2VUMG

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule tags Transferase
total genus 26
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vumG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2vumG01
1I5FA 2V1CC 4EX5A 1VQ6A 1IBKQ 2QA4A 4YCWA 4AH6A 5JJIA 1JT8A 4JI6Q 2RHSB 1HNZL 1PH3A 3S17H 2KCMA 1IZ6A 2NN6G 4JBJA 3NEMA 4J15A 4BXXG 3GTLH 4YY3Q 2ZJRA 1XMOL 3AEVA 3GTPH 2OWOA 1YBYA 1OTCA 2PMZE 1X65A 2VQEL 2NZOA 4QY7A 4DR6L 4P72A 4JI0L 1KQSA 1EQRA 1SR3A 2D0OA 4KLKA 2F3IA 3UDIA 5FJ8G 1AE3A 5ELNA 3KDFA 1EFWA 1L1OA 5BR8L 3KYHC 5GADC 4PZ7A 4AIMA 5AJ3L 3S1NH 1W3SA 1HZ9A 3PUXA 4X64L 4UP9A 1VQKA 4BY7G 4HJ9A 3HOUG 2RCNA 3PUZA 1LYLA 2Z6KC 1N9WA 1UE1A 1MKHA 3STBC 4YHHL 2B63G 1E1TA 5LMUL 2Q2TA 4FDBA 3EN2A 1N32L 1UE7A 3A74A 4JBWA 1GKHA 1Q8KA 2LSSA 2GVAA 3D0FA 2BA0A 4DR2L 1XNRQ 4IFDI 1GM5A 2A1AA 3EIVA 2A8VA 4KHPL 2VNUD 3U50C 1FGUA 1FVIA 1VQBA 1D7QA 2E2IH 4B3TQ 2F4VQ 2RF4A 3PIPA 1VS0A 4A3EH 4NXMQ 1M90C 2F4VL 1CKOA 3OTOQ 4DR1L 3E9IA 2AMCB 2WFWA 3SGIA 5IYDH 1U5KA 3RLOA 2E8GA 1I3QH 2N78A 4A3FG 4QQBX 5M3FH 3UDFA 3OW2A 3S2DH 2JA8G 3F1ZA 1EWIA 3GTKH 1IBKL 4JI1Q 1X3GA 2PNHA 1EIFA 2IX0A 3K0XA 2I5LX 1N33L 3CMAA 3PUWA 4JI3Q 5GAEC 3DLLA 4DUZL 4JYAQ 4C2MH 1QZHA 1IBLQ 2N3SA 1HZCA 1HZBA 1HH2P 1YHAA 4NPSA 4YY3L 1SFOH 4JBKA 4L5RC 3KLWA 3PO2G 2GVBA 4A93H 2ALYB 3A5ZB 3B6YA 3AYHB 3F2DA 3ZJYC 4B3RQ 4AQYQ 3E9HA 3ICEA 4GNXB 2OQKA 4LF6Q 5GQOA 3GD7A 2L15A 2PI2A 1N36Q 4BY1G 4WJ3M 1XJVA 5C4XG 2IHEA 2OCEA 5JEAJ 3JAMi 4GNXC 1YHQA 4DR5Q 5EAYA 3TS0A 1UWVA 2Q2IA 3NENA 5FLMH 4XTCS 4JV5Q 4LW1A 2VQFL 1KC8C 2JK8A 3G71A 1C7YA 2AKWB 2R7DA 4A3IH 5IYBG 3HOWH 2AWNA 4HIKA 4MNOA 1YHBA 4DR3L 3CC2A 1PFSA 1XNRL 1PYSB 3U4VA 3M4OH 1J6QA 2N8NA 4NB3A 1WJJA 4DV0Q 4PG3A 3CCUA 3FKIH 2K14A 5IP7H 4OONA 1NTGA 2R92G 1N8RC 5GAHC 5IWAQ 4LUOA 3FHWA 4B3TL 4UY8C 3STBD 4GNXA 4NXML 3M85A 4BBSG 3M4PA 3OTOL 3RN5A 1VQFA 3TRZA 1YJNA 2HQLA 2JQOA 3MXNB 1VQ9A 3S2HH 1B70B 3GDEA 4OWTB 2HT1A 4OXPA 3TREA 2UUCL 4POGA 1X6OA 1BVSA 2JA7G 3HOYH 1KRSA 1CSPA 1T9HA 3T1YQ 2ASBA 2HIXA 5JJLA 4K0KQ 4GOPB 1YITA 3S1MH 3LGJA 1KIXA 2XTIA 5IY0A 1ASYA 2NVTH 3S24A 3RZOH 4GOPC 1MJCA 1QVFA 3S14H 3L0OA 3CPFA 5IYCH 2MFIA 4LWCA 2CWAA 1Q1BA 4A3LH 3HKSA 2PQAB 2VUMH 4LF6L 1M1KC 5ELOA 3ULLA 4IO9A 1GD7A 4JI4Q 2JA9A 1VQ4A 4LF8L 1KRTA 1L1OC 3CXCA 4IJHA 3Q8DA 2CWPA 4DV1Q 3J81j 2RHQB 3W1GA 1X3EA 2R6GA 4HIOA 2ZTDA 3CCRA 3TQYA 1NMGA 2CFMA 3CC7A 1LUZA 4JV5L 4A3CH 4DV3L 1I6HH 5IT9c 1VQNA 1E7ZA 3M9BA 4B3SL 1PH1A 1IYJB 5GAGC 4GOPA 3KF8B 4LF9Q 3RLNA 1A0IA 5K36G 4JI5Q 1C0AA 4A3GH 3JAMc 1MIUA 1K8AC 4LFCQ 3K80C 4DV5L 1UE5A 1HZAA 4LUZA 3HOUH 5M3MH 3L7ZC 3I4NH 4A76A 3CMEA 4GKKQ 1YIJA 1TWFH 5IWAL 2K5VA 3RNUA 1S40A 1Q7YC 2PQAA 4DUYL 4TVAB 3J81i 1VQCA 2I5HA 1TWCH 4A3EG 4LF7Q 1KXLA 1HJPA 1A62A 2BH8A 1HNXQ 4JI7Q 4A3BH 4R4OA 1PV4A 2B3GA 3UDXA 5IYDG 1VQGA 1S3OA 4P71A 5M3FG 2D62A 1KL9A 2R93H 4JOIC 2JA6H 1RL2A 1O7IA 3ERSX 3I55A 4DV7Q 2Q2UA 2LXJA 1Q82C 1IBML 4DV4L 2CKZB 2K75A 2OQ0A 4QIWE 4LFBQ 1JMCA 1J5EL 5HGQA 1PH6A 1Y1WH 4A93G 1YZ6A 4A4IA 2JJQA 2NVYH 4BA1I 4HJAA 1XPRA 3HOZH 2F52A 1VQMA 1V43A 4EQ5A 3WWVA 4GKJQ 1FJGQ 2JA5H 2ZTEA 1XMQQ 2R7ZH 3I4MG 5C0XJ 2NN6I 3I56A 4AYBE 3CQZH 4X62Q 4X66Q 1SMXA 1E24A 2UU9Q 4JOIA 2Z0SA 5IP9H 4JI6L 2NVXH 5FLMG 5JJKA 4YWLA 1A8VA 1TXYA 4YCUA 4DPGA 1Y14B 4A3IG 3HOWG 5C3EH 3W5OA 4JBMA 4R1JA 4JI5L 3KF6B 4OWXB 4DK3C 2ZTCA 1SE8A 3TEHB 4LFCL 4JI8Q 1GVPA 2KBNA 4APVA 2NZHA 4R4TA 1PH4A 3K8AA 3I4MH 2YTXA 3FKIG 5IP7G 1VQEA 5DLQE 4LF4Q 4IOAA 2LXKA 3CC4A 1QZGA 1WCMG 1K73C 2ATWA 1DGSA 4LUVA 2IY5B 1HNXL 1N34Q 1QVGA 2WP8J 3K81C 4P75A 2E2HH 1VQAA 1PYBA 1SRUA 2IHFA 4PZ6A 2KCTA 1WI5A 4OO1G 3PO3H 2K50A 3HOYG 4IPCA 1SLJA 3TS2A 1I94Q 3H15A 3PCOB 2DUDA 4H02A 4IJLA 3J81c 3CPWA 2UXDQ 1X56A 1E22A 1G291 1X55A 2DGYA 3KF6A 4LFBL 4JI2Q 1IXRA 2QGQA 1V1QA 1K8GA 1VQOA 4DV6Q 3G4SA 1WCMH 1VQJA 3BZKA 2HIVA 3W1BA 1YI2A 1TWGH 1G51A 4AYBG 4OX9Q 2KHJA 5IYCG 4IPHA 2NVQH 4A3LG 2BH2A 4GKJL 3I7FA 3L2PA 3GTOH 1FJGL 3J80i 2VUMG 1CUKA 3H0GH 4L5SA 2EXDA 5M5YH 1NMFA 2JE6I 3I4OA 4X62L 4JCVE 4X66L 5C44H 2VL6A 3EBEA 3BJUA 2CCZA 2ZJQA 1OXXK 1OXSC 4GN4B 4JI1L 1XPOA 3KOJA 4C3IH 2VQEQ 1JE5A 4JG2A 3CCSA 4DR6Q 4JI3L 1NBWA 2ID0A 3E0EA 5HY6A 4JYAL 4A3MH 2K5HA 1IBLL 3GTMH 4DR7Q 4A3KH 2Y0SE 4QJFA 2OTLA 4A3CG 1AH9A 3H3VH 4DR4Q 4GLXA 4C3JH 5BR8Q 2OTJA 1VCIA 1X9NA 1PH5A 1Y1VH 5AJ3Q 3M3YH 1CKMA 4A3GG 4JI8L 4GLVB 4X64Q 4O2DA 3CCJA 4AQYL 4RMFA 3T1HQ 3HOXH 2UUBQ 3HOVH 1TWHH 4B3RL 2UXCQ 2N49A 5M3MG 1N36L 4QGUA 3I4NG 2K4KA 1SROA 1BBUA 2WB1E 4DV2Q 4OO1I 1BBWA 1N32Q 3RN2A 4DR5L 2UUAQ 1IL2A 2E5LQ 3K7UC 1PH9A 4O0AA 4A3BG 3CCQA 4OWWB 3UE0A 4R4IA 3FP9A 1XPUA 1WYDA 2MQHA 1VQPA 3J7A5 2R93G 3PGZA 1I94L 2JA6G 1AE2A 3CCLA 4NXNQ 1KD1C 2ZJPA 2UXDL 1VQLA 4DV0L 2C35B 1K0RA 4YWMA 3F2BA 1YJ9A 2HHHQ 2VZAA 4DV6L 1ASZA 4OX9L 2WAQE 4A3JH 2D0PA 5C0XG 1V9PA 1TWAH 1Y1WG 3G48A 1MJEA 3S1QH 1C9OA 4A3DH 2AHOB 4XIGS 3PIOA 1N33Q 3HOZG 4P73A 3VDYA 2UXBQ 4DUZQ 2JA5G 2R7ZG 4GN3B 2KHIA 3CW2C 1E3PA 4POFA 1D8LA 2JEBI 2CQOA 2Y0SG 2BA1A 4HJ8A 4IPGA 3T1YL 3M4QA 2YV5A 3CD6A 5IP9G 4K0KL 1JJ2A 3AFQA 1JJCB 4TQUS 3S16H 4BBRH 1HR0W 4DR7L 1NE3A 1VQHA 3HKZE 4DR4L 3J80c 4HJ5A 4IFDJ 5C3EG 1UEBA 1WOCA 4KHZA 3ULJA 1HR0Q 2WB1G 3T1HL 1RIPA 5JEAG 2UUBL 2IX1A 1QVCA 5IE8A 3GTQH 3M7NA 2UXCL 2VY3A 1W2BA 1OXVA 2ZM6Q 4JI4L 4BXXH 2B29A 1P8LA 3UE1A 2VQFQ 1K9MC 1K83H 2KENA 4DV2L 4QL5A 3GTJH 4DV1L 1VQ8A 1NY4A 4DR3Q 2UUAL 1YEZA 2E5LL 4R4QA 5LMNW 1QUQB 1JJGA 1PVOA 3RLFA 3RR5A 3CF5A 3DM3A 5E7NA 4YWKA 2YYZA 5FJ8H 1B8AA 1Q86C 2PI2E 1XTDA 2YTYA 5FLXc 3PF5A 5LMNQ 4LF9L 1OXTA 1OXUA 3PO3G 1KHIA 5C0XI 2R7FA 1VQ5A 1Z9FA 4BY7H 1L0WA 4NXNL 1Q81C 2WAQG 3A0JA 4LF5Q 3AQQA 3F8TA 1VQIA 3PUYA 4UP7A 1S72A 1SN8A 3AFPA 1PH7A 3J7ZC 5M5WH 4GKKL 2Z6KA 2HHHL 1Q1EA 2IT1A 3U58A 3A5UA 2EIFA 3RZDH 1EQQA 2B63H 2UUCQ 1XNQQ 1HNWQ 3NELA 3KJOA 4LF7L 4X6AH 1JB7A 2H5XA 1KAWA 2I0QA 1YVCA 4JI7L 3KFUA 2UXBL 4LNQA 1FL0A 3GO5A 4ALPA 4HIDA 3H0GG 2E2JH 3U4ZA 3ULPA 2JEAI 2EQSA 1QUQA 1EIYB 1Q46A 2FXQA 5C44G 3HKZG 1VQ7A 1P16A 4JC0A 4IPDA 1EOVA 4LFAQ 4A75A 1I50H 1X54A 4X65Q 3PUVA 4DV7L 4P74A 4Y7NH 5H1SE 3KJPA 4A3MG 3MEFA 1L2FA 3UDGA 4A3FH 4A3KG 1PH8A 4B3MQ 3CCEA 4LF8Q 5C4JH 3IRBA 2YTVA 4R4CA 2JA8H 2MNAA 1HR0L 4WJ4A 1NJIC 3G6EA 1Y1VG 4L5QA 4HJ7A 3NBHB 4DAMA 3HOXG 2ZM6L 3HOVG 1XMQL 1HNZQ 4ME3A 4DV3Q 4GN5A 3CAMA 3BZCA 4GS3A 4B3SQ 3PO2H 1K3RA 2VW9A 1XMOQ 2UU9L 1BKBA 1LTLA 4DK6C 2GN5A 4DNIA 3PSIA 3CCMA 1PA6A 1CSQA 4RG1A 4JI0Q 5M5XH 3JC66 4DV5Q 1VQDA 3ER0A 3BU2A 4UPAA 4BY1H 5C4XH 5LMNL 4C3HH 3GTGH 2K5NA 2QEXA 3F2CA 3I2ZA 4DUYQ 1CKNB 1UE6A 4GLAC 4KI0A 4Y52H 4LF5L 1H95A 4YCVA 1GO3E 4DKAC 1EYGA 2MO0A 2XGTA 3CP0A 1PHJA 4LF4L 2K52A 3PV0A 1U0LA 2I5MX 5IYBH 2VS1A 4YHHQ 1XNQL 1HNWL 1A63A 5LMUQ 4A3JG 2ES2A 1Z47A 1EUJA 1X3FA 4A3DG 2MO1A 4IOCA 4DR2Q 1N34L 1YNXA 4UP8A 4DAYB 1R9TH 3HFZB 2R92H 1G6PA 4HIMA 3CCVA 3S1RH 1IBMQ 4PMWA 4DV4Q 4KHPQ 1LM0A 3H3VI 1J5EQ 4LFAL 4BBSH 2Q2HA 5GROA 4X65L 3S15H 3OYYA 4MZ9A 3KDFB 2AWOA 4IFDG 1WFQA 1E1OA 3K7AH 4MTNA 1L1OB 4PZ8A 5J3BA 4DR1Q 2YU9H 4BA2I 4BBRG 4B3ML 1CKNA 4JI2L 1YJWA 1Q12A 1PH2A 2A19A 1B7YB 3D31A 3PF4A 2JA7H 4L5TA
chains in the Genus database with same CATH superfamily
1EL0A 4QUFA 1HUMA 2KSWA 2JSOA 4CKEA 3G6JB 4JI6Q 1J9OA 1IZ6A 2NN6G 4JBJA 4J15A 5D14A 4BXXG 1ESRA 3F8NA 5KGUA 3UI2A 3I72A 5C3WA 4YY3Q 3AEVA 3GTPH 2DLNA 2WB1A 2VQEL 4QY7A 4RHSA 1LTBD 1KQSA 4RWSC 5DG9A 3NPPA 4TV8F 4KLKA 3G8CA 4XX0B 1EQVA 4IRKA 4RU9A 2K1BA 1EFWA 3H0GB 3QWNA 1L1OA 1MZBA 1BNZA 1PFMA 2BE5C 4Z9CB 4LMYA 3Q1KA 5JUMA 1STYA 2SNSA 5EJWA 2E2HA 3RBDA 3PUZA 3PW4A 4JYAH 1EY9A 5M5XB 2FK3A 1N9WA 2B63G 1GUTA 1QNUA 1W6JA 5LMUL 3E0JA 3N41B 2M9VA 2YS6A 2JEIA 4FDBA 3EN2A 3Q2OA 3A74A 3ERQA 3I91A 4JBWA 4C3JB 2BA0A 4JUZA 4B3RH 2BDOA 4YJ3F 5EWFA 2FLPA 2K01A 1E4GT 4FS2A 2A8VA 1VDZA 2B2WA 4KHPL 2VNUD 1AUVA 1FGUA 2AQ4A 4WJWA 2GPWA 1E0BA 5EBDA 1D7QA 2E2IH 1HQMC 2F0WA 2R61A 2FE3A 1EU3A 4HCSA 4DR1L 2E75C 1UAPA 1RJRA 3F2UA 3SGIA 5JVH3 1ICWA 5IYDH 1NCVA 5M3FH 1ZHSA 3UDFA 3BAAA 2OEOA 5KFEA 3S2DH 5L1JA 2Z1CA 1HTPA 2L0CA 5I9OA 1T94A 2IX0A 3QZ7A 4ZHQF 1Q90A 4K2LA 4DUZL 1WTOA 4JYAQ 5C6AA 1AP0A 3QR8A 2ALZA 5KFJA 5K5PA 3KLWA 1Y1VA 1BBXC 1X3PA 3D6CA 4I50F 3SI8A 1MI2A 3AYHB 1I6HB 2C00A 4B3RQ 5GQOA 1AZQA 2W6PA 1XJVA 3KHGA 2OCEA 5JPNC 5CV6A 5KNBA 2NYZD 3MWMA 2JXMB 5EAYA 1ONLA 5KKNB 5KT6A 4K0KH 3FPUB 1L2ZA 2ENBA 4YAKB 4DR7H 1F2MA 4DR4H 2AKWB 2K05A 2R7DA 4A3IH 4HIKA 1I7NA 4DR3L 1LTSD 1XNRL 1DV2A 2BE5D 1J6QA 4NB3A 3T1HH 3V4ZA 3D4RA 2L12A 2RDHA 1JWMD 3CCUA 4JI4H 4F87A 2VB2X 4XT3B 4LUOA 1BNCA 2I46A 1K83B 2CH4A 2FJ2A 1TKWB 3IAYA 3M4PA 5KFYA 2HQLA 1EQTA 2JQOA 5KG0A 1PTOB 2QYZA 1N48A 5IGDA 4OXPA 1RCVD 3TREA 4EVOA 2HT1A 2UUCL 4OO1H 1D2BA 4NP5A 3RV4A 2FINB 1KRSA 1T5XD 2ASBA 1CQIB 2HIXA 2QDBA 4RKLA 4LFCH 4K0KQ 4GOPB 4BY7B 2YYAA 3DXJC 4JV1A 2QKIC 3RZOH 5JVDF 3PW7A 1QVFA 4BWSC 3L0OA 4LF7H 4A3LH 4RZQA 1Q1BA 4JI7H 4RUAA 2PQAB 2VUMH 1SNPA 4EQOA 3ULLA 4JI4Q 2JA9A 2EJMA 5ELDA 4C2MB 1I6VC 1SFOB 1EZ6A 2B2TC 2CWPA 2F4IA 1SYFA 2PZUA 4HIOA 5EKLA 4HSVA 4A93B 4ECRA 1E2ZA 2CFMA 4A3CH 5IT9c 2UVRA 2E2IA 2I80A 4MAMA 2WINB 1EFID 4A3FB 2R84A 5K36G 4UCSA 4RAYA 2W7PA 1C0AA 3SXHA 1K8AC 1ENCA 4LFCQ 4DV5L 4R7RA 3MR6A 4A76A 1YIJA 3R5HA 1JC7A 5IWAL 2NWGA 3RNUA 1Q7YC 4X62H 1VQCA 4TQSA 3PO2B 3MHBA 3HOWB 2NTTA 4LF7Q 1KXLA 5H80A 4LAAA 1A62A 4E4TA 3SK4A 4JI7Q 4A3BH 1GUNA 4ZUIA 4O4LF 2B3GA 2PW7A 1VQGA 3JAMW 1S3OA 1TS4A 3Q0AA 1DCZA 1IOWA 2L4NA 1I50A 3OSNA 5K36H 1O7IA 3ERSX 4ZQ3A 2XGPA 1FR3A 1YNND 3KF8A 4DFAA 4G7OC 2KECA 4F7XA 3K58A 4LFBQ 2UVVA 2W6NA 3BYTB 4A93G 3OSPA 5D1OB 2DPJA 4A4IA 2JJQA 4BA1I 1RD9D 4HJAA 1ILPA 4FXDA 1ZHQA 2CVRA 3H4DA 3HOYB 5KFVA 1VQMA 1KDAA 4GKJQ 3QG1A 3T5HA 1CM9A 2ZTEA 4O4IF 4J1MA 4QWCA 2NN6I 4TQRA 3MR3A 1JORA 2C2DA 3CQZH 4X62Q 1SMXA 5DM73 2Z0SA 4HNVA 1KJ8A 2WACA 3S14B 1RTOA 4ETSA 2RDJA 4JI6L 4BBSB 1IW7C 1DOMA 5JJKA 1PK8A 3ND8A 1A8VA 5JJZA 3HOWG 5BN4A 3SDZA 5C3EH 1HXYD 2XCAA 2HDLA 3W2DA 2ZTCA 2JA7B 3TEHB 1EYAA 4APVA 4R4TA 4U673 2YTXA 5IP7G 1VQEA 4RB2C 1T3NA 4DN4M 3S17B 3A56A 1WCMG 3UQ8A 1DGSA 1ILQA 2MP1A 2F0NA 1HNXL 2W70A 4H13C 2CQAA 1CE8A 3GIDA 5IT9L 1PYBA 4PZ6A 3H4BA 4I4TF 1WTRA 5BR8H 5EKIA 3MR5A 1SEIA 3HOYG 4ZUJA 2KHSA 2DY7A 2VUMA 5KIXA 1VF5C 2UXCH 4KJNA 4RNNA 1G291 1X55A 2VB3X 1B9MA 2QGQA 1V1QA 4FXKC 1VQOA 2R8KA 4DV2H 1WCMH 2M05A 4OX9Q 2YZMA 1TR5A 2KCCA 2E5LH 1AUXA 3J80i 1D1IA 3CHBD 1ZQ7A 5M5YH 2XVSA 2L11A 4JCVE 4X66L 2CCZA 1PTOC 4IUVA 3BS1A 1XPOA 4C3IH 5KNDA 3K5NA 5CBEE 2UVWA 1NBWA 5HY6A 4DGZA 4A3EB 4JYAL 1TY0A 1U9RA 2K5HA 3GTMH 5EPKA 5CC4A 5FLXE 3ND9A 4QJFA 1AH9A 3GV6A 1EY4A 2W9AA 2C28A 3N6XA 1I3QB 5BR8Q 5AJ3Q 1BUVT 1IBKH 4GLVB 3CCJA 4B3RL 1TA8A 2XIGA 2C2RA 1KDBA 3HOXH 1O80A 5A2QE 2UXCQ 2RGVA 1HFGA 2BOSA 4J9RA 1BO0A 1IW7D 5EOYA 3P20A 1SROA 2ASDA 2KEDA 4DV2Q 4OO1I 3NTKA 1H9MA 3RN2A 4ZK9B 1TS3A 1Z2OX 1Q3LA 1PMRA 1AN8A 4CJ1B 2E5LQ 4DXGA 4ECSA 1ZEQX 1L0XB 3TDQA 3UE0A 2IA6A 3ETJA 2YRWA 4R4IA 3FP9A 3I4MB 2C5CA 1TIID 3RBEA 3V05A 1VQPA 1DOKA 3VR5A 4KJOA 5G3LD 1KD1C 4MTDA 2ZJPA 2W6ZA 5CV9A 4DF7A 2HHHQ 3CQZA 2VQFH 5LL6X 4DL3A 1ASZA 3HXLA 4IUTA 2DZDA 4Q8FA 1Y1WG 3A8JE 2O4XA 4R8IA 3HOZG 1WTVA 5LOVF 3VDYA 2EJGC 1I4QA 1E3PA 1VMCA 2JEBI 5EDWA 5ISRA 4B3TH 4IPGA 3M4QA 2YV5A 4QWEA 1G91A 3OTOH 1MSGA 3TP8A 4N8FA 4K0KL 3T53B 1B9NA 4DR7L 5C1PA 4IHJF 4DR4L 3J80c 2ZDQA 4IUNA 3QO2A 2LFNA 4HJ5A 2PBZA 2OF1A 3RTXA 4KHZA 3ULJA 1PTOD 2EJFC 4MA0A 2B2YA 3E5SA 1EWCA 3T1HL 2UUBL 3M7NA 5I6WA 2RSOA 4JI4L 3UE1A 2VQFQ 3CVZA 4QL5A 3GTJH 2W9BA 3DMUA 1MBYA 1JJGA 3RLFA 3RR5A 3CF5A 2JEJA 4YWKA 4OIKA 1Q86C 1WCMA 1TWHB 5FLXc 1RYRA 4WD3A 1U4PA 3NWSA 4UAIA 1L0WA 4NXNL 1PH7A 1S72A 4UP7A 2R7MA 4XYMB 3N44B 5M5WH 1V1OA 2DJGC 1Q1EA 3RZDH 1S5ED 3Q8PB 2F0IA 1V1PB 2AQ1B 3NELA 2F0HA 4LF7L 4X6AH 1JB7A 4JI7L 3GTMA 1YVCA 1TVXA 2UXBL 4WRDA 4HIDA 2E2JH 1Z6HA 5KFMA 5M3MB 1K28A 1VQ7A 3HKZG 4JC0A 4IPDA 2H1EA 1JOKA 4MA5A 1PFBA 4K5XA 3VMMA 3S1QB 4FYDA 3QZ8A 1O78A 4Y7NH 1Z2NX 4A3MG 1GUOA 3MEFA 1PH8A 5JVLA 2D5DA 3VYSA 1ZETA 5C1OA 2JA8H 1HR0L 4R9WA 3MFHA 1JCKB 4RGOS 4HJ7A 3NBHB 3HOVG 4ME3A 3TIGA 4KHPH 2EY1A 3CAMA 1CQJB 1J5EH 1LTLA 4J9PA 2GN5A 5KFAA 2SOBA 1IYUA 2FJZA 1S10A 3JC66 2SNMA 1FD7D 3RAXA 1I4GA 3ER0A 3GTQB 2MPMA 4DL2A 3J80L 3V96A 3BVGA 4C3HH 5C4XH 3GTGH 2JA5B 2K5NA 2B8GA 2RDIA 2HQEA 1MSHA 2WE6A 4J8QA 3AB9A 3SVMA 2MCTA 4I65A 2WDTA 4V0BA 3VPCA 3C3LA 1U0LA 1ET9A 4QW9A 1HNWL 5LMUQ 4XDXA 1IKMA 3ONAB 4EBDA 1EUJA 1X3FA 4N9PA 3DWAA 5NUCA 1BCPC 1IL8A 2WB1B 1G6PA 3S1RH 3HOUB 3M3YB 4UCRA 4PMWA 4KHPQ 1Y1WA 5FLXL 1J5EQ 3OSOA 1KLUD 2Q2HA 1F9RA 4DR1Q 1L1OB 1SYEA 4PZ8A 2YU9H 5EGTA 4BA2I 3GIIA 3KBGA 5A2QL 1PH2A 3GTJA 2A19A 2E2HB 5KFOA 3D31A 2X6GA 4MV4A 1SAPA 4L5TA 4FP5D 1XNRH 2QA4A 5JJIA 2RHSB 1PH3A 2KCMA 5D3IB 2K28A 3GTLH 4C1NK 4U7CA 2XNAC 4TRDA 1YBYA 1BXTA 1G8ZD 1SE4A 1X65A 2NZOA 5C4JB 4P72A 4JI0L 3I3CA 1S0NA 4LSAA 5KG6A 1BR9A 1SR3A 4IUUA 1GSHA 2D0OA 4IR1A 5FJ8G 1AE3A 1ML0D 3NP8A 5BR8L 1B1ZA 3KYHC 5AJ3L 1QG7A 3MFIA 4JI1H 3U9TA 3PUXA 1VQKA 3KHHA 4HJ9A 3HOUG 1LYLA 2MHVA 4U6PA 1UE1A 4PMBA 4RUCA 1H9JA 1M8AA 4A3KB 2Q2TA 5KT3A 1CK1A 4BY1B 5EWGA 3TBIB 4J9QA 4EQPA 3HS0C 1XNRQ 3V6HA 1VMPA 5FK9C 5FO8B 5KG2A 4AQYH 1Y1VB 1LACA 1GM5A 3PQIA 3H3VC 1VBHA 1FYCA 2A1AA 4PWQA 2C9OA 3U50C 3ETHA 1FVIA 2N88A 4FVMA 1TY2A 5LP6F 1DXMA 4QWDA 4I7HA 1Q8IA 2NU6B 3E9IA 2AMCB 4DAVA 3GIPA 1U5KA 3RLOA 1BCPD 2N78A 3HKZA 4IAJA 4DL6A 5IGEA 3BABA 2WTFA 3GTKH 5DLFA 2J6TA 1IBKL 4JI1Q 2PNHA 2RSNA 1EIFA 4F4YA 3CMAA 3VA7A 5L1LA 3Q8RB 1QZHA 2N3SA 4NPSA 4L5RC 2OH2A 1LTRD 1SSOA 4FNFA 1X3QA 1GUWA 3JAME 2W6QA 2G9DA 1ULZA 4MTKA 1PRTF 2QEJC 3E9HA 4AQYQ 4CBVA 4A3DB 3WOFA 2L15A 2PI2A 4BY1G 3I4LA 4RGMA 1NR4A 2IHEA 3EFXD 4KN7C 3JAMi 3VYTA 5FKAC 3GTPB 1S5DD 5CORA 1UWVA 2A6HC 2F1MA 3H94A 3TP6A 1S0OA 2D2CC 5T1GA 2C22A 2QK4A 4NLGA 2VQFL 2JK8A 1C7YA 3PW5A 3MXUA 5GONF 4XYQA 1YHBA 3CC2A 1PFSA 3U4VA 3M4OH 4EEYA 2YU9A 4ECYA 1WJJA 3MXPA 3FKIH 2K14A 4OONA 1NTGA 1NNXA 1B50A 1TWAA 4Q43A 5HURA 1NAPA 2F0PA 5IWAQ 4B3TL 2W8KA 3OTOL 4ECTA 1VQFA 3TRZA 4DNTB 1YJNA 5FOBB 3BVZA 3GTLA 1QCBD 5C3XA 1GJXA 3GDEA 4KY6A 1J5EL 2QF7A 4POGA 2QILA 4DLKA 3OW7A 3GP7A 2E2IB 5JJLA 1F77A 3S1MH 1KIXA 1KJIA 4HQ6A 1SXTA 3TZDA 4ZKCB 2A68D 3GTPA 1U4RA 2F0EA 2CW8A 5M3FB 2NU7B 5IGCA 5IYCH 4XYOA 3S2DB 1G6ZA 4RB1A 2KVMA 1HNXH 1J8IA 4LF6L 4UCUA 5ELOA 2I8CA 2R86A 4O2BF 3OMGA 1E2WA 1KRTA 1L1OC 2AGOA 4TKOB 3Q8DA 2EZVA 3J81j 1SE3A 1X3EA 2R6GA 2ZTDA 5JAVA 4OIJA 3TQYA 5J2UF 4EYIB 5ELBA 1XX8A 2KOLA 1I50B 4ODGA 4JV5L 1ZXTA 3MTSA 1E7ZA 2SCUB 1PH1A 1IYJB 3LWUA 2J6SA 5GAGC 3KF8B 2EYHA 4C5AA 4YJ2F 5DAUA 1S97A 2TMPA 3JAMc 4S3SA 3JRXA 5LA6F 1XTCD 3SR1A 2B2WC 1LT3D 2A6HD 2KQ3A 3QOLA 1S40A 1AEXA 2F0SA 3SK8A 4TVAB 2IL8A 4X66H 1TWCH 2XN9C 2N55A 4ZRZA 1W96A 3PVXA 2Z4HA 2BH8A 1HNXQ 2FMAA 2F3WA 4HNTA 4K5VA 4EG0A 3LMLA 1PV4A 2PO4A 5IYDG 4O2AF 4ECUA 1LABA 4P71A 4RGNA 3PIO3 5M3FG 2R93H 4JK1C 2JA6H 2RVLA 1RL2A 3I55A 2Q2UA 2J4XA 2CKZB 4HNUA 4QIWE 1JMCA 1SYDA 5AFWA 4C1NI 1JWUD 5HGQA 5C0XH 2B8FA 1YZ6A 2G5DA 4K5WA 5KG3A 1RODA 1XPRA 1H9KA 2F52A 2W8LA 5ELCA 5DQHA 4RAZA 3RB4A 1W6KA 4Q44A 1G2TA 1YNJC 1T36A 5BN3A 4X66Q 1E24A 1F9QA 4FF1A 3RZOB 2F0QA 2NVXH 3FKIA 3N42B 5IT9E 2W7OA 4HMIA 4B3MH 2VUMB 2NZ1D 4DPGA 4DXFA 4A3IG 1T5EA 4E6IA 4JI5L 3BG5A 4TV9F 1GVPA 2KBNA 1PH4A 3K8AA 4NKLA 1D5MC 4ULLA 3BDCA 5DLQE 4IOAA 2LXKA 4QIWA 1QZGA 4OELB 3JSLA 3Q8SB 4YR3A 5JH7F 3NUCA 4K2KA 4LUVA 1S68A 1HPCA 2WP8J 3K81C 1QVGA 1NSNS 1O7ZA 1VF7A 4C5BA 2BQ3A 1GYFA 2IHFA 4M7EA 1WI5A 1H9SA 4OO1G 3PO3H 2ZDGA 1EY8A 4IPCA 4IN3A 5KT2A 3H15A 3PCOB 3JAML 3K5OA 3CPWA 3S1NB 5DM63 4X64H 2UUBH 2Z6BA 2AUJD 4LMQD 1IXRA 4YHHH 2OXPA 1VQJA 3BZKA 1YI2A 4RB3C 1TWGH 4O3QA 3OHBA 1YNNC 3QOJA 5ELEA 4IPHA 4A3LG 3I7FA 3D6WA 3L2PA 1FJGL 3GTOH 3T51B 2VUMG 2Q8IB 5I47A 3H0GH 1RDPD 1SYGA 2JE6I 3J81W 2A73B 5C44H 2ZJQA 2VL6A 3EBEA 5IGFA 1OXSC 2ZXOA 3EA6A 4JI1L 3M9NB 4JG2A 3CCSA 4GC7A 1FGBD 4NXNH 3HP3A 3E0EA 1B6RA 4DR7Q 4A3CG 2Y0SE 3GQBA 5L37A 4DR4Q 5J22A 4GLXA 4C3JH 1TWCA 2B2UA 3K0YA 2OTJA 2WKCA 2F0TA 4ECVA 1YNJD 3T5JA 3CQZB 4L63B 3K59A 4JI8L 1EU4A 4X64Q 4AQYL 3T1HQ 4RMFA 3TMEA 2UUBQ 4P2CB 1AFPA 3KXYT 1C8CA 1N33H 1EUCB 3V2TA 2UXBH 3DWPA 4EGVA 2R93A 2K4KA 1H9RA 4DK1A 2I87A 2JA6A 5HV6A 1SE2A 3BDOA 3BQ2A 2XGQA 1CZGA 1GXDC 1EZ1A 4O0AA 4A3BG 1HA5A 4FBTA 4L8JA 2CHBD 1VAJA 4J9NA 1XPUA 1JKJB 4K8IA 1WYDA 2NTSA 3OPOA 3J7A5 1HR0H 1TU2B 1CQVA 4NXNQ 1KBLA 2UXDL 2JYOA 3H6MA 1VQLA 3GILA 3RIZA 5BMVF 1O7YA 4J9KA 2VZAA 4DV6L 5FD5A 4A3JH 3N52A 2DPIA 2IMWP 1MJEA 2HD3A 1C9OA 5J1ZA 2AQ3B 2NVXA 4N8X1 1LLRD 4IURA 3PIOA 1N33Q 4ZYSA 2UXBQ 2W9BB 3A8KE 4J9MA 4CC6A 3CW2C 2BA1A 4NXMH 3OIQA 1LTAD 1WCMB 4IFDH 4ECWA 3H91A 3OWEB 1N56A 1C4QA 2K6AA 4KV6A 3LWBA 5C3EG 5M5YB 1HNWH 1HR0Q 3HZXA 3C1EA 1E4EA 5L1KA 1RIPA 3H20A 1WD1A 1QVCA 4O3OA 4ED6A 4C3IB 4UDUC 3A8IE 2V4RA 4X3SA 4NMZA 1W2BA 1KJJA 5KFUA 1P8LA 4ZKBB 5EBCA 3GTMB 1K83H 1XYIA 2NVTB 1VQ8A 1NY4A 3L4KA 3N43B 2XD4A 5LMNW 3MEHA 2C2EA 3CRLC 5E7NA 2DWCA 1V8QA 1QB5D 4IUPA 5E1FA 3PW0A 1SMYC 3HOXB 1PZJD 3PF5A 1TWGA 1KHIA 5C0XI 2R7FA 2R3ZA 1EYDA 1VQ5A 1K0SA 1LTID 1TS2A 4BY7H 3GTOA 3A0JA 1VQIA 2PYKA 4HN7A 2Z6KA 3PIP3 1EQQA 1JIHA 3A5UA 1JWSD 3T4AC 5J39A 4B3SH 1LV9A 3TN2A 1C3OA 5JOBA 1HNWQ 2NU9B 2EDGA 1K1SA 3KFUA 2H5XA 5HBRB 1SEBD 4JI0H 1ENAA 4LNQA 1FL0A 5CB4F 2L5TA 3U4ZA 3ULPA 4RCOA 4YBZB 1ICFB 1EIYB 1EY0A 4DA2A 3BQ1A 1S03G 1P16A 4DUYH 1EOVA 1STNA 2K33A 4C3IG 3K57A 4PMCA 4WFN3 3FMAA 3NHHA 3KJPA 5KFRA 2RDFA 4K6LA 4CJ2C 4CKCA 3J80E 1D5ZC 4A3FH 4IZ8A 1JDEA 3SE7A 3AMUA 3FMCA 3KHRA 4R4CA 1I4HA 5LL6S 2LY7A 4NDXA 4ECXA 3HOXG 1WVLA 2K03A 1R4PB 1B3QA 1IBMH 4V190 2KA7A 3LP8A 3PO2H 1Y8NB 1GUSA 3BZCA 4B3SQ 1B6SA 2VW9A 4J9OA 1BKBA 2J6UA 4DNIA 3PSIA 3TP5A 4GZYC 1CSQA 1Y1WB 4JI0Q 1PXUA 1Y69U 2V4QA 2MUYA 5D65A 3HOZB 3BU2A 1KTKA 1S5FD 3S9WA 1X32A 4QMGA 2AGQA 2Q8TA 2QEXA 3EVQA 3I2ZA 3F2CA 4DUYQ 1NUCA 1KAAA 4Y52H 4M1UB 2GLTA 5C4ZA 3E3XA 3GTJB 4LF5L 5KFTA 4ED1A 4IWYA 4KKSA 3CP0A 1PHJA 5IGGA 2K52A 3HEJA 3DWQA 5C5LA 3IG0A 3KHLA 5IYBH 2VS1A 1BCPB 1SMYD 1Z47A 2EYPA 2ICEC 3GV5B 4IOCA 5DGAA 3C2PA 2EPBA 1R9TH 2R92H 4HIMA 2EY6A 3CCVA 1IBMQ 2ICIA 2MGSA 2WYOA 4LFAL 3RZDB 4BBSH 1HA6A 5EWEA 3S15H 2J9GA 1E1OA 3K7AH 5J3BA 3K5IA 4I7ZC 4B3ML 1CKNA 3MAQA 5CV7A 2E2JB 2JA7H 2BH2A 1I5FA 4IQZA 5F9LA 4EX5A 1IBKQ 2B2YC 4AH6A 1K1QA 5K2MA 3I73A 2HVSA 3S17H 4Y7NB 5JVG3 2QCPX 2ZJRA 4DAYA 1OTCA 2PMZE 3OIPA 2QW7A 3NK9A 2JA8B 2PVPA 2EYFA 1KNEA 2WKDA 5ELNA 4B9XA 5JQWA 1B44D 3QB3A 4Q0YA 4UCTA 2X6LA 1L0YB 4MHEA 4AIMA 5GADC 1HZ9A 1CT1D 3HKZB 4L6TB 4UP9A 4X64L 1MD2D 5CGKA 2RCNA 4JI3H 4BWGB 1IBLH 3CRKC 2CH4W 1MKHA 4YHHL 2XWBB 4A3MB 2EYOA 2W71A 1EHIA 5M9OA 4RH6A 1UE7A 5C4XB 1GGOA 4C3HB 1Q8KA 2LSSA 2GVAA 4DR2L 4IFDI 1SJHD 4DL7A 1G2SA 4LF6H 1WTPA 1GUGA 3PZPA 4CDFC 3HOVB 1RKNA 1N36H 1VQBA 2L9HA 4O4HF 4B3TQ 1M4VA 1MHWC 2RF4A 3PIPA 1VS0A 4A3EH 2PMZA 4DR5H 3OTOQ 4M8AA 2A6EC 2YW2A 2R8IA 4RCNA 2L1BA 4JV5H 1A3UA 3K6OA 5CV5A 4QQBX 2E8GA 1I3QH 4MV6A 3OW2A 3S1RB 1CA5A 5C5MA 2JA8G 3F1ZA 1EWIA 4IALA 5TSSA 4CDDC 2FMMA 1I94H 3K5LA 1N33L 3D8GA 3FDSA 4JI3Q 5GAEC 3DLLA 1IBLQ 2YZNA 1HZCA 1YHAA 2YU9B 1I4RA 2NBFA 3OWFA 4JBKA 4MN3A 2VUGA 3DHQA 3B6YA 1TWAB 2EYLA 5A35A 3ICEA 4LF6Q 2OQKA 4MV9A 1EEID 3GD7A 1N36Q 4WJ3M 5ELFA 5C4XG 3DM1A 4C3HG 1EZ8A 4LSXA 3RFCA 3NBIA 4GNXC 3GTLB 3T1YH 4DR5Q 1R9TA 4YB8B 1JOQA 5IYZF 2R92A 2Q2IA 3P1HA 3NWTA 5FLMH 4XTCS 2K7VA 4JV5Q 4LW1A 4XQNA 3BQ0A 4HAEA 3IKJA 1IKLA 2XWJB 1D1KA 1KNAA 3MXGA 4MNOA 1S4ZA 1AN7A 4KD3A 1PYSB 4O3NA 2N8NA 4FXGC 5F2DA 1QILA 1A3VA 5KG4A 3E6ZX 4PG3A 5KFCA 5KX5F 2F0JA 5GAHC 3FHWA 3SK6A 4UY8C 1PYWD 4K6DA 4GNXA 4NXML 4DV1H 3T5LA 2UUAH 2RBMA 1BQQT 4ED2A 1JDBB 5FPRA 1XXGA 3TSSA 2FLNA 3Q24A 3S2HH 1B70B 1UC9A 1F2ZA 1X6OA 1BVSA 3T1YQ 4JI5H 2A74C 1C48A 4ECQA 1CFMA 1WH2A 2M00A 2XTIA 2A6ED 3V6KA 2I07B 2R8HA 3S24A 3VA5A 2VPSA 3CPFA 3M9MB 1PDQA 1KABA 3HKSA 3WOEA 4UHVA 1WD0A 4IO9A 1U4MA 3Q23A 1I4PA 3CXCA 2BDNA 4RA8A 3MXNA 4XT1B 4DV1Q 2CW0C 2RHQB 3W1GA 3WDNA 2VOBA 4YR2A 2HCIA 2W57A 3CC7A 3RMHA 2Z4IA 1PZKD 2RCFA 1W93A 3A54A 4IWXA 1STEA 1KLGD 4KMUC 1VQNA 3OOCA 4B3SL 3PN1A 4KKUA 3G6XA 4H7BA 4JI5Q 4A3GH 5KRUA 3K80C 1UE5A 1FJGH 4ED3A 5M3MH 3L7ZC 3I4NH 3CMEA 1TWFH 2K5VA 1DYQA 3EYYA 1UUPA 4DUYL 3CU7A 3J81i 1B33N 2I5HA 3N8DA 1DONA 1HJPA 3HRZC 1ZYRD 3UDXA 1HUNA 2FK2A 1JE4A 1O7LA 5LMNH 2D62A 1KL9A 3FKIB 2P5ZX 2YZGA 3T5KA 3MJFA 4JI8H 1Q82C 4R8UA 1IBML 4KD4A 2K75A 2OQ0A 4LF4H 3VPBA 3GIKA 2NVYH 4CDEC 1EY6A 5FPOA 3GV3A 4QIWB 2A68C 5KFXA 3WWVA 3TZUA 1FJGQ 1K8OA 1Z2PX 2JA5H 2R7ZH 3Q6SA 2NUAB 1LO5D 1EWHA 4AYBE 3S1MB 2VA3A 3QIAA 4HTHA 2FMCA 2PPBC 3FEWX 1I4XA 1RYSA 4QWAA 1QNKA 5IP9H 3IN5A 2E2DC 1H9SB 1STGA 2UXDH 3KK7A 3TP7A 4ZI7F 3GTGA 1F9PA 1TXYA 2EY5A 2OT2A 1Y14B 2VR1A 4DV6H 3CKIB 5KEEA 1FKAH 4UCVA 4OWXB 4DK3C 2P0AA 5JEAH 4ED0A 4JI8Q 2CW0D 3DUZA 3KBXA 1HNZH 5BPFA 4Q45A 2H4OA 3FKIG 4LF4Q 1XMOH 2FLLA 1K73C 2ATWA 3QFFA 1ET6A 4DR6H 2IY5B 1PFNA 1DIKA 4P75A 2E2HH 2LS01 1RHPA 2BQRA 1SRUA 4AYBA 5D8DA 1LT4D 4H0LC 5DG7A 4HR7A 3RGXA 3ORQA 4YAJB 3J81c 2F0MA 4H02A 4IJLA 3MWDA 1TWCB 5KFZA 2UXDQ 1X56A 1E22A 2DGYA 1A2TA 3KF6A 1DJRD 1PRTC 1K8GA 2RQXA 4DV6Q 2AQ2B 4RNOA 4Y8VB 1F2YA 1G51A 5CYUA 1F9SA 1IOVA 1N32H 2KHJA 5IYCG 2NVQH 2R93B 2FK1A 3MZ5A 4ZCKA 5KYLA 2JA6B 4KY5A 1BDOA 1NMFA 4ME5A 3J7AV 4F4WA 1DV1A 4DL4A 2IJ0A 1S9FA 3BJUA 2FPGB 1OXXK 3M4YA 4GN4B 3KOJA 1JE5A 4DR6Q 4MV8A 1UC8A 4JI3L 2ID0A 5CA1F 1IBLL 4ECZA 3A7LA 1XDNA 1TWFA 3OHXC 4A3KH 3MVVA 5I2XA 4QB4A 4FF3A 4QCLA 1VCIA 4HMJA 1Y1VH 1B53A 1CKMA 4O2DA 1AW7A 4QF4A 5JPMC 1WTQA 1N36L 2NVXB 2PZWA 2KUMA 3BA8A 1BBUA 2WB1E 1BBWA 4FF4A 2Z9HA 1N32Q 4DR5L 3VPDA 3P75A 2D9UA 1IL2A 3TQTA 3K7UC 1PH9A 1SCUB 5CA0F 3CCQA 2Z8LA 3OUZA 3VYUA 5CAEB 5KFLA 2NVYA 2R93G 2MQHA 2LKVA 2IWHA 3HBLA 3R2IA 3PGZA 1DZ1A 1I94L 2JA6G 1AE2A 3L4JA 2NB0A 3G6YA 2R7ZA 3TINA 4O1NA 4EEQA 4F8MA 2R6FA 1SYCA 1Y8PB 3QJYA 4OHJA 3IFTA 3F2BA 1E4EB 4APMA 3GTKA 3WNZA 2WAQE 2XC9A 5C0XG 1V9PA 5KFIA 4A3IB 4A3DH 3PO3B 5KFGA 4XIGS 3GV8B 1HRJA 4P73A 2A5HA 4POFA 2FKLA 1QWYA 2EYMA 2O5JC 1D8LA 1PRTD 2Y0SG 4ZAIA 3VYRA 4HJ8A 3T1YL 3EQLC 3J81L 4LF5H 1TWGB 3FVQA 4TQUS 1JJCB 3S16H 5FO7B 4BBRH 3M7GA 1VQHA 5I9PA 3GTOB 3IFDA 4RNMA 3J7YW 4O3PA 5C44B 1CHQD 1STBA 3SEBA 2IX1A 5EKKA 2NN6H 4BXXH 2B29A 1CZWA 2KENA 2ZXPA 3P7JA 4YQWA 4DV1L 2WAQA 4EGJA 4LFAH 2UUAL 2ZDHA 2W9CA 4XQJA 4R4QA 2W6OA 2K5QA 4U68A 2YYZA 2YTYA 2G9HD 2AUKA 2E76C 2PNRC 4EYHB 4LF8H 1OXTA 1OXUA 3PO3G 2BQUA 4G7HC 5E4WC 4IRCA 1RJPA 1Z9FA 3DEOA 2XCPA 4FF2A 4LF5Q 3AQQA 5IOCA 1SN8A 3AFPA 5CV4A 5KT5A 5T14A 2IPKD 2B63H 2YCHA 2EIFA 3VR6A 4DV3H 1VKZA 4QW8A 2I0QA 4B9WA 4EFEA 3HG9A 2ATLA 4ALPA 3MWEA 3H0GG 2JEAI 4KKTA 1QUQA 1Q46A 2FXQA 5C44G 3TS2A 1TAEA 3E5NA 3A7AB 4LFAQ 1I50H 1X54A 4XZ3B 4A3JB 5CR3A 2NUCA 3PR5B 2X69A 3UDGA 4B3MQ 4A3BB 1STHA 2DIKA 3CCEA 4C3JG 4LF8Q 2B2UC 2YTVA 1NJIC 3G6EA 4DR2H 4FM9A 3FPPA 1A15A 4DAMA 2ZM6L 3VR4A 1B04A 5C4HA 4DV3Q 4DV4H 4GN5A 4GS3A 1WSCA 5DLGA 4YR0A 1K3RA 5DQIA 3BVMA 5HGTA 3CCMA 1PA6A 5M5XH 2FPIB 2F0UA 2IBKA 1FNUA 2NU8B 5KFQA 1SNOA 5LMNL 2HJWA 3G6VA 3X3MA 2F0LA 1CKNB 4PV1C 1H95A 4YCVA 3JZIA 4IRDA 3RF2A 1U4LA 4XYLB 1EYGA 2MO0A 1B4OA 2WV6D 2XGTA 4HSPA 4LF4L 2YS7A 4G4KA 2DY8A 3C1FA 2VA2A 4IUQA 2I5MX 4YHHQ 2M2LA 1XNQL 3V4SA 4A3JG 4NW2A 4WBNF 1HTLD 3G7LA 1Z7TA 5C3EB 2MO1A 4DR2Q 4UFZA 2K32A 4UP8A 2VXWA 1JR0D 1WTHA 4QUCA 4DAYB 5KFNA 3HFZB 1WTXA 3EROA 4DV4Q 1R4QB 1GLVA 1M6VA 3NQIA 4ILWA 1OWTA 5GROA 4X65L 5KFBA 3OYYA 4CKBA 4IFDG 2PZTA 4MTNA 1HCZA 1FNWA 2R7LA 1YJWA 2Y0SA 1I6HH 1RJTA 2V1CC 3RUPA 1VQ6A 2EVBA 3L9AX 4YCWA 1JT8A 5E4XA 5KYIA 1HFNA 1JX4A 2V59A 1HNZL 1A6XA 3NEMA 4LFBH 1XMOL 2PCFB 3MWYW 2OWOA 4H44C 2F4VH 4Q0FA 4DR6L 3NGDA 4KY7A 1SYXB 4GKJH 1EQRA 2B63A 2DN8A 3UDIA 2F3IA 3K5HA 4DL5A 2PMZB 2R8GA 3KDFA 4LH7A 4HCEA 4DK0A 3S1NH 2B2TA 4PZ7A 1DM0B 1W3SA 4JPBW 4BY7G 3TQ1A 2IW3A 2EXZA 1V4YA 3KLRA 4UCOA 1TS5A 2Z6KC 3STBC 2FHTA 2R82A 1BGWA 1E1TA 4JV0A 2VQDA 1LTGD 1N32L 3RB0A 4OL7A 1GKHA 1PTOH 3D0FA 4GC6A 5F9NA 4O3SA 5L9XA 5CV8A 1EEFD 3EIVA 4J9LA 3NQTA 3UFXB 2JP1A 2F4VQ 3MA2B 5BN5A 4NXMQ 4C5CA 1M90C 1CKOA 1E2VA 3H0GA 2WFWA 3LNNA 1RK6A 5DNFA 5T1IA 5G3LF 4A3FG 1R9TB 3R8BA 2R92B 4ED8A 2WIIB 4YIJA 1X3GA 1LT5D 1JOOA 2YRXA 3ORRA 2GPSA 1RF2D 2I5LX 3K0XA 3RV3A 3S15B 3PUWA 2KJXA 4DV0H 3NSWA 4C2MH 3K7AB 4I55F 1HZBA 3Q22A 1HH2P 1SFOH 4J0MA 4YY3L 3PO2G 4M9UA 2AGPA 2GVBA 4ZQIA 4A93H 2ALYB 4FBUA 3A5ZB 4OX9H 3PW2A 4RGTA 2IX3A 3J7AK 1KDCA 5EPLA 3ZJYC 3VR3A 3F2DA 4GNXB 2DNCA 5COYA 3BA9A 3JRWA 3WO1A 1KJ9A 2X0SA 5JEAJ 1YHQA 2QDLA 3BZDB 3TS0A 3NENA 3D4WA 4FO2A 5D1PA 3BYYB 4X3UA 1PTOF 1KC8C 2W6MA 5J2TF 3G71A 3L3OC 5IYBG 3HOWH 3KALA 2AWNA 3NTHA 1I6UA 4WORA 4TUYF 2OLSA 4DV0Q 4N9TA 2R92G 3RD4A 3H09A 5IP7H 2CQYA 3K5MA 1N8RC 1MGSA 1B3AA 4MV3A 3STBD 3M85A 4BBSG 3RN5A 3M4IA 1EOTA 5LXTF 3MXNB 2K5DA 1VQ9A 2FFKB 4OWTB 4LK1C 1C30A 5DQGA 2DNEA 2KEEA 3GQCA 4RZRA 2B2VC 1ENFA 1IHZA 3SE0A 4LF9H 2JA7G 3HOYH 1CSPA 1T9HA 2HUGA 5KFDA 3D3RA 1VBGA 1ESFA 1YITA 3R2TA 3RUZA 3LGJA 3GIJA 3RB6A 5IY0A 1UNNC 4GKKH 1ASYA 5KFFA 2HHHH 2NVTH 4A2AA 5M5WB 3R3OA 1M7JA 5KG1A 4GOPC 1MJCA 3S14H 1DD2A 3SHLA 2PN1A 2MFIA 4J6HA 5DEHA 1CQFA 4IZOA 4LWCA 1D6EC 2CWAA 3WO0A 5KG5A 5KT7A 4BS9A 2XSCA 1M1KC 1RTNA 3EJIA 1K83A 1GD7A 3J7AF 1VQ4A 4IR9A 4LF8L 4ME6A 2FP4B 4DU9A 5KFKA 4K8JA 2B2VA 4IJHA 2V9WA 4XQQA 2Q8RE 2R7KA 3CCRA 4DV7H 1NMGA 4RB0A 1JQYD 4F50A 2XRQD 1LUZA 1XWEA 4DV3L 1CA6A 3M9BA 3H40A 3RAQA 2GA4B 4R8UB 4GOPA 1ZKOA 4LF9Q 3RLNA 3R23A 1A0IA 3NE5B 3C0FB 3TIIA 1MIUA 1B2TA 1HZAA 4LUZA 1XMQH 4GKKQ 1RJQA 2J7ZA 2BR0A 3N6RA 2PQAA 3I70A 2UU9H 3FDTA 4OEMB 1F2LA 2O2LD 4A3EG 5IT9W 4C2MA 4R4OA 1SFOA 3I90A 5LYJF 2YL2A 5KNCA 3PR4A 4JOIC 1EY7A 3GTGB 3T13A 4DV7Q 2LXJA 4F4ZA 2PQEA 2FB9A 2AU0A 4KHVA 4DV4L 2R85A 4HEDA 4KTAA 3S2HB 3U9SA 1PH6A 1Y1WH 3R5XA 4LJZC 3T16A 2F0KA 5E3FA 1N34H 3HOZH 1V43A 4EQ5A 1XMQQ 3I4MG 2K5WA 5C0XJ 3I56A 1RK5A 4X3KA 3GLKA 1II3A 5DG8A 2EOTA 3BJYA 2UU9Q 4JOIA 4F88A 4AYBB 4ZLTF 5FLMG 3LX0A 4HR7B 4YWLA 4JI2H 4YCUA 3VR2A 2R8JA 2EY2A 5CMDA 2HCCA 3W5OA 4JBMA 4R1JA 4HYKA 3KF6B 3MFYA 1UEAB 1SE8A 5CBAE 2HGSA 4RFBA 4LFCL 2NZHA 2CZGA 2JN4A 5D1OA 2ZT9C 3I4MH 5C8YF 2SEBD 5IODA 5KFPA 4MV1A 1SNQA 3CC4A 1PX2A 2FPPB 3RGZA 5EQ0A 1KEEA 3JSNA 2VQEH 3ZYYX 2ASLA 4KN4C 1N34Q 3MR2A 1SBBB 3IL8A 4A3GB 2VPQA 4RHRA 1VQAA 2EYJA 1EYZA 3GV7B 2KCTA 3I4NB 1CHPD 2K50A 4CC5A 1TWFB 1SLJA 1JB3A 1UNSA 1PRTB 1I94Q 1EY5A 1ZYRC 2DUDA 3KTMA 5L1IA 2MJ8A 2RKSA 4G7ZC 4LFBL 4JI2Q 1S5CD 2JA7A 5KFHA 1A9XA 3G4SA 2F4VL 5LMUH 2HIVA 3W1BA 1M0TA 4AYBG 2ASJA 5LL6b 2JEFA 3Q8QB 4EBEA 2XIWA 3KAKA 2XRSD 4GKJL 4FS1A 1QE6A 1CUKA 4L5SA 5DGBA 2EXDA 3OUUA 3MFGA 3I4OA 1Y8OB 3DEPA 4X62L 1IYVA 5FD6A 1BCPF 2A69C 2VQEQ 3R93A 3N40P 1S5BD 4DR1H 2NVYB 2LMCB 3D4DA 4A3MH 2E74C 3HGBA 4RKBA 5IIFA 2OTLA 3H3VH 5I4DA 2ZJTA 2R7ZB 4MV7A 3SK5A 4QWBA 3GIMA 1X9NA 1PH5A 2BCOA 4A3GG 3KLSX 1EIHA 3GTKB 3HOVH 4XXEA 1CTMA 1TT2A 1TWHH 4PDBA 2N49A 1DOLA 4DUZH 5M3MG 3I4NG 4QGUA 2RA4A 3KAJA 3U9OA 1JXLA 1HHVA 2UUAQ 2TSSA 5C5JA 5EPJA 4J9SA 4OWWB 2HVQA 1OO9B 5I2YA 3J81E 1K3BC 1HQRD 3CCLA 4L1KA 1SNCA 2EE1A 4KK7A 4B08A 4DV0L 2C35B 5EZYF 1K0RA 1I3QA 4EGQA 2ZM6H 4YWMA 1YJ9A 4YP3A 1BJTA 4OX9L 2D0PA 3S1QH 1TWAH 1KJQA 3G48A 3I12A 4RAUC 2UVUA 4DR3H 5KT4A 4PQXA 2F03A 2AHOB 3BG3A 2DJFC 1BF4A 2WAQB 3M4OB 4DUZQ 2JA5G 2R7ZG 5KG7A 2W9CB 4GN3B 2KHIA 1GSOA 2F0GA 1SYBA 4CDCC 4EQNA 3KUPA 2CQOA 1A3TA 3MC0B 4EBCA 1A2UA 3CD6A 1STAA 5IP9G 1JJ2A 5KFSA 3AFQA 4FU0A 1HR0W 2NVQB 4DNRB 2IP4A 1NE3A 4ABNA 3HKZE 3URYA 1I7LA 2UUCH 4IFDJ 1XNQH 1UEBA 3ITPA 2JEGA 1WOCA 4I7AA 2R7NA 2WB1G 5JEAG 2A69D 5IE8A 3GTQH 2UXCL 2VY3A 4ZOLF 1OXVA 2ZM6Q 4G57A 2RDGA 1CS0A 1KC7A 5BPHA 1K9MC 4DV2L 2XCLA 4DR3Q 4X65H 1YEZA 3EPIA 2E5LL 3J80W 4F4XA 1QUQB 1PVOA 1BOSA 2HDMA 1NR2A 3DM3A 2RGRA 5FJ8H 4Q5VA 3X3NA 1B8AA 2PI2E 1XTDA 3M9OB 3A55A 1AZPA 1GHKA 5LMNQ 4LF9L 4JV2A 2L55A 5D3DA 1Q81C 2WAQG 3V6JA 2ZXRA 3F8TA 3HOUH 3M3YH 3PUYA 5I6YA 3J7ZC 4GKKL 3EPGA 4O42A 1GHJA 2HHHL 4ID6A 2IT1A 3U58A 2K04A 1SJED 4CHTB 1CI3M 1PLFA 2UUCQ 1O75A 1XNQQ 4R8NA 2R87A 3KJOA 5FLXW 1KAWA 1GOZA 3HB9A 1WTWA 4PNYA 4A2BA 3GO5A 4DV5H 1LTTD 3NTIA 4O3RA 2EQSA 5IWAH 3OMCA 4A75A 5A2QW 4X65Q 3PUVA 4DV7L 1TWHA 3FRPB 3K3VA 4P74A 4C56C 5H1SE 3KLSA 3GIQA 1L2FA 4CJ0B 4A3KG 2F0OA 3RB3A 3BDLA 3O13A 2KCNA 3RJ0A 5C4JH 3IRBA 2MNAA 4WJ4A 1BXRA 3K3PA 1E4FT 1D5XC 1Y1VG 2F0VA 3PMFA 2V4DA 3LWEA 4L5QA 1V1PA 4K14A 1XMQL 4MTEA 4G3IA 1HNZQ 3S16B 4BBRB 1JLLB 4OGQC 2J0TD 1XMOQ 2UU9L 2V58A 4DK6C 1PZID 1QOHA 5IGBA 2B39A 4RG1A 2O03A 5KFWA 4DV5Q 2F3VA 1EIGA 1VQDA 4UPAA 3T56B 4BY1H 1S0MA 4JVZA 1UE6A 4GLAC 2F0FA 4KI0A 1M0WA 1WR2A 2Y0SB 4LH6A 1GO3E 2CW7A 4JI6H 4X3TA 4DKAC 1JICA 3PV0A 3DF7A 3R5FA 1A63A 4EFBA 4YY3H 1TQOA 3NBHA 1QJOA 3W3AA 2ES2A 4A3DG 4JW0A 1N34L 1EUDB 3I8ZA 1SNMA 1FNVA 1YNXA 4DAPA 2PW5A 1LM0A 3AU7A 2O5IC 3H3VI 1EYCA 3OHAA 2B63B 4MIUA 1V51A 4Q8EA 4MZ9A 2F0DA 3GTQA 3KDFB 2AWOA 1WFQA 1GSAA 5LHY1 1SDFA 5FO9B 2JA5A 4TSSA 4BBRG 4ED7A 2HVRA 1LT6D 1K8MA 4JI2L 2V5AA 1Q12A 3NXWA 1B7YB 3PF4A 3C46A 1SNDA 2SDFA 4CGYB
chains in the Genus database with same CATH topology
1I5FA 2V1CC 4EX5A 1VQ6A 1IBKQ 2QA4A 4YCWA 4AH6A 5JJIA 1JT8A 4JI6Q 2RHSB 1HNZL 1PH3A 3S17H 2KCMA 1IZ6A 2NN6G 4JBJA 3NEMA 4J15A 4BXXG 3GTLH 4YY3Q 2ZJRA 1XMOL 3AEVA 3GTPH 2OWOA 1YBYA 1OTCA 2PMZE 1X65A 2VQEL 2NZOA 4QY7A 4DR6L 4P72A 4JI0L 1KQSA 1EQRA 1SR3A 2D0OA 4KLKA 2F3IA 3UDIA 5FJ8G 1AE3A 5ELNA 3KDFA 1EFWA 1L1OA 5BR8L 3KYHC 5GADC 4PZ7A 4AIMA 5AJ3L 3S1NH 1W3SA 1HZ9A 3PUXA 4X64L 4UP9A 1VQKA 4BY7G 4HJ9A 3HOUG 2RCNA 3PUZA 1LYLA 2Z6KC 1N9WA 1UE1A 1MKHA 3STBC 4YHHL 2B63G 1E1TA 5LMUL 2Q2TA 4FDBA 3EN2A 1N32L 1UE7A 3A74A 4JBWA 1GKHA 1Q8KA 2LSSA 2GVAA 3D0FA 2BA0A 4DR2L 1XNRQ 4IFDI 1GM5A 2A1AA 3EIVA 2A8VA 4KHPL 2VNUD 3U50C 1FGUA 1FVIA 1VQBA 1D7QA 2E2IH 4B3TQ 2F4VQ 2RF4A 3PIPA 1VS0A 4A3EH 4NXMQ 1M90C 2F4VL 1CKOA 3OTOQ 4DR1L 3E9IA 2AMCB 2WFWA 3SGIA 5IYDH 1U5KA 3RLOA 2E8GA 1I3QH 2N78A 4A3FG 4QQBX 5M3FH 3UDFA 3OW2A 3S2DH 2JA8G 3F1ZA 1EWIA 3GTKH 1IBKL 4JI1Q 1X3GA 2PNHA 1EIFA 2IX0A 3K0XA 2I5LX 1N33L 3CMAA 3PUWA 4JI3Q 5GAEC 3DLLA 4DUZL 4JYAQ 4C2MH 1QZHA 1IBLQ 2N3SA 1HZCA 1HZBA 1HH2P 1YHAA 4NPSA 4YY3L 1SFOH 4JBKA 4L5RC 3KLWA 3PO2G 2GVBA 4A93H 2ALYB 3A5ZB 3B6YA 3AYHB 3F2DA 3ZJYC 4B3RQ 4AQYQ 3E9HA 3ICEA 4GNXB 2OQKA 4LF6Q 5GQOA 3GD7A 2L15A 2PI2A 1N36Q 4BY1G 4WJ3M 1XJVA 5C4XG 2IHEA 2OCEA 5JEAJ 3JAMi 4GNXC 1YHQA 4DR5Q 5EAYA 3TS0A 1UWVA 2Q2IA 3NENA 5FLMH 4XTCS 4JV5Q 4LW1A 2VQFL 1KC8C 2JK8A 3G71A 1C7YA 2AKWB 2R7DA 4A3IH 5IYBG 3HOWH 2AWNA 4HIKA 4MNOA 1YHBA 4DR3L 3CC2A 1PFSA 1XNRL 1PYSB 3U4VA 3M4OH 1J6QA 2N8NA 4NB3A 1WJJA 4DV0Q 4PG3A 3CCUA 3FKIH 2K14A 5IP7H 4OONA 1NTGA 2R92G 1N8RC 5GAHC 5IWAQ 4LUOA 3FHWA 4B3TL 4UY8C 3STBD 4GNXA 4NXML 3M85A 4BBSG 3M4PA 3OTOL 3RN5A 1VQFA 3TRZA 1YJNA 2HQLA 2JQOA 3MXNB 1VQ9A 3S2HH 1B70B 3GDEA 4OWTB 2HT1A 4OXPA 3TREA 2UUCL 4POGA 1X6OA 1BVSA 2JA7G 3HOYH 1KRSA 1CSPA 1T9HA 3T1YQ 2ASBA 2HIXA 5JJLA 4K0KQ 4GOPB 1YITA 3S1MH 3LGJA 1KIXA 2XTIA 5IY0A 1ASYA 2NVTH 3S24A 3RZOH 4GOPC 1MJCA 1QVFA 3S14H 3L0OA 3CPFA 5IYCH 2MFIA 4LWCA 2CWAA 1Q1BA 4A3LH 3HKSA 2PQAB 2VUMH 4LF6L 1M1KC 5ELOA 3ULLA 4IO9A 1GD7A 4JI4Q 2JA9A 1VQ4A 4LF8L 1KRTA 1L1OC 3CXCA 4IJHA 3Q8DA 2CWPA 4DV1Q 3J81j 2RHQB 3W1GA 1X3EA 2R6GA 4HIOA 2ZTDA 3CCRA 3TQYA 1NMGA 2CFMA 3CC7A 1LUZA 4JV5L 4A3CH 4DV3L 1I6HH 5IT9c 1VQNA 1E7ZA 3M9BA 4B3SL 1PH1A 1IYJB 5GAGC 4GOPA 3KF8B 4LF9Q 3RLNA 1A0IA 5K36G 4JI5Q 1C0AA 4A3GH 3JAMc 1MIUA 1K8AC 4LFCQ 3K80C 4DV5L 1UE5A 1HZAA 4LUZA 3HOUH 5M3MH 3L7ZC 3I4NH 4A76A 3CMEA 4GKKQ 1YIJA 1TWFH 5IWAL 2K5VA 3RNUA 1S40A 1Q7YC 2PQAA 4DUYL 4TVAB 3J81i 1VQCA 2I5HA 1TWCH 4A3EG 4LF7Q 1KXLA 1HJPA 1A62A 2BH8A 1HNXQ 4JI7Q 4A3BH 4R4OA 1PV4A 2B3GA 3UDXA 5IYDG 1VQGA 1S3OA 4P71A 5M3FG 2D62A 1KL9A 2R93H 4JOIC 2JA6H 1RL2A 1O7IA 3ERSX 3I55A 4DV7Q 2Q2UA 2LXJA 1Q82C 1IBML 4DV4L 2CKZB 2K75A 2OQ0A 4QIWE 4LFBQ 1JMCA 1J5EL 5HGQA 1PH6A 1Y1WH 4A93G 1YZ6A 4A4IA 2JJQA 2NVYH 4BA1I 4HJAA 1XPRA 3HOZH 2F52A 1VQMA 1V43A 4EQ5A 3WWVA 4GKJQ 1FJGQ 2JA5H 2ZTEA 1XMQQ 2R7ZH 3I4MG 5C0XJ 2NN6I 3I56A 4AYBE 3CQZH 4X62Q 4X66Q 1SMXA 1E24A 2UU9Q 4JOIA 2Z0SA 5IP9H 4JI6L 2NVXH 5FLMG 5JJKA 4YWLA 1A8VA 1TXYA 4YCUA 4DPGA 1Y14B 4A3IG 3HOWG 5C3EH 3W5OA 4JBMA 4R1JA 4JI5L 3KF6B 4OWXB 4DK3C 2ZTCA 1SE8A 3TEHB 4LFCL 4JI8Q 1GVPA 2KBNA 4APVA 2NZHA 4R4TA 1PH4A 3K8AA 3I4MH 2YTXA 3FKIG 5IP7G 1VQEA 5DLQE 4LF4Q 4IOAA 2LXKA 3CC4A 1QZGA 1WCMG 1K73C 2ATWA 1DGSA 4LUVA 2IY5B 1HNXL 1N34Q 1QVGA 2WP8J 3K81C 4P75A 2E2HH 1VQAA 1PYBA 1SRUA 2IHFA 4PZ6A 2KCTA 1WI5A 4OO1G 3PO3H 2K50A 3HOYG 4IPCA 1SLJA 3TS2A 1I94Q 3H15A 3PCOB 2DUDA 4H02A 4IJLA 3J81c 3CPWA 2UXDQ 1X56A 1E22A 1G291 1X55A 2DGYA 3KF6A 4LFBL 4JI2Q 1IXRA 2QGQA 1V1QA 1K8GA 1VQOA 4DV6Q 3G4SA 1WCMH 1VQJA 3BZKA 2HIVA 3W1BA 1YI2A 1TWGH 1G51A 4AYBG 4OX9Q 2KHJA 5IYCG 4IPHA 2NVQH 4A3LG 2BH2A 4GKJL 3I7FA 3L2PA 3GTOH 1FJGL 3J80i 2VUMG 1CUKA 3H0GH 4L5SA 2EXDA 5M5YH 1NMFA 2JE6I 3I4OA 4X62L 4JCVE 4X66L 5C44H 2VL6A 3EBEA 3BJUA 2CCZA 2ZJQA 1OXXK 1OXSC 4GN4B 4JI1L 1XPOA 3KOJA 4C3IH 2VQEQ 1JE5A 4JG2A 3CCSA 4DR6Q 4JI3L 1NBWA 2ID0A 3E0EA 5HY6A 4JYAL 4A3MH 2K5HA 1IBLL 3GTMH 4DR7Q 4A3KH 2Y0SE 4QJFA 2OTLA 4A3CG 1AH9A 3H3VH 4DR4Q 4GLXA 4C3JH 5BR8Q 2OTJA 1VCIA 1X9NA 1PH5A 1Y1VH 5AJ3Q 3M3YH 1CKMA 4A3GG 4JI8L 4GLVB 4X64Q 4O2DA 3CCJA 4AQYL 4RMFA 3T1HQ 3HOXH 2UUBQ 3HOVH 1TWHH 4B3RL 2UXCQ 2N49A 5M3MG 1N36L 4QGUA 3I4NG 2K4KA 1SROA 1BBUA 2WB1E 4DV2Q 4OO1I 1BBWA 1N32Q 3RN2A 4DR5L 2UUAQ 1IL2A 2E5LQ 3K7UC 1PH9A 4O0AA 4A3BG 3CCQA 4OWWB 3UE0A 4R4IA 3FP9A 1XPUA 1WYDA 2MQHA 1VQPA 3J7A5 2R93G 3PGZA 1I94L 2JA6G 1AE2A 3CCLA 4NXNQ 1KD1C 2ZJPA 2UXDL 1VQLA 4DV0L 2C35B 1K0RA 4YWMA 3F2BA 1YJ9A 2HHHQ 2VZAA 4DV6L 1ASZA 4OX9L 2WAQE 4A3JH 2D0PA 5C0XG 1V9PA 1TWAH 1Y1WG 3G48A 1MJEA 3S1QH 1C9OA 4A3DH 2AHOB 4XIGS 3PIOA 1N33Q 3HOZG 4P73A 3VDYA 2UXBQ 4DUZQ 2JA5G 2R7ZG 4GN3B 2KHIA 3CW2C 1E3PA 4POFA 1D8LA 2JEBI 2CQOA 2Y0SG 2BA1A 4HJ8A 4IPGA 3T1YL 3M4QA 2YV5A 3CD6A 5IP9G 4K0KL 1JJ2A 3AFQA 1JJCB 4TQUS 3S16H 4BBRH 1HR0W 4DR7L 1NE3A 1VQHA 3HKZE 4DR4L 3J80c 4HJ5A 4IFDJ 5C3EG 1UEBA 1WOCA 4KHZA 3ULJA 1HR0Q 2WB1G 3T1HL 1RIPA 5JEAG 2UUBL 2IX1A 1QVCA 5IE8A 3GTQH 3M7NA 2UXCL 2VY3A 1W2BA 1OXVA 2ZM6Q 4JI4L 4BXXH 2B29A 1P8LA 3UE1A 2VQFQ 1K9MC 1K83H 2KENA 4DV2L 4QL5A 3GTJH 4DV1L 1VQ8A 1NY4A 4DR3Q 2UUAL 1YEZA 2E5LL 4R4QA 5LMNW 1QUQB 1JJGA 1PVOA 3RLFA 3RR5A 3CF5A 3DM3A 5E7NA 4YWKA 2YYZA 5FJ8H 1B8AA 1Q86C 2PI2E 1XTDA 2YTYA 5FLXc 3PF5A 5LMNQ 4LF9L 1OXTA 1OXUA 3PO3G 1KHIA 5C0XI 2R7FA 1VQ5A 1Z9FA 4BY7H 1L0WA 4NXNL 1Q81C 2WAQG 3A0JA 4LF5Q 3AQQA 3F8TA 1VQIA 3PUYA 4UP7A 1S72A 1SN8A 3AFPA 1PH7A 3J7ZC 5M5WH 4GKKL 2Z6KA 2HHHL 1Q1EA 2IT1A 3U58A 3A5UA 2EIFA 3RZDH 1EQQA 2B63H 2UUCQ 1XNQQ 1HNWQ 3NELA 3KJOA 4LF7L 4X6AH 1JB7A 2H5XA 1KAWA 2I0QA 1YVCA 4JI7L 3KFUA 2UXBL 4LNQA 1FL0A 3GO5A 4ALPA 4HIDA 3H0GG 2E2JH 3U4ZA 3ULPA 2JEAI 2EQSA 1QUQA 1EIYB 1Q46A 2FXQA 5C44G 3HKZG 1VQ7A 1P16A 4JC0A 4IPDA 1EOVA 4LFAQ 4A75A 1I50H 1X54A 4X65Q 3PUVA 4DV7L 4P74A 4Y7NH 5H1SE 3KJPA 4A3MG 3MEFA 1L2FA 3UDGA 4A3FH 4A3KG 1PH8A 4B3MQ 3CCEA 4LF8Q 5C4JH 3IRBA 2YTVA 4R4CA 2JA8H 2MNAA 1HR0L 4WJ4A 1NJIC 3G6EA 1Y1VG 4L5QA 4HJ7A 3NBHB 4DAMA 3HOXG 2ZM6L 3HOVG 1XMQL 1HNZQ 4ME3A 4DV3Q 4GN5A 3CAMA 3BZCA 4GS3A 4B3SQ 3PO2H 1K3RA 2VW9A 1XMOQ 2UU9L 1BKBA 1LTLA 4DK6C 2GN5A 4DNIA 3PSIA 3CCMA 1PA6A 1CSQA 4RG1A 4JI0Q 5M5XH 3JC66 4DV5Q 1VQDA 3ER0A 3BU2A 4UPAA 4BY1H 5C4XH 5LMNL 4C3HH 3GTGH 2K5NA 2QEXA 3F2CA 3I2ZA 4DUYQ 1CKNB 1UE6A 4GLAC 4KI0A 4Y52H 4LF5L 1H95A 4YCVA 1GO3E 4DKAC 1EYGA 2MO0A 2XGTA 3CP0A 1PHJA 4LF4L 2K52A 3PV0A 1U0LA 2I5MX 5IYBH 2VS1A 4YHHQ 1XNQL 1HNWL 1A63A 5LMUQ 4A3JG 2ES2A 1Z47A 1EUJA 1X3FA 4A3DG 2MO1A 4IOCA 4DR2Q 1N34L 1YNXA 4UP8A 4DAYB 1R9TH 3HFZB 2R92H 1G6PA 4HIMA 3CCVA 3S1RH 1IBMQ 4PMWA 4DV4Q 4KHPQ 1LM0A 3H3VI 1J5EQ 4LFAL 4BBSH 2Q2HA 5GROA 4X65L 3S15H 3OYYA 4MZ9A 3KDFB 2AWOA 4IFDG 1WFQA 1E1OA 3K7AH 4MTNA 1L1OB 4PZ8A 5J3BA 4DR1Q 2YU9H 4BA2I 4BBRG 4B3ML 1CKNA 4JI2L 1YJWA 1Q12A 1PH2A 2A19A 1B7YB 3D31A 3PF4A 2JA7H 4L5TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1I5F A;  2V1C C;  4EX5 A;  1VQ6 A;  1IBK Q;  2QA4 A;  4YCW A;  4AH6 A;  5JJI A;  1JT8 A;  4JI6 Q;  2RHS B;  1HNZ L;  1PH3 A;  3S17 H;  2KCM A;  1IZ6 A;  2NN6 G;  4JBJ A;  3NEM A;  4J15 A;  4BXX G;  3GTL H;  4YY3 Q;  2ZJR A;  1XMO L;  3AEV A;  3GTP H;  2OWO A;  1YBY A;  1OTC A;  2PMZ E;  1X65 A;  2VQE L;  2NZO A;  4QY7 A;  4DR6 L;  4P72 A;  4JI0 L;  1KQS A;  1EQR A;  1SR3 A;  2D0O A;  4KLK A;  2F3I A;  3UDI A;  5FJ8 G;  1AE3 A;  5ELN A;  3KDF A;  1EFW A;  1L1O A;  5BR8 L;  3KYH C;  5GAD C;  4PZ7 A;  4AIM A;  5AJ3 L;  3S1N H;  1W3S A;  1HZ9 A;  3PUX A;  4X64 L;  4UP9 A;  1VQK A;  4BY7 G;  4HJ9 A;  3HOU G;  2RCN A;  3PUZ A;  1LYL A;  2Z6K C;  1N9W A;  1UE1 A;  1MKH A;  3STB C;  4YHH L;  2B63 G;  1E1T A;  5LMU L;  2Q2T A;  4FDB A;  3EN2 A;  1N32 L;  1UE7 A;  3A74 A;  4JBW A;  1GKH A;  1Q8K A;  2LSS A;  2GVA A;  3D0F A;  2BA0 A;  4DR2 L;  1XNR Q;  4IFD I;  1GM5 A;  2A1A A;  3EIV A;  2A8V A;  4KHP L;  2VNU D;  3U50 C;  1FGU A;  1FVI A;  1VQB A;  1D7Q A;  2E2I H;  4B3T Q;  2F4V Q;  2RF4 A;  3PIP A;  1VS0 A;  4A3E H;  4NXM Q;  1M90 C;  2F4V L;  1CKO A;  3OTO Q;  4DR1 L;  3E9I A;  2AMC B;  2WFW A;  3SGI A;  5IYD H;  1U5K A;  3RLO A;  2E8G A;  1I3Q H;  2N78 A;  4A3F G;  4QQB X;  5M3F H;  3UDF A;  3OW2 A;  3S2D H;  2JA8 G;  3F1Z A;  1EWI A;  3GTK H;  1IBK L;  4JI1 Q;  1X3G A;  2PNH A;  1EIF A;  2IX0 A;  3K0X A;  2I5L X;  1N33 L;  3CMA A;  3PUW A;  4JI3 Q;  5GAE C;  3DLL A;  4DUZ L;  4JYA Q;  4C2M H;  1QZH A;  1IBL Q;  2N3S A;  1HZC A;  1HZB A;  1HH2 P;  1YHA A;  4NPS A;  4YY3 L;  1SFO H;  4JBK A;  4L5R C;  3KLW A;  3PO2 G;  2GVB A;  4A93 H;  2ALY B;  3A5Z B;  3B6Y A;  3AYH B;  3F2D A;  3ZJY C;  4B3R Q;  4AQY Q;  3E9H A;  3ICE A;  4GNX B;  2OQK A;  4LF6 Q;  5GQO A;  3GD7 A;  2L15 A;  2PI2 A;  1N36 Q;  4BY1 G;  4WJ3 M;  1XJV A;  5C4X G;  2IHE A;  2OCE A;  5JEA J;  3JAM i;  4GNX C;  1YHQ A;  4DR5 Q;  5EAY A;  3TS0 A;  1UWV A;  2Q2I A;  3NEN A;  5FLM H;  4XTC S;  4JV5 Q;  4LW1 A;  2VQF L;  1KC8 C;  2JK8 A;  3G71 A;  1C7Y A;  2AKW B;  2R7D A;  4A3I H;  5IYB G;  3HOW H;  2AWN A;  4HIK A;  4MNO A;  1YHB A;  4DR3 L;  3CC2 A;  1PFS A;  1XNR L;  1PYS B;  3U4V A;  3M4O H;  1J6Q A;  2N8N A;  4NB3 A;  1WJJ A;  4DV0 Q;  4PG3 A;  3CCU A;  3FKI H;  2K14 A;  5IP7 H;  4OON A;  1NTG A;  2R92 G;  1N8R C;  5GAH C;  5IWA Q;  4LUO A;  3FHW A;  4B3T L;  4UY8 C;  3STB D;  4GNX A;  4NXM L;  3M85 A;  4BBS G;  3M4P A;  3OTO L;  3RN5 A;  1VQF A;  3TRZ A;  1YJN A;  2HQL A;  2JQO A;  3MXN B;  1VQ9 A;  3S2H H;  1B70 B;  3GDE A;  4OWT B;  2HT1 A;  4OXP A;  3TRE A;  2UUC L;  4POG A;  1X6O A;  1BVS A;  2JA7 G;  3HOY H;  1KRS A;  1CSP A;  1T9H A;  3T1Y Q;  2ASB A;  2HIX A;  5JJL A;  4K0K Q;  4GOP B;  1YIT A;  3S1M H;  3LGJ A;  1KIX A;  2XTI A;  5IY0 A;  1ASY A;  2NVT H;  3S24 A;  3RZO H;  4GOP C;  1MJC A;  1QVF A;  3S14 H;  3L0O A;  3CPF A;  5IYC H;  2MFI A;  4LWC A;  2CWA A;  1Q1B A;  4A3L H;  3HKS A;  2PQA B;  2VUM H;  4LF6 L;  1M1K C;  5ELO A;  3ULL A;  4IO9 A;  1GD7 A;  4JI4 Q;  2JA9 A;  1VQ4 A;  4LF8 L;  1KRT A;  1L1O C;  3CXC A;  4IJH A;  3Q8D A;  2CWP A;  4DV1 Q;  3J81 j;  2RHQ B;  3W1G A;  1X3E A;  2R6G A;  4HIO A;  2ZTD A;  3CCR A;  3TQY A;  1NMG A;  2CFM A;  3CC7 A;  1LUZ A;  4JV5 L;  4A3C H;  4DV3 L;  1I6H H;  5IT9 c;  1VQN A;  1E7Z A;  3M9B A;  4B3S L;  1PH1 A;  1IYJ B;  5GAG C;  4GOP A;  3KF8 B;  4LF9 Q;  3RLN A;  1A0I A;  5K36 G;  4JI5 Q;  1C0A A;  4A3G H;  3JAM c;  1MIU A;  1K8A C;  4LFC Q;  3K80 C;  4DV5 L;  1UE5 A;  1HZA A;  4LUZ A;  3HOU H;  5M3M H;  3L7Z C;  3I4N H;  4A76 A;  3CME A;  4GKK Q;  1YIJ A;  1TWF H;  5IWA L;  2K5V A;  3RNU A;  1S40 A;  1Q7Y C;  2PQA A;  4DUY L;  4TVA B;  3J81 i;  1VQC A;  2I5H A;  1TWC H;  4A3E G;  4LF7 Q;  1KXL A;  1HJP A;  1A62 A;  2BH8 A;  1HNX Q;  4JI7 Q;  4A3B H;  4R4O A;  1PV4 A;  2B3G A;  3UDX A;  5IYD G;  1VQG A;  1S3O A;  4P71 A;  5M3F G;  2D62 A;  1KL9 A;  2R93 H;  4JOI C;  2JA6 H;  1RL2 A;  1O7I A;  3ERS X;  3I55 A;  4DV7 Q;  2Q2U A;  2LXJ A;  1Q82 C;  1IBM L;  4DV4 L;  2CKZ B;  2K75 A;  2OQ0 A;  4QIW E;  4LFB Q;  1JMC A;  1J5E L;  5HGQ A;  1PH6 A;  1Y1W H;  4A93 G;  1YZ6 A;  4A4I A;  2JJQ A;  2NVY H;  4BA1 I;  4HJA A;  1XPR A;  3HOZ H;  2F52 A;  1VQM A;  1V43 A;  4EQ5 A;  3WWV A;  4GKJ Q;  1FJG Q;  2JA5 H;  2ZTE A;  1XMQ Q;  2R7Z H;  3I4M G;  5C0X J;  2NN6 I;  3I56 A;  4AYB E;  3CQZ H;  4X62 Q;  4X66 Q;  1SMX A;  1E24 A;  2UU9 Q;  4JOI A;  2Z0S A;  5IP9 H;  4JI6 L;  2NVX H;  5FLM G;  5JJK A;  4YWL A;  1A8V A;  1TXY A;  4YCU A;  4DPG A;  1Y14 B;  4A3I G;  3HOW G;  5C3E H;  3W5O A;  4JBM A;  4R1J A;  4JI5 L;  3KF6 B;  4OWX B;  4DK3 C;  2ZTC A;  1SE8 A;  3TEH B;  4LFC L;  4JI8 Q;  1GVP A;  2KBN A;  4APV A;  2NZH A;  4R4T A;  1PH4 A;  3K8A A;  3I4M H;  2YTX A;  3FKI G;  5IP7 G;  1VQE A;  5DLQ E;  4LF4 Q;  4IOA A;  2LXK A;  3CC4 A;  1QZG A;  1WCM G;  1K73 C;  2ATW A;  1DGS A;  4LUV A;  2IY5 B;  1HNX L;  1N34 Q;  1QVG A;  2WP8 J;  3K81 C;  4P75 A;  2E2H H;  1VQA A;  1PYB A;  1SRU A;  2IHF A;  4PZ6 A;  2KCT A;  1WI5 A;  4OO1 G;  3PO3 H;  2K50 A;  3HOY G;  4IPC A;  1SLJ A;  3TS2 A;  1I94 Q;  3H15 A;  3PCO B;  2DUD A;  4H02 A;  4IJL A;  3J81 c;  3CPW A;  2UXD Q;  1X56 A;  1E22 A;  1G29 1;  1X55 A;  2DGY A;  3KF6 A;  4LFB L;  4JI2 Q;  1IXR A;  2QGQ A;  1V1Q A;  1K8G A;  1VQO A;  4DV6 Q;  3G4S A;  1WCM H;  1VQJ A;  3BZK A;  2HIV A;  3W1B A;  1YI2 A;  1TWG H;  1G51 A;  4AYB G;  4OX9 Q;  2KHJ A;  5IYC G;  4IPH A;  2NVQ H;  4A3L G;  2BH2 A;  4GKJ L;  3I7F A;  3L2P A;  3GTO H;  1FJG L;  3J80 i;  2VUM G;  1CUK A;  3H0G H;  4L5S A;  2EXD A;  5M5Y H;  1NMF A;  2JE6 I;  3I4O A;  4X62 L;  4JCV E;  4X66 L;  5C44 H;  2VL6 A;  3EBE A;  3BJU A;  2CCZ A;  2ZJQ A;  1OXX K;  1OXS C;  4GN4 B;  4JI1 L;  1XPO A;  3KOJ A;  4C3I H;  2VQE Q;  1JE5 A;  4JG2 A;  3CCS A;  4DR6 Q;  4JI3 L;  1NBW A;  2ID0 A;  3E0E A;  5HY6 A;  4JYA L;  4A3M H;  2K5H A;  1IBL L;  3GTM H;  4DR7 Q;  4A3K H;  2Y0S E;  4QJF A;  2OTL A;  4A3C G;  1AH9 A;  3H3V H;  4DR4 Q;  4GLX A;  4C3J H;  5BR8 Q;  2OTJ A;  1VCI A;  1X9N A;  1PH5 A;  1Y1V H;  5AJ3 Q;  3M3Y H;  1CKM A;  4A3G G;  4JI8 L;  4GLV B;  4X64 Q;  4O2D A;  3CCJ A;  4AQY L;  4RMF A;  3T1H Q;  3HOX H;  2UUB Q;  3HOV H;  1TWH H;  4B3R L;  2UXC Q;  2N49 A;  5M3M G;  1N36 L;  4QGU A;  3I4N G;  2K4K A;  1SRO A;  1BBU A;  2WB1 E;  4DV2 Q;  4OO1 I;  1BBW A;  1N32 Q;  3RN2 A;  4DR5 L;  2UUA Q;  1IL2 A;  2E5L Q;  3K7U C;  1PH9 A;  4O0A A;  4A3B G;  3CCQ A;  4OWW B;  3UE0 A;  4R4I A;  3FP9 A;  1XPU A;  1WYD A;  2MQH A;  1VQP A;  3J7A 5;  2R93 G;  3PGZ A;  1I94 L;  2JA6 G;  1AE2 A;  3CCL A;  4NXN Q;  1KD1 C;  2ZJP A;  2UXD L;  1VQL A;  4DV0 L;  2C35 B;  1K0R A;  4YWM A;  3F2B A;  1YJ9 A;  2HHH Q;  2VZA A;  4DV6 L;  1ASZ A;  4OX9 L;  2WAQ E;  4A3J H;  2D0P A;  5C0X G;  1V9P A;  1TWA H;  1Y1W G;  3G48 A;  1MJE A;  3S1Q H;  1C9O A;  4A3D H;  2AHO B;  4XIG S;  3PIO A;  1N33 Q;  3HOZ G;  4P73 A;  3VDY A;  2UXB Q;  4DUZ Q;  2JA5 G;  2R7Z G;  4GN3 B;  2KHI A;  3CW2 C;  1E3P A;  4POF A;  1D8L A;  2JEB I;  2CQO A;  2Y0S G;  2BA1 A;  4HJ8 A;  4IPG A;  3T1Y L;  3M4Q A;  2YV5 A;  3CD6 A;  5IP9 G;  4K0K L;  1JJ2 A;  3AFQ A;  1JJC B;  4TQU S;  3S16 H;  4BBR H;  1HR0 W;  4DR7 L;  1NE3 A;  1VQH A;  3HKZ E;  4DR4 L;  3J80 c;  4HJ5 A;  4IFD J;  5C3E G;  1UEB A;  1WOC A;  4KHZ A;  3ULJ A;  1HR0 Q;  2WB1 G;  3T1H L;  1RIP A;  5JEA G;  2UUB L;  2IX1 A;  1QVC A;  5IE8 A;  3GTQ H;  3M7N A;  2UXC L;  2VY3 A;  1W2B A;  1OXV A;  2ZM6 Q;  4JI4 L;  4BXX H;  2B29 A;  1P8L A;  3UE1 A;  2VQF Q;  1K9M C;  1K83 H;  2KEN A;  4DV2 L;  4QL5 A;  3GTJ H;  4DV1 L;  1VQ8 A;  1NY4 A;  4DR3 Q;  2UUA L;  1YEZ A;  2E5L L;  4R4Q A;  5LMN W;  1QUQ B;  1JJG A;  1PVO A;  3RLF A;  3RR5 A;  3CF5 A;  3DM3 A;  5E7N A;  4YWK A;  2YYZ A;  5FJ8 H;  1B8A A;  1Q86 C;  2PI2 E;  1XTD A;  2YTY A;  5FLX c;  3PF5 A;  5LMN Q;  4LF9 L;  1OXT A;  1OXU A;  3PO3 G;  1KHI A;  5C0X I;  2R7F A;  1VQ5 A;  1Z9F A;  4BY7 H;  1L0W A;  4NXN L;  1Q81 C;  2WAQ G;  3A0J A;  4LF5 Q;  3AQQ A;  3F8T A;  1VQI A;  3PUY A;  4UP7 A;  1S72 A;  1SN8 A;  3AFP A;  1PH7 A;  3J7Z C;  5M5W H;  4GKK L;  2Z6K A;  2HHH L;  1Q1E A;  2IT1 A;  3U58 A;  3A5U A;  2EIF A;  3RZD H;  1EQQ A;  2B63 H;  2UUC Q;  1XNQ Q;  1HNW Q;  3NEL A;  3KJO A;  4LF7 L;  4X6A H;  1JB7 A;  2H5X A;  1KAW A;  2I0Q A;  1YVC A;  4JI7 L;  3KFU A;  2UXB L;  4LNQ A;  1FL0 A;  3GO5 A;  4ALP A;  4HID A;  3H0G G;  2E2J H;  3U4Z A;  3ULP A;  2JEA I;  2EQS A;  1QUQ A;  1EIY B;  1Q46 A;  2FXQ A;  5C44 G;  3HKZ G;  1VQ7 A;  1P16 A;  4JC0 A;  4IPD A;  1EOV A;  4LFA Q;  4A75 A;  1I50 H;  1X54 A;  4X65 Q;  3PUV A;  4DV7 L;  4P74 A;  4Y7N H;  5H1S E;  3KJP A;  4A3M G;  3MEF A;  1L2F A;  3UDG A;  4A3F H;  4A3K G;  1PH8 A;  4B3M Q;  3CCE A;  4LF8 Q;  5C4J H;  3IRB A;  2YTV A;  4R4C A;  2JA8 H;  2MNA A;  1HR0 L;  4WJ4 A;  1NJI C;  3G6E A;  1Y1V G;  4L5Q A;  4HJ7 A;  3NBH B;  4DAM A;  3HOX G;  2ZM6 L;  3HOV G;  1XMQ L;  1HNZ Q;  4ME3 A;  4DV3 Q;  4GN5 A;  3CAM A;  3BZC A;  4GS3 A;  4B3S Q;  3PO2 H;  1K3R A;  2VW9 A;  1XMO Q;  2UU9 L;  1BKB A;  1LTL A;  4DK6 C;  2GN5 A;  4DNI A;  3PSI A;  3CCM A;  1PA6 A;  1CSQ A;  4RG1 A;  4JI0 Q;  5M5X H;  3JC6 6;  4DV5 Q;  1VQD A;  3ER0 A;  3BU2 A;  4UPA A;  4BY1 H;  5C4X H;  5LMN L;  4C3H H;  3GTG H;  2K5N A;  2QEX A;  3F2C A;  3I2Z A;  4DUY Q;  1CKN B;  1UE6 A;  4GLA C;  4KI0 A;  4Y52 H;  4LF5 L;  1H95 A;  4YCV A;  1GO3 E;  4DKA C;  1EYG A;  2MO0 A;  2XGT A;  3CP0 A;  1PHJ A;  4LF4 L;  2K52 A;  3PV0 A;  1U0L A;  2I5M X;  5IYB H;  2VS1 A;  4YHH Q;  1XNQ L;  1HNW L;  1A63 A;  5LMU Q;  4A3J G;  2ES2 A;  1Z47 A;  1EUJ A;  1X3F A;  4A3D G;  2MO1 A;  4IOC A;  4DR2 Q;  1N34 L;  1YNX A;  4UP8 A;  4DAY B;  1R9T H;  3HFZ B;  2R92 H;  1G6P A;  4HIM A;  3CCV A;  3S1R H;  1IBM Q;  4PMW A;  4DV4 Q;  4KHP Q;  1LM0 A;  3H3V I;  1J5E Q;  4LFA L;  4BBS H;  2Q2H A;  5GRO A;  4X65 L;  3S15 H;  3OYY A;  4MZ9 A;  3KDF B;  2AWO A;  4IFD G;  1WFQ A;  1E1O A;  3K7A H;  4MTN A;  1L1O B;  4PZ8 A;  5J3B A;  4DR1 Q;  2YU9 H;  4BA2 I;  4BBR G;  4B3M L;  1CKN A;  4JI2 L;  1YJW A;  1Q12 A;  1PH2 A;  2A19 A;  1B7Y B;  3D31 A;  3PF4 A;  2JA7 H;  4L5T A; 
#chains in the Genus database with same CATH topology
 1EL0 A;  4QUF A;  1HUM A;  2KSW A;  2JSO A;  4CKE A;  3G6J B;  4JI6 Q;  1J9O A;  1IZ6 A;  2NN6 G;  4JBJ A;  4J15 A;  5D14 A;  4BXX G;  1ESR A;  3F8N A;  5KGU A;  3UI2 A;  3I72 A;  5C3W A;  4YY3 Q;  3AEV A;  3GTP H;  2DLN A;  2WB1 A;  2VQE L;  4QY7 A;  4RHS A;  1LTB D;  1KQS A;  4RWS C;  5DG9 A;  3NPP A;  4TV8 F;  4KLK A;  3G8C A;  4XX0 B;  1EQV A;  4IRK A;  4RU9 A;  2K1B A;  1EFW A;  3H0G B;  3QWN A;  1L1O A;  1MZB A;  1BNZ A;  1PFM A;  2BE5 C;  4Z9C B;  4LMY A;  3Q1K A;  5JUM A;  1STY A;  2SNS A;  5EJW A;  2E2H A;  3RBD A;  3PUZ A;  3PW4 A;  4JYA H;  1EY9 A;  5M5X B;  2FK3 A;  1N9W A;  2B63 G;  1GUT A;  1QNU A;  1W6J A;  5LMU L;  3E0J A;  3N41 B;  2M9V A;  2YS6 A;  2JEI A;  4FDB A;  3EN2 A;  3Q2O A;  3A74 A;  3ERQ A;  3I91 A;  4JBW A;  4C3J B;  2BA0 A;  4JUZ A;  4B3R H;  2BDO A;  4YJ3 F;  5EWF A;  2FLP A;  2K01 A;  1E4G T;  4FS2 A;  2A8V A;  1VDZ A;  2B2W A;  4KHP L;  2VNU D;  1AUV A;  1FGU A;  2AQ4 A;  4WJW A;  2GPW A;  1E0B A;  5EBD A;  1D7Q A;  2E2I H;  1HQM C;  2F0W A;  2R61 A;  2FE3 A;  1EU3 A;  4HCS A;  4DR1 L;  2E75 C;  1UAP A;  1RJR A;  3F2U A;  3SGI A;  5JVH 3;  1ICW A;  5IYD H;  1NCV A;  5M3F H;  1ZHS A;  3UDF A;  3BAA A;  2OEO A;  5KFE A;  3S2D H;  5L1J A;  2Z1C A;  1HTP A;  2L0C A;  5I9O A;  1T94 A;  2IX0 A;  3QZ7 A;  4ZHQ F;  1Q90 A;  4K2L A;  4DUZ L;  1WTO A;  4JYA Q;  5C6A A;  1AP0 A;  3QR8 A;  2ALZ A;  5KFJ A;  5K5P A;  3KLW A;  1Y1V A;  1BBX C;  1X3P A;  3D6C A;  4I50 F;  3SI8 A;  1MI2 A;  3AYH B;  1I6H B;  2C00 A;  4B3R Q;  5GQO A;  1AZQ A;  2W6P A;  1XJV A;  3KHG A;  2OCE A;  5JPN C;  5CV6 A;  5KNB A;  2NYZ D;  3MWM A;  2JXM B;  5EAY A;  1ONL A;  5KKN B;  5KT6 A;  4K0K H;  3FPU B;  1L2Z A;  2ENB A;  4YAK B;  4DR7 H;  1F2M A;  4DR4 H;  2AKW B;  2K05 A;  2R7D A;  4A3I H;  4HIK A;  1I7N A;  4DR3 L;  1LTS D;  1XNR L;  1DV2 A;  2BE5 D;  1J6Q A;  4NB3 A;  3T1H H;  3V4Z A;  3D4R A;  2L12 A;  2RDH A;  1JWM D;  3CCU A;  4JI4 H;  4F87 A;  2VB2 X;  4XT3 B;  4LUO A;  1BNC A;  2I46 A;  1K83 B;  2CH4 A;  2FJ2 A;  1TKW B;  3IAY A;  3M4P A;  5KFY A;  2HQL A;  1EQT A;  2JQO A;  5KG0 A;  1PTO B;  2QYZ A;  1N48 A;  5IGD A;  4OXP A;  1RCV D;  3TRE A;  4EVO A;  2HT1 A;  2UUC L;  4OO1 H;  1D2B A;  4NP5 A;  3RV4 A;  2FIN B;  1KRS A;  1T5X D;  2ASB A;  1CQI B;  2HIX A;  2QDB A;  4RKL A;  4LFC H;  4K0K Q;  4GOP B;  4BY7 B;  2YYA A;  3DXJ C;  4JV1 A;  2QKI C;  3RZO H;  5JVD F;  3PW7 A;  1QVF A;  4BWS C;  3L0O A;  4LF7 H;  4A3L H;  4RZQ A;  1Q1B A;  4JI7 H;  4RUA A;  2PQA B;  2VUM H;  1SNP A;  4EQO A;  3ULL A;  4JI4 Q;  2JA9 A;  2EJM A;  5ELD A;  4C2M B;  1I6V C;  1SFO B;  1EZ6 A;  2B2T C;  2CWP A;  2F4I A;  1SYF A;  2PZU A;  4HIO A;  5EKL A;  4HSV A;  4A93 B;  4ECR A;  1E2Z A;  2CFM A;  4A3C H;  5IT9 c;  2UVR A;  2E2I A;  2I80 A;  4MAM A;  2WIN B;  1EFI D;  4A3F B;  2R84 A;  5K36 G;  4UCS A;  4RAY A;  2W7P A;  1C0A A;  3SXH A;  1K8A C;  1ENC A;  4LFC Q;  4DV5 L;  4R7R A;  3MR6 A;  4A76 A;  1YIJ A;  3R5H A;  1JC7 A;  5IWA L;  2NWG A;  3RNU A;  1Q7Y C;  4X62 H;  1VQC A;  4TQS A;  3PO2 B;  3MHB A;  3HOW B;  2NTT A;  4LF7 Q;  1KXL A;  5H80 A;  4LAA A;  1A62 A;  4E4T A;  3SK4 A;  4JI7 Q;  4A3B H;  1GUN A;  4ZUI A;  4O4L F;  2B3G A;  2PW7 A;  1VQG A;  3JAM W;  1S3O A;  1TS4 A;  3Q0A A;  1DCZ A;  1IOW A;  2L4N A;  1I50 A;  3OSN A;  5K36 H;  1O7I A;  3ERS X;  4ZQ3 A;  2XGP A;  1FR3 A;  1YNN D;  3KF8 A;  4DFA A;  4G7O C;  2KEC A;  4F7X A;  3K58 A;  4LFB Q;  2UVV A;  2W6N A;  3BYT B;  4A93 G;  3OSP A;  5D1O B;  2DPJ A;  4A4I A;  2JJQ A;  4BA1 I;  1RD9 D;  4HJA A;  1ILP A;  4FXD A;  1ZHQ A;  2CVR A;  3H4D A;  3HOY B;  5KFV A;  1VQM A;  1KDA A;  4GKJ Q;  3QG1 A;  3T5H A;  1CM9 A;  2ZTE A;  4O4I F;  4J1M A;  4QWC A;  2NN6 I;  4TQR A;  3MR3 A;  1JOR A;  2C2D A;  3CQZ H;  4X62 Q;  1SMX A;  5DM7 3;  2Z0S A;  4HNV A;  1KJ8 A;  2WAC A;  3S14 B;  1RTO A;  4ETS A;  2RDJ A;  4JI6 L;  4BBS B;  1IW7 C;  1DOM A;  5JJK A;  1PK8 A;  3ND8 A;  1A8V A;  5JJZ A;  3HOW G;  5BN4 A;  3SDZ A;  5C3E H;  1HXY D;  2XCA A;  2HDL A;  3W2D A;  2ZTC A;  2JA7 B;  3TEH B;  1EYA A;  4APV A;  4R4T A;  4U67 3;  2YTX A;  5IP7 G;  1VQE A;  4RB2 C;  1T3N A;  4DN4 M;  3S17 B;  3A56 A;  1WCM G;  3UQ8 A;  1DGS A;  1ILQ A;  2MP1 A;  2F0N A;  1HNX L;  2W70 A;  4H13 C;  2CQA A;  1CE8 A;  3GID A;  5IT9 L;  1PYB A;  4PZ6 A;  3H4B A;  4I4T F;  1WTR A;  5BR8 H;  5EKI A;  3MR5 A;  1SEI A;  3HOY G;  4ZUJ A;  2KHS A;  2DY7 A;  2VUM A;  5KIX A;  1VF5 C;  2UXC H;  4KJN A;  4RNN A;  1G29 1;  1X55 A;  2VB3 X;  1B9M A;  2QGQ A;  1V1Q A;  4FXK C;  1VQO A;  2R8K A;  4DV2 H;  1WCM H;  2M05 A;  4OX9 Q;  2YZM A;  1TR5 A;  2KCC A;  2E5L H;  1AUX A;  3J80 i;  1D1I A;  3CHB D;  1ZQ7 A;  5M5Y H;  2XVS A;  2L11 A;  4JCV E;  4X66 L;  2CCZ A;  1PTO C;  4IUV A;  3BS1 A;  1XPO A;  4C3I H;  5KND A;  3K5N A;  5CBE E;  2UVW A;  1NBW A;  5HY6 A;  4DGZ A;  4A3E B;  4JYA L;  1TY0 A;  1U9R A;  2K5H A;  3GTM H;  5EPK A;  5CC4 A;  5FLX E;  3ND9 A;  4QJF A;  1AH9 A;  3GV6 A;  1EY4 A;  2W9A A;  2C28 A;  3N6X A;  1I3Q B;  5BR8 Q;  5AJ3 Q;  1BUV T;  1IBK H;  4GLV B;  3CCJ A;  4B3R L;  1TA8 A;  2XIG A;  2C2R A;  1KDB A;  3HOX H;  1O80 A;  5A2Q E;  2UXC Q;  2RGV A;  1HFG A;  2BOS A;  4J9R A;  1BO0 A;  1IW7 D;  5EOY A;  3P20 A;  1SRO A;  2ASD A;  2KED A;  4DV2 Q;  4OO1 I;  3NTK A;  1H9M A;  3RN2 A;  4ZK9 B;  1TS3 A;  1Z2O X;  1Q3L A;  1PMR A;  1AN8 A;  4CJ1 B;  2E5L Q;  4DXG A;  4ECS A;  1ZEQ X;  1L0X B;  3TDQ A;  3UE0 A;  2IA6 A;  3ETJ A;  2YRW A;  4R4I A;  3FP9 A;  3I4M B;  2C5C A;  1TII D;  3RBE A;  3V05 A;  1VQP A;  1DOK A;  3VR5 A;  4KJO A;  5G3L D;  1KD1 C;  4MTD A;  2ZJP A;  2W6Z A;  5CV9 A;  4DF7 A;  2HHH Q;  3CQZ A;  2VQF H;  5LL6 X;  4DL3 A;  1ASZ A;  3HXL A;  4IUT A;  2DZD A;  4Q8F A;  1Y1W G;  3A8J E;  2O4X A;  4R8I A;  3HOZ G;  1WTV A;  5LOV F;  3VDY A;  2EJG C;  1I4Q A;  1E3P A;  1VMC A;  2JEB I;  5EDW A;  5ISR A;  4B3T H;  4IPG A;  3M4Q A;  2YV5 A;  4QWE A;  1G91 A;  3OTO H;  1MSG A;  3TP8 A;  4N8F A;  4K0K L;  3T53 B;  1B9N A;  4DR7 L;  5C1P A;  4IHJ F;  4DR4 L;  3J80 c;  2ZDQ A;  4IUN A;  3QO2 A;  2LFN A;  4HJ5 A;  2PBZ A;  2OF1 A;  3RTX A;  4KHZ A;  3ULJ A;  1PTO D;  2EJF C;  4MA0 A;  2B2Y A;  3E5S A;  1EWC A;  3T1H L;  2UUB L;  3M7N A;  5I6W A;  2RSO A;  4JI4 L;  3UE1 A;  2VQF Q;  3CVZ A;  4QL5 A;  3GTJ H;  2W9B A;  3DMU A;  1MBY A;  1JJG A;  3RLF A;  3RR5 A;  3CF5 A;  2JEJ A;  4YWK A;  4OIK A;  1Q86 C;  1WCM A;  1TWH B;  5FLX c;  1RYR A;  4WD3 A;  1U4P A;  3NWS A;  4UAI A;  1L0W A;  4NXN L;  1PH7 A;  1S72 A;  4UP7 A;  2R7M A;  4XYM B;  3N44 B;  5M5W H;  1V1O A;  2DJG C;  1Q1E A;  3RZD H;  1S5E D;  3Q8P B;  2F0I A;  1V1P B;  2AQ1 B;  3NEL A;  2F0H A;  4LF7 L;  4X6A H;  1JB7 A;  4JI7 L;  3GTM A;  1YVC A;  1TVX A;  2UXB L;  4WRD A;  4HID A;  2E2J H;  1Z6H A;  5KFM A;  5M3M B;  1K28 A;  1VQ7 A;  3HKZ G;  4JC0 A;  4IPD A;  2H1E A;  1JOK A;  4MA5 A;  1PFB A;  4K5X A;  3VMM A;  3S1Q B;  4FYD A;  3QZ8 A;  1O78 A;  4Y7N H;  1Z2N X;  4A3M G;  1GUO A;  3MEF A;  1PH8 A;  5JVL A;  2D5D A;  3VYS A;  1ZET A;  5C1O A;  2JA8 H;  1HR0 L;  4R9W A;  3MFH A;  1JCK B;  4RGO S;  4HJ7 A;  3NBH B;  3HOV G;  4ME3 A;  3TIG A;  4KHP H;  2EY1 A;  3CAM A;  1CQJ B;  1J5E H;  1LTL A;  4J9P A;  2GN5 A;  5KFA A;  2SOB A;  1IYU A;  2FJZ A;  1S10 A;  3JC6 6;  2SNM A;  1FD7 D;  3RAX A;  1I4G A;  3ER0 A;  3GTQ B;  2MPM A;  4DL2 A;  3J80 L;  3V96 A;  3BVG A;  4C3H H;  5C4X H;  3GTG H;  2JA5 B;  2K5N A;  2B8G A;  2RDI A;  2HQE A;  1MSH A;  2WE6 A;  4J8Q A;  3AB9 A;  3SVM A;  2MCT A;  4I65 A;  2WDT A;  4V0B A;  3VPC A;  3C3L A;  1U0L A;  1ET9 A;  4QW9 A;  1HNW L;  5LMU Q;  4XDX A;  1IKM A;  3ONA B;  4EBD A;  1EUJ A;  1X3F A;  4N9P A;  3DWA A;  5NUC A;  1BCP C;  1IL8 A;  2WB1 B;  1G6P A;  3S1R H;  3HOU B;  3M3Y B;  4UCR A;  4PMW A;  4KHP Q;  1Y1W A;  5FLX L;  1J5E Q;  3OSO A;  1KLU D;  2Q2H A;  1F9R A;  4DR1 Q;  1L1O B;  1SYE A;  4PZ8 A;  2YU9 H;  5EGT A;  4BA2 I;  3GII A;  3KBG A;  5A2Q L;  1PH2 A;  3GTJ A;  2A19 A;  2E2H B;  5KFO A;  3D31 A;  2X6G A;  4MV4 A;  1SAP A;  4L5T A;  4FP5 D;  1XNR H;  2QA4 A;  5JJI A;  2RHS B;  1PH3 A;  2KCM A;  5D3I B;  2K28 A;  3GTL H;  4C1N K;  4U7C A;  2XNA C;  4TRD A;  1YBY A;  1BXT A;  1G8Z D;  1SE4 A;  1X65 A;  2NZO A;  5C4J B;  4P72 A;  4JI0 L;  3I3C A;  1S0N A;  4LSA A;  5KG6 A;  1BR9 A;  1SR3 A;  4IUU A;  1GSH A;  2D0O A;  4IR1 A;  5FJ8 G;  1AE3 A;  1ML0 D;  3NP8 A;  5BR8 L;  1B1Z A;  3KYH C;  5AJ3 L;  1QG7 A;  3MFI A;  4JI1 H;  3U9T A;  3PUX A;  1VQK A;  3KHH A;  4HJ9 A;  3HOU G;  1LYL A;  2MHV A;  4U6P A;  1UE1 A;  4PMB A;  4RUC A;  1H9J A;  1M8A A;  4A3K B;  2Q2T A;  5KT3 A;  1CK1 A;  4BY1 B;  5EWG A;  3TBI B;  4J9Q A;  4EQP A;  3HS0 C;  1XNR Q;  3V6H A;  1VMP A;  5FK9 C;  5FO8 B;  5KG2 A;  4AQY H;  1Y1V B;  1LAC A;  1GM5 A;  3PQI A;  3H3V C;  1VBH A;  1FYC A;  2A1A A;  4PWQ A;  2C9O A;  3U50 C;  3ETH A;  1FVI A;  2N88 A;  4FVM A;  1TY2 A;  5LP6 F;  1DXM A;  4QWD A;  4I7H A;  1Q8I A;  2NU6 B;  3E9I A;  2AMC B;  4DAV A;  3GIP A;  1U5K A;  3RLO A;  1BCP D;  2N78 A;  3HKZ A;  4IAJ A;  4DL6 A;  5IGE A;  3BAB A;  2WTF A;  3GTK H;  5DLF A;  2J6T A;  1IBK L;  4JI1 Q;  2PNH A;  2RSN A;  1EIF A;  4F4Y A;  3CMA A;  3VA7 A;  5L1L A;  3Q8R B;  1QZH A;  2N3S A;  4NPS A;  4L5R C;  2OH2 A;  1LTR D;  1SSO A;  4FNF A;  1X3Q A;  1GUW A;  3JAM E;  2W6Q A;  2G9D A;  1ULZ A;  4MTK A;  1PRT F;  2QEJ C;  3E9H A;  4AQY Q;  4CBV A;  4A3D B;  3WOF A;  2L15 A;  2PI2 A;  4BY1 G;  3I4L A;  4RGM A;  1NR4 A;  2IHE A;  3EFX D;  4KN7 C;  3JAM i;  3VYT A;  5FKA C;  3GTP B;  1S5D D;  5COR A;  1UWV A;  2A6H C;  2F1M A;  3H94 A;  3TP6 A;  1S0O A;  2D2C C;  5T1G A;  2C22 A;  2QK4 A;  4NLG A;  2VQF L;  2JK8 A;  1C7Y A;  3PW5 A;  3MXU A;  5GON F;  4XYQ A;  1YHB A;  3CC2 A;  1PFS A;  3U4V A;  3M4O H;  4EEY A;  2YU9 A;  4ECY A;  1WJJ A;  3MXP A;  3FKI H;  2K14 A;  4OON A;  1NTG A;  1NNX A;  1B50 A;  1TWA A;  4Q43 A;  5HUR A;  1NAP A;  2F0P A;  5IWA Q;  4B3T L;  2W8K A;  3OTO L;  4ECT A;  1VQF A;  3TRZ A;  4DNT B;  1YJN A;  5FOB B;  3BVZ A;  3GTL A;  1QCB D;  5C3X A;  1GJX A;  3GDE A;  4KY6 A;  1J5E L;  2QF7 A;  4POG A;  2QIL A;  4DLK A;  3OW7 A;  3GP7 A;  2E2I B;  5JJL A;  1F77 A;  3S1M H;  1KIX A;  1KJI A;  4HQ6 A;  1SXT A;  3TZD A;  4ZKC B;  2A68 D;  3GTP A;  1U4R A;  2F0E A;  2CW8 A;  5M3F B;  2NU7 B;  5IGC A;  5IYC H;  4XYO A;  3S2D B;  1G6Z A;  4RB1 A;  2KVM A;  1HNX H;  1J8I A;  4LF6 L;  4UCU A;  5ELO A;  2I8C A;  2R86 A;  4O2B F;  3OMG A;  1E2W A;  1KRT A;  1L1O C;  2AGO A;  4TKO B;  3Q8D A;  2EZV A;  3J81 j;  1SE3 A;  1X3E A;  2R6G A;  2ZTD A;  5JAV A;  4OIJ A;  3TQY A;  5J2U F;  4EYI B;  5ELB A;  1XX8 A;  2KOL A;  1I50 B;  4ODG A;  4JV5 L;  1ZXT A;  3MTS A;  1E7Z A;  2SCU B;  1PH1 A;  1IYJ B;  3LWU A;  2J6S A;  5GAG C;  3KF8 B;  2EYH A;  4C5A A;  4YJ2 F;  5DAU A;  1S97 A;  2TMP A;  3JAM c;  4S3S A;  3JRX A;  5LA6 F;  1XTC D;  3SR1 A;  2B2W C;  1LT3 D;  2A6H D;  2KQ3 A;  3QOL A;  1S40 A;  1AEX A;  2F0S A;  3SK8 A;  4TVA B;  2IL8 A;  4X66 H;  1TWC H;  2XN9 C;  2N55 A;  4ZRZ A;  1W96 A;  3PVX A;  2Z4H A;  2BH8 A;  1HNX Q;  2FMA A;  2F3W A;  4HNT A;  4K5V A;  4EG0 A;  3LML A;  1PV4 A;  2PO4 A;  5IYD G;  4O2A F;  4ECU A;  1LAB A;  4P71 A;  4RGN A;  3PIO 3;  5M3F G;  2R93 H;  4JK1 C;  2JA6 H;  2RVL A;  1RL2 A;  3I55 A;  2Q2U A;  2J4X A;  2CKZ B;  4HNU A;  4QIW E;  1JMC A;  1SYD A;  5AFW A;  4C1N I;  1JWU D;  5HGQ A;  5C0X H;  2B8F A;  1YZ6 A;  2G5D A;  4K5W A;  5KG3 A;  1ROD A;  1XPR A;  1H9K A;  2F52 A;  2W8L A;  5ELC A;  5DQH A;  4RAZ A;  3RB4 A;  1W6K A;  4Q44 A;  1G2T A;  1YNJ C;  1T36 A;  5BN3 A;  4X66 Q;  1E24 A;  1F9Q A;  4FF1 A;  3RZO B;  2F0Q A;  2NVX H;  3FKI A;  3N42 B;  5IT9 E;  2W7O A;  4HMI A;  4B3M H;  2VUM B;  2NZ1 D;  4DPG A;  4DXF A;  4A3I G;  1T5E A;  4E6I A;  4JI5 L;  3BG5 A;  4TV9 F;  1GVP A;  2KBN A;  1PH4 A;  3K8A A;  4NKL A;  1D5M C;  4ULL A;  3BDC A;  5DLQ E;  4IOA A;  2LXK A;  4QIW A;  1QZG A;  4OEL B;  3JSL A;  3Q8S B;  4YR3 A;  5JH7 F;  3NUC A;  4K2K A;  4LUV A;  1S68 A;  1HPC A;  2WP8 J;  3K81 C;  1QVG A;  1NSN S;  1O7Z A;  1VF7 A;  4C5B A;  2BQ3 A;  1GYF A;  2IHF A;  4M7E A;  1WI5 A;  1H9S A;  4OO1 G;  3PO3 H;  2ZDG A;  1EY8 A;  4IPC A;  4IN3 A;  5KT2 A;  3H15 A;  3PCO B;  3JAM L;  3K5O A;  3CPW A;  3S1N B;  5DM6 3;  4X64 H;  2UUB H;  2Z6B A;  2AUJ D;  4LMQ D;  1IXR A;  4YHH H;  2OXP A;  1VQJ A;  3BZK A;  1YI2 A;  4RB3 C;  1TWG H;  4O3Q A;  3OHB A;  1YNN C;  3QOJ A;  5ELE A;  4IPH A;  4A3L G;  3I7F A;  3D6W A;  3L2P A;  1FJG L;  3GTO H;  3T51 B;  2VUM G;  2Q8I B;  5I47 A;  3H0G H;  1RDP D;  1SYG A;  2JE6 I;  3J81 W;  2A73 B;  5C44 H;  2ZJQ A;  2VL6 A;  3EBE A;  5IGF A;  1OXS C;  2ZXO A;  3EA6 A;  4JI1 L;  3M9N B;  4JG2 A;  3CCS A;  4GC7 A;  1FGB D;  4NXN H;  3HP3 A;  3E0E A;  1B6R A;  4DR7 Q;  4A3C G;  2Y0S E;  3GQB A;  5L37 A;  4DR4 Q;  5J22 A;  4GLX A;  4C3J H;  1TWC A;  2B2U A;  3K0Y A;  2OTJ A;  2WKC A;  2F0T A;  4ECV A;  1YNJ D;  3T5J A;  3CQZ B;  4L63 B;  3K59 A;  4JI8 L;  1EU4 A;  4X64 Q;  4AQY L;  3T1H Q;  4RMF A;  3TME A;  2UUB Q;  4P2C B;  1AFP A;  3KXY T;  1C8C A;  1N33 H;  1EUC B;  3V2T A;  2UXB H;  3DWP A;  4EGV A;  2R93 A;  2K4K A;  1H9R A;  4DK1 A;  2I87 A;  2JA6 A;  5HV6 A;  1SE2 A;  3BDO A;  3BQ2 A;  2XGQ A;  1CZG A;  1GXD C;  1EZ1 A;  4O0A A;  4A3B G;  1HA5 A;  4FBT A;  4L8J A;  2CHB D;  1VAJ A;  4J9N A;  1XPU A;  1JKJ B;  4K8I A;  1WYD A;  2NTS A;  3OPO A;  3J7A 5;  1HR0 H;  1TU2 B;  1CQV A;  4NXN Q;  1KBL A;  2UXD L;  2JYO A;  3H6M A;  1VQL A;  3GIL A;  3RIZ A;  5BMV F;  1O7Y A;  4J9K A;  2VZA A;  4DV6 L;  5FD5 A;  4A3J H;  3N52 A;  2DPI A;  2IMW P;  1MJE A;  2HD3 A;  1C9O A;  5J1Z A;  2AQ3 B;  2NVX A;  4N8X 1;  1LLR D;  4IUR A;  3PIO A;  1N33 Q;  4ZYS A;  2UXB Q;  2W9B B;  3A8K E;  4J9M A;  4CC6 A;  3CW2 C;  2BA1 A;  4NXM H;  3OIQ A;  1LTA D;  1WCM B;  4IFD H;  4ECW A;  3H91 A;  3OWE B;  1N56 A;  1C4Q A;  2K6A A;  4KV6 A;  3LWB A;  5C3E G;  5M5Y B;  1HNW H;  1HR0 Q;  3HZX A;  3C1E A;  1E4E A;  5L1K A;  1RIP A;  3H20 A;  1WD1 A;  1QVC A;  4O3O A;  4ED6 A;  4C3I B;  4UDU C;  3A8I E;  2V4R A;  4X3S A;  4NMZ A;  1W2B A;  1KJJ A;  5KFU A;  1P8L A;  4ZKB B;  5EBC A;  3GTM B;  1K83 H;  1XYI A;  2NVT B;  1VQ8 A;  1NY4 A;  3L4K A;  3N43 B;  2XD4 A;  5LMN W;  3MEH A;  2C2E A;  3CRL C;  5E7N A;  2DWC A;  1V8Q A;  1QB5 D;  4IUP A;  5E1F A;  3PW0 A;  1SMY C;  3HOX B;  1PZJ D;  3PF5 A;  1TWG A;  1KHI A;  5C0X I;  2R7F A;  2R3Z A;  1EYD A;  1VQ5 A;  1K0S A;  1LTI D;  1TS2 A;  4BY7 H;  3GTO A;  3A0J A;  1VQI A;  2PYK A;  4HN7 A;  2Z6K A;  3PIP 3;  1EQQ A;  1JIH A;  3A5U A;  1JWS D;  3T4A C;  5J39 A;  4B3S H;  1LV9 A;  3TN2 A;  1C3O A;  5JOB A;  1HNW Q;  2NU9 B;  2EDG A;  1K1S A;  3KFU A;  2H5X A;  5HBR B;  1SEB D;  4JI0 H;  1ENA A;  4LNQ A;  1FL0 A;  5CB4 F;  2L5T A;  3U4Z A;  3ULP A;  4RCO A;  4YBZ B;  1ICF B;  1EIY B;  1EY0 A;  4DA2 A;  3BQ1 A;  1S03 G;  1P16 A;  4DUY H;  1EOV A;  1STN A;  2K33 A;  4C3I G;  3K57 A;  4PMC A;  4WFN 3;  3FMA A;  3NHH A;  3KJP A;  5KFR A;  2RDF A;  4K6L A;  4CJ2 C;  4CKC A;  3J80 E;  1D5Z C;  4A3F H;  4IZ8 A;  1JDE A;  3SE7 A;  3AMU A;  3FMC A;  3KHR A;  4R4C A;  1I4H A;  5LL6 S;  2LY7 A;  4NDX A;  4ECX A;  3HOX G;  1WVL A;  2K03 A;  1R4P B;  1B3Q A;  1IBM H;  4V19 0;  2KA7 A;  3LP8 A;  3PO2 H;  1Y8N B;  1GUS A;  3BZC A;  4B3S Q;  1B6S A;  2VW9 A;  4J9O A;  1BKB A;  2J6U A;  4DNI A;  3PSI A;  3TP5 A;  4GZY C;  1CSQ A;  1Y1W B;  4JI0 Q;  1PXU A;  1Y69 U;  2V4Q A;  2MUY A;  5D65 A;  3HOZ B;  3BU2 A;  1KTK A;  1S5F D;  3S9W A;  1X32 A;  4QMG A;  2AGQ A;  2Q8T A;  2QEX A;  3EVQ A;  3I2Z A;  3F2C A;  4DUY Q;  1NUC A;  1KAA A;  4Y52 H;  4M1U B;  2GLT A;  5C4Z A;  3E3X A;  3GTJ B;  4LF5 L;  5KFT A;  4ED1 A;  4IWY A;  4KKS A;  3CP0 A;  1PHJ A;  5IGG A;  2K52 A;  3HEJ A;  3DWQ A;  5C5L A;  3IG0 A;  3KHL A;  5IYB H;  2VS1 A;  1BCP B;  1SMY D;  1Z47 A;  2EYP A;  2ICE C;  3GV5 B;  4IOC A;  5DGA A;  3C2P A;  2EPB A;  1R9T H;  2R92 H;  4HIM A;  2EY6 A;  3CCV A;  1IBM Q;  2ICI A;  2MGS A;  2WYO A;  4LFA L;  3RZD B;  4BBS H;  1HA6 A;  5EWE A;  3S15 H;  2J9G A;  1E1O A;  3K7A H;  5J3B A;  3K5I A;  4I7Z C;  4B3M L;  1CKN A;  3MAQ A;  5CV7 A;  2E2J B;  2JA7 H;  2BH2 A;  1I5F A;  4IQZ A;  5F9L A;  4EX5 A;  1IBK Q;  2B2Y C;  4AH6 A;  1K1Q A;  5K2M A;  3I73 A;  2HVS A;  3S17 H;  4Y7N B;  5JVG 3;  2QCP X;  2ZJR A;  4DAY A;  1OTC A;  2PMZ E;  3OIP A;  2QW7 A;  3NK9 A;  2JA8 B;  2PVP A;  2EYF A;  1KNE A;  2WKD A;  5ELN A;  4B9X A;  5JQW A;  1B44 D;  3QB3 A;  4Q0Y A;  4UCT A;  2X6L A;  1L0Y B;  4MHE A;  4AIM A;  5GAD C;  1HZ9 A;  1CT1 D;  3HKZ B;  4L6T B;  4UP9 A;  4X64 L;  1MD2 D;  5CGK A;  2RCN A;  4JI3 H;  4BWG B;  1IBL H;  3CRK C;  2CH4 W;  1MKH A;  4YHH L;  2XWB B;  4A3M B;  2EYO A;  2W71 A;  1EHI A;  5M9O A;  4RH6 A;  1UE7 A;  5C4X B;  1GGO A;  4C3H B;  1Q8K A;  2LSS A;  2GVA A;  4DR2 L;  4IFD I;  1SJH D;  4DL7 A;  1G2S A;  4LF6 H;  1WTP A;  1GUG A;  3PZP A;  4CDF C;  3HOV B;  1RKN A;  1N36 H;  1VQB A;  2L9H A;  4O4H F;  4B3T Q;  1M4V A;  1MHW C;  2RF4 A;  3PIP A;  1VS0 A;  4A3E H;  2PMZ A;  4DR5 H;  3OTO Q;  4M8A A;  2A6E C;  2YW2 A;  2R8I A;  4RCN A;  2L1B A;  4JV5 H;  1A3U A;  3K6O A;  5CV5 A;  4QQB X;  2E8G A;  1I3Q H;  4MV6 A;  3OW2 A;  3S1R B;  1CA5 A;  5C5M A;  2JA8 G;  3F1Z A;  1EWI A;  4IAL A;  5TSS A;  4CDD C;  2FMM A;  1I94 H;  3K5L A;  1N33 L;  3D8G A;  3FDS A;  4JI3 Q;  5GAE C;  3DLL A;  1IBL Q;  2YZN A;  1HZC A;  1YHA A;  2YU9 B;  1I4R A;  2NBF A;  3OWF A;  4JBK A;  4MN3 A;  2VUG A;  3DHQ A;  3B6Y A;  1TWA B;  2EYL A;  5A35 A;  3ICE A;  4LF6 Q;  2OQK A;  4MV9 A;  1EEI D;  3GD7 A;  1N36 Q;  4WJ3 M;  5ELF A;  5C4X G;  3DM1 A;  4C3H G;  1EZ8 A;  4LSX A;  3RFC A;  3NBI A;  4GNX C;  3GTL B;  3T1Y H;  4DR5 Q;  1R9T A;  4YB8 B;  1JOQ A;  5IYZ F;  2R92 A;  2Q2I A;  3P1H A;  3NWT A;  5FLM H;  4XTC S;  2K7V A;  4JV5 Q;  4LW1 A;  4XQN A;  3BQ0 A;  4HAE A;  3IKJ A;  1IKL A;  2XWJ B;  1D1K A;  1KNA A;  3MXG A;  4MNO A;  1S4Z A;  1AN7 A;  4KD3 A;  1PYS B;  4O3N A;  2N8N A;  4FXG C;  5F2D A;  1QIL A;  1A3V A;  5KG4 A;  3E6Z X;  4PG3 A;  5KFC A;  5KX5 F;  2F0J A;  5GAH C;  3FHW A;  3SK6 A;  4UY8 C;  1PYW D;  4K6D A;  4GNX A;  4NXM L;  4DV1 H;  3T5L A;  2UUA H;  2RBM A;  1BQQ T;  4ED2 A;  1JDB B;  5FPR A;  1XXG A;  3TSS A;  2FLN A;  3Q24 A;  3S2H H;  1B70 B;  1UC9 A;  1F2Z A;  1X6O A;  1BVS A;  3T1Y Q;  4JI5 H;  2A74 C;  1C48 A;  4ECQ A;  1CFM A;  1WH2 A;  2M00 A;  2XTI A;  2A6E D;  3V6K A;  2I07 B;  2R8H A;  3S24 A;  3VA5 A;  2VPS A;  3CPF A;  3M9M B;  1PDQ A;  1KAB A;  3HKS A;  3WOE A;  4UHV A;  1WD0 A;  4IO9 A;  1U4M A;  3Q23 A;  1I4P A;  3CXC A;  2BDN A;  4RA8 A;  3MXN A;  4XT1 B;  4DV1 Q;  2CW0 C;  2RHQ B;  3W1G A;  3WDN A;  2VOB A;  4YR2 A;  2HCI A;  2W57 A;  3CC7 A;  3RMH A;  2Z4I A;  1PZK D;  2RCF A;  1W93 A;  3A54 A;  4IWX A;  1STE A;  1KLG D;  4KMU C;  1VQN A;  3OOC A;  4B3S L;  3PN1 A;  4KKU A;  3G6X A;  4H7B A;  4JI5 Q;  4A3G H;  5KRU A;  3K80 C;  1UE5 A;  1FJG H;  4ED3 A;  5M3M H;  3L7Z C;  3I4N H;  3CME A;  1TWF H;  2K5V A;  1DYQ A;  3EYY A;  1UUP A;  4DUY L;  3CU7 A;  3J81 i;  1B33 N;  2I5H A;  3N8D A;  1DON A;  1HJP A;  3HRZ C;  1ZYR D;  3UDX A;  1HUN A;  2FK2 A;  1JE4 A;  1O7L A;  5LMN H;  2D62 A;  1KL9 A;  3FKI B;  2P5Z X;  2YZG A;  3T5K A;  3MJF A;  4JI8 H;  1Q82 C;  4R8U A;  1IBM L;  4KD4 A;  2K75 A;  2OQ0 A;  4LF4 H;  3VPB A;  3GIK A;  2NVY H;  4CDE C;  1EY6 A;  5FPO A;  3GV3 A;  4QIW B;  2A68 C;  5KFX A;  3WWV A;  3TZU A;  1FJG Q;  1K8O A;  1Z2P X;  2JA5 H;  2R7Z H;  3Q6S A;  2NUA B;  1LO5 D;  1EWH A;  4AYB E;  3S1M B;  2VA3 A;  3QIA A;  4HTH A;  2FMC A;  2PPB C;  3FEW X;  1I4X A;  1RYS A;  4QWA A;  1QNK A;  5IP9 H;  3IN5 A;  2E2D C;  1H9S B;  1STG A;  2UXD H;  3KK7 A;  3TP7 A;  4ZI7 F;  3GTG A;  1F9P A;  1TXY A;  2EY5 A;  2OT2 A;  1Y14 B;  2VR1 A;  4DV6 H;  3CKI B;  5KEE A;  1FKA H;  4UCV A;  4OWX B;  4DK3 C;  2P0A A;  5JEA H;  4ED0 A;  4JI8 Q;  2CW0 D;  3DUZ A;  3KBX A;  1HNZ H;  5BPF A;  4Q45 A;  2H4O A;  3FKI G;  4LF4 Q;  1XMO H;  2FLL A;  1K73 C;  2ATW A;  3QFF A;  1ET6 A;  4DR6 H;  2IY5 B;  1PFN A;  1DIK A;  4P75 A;  2E2H H;  2LS0 1;  1RHP A;  2BQR A;  1SRU A;  4AYB A;  5D8D A;  1LT4 D;  4H0L C;  5DG7 A;  4HR7 A;  3RGX A;  3ORQ A;  4YAJ B;  3J81 c;  2F0M A;  4H02 A;  4IJL A;  3MWD A;  1TWC B;  5KFZ A;  2UXD Q;  1X56 A;  1E22 A;  2DGY A;  1A2T A;  3KF6 A;  1DJR D;  1PRT C;  1K8G A;  2RQX A;  4DV6 Q;  2AQ2 B;  4RNO A;  4Y8V B;  1F2Y A;  1G51 A;  5CYU A;  1F9S A;  1IOV A;  1N32 H;  2KHJ A;  5IYC G;  2NVQ H;  2R93 B;  2FK1 A;  3MZ5 A;  4ZCK A;  5KYL A;  2JA6 B;  4KY5 A;  1BDO A;  1NMF A;  4ME5 A;  3J7A V;  4F4W A;  1DV1 A;  4DL4 A;  2IJ0 A;  1S9F A;  3BJU A;  2FPG B;  1OXX K;  3M4Y A;  4GN4 B;  3KOJ A;  1JE5 A;  4DR6 Q;  4MV8 A;  1UC8 A;  4JI3 L;  2ID0 A;  5CA1 F;  1IBL L;  4ECZ A;  3A7L A;  1XDN A;  1TWF A;  3OHX C;  4A3K H;  3MVV A;  5I2X A;  4QB4 A;  4FF3 A;  4QCL A;  1VCI A;  4HMJ A;  1Y1V H;  1B53 A;  1CKM A;  4O2D A;  1AW7 A;  4QF4 A;  5JPM C;  1WTQ A;  1N36 L;  2NVX B;  2PZW A;  2KUM A;  3BA8 A;  1BBU A;  2WB1 E;  1BBW A;  4FF4 A;  2Z9H A;  1N32 Q;  4DR5 L;  3VPD A;  3P75 A;  2D9U A;  1IL2 A;  3TQT A;  3K7U C;  1PH9 A;  1SCU B;  5CA0 F;  3CCQ A;  2Z8L A;  3OUZ A;  3VYU A;  5CAE B;  5KFL A;  2NVY A;  2R93 G;  2MQH A;  2LKV A;  2IWH A;  3HBL A;  3R2I A;  3PGZ A;  1DZ1 A;  1I94 L;  2JA6 G;  1AE2 A;  3L4J A;  2NB0 A;  3G6Y A;  2R7Z A;  3TIN A;  4O1N A;  4EEQ A;  4F8M A;  2R6F A;  1SYC A;  1Y8P B;  3QJY A;  4OHJ A;  3IFT A;  3F2B A;  1E4E B;  4APM A;  3GTK A;  3WNZ A;  2WAQ E;  2XC9 A;  5C0X G;  1V9P A;  5KFI A;  4A3I B;  4A3D H;  3PO3 B;  5KFG A;  4XIG S;  3GV8 B;  1HRJ A;  4P73 A;  2A5H A;  4POF A;  2FKL A;  1QWY A;  2EYM A;  2O5J C;  1D8L A;  1PRT D;  2Y0S G;  4ZAI A;  3VYR A;  4HJ8 A;  3T1Y L;  3EQL C;  3J81 L;  4LF5 H;  1TWG B;  3FVQ A;  4TQU S;  1JJC B;  3S16 H;  5FO7 B;  4BBR H;  3M7G A;  1VQH A;  5I9P A;  3GTO B;  3IFD A;  4RNM A;  3J7Y W;  4O3P A;  5C44 B;  1CHQ D;  1STB A;  3SEB A;  2IX1 A;  5EKK A;  2NN6 H;  4BXX H;  2B29 A;  1CZW A;  2KEN A;  2ZXP A;  3P7J A;  4YQW A;  4DV1 L;  2WAQ A;  4EGJ A;  4LFA H;  2UUA L;  2ZDH A;  2W9C A;  4XQJ A;  4R4Q A;  2W6O A;  2K5Q A;  4U68 A;  2YYZ A;  2YTY A;  2G9H D;  2AUK A;  2E76 C;  2PNR C;  4EYH B;  4LF8 H;  1OXT A;  1OXU A;  3PO3 G;  2BQU A;  4G7H C;  5E4W C;  4IRC A;  1RJP A;  1Z9F A;  3DEO A;  2XCP A;  4FF2 A;  4LF5 Q;  3AQQ A;  5IOC A;  1SN8 A;  3AFP A;  5CV4 A;  5KT5 A;  5T14 A;  2IPK D;  2B63 H;  2YCH A;  2EIF A;  3VR6 A;  4DV3 H;  1VKZ A;  4QW8 A;  2I0Q A;  4B9W A;  4EFE A;  3HG9 A;  2ATL A;  4ALP A;  3MWE A;  3H0G G;  2JEA I;  4KKT A;  1QUQ A;  1Q46 A;  2FXQ A;  5C44 G;  3TS2 A;  1TAE A;  3E5N A;  3A7A B;  4LFA Q;  1I50 H;  1X54 A;  4XZ3 B;  4A3J B;  5CR3 A;  2NUC A;  3PR5 B;  2X69 A;  3UDG A;  4B3M Q;  4A3B B;  1STH A;  2DIK A;  3CCE A;  4C3J G;  4LF8 Q;  2B2U C;  2YTV A;  1NJI C;  3G6E A;  4DR2 H;  4FM9 A;  3FPP A;  1A15 A;  4DAM A;  2ZM6 L;  3VR4 A;  1B04 A;  5C4H A;  4DV3 Q;  4DV4 H;  4GN5 A;  4GS3 A;  1WSC A;  5DLG A;  4YR0 A;  1K3R A;  5DQI A;  3BVM A;  5HGT A;  3CCM A;  1PA6 A;  5M5X H;  2FPI B;  2F0U A;  2IBK A;  1FNU A;  2NU8 B;  5KFQ A;  1SNO A;  5LMN L;  2HJW A;  3G6V A;  3X3M A;  2F0L A;  1CKN B;  4PV1 C;  1H95 A;  4YCV A;  3JZI A;  4IRD A;  3RF2 A;  1U4L A;  4XYL B;  1EYG A;  2MO0 A;  1B4O A;  2WV6 D;  2XGT A;  4HSP A;  4LF4 L;  2YS7 A;  4G4K A;  2DY8 A;  3C1F A;  2VA2 A;  4IUQ A;  2I5M X;  4YHH Q;  2M2L A;  1XNQ L;  3V4S A;  4A3J G;  4NW2 A;  4WBN F;  1HTL D;  3G7L A;  1Z7T A;  5C3E B;  2MO1 A;  4DR2 Q;  4UFZ A;  2K32 A;  4UP8 A;  2VXW A;  1JR0 D;  1WTH A;  4QUC A;  4DAY B;  5KFN A;  3HFZ B;  1WTX A;  3ERO A;  4DV4 Q;  1R4Q B;  1GLV A;  1M6V A;  3NQI A;  4ILW A;  1OWT A;  5GRO A;  4X65 L;  5KFB A;  3OYY A;  4CKB A;  4IFD G;  2PZT A;  4MTN A;  1HCZ A;  1FNW A;  2R7L A;  1YJW A;  2Y0S A;  1I6H H;  1RJT A;  2V1C C;  3RUP A;  1VQ6 A;  2EVB A;  3L9A X;  4YCW A;  1JT8 A;  5E4X A;  5KYI A;  1HFN A;  1JX4 A;  2V59 A;  1HNZ L;  1A6X A;  3NEM A;  4LFB H;  1XMO L;  2PCF B;  3MWY W;  2OWO A;  4H44 C;  2F4V H;  4Q0F A;  4DR6 L;  3NGD A;  4KY7 A;  1SYX B;  4GKJ H;  1EQR A;  2B63 A;  2DN8 A;  3UDI A;  2F3I A;  3K5H A;  4DL5 A;  2PMZ B;  2R8G A;  3KDF A;  4LH7 A;  4HCE A;  4DK0 A;  3S1N H;  2B2T A;  4PZ7 A;  1DM0 B;  1W3S A;  4JPB W;  4BY7 G;  3TQ1 A;  2IW3 A;  2EXZ A;  1V4Y A;  3KLR A;  4UCO A;  1TS5 A;  2Z6K C;  3STB C;  2FHT A;  2R82 A;  1BGW A;  1E1T A;  4JV0 A;  2VQD A;  1LTG D;  1N32 L;  3RB0 A;  4OL7 A;  1GKH A;  1PTO H;  3D0F A;  4GC6 A;  5F9N A;  4O3S A;  5L9X A;  5CV8 A;  1EEF D;  3EIV A;  4J9L A;  3NQT A;  3UFX B;  2JP1 A;  2F4V Q;  3MA2 B;  5BN5 A;  4NXM Q;  4C5C A;  1M90 C;  1CKO A;  1E2V A;  3H0G A;  2WFW A;  3LNN A;  1RK6 A;  5DNF A;  5T1I A;  5G3L F;  4A3F G;  1R9T B;  3R8B A;  2R92 B;  4ED8 A;  2WII B;  4YIJ A;  1X3G A;  1LT5 D;  1JOO A;  2YRX A;  3ORR A;  2GPS A;  1RF2 D;  2I5L X;  3K0X A;  3RV3 A;  3S15 B;  3PUW A;  2KJX A;  4DV0 H;  3NSW A;  4C2M H;  3K7A B;  4I55 F;  1HZB A;  3Q22 A;  1HH2 P;  1SFO H;  4J0M A;  4YY3 L;  3PO2 G;  4M9U A;  2AGP A;  2GVB A;  4ZQI A;  4A93 H;  2ALY B;  4FBU A;  3A5Z B;  4OX9 H;  3PW2 A;  4RGT A;  2IX3 A;  3J7A K;  1KDC A;  5EPL A;  3ZJY C;  3VR3 A;  3F2D A;  4GNX B;  2DNC A;  5COY A;  3BA9 A;  3JRW A;  3WO1 A;  1KJ9 A;  2X0S A;  5JEA J;  1YHQ A;  2QDL A;  3BZD B;  3TS0 A;  3NEN A;  3D4W A;  4FO2 A;  5D1P A;  3BYY B;  4X3U A;  1PTO F;  1KC8 C;  2W6M A;  5J2T F;  3G71 A;  3L3O C;  5IYB G;  3HOW H;  3KAL A;  2AWN A;  3NTH A;  1I6U A;  4WOR A;  4TUY F;  2OLS A;  4DV0 Q;  4N9T A;  2R92 G;  3RD4 A;  3H09 A;  5IP7 H;  2CQY A;  3K5M A;  1N8R C;  1MGS A;  1B3A A;  4MV3 A;  3STB D;  3M85 A;  4BBS G;  3RN5 A;  3M4I A;  1EOT A;  5LXT F;  3MXN B;  2K5D A;  1VQ9 A;  2FFK B;  4OWT B;  4LK1 C;  1C30 A;  5DQG A;  2DNE A;  2KEE A;  3GQC A;  4RZR A;  2B2V C;  1ENF A;  1IHZ A;  3SE0 A;  4LF9 H;  2JA7 G;  3HOY H;  1CSP A;  1T9H A;  2HUG A;  5KFD A;  3D3R A;  1VBG A;  1ESF A;  1YIT A;  3R2T A;  3RUZ A;  3LGJ A;  3GIJ A;  3RB6 A;  5IY0 A;  1UNN C;  4GKK H;  1ASY A;  5KFF A;  2HHH H;  2NVT H;  4A2A A;  5M5W B;  3R3O A;  1M7J A;  5KG1 A;  4GOP C;  1MJC A;  3S14 H;  1DD2 A;  3SHL A;  2PN1 A;  2MFI A;  4J6H A;  5DEH A;  1CQF A;  4IZO A;  4LWC A;  1D6E C;  2CWA A;  3WO0 A;  5KG5 A;  5KT7 A;  4BS9 A;  2XSC A;  1M1K C;  1RTN A;  3EJI A;  1K83 A;  1GD7 A;  3J7A F;  1VQ4 A;  4IR9 A;  4LF8 L;  4ME6 A;  2FP4 B;  4DU9 A;  5KFK A;  4K8J A;  2B2V A;  4IJH A;  2V9W A;  4XQQ A;  2Q8R E;  2R7K A;  3CCR A;  4DV7 H;  1NMG A;  4RB0 A;  1JQY D;  4F50 A;  2XRQ D;  1LUZ A;  1XWE A;  4DV3 L;  1CA6 A;  3M9B A;  3H40 A;  3RAQ A;  2GA4 B;  4R8U B;  4GOP A;  1ZKO A;  4LF9 Q;  3RLN A;  3R23 A;  1A0I A;  3NE5 B;  3C0F B;  3TII A;  1MIU A;  1B2T A;  1HZA A;  4LUZ A;  1XMQ H;  4GKK Q;  1RJQ A;  2J7Z A;  2BR0 A;  3N6R A;  2PQA A;  3I70 A;  2UU9 H;  3FDT A;  4OEM B;  1F2L A;  2O2L D;  4A3E G;  5IT9 W;  4C2M A;  4R4O A;  1SFO A;  3I90 A;  5LYJ F;  2YL2 A;  5KNC A;  3PR4 A;  4JOI C;  1EY7 A;  3GTG B;  3T13 A;  4DV7 Q;  2LXJ A;  4F4Z A;  2PQE A;  2FB9 A;  2AU0 A;  4KHV A;  4DV4 L;  2R85 A;  4HED A;  4KTA A;  3S2H B;  3U9S A;  1PH6 A;  1Y1W H;  3R5X A;  4LJZ C;  3T16 A;  2F0K A;  5E3F A;  1N34 H;  3HOZ H;  1V43 A;  4EQ5 A;  1XMQ Q;  3I4M G;  2K5W A;  5C0X J;  3I56 A;  1RK5 A;  4X3K A;  3GLK A;  1II3 A;  5DG8 A;  2EOT A;  3BJY A;  2UU9 Q;  4JOI A;  4F88 A;  4AYB B;  4ZLT F;  5FLM G;  3LX0 A;  4HR7 B;  4YWL A;  4JI2 H;  4YCU A;  3VR2 A;  2R8J A;  2EY2 A;  5CMD A;  2HCC A;  3W5O A;  4JBM A;  4R1J A;  4HYK A;  3KF6 B;  3MFY A;  1UEA B;  1SE8 A;  5CBA E;  2HGS A;  4RFB A;  4LFC L;  2NZH A;  2CZG A;  2JN4 A;  5D1O A;  2ZT9 C;  3I4M H;  5C8Y F;  2SEB D;  5IOD A;  5KFP A;  4MV1 A;  1SNQ A;  3CC4 A;  1PX2 A;  2FPP B;  3RGZ A;  5EQ0 A;  1KEE A;  3JSN A;  2VQE H;  3ZYY X;  2ASL A;  4KN4 C;  1N34 Q;  3MR2 A;  1SBB B;  3IL8 A;  4A3G B;  2VPQ A;  4RHR A;  1VQA A;  2EYJ A;  1EYZ A;  3GV7 B;  2KCT A;  3I4N B;  1CHP D;  2K50 A;  4CC5 A;  1TWF B;  1SLJ A;  1JB3 A;  1UNS A;  1PRT B;  1I94 Q;  1EY5 A;  1ZYR C;  2DUD A;  3KTM A;  5L1I A;  2MJ8 A;  2RKS A;  4G7Z C;  4LFB L;  4JI2 Q;  1S5C D;  2JA7 A;  5KFH A;  1A9X A;  3G4S A;  2F4V L;  5LMU H;  2HIV A;  3W1B A;  1M0T A;  4AYB G;  2ASJ A;  5LL6 b;  2JEF A;  3Q8Q B;  4EBE A;  2XIW A;  3KAK A;  2XRS D;  4GKJ L;  4FS1 A;  1QE6 A;  1CUK A;  4L5S A;  5DGB A;  2EXD A;  3OUU A;  3MFG A;  3I4O A;  1Y8O B;  3DEP A;  4X62 L;  1IYV A;  5FD6 A;  1BCP F;  2A69 C;  2VQE Q;  3R93 A;  3N40 P;  1S5B D;  4DR1 H;  2NVY B;  2LMC B;  3D4D A;  4A3M H;  2E74 C;  3HGB A;  4RKB A;  5IIF A;  2OTL A;  3H3V H;  5I4D A;  2ZJT A;  2R7Z B;  4MV7 A;  3SK5 A;  4QWB A;  3GIM A;  1X9N A;  1PH5 A;  2BCO A;  4A3G G;  3KLS X;  1EIH A;  3GTK B;  3HOV H;  4XXE A;  1CTM A;  1TT2 A;  1TWH H;  4PDB A;  2N49 A;  1DOL A;  4DUZ H;  5M3M G;  3I4N G;  4QGU A;  2RA4 A;  3KAJ A;  3U9O A;  1JXL A;  1HHV A;  2UUA Q;  2TSS A;  5C5J A;  5EPJ A;  4J9S A;  4OWW B;  2HVQ A;  1OO9 B;  5I2Y A;  3J81 E;  1K3B C;  1HQR D;  3CCL A;  4L1K A;  1SNC A;  2EE1 A;  4KK7 A;  4B08 A;  4DV0 L;  2C35 B;  5EZY F;  1K0R A;  1I3Q A;  4EGQ A;  2ZM6 H;  4YWM A;  1YJ9 A;  4YP3 A;  1BJT A;  4OX9 L;  2D0P A;  3S1Q H;  1TWA H;  1KJQ A;  3G48 A;  3I12 A;  4RAU C;  2UVU A;  4DR3 H;  5KT4 A;  4PQX A;  2F03 A;  2AHO B;  3BG3 A;  2DJF C;  1BF4 A;  2WAQ B;  3M4O B;  4DUZ Q;  2JA5 G;  2R7Z G;  5KG7 A;  2W9C B;  4GN3 B;  2KHI A;  1GSO A;  2F0G A;  1SYB A;  4CDC C;  4EQN A;  3KUP A;  2CQO A;  1A3T A;  3MC0 B;  4EBC A;  1A2U A;  3CD6 A;  1STA A;  5IP9 G;  1JJ2 A;  5KFS A;  3AFQ A;  4FU0 A;  1HR0 W;  2NVQ B;  4DNR B;  2IP4 A;  1NE3 A;  4ABN A;  3HKZ E;  3URY A;  1I7L A;  2UUC H;  4IFD J;  1XNQ H;  1UEB A;  3ITP A;  2JEG A;  1WOC A;  4I7A A;  2R7N A;  2WB1 G;  5JEA G;  2A69 D;  5IE8 A;  3GTQ H;  2UXC L;  2VY3 A;  4ZOL F;  1OXV A;  2ZM6 Q;  4G57 A;  2RDG A;  1CS0 A;  1KC7 A;  5BPH A;  1K9M C;  4DV2 L;  2XCL A;  4DR3 Q;  4X65 H;  1YEZ A;  3EPI A;  2E5L L;  3J80 W;  4F4X A;  1QUQ B;  1PVO A;  1BOS A;  2HDM A;  1NR2 A;  3DM3 A;  2RGR A;  5FJ8 H;  4Q5V A;  3X3N A;  1B8A A;  2PI2 E;  1XTD A;  3M9O B;  3A55 A;  1AZP A;  1GHK A;  5LMN Q;  4LF9 L;  4JV2 A;  2L55 A;  5D3D A;  1Q81 C;  2WAQ G;  3V6J A;  2ZXR A;  3F8T A;  3HOU H;  3M3Y H;  3PUY A;  5I6Y A;  3J7Z C;  4GKK L;  3EPG A;  4O42 A;  1GHJ A;  2HHH L;  4ID6 A;  2IT1 A;  3U58 A;  2K04 A;  1SJE D;  4CHT B;  1CI3 M;  1PLF A;  2UUC Q;  1O75 A;  1XNQ Q;  4R8N A;  2R87 A;  3KJO A;  5FLX W;  1KAW A;  1GOZ A;  3HB9 A;  1WTW A;  4PNY A;  4A2B A;  3GO5 A;  4DV5 H;  1LTT D;  3NTI A;  4O3R A;  2EQS A;  5IWA H;  3OMC A;  4A75 A;  5A2Q W;  4X65 Q;  3PUV A;  4DV7 L;  1TWH A;  3FRP B;  3K3V A;  4P74 A;  4C56 C;  5H1S E;  3KLS A;  3GIQ A;  1L2F A;  4CJ0 B;  4A3K G;  2F0O A;  3RB3 A;  3BDL A;  3O13 A;  2KCN A;  3RJ0 A;  5C4J H;  3IRB A;  2MNA A;  4WJ4 A;  1BXR A;  3K3P A;  1E4F T;  1D5X C;  1Y1V G;  2F0V A;  3PMF A;  2V4D A;  3LWE A;  4L5Q A;  1V1P A;  4K14 A;  1XMQ L;  4MTE A;  4G3I A;  1HNZ Q;  3S16 B;  4BBR B;  1JLL B;  4OGQ C;  2J0T D;  1XMO Q;  2UU9 L;  2V58 A;  4DK6 C;  1PZI D;  1QOH A;  5IGB A;  2B39 A;  4RG1 A;  2O03 A;  5KFW A;  4DV5 Q;  2F3V A;  1EIG A;  1VQD A;  4UPA A;  3T56 B;  4BY1 H;  1S0M A;  4JVZ A;  1UE6 A;  4GLA C;  2F0F A;  4KI0 A;  1M0W A;  1WR2 A;  2Y0S B;  4LH6 A;  1GO3 E;  2CW7 A;  4JI6 H;  4X3T A;  4DKA C;  1JIC A;  3PV0 A;  3DF7 A;  3R5F A;  1A63 A;  4EFB A;  4YY3 H;  1TQO A;  3NBH A;  1QJO A;  3W3A A;  2ES2 A;  4A3D G;  4JW0 A;  1N34 L;  1EUD B;  3I8Z A;  1SNM A;  1FNV A;  1YNX A;  4DAP A;  2PW5 A;  1LM0 A;  3AU7 A;  2O5I C;  3H3V I;  1EYC A;  3OHA A;  2B63 B;  4MIU A;  1V51 A;  4Q8E A;  4MZ9 A;  2F0D A;  3GTQ A;  3KDF B;  2AWO A;  1WFQ A;  1GSA A;  5LHY 1;  1SDF A;  5FO9 B;  2JA5 A;  4TSS A;  4BBR G;  4ED7 A;  2HVR A;  1LT6 D;  1K8M A;  4JI2 L;  2V5A A;  1Q12 A;  3NXW A;  1B7Y B;  3PF4 A;  3C46 A;  1SND A;  2SDF A;  4CGY B; 
#chains in the Genus database with same CATH homology
 1I5F A;  2V1C C;  4EX5 A;  1VQ6 A;  1IBK Q;  2QA4 A;  4YCW A;  4AH6 A;  5JJI A;  1JT8 A;  4JI6 Q;  2RHS B;  1HNZ L;  1PH3 A;  3S17 H;  2KCM A;  1IZ6 A;  2NN6 G;  4JBJ A;  3NEM A;  4J15 A;  4BXX G;  3GTL H;  4YY3 Q;  2ZJR A;  1XMO L;  3AEV A;  3GTP H;  2OWO A;  1YBY A;  1OTC A;  2PMZ E;  1X65 A;  2VQE L;  2NZO A;  4QY7 A;  4DR6 L;  4P72 A;  4JI0 L;  1KQS A;  1EQR A;  1SR3 A;  2D0O A;  4KLK A;  2F3I A;  3UDI A;  5FJ8 G;  1AE3 A;  5ELN A;  3KDF A;  1EFW A;  1L1O A;  5BR8 L;  3KYH C;  5GAD C;  4PZ7 A;  4AIM A;  5AJ3 L;  3S1N H;  1W3S A;  1HZ9 A;  3PUX A;  4X64 L;  4UP9 A;  1VQK A;  4BY7 G;  4HJ9 A;  3HOU G;  2RCN A;  3PUZ A;  1LYL A;  2Z6K C;  1N9W A;  1UE1 A;  1MKH A;  3STB C;  4YHH L;  2B63 G;  1E1T A;  5LMU L;  2Q2T A;  4FDB A;  3EN2 A;  1N32 L;  1UE7 A;  3A74 A;  4JBW A;  1GKH A;  1Q8K A;  2LSS A;  2GVA A;  3D0F A;  2BA0 A;  4DR2 L;  1XNR Q;  4IFD I;  1GM5 A;  2A1A A;  3EIV A;  2A8V A;  4KHP L;  2VNU D;  3U50 C;  1FGU A;  1FVI A;  1VQB A;  1D7Q A;  2E2I H;  4B3T Q;  2F4V Q;  2RF4 A;  3PIP A;  1VS0 A;  4A3E H;  4NXM Q;  1M90 C;  2F4V L;  1CKO A;  3OTO Q;  4DR1 L;  3E9I A;  2AMC B;  2WFW A;  3SGI A;  5IYD H;  1U5K A;  3RLO A;  2E8G A;  1I3Q H;  2N78 A;  4A3F G;  4QQB X;  5M3F H;  3UDF A;  3OW2 A;  3S2D H;  2JA8 G;  3F1Z A;  1EWI A;  3GTK H;  1IBK L;  4JI1 Q;  1X3G A;  2PNH A;  1EIF A;  2IX0 A;  3K0X A;  2I5L X;  1N33 L;  3CMA A;  3PUW A;  4JI3 Q;  5GAE C;  3DLL A;  4DUZ L;  4JYA Q;  4C2M H;  1QZH A;  1IBL Q;  2N3S A;  1HZC A;  1HZB A;  1HH2 P;  1YHA A;  4NPS A;  4YY3 L;  1SFO H;  4JBK A;  4L5R C;  3KLW A;  3PO2 G;  2GVB A;  4A93 H;  2ALY B;  3A5Z B;  3B6Y A;  3AYH B;  3F2D A;  3ZJY C;  4B3R Q;  4AQY Q;  3E9H A;  3ICE A;  4GNX B;  2OQK A;  4LF6 Q;  5GQO A;  3GD7 A;  2L15 A;  2PI2 A;  1N36 Q;  4BY1 G;  4WJ3 M;  1XJV A;  5C4X G;  2IHE A;  2OCE A;  5JEA J;  3JAM i;  4GNX C;  1YHQ A;  4DR5 Q;  5EAY A;  3TS0 A;  1UWV A;  2Q2I A;  3NEN A;  5FLM H;  4XTC S;  4JV5 Q;  4LW1 A;  2VQF L;  1KC8 C;  2JK8 A;  3G71 A;  1C7Y A;  2AKW B;  2R7D A;  4A3I H;  5IYB G;  3HOW H;  2AWN A;  4HIK A;  4MNO A;  1YHB A;  4DR3 L;  3CC2 A;  1PFS A;  1XNR L;  1PYS B;  3U4V A;  3M4O H;  1J6Q A;  2N8N A;  4NB3 A;  1WJJ A;  4DV0 Q;  4PG3 A;  3CCU A;  3FKI H;  2K14 A;  5IP7 H;  4OON A;  1NTG A;  2R92 G;  1N8R C;  5GAH C;  5IWA Q;  4LUO A;  3FHW A;  4B3T L;  4UY8 C;  3STB D;  4GNX A;  4NXM L;  3M85 A;  4BBS G;  3M4P A;  3OTO L;  3RN5 A;  1VQF A;  3TRZ A;  1YJN A;  2HQL A;  2JQO A;  3MXN B;  1VQ9 A;  3S2H H;  1B70 B;  3GDE A;  4OWT B;  2HT1 A;  4OXP A;  3TRE A;  2UUC L;  4POG A;  1X6O A;  1BVS A;  2JA7 G;  3HOY H;  1KRS A;  1CSP A;  1T9H A;  3T1Y Q;  2ASB A;  2HIX A;  5JJL A;  4K0K Q;  4GOP B;  1YIT A;  3S1M H;  3LGJ A;  1KIX A;  2XTI A;  5IY0 A;  1ASY A;  2NVT H;  3S24 A;  3RZO H;  4GOP C;  1MJC A;  1QVF A;  3S14 H;  3L0O A;  3CPF A;  5IYC H;  2MFI A;  4LWC A;  2CWA A;  1Q1B A;  4A3L H;  3HKS A;  2PQA B;  2VUM H;  4LF6 L;  1M1K C;  5ELO A;  3ULL A;  4IO9 A;  1GD7 A;  4JI4 Q;  2JA9 A;  1VQ4 A;  4LF8 L;  1KRT A;  1L1O C;  3CXC A;  4IJH A;  3Q8D A;  2CWP A;  4DV1 Q;  3J81 j;  2RHQ B;  3W1G A;  1X3E A;  2R6G A;  4HIO A;  2ZTD A;  3CCR A;  3TQY A;  1NMG A;  2CFM A;  3CC7 A;  1LUZ A;  4JV5 L;  4A3C H;  4DV3 L;  1I6H H;  5IT9 c;  1VQN A;  1E7Z A;  3M9B A;  4B3S L;  1PH1 A;  1IYJ B;  5GAG C;  4GOP A;  3KF8 B;  4LF9 Q;  3RLN A;  1A0I A;  5K36 G;  4JI5 Q;  1C0A A;  4A3G H;  3JAM c;  1MIU A;  1K8A C;  4LFC Q;  3K80 C;  4DV5 L;  1UE5 A;  1HZA A;  4LUZ A;  3HOU H;  5M3M H;  3L7Z C;  3I4N H;  4A76 A;  3CME A;  4GKK Q;  1YIJ A;  1TWF H;  5IWA L;  2K5V A;  3RNU A;  1S40 A;  1Q7Y C;  2PQA A;  4DUY L;  4TVA B;  3J81 i;  1VQC A;  2I5H A;  1TWC H;  4A3E G;  4LF7 Q;  1KXL A;  1HJP A;  1A62 A;  2BH8 A;  1HNX Q;  4JI7 Q;  4A3B H;  4R4O A;  1PV4 A;  2B3G A;  3UDX A;  5IYD G;  1VQG A;  1S3O A;  4P71 A;  5M3F G;  2D62 A;  1KL9 A;  2R93 H;  4JOI C;  2JA6 H;  1RL2 A;  1O7I A;  3ERS X;  3I55 A;  4DV7 Q;  2Q2U A;  2LXJ A;  1Q82 C;  1IBM L;  4DV4 L;  2CKZ B;  2K75 A;  2OQ0 A;  4QIW E;  4LFB Q;  1JMC A;  1J5E L;  5HGQ A;  1PH6 A;  1Y1W H;  4A93 G;  1YZ6 A;  4A4I A;  2JJQ A;  2NVY H;  4BA1 I;  4HJA A;  1XPR A;  3HOZ H;  2F52 A;  1VQM A;  1V43 A;  4EQ5 A;  3WWV A;  4GKJ Q;  1FJG Q;  2JA5 H;  2ZTE A;  1XMQ Q;  2R7Z H;  3I4M G;  5C0X J;  2NN6 I;  3I56 A;  4AYB E;  3CQZ H;  4X62 Q;  4X66 Q;  1SMX A;  1E24 A;  2UU9 Q;  4JOI A;  2Z0S A;  5IP9 H;  4JI6 L;  2NVX H;  5FLM G;  5JJK A;  4YWL A;  1A8V A;  1TXY A;  4YCU A;  4DPG A;  1Y14 B;  4A3I G;  3HOW G;  5C3E H;  3W5O A;  4JBM A;  4R1J A;  4JI5 L;  3KF6 B;  4OWX B;  4DK3 C;  2ZTC A;  1SE8 A;  3TEH B;  4LFC L;  4JI8 Q;  1GVP A;  2KBN A;  4APV A;  2NZH A;  4R4T A;  1PH4 A;  3K8A A;  3I4M H;  2YTX A;  3FKI G;  5IP7 G;  1VQE A;  5DLQ E;  4LF4 Q;  4IOA A;  2LXK A;  3CC4 A;  1QZG A;  1WCM G;  1K73 C;  2ATW A;  1DGS A;  4LUV A;  2IY5 B;  1HNX L;  1N34 Q;  1QVG A;  2WP8 J;  3K81 C;  4P75 A;  2E2H H;  1VQA A;  1PYB A;  1SRU A;  2IHF A;  4PZ6 A;  2KCT A;  1WI5 A;  4OO1 G;  3PO3 H;  2K50 A;  3HOY G;  4IPC A;  1SLJ A;  3TS2 A;  1I94 Q;  3H15 A;  3PCO B;  2DUD A;  4H02 A;  4IJL A;  3J81 c;  3CPW A;  2UXD Q;  1X56 A;  1E22 A;  1G29 1;  1X55 A;  2DGY A;  3KF6 A;  4LFB L;  4JI2 Q;  1IXR A;  2QGQ A;  1V1Q A;  1K8G A;  1VQO A;  4DV6 Q;  3G4S A;  1WCM H;  1VQJ A;  3BZK A;  2HIV A;  3W1B A;  1YI2 A;  1TWG H;  1G51 A;  4AYB G;  4OX9 Q;  2KHJ A;  5IYC G;  4IPH A;  2NVQ H;  4A3L G;  2BH2 A;  4GKJ L;  3I7F A;  3L2P A;  3GTO H;  1FJG L;  3J80 i;  2VUM G;  1CUK A;  3H0G H;  4L5S A;  2EXD A;  5M5Y H;  1NMF A;  2JE6 I;  3I4O A;  4X62 L;  4JCV E;  4X66 L;  5C44 H;  2VL6 A;  3EBE A;  3BJU A;  2CCZ A;  2ZJQ A;  1OXX K;  1OXS C;  4GN4 B;  4JI1 L;  1XPO A;  3KOJ A;  4C3I H;  2VQE Q;  1JE5 A;  4JG2 A;  3CCS A;  4DR6 Q;  4JI3 L;  1NBW A;  2ID0 A;  3E0E A;  5HY6 A;  4JYA L;  4A3M H;  2K5H A;  1IBL L;  3GTM H;  4DR7 Q;  4A3K H;  2Y0S E;  4QJF A;  2OTL A;  4A3C G;  1AH9 A;  3H3V H;  4DR4 Q;  4GLX A;  4C3J H;  5BR8 Q;  2OTJ A;  1VCI A;  1X9N A;  1PH5 A;  1Y1V H;  5AJ3 Q;  3M3Y H;  1CKM A;  4A3G G;  4JI8 L;  4GLV B;  4X64 Q;  4O2D A;  3CCJ A;  4AQY L;  4RMF A;  3T1H Q;  3HOX H;  2UUB Q;  3HOV H;  1TWH H;  4B3R L;  2UXC Q;  2N49 A;  5M3M G;  1N36 L;  4QGU A;  3I4N G;  2K4K A;  1SRO A;  1BBU A;  2WB1 E;  4DV2 Q;  4OO1 I;  1BBW A;  1N32 Q;  3RN2 A;  4DR5 L;  2UUA Q;  1IL2 A;  2E5L Q;  3K7U C;  1PH9 A;  4O0A A;  4A3B G;  3CCQ A;  4OWW B;  3UE0 A;  4R4I A;  3FP9 A;  1XPU A;  1WYD A;  2MQH A;  1VQP A;  3J7A 5;  2R93 G;  3PGZ A;  1I94 L;  2JA6 G;  1AE2 A;  3CCL A;  4NXN Q;  1KD1 C;  2ZJP A;  2UXD L;  1VQL A;  4DV0 L;  2C35 B;  1K0R A;  4YWM A;  3F2B A;  1YJ9 A;  2HHH Q;  2VZA A;  4DV6 L;  1ASZ A;  4OX9 L;  2WAQ E;  4A3J H;  2D0P A;  5C0X G;  1V9P A;  1TWA H;  1Y1W G;  3G48 A;  1MJE A;  3S1Q H;  1C9O A;  4A3D H;  2AHO B;  4XIG S;  3PIO A;  1N33 Q;  3HOZ G;  4P73 A;  3VDY A;  2UXB Q;  4DUZ Q;  2JA5 G;  2R7Z G;  4GN3 B;  2KHI A;  3CW2 C;  1E3P A;  4POF A;  1D8L A;  2JEB I;  2CQO A;  2Y0S G;  2BA1 A;  4HJ8 A;  4IPG A;  3T1Y L;  3M4Q A;  2YV5 A;  3CD6 A;  5IP9 G;  4K0K L;  1JJ2 A;  3AFQ A;  1JJC B;  4TQU S;  3S16 H;  4BBR H;  1HR0 W;  4DR7 L;  1NE3 A;  1VQH A;  3HKZ E;  4DR4 L;  3J80 c;  4HJ5 A;  4IFD J;  5C3E G;  1UEB A;  1WOC A;  4KHZ A;  3ULJ A;  1HR0 Q;  2WB1 G;  3T1H L;  1RIP A;  5JEA G;  2UUB L;  2IX1 A;  1QVC A;  5IE8 A;  3GTQ H;  3M7N A;  2UXC L;  2VY3 A;  1W2B A;  1OXV A;  2ZM6 Q;  4JI4 L;  4BXX H;  2B29 A;  1P8L A;  3UE1 A;  2VQF Q;  1K9M C;  1K83 H;  2KEN A;  4DV2 L;  4QL5 A;  3GTJ H;  4DV1 L;  1VQ8 A;  1NY4 A;  4DR3 Q;  2UUA L;  1YEZ A;  2E5L L;  4R4Q A;  5LMN W;  1QUQ B;  1JJG A;  1PVO A;  3RLF A;  3RR5 A;  3CF5 A;  3DM3 A;  5E7N A;  4YWK A;  2YYZ A;  5FJ8 H;  1B8A A;  1Q86 C;  2PI2 E;  1XTD A;  2YTY A;  5FLX c;  3PF5 A;  5LMN Q;  4LF9 L;  1OXT A;  1OXU A;  3PO3 G;  1KHI A;  5C0X I;  2R7F A;  1VQ5 A;  1Z9F A;  4BY7 H;  1L0W A;  4NXN L;  1Q81 C;  2WAQ G;  3A0J A;  4LF5 Q;  3AQQ A;  3F8T A;  1VQI A;  3PUY A;  4UP7 A;  1S72 A;  1SN8 A;  3AFP A;  1PH7 A;  3J7Z C;  5M5W H;  4GKK L;  2Z6K A;  2HHH L;  1Q1E A;  2IT1 A;  3U58 A;  3A5U A;  2EIF A;  3RZD H;  1EQQ A;  2B63 H;  2UUC Q;  1XNQ Q;  1HNW Q;  3NEL A;  3KJO A;  4LF7 L;  4X6A H;  1JB7 A;  2H5X A;  1KAW A;  2I0Q A;  1YVC A;  4JI7 L;  3KFU A;  2UXB L;  4LNQ A;  1FL0 A;  3GO5 A;  4ALP A;  4HID A;  3H0G G;  2E2J H;  3U4Z A;  3ULP A;  2JEA I;  2EQS A;  1QUQ A;  1EIY B;  1Q46 A;  2FXQ A;  5C44 G;  3HKZ G;  1VQ7 A;  1P16 A;  4JC0 A;  4IPD A;  1EOV A;  4LFA Q;  4A75 A;  1I50 H;  1X54 A;  4X65 Q;  3PUV A;  4DV7 L;  4P74 A;  4Y7N H;  5H1S E;  3KJP A;  4A3M G;  3MEF A;  1L2F A;  3UDG A;  4A3F H;  4A3K G;  1PH8 A;  4B3M Q;  3CCE A;  4LF8 Q;  5C4J H;  3IRB A;  2YTV A;  4R4C A;  2JA8 H;  2MNA A;  1HR0 L;  4WJ4 A;  1NJI C;  3G6E A;  1Y1V G;  4L5Q A;  4HJ7 A;  3NBH B;  4DAM A;  3HOX G;  2ZM6 L;  3HOV G;  1XMQ L;  1HNZ Q;  4ME3 A;  4DV3 Q;  4GN5 A;  3CAM A;  3BZC A;  4GS3 A;  4B3S Q;  3PO2 H;  1K3R A;  2VW9 A;  1XMO Q;  2UU9 L;  1BKB A;  1LTL A;  4DK6 C;  2GN5 A;  4DNI A;  3PSI A;  3CCM A;  1PA6 A;  1CSQ A;  4RG1 A;  4JI0 Q;  5M5X H;  3JC6 6;  4DV5 Q;  1VQD A;  3ER0 A;  3BU2 A;  4UPA A;  4BY1 H;  5C4X H;  5LMN L;  4C3H H;  3GTG H;  2K5N A;  2QEX A;  3F2C A;  3I2Z A;  4DUY Q;  1CKN B;  1UE6 A;  4GLA C;  4KI0 A;  4Y52 H;  4LF5 L;  1H95 A;  4YCV A;  1GO3 E;  4DKA C;  1EYG A;  2MO0 A;  2XGT A;  3CP0 A;  1PHJ A;  4LF4 L;  2K52 A;  3PV0 A;  1U0L A;  2I5M X;  5IYB H;  2VS1 A;  4YHH Q;  1XNQ L;  1HNW L;  1A63 A;  5LMU Q;  4A3J G;  2ES2 A;  1Z47 A;  1EUJ A;  1X3F A;  4A3D G;  2MO1 A;  4IOC A;  4DR2 Q;  1N34 L;  1YNX A;  4UP8 A;  4DAY B;  1R9T H;  3HFZ B;  2R92 H;  1G6P A;  4HIM A;  3CCV A;  3S1R H;  1IBM Q;  4PMW A;  4DV4 Q;  4KHP Q;  1LM0 A;  3H3V I;  1J5E Q;  4LFA L;  4BBS H;  2Q2H A;  5GRO A;  4X65 L;  3S15 H;  3OYY A;  4MZ9 A;  3KDF B;  2AWO A;  4IFD G;  1WFQ A;  1E1O A;  3K7A H;  4MTN A;  1L1O B;  4PZ8 A;  5J3B A;  4DR1 Q;  2YU9 H;  4BA2 I;  4BBR G;  4B3M L;  1CKN A;  4JI2 L;  1YJW A;  1Q12 A;  1PH2 A;  2A19 A;  1B7Y B;  3D31 A;  3PF4 A;  2JA7 H;  4L5T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...