  4JBJ A;  2K5N A;  3STB C;  3J80 c;  1S40 A;  1LUZ A;  1IBM L;  1WI5 A;  4LF5 Q;  1TWH H;  1M1K C;  1X55 A;  4DR7 Q;  1A0I A;  1CSQ A;  3RLO A;  4BA1 I;  4AIM A;  2UU9 L;  5M3M H;  4DV7 L;  1XMQ Q;  2R7Z H;  4DR3 Q;  4HJ9 A;  4A93 G;  3BU2 A;  1X6O A;  1B8A A;  3UDX A;  1A63 A;  1WOC A;  2JK8 A;  3H3V H;  1EIY B;  4X64 L;  2GVB A;  3NEM A;  1VQ4 A;  2HT1 A;  3HOY H;  5JJI A;  2BH8 A;  1YJ9 A;  4L5R C;  1XNQ Q;  4A3L G;  4QY7 A;  4P71 A;  1YHB A;  4DR5 Q;  2UUC Q;  1VQF A;  4KHP Q;  2CQO A;  3M7N A;  2FXQ A;  4AYB G;  4MNO A;  1OXS C;  1JJC B;  1GO3 E;  4IO9 A;  3S15 H;  1TWC H;  4A3I G;  2A1A A;  3S1Q H;  4A3D G;  4IFD I;  5K36 G;  3GD7 A;  4BY1 G;  4JI5 Q;  1VQA A;  5M3F H;  2NZH A;  4DR6 Q;  3S2D H;  4LFB L;  1JJG A;  4BA2 I;  3GO5 A;  4HID A;  2PQA B;  2ZM6 L;  1I5F A;  3BZK A;  3DM3 A;  4GS3 A;  4YHH L;  1C7Y A;  1VQN A;  2ZTD A;  4X66 L;  1SN8 A;  1UWV A;  1PA6 A;  3K7A H;  2R92 H;  4AH6 A;  3S16 H;  4LUO A;  3NBH B;  3HOW G;  1YZ6 A;  5GQO A;  1YIT A;  1Y1W H;  4JI6 L;  1SRU A;  5LMU Q;  4JI7 Q;  2A19 A;  3KF6 B;  3PIO A;  3GTJ H;  3ICE A;  2JEA I;  1O7I A;  2CFM A;  4WJ3 M;  1LM0 A;  1A62 A;  3I56 A;  3RLF A;  2WB1 E;  2RF4 A;  4A3F H;  2UXC Q;  4LNQ A;  2RHS B;  1PYS B;  4LFB Q;  4BXX H;  1GKH A;  4GOP A;  5M5W H;  3PO2 G;  4GKJ L;  1KRT A;  4OX9 L;  3K80 C;  1PH7 A;  1FVI A;  4HIO A;  3S24 A;  3K81 C;  1BKB A;  2B63 G;  3MEF A;  2I5M X;  2IHF A;  1N34 Q;  2JE6 I;  2VUM H;  1CKN A;  1L2F A;  4ME3 A;  4A4I A;  1N32 L;  3A0J A;  1PH9 A;  4JV5 Q;  1BVS A;  4C2M H;  1RIP A;  3T1Y Q;  2R7D A;  3F8T A;  2UU9 Q;  3J7A 5;  1PV4 A;  5C4X H;  2ZM6 Q;  4PMW A;  1B7Y B;  2HIV A;  4DV4 Q;  1Q7Y C;  5C44 H;  3PUX A;  5E7N A;  4JI8 L;  2D0O A;  4H02 A;  2KBN A;  2K75 A;  1EIF A;  5BR8 L;  4IPH A;  4KHP L;  4LF7 L;  1YJW A;  2HHH L;  5IT9 c;  3G71 A;  1YVC A;  5C4J H;  2MFI A;  4LF8 L;  1VS0 A;  2YTX A;  3S1M H;  2VL6 A;  5IYC H;  3F1Z A;  3CCU A;  2AHO B;  1JE5 A;  4C3I H;  3M4Q A;  4JI0 L;  1Q1B A;  1P16 A;  3E9H A;  1G6P A;  1J6Q A;  2VY3 A;  4JI2 Q;  3KF6 A;  4J15 A;  2XGT A;  1VQO A;  1NJI C;  1HZ9 A;  3CCE A;  2OTL A;  1NMF A;  2JEB I;  3FP9 A;  5BR8 Q;  3PV0 A;  1X3G A;  4QIW E;  1VCI A;  1ASZ A;  4LF7 Q;  3PUV A;  4OON A;  1VQD A;  5FLX c;  3HOX G;  3H0G G;  2F4V L;  2E2H H;  1V43 A;  2NVT H;  3CCJ A;  3K0X A;  4A3J H;  4R4O A;  3AQQ A;  1PH1 A;  3CCL A;  3I4N H;  2UXD L;  3CF5 A;  1G51 A;  4Y52 H;  4RMF A;  1V9P A;  2JA5 G;  3HOU H;  2KCM A;  1VQH A;  3L7Z C;  4GN4 B;  4LF4 L;  1HNZ L;  4A3B G;  4A93 H;  4BBS G;  2R7Z G;  3CD6 A;  4A3C G;  3HFZ B;  1KHI A;  2KCT A;  3EN2 A;  4A76 A;  1EUJ A;  4PZ7 A;  1Q81 C;  4OO1 I;  5JJL A;  4HJ8 A;  4L5S A;  2JA9 A;  5C0X J;  2OTJ A;  3J80 i;  1PH3 A;  1L1O C;  2OQ0 A;  3AEV A;  2UXD Q;  1OXX K;  1V1Q A;  2NN6 G;  2CCZ A;  1OXT A;  4GLA C;  4X62 L;  4JBK A;  2WAQ E;  2B3G A;  3ERS X;  3W1B A;  1B70 B;  5HY6 A;  1E7Z A;  1NBW A;  4LFC Q;  3PUZ A;  3U4Z A;  4GLX A;  1HR0 W;  2JA7 H;  1YHA A;  3CAM A;  3PF5 A;  1X65 A;  4AQY Q;  2D62 A;  2JA8 G;  4DR7 L;  4WJ4 A;  1OXU A;  2YYZ A;  2RCN A;  1UE7 A;  5ELO A;  3RN5 A;  1PH4 A;  4JI6 Q;  2AMC B;  3E0E A;  4DV1 L;  4IPD A;  1K9M C;  2BH2 A;  2R92 G;  2Y0S G;  4DR2 L;  4JOI A;  4DK3 C;  3F2B A;  1D8L A;  1Q1E A;  3IRB A;  1VQ8 A;  4IFD J;  1KC8 C;  3RLN A;  3EIV A;  4HIM A;  1H95 A;  4X65 Q;  4LW1 A;  4O2D A;  4K0K L;  4ALP A;  4JI5 L;  4DR5 L;  4KI0 A;  2Z0S A;  4UP9 A;  4GNX C;  1K73 C;  1PH2 A;  5FLM H;  3GTM H;  4EX5 A;  4TVA B;  3I55 A;  4A3M G;  4GLV B;  1RL2 A;  4X64 Q;  2C35 B;  1N33 Q;  3I4M H;  4BY7 G;  3NEL A;  2MQH A;  5IYB G;  1T9H A;  2N8N A;  5C0X I;  3M85 A;  5ELN A;  2BA1 A;  2CWA A;  4DAY B;  5IYD G;  4DR3 L;  1K8A C;  2EIF A;  3PUY A;  1TWA H;  1P8L A;  3I7F A;  1EYG A;  1E3P A;  3DLL A;  3CCM A;  3U50 C;  1VQP A;  1X9N A;  3H3V I;  1UEB A;  4LF8 Q;  3S14 H;  3PO3 H;  4YCW A;  4LUZ A;  3CMA A;  1K3R A;  1QUQ B;  1VQ6 A;  2R93 G;  4LF9 L;  4YHH Q;  1HNW L;  3M4P A;  3K8A A;  4JYA Q;  3FKI H;  4JI8 Q;  1YI2 A;  1YBY A;  3I4O A;  2DGY A;  4DR6 L;  2HIX A;  3CCS A;  4DV2 Q;  5JEA J;  5C4X G;  2OCE A;  3PIP A;  1HZC A;  1MIU A;  3OTO L;  3GTP H;  2JQO A;  4B3T L;  2LXJ A;  3W5O A;  3GTG H;  2KHJ A;  4DR4 L;  1SRO A;  1KXL A;  4QJF A;  1Q82 C;  2HQL A;  2ZJR A;  2E2I H;  3S1R H;  4JI4 L;  2Z6K A;  3RN2 A;  4C3J H;  1X3E A;  1JJ2 A;  3K7U C;  3UDF A;  1G29 1;  3EBE A;  5M5Y H;  4X6A H;  2IHE A;  4JI3 L;  1IXR A;  2AWN A;  2YTY A;  3D31 A;  3PGZ A;  4A3J G;  1J5E Q;  4GNX B;  3BJU A;  3CP0 A;  4YCU A;  1ASY A;  1TWG H;  5AJ3 Q;  4PG3 A;  4YCV A;  1XMO L;  1EFW A;  2NVQ H;  1W2B A;  3TS2 A;  4C3H H;  2K50 A;  2E8G A;  1QVC A;  4OWT B;  3HKZ E;  3CCV A;  1VQM A;  3WWV A;  4HJ5 A;  3FKI G;  2IY5 B;  1KD1 C;  4L5Q A;  4XIG S;  5H1S E;  2VQE Q;  5EAY A;  4YWK A;  3GTQ H;  3J81 c;  4JI0 Q;  4AYB E;  4IPG A;  4A3K G;  1L1O B;  1NE3 A;  4UPA A;  3UDI A;  4JYA L;  3HOW H;  1E1O A;  5IY0 A;  1BBW A;  3HOZ H;  3T1Y L;  1LTL A;  1MJE A;  1HJP A;  2AWO A;  1Q86 C;  2JA5 H;  3HOU G;  1KRS A;  1VQL A;  2VW9 A;  1L0W A;  1HZB A;  1WCM G;  5LMN Q;  4BY1 H;  2ZJQ A;  3U58 A;  3L2P A;  4A3I H;  2ZTC A;  3CC7 A;  2VNU D;  1U5K A;  4A3M H;  1YJN A;  2PI2 E;  4PZ8 A;  1VQ9 A;  3PF4 A;  1K0R A;  3PO2 H;  4X62 Q;  1SR3 A;  4YY3 L;  1CKO A;  2F4V Q;  3E9I A;  2KHI A;  5HGQ A;  4A3L H;  4LWC A;  1UE1 A;  2UXC L;  1IYJ B;  3KOJ A;  3TRE A;  1YIJ A;  3U4V A;  1D7Q A;  2VS1 A;  2K4K A;  1PHJ A;  1IBL Q;  4POF A;  3CPW A;  1I94 L;  4HIK A;  2PMZ E;  3BZC A;  1XNR L;  3G4S A;  2MNA A;  1OXV A;  5LMN L;  4DR4 Q;  1WJJ A;  1YNX A;  1PYB A;  1I50 H;  4IOC A;  1E1T A;  5LMN W;  5IYD H;  2PI2 A;  2Y0S E;  3ER0 A;  2NN6 I;  3CW2 C;  3UE1 A;  1N32 Q;  4EQ5 A;  4MTN A;  1KQS A;  4R4T A;  4YY3 Q;  4LF5 L;  4DR1 L;  1TWF H;  2WB1 G;  4A3D H;  4QQB X;  4DK6 C;  1MJC A;  2QGQ A;  3FHW A;  4LFC L;  3SGI A;  2I5L X;  1QZG A;  2E5L Q;  4LF9 Q;  2PQA A;  1UE5 A;  1HR0 L;  1VQI A;  1VQ5 A;  4YWM A;  1VQG A;  1SMX A;  3CME A;  4JI2 L;  2WAQ G;  1XTD A;  2RHQ B;  4DUY L;  4NXN Q;  2L15 A;  4DKA C;  3HKZ G;  2KEN A;  4R4C A;  1HNZ Q;  4DV1 Q;  4DUZ L;  1EQQ A;  1Q12 A;  4UP8 A;  2YTV A;  1XPU A;  2VQF L;  4DV6 Q;  3J81 j;  4BBS H;  4AQY L;  3ZJY C;  3CCR A;  4OXP A;  2Z6K C;  3ULJ A;  4B3T Q;  4O0A A;  2YU9 H;  1TXY A;  2Q2I A;  4DPG A;  1XPO A;  1Q46 A;  1WYD A;  2UUB L;  3KF8 B;  2VQE L;  5M3F G;  3A5U A;  1EWI A;  2E5L L;  4JI4 Q;  3B6Y A;  1IZ6 A;  5GAH C;  3TQY A;  4P74 A;  5IWA Q;  4DV3 L;  1HNX Q;  3G6E A;  4K0K Q;  2CKZ B;  3AYH B;  3STB D;  3KFU A;  4OO1 G;  2K52 A;  3UDG A;  1X3F A;  3F2C A;  1J5E L;  3AFQ A;  2A8V A;  2OQK A;  3OYY A;  3GTO H;  1EOV A;  1MKH A;  2BA0 A;  3HOY G;  2N78 A;  4NPS A;  1WCM H;  4X65 L;  3M4O H;  4HJA A;  5IP9 G;  1PFS A;  4JG2 A;  4A3C H;  1FL0 A;  3CCQ A;  1FJG Q;  1I6H H;  1YEZ A;  4A3B H;  4IJH A;  1IBM Q;  4R4Q A;  3T1H L;  1UE6 A;  3HOZ G;  4OX9 Q;  1N9W A;  1VQB A;  1XJV A;  2E2J H;  2OWO A;  4YWL A;  2K5V A;  1XMQ L;  4BBR H;  2B63 H;  1BBU A;  3MXN B;  4DV2 L;  1XPR A;  1AE2 A;  1X54 A;  1QUQ A;  2UXB Q;  2N3S A;  3PCO B;  3KJP A;  2UUC L;  4GKK Q;  5C3E G;  4DV5 L;  5GRO A;  5GAE C;  1GD7 A;  2WP8 J;  3RR5 A;  2IT1 A;  2MO0 A;  2ES2 A;  1XNQ L;  3S1N H;  4A3F G;  1JT8 A;  2UUB Q;  2YV5 A;  2R6G A;  3GTK H;  3KDF A;  1VQC A;  1GVP A;  2I5H A;  2NVX H;  4B3S Q;  4LF6 Q;  4APV A;  4IJL A;  1Z47 A;  2EXD A;  4JI1 L;  4R4I A;  5M3M G;  4A3E H;  1IBK L;  2UUA Q;  3M3Y H;  1PH8 A;  1PH5 A;  1IBL L;  1CUK A;  4DUZ Q;  4LFA Q;  4NXM L;  1KL9 A;  2Q2T A;  3CC4 A;  2VUM G;  3S2H H;  4IOA A;  3A74 A;  1C9O A;  3GDE A;  1N33 L;  5IP9 H;  4JC0 A;  3S17 H;  3G48 A;  3I4M G;  4BY7 H;  3J81 i;  4FDB A;  2ID0 A;  1AH9 A;  3J7Z C;  1U0L A;  4DAM A;  1PVO A;  2Q2U A;  4DR1 Q;  5FJ8 H;  5C44 G;  2JA6 G;  1HR0 Q;  3TS0 A;  1L1O A;  1S72 A;  2NZO A;  1Q8K A;  3PUW A;  2ZTE A;  2EQS A;  3JC6 6;  4LUV A;  3JAM c;  1YHQ A;  3RZO H;  4BBR G;  4QGU A;  2GVA A;  4P73 A;  4LFA L;  1Y1V G;  2LSS A;  4NXM Q;  1HNW Q;  5AJ3 L;  1XMO Q;  2I0Q A;  2UXB L;  5IWA L;  1SLJ A;  4OWX B;  1HZA A;  2IX0 A;  3AFP A;  1WFQ A;  1OTC A;  2R7F A;  4P72 A;  4QL5 A;  4GOP C;  3KYH C;  4JI3 Q;  4OWW B;  4B3R Q;  4GNX A;  5LMU L;  2QA4 A;  4DV0 Q;  4A3E G;  2ZJP A;  1R9T H;  2Q2H A;  3CPF A;  5IYC G;  1QVG A;  1N36 Q;  1NTG A;  1AE3 A;  4A3K H;  1CKM A;  1Y1V H;  3W1G A;  5GAD C;  1JMC A;  1EQR A;  5DLQ E;  4KLK A;  2PNH A;  1CSP A;  5IP7 H;  4UY8 C;  1QZH A;  4BXX G;  4A75 A;  1K83 H;  1A8V A;  4DV3 Q;  1HNX L;  2MO1 A;  1LYL A;  5C3E H;  4JBW A;  2LXK A;  4JCV E;  1VQE A;  4GKK L;  4DV7 Q;  1XNR Q;  5GAG C;  4B3R L;  1N34 L;  2DUD A;  5JJK A;  3I2Z A;  4GN3 B;  3D0F A;  4X66 Q;  3GTL H;  5IE8 A;  2VQF Q;  4DV6 L;  3HOV G;  2F3I A;  4PZ6 A;  2WFW A;  2XTI A;  5M5X H;  4IFD G;  4JV5 L;  1SE8 A;  1E22 A;  2K5H A;  4HJ7 A;  4XTC S;  3T1H Q;  1JB7 A;  1VQ7 A;  2JA8 H;  3JAM i;  3UE0 A;  1VQJ A;  2NVY H;  4NB3 A;  2JA7 G;  4LF4 Q;  4P75 A;  1KAW A;  4JOI C;  1IL2 A;  3ULP A;  1I94 Q;  1NY4 A;  4POG A;  2H5X A;  4DV4 L;  3HOX H;  2D0P A;  3KLW A;  3RZD H;  1W3S A;  2VZA A;  1DGS A;  1C0A A;  3TEH B;  4L5T A;  4IPC A;  5FLM G;  4GKJ Q;  3LGJ A;  3OW2 A;  3KDF B;  1K8G A;  1NMG A;  1S3O A;  1VQK A;  2CWP A;  5J3B A;  2V1C C;  1I3Q H;  4B3M Q;  3M9B A;  2ALY B;  3CC2 A;  4GOP B;  1FJG L;  1KIX A;  3PO3 G;  2N49 A;  4UP7 A;  3NEN A;  4JI1 Q;  3RNU A;  4DNI A;  1Y1W G;  4R1J A;  1IBK Q;  4JI7 L;  2QEX A;  4B3S L;  4LF6 L;  3TRZ A;  1N8R C;  3HOV H;  2F52 A;  1PH6 A;  2ATW A;  4Y7N H;  2B29 A;  3ULL A; 
#chains in the Genus database with same CATH topology
 1GM5 A;  3RAQ A;  5CGK A;  1C3O A;  3L0O A;  1ROD A;  4A3G H;  2UUA L;  1RYR A;  1HRJ A;  1TS2 A;  3PW7 A;  3OTO Q;  1C4Q A;  3BDL A;  2B63 B;  4K2K A;  4F4Y A;  4ZQI A;  1HH2 P;  4GN5 A;  2ZDQ A;  2GPS A;  5DQI A;  4DV0 L;  1WSC A;  1CA6 A;  4XT3 B;  4MV7 A;  4JBJ A;  2K5N A;  4CGY B;  5KG7 A;  1LUZ A;  3T51 B;  1M1K C;  4DR7 Q;  1A0I A;  3BQ1 A;  4AQY H;  1DXM A;  2E74 C;  2R7Z H;  4A93 G;  4HJ9 A;  1X6O A;  2W9B B;  2UVU A;  1WOC A;  2JK8 A;  1TKW B;  2AGQ A;  3HOY H;  1LTB D;  2GVB A;  2GPW A;  5JJI A;  4O3O A;  1XNQ Q;  4QY7 A;  3NP8 A;  3GTM A;  1VQF A;  2CQO A;  5KG5 A;  3M7N A;  4YQW A;  3S17 B;  4ECS A;  1NR2 A;  4MNO A;  4IO9 A;  2I87 A;  5LMN H;  4A3I G;  5KFX A;  4BY1 G;  5KFM A;  1VQA A;  3S2D H;  3GO5 A;  5FOB B;  3WNZ A;  4R8N A;  3K5I A;  3BZK A;  3J81 E;  4YHH L;  1C7Y A;  4NLG A;  4DU9 A;  1SN8 A;  1PA6 A;  2H4O A;  2R92 H;  2W6O A;  1ENC A;  2K04 A;  3NBH B;  3I91 A;  4DR3 H;  1YZ6 A;  1IOV A;  4LFC H;  1PTO C;  4JI7 Q;  2A19 A;  1NAP A;  1STN A;  3Q6S A;  5KFK A;  1O7I A;  2CFM A;  5DAU A;  1GSH A;  4R8U B;  5KFH A;  1OO9 B;  1B6R A;  4JI0 H;  4LNQ A;  2R7K A;  5EPL A;  3VYR A;  4J9M A;  3I72 A;  2NN6 H;  2Z9H A;  3N44 B;  2K5D A;  1KRT A;  3N43 B;  3K80 C;  4FU0 A;  5KT4 A;  4PMC A;  1VBH A;  3K81 C;  5A2Q E;  5CV5 A;  2EJG C;  5KFV A;  1K28 A;  3MEF A;  2I5M X;  3H91 A;  5BPF A;  2AQ4 A;  2K33 A;  4ME3 A;  1IKM A;  2XNA C;  4JV5 Q;  3Q1K A;  3QJY A;  5KFI A;  3CHB D;  2R7D A;  2UU9 Q;  3NHH A;  1Y8P B;  4X3U A;  4PMW A;  4DV4 Q;  4FBT A;  3PUX A;  2D0O A;  2KBN A;  1O7Z A;  1EIF A;  1M4V A;  4IPH A;  3N8D A;  3KAK A;  1ESR A;  4XYO A;  3MWD A;  3V96 A;  4KHP L;  2UXC H;  2QDL A;  1JWU D;  1EY4 A;  5C4J H;  2YTX A;  1X32 A;  2VL6 A;  5IYC H;  3H20 A;  3OUU A;  4CKE A;  4MAM A;  2W9C A;  1M8A A;  2EVB A;  1JE5 A;  1STG A;  1Q1B A;  3H6M A;  2VUG A;  5KIX A;  1D6E C;  4LK1 C;  3K5M A;  3DWP A;  2OTL A;  4J9K A;  3RUZ A;  1NMF A;  1LO5 D;  3PV0 A;  3GIM A;  1ASZ A;  1DV2 A;  1AZP A;  1AFP A;  2QW7 A;  4MV6 A;  3MR2 A;  2R8J A;  2ZM6 H;  4YHH H;  1I4Q A;  2A69 D;  2J4X A;  3K0X A;  1XYI A;  3OSN A;  4R4O A;  3EQL C;  3CCL A;  3D8G A;  1WD1 A;  4I4T F;  2E2H A;  5G3L D;  3MWM A;  1BCP D;  2EYP A;  3VYT A;  2KEE A;  3MVV A;  1ENF A;  3HOU H;  4Q45 A;  5JPM C;  4A3B G;  2WII B;  2Z1C A;  3HFZ B;  4EGQ A;  1TQO A;  3EN2 A;  4AYB B;  4A76 A;  1EUJ A;  1TAE A;  4MHE A;  4EGJ A;  3OSO A;  4PZ7 A;  2FFK B;  4OO1 I;  2EPB A;  5FLX L;  5C0X J;  3J80 i;  3NWS A;  2OQ0 A;  2SEB D;  4O4I F;  3AEV A;  5FPR A;  2CCZ A;  5BN4 A;  2KCC A;  4GLA C;  4UCR A;  2WAQ E;  2B3G A;  4DF7 A;  3RF2 A;  1KBL A;  4LF7 H;  1HFG A;  2W9C B;  3MFI A;  1NBW A;  4ODG A;  3U4Z A;  3K5N A;  3TP7 A;  1U4L A;  2C2E A;  1L0Y B;  2VR1 A;  1YHA A;  3CAM A;  5NUC A;  1X65 A;  2DJG C;  3U9T A;  1K9M C;  4DR2 L;  2NBF A;  5HBR B;  2SNS A;  1D8L A;  4ECY A;  1VQ8 A;  4OHJ A;  4KKU A;  4IFD J;  4RAY A;  2F0J A;  3RLN A;  1KEE A;  1S5B D;  2Z0S A;  4RB2 C;  3GTM H;  4EX5 A;  4TVA B;  4BY1 B;  3V6J A;  4GLV B;  4CKB A;  4DL5 A;  4H44 C;  5JVD F;  1ILP A;  2N8N A;  5C0X I;  2CWA A;  4OEL B;  2BR0 A;  5KT3 A;  5KFP A;  4JV0 A;  5FLX E;  3HOY B;  5EWG A;  3U50 C;  4Q0F A;  5J2U F;  1KAA A;  5IOC A;  3S14 H;  3CMA A;  2AUJ D;  1K83 B;  2W57 A;  2K7V A;  4ZK9 B;  4LF9 L;  4HTH A;  5GON F;  1HNW L;  1M7J A;  1F9Q A;  5D1P A;  3K8A A;  1XWE A;  4C1N I;  1JOR A;  2BE5 D;  2DPI A;  3NQT A;  3C0F B;  5M3F B;  4JI8 H;  1WTO A;  2WE6 A;  4JI4 H;  1A2U A;  1HZC A;  2RDG A;  3OTO L;  1B1Z A;  2JQO A;  1KNE A;  4B3T L;  3AB9 A;  1I4R A;  2KHJ A;  4J6H A;  3TBI B;  3GTG H;  2W71 A;  4X65 H;  3SHL A;  4RUC A;  3PN1 A;  3J81 L;  2UU9 H;  3E6Z X;  2J6T A;  4JI4 L;  4J9P A;  2Z6K A;  3RGZ A;  3ORR A;  3SE0 A;  4BS9 A;  4B3M H;  3PW5 A;  4Q0Y A;  2IHE A;  2ALZ A;  1IXR A;  2AWN A;  4RWS C;  4Q5V A;  3BJU A;  1O7L A;  3CP0 A;  1ASY A;  3OUZ A;  5E3F A;  2C28 A;  1LTR D;  2A6H D;  2ENB A;  4DV4 H;  1S5E D;  3SR1 A;  4HJ5 A;  3FKI G;  3IN5 A;  1Z2P X;  2D5D A;  4IAL A;  5H1S E;  4LFB H;  2VQE Q;  5EAY A;  1PTO F;  1ET9 A;  4JI0 Q;  4UPA A;  3T1H H;  3UDI A;  5CV9 A;  1U4R A;  5IY0 A;  2W6Z A;  4ECR A;  1O75 A;  2JA5 H;  1KRS A;  1Y1W A;  3RUP A;  2EJF C;  2B2W A;  3N52 A;  4KTA A;  2B2T C;  1JLL B;  2UUA H;  4LSX A;  1YNN D;  1L0W A;  1CA5 A;  2F03 A;  3GTL B;  5BMV F;  2XSC A;  1WCM G;  4BY1 H;  2ZJQ A;  1KDB A;  3GV3 A;  3M9O B;  4DR2 H;  1YJN A;  3PF4 A;  5JUM A;  1EZ8 A;  5KFO A;  1I7L A;  1WCM A;  3NTI A;  5IGE A;  1F2Z A;  4KKS A;  1KDA A;  3KOJ A;  3TRE A;  4EVO A;  1YIJ A;  2JXM B;  4RZQ A;  3R5H A;  3BAB A;  1I94 L;  4A3K B;  3G8C A;  4IN3 A;  1V1P A;  3RD4 A;  1JC7 A;  1OXV A;  3X3N A;  4ED2 A;  2NVX B;  1LT6 D;  1GOZ A;  3DM1 A;  1XXG A;  5LMN W;  2PI2 A;  2G5D A;  5J39 A;  5IYD H;  4UCS A;  3GQC A;  4J9O A;  2OXP A;  4IAJ A;  4UAI A;  1ZQ7 A;  2WAQ A;  1TWF H;  5C5M A;  2R93 A;  2ZDG A;  4DK6 C;  2JA6 A;  2HQE A;  4OEM B;  3SGI A;  1QZG A;  1RDP D;  3U9O A;  4YWM A;  1SMX A;  1JOO A;  1EUD B;  2X6G A;  3S16 B;  1CZW A;  1Q12 A;  1XPU A;  2VQF L;  4DV6 Q;  3J81 j;  4BBS H;  3A8J E;  3TIN A;  2YZG A;  2VPS A;  2IW3 A;  2Z6K C;  2HVS A;  5KT6 A;  4KJN A;  3DEP A;  1B2T A;  1Q46 A;  2Q8R E;  1I3Q A;  1NR4 A;  2VQE L;  5KND A;  1W96 A;  1AUX A;  3VYU A;  2F0E A;  1MGS A;  4DV3 L;  5IWA Q;  2HHH H;  3OPO A;  2CKZ B;  3KFU A;  2PO4 A;  1AW7 A;  2O03 A;  4GKK H;  2F3W A;  3UDG A;  1X3F A;  2A8V A;  3BVG A;  3FKI B;  2OQK A;  3K3V A;  2EY2 A;  3GIQ A;  3G6V A;  1HQR D;  2R86 A;  2PYK A;  5LL6 S;  4NPS A;  1RJT A;  3M4O H;  4HJA A;  1EQV A;  5J1Z A;  1FL0 A;  4A3C H;  5L9X A;  1SE2 A;  1V1O A;  1ZET A;  1YEZ A;  4A3B H;  4K5W A;  2K28 A;  1HHV A;  1VAJ A;  2XRS D;  2VQD A;  2WAQ B;  5D65 A;  2XD4 A;  1VQB A;  2E2J H;  2OWO A;  4YWL A;  2TMP A;  2B63 H;  4BBR H;  1BBU A;  1I50 A;  3ETJ A;  2B2Y A;  1AE2 A;  1X54 A;  5DEH A;  1QUQ A;  2N3S A;  3GTO B;  3KJP A;  2NVY B;  5C3E G;  1JX4 A;  2K1B A;  4Y8V B;  4RNM A;  4IRD A;  4PDB A;  1GD7 A;  1XNQ L;  2IT1 A;  2ES2 A;  4MV4 A;  4DXG A;  2R6G A;  1GVP A;  4B3R H;  1QE6 A;  4APV A;  2PZW A;  3RFC A;  4ECW A;  3M3Y H;  1FD7 D;  3IFD A;  1AN7 A;  2Y0S A;  4RZR A;  3A74 A;  1PRT D;  3GDE A;  5IP9 H;  2B39 A;  3S17 H;  3I4M G;  2WV6 D;  4BY7 H;  1KJJ A;  4EG0 A;  5D1O B;  1JWM D;  4HCE A;  1PVO A;  2X69 A;  1LTA D;  5FJ8 H;  2RVL A;  4EBC A;  1JDB B;  4ECZ A;  4LUV A;  1Q8K A;  2NZO A;  2SNM A;  2ZTE A;  3RZO H;  4BBS B;  1KTK A;  2PVP A;  3GTP A;  5I6Y A;  5KFC A;  4LH6 A;  1S0M A;  2XRQ D;  2UXB L;  5EBC A;  3ND9 A;  1SLJ A;  4OWX B;  1HZA A;  5M5Y B;  3NE5 B;  3D6C A;  1PX2 A;  1CHP D;  5HUR A;  4QL5 A;  4GOP C;  4JI3 Q;  1Z2O X;  4CDC C;  1N36 Q;  1TWH B;  1IW7 D;  3CPF A;  1NTG A;  4L6T B;  3KBG A;  1RK5 A;  1FJG H;  1Y1V H;  2DY8 A;  3W1G A;  5GAD C;  1EQR A;  2JEJ A;  1HTL D;  4LF5 H;  4JW0 A;  2F4I A;  4J0M A;  2UVV A;  1CS0 A;  5E1F A;  4C56 C;  4ZOL F;  1PFN A;  1QZH A;  2L55 A;  1QB5 D;  2OF1 A;  3T16 A;  4DV3 Q;  3FDT A;  3M4O B;  4UHV A;  1O7Y A;  1A3T A;  2QDB A;  4F87 A;  4GKK L;  1PDQ A;  3RIZ A;  3QZ8 A;  1XNR Q;  3T13 A;  4IUN A;  1GUG A;  3EVQ A;  3I2Z A;  4GN3 B;  3D0F A;  4KD4 A;  2VQF Q;  1NCV A;  4DV6 L;  5DQH A;  5L1J A;  2F3I A;  1PYW D;  4MA5 A;  1TY2 A;  3C3L A;  5C4X B;  1RJP A;  4HJ7 A;  3T1H Q;  4HNV A;  4XTC S;  3NUC A;  5ELB A;  3GTL A;  4NB3 A;  4LF4 Q;  3RV4 A;  3ULP A;  1NY4 A;  3I73 A;  4OO1 H;  5KFG A;  1BXR A;  2KVM A;  2VZA A;  1C0A A;  4YIJ A;  1YNJ D;  4GKJ Q;  2RGV A;  3OW2 A;  5ELE A;  5EWE A;  5I9P A;  1OWT A;  3G6Y A;  2PNR C;  2R7M A;  4WRD A;  4U68 A;  3M3Y B;  2V1C C;  1G91 A;  2JN4 A;  3BA8 A;  3J80 E;  3RNU A;  2J7Z A;  1Y1W G;  3J80 L;  2QEX A;  1SYB A;  3HOV H;  2F52 A;  2EYL A;  3M7G A;  3HG9 A;  4Y7N H;  4DV7 H;  4DR4 H;  4EBE A;  1E2V A;  1ZYR D;  2K14 A;  4MZ9 A;  3DF7 A;  2YZN A;  4DV2 H;  3JAM W;  2IX1 A;  4NXM H;  1QVF A;  3F2D A;  1H9J A;  1I4G A;  4DR6 H;  1B4O A;  1M90 C;  5EJW A;  5FJ8 G;  1G2S A;  4Q8F A;  3CXC A;  2HHH Q;  5J2T F;  4KHZ A;  1TII D;  2GN5 A;  1CFM A;  5C0X G;  3CQZ H;  4TQU S;  3PW0 A;  1Z9F A;  1Y14 B;  4A3G G;  3PSI A;  4EEY A;  1JKJ B;  4C3J B;  1IBM L;  1S40 A;  2FJ2 A;  1TWH H;  4HMJ A;  3LWE A;  1HUN A;  1CSQ A;  1X3Q A;  3GLK A;  5ELF A;  4DFA A;  2DLN A;  3P75 A;  5IT9 W;  1D5M C;  1K83 A;  2HT1 A;  1PTO H;  1B9N A;  2ICE C;  4C3I B;  4JPB W;  4P71 A;  4TRD A;  4KY5 A;  1YHB A;  4DR5 Q;  3DUZ A;  2F0F A;  2IWH A;  3JAM L;  1LLR D;  4IFD I;  4FM9 A;  4KK7 A;  3N6R A;  3SK5 A;  3S1Q H;  1SYD A;  3GD7 A;  2UUC H;  2Q8T A;  4JI5 Q;  1JJG A;  4DR6 Q;  3BDO A;  2JA5 B;  2JYO A;  4K6D A;  4HYK A;  4BA2 I;  2ZM6 L;  4GS3 A;  2W7O A;  1SYE A;  4X66 L;  4IFD H;  4DR7 H;  3Q0A A;  1B9M A;  4ED8 A;  3H09 A;  3KUP A;  3OW7 A;  3EPG A;  4AH6 A;  2BQ3 A;  2FK3 A;  2AGP A;  3I90 A;  3LX0 A;  3GID A;  5LMU Q;  4L63 B;  4QWB A;  1A62 A;  2WB1 E;  2RF4 A;  4FXG C;  4JK1 C;  2UXC Q;  3GIL A;  1KNA A;  2RHS B;  4IRK A;  4LFB Q;  4BXX H;  1GKH A;  3PO2 G;  4NW2 A;  5F9L A;  3FRP B;  5KG6 A;  4R8I A;  4HIO A;  5JVL A;  4RA8 A;  2HJW A;  1HA5 A;  2LY7 A;  4Y7N B;  3TDQ A;  1CKN A;  3T1Y H;  1L2F A;  4A4I A;  1SSO A;  2AGO A;  4JV5 H;  1QG7 A;  5T14 A;  1S5F D;  1BVS A;  3VR5 A;  5KFT A;  3T1Y Q;  1EL0 A;  5CA0 F;  3F8T A;  3J7A 5;  2F0D A;  2B2V C;  1HTP A;  2ZM6 Q;  4DV1 H;  4ETS A;  1DOL A;  5C44 H;  3HXL A;  3ONA B;  3D3R A;  1I4P A;  5E7N A;  1LAC A;  3Q22 A;  4RNO A;  5BR8 L;  4FF3 A;  3EPI A;  3OHX C;  5ELD A;  5KFA A;  4LF7 L;  1VMP A;  3UI2 A;  4OX9 H;  4N8X 1;  4LF8 L;  2PBZ A;  1YNN C;  3Q24 A;  1PRT C;  4I7H A;  1VS0 A;  1R9T B;  5DG8 A;  1PFM A;  4RB0 A;  3F1Z A;  1ICW A;  1Y1V B;  4C3I H;  3E9H A;  1G6P A;  2VY3 A;  1FGB D;  4J15 A;  2XGT A;  1VQO A;  1EWH A;  4RGO S;  2DZD A;  3EFX D;  2JEB I;  2ZXO A;  5KYI A;  3S15 B;  2E5L H;  1SE4 A;  4RFB A;  4NXN H;  2W6Q A;  4OON A;  4ED1 A;  4MV1 A;  1SDF A;  3HOX G;  4J9S A;  2F4V L;  3ERO A;  5JAV A;  3I12 A;  5EDW A;  3CCJ A;  1PH1 A;  2UXD L;  4Y52 H;  3MA2 B;  1LV9 A;  4RMF A;  1V9P A;  1JXL A;  1VQH A;  3L7Z C;  4NMZ A;  4BBR B;  4A93 H;  3FMC A;  4XQQ A;  1MHW C;  2CH4 W;  1A6X A;  4RAZ A;  2A68 D;  4RB3 C;  4CDE C;  1KHI A;  3SXH A;  3TN2 A;  3C2P A;  3VMM A;  3HGB A;  3MWE A;  4L5S A;  2JA9 A;  2ZXP A;  2OTJ A;  5EZY F;  4FF2 A;  1V51 A;  1PH3 A;  3LP8 A;  1OXX K;  3K5L A;  2VA3 A;  4ZUI A;  4ME6 A;  3W1B A;  2VUM B;  1B70 B;  1F9S A;  4KN4 C;  2V9W A;  2Z4H A;  3CQZ A;  4LFC Q;  3OMC A;  3QB3 A;  4WD3 A;  4AQY Q;  2D62 A;  2J9G A;  2X6L A;  1PH4 A;  4JI6 Q;  2BH2 A;  2J6S A;  2AMC B;  3E0E A;  4DV1 L;  4IPD A;  2F0V A;  1TA8 A;  2WKD A;  1I6H B;  5IGD A;  3F2B A;  2FLN A;  1Q1E A;  3QZ7 A;  5LA6 F;  3T4A C;  3EIV A;  3NBH A;  3AU7 A;  5ELC A;  5D3D A;  4GNX C;  1K73 C;  2KED A;  1HXY D;  3I55 A;  4A3M G;  4A3I B;  1CQI B;  4ZLT F;  4A3F B;  2XIW A;  4RKB A;  1MD2 D;  4LAA A;  4A2B A;  2R8K A;  3M85 A;  5ELN A;  4DR3 L;  5BR8 H;  2RDI A;  1J5E H;  2EIF A;  5KFY A;  1TWA H;  1II3 A;  1KJ9 A;  3MFH A;  2ICI A;  4HN7 A;  5I6W A;  2YU9 A;  3MFY A;  1WTV A;  2CW8 A;  4LF8 Q;  3VR4 A;  5ISR A;  3PO3 H;  2EDG A;  5D14 A;  4LUZ A;  1GUS A;  1K3R A;  4B08 A;  3K3P A;  2R93 G;  4YHH Q;  5LYJ F;  3VR6 A;  2O5J C;  3MC0 B;  2EY5 A;  1YNJ C;  5K36 H;  1EFI D;  2IPK D;  4RGT A;  4DR6 L;  1EQT A;  2QCP X;  4IUR A;  5IWA H;  2I46 A;  4DV2 Q;  2QEJ C;  3EA6 A;  5EPK A;  1VBG A;  4ZHQ F;  2HDM A;  1FNV A;  3ND8 A;  4CHT B;  5IGF A;  2LXJ A;  3T5J A;  2JA8 B;  4APM A;  5IGC A;  2F0I A;  3S1R H;  3KHG A;  2R93 B;  3K7U C;  2V4Q A;  1RTN A;  2R7L A;  4RHR A;  4TSS A;  2FLP A;  2YTY A;  2GLT A;  3D31 A;  3PGZ A;  4A3J G;  2W6N A;  1LT3 D;  3OMG A;  4O3S A;  2WB1 B;  1DON A;  3H94 A;  1XMO L;  4YCV A;  3F8N A;  2W9A A;  4ZI7 F;  2IY5 B;  4DV3 H;  1KD1 C;  4L5Q A;  3DMU A;  2CW0 C;  4XIG S;  1S4Z A;  1CE8 A;  4JV2 A;  3J81 c;  4I55 F;  4A3K G;  1TS4 A;  1NE3 A;  5K2M A;  4JYA L;  3HOW H;  1E1O A;  1JR0 D;  3A8K E;  1BBW A;  4FXD A;  1MJE A;  2AWO A;  1Q86 C;  3GIK A;  5JVH 3;  4NP5 A;  1B6S A;  2R92 A;  2IJ0 A;  2NU6 B;  3K7A B;  2F1M A;  2R87 A;  5M5X B;  1TWF A;  2HUG A;  1L2Z A;  5F9N A;  3U58 A;  3R93 A;  4MN3 A;  3CC7 A;  3RZO B;  2XCP A;  4A3M H;  1TY0 A;  3GV8 B;  3PO2 H;  4YY3 L;  4UFZ A;  5KFQ A;  4OIJ A;  4A3L H;  4CDD C;  3GTQ A;  4O4H F;  1EZ6 A;  2KHS A;  2L12 A;  5M3M B;  1D7Q A;  1IBL Q;  1FNU A;  2B2T A;  3CPW A;  1XNQ H;  4RH6 A;  5CV4 A;  3Q8S B;  3G4S A;  2MNA A;  3KHR A;  1WJJ A;  2A74 C;  4ZCK A;  2V5A A;  1I50 H;  4DNT B;  2FKL A;  2KEC A;  3ER0 A;  4CC5 A;  1EY5 A;  3CW2 C;  2IP4 A;  5EKK A;  4IUU A;  3MEH A;  4DR1 L;  4QQB X;  1JIC A;  1MJC A;  2QGQ A;  4LF9 Q;  3N42 B;  3WO0 A;  3P7J A;  5JEA H;  2RDJ A;  4C5C A;  1EY6 A;  1VQ5 A;  3ETH A;  4JI2 L;  1XTD A;  2IA6 A;  2L15 A;  3HKZ G;  3H0G B;  1HNZ Q;  4DV1 Q;  4J9N A;  3PZP A;  1SYC A;  2RQX A;  3E5N A;  2NU9 B;  4RKL A;  2EYF A;  2P5Z X;  2D2C C;  3I4M B;  4AQY L;  3PQI A;  5A2Q W;  4DXF A;  5C8Y F;  3UQ8 A;  1QJO A;  2EZV A;  3CVZ A;  4ED3 A;  1TXY A;  4DPG A;  3QG1 A;  1SBB B;  4G3I A;  2NU8 B;  1QNK A;  3A5U A;  5CAE B;  4JI4 Q;  5GAH C;  3G6E A;  1ZHQ A;  5KX5 F;  3T53 B;  1JOK A;  3W3A A;  3F2C A;  1C30 A;  4QCL A;  5DG9 A;  1J5E L;  3AFQ A;  3PIP 3;  1X3P A;  3OYY A;  2BOS A;  2NU7 B;  2A6H C;  2BA0 A;  3HOY G;  4JI2 H;  4YR0 A;  2N78 A;  4X65 L;  2VB3 X;  4ECU A;  1AEX A;  2W6M A;  2M9V A;  4DAV A;  2FHT A;  3GTO A;  3NXW A;  1ZYR C;  4H0L C;  4TUY F;  3T1H L;  2WTF A;  1UE6 A;  3ITP A;  3HOZ G;  1SNM A;  1N9W A;  4OX9 Q;  3KBX A;  4MTD A;  1ESF A;  2K5V A;  4RCN A;  1E4F T;  4XDX A;  3DHQ A;  4RAU C;  5C6A A;  1XPR A;  1SFO B;  3PCO B;  4Q8E A;  4O2B F;  2UUC L;  4GKK Q;  4DV5 L;  3O13 A;  1JOQ A;  2WIN B;  5CV6 A;  1HNX H;  1JT8 A;  3RR5 A;  4F88 A;  2MO0 A;  3S1N H;  3QFF A;  1BO0 A;  5LXT F;  4A3F G;  1N32 H;  2UUB Q;  4H7B A;  3LNN A;  3GTK H;  1B50 A;  1C8C A;  5CB4 F;  4YY3 H;  4B3S Q;  3PVX A;  1JE4 A;  2EXD A;  4V0B A;  4JI1 L;  1IBK L;  2N88 A;  2UUA Q;  1TWG A;  1PH8 A;  1IBL L;  2R7N A;  1CUK A;  4DUZ Q;  4FBU A;  1H9S B;  1KL9 A;  2Q2T A;  3S2H H;  4IOA A;  1JDE A;  3ZYY X;  4DAP A;  2MHV A;  1GSO A;  5A2Q L;  1N33 L;  1DIK A;  5HV6 A;  1S97 A;  4JC0 A;  5KFW A;  1V8Q A;  2B2U C;  3G48 A;  3V6K A;  4K8J A;  4FDB A;  3J81 i;  1HR0 H;  2ID0 A;  3PR4 A;  3J7Z C;  1U0L A;  4QW8 A;  4DAM A;  1K1S A;  2M2L A;  4J8Q A;  2Q2U A;  1MBY A;  3MXG A;  1HR0 Q;  4HNU A;  1L1O A;  3L4J A;  4DR1 H;  3PUW A;  3BAA A;  4QWC A;  2EQS A;  1J9O A;  2PQE A;  4YB8 B;  5CV8 A;  4M1U B;  5KG4 A;  4WOR A;  2KA7 A;  4G57 A;  4F4W A;  1Y1V G;  1HNW Q;  1SMY D;  5AJ3 L;  3KHL A;  5F2D A;  5E4W C;  2I0Q A;  5IWA L;  3AFP A;  2JSO A;  1OTC A;  1WFQ A;  5IIF A;  2BQU A;  4OWW B;  3KYH C;  2RKS A;  1GLV A;  4B3S H;  4A3E G;  2ZJP A;  1Y8O B;  5IYC G;  2R7Z A;  1UUP A;  3T5L A;  4FP5 D;  1AE3 A;  1LT5 D;  2NTT A;  1BNZ A;  5H80 A;  2NVX A;  1HA6 A;  2PNH A;  1BDO A;  1CQF A;  2W8L A;  5IP7 H;  3OWE B;  4V19 0;  4A75 A;  1K83 H;  1A8V A;  1HNX L;  5COR A;  4GKJ H;  3K5H A;  1SNQ A;  1AN8 A;  2LXK A;  4F4Z A;  4O1N A;  1M0T A;  3DWQ A;  2YW2 A;  2ZXR A;  1I4X A;  3IL8 A;  2DUD A;  5JJK A;  4ME5 A;  4X66 Q;  2V4D A;  2E2I A;  4KMU C;  1AZQ A;  5M5X H;  1BOS A;  1SE8 A;  1E22 A;  1KDC A;  5C5J A;  1VQ7 A;  2FK1 A;  1BCP C;  4X66 H;  3HOU B;  2JA7 G;  4UDU C;  4P75 A;  5IGG A;  4JOI C;  4M7E A;  4DL3 A;  1Y1W B;  1I94 Q;  1I7N A;  2OEO A;  4POG A;  1DOM A;  3HOX H;  1ICF B;  2D0P A;  3GTJ B;  1W3S A;  1DGS A;  3TEH B;  4L5T A;  5BN5 A;  5E4X A;  1BXT A;  3R8B A;  4KY6 A;  5KFR A;  1UNS A;  5KRU A;  3BVZ A;  4DL7 A;  1NMG A;  2DIK A;  4LF9 H;  1VQK A;  5J22 A;  2VA2 A;  5I47 A;  4C5A A;  4B3M Q;  1F2L A;  3ORQ A;  3CC2 A;  2CQY A;  1DOK A;  2A6E C;  4UP7 A;  4IUQ A;  1A3V A;  4JI1 Q;  1IBK Q;  4ED0 A;  3I8Z A;  4B3S L;  1S68 A;  1ULZ A;  1N8R C;  1PH6 A;  1JB3 A;  3QR8 A;  3BU2 A;  2B29 A;  3ULL A;  3R5X A;  3L3O C;  2SOB A;  3A5Z B;  3I4N G;  3H15 A;  4ECX A;  5EQ0 A;  4DV5 Q;  2EJM A;  2JA6 H;  3OOC A;  4B3M L;  3H0G H;  1FGU A;  4CKC A;  4MIU A;  2Y0S B;  2AKW B;  1U4P A;  3VDY A;  5IP7 G;  4RG1 A;  1YHQ A;  3GTO H;  1WR2 A;  5DG7 A;  1X56 A;  3N6X A;  2R93 H;  3HEJ A;  3STB C;  3J80 c;  1WI5 A;  3KXY T;  3FEW X;  2XC9 A;  3RLO A;  4MA0 A;  4BA1 I;  4AIM A;  4E4T A;  4DV7 L;  4LSA A;  1IBL H;  2FK2 A;  4G7H C;  1A63 A;  4O2A F;  4A3E B;  1EIY B;  4X64 L;  3NEM A;  2BH8 A;  1YJ9 A;  1HNW H;  3G6J B;  3OIQ A;  1RD9 D;  2RDF A;  1D5X C;  3GTK A;  4KHP Q;  5KG1 A;  1DV1 A;  4XX0 B;  3R2I A;  1W6J A;  3VPB A;  1OXS C;  1JJC B;  1GO3 E;  1BUV T;  2G9D A;  5L1I A;  3HOZ B;  1EIH A;  5M3F H;  2NZH A;  5EBD A;  4LFB L;  1N36 H;  4LH7 A;  2PQA B;  1VF5 C;  3DM3 A;  3FPP A;  4I50 F;  4TQR A;  1GUW A;  4JI3 H;  1VQN A;  2ZTD A;  3K7A H;  4U6P A;  3S16 H;  1AP0 A;  4DK1 A;  3HOW G;  1GUN A;  1YIT A;  1Y1W H;  1CI3 M;  3HOX B;  3GV6 A;  3KF6 B;  3GTJ H;  2JEA I;  2LS0 1;  3C1E A;  3MXP A;  4WJ3 M;  3I56 A;  4X62 H;  3RLF A;  2A5H A;  2CVR A;  2F0Q A;  1F2Y A;  4A3F H;  1WD0 A;  3G6X A;  4DR5 H;  1PYS B;  3AMU A;  4GOP A;  1PMR A;  2KCN A;  4X3S A;  1IKL A;  4OX9 L;  1DZ1 A;  1K3B C;  2FMM A;  3S24 A;  4ED7 A;  4QB4 A;  4G7Z C;  3PO3 B;  2SDF A;  2L5T A;  1N32 L;  3GIP A;  1PH9 A;  2W70 A;  2R8I A;  4Q43 A;  2KOL A;  4A3B B;  4PQX A;  3RJ0 A;  3RB4 A;  1PV4 A;  2CQA A;  1SFO A;  5C4X H;  4R9W A;  4KN7 C;  2HIV A;  1Q7Y C;  2KUM A;  4H02 A;  4JVZ A;  1UC8 A;  1I4H A;  1FKA H;  1PXU A;  3OHB A;  1DYQ A;  1BBX C;  4IR1 A;  2A73 B;  2B2V A;  2X0S A;  3S1R B;  1YJW A;  2EY1 A;  5IT9 c;  2HHH L;  3G71 A;  1YVC A;  3KLR A;  3A55 A;  1PZK D;  4KY7 A;  3S1M H;  1EY7 A;  4EYI B;  5FD5 A;  2C2R A;  2Z8L A;  2VUM A;  1Z6H A;  2F0N A;  1H9M A;  4JI0 L;  5C4Z A;  4ED6 A;  1J6Q A;  4EEQ A;  4JI2 Q;  3KF6 A;  2B2Y C;  2NUC A;  3JSN A;  4IWY A;  3CCE A;  4EYH B;  5FPO A;  3URY A;  2YS7 A;  4IRC A;  4YR2 A;  4QIW E;  1SJE D;  5FD6 A;  3PUV A;  1VQD A;  5FK9 C;  2HDL A;  3H0G G;  3HKZ B;  3TSS A;  4ZYS A;  2E2H H;  2NVT H;  4O3N A;  5KFB A;  3K59 A;  1LTG D;  3K58 A;  3AQQ A;  3I4N H;  3IAY A;  3CF5 A;  4X3T A;  1UAP A;  2PMZ A;  5IOD A;  1PRT F;  5KKN B;  4IQZ A;  2JA5 G;  2KCM A;  4YJ2 F;  4LF4 L;  5CA1 F;  3HP3 A;  3K5O A;  2R7Z G;  1D2B A;  2C9O A;  4ZRZ A;  3OHA A;  1D1K A;  5LHY 1;  3A7A B;  1LTS D;  4UCO A;  4KV6 A;  3JRW A;  4E6I A;  4X64 H;  4M8A A;  5CMD A;  5KFD A;  4R7R A;  1Q81 C;  5KFU A;  5EKI A;  2ZDH A;  1PLF A;  3PW2 A;  2PW5 A;  2UXD Q;  1V1Q A;  2UVW A;  1EY0 A;  2VB2 X;  4JBK A;  3OWF A;  3ERS X;  5EOY A;  5HY6 A;  5CR3 A;  1E7Z A;  1AUV A;  3PUZ A;  4F8M A;  1HR0 W;  1N56 A;  2JA7 H;  1XMQ H;  1TWC B;  4XYL B;  3MAQ A;  4WJ4 A;  2JA8 G;  1OXU A;  2C22 A;  2YYZ A;  3VA7 A;  2RCN A;  1UE7 A;  2TSS A;  3OIP A;  2R92 G;  2QYZ A;  3A8I E;  2Y0S G;  4JOI A;  1D1I A;  4DK3 C;  5D1O A;  3IRB A;  1SEB D;  4IUT A;  2NB0 A;  1KC8 C;  4X65 Q;  4LW1 A;  3GTG A;  4K0K L;  2JEI A;  4KJO A;  1J8I A;  2F0P A;  1PH2 A;  3WDN A;  1WTR A;  3NGD A;  3S1M B;  4X64 Q;  3I4M H;  4BY7 G;  1PZI D;  2M05 A;  2IMW P;  2MQH A;  5IYB G;  3CRL C;  3VR2 A;  2YZM A;  1E4E B;  2BA1 A;  1K8A C;  3BZD B;  1G8Z D;  3I7F A;  5FO8 B;  3SVM A;  1EYG A;  2K05 A;  4MV9 A;  1E3P A;  2DNC A;  3CCM A;  4XYQ A;  2ATL A;  3J7A K;  3H3V I;  1UEB A;  1A3U A;  4Z9C B;  5KFE A;  4YCW A;  1RTO A;  2VQE H;  4KD3 A;  3W2D A;  1VQ6 A;  4BWS C;  4JYA Q;  4EFE A;  4C2M B;  1YI2 A;  1A15 A;  1BGW A;  1SYG A;  3CCS A;  5C4H A;  1PK8 A;  1EHI A;  5C4X G;  2RGR A;  2AQ1 B;  3W5O A;  2OH2 A;  2OLS A;  2HQL A;  3K57 A;  2NWG A;  2ZJR A;  2E2I H;  3MZ5 A;  3U9S A;  3IKJ A;  1FR3 A;  4C5B A;  3RN2 A;  2EYH A;  4C3J H;  1QWY A;  1V4Y A;  3UDF A;  1G29 1;  3D6W A;  5C3X A;  1ZHS A;  4IR9 A;  2EYJ A;  1F9R A;  3EBE A;  5M5Y H;  4X6A H;  3KAJ A;  2J6U A;  1K8M A;  1QNU A;  2RDH A;  2FE3 A;  3LML A;  3N41 B;  2QIL A;  3Q23 A;  4GNX B;  4X3K A;  1JCK B;  1O80 A;  2XWJ B;  4YCU A;  2W7P A;  2Q8I B;  3GV5 B;  3G7L A;  4PG3 A;  5AJ3 Q;  1EFW A;  3TS2 A;  2VXW A;  1W2B A;  3RTX A;  1BJT A;  4C3H H;  1EWC A;  4YR3 A;  2K50 A;  2E8G A;  1QVC A;  4OWT B;  3VA5 A;  4HNT A;  3CCV A;  1VQM A;  3WWV A;  3J81 W;  1K1Q A;  4MV3 A;  2F4V H;  3KLS X;  2NUA B;  2LKV A;  2C2D A;  4YAJ B;  4FF4 A;  2V59 A;  1EUC B;  1S5C D;  2YCH A;  4K5V A;  3BVM A;  2Z4I A;  2DY7 A;  5I4D A;  3T1Y L;  3HOU G;  2UVR A;  3TZD A;  2VW9 A;  2HCC A;  1CQJ B;  4QWE A;  4HSP A;  2JA6 B;  2F0U A;  5JVG 3;  1LT4 D;  1HZB A;  2XCA A;  2ASJ A;  2R8H A;  3L2P A;  1IYU A;  2L9H A;  2ZTC A;  1K0R A;  1VMC A;  2NYZ D;  5C4J B;  4X62 Q;  1SR3 A;  1HUM A;  2KHI A;  5HGQ A;  1Y1V A;  1U4M A;  4LWC A;  4IHJ F;  2UXC L;  2DJF C;  2J0T D;  4O3P A;  2DWC A;  2JA7 A;  2VS1 A;  1PHJ A;  4FS2 A;  1WH2 A;  4POF A;  3J7A V;  1Q3L A;  1GJX A;  2PMZ E;  2JP1 A;  1XNR L;  5LMN L;  4DR4 Q;  2XGP A;  3WO1 A;  1PYB A;  3JRX A;  4IOC A;  2AQ3 B;  5TSS A;  4F7X A;  2M00 A;  1N48 A;  4G7O C;  3UE1 A;  4EQ5 A;  1KQS A;  4YJ3 F;  1KAB A;  2WB1 G;  3TZU A;  5DNF A;  2PZT A;  5DGA A;  4LFC L;  4DV5 H;  1LTT D;  2E5L Q;  1SYF A;  3NQI A;  2QF7 A;  2PQA A;  1HR0 L;  3CME A;  4WBN F;  1T3N A;  2WAQ G;  4KHV A;  1WVL A;  1QIL A;  1SNO A;  2RHQ B;  4CJ0 B;  4HQ6 A;  4DKA C;  1HQM C;  2XVS A;  2HGS A;  4R4C A;  3V4S A;  4YAK B;  4DUZ L;  3HBL A;  5C3W A;  2KSW A;  4UP8 A;  2YTV A;  3GP7 A;  3RB0 A;  4YP3 A;  2FP4 B;  3NWT A;  1IBK H;  4JI1 H;  3CCR A;  2BDN A;  4B3T Q;  3SE7 A;  1TT2 A;  4O0A A;  2Q2I A;  5KT5 A;  1XPO A;  1EYZ A;  2UUB L;  3BA9 A;  1SE3 A;  5M3F G;  1MSG A;  2E5L L;  1EY9 A;  2R85 A;  3TQY A;  4P74 A;  2FMA A;  3AYH B;  3STB D;  1Q90 A;  1F9P A;  3SDZ A;  2K52 A;  3RMH A;  1I94 H;  1H9K A;  2H1E A;  1MZB A;  4I7A A;  3IG0 A;  4UCV A;  1EOV A;  5EPJ A;  1MKH A;  2F0O A;  2K03 A;  4QUC A;  1PFS A;  4JG2 A;  4A3J B;  1FJG Q;  3GTP B;  2RBM A;  1IBM Q;  4R4Q A;  1KC7 A;  1R4Q B;  1IL8 A;  1XJV A;  2Z6B A;  1Z2N X;  1XMQ L;  4J9Q A;  2F0M A;  4HCS A;  5KG3 A;  3GTM B;  3MXN B;  4DLK A;  2UXB Q;  4GC7 A;  3Q8P B;  5FO7 B;  4I65 A;  4N9T A;  1TWC A;  4ECV A;  1EYD A;  5GRO A;  1EU4 A;  2K01 A;  2WP8 J;  5L37 A;  5EWF A;  2YV5 A;  3QIA A;  4QWA A;  3KDF A;  4HSV A;  1VQC A;  2NVX H;  4IJL A;  1Z47 A;  3GTJ A;  4A3E H;  5M3M G;  1LAB A;  4EBD A;  5LMU H;  4CJ2 C;  1K8O A;  4C3J G;  1PH5 A;  2VOB A;  3CRK C;  1WTX A;  2XN9 C;  1WTP A;  5M9O A;  1C9O A;  1S0O A;  2YRX A;  2B63 A;  2L4N A;  2HCI A;  1FYC A;  2O2L D;  2NVT B;  3GII A;  1R4P B;  3BYT B;  4QWD A;  1STY A;  4DR1 Q;  1GSA A;  1EU3 A;  3JC6 6;  1FNW A;  4MV8 A;  1ZEQ X;  4BBR G;  4QGU A;  3A56 A;  2GVA A;  3QWN A;  4LFA L;  4NXM Q;  4TV8 F;  3H3V C;  1MI2 A;  1XMO Q;  2B2W C;  2L11 A;  3CQZ B;  2XGQ A;  5JPN C;  2IX0 A;  2R7F A;  1CTM A;  4GNX A;  4DUZ H;  5LMU L;  2FPP B;  1R9T H;  4DGZ A;  4J1M A;  2Q2H A;  1D5Z C;  5CV7 A;  2I8C A;  1KLU D;  1SNP A;  2YL2 A;  3D4R A;  5DLQ E;  4KLK A;  1H9R A;  2F0H A;  1B44 D;  4UY8 C;  4BXX G;  2MO1 A;  2JA7 B;  4DL4 A;  5KT2 A;  3DXJ C;  3HRZ C;  1VQE A;  2WAC A;  2FPG B;  3MR5 A;  5FLX W;  4DV7 Q;  2MP1 A;  2UXB H;  3HS0 C;  3N40 P;  3ERQ A;  1N34 L;  1S0N A;  1PTO D;  2F0S A;  1A9X A;  3P20 A;  5D3I B;  5CBE E;  5IE8 A;  3GTL H;  3HOV G;  2WFW A;  2XTI A;  4IFD G;  3X3M A;  3J7Y W;  2K5H A;  2JA8 H;  3PMF A;  2B8F A;  2NVY H;  3BG3 A;  1BR9 A;  4HED A;  2CZG A;  4DL6 A;  1N34 H;  2F0T A;  3M9M B;  1IL2 A;  4UCT A;  2FJZ A;  4HAE A;  2RA4 A;  4DV4 L;  1RF2 D;  4P2C B;  3RZD H;  4N8F A;  3GV7 B;  5FLM G;  1UNN C;  1S5D D;  3LGJ A;  3KDF B;  1V1P B;  2EYO A;  2KQ3 A;  5J3B A;  1I3Q H;  4JYA H;  2MUY A;  4LF8 H;  2ALY B;  1FJG L;  2N49 A;  3NEN A;  2L0C A;  4DNI A;  1Y69 U;  3GTQ B;  1M6V A;  4DK0 A;  3PR5 B;  2BQR A;  4BY7 B;  3RAX A;  3MXN A;  1VQ9 A;  4FF1 A;  1OXT A;  1BF4 A;  1EZ1 A;  3Q8Q B;  2VQF H;  3RV3 A;  5IYB H;  1MSH A;  1SXT A;  3GIJ A;  3T56 B;  2W6P A;  1KJI A;  5JEA G;  4NXN L;  4DUY Q;  2JJQ A;  3HKS A;  2IX3 A;  2ASB A;  3KJO A;  1SFO H;  1N36 L;  2E2I B;  2O4X A;  1CKN B;  3RB3 A;  3Q8D A;  4DR2 Q;  5IYZ F;  3PO2 B;  4JBM A;  1E24 A;  4EFB A;  3E5S A;  1T5X D;  4I7Z C;  4LF5 Q;  3S1N B;  2RSN A;  3NTH A;  4ZQ3 A;  4G4K A;  2YYA A;  1T36 A;  1A2T A;  1X55 A;  4K8I A;  2I80 A;  1ZXT A;  3GTK B;  1JWS D;  2MPM A;  4ZKB B;  5M3M H;  2UU9 L;  1XMQ Q;  1HFN A;  2ZJT A;  4EQP A;  4DR3 Q;  1ILQ A;  1B8A A;  3UDX A;  4PNY A;  2GA4 B;  3TP5 A;  3TII A;  1XNR H;  2R3Z A;  3H3V H;  3A54 A;  5CC4 A;  2MGS A;  1VQ4 A;  3L4K A;  1CM9 A;  4L5R C;  1W93 A;  4A3L G;  1I50 B;  2A69 C;  1SYX B;  2IBK A;  5C5L A;  2UUC Q;  1GUO A;  3M4I A;  4DL2 A;  2FXQ A;  1DM0 B;  2PMZ B;  4AYB G;  1E0B A;  2I07 B;  3S15 H;  1EY8 A;  1TWC H;  2A1A A;  4HMI A;  4NKL A;  4A3D G;  4A3D B;  5K36 G;  3OTO H;  1NSN S;  3KLS A;  2ZT9 C;  4DV0 H;  4GC6 A;  4HID A;  4LFA H;  1I5F A;  1CK1 A;  1ET6 A;  1GGO A;  2JA5 A;  3NSW A;  4TQS A;  1UWV A;  3BQ0 A;  4LUO A;  4LMQ D;  5GQO A;  4JI6 L;  3BS1 A;  1SRU A;  3Q8R B;  3PIO A;  2WKC A;  3ICE A;  4A93 B;  1EYC A;  1LM0 A;  1CHQ D;  3NTK A;  4TV9 F;  4U67 3;  2QK4 A;  3KF8 A;  1BQQ T;  1I3Q B;  2P0A A;  2W9B A;  5M5W H;  4GKJ L;  1SJH D;  1B3Q A;  1TWG B;  3I3C A;  5CBA E;  1PH7 A;  1FVI A;  2R82 A;  1Y8N B;  4O3R A;  3HOV B;  4XZ3 B;  1BKB A;  3SK8 A;  2RCF A;  4KKT A;  1TR5 A;  2IHF A;  5C3E B;  2B63 G;  3TME A;  3S14 B;  1N34 Q;  2JE6 I;  2VUM H;  3FMA A;  3A0J A;  1SNC A;  5HGT A;  2CH4 A;  3NBI A;  3TQ1 A;  1TWF B;  1RJQ A;  3MR3 A;  3IFT A;  2FMC A;  2NVY A;  4C2M H;  1RIP A;  4RNN A;  1GHK A;  3TIG A;  5CYU A;  4TKO B;  1SAP A;  3TQT A;  3HZX A;  2F0K A;  1RYS A;  1B7Y B;  4XQN A;  3KTM A;  1SND A;  3RBD A;  4PV1 C;  4JI8 L;  2EYM A;  1G2T A;  3VYS A;  2K75 A;  3R23 A;  4ULL A;  1BCP F;  1JIH A;  2PZU A;  1CT1 D;  4FVM A;  3V2T A;  2K5W A;  2MFI A;  4L1K A;  3HKZ A;  1ONL A;  4LF4 H;  3CCU A;  1VKZ A;  3MR6 A;  2AHO B;  2HD3 A;  1TWA A;  3M4Q A;  3SK4 A;  1P16 A;  5C1P A;  4Q44 A;  5DLF A;  3BYY B;  2NZ1 D;  4C3H B;  1NJI C;  1HZ9 A;  5BR8 Q;  3FP9 A;  3KHH A;  5KFL A;  1X3G A;  1VCI A;  5I9O A;  4LF7 Q;  5LP6 F;  1B3A A;  5FLX c;  4HR7 A;  5IT9 L;  1V43 A;  4A3J H;  1E2Z A;  4CBV A;  3SI8 A;  1SCU B;  1G51 A;  4O3Q A;  4JI6 H;  5KGU A;  4F50 A;  4GN4 B;  4DV6 H;  1Q8I A;  1HNZ L;  4BBS G;  4WJW A;  3CD6 A;  4A3C G;  1EIG A;  3M9N B;  1STH A;  2KCT A;  3R5F A;  3RZD B;  1JQY D;  4RGN A;  1GUT A;  5JJL A;  4HJ8 A;  2PCF B;  2YU9 B;  2DNE A;  3PIO 3;  1S10 A;  1L1O C;  1XTC D;  5LOV F;  1TWH A;  3A7L A;  2NN6 G;  1PFB A;  3J7A F;  4X62 L;  1E4E A;  4IZO A;  2UXD H;  2R61 A;  4GLX A;  2BCO A;  1QCB D;  4RU9 A;  3PF5 A;  3NPP A;  2RSO A;  4DR7 L;  2YS6 A;  4QW9 A;  3VPC A;  4S3S A;  2K6A A;  3BQ2 A;  3S2D B;  4XT1 B;  5ELO A;  1WCM B;  3RN5 A;  1CZG A;  2QKI C;  1IBM H;  3HOW B;  1WTQ A;  1TU2 B;  3KK7 A;  5DGB A;  3V6H A;  3OSP A;  5KEE A;  5T1I A;  4HIM A;  1H95 A;  4O2D A;  4ALP A;  1E2W A;  3E0J A;  4JI5 L;  4DR5 L;  4KI0 A;  4KHP H;  4UP9 A;  5FLM H;  1S9F A;  3BG5 A;  5KFS A;  3J80 W;  3K6O A;  5G3L F;  1RL2 A;  2R84 A;  2C35 B;  1RKN A;  1N33 Q;  3NEL A;  4ILW A;  4K0K H;  1T9H A;  1O78 A;  1VF7 A;  4DAY B;  5IYD G;  2R6F A;  3PUY A;  2A68 C;  3QOL A;  1P8L A;  5KNB A;  4C3I G;  1SMY C;  3DLL A;  5BPH A;  1VQP A;  4DNR B;  1RCV D;  1X9N A;  2DN8 A;  2FIN B;  5KFF A;  1GXD C;  1EEF D;  2HVQ A;  1STE A;  1QUQ B;  2WB1 A;  5K5P A;  3M4P A;  3FKI H;  4JI8 Q;  1HCZ A;  3S1Q B;  4FXK C;  1YBY A;  3I4O A;  2DGY A;  4A3G B;  2HIX A;  2PPB C;  4CC6 A;  4K14 A;  5JEA J;  4NDX A;  3C46 A;  2OCE A;  3PIP A;  1MIU A;  4CDF C;  5IT9 E;  3GTP H;  4FNF A;  3Q2O A;  1I6U A;  4CJ1 B;  4DR4 L;  4OGQ C;  1KXL A;  1SRO A;  1EOT A;  1RK6 A;  5FKA C;  2F0G A;  4K2L A;  4L8J A;  1F2M A;  1WTH A;  4QJF A;  5COY A;  1Q82 C;  2E2J B;  3VPD A;  5EKL A;  5LL6 b;  1X3E A;  4U7C A;  1JJ2 A;  4XYM B;  3JAM E;  2SCU B;  4JI3 L;  5IGB A;  2V58 A;  1B53 A;  2EOT A;  1J5E Q;  3QOJ A;  1M0W A;  5M5W B;  1LTI D;  5JH7 F;  1TWG H;  2PW7 A;  3D4W A;  2NVQ H;  2R8G A;  1B04 A;  3MTS A;  1BCP B;  3HKZ E;  4QMG A;  4ZKC B;  4LJZ C;  3DWA A;  4YWK A;  2KJX A;  3SK6 A;  3GTQ H;  5LL6 X;  4AYB E;  4IPG A;  1L1O B;  3RB6 A;  4B3T H;  4ECQ A;  1TVX A;  3I70 A;  3L9A X;  3HOZ H;  3UFX B;  4OL7 A;  5JOB A;  1LTL A;  1HJP A;  4B9X A;  3CU7 A;  1QOH A;  1VQL A;  1VDZ A;  4JI5 H;  5C44 B;  1N33 H;  4K6L A;  5LMN Q;  2R92 B;  4QF4 A;  5JJZ A;  4JUZ A;  4A3I H;  1ML0 D;  5KT7 A;  2VNU D;  1U5K A;  2PI2 E;  2LFN A;  4PZ8 A;  1XX8 A;  4GZY C;  1STB A;  4PWQ A;  1CKO A;  2F4V Q;  1T5E A;  3E9I A;  4N9P A;  1UE1 A;  2B2U A;  2E2D C;  1IYJ B;  4K5X A;  4M9U A;  2ASD A;  3U4V A;  1IOW A;  4FS1 A;  3RBE A;  2K4K A;  5L1L A;  1STA A;  1Z7T A;  4HIK A;  1PZJ D;  3BZC A;  4FYD A;  2JEG A;  1PTO B;  3BDC A;  2CW7 A;  1XMO H;  1YNX A;  5FO9 B;  1E1T A;  2K32 A;  4B9W A;  2Y0S E;  2G9H D;  2NN6 I;  1N32 Q;  3LWB A;  4MTN A;  1HPC A;  4R4T A;  4YY3 Q;  4LF5 L;  3S2H B;  2IL8 A;  4RGM A;  3KAL A;  4IWX A;  2MCT A;  2CW0 D;  4A3D H;  3FDS A;  2C5C A;  1WTW A;  1EEI D;  4XXE A;  3FHW A;  2AU0 A;  2I5L X;  3JSL A;  1UE5 A;  1VQI A;  4A2A A;  1VQG A;  4LMY A;  4DUY L;  1DCZ A;  4NXN Q;  1IYV A;  2KEN A;  1C48 A;  5T1G A;  2AUK A;  1EQQ A;  4RB1 A;  1IW7 C;  4OIK A;  4C2M A;  5DLG A;  2D9U A;  3ZJY C;  4J9L A;  2HVR A;  4OXP A;  2V4R A;  3ULJ A;  3S9W A;  4O4L F;  1E4G T;  2YU9 H;  1WYD A;  3T5H A;  3KF8 B;  4EGV A;  4UCU A;  4R8U A;  1EWI A;  1EYA A;  3B6Y A;  1IZ6 A;  1HNX Q;  2PN1 A;  3MHB A;  4IZ8 A;  4K0K Q;  5KFJ A;  2XWB B;  3FVQ A;  3MXU A;  4OO1 G;  5C1O A;  1TS5 A;  2N55 A;  2L1B A;  1KJQ A;  2JEF A;  3H4B A;  1WCM H;  4BWG B;  5IP9 G;  3GQB A;  1RHP A;  3HB9 A;  3CCQ A;  1I6H H;  4RUA A;  4JI7 H;  4IJH A;  3H4D A;  4FO2 A;  3T5K A;  2W8K A;  3GTG B;  2BDO A;  4O42 A;  1DD2 A;  5KNC A;  4YBZ B;  2DPJ A;  1HNZ H;  4A3M B;  3SEB A;  1I6V C;  4WFN 3;  2E76 C;  3R2T A;  4DV2 L;  2YRW A;  4ZAI A;  2E75 C;  2F0L A;  5DM7 3;  2CHB D;  4ABN A;  5GAE C;  1IHZ A;  1KJ8 A;  4RHS A;  4ECT A;  3R3O A;  1KLG D;  2EY6 A;  2I5H A;  4DAY A;  4MTE A;  3BJY A;  4LF6 Q;  1T94 A;  4IUV A;  3EJI A;  4R4I A;  2MJ8 A;  2EXZ A;  3H40 A;  1XDN A;  2VUM G;  3MWY W;  2B8G A;  4LFA Q;  3TP6 A;  4EQO A;  3CC4 A;  4NXM L;  2FB9 A;  2XCL A;  1U9R A;  1SEI A;  2VPQ A;  1S03 G;  3C1F A;  1ZKO A;  1BNC A;  4F4X A;  2F3V A;  3NK9 A;  3FPU B;  5D8D A;  4C1N K;  4XQJ A;  1K0S A;  4IUP A;  1AH9 A;  3RGX A;  5KG0 A;  2JA6 G;  5C44 G;  3TS0 A;  4C3H G;  1S72 A;  5JQW A;  2C00 A;  2EE1 A;  4QUF A;  5I2Y A;  3JAM c;  3H0G A;  5I2X A;  2ASL A;  3M4Y A;  4P73 A;  2AQ2 B;  2LSS A;  4JV1 A;  1CQV A;  3E3X A;  3DEO A;  5KFZ A;  3FKI A;  4P72 A;  5DQG A;  4EQN A;  4LF6 H;  4B3R Q;  1GYF A;  3P1H A;  2QA4 A;  4DV0 Q;  5L1K A;  2A6E D;  1TS3 A;  1QVG A;  2NVQ B;  3JZI A;  4A3K H;  3I4L A;  2WDT A;  1CKM A;  2R7Z B;  1JMC A;  3MJF A;  2FLL A;  1NUC A;  1CSP A;  1ENA A;  1PRT B;  1F77 A;  4QIW B;  2NTS A;  5C0X H;  3V4Z A;  4AYB A;  5BN3 A;  1R9T A;  3WOF A;  5KYL A;  1LYL A;  5C3E H;  4RCO A;  3QO2 A;  4JBW A;  4JCV E;  2WYO A;  1RJR A;  3TP8 A;  2O5I C;  5GAG C;  1NNX A;  3F2U A;  1GHJ A;  4B3R L;  1W6K A;  2E2H B;  3LWU A;  5KFN A;  4MTK A;  2OT2 A;  3I4N B;  4DA2 A;  4PZ6 A;  4H13 C;  4JV5 L;  1UC9 A;  5A35 A;  1JB7 A;  4HR7 B;  1L0X B;  3JAM i;  4PMB A;  3UE0 A;  5KG2 A;  4QIW A;  1VQJ A;  2UUB H;  3K0Y A;  2F0W A;  1UEA B;  1KAW A;  3EYY A;  1H9S A;  3WOE A;  2H5X A;  5EGT A;  4DUY H;  3KLW A;  4ZUJ A;  2FPI B;  3VR3 A;  4J9R A;  4IPC A;  5DM6 3;  1G6Z A;  2BE5 C;  1DJR D;  1TWA B;  1K8G A;  1S3O A;  2CWP A;  3PW4 A;  3M9B A;  3D4D A;  2LMC B;  3MFG A;  4GOP B;  3PO3 G;  1KIX A;  5AFW A;  2XIG A;  4ID6 A;  4JI7 L;  4R1J A;  3V05 A;  3CKI B;  4DN4 M;  4LF6 L;  3TRZ A;  1B33 N;  2ATW A;  2K5Q A; 
#chains in the Genus database with same CATH homology
 1GM5 A;  3L0O A;  5IYB H;  2K14 A;  3A5Z B;  2UUA L;  4A3G H;  4MZ9 A;  2IX1 A;  3I4N G;  1QVF A;  3H15 A;  3F2D A;  4DV5 Q;  5JEA G;  5FJ8 G;  1M90 C;  2JA6 H;  3OTO Q;  4NXN L;  4DUY Q;  2JJQ A;  3CXC A;  3H0G H;  1FGU A;  3HKS A;  2HHH Q;  4B3M L;  4KHZ A;  2GN5 A;  2ASB A;  3KJO A;  2AKW B;  5C0X G;  1SFO H;  1HH2 P;  3CQZ H;  4GN5 A;  4TQU S;  4RG1 A;  5IP7 G;  4DV0 L;  1Z9F A;  3VDY A;  1CKN B;  1Y14 B;  3Q8D A;  3PSI A;  4DR2 Q;  1N36 L;  4A3G G;  1X56 A;  2R93 H;  4JBM A;  1E24 A;  4JBJ A;  2K5N A;  3STB C;  3J80 c;  1S40 A;  1LUZ A;  1IBM L;  1WI5 A;  4LF5 Q;  1TWH H;  1M1K C;  1X55 A;  4DR7 Q;  1A0I A;  1CSQ A;  3RLO A;  4BA1 I;  4AIM A;  2UU9 L;  5M3M H;  4DV7 L;  1XMQ Q;  2R7Z H;  4DR3 Q;  4HJ9 A;  4A93 G;  3BU2 A;  1X6O A;  1B8A A;  3UDX A;  1A63 A;  1WOC A;  2JK8 A;  3H3V H;  1EIY B;  4X64 L;  2GVB A;  3NEM A;  1VQ4 A;  2HT1 A;  3HOY H;  5JJI A;  2BH8 A;  1YJ9 A;  4L5R C;  1XNQ Q;  4A3L G;  4QY7 A;  4P71 A;  1YHB A;  4DR5 Q;  2UUC Q;  1VQF A;  4KHP Q;  2CQO A;  3M7N A;  2FXQ A;  4AYB G;  4MNO A;  1OXS C;  1JJC B;  1GO3 E;  4IO9 A;  3S15 H;  1TWC H;  4A3I G;  2A1A A;  3S1Q H;  4A3D G;  4IFD I;  5K36 G;  3GD7 A;  4BY1 G;  4JI5 Q;  1VQA A;  5M3F H;  2NZH A;  4DR6 Q;  3S2D H;  4LFB L;  1JJG A;  4BA2 I;  3GO5 A;  4HID A;  2PQA B;  2ZM6 L;  1I5F A;  3BZK A;  3DM3 A;  4GS3 A;  4YHH L;  1C7Y A;  1VQN A;  2ZTD A;  4X66 L;  1SN8 A;  1UWV A;  1PA6 A;  3K7A H;  2R92 H;  4AH6 A;  3S16 H;  4LUO A;  3NBH B;  3HOW G;  1YZ6 A;  5GQO A;  1YIT A;  1Y1W H;  4JI6 L;  1SRU A;  5LMU Q;  4JI7 Q;  2A19 A;  3KF6 B;  3PIO A;  3GTJ H;  3ICE A;  2JEA I;  1O7I A;  2CFM A;  4WJ3 M;  1LM0 A;  1A62 A;  3I56 A;  3RLF A;  2WB1 E;  2RF4 A;  4A3F H;  2UXC Q;  4LNQ A;  2RHS B;  1PYS B;  4LFB Q;  4BXX H;  1GKH A;  4GOP A;  5M5W H;  3PO2 G;  4GKJ L;  1KRT A;  4OX9 L;  3K80 C;  1PH7 A;  1FVI A;  4HIO A;  3S24 A;  3K81 C;  1BKB A;  2B63 G;  3MEF A;  2I5M X;  2IHF A;  1N34 Q;  2JE6 I;  2VUM H;  1CKN A;  1L2F A;  4ME3 A;  4A4I A;  1N32 L;  3A0J A;  1PH9 A;  4JV5 Q;  1BVS A;  4C2M H;  1RIP A;  3T1Y Q;  2R7D A;  3F8T A;  2UU9 Q;  3J7A 5;  1PV4 A;  5C4X H;  2ZM6 Q;  4PMW A;  1B7Y B;  2HIV A;  4DV4 Q;  1Q7Y C;  5C44 H;  3PUX A;  5E7N A;  4JI8 L;  2D0O A;  4H02 A;  2KBN A;  2K75 A;  1EIF A;  5BR8 L;  4IPH A;  4KHP L;  4LF7 L;  1YJW A;  2HHH L;  5IT9 c;  3G71 A;  1YVC A;  5C4J H;  2MFI A;  4LF8 L;  1VS0 A;  2YTX A;  3S1M H;  2VL6 A;  5IYC H;  3F1Z A;  3CCU A;  2AHO B;  1JE5 A;  4C3I H;  3M4Q A;  4JI0 L;  1Q1B A;  1P16 A;  3E9H A;  1G6P A;  1J6Q A;  2VY3 A;  4JI2 Q;  3KF6 A;  4J15 A;  2XGT A;  1VQO A;  1NJI C;  1HZ9 A;  3CCE A;  2OTL A;  1NMF A;  2JEB I;  3FP9 A;  5BR8 Q;  3PV0 A;  1X3G A;  4QIW E;  1VCI A;  1ASZ A;  4LF7 Q;  3PUV A;  4OON A;  1VQD A;  5FLX c;  3HOX G;  3H0G G;  2F4V L;  2E2H H;  1V43 A;  2NVT H;  3CCJ A;  3K0X A;  4A3J H;  4R4O A;  3AQQ A;  1PH1 A;  3CCL A;  3I4N H;  2UXD L;  3CF5 A;  1G51 A;  4Y52 H;  4RMF A;  1V9P A;  2JA5 G;  3HOU H;  2KCM A;  1VQH A;  3L7Z C;  4GN4 B;  4LF4 L;  1HNZ L;  4A3B G;  4A93 H;  4BBS G;  2R7Z G;  3CD6 A;  4A3C G;  3HFZ B;  1KHI A;  2KCT A;  3EN2 A;  4A76 A;  1EUJ A;  4PZ7 A;  1Q81 C;  4OO1 I;  5JJL A;  4HJ8 A;  4L5S A;  2JA9 A;  5C0X J;  2OTJ A;  3J80 i;  1PH3 A;  1L1O C;  2OQ0 A;  3AEV A;  2UXD Q;  1OXX K;  1V1Q A;  2NN6 G;  2CCZ A;  1OXT A;  4GLA C;  4X62 L;  4JBK A;  2WAQ E;  2B3G A;  3ERS X;  3W1B A;  1B70 B;  5HY6 A;  1E7Z A;  1NBW A;  4LFC Q;  3PUZ A;  3U4Z A;  4GLX A;  1HR0 W;  2JA7 H;  1YHA A;  3CAM A;  3PF5 A;  1X65 A;  4AQY Q;  2D62 A;  2JA8 G;  4DR7 L;  4WJ4 A;  1OXU A;  2YYZ A;  2RCN A;  1UE7 A;  5ELO A;  3RN5 A;  1PH4 A;  4JI6 Q;  2AMC B;  3E0E A;  4DV1 L;  4IPD A;  1K9M C;  2BH2 A;  2R92 G;  2Y0S G;  4DR2 L;  4JOI A;  4DK3 C;  3F2B A;  1D8L A;  1Q1E A;  3IRB A;  1VQ8 A;  4IFD J;  1KC8 C;  3RLN A;  3EIV A;  4HIM A;  1H95 A;  4X65 Q;  4LW1 A;  4O2D A;  4K0K L;  4ALP A;  4JI5 L;  4DR5 L;  4KI0 A;  2Z0S A;  4UP9 A;  4GNX C;  1K73 C;  1PH2 A;  5FLM H;  3GTM H;  4EX5 A;  4TVA B;  3I55 A;  4A3M G;  4GLV B;  1RL2 A;  4X64 Q;  2C35 B;  1N33 Q;  3I4M H;  4BY7 G;  3NEL A;  2MQH A;  5IYB G;  1T9H A;  2N8N A;  5C0X I;  3M85 A;  5ELN A;  2BA1 A;  2CWA A;  4DAY B;  5IYD G;  4DR3 L;  1K8A C;  2EIF A;  3PUY A;  1TWA H;  1P8L A;  3I7F A;  1EYG A;  1E3P A;  3DLL A;  3CCM A;  3U50 C;  1VQP A;  1X9N A;  3H3V I;  1UEB A;  4LF8 Q;  3S14 H;  3PO3 H;  4YCW A;  4LUZ A;  3CMA A;  1K3R A;  1QUQ B;  1VQ6 A;  2R93 G;  4LF9 L;  4YHH Q;  1HNW L;  3M4P A;  3K8A A;  4JYA Q;  3FKI H;  4JI8 Q;  1YI2 A;  1YBY A;  3I4O A;  2DGY A;  4DR6 L;  2HIX A;  3CCS A;  4DV2 Q;  5JEA J;  5C4X G;  2OCE A;  3PIP A;  1HZC A;  1MIU A;  3OTO L;  3GTP H;  2JQO A;  4B3T L;  2LXJ A;  3W5O A;  3GTG H;  2KHJ A;  4DR4 L;  1SRO A;  1KXL A;  4QJF A;  1Q82 C;  2HQL A;  2ZJR A;  2E2I H;  3S1R H;  4JI4 L;  2Z6K A;  3RN2 A;  4C3J H;  1X3E A;  1JJ2 A;  3K7U C;  3UDF A;  1G29 1;  3EBE A;  5M5Y H;  4X6A H;  2IHE A;  4JI3 L;  1IXR A;  2AWN A;  2YTY A;  3D31 A;  3PGZ A;  4A3J G;  1J5E Q;  4GNX B;  3BJU A;  3CP0 A;  4YCU A;  1ASY A;  1TWG H;  5AJ3 Q;  4PG3 A;  4YCV A;  1XMO L;  1EFW A;  2NVQ H;  1W2B A;  3TS2 A;  4C3H H;  2K50 A;  2E8G A;  1QVC A;  4OWT B;  3HKZ E;  3CCV A;  1VQM A;  3WWV A;  4HJ5 A;  3FKI G;  2IY5 B;  1KD1 C;  4L5Q A;  4XIG S;  5H1S E;  2VQE Q;  5EAY A;  4YWK A;  3GTQ H;  3J81 c;  4JI0 Q;  4AYB E;  4IPG A;  4A3K G;  1L1O B;  1NE3 A;  4UPA A;  3UDI A;  4JYA L;  3HOW H;  1E1O A;  5IY0 A;  1BBW A;  3HOZ H;  3T1Y L;  1LTL A;  1MJE A;  1HJP A;  2AWO A;  1Q86 C;  2JA5 H;  3HOU G;  1KRS A;  1VQL A;  2VW9 A;  1L0W A;  1HZB A;  1WCM G;  5LMN Q;  4BY1 H;  2ZJQ A;  3U58 A;  3L2P A;  4A3I H;  2ZTC A;  3CC7 A;  2VNU D;  1U5K A;  4A3M H;  1YJN A;  2PI2 E;  4PZ8 A;  1VQ9 A;  3PF4 A;  1K0R A;  3PO2 H;  4X62 Q;  1SR3 A;  4YY3 L;  1CKO A;  2F4V Q;  3E9I A;  2KHI A;  5HGQ A;  4A3L H;  4LWC A;  1UE1 A;  2UXC L;  1IYJ B;  3KOJ A;  3TRE A;  1YIJ A;  3U4V A;  1D7Q A;  2VS1 A;  2K4K A;  1PHJ A;  1IBL Q;  4POF A;  3CPW A;  1I94 L;  4HIK A;  2PMZ E;  3BZC A;  1XNR L;  3G4S A;  2MNA A;  1OXV A;  5LMN L;  4DR4 Q;  1WJJ A;  1YNX A;  1PYB A;  1I50 H;  4IOC A;  1E1T A;  5LMN W;  5IYD H;  2PI2 A;  2Y0S E;  3ER0 A;  2NN6 I;  3CW2 C;  3UE1 A;  1N32 Q;  4EQ5 A;  4MTN A;  1KQS A;  4R4T A;  4YY3 Q;  4LF5 L;  4DR1 L;  1TWF H;  2WB1 G;  4A3D H;  4QQB X;  4DK6 C;  1MJC A;  2QGQ A;  3FHW A;  4LFC L;  3SGI A;  2I5L X;  1QZG A;  2E5L Q;  4LF9 Q;  2PQA A;  1UE5 A;  1HR0 L;  1VQI A;  1VQ5 A;  4YWM A;  1VQG A;  1SMX A;  3CME A;  4JI2 L;  2WAQ G;  1XTD A;  2RHQ B;  4DUY L;  4NXN Q;  2L15 A;  4DKA C;  3HKZ G;  2KEN A;  4R4C A;  1HNZ Q;  4DV1 Q;  4DUZ L;  1EQQ A;  1Q12 A;  4UP8 A;  2YTV A;  1XPU A;  2VQF L;  4DV6 Q;  3J81 j;  4BBS H;  4AQY L;  3ZJY C;  3CCR A;  4OXP A;  2Z6K C;  3ULJ A;  4B3T Q;  4O0A A;  2YU9 H;  1TXY A;  2Q2I A;  4DPG A;  1XPO A;  1Q46 A;  1WYD A;  2UUB L;  3KF8 B;  2VQE L;  5M3F G;  3A5U A;  1EWI A;  2E5L L;  4JI4 Q;  3B6Y A;  1IZ6 A;  5GAH C;  3TQY A;  4P74 A;  5IWA Q;  4DV3 L;  1HNX Q;  3G6E A;  4K0K Q;  2CKZ B;  3AYH B;  3STB D;  3KFU A;  4OO1 G;  2K52 A;  3UDG A;  1X3F A;  3F2C A;  1J5E L;  3AFQ A;  2A8V A;  2OQK A;  3OYY A;  3GTO H;  1EOV A;  1MKH A;  2BA0 A;  3HOY G;  2N78 A;  4NPS A;  1WCM H;  4X65 L;  3M4O H;  4HJA A;  5IP9 G;  1PFS A;  4JG2 A;  4A3C H;  1FL0 A;  3CCQ A;  1FJG Q;  1I6H H;  1YEZ A;  4A3B H;  4IJH A;  1IBM Q;  4R4Q A;  3T1H L;  1UE6 A;  3HOZ G;  4OX9 Q;  1N9W A;  1VQB A;  1XJV A;  2E2J H;  2OWO A;  4YWL A;  2K5V A;  1XMQ L;  4BBR H;  2B63 H;  1BBU A;  3MXN B;  4DV2 L;  1XPR A;  1AE2 A;  1X54 A;  1QUQ A;  2UXB Q;  2N3S A;  3PCO B;  3KJP A;  2UUC L;  4GKK Q;  5C3E G;  4DV5 L;  5GRO A;  5GAE C;  1GD7 A;  2WP8 J;  3RR5 A;  2IT1 A;  2MO0 A;  2ES2 A;  1XNQ L;  3S1N H;  4A3F G;  1JT8 A;  2UUB Q;  2YV5 A;  2R6G A;  3GTK H;  3KDF A;  1VQC A;  1GVP A;  2I5H A;  2NVX H;  4B3S Q;  4LF6 Q;  4APV A;  4IJL A;  1Z47 A;  2EXD A;  4JI1 L;  4R4I A;  5M3M G;  4A3E H;  1IBK L;  2UUA Q;  3M3Y H;  1PH8 A;  1PH5 A;  1IBL L;  1CUK A;  4DUZ Q;  4LFA Q;  4NXM L;  1KL9 A;  2Q2T A;  3CC4 A;  2VUM G;  3S2H H;  4IOA A;  3A74 A;  1C9O A;  3GDE A;  1N33 L;  5IP9 H;  4JC0 A;  3S17 H;  3G48 A;  3I4M G;  4BY7 H;  3J81 i;  4FDB A;  2ID0 A;  1AH9 A;  3J7Z C;  1U0L A;  4DAM A;  1PVO A;  2Q2U A;  4DR1 Q;  5FJ8 H;  5C44 G;  2JA6 G;  1HR0 Q;  3TS0 A;  1L1O A;  1S72 A;  2NZO A;  1Q8K A;  3PUW A;  2ZTE A;  2EQS A;  3JC6 6;  4LUV A;  3JAM c;  1YHQ A;  3RZO H;  4BBR G;  4QGU A;  2GVA A;  4P73 A;  4LFA L;  1Y1V G;  2LSS A;  4NXM Q;  1HNW Q;  5AJ3 L;  1XMO Q;  2I0Q A;  2UXB L;  5IWA L;  1SLJ A;  4OWX B;  1HZA A;  2IX0 A;  3AFP A;  1WFQ A;  1OTC A;  2R7F A;  4P72 A;  4QL5 A;  4GOP C;  3KYH C;  4JI3 Q;  4OWW B;  4B3R Q;  4GNX A;  5LMU L;  2QA4 A;  4DV0 Q;  4A3E G;  2ZJP A;  1R9T H;  2Q2H A;  3CPF A;  5IYC G;  1QVG A;  1N36 Q;  1NTG A;  1AE3 A;  4A3K H;  1CKM A;  1Y1V H;  3W1G A;  5GAD C;  1JMC A;  1EQR A;  5DLQ E;  4KLK A;  2PNH A;  1CSP A;  5IP7 H;  4UY8 C;  1QZH A;  4BXX G;  4A75 A;  1K83 H;  1A8V A;  4DV3 Q;  1HNX L;  2MO1 A;  1LYL A;  5C3E H;  4JBW A;  2LXK A;  4JCV E;  1VQE A;  4GKK L;  4DV7 Q;  1XNR Q;  5GAG C;  4B3R L;  1N34 L;  2DUD A;  5JJK A;  3I2Z A;  4GN3 B;  3D0F A;  4X66 Q;  3GTL H;  5IE8 A;  2VQF Q;  4DV6 L;  3HOV G;  2F3I A;  4PZ6 A;  2WFW A;  2XTI A;  5M5X H;  4IFD G;  4JV5 L;  1SE8 A;  1E22 A;  2K5H A;  4HJ7 A;  4XTC S;  3T1H Q;  1JB7 A;  1VQ7 A;  2JA8 H;  3JAM i;  3UE0 A;  1VQJ A;  2NVY H;  4NB3 A;  2JA7 G;  4LF4 Q;  4P75 A;  1KAW A;  4JOI C;  1IL2 A;  3ULP A;  1I94 Q;  1NY4 A;  4POG A;  2H5X A;  4DV4 L;  3HOX H;  2D0P A;  3KLW A;  3RZD H;  1W3S A;  2VZA A;  1DGS A;  1C0A A;  3TEH B;  4L5T A;  4IPC A;  5FLM G;  4GKJ Q;  3LGJ A;  3OW2 A;  3KDF B;  1K8G A;  1NMG A;  1S3O A;  1VQK A;  2CWP A;  5J3B A;  2V1C C;  1I3Q H;  4B3M Q;  3M9B A;  2ALY B;  3CC2 A;  4GOP B;  1FJG L;  1KIX A;  3PO3 G;  2N49 A;  4UP7 A;  3NEN A;  4JI1 Q;  3RNU A;  4DNI A;  1Y1W G;  4R1J A;  1IBK Q;  4JI7 L;  2QEX A;  4B3S L;  4LF6 L;  3TRZ A;  1N8R C;  3HOV H;  2F52 A;  1PH6 A;  2ATW A;  4Y7N H;  2B29 A;  3ULL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...