2VUMG

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 26
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vumG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2vumG01
4JBJA 2K75A 3ER0A 4R4QA 3Q8DA 3CCLA 5HGQA 4IPGA 4B3MQ 2Q2HA 2B63H 2R6GA 4DV1Q 4LF8Q 5GAHC 2ID0A 3U58A 1NBWA 1E1TA 2BH8A 2V1CC 1NTGA 3GO5A 4OX9Q 4A3LG 1RL2A 4DR6L 3J80i 3UE1A 4JI7Q 2D0PA 1N36Q 1A62A 3HKSA 4AQYQ 4H02A 1HNZQ 4APVA 4YCWA 1GD7A 4A3IG 4LUZA 1M90C 4ME3A 2ZJQA 4A3KH 4OXPA 4JYAQ 2EXDA 3F2DA 1Y14B 2PNHA 1KD1C 3KJPA 2VS1A 4B3SQ 1S72A 2IX1A 4A3MG 5LMUL 4DV0Q 1TXYA 3AEVA 5BR8L 2MNAA 4P73A 4QL5A 4NPSA 2NZHA 1R9TH 1Q1EA 1CKOA 3DLLA 4DUZL 2QGQA 3HOXG 1XMOL 1PYBA 3HOYG 4DR6Q 5IP7H 3PF4A 2L15A 1YI2A 5FJ8G 1UWVA 3K0XA 3L7ZC 1Q81C 2KENA 3GD7A 3K8AA 1L1OB 5M3MG 1KC8C 1UEBA 4K0KQ 4IPCA 4FDBA 4B3ML 2ZTCA 1MIUA 2RHQB 1M1KC 2IHFA 4TVAB 3T1YL 2I5LX 1NY4A 2UUCQ 2NVQH 3GTMH 3H0GG 4DPGA 4A93H 2VQEQ 3ULPA 2JA8G 4BY7G 2HIXA 2XTIA 5AJ3L 1WYDA 5LMNW 2OTJA 4R4CA 1TWFH 1FJGQ 2KCMA 5HY6A 2OCEA 3D0FA 4LFAQ 1SMXA 1VQLA 2E2JH 1K83H 1Y1WH 4IFDI 4L5SA 3I7FA 3HOUG 1CSPA 3CAMA 1IL2A 2HQLA 1WOCA 3PUWA 2DGYA 2WFWA 2Y0SE 4B3TQ 3CCUA 2AHOB 4DR1Q 1VQ4A 3HOZG 3CCJA 5IYBG 5GAEC 2R7DA 2K52A 5H1SE 3CC4A 3TS0A 4JBWA 4GLVB 4MZ9A 5IP9G 1H95A 4KI0A 3M85A 3S24A 3BU2A 4A3DG 1OXTA 1V43A 3PF5A 5GROA 5GQOA 1IBKL 1QUQA 2VUMG 5C4JH 1GM5A 3M4PA 1N33L 2Z0SA 3CPFA 3J81c 5JEAJ 3RN2A 1EIFA 1KRTA 4GKKQ 4IOAA 1HR0Q 4POGA 4JYAL 4JI0L 1EIYB 3CPWA 1TWHH 3SGIA 2OWOA 4B3TL 1VQNA 4IPDA 4YCUA 3HOUH 4LW1A 4AH6A 3D31A 4A75A 1SE8A 1HNZL 1KL9A 4EQ5A 3CC2A 1N36L 1VQBA 4GN5A 1YJ9A 3M3YH 5E7NA 5C0XI 4JV5Q 2CWPA 1FJGL 2ALYB 3S1RH 3ICEA 3I4MH 2IY5B 4PZ7A 5J3BA 4X64L 2H5XA 4A3CH 5GADC 3K7UC 1EQQA 3S1MH 4JI4L 4A93G 1XMQL 2JA6G 2UU9Q 3T1YQ 2N8NA 4GNXB 1I5FA 1Z9FA 4GOPB 3CMAA 4OO1G 3RLFA 4DV2Q 1E3PA 2YV5A 2XGTA 5FJ8H 4DV3L 3S15H 5IP7G 4LF7L 5LMNQ 1W3SA 3J81j 3PGZA 3OTOL 3F2CA 5BR8Q 1QZGA 2KCTA 3CF5A 1VQKA 2MFIA 2F3IA 2Q2UA 3GTQH 4BBRH 1VQ8A 2ZTDA 4IJHA 4DV5L 2A8VA 3BZCA 2JA6H 2UXCQ 1XPUA 1OXSC 1VCIA 2WP8J 2RF4A 1PH1A 3EN2A 4C3IH 1N9WA 1PH6A 1D8LA 2K5NA 2JEBI 4JI5L 1AE2A 1I94L 4KLKA 4A3CG 4OONA 4BXXG 3I2ZA 3RN5A 3CCEA 4JOIA 3UDXA 1IBLL 4QIWE 3I56A 2WB1G 1KAWA 1ASYA 3PO2G 3HKZG 1K3RA 1UE1A 4YWKA 1HNWQ 1P8LA 5C0XJ 2ZJRA 4DR4Q 1IZ6A 2R92H 1QVGA 1JB7A 4OX9L 3NEMA 4OWWB 4EX5A 3RR5A 5FLXc 1EFWA 5M5XH 3KLWA 2UXDL 1VQJA 3H0GH 3GTGH 1PH3A 1K0RA 3UDIA 1YNXA 1Y1VG 4DV5Q 4DR2Q 5IWAQ 4JI5Q 2IX0A 4DR5Q 1I94Q 2UXCL 2UXBL 2K14A 1Q8KA 3S16H 4DR3Q 3HOVG 5C0XG 2NVTH 1EYGA 4BY1G 1UE6A 2HIVA 1K8AC 2UUBL 3OW2A 1Q12A 1X56A 3H3VI 2CKZB 1BBWA 2IT1A 2CWAA 5IP9H 3PSIA 1D7QA 2OQKA 4LF4Q 2OQ0A 2B3GA 2RHSB 5ELNA 3PO3H 3RNUA 3KYHC 3M4OH 2QEXA 1HJPA 2PMZE 4X65L 1VQOA 1A63A 3PUVA 4C2MH 2D62A 2DUDA 5EAYA 2JJQA 4QQBX 4OO1I 3I4OA 2Z6KC 1Y1VH 3K80C 3RZOH 1EQRA 3CC7A 4X64Q 1VQAA 4WJ4A 1LM0A 2LXJA 4DKAC 2VQFL 3L0OA 4A3EG 1XJVA 2HHHQ 1HNWL 3F1ZA 4PMWA 3M9BA 1KHIA 3MEFA 4X66L 5FLMG 3AFPA 1VQEA 1T9HA 3PUXA 4C3HH 5FLMH 4JV5L 4DUYL 4LF9L 2WAQE 4A3EH 3A74A 5IY0A 2VZAA 2A19A 3CCRA 1VQMA 3BJUA 1IXRA 3GTLH 4DK6C 2E2HH 3B6YA 1LYLA 4JI1L 3UDGA 4NXNL 4R4TA 1L0WA 4AYBG 1EOVA 4JI0Q 4JI6Q 2JA5G 3GTJH 1X65A 3AFQA 1WCMG 2NZOA 2VUMH 3PO3G 4QJFA 1W2BA 1NMGA 3HOXH 1L1OA 1QVCA 4IO9A 4DV3Q 5IYCH 3K81C 1JT8A 1EUJA 2JEAI 2PI2A 4BY1H 4JBKA 4B3RQ 4R1JA 1NE3A 4X6AH 3K7AH 3OYYA 1WCMH 3UDFA 1K8GA 1B8AA 4DV2L 3HOZH 1SN8A 1WI5A 4A4IA 1BBUA 4JI4Q 1E1OA 3GTOH 1SRUA 1PV4A 3WWVA 1K9MC 1XNRL 4JBMA 2VL6A 1CKMA 1I3QH 1G291 2ZM6L 4IJLA 4JOIC 5IYDG 1E7ZA 5M3FH 1VQIA 4JI3Q 1C0AA 1CSQA 3KF8B 4LFAL 2VY3A 4IPHA 1QZHA 4MNOA 4OWXB 5AJ3Q 3I4MG 5IYDH 4A3DH 3G48A 4KHPQ 1MJCA 3PIOA 4BA2I 1SROA 1I6HH 2K4KA 2ZM6Q 2F52A 4DV6L 2VQEL 4O2DA 3JAMc 4BXXH 3VDYA 4GKKL 4KHZA 3PCOB 1JJGA 5M5WH 4J15A 4P75A 1JMCA 1N34Q 1J6QA 1RIPA 3J7A5 4K0KL 4BBSG 5IE8A 1YEZA 3IRBA 4B3RL 5K36G 5C44G 1PH2A 4DK3C 3FKIH 3PIPA 4PZ8A 2ZJPA 1B7YB 3H3VH 2BA1A 4GN4B 1IBKQ 1XPOA 2RCNA 2ASBA 4A3MH 4DUZQ 1AH9A 1YZ6A 3TEHB 2PI2E 3S17H 2VNUD 1G6PA 3FP9A 1YIJA 1N32L 1VQCA 4DR1L 3AQQA 3NENA 1OXXK 4A3BH 1KXLA 2MO0A 1WJJA 1CKNA 3CMEA 4JI6L 4NXNQ 1U5KA 1S3OA 2WB1E 4JI1Q 5IYBH 3RZDH 2LXKA 1AE3A 3G71A 4DAMA 2C35B 2K5HA 4UP7A 1PH5A 2E5LQ 4JI7L 1B70B 4DAYB 4KHPL 2N3SA 2A1AA 1ASZA 1Q7YC 4AYBE 2KHJA 5JEAG 2ZTEA 1YVCA 1C7YA 3PO2H 2HHHL 3CP0A 4UP8A 4LWCA 2B29A 3H15A 1XNRQ 2R7ZG 3CXCA 2GVBA 2JQOA 1JJ2A 4DV7L 4DV1L 2AWNA 4GNXC 4GOPC 1FL0A 4NB3A 2UUCL 1CUKA 3S1QH 3KDFA 1N8RC 4LNQA 1X6OA 4GOPA 4A3FH 5M3MH 4GS3A 3STBD 3W1GA 4HJAA 3ERSX 2CQOA 2MQHA 1PH8A 2Q2TA 3I4NG 2K50A 2YTVA 3BZKA 3CW2C 5LMUQ 4DV0L 5DLQE 4YWLA 4DV4Q 1VQPA 1SFOH 1VQ5A 2E2IH 4LF6Q 2ATWA 2F4VQ 5C3EG 3HOVH 2HT1A 2R93G 3FHWA 4RG1A 3I55A 2PQAA 4JCVE 4HIMA 4BA1I 1KQSA 1FGUA 4HIOA 1I50H 5C4XG 3J7ZC 1HZ9A 4R4IA 1YHBA 1MJEA 2UXDQ 1Q82C 1N32Q 1VQFA 2KBNA 5M5YH 5C3EH 5GAGC 4DUYQ 1NMFA 2NVXH 4A3IH 2F4VL 2JA7H 2R92G 1VQGA 3KOJA 3CCSA 1E22A 1HZCA 4JG2A 3HOWG 4QY7A 3A5UA 1X3GA 4YHHL 1NJIC 4WJ3M 1Q46A 2JE6I 1Q1BA 3TQYA 4LF8L 2N78A 1HZBA 2AMCB 1YJWA 1X55A 3S1NH 4BY7H 1L1OC 3S2HH 4UPAA 1MKHA 2EQSA 4O0AA 3ULJA 4X65Q 1BVSA 4LF5Q 4DV7Q 2FXQA 4NXMQ 2N49A 4BBRG 4A3GH 4L5RC 1C9OA 4JI8L 1X3EA 4DV6Q 3U50C 3EBEA 1OTCA 4XIGS 4JC0A 4P71A 3OTOQ 3HOWH 3S2DH 3JAMi 1P16A 2YTYA 1SLJA 1YHAA 4OWTB 1E24A 4R4OA 4HJ5A 1HNXQ 2E5LL 1PFSA 5IT9c 2BA0A 3GTKH 3W1BA 4HJ8A 3GTPH 2Z6KA 2QA4A 1VQHA 1VS0A 4LFBL 4DR7L 1HH2P 3CD6A 4L5QA 4DR2L 1LTLA 1XNQL 2UU9L 3T1HL 2YTXA 4A3BG 1TWGH 2AKWB 4C3JH 1CKNB 3KFUA 1HR0W 3PV0A 3CCMA 3STBC 2NVYH 1PVOA 3RLNA 1Y1WG 1J5EL 4GKJQ 1PYSB 3KF6B 3G6EA 4PZ6A 2UUAL 1QVFA 3TRZA 1TWCH 1G51A 4YY3L 1K73C 1YBYA 3FKIG 1A0IA 1BKBA 4PG3A 1IBLQ 4P72A 4A3JG 1IBMQ 4A3LH 3TS2A 3J80c 1N34L 2JA8H 2I5HA 3JC66 3PUYA 3AYHB 4JI2L 2GVAA 3DM3A 1OXVA 4LFCL 2CCZA 4IFDG 3KDFB 1HR0L 4Y52H 4GN3B 1PH4A 4X62Q 3MXNB 2JA9A 5ELOA 4JI2Q 1DGSA 3S14H 1N33Q 4L5TA 3PUZA 4DNIA 4TQUS 4Y7NH 4HJ7A 2UUAQ 3GDEA 3W5OA 1TWAH 5JJLA 3TREA 4X66Q 4LF7Q 2Q2IA 4JI3L 1PHJA 5M3FG 2NN6G 1SR3A 2WAQG 3A5ZB 4YY3Q 1PA6A 1PH9A 2JA7G 1UE5A 2VQFQ 4GKJL 3E9HA 4YWMA 1XNQQ 4IFDJ 1VQ6A 1OXUA 3RLOA 4A76A 1U0LA 4LFBQ 4HIKA 1XMQQ 1LUZA 2PQAB 4XTCS 1GO3E 1HZAA 2LSSA 4GLAC 4YCVA 2ES2A 4AIMA 4IOCA 4DR7Q 4QGUA 4LF4L 4P74A 1VQ7A 2MO1A 1FVIA 5IYCG 4GNXA 1S40A 2UUBQ 5C44H 2Y0SG 3HFZB 4LF5L 1Q86C 4LFCQ 2UXBQ 4X62L 2K5VA 4DR5L 1GVPA 3F2BA 1JE5A 4LUOA 3CCVA 2R7ZH 3A0JA 3G4SA 1IYJB 1A8VA 3M4QA 2YYZA 3U4ZA 1JJCB 3NBHB 2JK8A 4LF9Q 3NELA 1L2FA 1YJNA 1QUQB 2I0QA 1IBML 4YHHQ 4A3JH 4DR4L 2AWOA 1XMOQ 3HOYH 1J5EQ 2I5MX 1X3FA 3LGJA 4HJ9A 1Z47A 1EWIA 3E9IA 1O7IA 2R7FA 5C4XH 1XPRA 4UY8C 3E0EA 2CFMA 2VW9A 4B3SL 1GKHA 4ALPA 2YU9H 2IHEA 1KRSA 3HKZE 5JJIA 1PH7A 4HIDA 1X54A 4A3KG 3T1HQ 1V1QA 2KHIA 3ZJYC 4GLXA 3J81i 3L2PA 2EIFA 2GN5A 1YHQA 4POFA 2R93H 1VQDA 2D0OA 3F8TA 3UE0A 1WFQA 4LF6L 1HNXL 3M7NA 4DV4L 4AQYL 3I4NH 3EIVA 5JJKA 1VQ9A 2NN6I 3ULLA 2OTLA 3CQZH 1UE7A 5LMNL 4UP9A 1YITA 4JI8Q 4A3FG 1X9NA 3CCQA 2E8GA 4BBSH 3KF6A 4LUVA 4RMFA 1KIXA 4DR3L 1XTDA 4NXML 1V9PA 4MTNA 3KJOA 2JA5H 2BH2A 4A3GG 2B63G 3U4VA 5IWAL
chains in the Genus database with same CATH superfamily
4JBJA 4R4QA 5KFKA 3K5IA 3Q8DA 4XYQA 1E2ZA 1QOHA 2B63H 4B3MQ 2Q2HA 3T56B 1H9MA 3R3OA 1KJ9A 1PLFA 1FGBD 2GLTA 5GAHC 2ID0A 3U58A 1NBWA 1E1TA 2IMWP 1CHQD 2QDLA 2CH4W 4ME5A 1SYXB 1M0TA 1ZEQX 4BY7B 4DR6L 1R9TA 3L3OC 2XGPA 1STEA 1U4PA 1EZ6A 1V8QA 5CV5A 3N43B 2FFKB 2WDTA 2YW2A 4C5AA 4J9SA 4OXPA 3A7LA 2PNHA 5IODA 3KJPA 3GTMB 1BCPF 1XYIA 5LMUL 4DV0Q 2E2IB 4X66H 1PZKD 4P73A 2X0SA 2NN6H 3I12A 1SYFA 1E4FT 1D7QA 1BO0A 2ZT9C 1KNAA 3BVMA 4FS2A 1MBYA 2L15A 1YI2A 5FJ8G 3FMAA 3K0XA 3MTSA 3RF2A 1KDAA 2B2VC 5M3MG 1KJQA 5LOVF 1L1OB 3V2TA 3OUUA 5T1GA 1KJJA 2ZTCA 1MIUA 1PRTC 2NVQH 3BVGA 1NY4A 3P75A 5KG7A 4ED8A 1EIHA 4A3JB 5FPRA 4J0MA 2C2RA 5CV6A 3EVQA 5LMNW 2OTJA 4YR2A 4UAIA 1FJGQ 5HY6A 1BQQT 1B50A 1W6KA 3D0FA 1SMXA 1VQLA 1Y1WH 2CW0C 2FPGB 5KT3A 4QWCA 4B3TQ 2Z9HA 1WVLA 1RD9D 2PQEA 3CCJA 4ODGA 4DUYH 2R7DA 3D6WA 5EQ0A 2YZGA 4DV1H 1LACA 2ZXRA 1U9RA 4GLVB 5IP9G 3JSNA 2RGRA 2XC9A 3M85A 1X32A 3KHLA 2OXPA 3OSOA 3P1HA 3S1QB 4Q0YA 5ELBA 3PF5A 2ASDA 1EWHA 1IBKL 1N48A 1GM5A 3SVMA 3CPFA 3J81c 4DL5A 3RN2A 2NU6B 4I7AA 4F7XA 3SHLA 4JYAL 2Z4HA 4JK1C 4QW9A 1I4HA 3CPWA 2EY5A 4Y8VB 2K1BA 4RCOA 1ZETA 1SE8A 1HNZL 3QO2A 1OWTA 3CVZA 4EQ5A 4LH7A 1YJ9A 3NQIA 5E7NA 2DJFC 2CWPA 4O1NA 2V58A 5DLGA 2AGPA 1GJXA 5GONF 3S1MH 3DMUA 4JI4L 3KAKA 4A93G 2VUMA 3J7YW 3KLSX 3GQCA 4OX9H 4B9XA 2E2IA 1UUPA 3KF8A 3RLFA 4DV2Q 1EQVA 2V9WA 4R8UB 5DLFA 1STBA 1SXTA 5IP7G 1LT3D 5F2DA 2K05A 3J81j 4EEQA 5IGGA 4CDCC 1RTOA 3GIIA 1L2ZA 1CZWA 2Z1CA 3F2CA 2D9UA 3CF5A 3PIO3 1QCBD 4G7HC 5C8YF 2LMCB 3SK6A 4JI0H 3D6CA 4KHPH 3KHHA 2A8VA 2JA6H 2R7MA 1LT4D 1VCIA 4OIJA 1K3BC 3EN2A 1PH6A 1I94L 4OGQC 3S1NB 1AE2A 4A3CG 4BXXG 4PMBA 3UDXA 1O75A 4QIWE 3KHGA 3TINA 2WB1G 3IAYA 1ASYA 4QWBA 3HKZG 1K3RA 4BS9A 4YR0A 1HNWQ 1Y1WB 1CK1A 1SNDA 1QVGA 4OX9L 3NEMA 4RUAA 1EUDB 4EX5A 2JEJA 2O2LD 3EFXD 1STAA 3GTGH 3RUPA 1K0RA 1YNXA 4JI5Q 4DV5Q 3I4NB 2UXCL 3ETJA 2IX0A 4RGMA 3KBGA 4JI1H 4RHRA 3G6VA 4J9MA 2NTSA 1EYCA 4K8JA 4LSAA 5HURA 1UE6A 1X3QA 1K8AC 1TWGB 4HMJA 5FD5A 4XXEA 5KFQA 2C5CA 5K36H 1IHZA 5ELNA 5A2QW 2F0QA 5EGTA 2H4OA 5T14A 2EYOA 2WYOA 2QEXA 4GC6A 3MR3A 1VQOA 1V51A 1PTOF 3PUVA 4OO1I 1XNRH 2HQEA 3RZOH 5KG5A 1EQRA 3GIQA 4J9RA 4X64Q 5KG0A 2DZDA 3MFIA 2IPKD 4CBVA 1DV2A 2B2WC 3VR6A 3C1EA 1HCZA 2W70A 3DHQA 3PUXA 4H44C 4JV5L 1K28A 5IY0A 2Z6BA 4Q8FA 2KHSA 4DK6C 4FXKC 2E2HH 2AGOA 3IL8A 3K3VA 2HDMA 1C4QA 4UCOA 4P2CB 1PFBA 3LWEA 4R4TA 3BVZA 4AYBG 1EOVA 3Q8RB 2VB2X 2PN1A 2VUMH 3R5FA 2XCAA 3PO3G 1NMGA 5FO7B 4A3FB 3JSLA 1AUVA 5IYCH 5EPJA 3C3LA 1EUJA 4BY1H 2KCNA 1K1SA 4B3RQ 4R1JA 2B2UC 2RKSA 4KHVA 1IW7C 3UDFA 3GTGB 1K8GA 1B8AA 4DV2L 1HNWH 1SN8A 4JV1A 1BBUA 1PRTB 4IUQA 1A6XA 4C1NK 1PV4A 5LP6F 1RDPD 4O3OA 2ZM6L 1HFGA 1MHWC 4KD3A 5CB4F 4KJNA 4AQYH 5LMUH 1T36A 2YS6A 2PZUA 4KHPQ 1IYUA 3SDZA 3PIOA 3VYRA 1VBGA 4TV9F 5KNCA 4F4WA 2F52A 4PDBA 4O2DA 1V4YA 4RGOS 4FF2A 2UVWA 1WTQA 3AU7A 3G6YA 2UVRA 4J1MA 5CAEB 1JMCA 3VPCA 4KV6A 1J6QA 2YCHA 4U6PA 4WJWA 1ONLA 4NMZA 3V05A 3IRBA 4XT1B 5K36G 3PIPA 4PZ8A 2K32A 4GN4B 1IBKQ 1C8CA 4JW0A 2NB0A 1XPOA 2R7ZB 1VAJA 1EFID 4CC5A 2ASBA 1AZPA 3EA6A 3J7AV 3S17H 5DG8A 2VNUD 3Q8PB 5IWAH 3NENA 4MV3A 2R8IA 3PVXA 4NXNQ 2EYLA 4QWDA 3CMEA 1HNZH 1S3OA 1F2YA 4ZAIA 1AEXA 2PW7A 4MA5A 4FM9A 1MSGA 2LXKA 4DNRB 2ZDQA 4IR9A 2M9VA 4JI7L 5C3EB 2WINB 4LF4H 4ZHQF 4AYBE 4A3MB 2ZTEA 3T4AC 1C7YA 2V4QA 3CP0A 4LWCA 2K6AA 1S5CD 1RJRA 4Q45A 1XNRQ 2R7ZG 3CXCA 2GVBA 1ZYRD 3CQZB 2SCUB 4C3IG 4DAVA 2R7KA 3S9WA 1BGWA 5H80A 4IWYA 3S1QH 3MR5A 3A54A 4A3FH 2PZTA 5M3MH 1WH2A 3Q8QB 3I73A 1S10A 3K0YA 2CQOA 2MQHA 3I4NG 3CCLA 3BZKA 2K5WA 4A3DH 3OW7A 1CE8A 2ATWA 3PN1A 5C0XH 1S0NA 4LF6Q 5C3EG 1H9RA 2HT1A 3I55A 4O3SA 3Q22A 1LTGD 1JIHA 2E74C 4X3TA 1VKZA 1CT1D 1ZYRC 3DXJC 4F87A 2E2JB 3J80E 4YB8B 1HZ9A 2RSNA 2UXDQ 5C3EH 1NAPA 3UI2A 5GAGC 4A3GB 2NVXH 2JA7H 4A3IH 5EZYF 1WTXA 4LAAA 4JG2A 1E22A 2A73B 3MJFA 4MHEA 1GOZA 4L6TB 3M4OB 3GTJA 2I07B 3T16A 3TQYA 5KKNB 3ZYYX 4L63B 5LA6F 3TSSA 4Q0FA 1X55A 5C44B 3H09A 1WD0A 1L1OC 4DA2A 4DR7H 1HA5A 5J39A 1O7LA 4MV8A 4O0AA 4EBEA 4DU9A 3MWEA 1XX8A 2K01A 4MV6A 2F3VA 2JN4A 2PZWA 3HS0C 5CV7A 2FE3A 1JX4A 2N49A 2WKDA 4XYMB 3F8NA 4ETSA 1Y8NB 2UVUA 3EBEA 4F4YA 3TP5A 4P71A 1W6JA 1I7LA 3A7AB 4AYBB 3PW7A 4C2MB 4BWGB 2EYMA 2LFNA 4C2MA 4K5VA 1K8MA 3GTKH 2KECA 4J9LA 1R4PB 3M3YB 1YNJC 1PZID 2QA4A 2NVXA 1VS0A 3X3NA 4ID6A 4UDUC 5EJWA 2C2EA 1EYAA 3T1HL 1TWGH 5C5JA 1CKNB 2I8CA 5M3MB 3VMMA 2SOBA 4ULLA 1CQJB 3BJYA 3CCMA 4B3MH 1Y1WG 3OWEB 4GKJQ 2FKLA 2PVPA 3CHBD 3W3AA 1II3A 4YY3L 3WO1A 1YBYA 3NXWA 1A0IA 3E5SA 5D3IB 5LMNH 4PG3A 3V4SA 4MA0A 5DQHA 1Y1VB 1YNNC 3X3MA 2J4XA 2XNAC 3BZDB 1OXVA 1S5ED 1HR0L 4Y52H 3EPIA 4XT3B 2ZJTA 4A3IB 2JA9A 1UC9A 2K04A 5CMDA 2UUAQ 3W5OA 3HOZB 5JPNC 3RB6A 2Q2IA 2R61A 4JI3L 1PHJA 2NN6G 2JA7G 4F8MA 3OWFA 3E9HA 4YWMA 1GHKA 4DR4H 2F1MA 4QIWA 1U0LA 1LUZA 1TR5A 2PQAB 4GLAC 4RZQA 4IOCA 2FLPA 4JUZA 4DXFA 2EYFA 3NHHA 4LF4L 4LF5H 5DGAA 1FVIA 1G91A 3L9AX 1SYBA 1S40A 5F9LA 1KEEA 4RAUC 2J7ZA 1GGOA 3QR8A 2FMAA 5HGTA 2XN9C 4G3IA 2Y0SB 1IKMA 1Q86C 4DK1A 2K5VA 3ORQA 2EJMA 4Q43A 1FR3A 4CKEA 3PO3B 4IRKA 3M4QA 3U4ZA 4R7RA 3NELA 2I46A 4YP3A 1IBML 4A3JH 1EEFD 1XMOQ 4RB0A 4C3IB 1DXMA 3HOYH 1TWFB 3LGJA 5I6YA 5KFPA 1Z47A 3E9IA 5BN5A 1O7IA 2R7FA 3R2TA 2VPSA 4IUVA 1BCPC 4UY8C 2XIWA 3E0EA 5I4DA 4FF3A 4ALPA 2KQ3A 2IHEA 2B2TA 5JJIA 1PH7A 4GC7A 2B8GA 2AQ2B 5JVG3 2RDFA 1YHQA 3K59A 4POFA 4ED7A 1A15A 3UE0A 2BCOA 3RBDA 4CDEC 1BOSA 4EQOA 3TQ1A 4U673 4EG0A 5JJKA 2F0MA 2EOTA 2OTLA 1GSOA 4TUYF 2ZM6H 1ZKOA 3KF6A 1JR0D 1BDOA 3JAMW 1V9PA 4CKBA 2JA5H 2BH2A 1I50A 1IKLA 4L1KA 2ICIA 4C3HB 5IWAL 4QCLA 4IRDA 2K75A 1AUXA 4KY5A 1CA6A 3HBLA 4IPGA 3Q8SB 1FNUA 4UCRA 1LT6D 3OMGA 5KEEA 2R6GA 2DLNA 1PXUA 3M9MB 2JP1A 1NTGA 4OX9Q 1CQFA 1J9OA 2RCFA 4LFBH 1RL2A 5BN3A 5LL6S 3J80i 1GUTA 3UE1A 3N6RA 2K7VA 3QJYA 1G6ZA 1S5DD 2D0PA 2X6LA 1I3QA 1I3QB 1GD7A 1PMRA 3Q1KA 4QIWB 3A56A 2Q8TA 3VR5A 4A3KH 2X6GA 2SNSA 3F2DA 1NR2A 1Y14B 1KD1C 1HRJA 2VS1A 4M7EA 2LKVA 4FXGC 4RWSC 1M6VA 4ZCKA 2KJXA 3AEVA 2TSSA 3OOCA 4QL5A 1SYGA 5T1IA 5KX5F 3QB3A 2NZHA 1R9TH 1Q1EA 1CKOA 1SNOA 3DLLA 3HOXG 4DUZL 1XMOL 1PYBA 3HOYG 4DR6Q 3R23A 4RHSA 3PF4A 4DL6A 2O5IC 3HB9A 4Z9CB 1RTNA 3L7ZC 2EJGC 4YHHH 1KC8C 1UEBA 1JDBB 5KNBA 2RHQB 2IHFA 5CV8A 3GTMH 4GZYC 5D3DA 3H0GG 4A93H 2VQEQ 1U4RA 3GIKA 4DR2H 2YU9A 2JA8G 3VR4A 3NTIA 4I4TF 2F0TA 4BY7G 2HIXA 2XTIA 5AJ3L 4F50A 4R4CA 1V1OA 1TWFH 3AB9A 5EDWA 1KDCA 3C46A 1EY0A 4M8AA 3EQLC 2WB1A 1K83H 4C5BA 2OF1A 3I4MB 4L5SA 4YIJA 1CSPA 3HOUG 3CAMA 2W9BA 1IW7D 2W9BB 1TS3A 3MEHA 3CCUA 3SE7A 5KFYA 4JI8H 3HOZG 5GAEC 4J8QA 5EKKA 5JQWA 1LABA 5H1SE 3CC4A 4J9NA 3TS0A 5KFHA 1CHPD 1B33N 4MZ9A 2CVRA 4KI0A 3TMEA 4V190 3H4BA 3BU2A 3GV6A 4A3DG 4HYKA 1V43A 3HEJA 5GROA 5EBDA 5GQOA 1QUQA 2WV6D 5DNFA 5C4JH 1E4GT 4JI5H 2A68C 2QYZA 2Z0SA 4X65H 2FLNA 1KLGD 1EIFA 3NWSA 1KRTA 2NUAB 4IOAA 3QG1A 1HR0Q 1HUMA 4POGA 1EIYB 1SNQA 3C0FB 1TWHH 2EYPA 4B3TL 2QF7A 3MWMA 1F9RA 4DLKA 3OIQA 1VQBA 4RB3C 1TVXA 2ALYB 3I4MH 1BUVT 4DFAA 2H5XA 3BDLA 4KY6A 1EQQA 1G2SA 3D8GA 1XMQL 1V1PB 4K0KH 2N8NA 2F0EA 1I5FA 2F0VA 3CMAA 4OO1G 3DUZA 2F0LA 5L37A 5FJ8H 3GTMA 1K8OA 3S15H 1JB3A 2AUJD 1A2UA 2Z4IA 2VQEH 1IBLH 2JEGA 3EJIA 2A5HA 1QZGA 1A9XA 1F2ZA 3S1MB 4LFAH 2MFIA 2NVYA 3GTQH 1I6VC 4JYAH 3SXHA 1VQ8A 1J8IA 3H4DA 1XPUA 1SCUB 1OXSC 2WP8J 1NNXA 4QF4A 1B3QA 2JEBI 4JI5L 4FS1A 2NU7B 1AP0A 4JOIA 3I56A 2D5DA 3S16B 4KY7A 3GTJB 4DR1H 3PO2G 1JWUD 5IGBA 5D14A 1UE1A 4HSVA 1K83B 3P20A 1P8LA 3PW5A 2ZJRA 4DR4Q 3RIZA 3NE5B 1JB7A 5EWFA 4OWWB 1EFWA 1BCPB 2UXDL 1BNZA 1VQJA 1FNVA 3H0GH 2NYZD 4IURA 1TWCB 3WNZA 4EGQA 1PH3A 4JI4H 3UDIA 4UCTA 1I94Q 4FYDA 2K14A 4QWEA 4DR3Q 2V5AA 2F03A 4DGZA 2NVTH 2PPBC 1UEAB 4BY1G 2UUBL 1Q12A 2CKZB 4B9WA 4ED1A 1W96A 1STHA 3NWTA 4LF4Q 4G57A 2OQ0A 2B3GA 3PO3H 5BPHA 3RNUA 4N9TA 3OUZA 4F4ZA 1A63A 1RJQA 2D62A 4K6DA 1TA8A 4LMYA 2Z6KC 5KYLA 3JAME 1IBKH 4Q8EA 3CC7A 1VQAA 1HPCA 2LXJA 4WJ4A 3L0OA 1GUNA 4PMWA 3RGXA 1KHIA 3MXPA 5FLMG 3BQ0A 3MFYA 1JORA 3N8DA 4CJ1B 5A2QL 4DUYL 2XSCA 1S4ZA 4A3EH 3CCRA 1VQMA 5KT2A 4JV2A 3BJUA 4RH6A 3K6OA 2L11A 3B6YA 1PK8A 1LYLA 3UDGA 2JSOA 2B63A 4JI6Q 1X65A 2SNMA 3AFQA 1BBXC 1TQOA 1L1OA 1QVCA 3DEPA 4IO9A 1EZ1A 2JEAI 4JBKA 1NE3A 5ELCA 3GILA 2CW7A 4K5XA 4OO1H 4JI4Q 4KKTA 1SYDA 5FO8B 1SRUA 3H3VC 2PMZA 3WWVA 4K5WA 2VUMB 1VMCA 1EY5A 4C5CA 3I90A 2ICEC 4DV5H 1S0OA 1E7ZA 5BR8H 1C0AA 2W9AA 3KF8B 2VY3A 1QZHA 4DV4H 4MNOA 2B8FA 4X3UA 1MJCA 1SROA 4WORA 2K4KA 2ZM6Q 1GSHA 1TWAB 4BXXH 4FF1A 1ENFA 2VPQA 5A2QE 1ENCA 1DCZA 1M8AA 1D5ZC 3PCOB 4RNOA 3PR4A 2B2VA 2F0OA 1TIID 1N34Q 1RIPA 1H9KA 4PQXA 5C4HA 2Y0SA 4BBSG 4B3RL 4DK3C 1EHIA 1B7YB 1I7NA 2E76C 4RU9A 3PW4A 5G3LD 4XYOA 2RCNA 2R87A 3RBEA 1HUNA 5LXTF 5KFVA 4N8FA 4MTEA 2PI2E 2R84A 5LHY1 1VQCA 1N36H 1KABA 4DR1L 1KXLA 1OXXK 4A3BH 2BQUA 1N56A 1U5KA 5IYBH 1I4QA 3BABA 3GTOA 3ND9A 1JDEA 4OELB 1B3AA 5L1LA 2C35B 1PH5A 2E5LQ 3PR5B 5DG9A 2N3SA 3DM1A 5C3WA 1Q7YC 5JEAG 1N33H 1IYVA 1C48A 3HOWB 4TQSA 1DZ1A 4ZKBB 5C1OA 2B29A 4ECZA 2JQOA 1SNCA 4DV7L 2FHTA 3FPUB 4GOPC 1STGA 3RAQA 4NB3A 3N52A 3KDFA 1X6OA 4GOPA 1NSNS 4GS3A 3STBD 3T5KA 2ATLA 4V0BA 3W1GA 3GV5B 3ERSX 1D2BA 3RB0A 2CQAA 2JA6B 4MV1A 5G3LF 5LMUQ 4DV0L 1SFOH 5DLQE 1LTSD 1VQPA 2A68D 2F4VQ 3HOVH 4MTDA 1HR0H 2R93G 1L0YB 2DNEA 2HJWA 1HHVA 2W6QA 5E1FA 4O4HF 1VQFA 3BS1A 4IUPA 3V4ZA 2F4VL 1S5BD 1SEBD 3D3RA 1VQGA 3A55A 5DEHA 5FK9C 3CCSA 4IUUA 2R92G 3GTQB 2KSWA 4WJ3M 3A5UA 4ECYA 1O80A 2KOLA 3G6JB 4DL3A 3S17B 2SDFA 3OMCA 2AMCB 1I4XA 1XNQH 4A3BB 3S1NH 1CM9A 3S2HH 2HGSA 3M7GA 1G8ZD 1TT2A 2PNRC 5CBAE 4C56C 3ULJA 4X65Q 1BVSA 4DV7Q 4NXMQ 1PTOD 4L5RC 1C9OA 1B1ZA 2OLSA 1GSAA 5ELDA 1RJPA 3U50C 3K5OA 4EQNA 3OTOQ 4X3KA 3HOWH 3DF7A 1K0SA 1P16A 2HVRA 5AFWA 4IR1A 1SLJA 1YHAA 1TU2B 2HD3A 2IP4A 4HJ8A 1T5XD 2RDHA 2P0AA 2ZXOA 2A6ED 1NR4A 1R4QB 3I70A 3A8KE 3MVVA 4DR7L 4QUCA 3CD6A 1EOTA 4A3BG 2L1BA 2GPWA 4YAJB 2BE5C 3SE0A 1PRTD 1O7ZA 3PV0A 4O42A 3STBC 1RODA 1PVOA 3RLNA 1J5EL 1PYSB 3GV8B 3TRZA 1ZXTA 1K73C 2RQXA 1TWHA 5IIFA 1BKBA 1TS5A 1FD7D 1NCVA 4P72A 4HCSA 4A3LH 4FO2A 3I72A 3TS2A 1RCVD 2JA8H 2I5HA 3JC66 3MR6A 3AYHB 4K2KA 3DM3A 2JA5B 1LTRD 4LFCL 1EY8A 5L1JA 1RKNA 3KDFB 1OO9B 2WAQA 1LV9A 4S3SA 2R8GA 3MXNB 4KK7A 1WTPA 5ELOA 4BY1B 3VPBA 1DGSA 3S14H 3R2IA 2A6HD 1ENAA 2C00A 3PUZA 4DNIA 4TQUS 4HJ7A 1ULZA 3SI8A 3RB3A 5JJLA 4X66Q 1SEIA 5FLXE 4APMA 5CORA 2MPMA 5M3FG 1PA6A 1SR3A 5IYDH 3A5ZB 1RK5A 5BPFA 3TQTA 1ZHSA 3GQBA 2F0HA 2PBZA 1CS0A 5CA1F 2HCIA 2N55A 4MTKA 3RLOA 4A76A 1XMQQ 1SMYD 3Q2OA 1ET9A 1GO3E 2LSSA 4XTCS 4A3KB 2ES2A 4IUTA 1LTBD 4PWQA 4LF8H 4DR7Q 1TWFA 3U9OA 3JAML 5KG6A 1SFOA 4ZRZA 4XQJA 2CQYA 3H40A 4MAMA 2NU8B 4ED3A 1MZBA 1SDFA 3HFZB 4EVOA 3HKZB 4LFCQ 5EKLA 4X62L 4DR5L 3OSNA 1I4RA 3GTPA 5JPMC 1B04A 1QWYA 4CDFC 4ECUA 3G4SA 2VXWA 1IYJB 2NWGA 1JJCB 2H1EA 1L2FA 2I0QA 1QUQB 3UFXB 4EFBA 4HNVA 4YHHQ 3VR3A 5JEAH 2E2HA 3DWQA 5LL6X 3FRPB 2I5MX 5C5MA 4HR7B 1RYSA 3Q6SA 3Q24A 4HJ9A 2UUCH 1EWIA 3MHBA 4FNFA 3IG0A 3R8BA 3HG9A 1HQRD 1T5EA 3OHXC 2VW9A 1EZ8A 3GV7B 1GKHA 5DG7A 2YRXA 3HKZE 1XWEA 3J7AF 1UNSA 3T1HQ 4UCVA 1VBHA 3KALA 3L2PA 5K5PA 5HV6A 2GN5A 2QILA 2D0OA 2I80A 3CRLC 3MC0B 1WFQA 1W93A 1BR9A 4X62H 3ITPA 3M7NA 4AQYL 4R8NA 3I4NH 3EIVA 4RA8A 1DV1A 3ULLA 4XYLB 4DAYA 2O5JC 4UP9A 1V1PA 2E8GA 5C4XB 1KIXA 4I55F 4DR3L 1JKJB 2JA5A 1I4GA 2HCCA 3NP8A 4Q44A 3ER0A 2V59A 2HVSA 1M0WA 2DY7A 2I87A 4DV1Q 4A3DB 3CKIB 3GO5A 2V1CC 4XX0B 4A3LG 4R9WA 4CJ0B 1X3PA 1B9MA 4JI7Q 4DF7A 1ML0D 1N36Q 4AQYQ 4WD3A 5KT4A 4H02A 3HP3A 1HNZQ 4YCWA 4NXNH 3R93A 4A3IG 1UAPA 5COYA 3PZPA 3A8IE 1M90C 1M4VA 4ME3A 4JYAQ 5KFRA 4RGTA 4J9PA 3NK9A 1Z2NX 3J81E 1DIKA 2PCFB 4LFCH 4A3MG 2F0FA 1S03G 2MNAA 2VA3A 2WKCA 3T51B 3VPDA 2EY6A 4NPSA 1LTAD 1JOQA 1UWVA 2L4NA 1Q81C 3GD7A 1S97A 3K8AA 4PNYA 1WTVA 1J5EH 4K0KQ 5J2TF 4IPCA 4FDBA 2JA7B 4NDXA 4BBRB 1M1KC 4TVAB 2UUCQ 2I5LX 3D4DA 1G2TA 4IRCA 4DPGA 5JVLA 4NLGA 3ULPA 2E2HB 3Q23A 1WYDA 3FKIA 5FD6A 1KTKA 1TKWB 2UVVA 5EPLA 5CYUA 2OCEA 1QJOA 2WACA 4LFAQ 2BDNA 2E2JH 1DYQA 4IFDI 5KFBA 2JEIA 3BDCA 2UXBH 4ED2A 2P5ZX 1IL2A 2UXCH 1WOCA 2EJFC 2WFWA 2Y0SE 1H9SA 2XD4A 1S0MA 3OHBA 2VA2A 3PQIA 2E2DC 2AHOB 2SEBD 4DR1Q 3QFFA 4MV4A 3E6ZX 4UCSA 2W7OA 4O4IF 4RAYA 2K52A 3OIPA 3CRKC 1JOKA 4HEDA 5DQGA 5EWEA 3G6XA 5D65A 1TY2A 3KHRA 4KD4A 2W9CB 1OXTA 4RKLA 2HHHH 2VUMG 5I9PA 3MA2B 3MAQA 1N33L 3PW2A 1BF4A 2OEOA 5D1PA 1C30A 4QWAA 4GKKQ 5L9XA 4JI0L 2AQ4A 2M00A 1O78A 4IPDA 4YCUA 3HOUH 4LW1A 4AH6A 3D31A 2NTTA 1TAEA 4JI6H 1TY0A 4QUFA 1KL9A 4TRDA 3M3YH 3CC2A 1N36L 1N32H 5C0XI 3H94A 3ICEA 1ZQ7A 2RSOA 4PZ7A 5J3BA 4X64L 4DV0H 4XQQA 5EOYA 4K6LA 3N44B 4EBCA 1T3NA 2A69C 4RNMA 2UU9Q 3T1YQ 4A93B 1TWHB 2F0GA 2DNCA 3MWDA 1Z9FA 4GOPB 3LNNA 2YZMA 4UHVA 4ECSA 4DV3L 5KFTA 5ISRA 5LMNQ 3PIP3 1A3TA 3PGZA 2DPJA 4O3NA 3OTOL 1TWCA 1PZJD 1LT5D 1QNUA 1KJIA 5BR8Q 1VQKA 1Y69U 2Q2UA 4BBRH 2ZTDA 4MIUA 4IJHA 4DV5L 2UXCQ 1A3UA 2BE5D 1EYDA 1K1QA 2RBMA 1PH1A 4C3IH 3HOYB 1D8LA 2F0WA 4KLKA 4OONA 3RN5A 3CCEA 1I6UA 4ECWA 4EQPA 5KFOA 1KAWA 3BYTB 2J9GA 2AUKA 4YWKA 3I91A 5C0XJ 2V4RA 2R92H 5M5YB 1SE3A 1S5FD 4O2BF 1HFNA 4EYIB 3RR5A 5M5XH 3KLWA 1HTPA 2C22A 4ILWA 1CI3M 4DR2Q 2JA6G 5IWAQ 4DR5Q 1UNNC 1IL8A 3TZUA 2W8KA 4K8IA 1BXRA 3RUZA 3S16H 1SBBB 3HOVG 3HKZA 1I50B 4IAJA 4ECVA 5KG1A 2HIVA 5J22A 1WTHA 4DXGA 4O3PA 4C3JB 3H3VI 1BBWA 2EE1A 1EY9A 2CWAA 1HA6A 1TWGA 4MN3A 5DGBA 2OQKA 3NUCA 2B63B 2Z8LA 4CKCA 3LMLA 2F0SA 2N88A 3KYHC 3JZIA 1K83A 1WCMB 1QE6A 1HJPA 2PMZE 1VDZA 4C2MH 5D1OB 2BQ3A 5EAYA 2JJQA 4QQBX 3HOUB 3EROA 3I4OA 3K80C 5D1OA 2IA6A 4HQ6A 2F0JA 3I3CA 1YNJD 2Q8RE 2AU0A 2VQFL 4A3EG 3F1ZA 3L4JA 5KFFA 3M9BA 3MEFA 4X66L 2DY8A 2XGQA 3E0JA 4C3HH 5FLMH 1B44D 3KTMA 2FMMA 4J9OA 2WAQE 2UUBH 2L0CA 2NUCA 5LL6b 1IXRA 4J9QA 2DJGC 2RGVA 4K2LA 1T94A 3BG3A 4ZLTF 5A35A 5CBEE 4R8UA 3GTJH 3H91A 3GP7A 1WCMG 2F0DA 3RZDB 3TIIA 3DWPA 3HOXH 2UXDH 5C3XA 5EWGA 1BXTA 4E4TA 2JYOA 4A3EB 4M9UA 3K7AH 1SE2A 3OYYA 1WCMH 3TIGA 4ABNA 2XIGA 1WI5A 1RK6A 2W57A 2PYKA 3G8CA 4ED6A 1K9MC 1XNRL 1EU3A 3SEBA 1I3QH 1G291 2CHBD 2G5DA 2RDGA 2YU9B 1KAAA 4JOIC 3KBXA 4JI3Q 2VB3X 2R93B 4X3SA 4CHTB 4OWXB 1U4LA 4ED0A 4IWXA 3G48A 1M7JA 1GUWA 4BA2I 4B08A 2W6PA 3JAMc 1XXGA 3N6XA 3H20A 1U4MA 1BCPD 1STYA 2B39A 5KIXA 5M5WH 4J15A 2EZVA 1JJGA 1D1IA 3FDSA 1F2MA 1SNPA 3MR2A 2K33A 5IE8A 4RAZA 5C44G 4I7ZC 1JCKB 1Z6HA 3FKIH 4I65A 2ZJPA 5IT9L 1FNWA 1SAPA 3BDOA 3I8ZA 2GA4B 5DM73 4A3MH 4DUZQ 1AZQA 1AH9A 2L12A 4ECXA 1B9NA 4HN7A 1YZ6A 5EKIA 3TEHB 3PO2B 1N32L 5JOBA 1B6RA 3AQQA 3JRXA 3LP8A 2F0NA 4JI6L 3TP7A 4JI1Q 4ZUIA 1PFMA 4HCEA 4UP7A 2IWHA 4DAYB 5K2MA 4KHPL 2A1AA 1ASZA 4ECRA 4JPBW 1YVCA 3RV4A 2EDGA 2HHHL 2VUGA 2D2CC 2R6FA 3ND8A 4HAEA 1JXLA 5KGUA 5C1PA 2C28A 4F4XA 2AWNA 4GKJH 1E2WA 3GTQA 4XQNA 1FL0A 2UUCL 1KJ8A 2KEEA 3NPPA 3HGBA 1HQMC 3NTHA 1GUOA 5CV9A 4C1NI 4FBUA 4HJAA 2Q2TA 1PH8A 2YTVA 1VQ5A 4YBZB 4DV4Q 3U9TA 1PTOC 3GTGA 3LWUA 4RG1A 4JCVE 4HIMA 4BA1I 4JI2H 4IZ8A 1FGUA 2NVTB 2HVQA 5KNDA 4B3TH 5C4XG 3J7ZC 1YHBA 2WB1B 4EEYA 1Q82C 4L8JA 5KFLA 4EGJA 1NMFA 1DOLA 3WOEA 3K3PA 2PO4A 1DM0B 1HZCA 4ZI7F 3FVQA 4QY7A 3HOWG 1X3GA 3H0GB 4YHHL 4ZQIA 2JE6I 1Q1BA 4LF8L 2N78A 3BQ2A 1YJWA 4FU0A 2UU9H 4BY7H 2L55A 3GTKB 1D1KA 4UPAA 2FINB 4DK0A 1MKHA 2EQSA 1QB5D 2W71A 4DNTB 4LF5Q 1GYFA 5I2YA 5I6WA 4A3GH 3UQ8A 3FKIB 4JI8L 1X3EA 2XCPA 3MZ5A 4ZQ3A 4DV6Q 3HXLA 3T5JA 2J6TA 1OTCA 2DWCA 4XIGS 4LH6A 2L9HA 4JC0A 3S2DH 3N40P 3JAMi 4XDXA 2YTYA 4OWTB 1E24A 2W8LA 3HZXA 2RDIA 3GLKA 1PFSA 5IT9c 2BA0A 3NTKA 3GV3A 2WAQB 3GTPH 3C2PA 5IYZF 2Z6KA 2XCLA 3URYA 5ELEA 4JV0A 1HH2P 4E6IA 4L5QA 1E2VA 5FPOA 4DR2L 1LTLA 2WIIB 3R5XA 2KVMA 3AMUA 4N9PA 2AKWB 4C3JH 2B2TC 3J80W 1RF2D 2VOBA 5J2UF 1SSOA 3IN5A 1QVFA 4PZ6A 2Q8IB 1CFMA 1TWCH 2ASJA 2DPIA 1D6EC 4EYHB 3FKIG 4BWSC 2EYHA 3P7JA 4OHJA 2ZXPA 2YS7A 1FYCA 3JRWA 1JE4A 2CCZA 4IFDG 2A6HC 4GN3B 2ALZA 1PH4A 4X62Q 2WE6A 2F0UA 5KFCA 3BQ1A 2GPSA 4EFEA 2PW5A 4KJOA 2QKIC 4L5TA 3KLSA 4Y7NH 4FP5D 1TWAH 1SMYC 4YY3Q 2JA7A 3GTPB 2B2UA 4GKJL 3VA5A 2JA6A 4XZ3B 1XNQQ 5FLXL 4IFDJ 1ET6A 2R85A 5KFJA 1Z2PX 3RFCA 4LFBQ 1S68A 4HIKA 1RYRA 4FBTA 2K5QA 1ILQA 5IGDA 2DN8A 4AIMA 2FLLA 4QGUA 4HMIA 4FF4A 1KC7A 2CZGA 4P74A 3K7AB 1WD1A 5JAVA 1VQ7A 4WFN3 5IYCG 4NXMH 3NBIA 2UUBQ 1CQIB 2Y0SG 3DWAA 1AN7A 1B6SA 4HNTA 2UXBQ 5KFUA 1SNMA 5NUCA 1GVPA 3C1FA 1MGSA 5L1IA 1JE5A 4LUOA 3CCVA 2R7ZH 3A0JA 4IQZA 1A8VA 5CV4A 2DIKA 2YYZA 1D5XC 3NBHB 4RCNA 1YJNA 4PV1C 5DQIA 5KRUA 4DR4L 1SJHD 2AWOA 2F3WA 4NW2A 4YR3A 3RZOB 3V6KA 3J7AK 5F9NA 3Q0AA 4M1UB 4LMQD 1CQVA 2KEDA 1QNKA 2CFMA 4DV7H 5IGEA 1ICWA 4B3SL 2FPIB 1WSCA 3PMFA 4HIDA 4HNUA 4A3KG 3F2UA 2KHIA 3FEWX 3ZJYC 4GLXA 2R93H 2EIFA 4IALA 2NVQB 4DV6H 1I4PA 3F8TA 3LWBA 4CC6A 3FDTA 1VQ9A 4OEMB 3RGZA 3CQZH 2ZDGA 4JI8Q 3CCQA 1GHJA 4RMFA 4LUVA 4I50F 4YY3H 4MTNA 2QK4A 4PMCA 2IL8A 3QZ7A 1SJED 1F9PA 3U4VA 1F77A 5HGQA 1WR2A 2RDJA 1GLVA 3K58A 4LF8Q 1ICFB 2CW8A 3RJ0A 2BH8A 1XTCD 2EY1A 4KN7C 3GIMA 3FMCA 1JOOA 3V96A 3OPOA 1A62A 3HKSA 5IT9E 1SYCA 4APVA 3S1RB 1KBLA 3OSPA 4YAKB 4LUZA 3TZDA 1AFPA 1S9FA 2R8JA 2ZJQA 4C3JG 1DONA 3TDQA 2EXDA 1I6HB 4O4LF 4B3SQ 1S72A 2IX1A 1TXYA 3VR2A 5BR8L 5JH7F 2WTFA 1N34H 4YJ2F 2VQFH 4NP5A 4KN4C 2AGQA 2QGQA 3J81L 3GIPA 5IP7H 4HTHA 1CA5A 1SE4A 2KENA 5CGKA 3RTXA 4B3ML 3ORRA 3T1YL 3T1HH 3NBHA 2MCTA 5KT7A 2KCMA 2QEJC 2XRQD 3RAXA 2E5LH 2R8HA 5HBRB 2MGSA 3VA7A 1ZHQA 3I7FA 2HQLA 3PUWA 2DGYA 2A74C 1BJTA 1GUGA 4U68A 3S14B 1A3VA 3DEOA 4ZOLF 1VQ4A 5C6AA 4JVZA 5IYBG 3BAAA 1F9SA 1JC7A 1JWSD 5E4XA 2QW7A 4JBWA 4F88A 4H7BA 1H95A 4NKLA 3S24A 1JQYD 4BBSB 4IN3A 5J1ZA 1CTMA 3M4PA 1EIGA 5JEAJ 5FKAC 4JI7H 5CA0F 3M4IA 4IFDH 1VMPA 3S2DB 1HXYD 1PYWD 3SGIA 4CGYB 2OWOA 5KG3A 1VQNA 2IW3A 1D5MC 2W6OA 4TV8F 4A75A 3WOFA 3OTOH 3J81W 3MXNA 2R8KA 2V4DA 4GN5A 4H13C 2R7LA 3S15B 4JV5Q 3LX0A 1FJGL 3S1RH 2F4IA 2IY5B 4A3CH 5GADC 2FMCA 3K7UC 3CQZA 3KAJA 4RB2C 2W9CA 1DOMA 2R86A 1PDQA 2LS01 3O13A 4GNXB 4MV7A 1A2TA 2AQ1B 5I9OA 4X64H 2R93A 2E75C 1NUCA 1E3PA 2YV5A 2XGTA 5E3FA 4LF7L 3G7LA 1W3SA 2F0KA 2EPBA 3SK8A 4OL7A 2O4XA 5CC4A 5KFDA 1Q3LA 1PTOB 2KCTA 2F3IA 3IFTA 3J80L 1AN8A 3BZCA 1E4EA 4Y7NB 2RF4A 1FKAH 4J9KA 1N9WA 1TS4A 2K5NA 5KYIA 4RB1A 2R7ZA 4I7HA 1LTTD 3I2ZA 1IBLL 1O7YA 3MFGA 5KFIA 4DV3H 1BNCA 3KUPA 3N42B 1IZ6A 3K5LA 5BMVF 4YQWA 1XDNA 5FLXc 5TSSA 4O3QA 1XMQH 2M2LA 5IOCA 1EQTA 3GTLB 3H0GA 2FJZA 2YZNA 1Y1VG 2CW0D 3SK5A 2UXBL 2IX3A 5KFAA 2K5DA 2BR0A 1Q8KA 4GKKH 2MUYA 5C0XG 1DD2A 1EYGA 1IOVA 3OW2A 1X56A 2EYJA 5JUMA 2IT1A 5IP9H 4JV5H 3PSIA 1RHPA 4EGVA 2NVXB 3K5MA 5M5XB 1EL0A 3EYYA 2RHSB 3D4WA 2FK3A 4UFZA 3M4OH 1Y1WA 4X65L 3QOJA 2DUDA 3M9OB 5KFGA 5JVH3 3H6MA 1Y1VH 3GTOB 1H9SB 2J6SA 2B2WA 2QDBA 5L1KA 1LM0A 4DKAC 1XJVA 1HTLD 2HHHQ 1HNWL 4UCUA 4DV2H 4LSXA 3AFPA 4C3HG 1VQEA 1PTOH 1T9HA 3VYSA 2ZDHA 1WTOA 1IOWA 3BA9A 1PFNA 1WTWA 4LF9L 5KFEA 2G9HD 3A74A 2VZAA 2A19A 3GTLH 4DL7A 5KFNA 5KT5A 2XWJB 5IT9W 3SK4A 4MV9A 4JI1L 4IUNA 3CU7A 4NXNL 1L0WA 4JI0Q 2JA5G 4A2AA 2R3ZA 2YYAA 2NZOA 4QJFA 2MHVA 1W2BA 2BOSA 3KXYT 1LLRD 4DV3Q 4LF9H 2FK1A 1EY7A 3K81C 1JT8A 1VF7A 2PI2A 2JXMB 3U9SA 4KKUA 4X6AH 3RV3A 4QW8A 5I2XA 2C9OA 2CH4A 5CR3A 3HOZH 2KCCA 4A4IA 3NQTA 1E1OA 3GTOH 4IHJF 1AW7A 2PMZB 1WTRA 1I94H 4ME6A 3BYYB 5FO9B 4JBMA 1VF5C 2JA8B 3RB4A 2VL6A 1CKMA 4H0LC 1C3OA 1F2LA 4IJLA 3ONAB 5IYDG 5M3FH 4O3RA 2R92A 1VQIA 2AQ3B 1CSQA 2QCPX 4LFAL 3I4MG 4IPHA 5AJ3Q 2RVLA 1I6HH 5KFWA 4DV6L 3GIDA 3MXGA 2VQEL 4LJZC 3RD4A 1E0BA 1GXDC 1TWAA 3VDYA 4B3SH 4GKKL 4KHZA 3V6HA 3E5NA 2A6EC 4P75A 3J7A5 2ENBA 4K0KL 3OHAA 1YEZA 1Y8OB 1PH2A 3H3VH 2BA1A 1QG7A 2XVSA 4R8IA 1EY4A 1JLLB 4EBDA 5FOBB 1G6PA 3QOLA 3FP9A 1YIJA 4DR5H 2NU9B 1MD2D 1ESRA 3IKJA 2J6UA 2MO0A 1WJJA 1CKNA 5JJZA 2WB1E 1DOKA 4J6HA 4DR3H 1YNND 2IBKA 3RZDH 1AE3A 3G71A 2YRWA 4DAMA 2K5HA 1SYEA 2HUGA 1B70B 3TN2A 5BN4A 4RKBA 3A8JE 1EEID 1JWMD 1Y1VA 2KHJA 4TQRA 2VR1A 2O03A 3PO2H 4K14A 2C2DA 4UP8A 4LF7H 3H15A 5M9OA 1JJ2A 2K03A 4DV1L 4DN4M 2KA7A 2EY2A 2F0IA 3E3XA 4GNXC 4CDDC 1CUKA 3SR1A 1Z2OX 1N8RC 4LNQA 4HSPA 2A69D 3KK7A 1IBMH 3V6JA 2L5TA 1RJTA 2K50A 2X69A 3CW2C 4YWLA 3N41B 3MFHA 2ASLA 2E2IH 2OH2A 3KLRA 1FJGH 5IGFA 5EBCA 1EU4A 1LTID 2FP4B 3L4KA 3FHWA 5KT6A 2PQAA 1B4OA 3QWNA 3BA8A 1KQSA 4HIOA 1I50H 4WRDA 1ESFA 1MJEA 4R4IA 4YJ3F 5KG4A 1N32Q 5M3FB 2KBNA 5M5YH 2R92B 3MWYW 1Q90A 4TKOB 4DUYQ 1TS2A 2F0PA 3KOJA 5E4WC 2M05A 5KFXA 1SFOB 1NJIC 3T53B 1Q46A 2W6MA 1PX2A 2BDOA 1XMOH 1HZBA 3QZ8A 4DUZH 2B2YC 2YL2A 4FXDA 4RZRA 1MI2A 3T13A 3K57A 4KTAA 3NSWA 3R5HA 3ERQA 4DL4A 2FXQA 4BBRG 4JI3H 5I47A 4KKSA 2LY7A 1EWCA 3D4RA 5FLXW 4LK1C 1WCMA 3IFDA 4R4OA 1HNXQ 2XWBB 4HJ5A 2HDLA 3K5NA 2E5LL 4Q5VA 4DAPA 3S2HB 3W1BA 1KLUD 4G7OC 5IGCA 2W6ZA 1VQHA 4LFBL 4KMUC 4ECTA 1GUSA 2XRSD 1L0XB 1XNQL 2UU9L 2FJ2A 1QILA 2YTXA 4IZOA 2G9DA 3T1YH 1KDBA 2TMPA 4RFBA 3KFUA 1HR0W 2NVYH 2VQDA 3KF6B 3G6EA 2UUAL 3W2DA 1G51A 5ELFA 3BG5A 4N8X1 2KUMA 3GIJA 1IBLQ 1ILPA 4A3JG 1IBMQ 3TBIB 3J80c 1JICA 1N34L 3PUYA 4JI2L 2GVAA 2FK2A 4QB4A 5C4JB 4LF6H 1MSHA 4RGNA 3VYUA 3FPPA 4JI2Q 2BQRA 2OT2A 1N33Q 3I4LA 1B53A 3GDEA 3TREA 2EVBA 3M4YA 2K28A 3QIAA 4ZUJA 4LF7Q 1PH9A 5KFZA 3NGDA 2WAQG 1UE5A 2VQFQ 5M5WB 4U7CA 4ECQA 4DR6H 1Q8IA 3K5HA 3PW0A 3T5LA 1VQ6A 1OXUA 4FVMA 2W7PA 3HOXB 4O2AF 5LYJF 1HZAA 4YCVA 1PRTF 4RUCA 4TSSA 5JVDF 1F9QA 1LO5D 2IJ0A 4CJ2C 3WO0A 2MO1A 2MJ8A 4GNXA 2F4VH 2NBFA 2JEFA 1UC8A 5C44H 3VYTA 1E4EB 4RNNA 2B2YA 4LF5L 3M9NB 2RA4A 1HNXH 5C4ZA 3F2BA 1CZGA 5KFMA 3GTKA 4OIKA 5DM63 3TP6A 2NVYB 2FPPB 2J0TD 1KNEA 2JK8A 4LF9Q 5KG2A 3WDNA 5EPKA 4B3RH 1J5EQ 1EYZA 3RMHA 1X3FA 2MP1A 4HR7A 5D8DA 3T5HA 4G4KA 3ETHA 3GTLA 1B2TA 1EUCB 1EY6A 3EPGA 5C4XH 1XPRA 4ZYSA 2R7NA 2YU9H 1KRSA 1X54A 4A2BA 2FB9A 1V1QA 3MXUA 3J81i 4G7ZC 2R82A 1VQDA 4WBNF 4LF6L 1HNXL 4DV4L 5KFSA 3HOVB 1DJRD 4DL2A 2NN6I 1H9JA 1STNA 1UE7A 1Z7TA 4QMGA 4ZKCB 5LMNL 2EXZA 2NZ1D 4A3FG 1YITA 1X9NA 1R9TB 4BBSH 2W6NA 1XTDA 4NXML 1Y8PB 5C5LA 3KJOA 2UUAH 3HRZC 3TP8A 4A3GG 4AYBA 2B63G 5DAUA 4ZK9B
chains in the Genus database with same CATH topology
4JBJA 2K75A 3ER0A 4R4QA 3Q8DA 3CCLA 5HGQA 4IPGA 4B3MQ 2Q2HA 2B63H 2R6GA 4DV1Q 4LF8Q 5GAHC 2ID0A 3U58A 1NBWA 1E1TA 2BH8A 2V1CC 1NTGA 3GO5A 4OX9Q 4A3LG 1RL2A 4DR6L 3J80i 3UE1A 4JI7Q 2D0PA 1N36Q 1A62A 3HKSA 4AQYQ 4H02A 1HNZQ 4APVA 4YCWA 1GD7A 4A3IG 4LUZA 1M90C 4ME3A 2ZJQA 4A3KH 4OXPA 4JYAQ 2EXDA 3F2DA 1Y14B 2PNHA 1KD1C 3KJPA 2VS1A 4B3SQ 1S72A 2IX1A 4A3MG 5LMUL 4DV0Q 1TXYA 3AEVA 5BR8L 2MNAA 4P73A 4QL5A 4NPSA 2NZHA 1R9TH 1Q1EA 1CKOA 3DLLA 4DUZL 2QGQA 3HOXG 1XMOL 1PYBA 3HOYG 4DR6Q 5IP7H 3PF4A 2L15A 1YI2A 5FJ8G 1UWVA 3K0XA 3L7ZC 1Q81C 2KENA 3GD7A 3K8AA 1L1OB 5M3MG 1KC8C 1UEBA 4K0KQ 4IPCA 4FDBA 4B3ML 2ZTCA 1MIUA 2RHQB 1M1KC 2IHFA 4TVAB 3T1YL 2I5LX 1NY4A 2UUCQ 2NVQH 3GTMH 3H0GG 4DPGA 4A93H 2VQEQ 3ULPA 2JA8G 4BY7G 2HIXA 2XTIA 5AJ3L 1WYDA 5LMNW 2OTJA 4R4CA 1TWFH 1FJGQ 2KCMA 5HY6A 2OCEA 3D0FA 4LFAQ 1SMXA 1VQLA 2E2JH 1K83H 1Y1WH 4IFDI 4L5SA 3I7FA 3HOUG 1CSPA 3CAMA 1IL2A 2HQLA 1WOCA 3PUWA 2DGYA 2WFWA 2Y0SE 4B3TQ 3CCUA 2AHOB 4DR1Q 1VQ4A 3HOZG 3CCJA 5IYBG 5GAEC 2R7DA 2K52A 5H1SE 3CC4A 3TS0A 4JBWA 4GLVB 4MZ9A 5IP9G 1H95A 4KI0A 3M85A 3S24A 3BU2A 4A3DG 1OXTA 1V43A 3PF5A 5GROA 5GQOA 1IBKL 1QUQA 2VUMG 5C4JH 1GM5A 3M4PA 1N33L 2Z0SA 3CPFA 3J81c 5JEAJ 3RN2A 1EIFA 1KRTA 4GKKQ 4IOAA 1HR0Q 4POGA 4JYAL 4JI0L 1EIYB 3CPWA 1TWHH 3SGIA 2OWOA 4B3TL 1VQNA 4IPDA 4YCUA 3HOUH 4LW1A 4AH6A 3D31A 4A75A 1SE8A 1HNZL 1KL9A 4EQ5A 3CC2A 1N36L 1VQBA 4GN5A 1YJ9A 3M3YH 5E7NA 5C0XI 4JV5Q 2CWPA 1FJGL 2ALYB 3S1RH 3ICEA 3I4MH 2IY5B 4PZ7A 5J3BA 4X64L 2H5XA 4A3CH 5GADC 3K7UC 1EQQA 3S1MH 4JI4L 4A93G 1XMQL 2JA6G 2UU9Q 3T1YQ 2N8NA 4GNXB 1I5FA 1Z9FA 4GOPB 3CMAA 4OO1G 3RLFA 4DV2Q 1E3PA 2YV5A 2XGTA 5FJ8H 4DV3L 3S15H 5IP7G 4LF7L 5LMNQ 1W3SA 3J81j 3PGZA 3OTOL 3F2CA 5BR8Q 1QZGA 2KCTA 3CF5A 1VQKA 2MFIA 2F3IA 2Q2UA 3GTQH 4BBRH 1VQ8A 2ZTDA 4IJHA 4DV5L 2A8VA 3BZCA 2JA6H 2UXCQ 1XPUA 1OXSC 1VCIA 2WP8J 2RF4A 1PH1A 3EN2A 4C3IH 1N9WA 1PH6A 1D8LA 2K5NA 2JEBI 4JI5L 1AE2A 1I94L 4KLKA 4A3CG 4OONA 4BXXG 3I2ZA 3RN5A 3CCEA 4JOIA 3UDXA 1IBLL 4QIWE 3I56A 2WB1G 1KAWA 1ASYA 3PO2G 3HKZG 1K3RA 1UE1A 4YWKA 1HNWQ 1P8LA 5C0XJ 2ZJRA 4DR4Q 1IZ6A 2R92H 1QVGA 1JB7A 4OX9L 3NEMA 4OWWB 4EX5A 3RR5A 5FLXc 1EFWA 5M5XH 3KLWA 2UXDL 1VQJA 3H0GH 3GTGH 1PH3A 1K0RA 3UDIA 1YNXA 1Y1VG 4DV5Q 4DR2Q 5IWAQ 4JI5Q 2IX0A 4DR5Q 1I94Q 2UXCL 2UXBL 2K14A 1Q8KA 3S16H 4DR3Q 3HOVG 5C0XG 2NVTH 1EYGA 4BY1G 1UE6A 2HIVA 1K8AC 2UUBL 3OW2A 1Q12A 1X56A 3H3VI 2CKZB 1BBWA 2IT1A 2CWAA 5IP9H 3PSIA 1D7QA 2OQKA 4LF4Q 2OQ0A 2B3GA 2RHSB 5ELNA 3PO3H 3RNUA 3KYHC 3M4OH 2QEXA 1HJPA 2PMZE 4X65L 1VQOA 1A63A 3PUVA 4C2MH 2D62A 2DUDA 5EAYA 2JJQA 4QQBX 4OO1I 3I4OA 2Z6KC 1Y1VH 3K80C 3RZOH 1EQRA 3CC7A 4X64Q 1VQAA 4WJ4A 1LM0A 2LXJA 4DKAC 2VQFL 3L0OA 4A3EG 1XJVA 2HHHQ 1HNWL 3F1ZA 4PMWA 3M9BA 1KHIA 3MEFA 4X66L 5FLMG 3AFPA 1VQEA 1T9HA 3PUXA 4C3HH 5FLMH 4JV5L 4DUYL 4LF9L 2WAQE 4A3EH 3A74A 5IY0A 2VZAA 2A19A 3CCRA 1VQMA 3BJUA 1IXRA 3GTLH 4DK6C 2E2HH 3B6YA 1LYLA 4JI1L 3UDGA 4NXNL 4R4TA 1L0WA 4AYBG 1EOVA 4JI0Q 4JI6Q 2JA5G 3GTJH 1X65A 3AFQA 1WCMG 2NZOA 2VUMH 3PO3G 4QJFA 1W2BA 1NMGA 3HOXH 1L1OA 1QVCA 4IO9A 4DV3Q 5IYCH 3K81C 1JT8A 1EUJA 2JEAI 2PI2A 4BY1H 4JBKA 4B3RQ 4R1JA 1NE3A 4X6AH 3K7AH 3OYYA 1WCMH 3UDFA 1K8GA 1B8AA 4DV2L 3HOZH 1SN8A 1WI5A 4A4IA 1BBUA 4JI4Q 1E1OA 3GTOH 1SRUA 1PV4A 3WWVA 1K9MC 1XNRL 4JBMA 2VL6A 1CKMA 1I3QH 1G291 2ZM6L 4IJLA 4JOIC 5IYDG 1E7ZA 5M3FH 1VQIA 4JI3Q 1C0AA 1CSQA 3KF8B 4LFAL 2VY3A 4IPHA 1QZHA 4MNOA 4OWXB 5AJ3Q 3I4MG 5IYDH 4A3DH 3G48A 4KHPQ 1MJCA 3PIOA 4BA2I 1SROA 1I6HH 2K4KA 2ZM6Q 2F52A 4DV6L 2VQEL 4O2DA 3JAMc 4BXXH 3VDYA 4GKKL 4KHZA 3PCOB 1JJGA 5M5WH 4J15A 4P75A 1JMCA 1N34Q 1J6QA 1RIPA 3J7A5 4K0KL 4BBSG 5IE8A 1YEZA 3IRBA 4B3RL 5K36G 5C44G 1PH2A 4DK3C 3FKIH 3PIPA 4PZ8A 2ZJPA 1B7YB 3H3VH 2BA1A 4GN4B 1IBKQ 1XPOA 2RCNA 2ASBA 4A3MH 4DUZQ 1AH9A 1YZ6A 3TEHB 2PI2E 3S17H 2VNUD 1G6PA 3FP9A 1YIJA 1N32L 1VQCA 4DR1L 3AQQA 3NENA 1OXXK 4A3BH 1KXLA 2MO0A 1WJJA 1CKNA 3CMEA 4JI6L 4NXNQ 1U5KA 1S3OA 2WB1E 4JI1Q 5IYBH 3RZDH 2LXKA 1AE3A 3G71A 4DAMA 2C35B 2K5HA 4UP7A 1PH5A 2E5LQ 4JI7L 1B70B 4DAYB 4KHPL 2N3SA 2A1AA 1ASZA 1Q7YC 4AYBE 2KHJA 5JEAG 2ZTEA 1YVCA 1C7YA 3PO2H 2HHHL 3CP0A 4UP8A 4LWCA 2B29A 3H15A 1XNRQ 2R7ZG 3CXCA 2GVBA 2JQOA 1JJ2A 4DV7L 4DV1L 2AWNA 4GNXC 4GOPC 1FL0A 4NB3A 2UUCL 1CUKA 3S1QH 3KDFA 1N8RC 4LNQA 1X6OA 4GOPA 4A3FH 5M3MH 4GS3A 3STBD 3W1GA 4HJAA 3ERSX 2CQOA 2MQHA 1PH8A 2Q2TA 3I4NG 2K50A 2YTVA 3BZKA 3CW2C 5LMUQ 4DV0L 5DLQE 4YWLA 4DV4Q 1VQPA 1SFOH 1VQ5A 2E2IH 4LF6Q 2ATWA 2F4VQ 5C3EG 3HOVH 2HT1A 2R93G 3FHWA 4RG1A 3I55A 2PQAA 4JCVE 4HIMA 4BA1I 1KQSA 1FGUA 4HIOA 1I50H 5C4XG 3J7ZC 1HZ9A 4R4IA 1YHBA 1MJEA 2UXDQ 1Q82C 1N32Q 1VQFA 2KBNA 5M5YH 5C3EH 5GAGC 4DUYQ 1NMFA 2NVXH 4A3IH 2F4VL 2JA7H 2R92G 1VQGA 3KOJA 3CCSA 1E22A 1HZCA 4JG2A 3HOWG 4QY7A 3A5UA 1X3GA 4YHHL 1NJIC 4WJ3M 1Q46A 2JE6I 1Q1BA 3TQYA 4LF8L 2N78A 1HZBA 2AMCB 1YJWA 1X55A 3S1NH 4BY7H 1L1OC 3S2HH 4UPAA 1MKHA 2EQSA 4O0AA 3ULJA 4X65Q 1BVSA 4LF5Q 4DV7Q 2FXQA 4NXMQ 2N49A 4BBRG 4A3GH 4L5RC 1C9OA 4JI8L 1X3EA 4DV6Q 3U50C 3EBEA 1OTCA 4XIGS 4JC0A 4P71A 3OTOQ 3HOWH 3S2DH 3JAMi 1P16A 2YTYA 1SLJA 1YHAA 4OWTB 1E24A 4R4OA 4HJ5A 1HNXQ 2E5LL 1PFSA 5IT9c 2BA0A 3GTKH 3W1BA 4HJ8A 3GTPH 2Z6KA 2QA4A 1VQHA 1VS0A 4LFBL 4DR7L 1HH2P 3CD6A 4L5QA 4DR2L 1LTLA 1XNQL 2UU9L 3T1HL 2YTXA 4A3BG 1TWGH 2AKWB 4C3JH 1CKNB 3KFUA 1HR0W 3PV0A 3CCMA 3STBC 2NVYH 1PVOA 3RLNA 1Y1WG 1J5EL 4GKJQ 1PYSB 3KF6B 3G6EA 4PZ6A 2UUAL 1QVFA 3TRZA 1TWCH 1G51A 4YY3L 1K73C 1YBYA 3FKIG 1A0IA 1BKBA 4PG3A 1IBLQ 4P72A 4A3JG 1IBMQ 4A3LH 3TS2A 3J80c 1N34L 2JA8H 2I5HA 3JC66 3PUYA 3AYHB 4JI2L 2GVAA 3DM3A 1OXVA 4LFCL 2CCZA 4IFDG 3KDFB 1HR0L 4Y52H 4GN3B 1PH4A 4X62Q 3MXNB 2JA9A 5ELOA 4JI2Q 1DGSA 3S14H 1N33Q 4L5TA 3PUZA 4DNIA 4TQUS 4Y7NH 4HJ7A 2UUAQ 3GDEA 3W5OA 1TWAH 5JJLA 3TREA 4X66Q 4LF7Q 2Q2IA 4JI3L 1PHJA 5M3FG 2NN6G 1SR3A 2WAQG 3A5ZB 4YY3Q 1PA6A 1PH9A 2JA7G 1UE5A 2VQFQ 4GKJL 3E9HA 4YWMA 1XNQQ 4IFDJ 1VQ6A 1OXUA 3RLOA 4A76A 1U0LA 4LFBQ 4HIKA 1XMQQ 1LUZA 2PQAB 4XTCS 1GO3E 1HZAA 2LSSA 4GLAC 4YCVA 2ES2A 4AIMA 4IOCA 4DR7Q 4QGUA 4LF4L 4P74A 1VQ7A 2MO1A 1FVIA 5IYCG 4GNXA 1S40A 2UUBQ 5C44H 2Y0SG 3HFZB 4LF5L 1Q86C 4LFCQ 2UXBQ 4X62L 2K5VA 4DR5L 1GVPA 3F2BA 1JE5A 4LUOA 3CCVA 2R7ZH 3A0JA 3G4SA 1IYJB 1A8VA 3M4QA 2YYZA 3U4ZA 1JJCB 3NBHB 2JK8A 4LF9Q 3NELA 1L2FA 1YJNA 1QUQB 2I0QA 1IBML 4YHHQ 4A3JH 4DR4L 2AWOA 1XMOQ 3HOYH 1J5EQ 2I5MX 1X3FA 3LGJA 4HJ9A 1Z47A 1EWIA 3E9IA 1O7IA 2R7FA 5C4XH 1XPRA 4UY8C 3E0EA 2CFMA 2VW9A 4B3SL 1GKHA 4ALPA 2YU9H 2IHEA 1KRSA 3HKZE 5JJIA 1PH7A 4HIDA 1X54A 4A3KG 3T1HQ 1V1QA 2KHIA 3ZJYC 4GLXA 3J81i 3L2PA 2EIFA 2GN5A 1YHQA 4POFA 2R93H 1VQDA 2D0OA 3F8TA 3UE0A 1WFQA 4LF6L 1HNXL 3M7NA 4DV4L 4AQYL 3I4NH 3EIVA 5JJKA 1VQ9A 2NN6I 3ULLA 2OTLA 3CQZH 1UE7A 5LMNL 4UP9A 1YITA 4JI8Q 4A3FG 1X9NA 3CCQA 2E8GA 4BBSH 3KF6A 4LUVA 4RMFA 1KIXA 4DR3L 1XTDA 4NXML 1V9PA 4MTNA 3KJOA 2JA5H 2BH2A 4A3GG 2B63G 3U4VA 5IWAL
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JBJ A;  2K75 A;  3ER0 A;  4R4Q A;  3Q8D A;  3CCL A;  5HGQ A;  4IPG A;  4B3M Q;  2Q2H A;  2B63 H;  2R6G A;  4DV1 Q;  4LF8 Q;  5GAH C;  2ID0 A;  3U58 A;  1NBW A;  1E1T A;  2BH8 A;  2V1C C;  1NTG A;  3GO5 A;  4OX9 Q;  4A3L G;  1RL2 A;  4DR6 L;  3J80 i;  3UE1 A;  4JI7 Q;  2D0P A;  1N36 Q;  1A62 A;  3HKS A;  4AQY Q;  4H02 A;  1HNZ Q;  4APV A;  4YCW A;  1GD7 A;  4A3I G;  4LUZ A;  1M90 C;  4ME3 A;  2ZJQ A;  4A3K H;  4OXP A;  4JYA Q;  2EXD A;  3F2D A;  1Y14 B;  2PNH A;  1KD1 C;  3KJP A;  2VS1 A;  4B3S Q;  1S72 A;  2IX1 A;  4A3M G;  5LMU L;  4DV0 Q;  1TXY A;  3AEV A;  5BR8 L;  2MNA A;  4P73 A;  4QL5 A;  4NPS A;  2NZH A;  1R9T H;  1Q1E A;  1CKO A;  3DLL A;  4DUZ L;  2QGQ A;  3HOX G;  1XMO L;  1PYB A;  3HOY G;  4DR6 Q;  5IP7 H;  3PF4 A;  2L15 A;  1YI2 A;  5FJ8 G;  1UWV A;  3K0X A;  3L7Z C;  1Q81 C;  2KEN A;  3GD7 A;  3K8A A;  1L1O B;  5M3M G;  1KC8 C;  1UEB A;  4K0K Q;  4IPC A;  4FDB A;  4B3M L;  2ZTC A;  1MIU A;  2RHQ B;  1M1K C;  2IHF A;  4TVA B;  3T1Y L;  2I5L X;  1NY4 A;  2UUC Q;  2NVQ H;  3GTM H;  3H0G G;  4DPG A;  4A93 H;  2VQE Q;  3ULP A;  2JA8 G;  4BY7 G;  2HIX A;  2XTI A;  5AJ3 L;  1WYD A;  5LMN W;  2OTJ A;  4R4C A;  1TWF H;  1FJG Q;  2KCM A;  5HY6 A;  2OCE A;  3D0F A;  4LFA Q;  1SMX A;  1VQL A;  2E2J H;  1K83 H;  1Y1W H;  4IFD I;  4L5S A;  3I7F A;  3HOU G;  1CSP A;  3CAM A;  1IL2 A;  2HQL A;  1WOC A;  3PUW A;  2DGY A;  2WFW A;  2Y0S E;  4B3T Q;  3CCU A;  2AHO B;  4DR1 Q;  1VQ4 A;  3HOZ G;  3CCJ A;  5IYB G;  5GAE C;  2R7D A;  2K52 A;  5H1S E;  3CC4 A;  3TS0 A;  4JBW A;  4GLV B;  4MZ9 A;  5IP9 G;  1H95 A;  4KI0 A;  3M85 A;  3S24 A;  3BU2 A;  4A3D G;  1OXT A;  1V43 A;  3PF5 A;  5GRO A;  5GQO A;  1IBK L;  1QUQ A;  2VUM G;  5C4J H;  1GM5 A;  3M4P A;  1N33 L;  2Z0S A;  3CPF A;  3J81 c;  5JEA J;  3RN2 A;  1EIF A;  1KRT A;  4GKK Q;  4IOA A;  1HR0 Q;  4POG A;  4JYA L;  4JI0 L;  1EIY B;  3CPW A;  1TWH H;  3SGI A;  2OWO A;  4B3T L;  1VQN A;  4IPD A;  4YCU A;  3HOU H;  4LW1 A;  4AH6 A;  3D31 A;  4A75 A;  1SE8 A;  1HNZ L;  1KL9 A;  4EQ5 A;  3CC2 A;  1N36 L;  1VQB A;  4GN5 A;  1YJ9 A;  3M3Y H;  5E7N A;  5C0X I;  4JV5 Q;  2CWP A;  1FJG L;  2ALY B;  3S1R H;  3ICE A;  3I4M H;  2IY5 B;  4PZ7 A;  5J3B A;  4X64 L;  2H5X A;  4A3C H;  5GAD C;  3K7U C;  1EQQ A;  3S1M H;  4JI4 L;  4A93 G;  1XMQ L;  2JA6 G;  2UU9 Q;  3T1Y Q;  2N8N A;  4GNX B;  1I5F A;  1Z9F A;  4GOP B;  3CMA A;  4OO1 G;  3RLF A;  4DV2 Q;  1E3P A;  2YV5 A;  2XGT A;  5FJ8 H;  4DV3 L;  3S15 H;  5IP7 G;  4LF7 L;  5LMN Q;  1W3S A;  3J81 j;  3PGZ A;  3OTO L;  3F2C A;  5BR8 Q;  1QZG A;  2KCT A;  3CF5 A;  1VQK A;  2MFI A;  2F3I A;  2Q2U A;  3GTQ H;  4BBR H;  1VQ8 A;  2ZTD A;  4IJH A;  4DV5 L;  2A8V A;  3BZC A;  2JA6 H;  2UXC Q;  1XPU A;  1OXS C;  1VCI A;  2WP8 J;  2RF4 A;  1PH1 A;  3EN2 A;  4C3I H;  1N9W A;  1PH6 A;  1D8L A;  2K5N A;  2JEB I;  4JI5 L;  1AE2 A;  1I94 L;  4KLK A;  4A3C G;  4OON A;  4BXX G;  3I2Z A;  3RN5 A;  3CCE A;  4JOI A;  3UDX A;  1IBL L;  4QIW E;  3I56 A;  2WB1 G;  1KAW A;  1ASY A;  3PO2 G;  3HKZ G;  1K3R A;  1UE1 A;  4YWK A;  1HNW Q;  1P8L A;  5C0X J;  2ZJR A;  4DR4 Q;  1IZ6 A;  2R92 H;  1QVG A;  1JB7 A;  4OX9 L;  3NEM A;  4OWW B;  4EX5 A;  3RR5 A;  5FLX c;  1EFW A;  5M5X H;  3KLW A;  2UXD L;  1VQJ A;  3H0G H;  3GTG H;  1PH3 A;  1K0R A;  3UDI A;  1YNX A;  1Y1V G;  4DV5 Q;  4DR2 Q;  5IWA Q;  4JI5 Q;  2IX0 A;  4DR5 Q;  1I94 Q;  2UXC L;  2UXB L;  2K14 A;  1Q8K A;  3S16 H;  4DR3 Q;  3HOV G;  5C0X G;  2NVT H;  1EYG A;  4BY1 G;  1UE6 A;  2HIV A;  1K8A C;  2UUB L;  3OW2 A;  1Q12 A;  1X56 A;  3H3V I;  2CKZ B;  1BBW A;  2IT1 A;  2CWA A;  5IP9 H;  3PSI A;  1D7Q A;  2OQK A;  4LF4 Q;  2OQ0 A;  2B3G A;  2RHS B;  5ELN A;  3PO3 H;  3RNU A;  3KYH C;  3M4O H;  2QEX A;  1HJP A;  2PMZ E;  4X65 L;  1VQO A;  1A63 A;  3PUV A;  4C2M H;  2D62 A;  2DUD A;  5EAY A;  2JJQ A;  4QQB X;  4OO1 I;  3I4O A;  2Z6K C;  1Y1V H;  3K80 C;  3RZO H;  1EQR A;  3CC7 A;  4X64 Q;  1VQA A;  4WJ4 A;  1LM0 A;  2LXJ A;  4DKA C;  2VQF L;  3L0O A;  4A3E G;  1XJV A;  2HHH Q;  1HNW L;  3F1Z A;  4PMW A;  3M9B A;  1KHI A;  3MEF A;  4X66 L;  5FLM G;  3AFP A;  1VQE A;  1T9H A;  3PUX A;  4C3H H;  5FLM H;  4JV5 L;  4DUY L;  4LF9 L;  2WAQ E;  4A3E H;  3A74 A;  5IY0 A;  2VZA A;  2A19 A;  3CCR A;  1VQM A;  3BJU A;  1IXR A;  3GTL H;  4DK6 C;  2E2H H;  3B6Y A;  1LYL A;  4JI1 L;  3UDG A;  4NXN L;  4R4T A;  1L0W A;  4AYB G;  1EOV A;  4JI0 Q;  4JI6 Q;  2JA5 G;  3GTJ H;  1X65 A;  3AFQ A;  1WCM G;  2NZO A;  2VUM H;  3PO3 G;  4QJF A;  1W2B A;  1NMG A;  3HOX H;  1L1O A;  1QVC A;  4IO9 A;  4DV3 Q;  5IYC H;  3K81 C;  1JT8 A;  1EUJ A;  2JEA I;  2PI2 A;  4BY1 H;  4JBK A;  4B3R Q;  4R1J A;  1NE3 A;  4X6A H;  3K7A H;  3OYY A;  1WCM H;  3UDF A;  1K8G A;  1B8A A;  4DV2 L;  3HOZ H;  1SN8 A;  1WI5 A;  4A4I A;  1BBU A;  4JI4 Q;  1E1O A;  3GTO H;  1SRU A;  1PV4 A;  3WWV A;  1K9M C;  1XNR L;  4JBM A;  2VL6 A;  1CKM A;  1I3Q H;  1G29 1;  2ZM6 L;  4IJL A;  4JOI C;  5IYD G;  1E7Z A;  5M3F H;  1VQI A;  4JI3 Q;  1C0A A;  1CSQ A;  3KF8 B;  4LFA L;  2VY3 A;  4IPH A;  1QZH A;  4MNO A;  4OWX B;  5AJ3 Q;  3I4M G;  5IYD H;  4A3D H;  3G48 A;  4KHP Q;  1MJC A;  3PIO A;  4BA2 I;  1SRO A;  1I6H H;  2K4K A;  2ZM6 Q;  2F52 A;  4DV6 L;  2VQE L;  4O2D A;  3JAM c;  4BXX H;  3VDY A;  4GKK L;  4KHZ A;  3PCO B;  1JJG A;  5M5W H;  4J15 A;  4P75 A;  1JMC A;  1N34 Q;  1J6Q A;  1RIP A;  3J7A 5;  4K0K L;  4BBS G;  5IE8 A;  1YEZ A;  3IRB A;  4B3R L;  5K36 G;  5C44 G;  1PH2 A;  4DK3 C;  3FKI H;  3PIP A;  4PZ8 A;  2ZJP A;  1B7Y B;  3H3V H;  2BA1 A;  4GN4 B;  1IBK Q;  1XPO A;  2RCN A;  2ASB A;  4A3M H;  4DUZ Q;  1AH9 A;  1YZ6 A;  3TEH B;  2PI2 E;  3S17 H;  2VNU D;  1G6P A;  3FP9 A;  1YIJ A;  1N32 L;  1VQC A;  4DR1 L;  3AQQ A;  3NEN A;  1OXX K;  4A3B H;  1KXL A;  2MO0 A;  1WJJ A;  1CKN A;  3CME A;  4JI6 L;  4NXN Q;  1U5K A;  1S3O A;  2WB1 E;  4JI1 Q;  5IYB H;  3RZD H;  2LXK A;  1AE3 A;  3G71 A;  4DAM A;  2C35 B;  2K5H A;  4UP7 A;  1PH5 A;  2E5L Q;  4JI7 L;  1B70 B;  4DAY B;  4KHP L;  2N3S A;  2A1A A;  1ASZ A;  1Q7Y C;  4AYB E;  2KHJ A;  5JEA G;  2ZTE A;  1YVC A;  1C7Y A;  3PO2 H;  2HHH L;  3CP0 A;  4UP8 A;  4LWC A;  2B29 A;  3H15 A;  1XNR Q;  2R7Z G;  3CXC A;  2GVB A;  2JQO A;  1JJ2 A;  4DV7 L;  4DV1 L;  2AWN A;  4GNX C;  4GOP C;  1FL0 A;  4NB3 A;  2UUC L;  1CUK A;  3S1Q H;  3KDF A;  1N8R C;  4LNQ A;  1X6O A;  4GOP A;  4A3F H;  5M3M H;  4GS3 A;  3STB D;  3W1G A;  4HJA A;  3ERS X;  2CQO A;  2MQH A;  1PH8 A;  2Q2T A;  3I4N G;  2K50 A;  2YTV A;  3BZK A;  3CW2 C;  5LMU Q;  4DV0 L;  5DLQ E;  4YWL A;  4DV4 Q;  1VQP A;  1SFO H;  1VQ5 A;  2E2I H;  4LF6 Q;  2ATW A;  2F4V Q;  5C3E G;  3HOV H;  2HT1 A;  2R93 G;  3FHW A;  4RG1 A;  3I55 A;  2PQA A;  4JCV E;  4HIM A;  4BA1 I;  1KQS A;  1FGU A;  4HIO A;  1I50 H;  5C4X G;  3J7Z C;  1HZ9 A;  4R4I A;  1YHB A;  1MJE A;  2UXD Q;  1Q82 C;  1N32 Q;  1VQF A;  2KBN A;  5M5Y H;  5C3E H;  5GAG C;  4DUY Q;  1NMF A;  2NVX H;  4A3I H;  2F4V L;  2JA7 H;  2R92 G;  1VQG A;  3KOJ A;  3CCS A;  1E22 A;  1HZC A;  4JG2 A;  3HOW G;  4QY7 A;  3A5U A;  1X3G A;  4YHH L;  1NJI C;  4WJ3 M;  1Q46 A;  2JE6 I;  1Q1B A;  3TQY A;  4LF8 L;  2N78 A;  1HZB A;  2AMC B;  1YJW A;  1X55 A;  3S1N H;  4BY7 H;  1L1O C;  3S2H H;  4UPA A;  1MKH A;  2EQS A;  4O0A A;  3ULJ A;  4X65 Q;  1BVS A;  4LF5 Q;  4DV7 Q;  2FXQ A;  4NXM Q;  2N49 A;  4BBR G;  4A3G H;  4L5R C;  1C9O A;  4JI8 L;  1X3E A;  4DV6 Q;  3U50 C;  3EBE A;  1OTC A;  4XIG S;  4JC0 A;  4P71 A;  3OTO Q;  3HOW H;  3S2D H;  3JAM i;  1P16 A;  2YTY A;  1SLJ A;  1YHA A;  4OWT B;  1E24 A;  4R4O A;  4HJ5 A;  1HNX Q;  2E5L L;  1PFS A;  5IT9 c;  2BA0 A;  3GTK H;  3W1B A;  4HJ8 A;  3GTP H;  2Z6K A;  2QA4 A;  1VQH A;  1VS0 A;  4LFB L;  4DR7 L;  1HH2 P;  3CD6 A;  4L5Q A;  4DR2 L;  1LTL A;  1XNQ L;  2UU9 L;  3T1H L;  2YTX A;  4A3B G;  1TWG H;  2AKW B;  4C3J H;  1CKN B;  3KFU A;  1HR0 W;  3PV0 A;  3CCM A;  3STB C;  2NVY H;  1PVO A;  3RLN A;  1Y1W G;  1J5E L;  4GKJ Q;  1PYS B;  3KF6 B;  3G6E A;  4PZ6 A;  2UUA L;  1QVF A;  3TRZ A;  1TWC H;  1G51 A;  4YY3 L;  1K73 C;  1YBY A;  3FKI G;  1A0I A;  1BKB A;  4PG3 A;  1IBL Q;  4P72 A;  4A3J G;  1IBM Q;  4A3L H;  3TS2 A;  3J80 c;  1N34 L;  2JA8 H;  2I5H A;  3JC6 6;  3PUY A;  3AYH B;  4JI2 L;  2GVA A;  3DM3 A;  1OXV A;  4LFC L;  2CCZ A;  4IFD G;  3KDF B;  1HR0 L;  4Y52 H;  4GN3 B;  1PH4 A;  4X62 Q;  3MXN B;  2JA9 A;  5ELO A;  4JI2 Q;  1DGS A;  3S14 H;  1N33 Q;  4L5T A;  3PUZ A;  4DNI A;  4TQU S;  4Y7N H;  4HJ7 A;  2UUA Q;  3GDE A;  3W5O A;  1TWA H;  5JJL A;  3TRE A;  4X66 Q;  4LF7 Q;  2Q2I A;  4JI3 L;  1PHJ A;  5M3F G;  2NN6 G;  1SR3 A;  2WAQ G;  3A5Z B;  4YY3 Q;  1PA6 A;  1PH9 A;  2JA7 G;  1UE5 A;  2VQF Q;  4GKJ L;  3E9H A;  4YWM A;  1XNQ Q;  4IFD J;  1VQ6 A;  1OXU A;  3RLO A;  4A76 A;  1U0L A;  4LFB Q;  4HIK A;  1XMQ Q;  1LUZ A;  2PQA B;  4XTC S;  1GO3 E;  1HZA A;  2LSS A;  4GLA C;  4YCV A;  2ES2 A;  4AIM A;  4IOC A;  4DR7 Q;  4QGU A;  4LF4 L;  4P74 A;  1VQ7 A;  2MO1 A;  1FVI A;  5IYC G;  4GNX A;  1S40 A;  2UUB Q;  5C44 H;  2Y0S G;  3HFZ B;  4LF5 L;  1Q86 C;  4LFC Q;  2UXB Q;  4X62 L;  2K5V A;  4DR5 L;  1GVP A;  3F2B A;  1JE5 A;  4LUO A;  3CCV A;  2R7Z H;  3A0J A;  3G4S A;  1IYJ B;  1A8V A;  3M4Q A;  2YYZ A;  3U4Z A;  1JJC B;  3NBH B;  2JK8 A;  4LF9 Q;  3NEL A;  1L2F A;  1YJN A;  1QUQ B;  2I0Q A;  1IBM L;  4YHH Q;  4A3J H;  4DR4 L;  2AWO A;  1XMO Q;  3HOY H;  1J5E Q;  2I5M X;  1X3F A;  3LGJ A;  4HJ9 A;  1Z47 A;  1EWI A;  3E9I A;  1O7I A;  2R7F A;  5C4X H;  1XPR A;  4UY8 C;  3E0E A;  2CFM A;  2VW9 A;  4B3S L;  1GKH A;  4ALP A;  2YU9 H;  2IHE A;  1KRS A;  3HKZ E;  5JJI A;  1PH7 A;  4HID A;  1X54 A;  4A3K G;  3T1H Q;  1V1Q A;  2KHI A;  3ZJY C;  4GLX A;  3J81 i;  3L2P A;  2EIF A;  2GN5 A;  1YHQ A;  4POF A;  2R93 H;  1VQD A;  2D0O A;  3F8T A;  3UE0 A;  1WFQ A;  4LF6 L;  1HNX L;  3M7N A;  4DV4 L;  4AQY L;  3I4N H;  3EIV A;  5JJK A;  1VQ9 A;  2NN6 I;  3ULL A;  2OTL A;  3CQZ H;  1UE7 A;  5LMN L;  4UP9 A;  1YIT A;  4JI8 Q;  4A3F G;  1X9N A;  3CCQ A;  2E8G A;  4BBS H;  3KF6 A;  4LUV A;  4RMF A;  1KIX A;  4DR3 L;  1XTD A;  4NXM L;  1V9P A;  4MTN A;  3KJO A;  2JA5 H;  2BH2 A;  4A3G G;  2B63 G;  3U4V A;  5IWA L; 
#chains in the Genus database with same CATH topology
 4JBJ A;  4R4Q A;  5KFK A;  3K5I A;  3Q8D A;  4XYQ A;  1E2Z A;  1QOH A;  2B63 H;  4B3M Q;  2Q2H A;  3T56 B;  1H9M A;  3R3O A;  1KJ9 A;  1PLF A;  1FGB D;  2GLT A;  5GAH C;  2ID0 A;  3U58 A;  1NBW A;  1E1T A;  2IMW P;  1CHQ D;  2QDL A;  2CH4 W;  4ME5 A;  1SYX B;  1M0T A;  1ZEQ X;  4BY7 B;  4DR6 L;  1R9T A;  3L3O C;  2XGP A;  1STE A;  1U4P A;  1EZ6 A;  1V8Q A;  5CV5 A;  3N43 B;  2FFK B;  2WDT A;  2YW2 A;  4C5A A;  4J9S A;  4OXP A;  3A7L A;  2PNH A;  5IOD A;  3KJP A;  3GTM B;  1BCP F;  1XYI A;  5LMU L;  4DV0 Q;  2E2I B;  4X66 H;  1PZK D;  4P73 A;  2X0S A;  2NN6 H;  3I12 A;  1SYF A;  1E4F T;  1D7Q A;  1BO0 A;  2ZT9 C;  1KNA A;  3BVM A;  4FS2 A;  1MBY A;  2L15 A;  1YI2 A;  5FJ8 G;  3FMA A;  3K0X A;  3MTS A;  3RF2 A;  1KDA A;  2B2V C;  5M3M G;  1KJQ A;  5LOV F;  1L1O B;  3V2T A;  3OUU A;  5T1G A;  1KJJ A;  2ZTC A;  1MIU A;  1PRT C;  2NVQ H;  3BVG A;  1NY4 A;  3P75 A;  5KG7 A;  4ED8 A;  1EIH A;  4A3J B;  5FPR A;  4J0M A;  2C2R A;  5CV6 A;  3EVQ A;  5LMN W;  2OTJ A;  4YR2 A;  4UAI A;  1FJG Q;  5HY6 A;  1BQQ T;  1B50 A;  1W6K A;  3D0F A;  1SMX A;  1VQL A;  1Y1W H;  2CW0 C;  2FPG B;  5KT3 A;  4QWC A;  4B3T Q;  2Z9H A;  1WVL A;  1RD9 D;  2PQE A;  3CCJ A;  4ODG A;  4DUY H;  2R7D A;  3D6W A;  5EQ0 A;  2YZG A;  4DV1 H;  1LAC A;  2ZXR A;  1U9R A;  4GLV B;  5IP9 G;  3JSN A;  2RGR A;  2XC9 A;  3M85 A;  1X32 A;  3KHL A;  2OXP A;  3OSO A;  3P1H A;  3S1Q B;  4Q0Y A;  5ELB A;  3PF5 A;  2ASD A;  1EWH A;  1IBK L;  1N48 A;  1GM5 A;  3SVM A;  3CPF A;  3J81 c;  4DL5 A;  3RN2 A;  2NU6 B;  4I7A A;  4F7X A;  3SHL A;  4JYA L;  2Z4H A;  4JK1 C;  4QW9 A;  1I4H A;  3CPW A;  2EY5 A;  4Y8V B;  2K1B A;  4RCO A;  1ZET A;  1SE8 A;  1HNZ L;  3QO2 A;  1OWT A;  3CVZ A;  4EQ5 A;  4LH7 A;  1YJ9 A;  3NQI A;  5E7N A;  2DJF C;  2CWP A;  4O1N A;  2V58 A;  5DLG A;  2AGP A;  1GJX A;  5GON F;  3S1M H;  3DMU A;  4JI4 L;  3KAK A;  4A93 G;  2VUM A;  3J7Y W;  3KLS X;  3GQC A;  4OX9 H;  4B9X A;  2E2I A;  1UUP A;  3KF8 A;  3RLF A;  4DV2 Q;  1EQV A;  2V9W A;  4R8U B;  5DLF A;  1STB A;  1SXT A;  5IP7 G;  1LT3 D;  5F2D A;  2K05 A;  3J81 j;  4EEQ A;  5IGG A;  4CDC C;  1RTO A;  3GII A;  1L2Z A;  1CZW A;  2Z1C A;  3F2C A;  2D9U A;  3CF5 A;  3PIO 3;  1QCB D;  4G7H C;  5C8Y F;  2LMC B;  3SK6 A;  4JI0 H;  3D6C A;  4KHP H;  3KHH A;  2A8V A;  2JA6 H;  2R7M A;  1LT4 D;  1VCI A;  4OIJ A;  1K3B C;  3EN2 A;  1PH6 A;  1I94 L;  4OGQ C;  3S1N B;  1AE2 A;  4A3C G;  4BXX G;  4PMB A;  3UDX A;  1O75 A;  4QIW E;  3KHG A;  3TIN A;  2WB1 G;  3IAY A;  1ASY A;  4QWB A;  3HKZ G;  1K3R A;  4BS9 A;  4YR0 A;  1HNW Q;  1Y1W B;  1CK1 A;  1SND A;  1QVG A;  4OX9 L;  3NEM A;  4RUA A;  1EUD B;  4EX5 A;  2JEJ A;  2O2L D;  3EFX D;  1STA A;  3GTG H;  3RUP A;  1K0R A;  1YNX A;  4JI5 Q;  4DV5 Q;  3I4N B;  2UXC L;  3ETJ A;  2IX0 A;  4RGM A;  3KBG A;  4JI1 H;  4RHR A;  3G6V A;  4J9M A;  2NTS A;  1EYC A;  4K8J A;  4LSA A;  5HUR A;  1UE6 A;  1X3Q A;  1K8A C;  1TWG B;  4HMJ A;  5FD5 A;  4XXE A;  5KFQ A;  2C5C A;  5K36 H;  1IHZ A;  5ELN A;  5A2Q W;  2F0Q A;  5EGT A;  2H4O A;  5T14 A;  2EYO A;  2WYO A;  2QEX A;  4GC6 A;  3MR3 A;  1VQO A;  1V51 A;  1PTO F;  3PUV A;  4OO1 I;  1XNR H;  2HQE A;  3RZO H;  5KG5 A;  1EQR A;  3GIQ A;  4J9R A;  4X64 Q;  5KG0 A;  2DZD A;  3MFI A;  2IPK D;  4CBV A;  1DV2 A;  2B2W C;  3VR6 A;  3C1E A;  1HCZ A;  2W70 A;  3DHQ A;  3PUX A;  4H44 C;  4JV5 L;  1K28 A;  5IY0 A;  2Z6B A;  4Q8F A;  2KHS A;  4DK6 C;  4FXK C;  2E2H H;  2AGO A;  3IL8 A;  3K3V A;  2HDM A;  1C4Q A;  4UCO A;  4P2C B;  1PFB A;  3LWE A;  4R4T A;  3BVZ A;  4AYB G;  1EOV A;  3Q8R B;  2VB2 X;  2PN1 A;  2VUM H;  3R5F A;  2XCA A;  3PO3 G;  1NMG A;  5FO7 B;  4A3F B;  3JSL A;  1AUV A;  5IYC H;  5EPJ A;  3C3L A;  1EUJ A;  4BY1 H;  2KCN A;  1K1S A;  4B3R Q;  4R1J A;  2B2U C;  2RKS A;  4KHV A;  1IW7 C;  3UDF A;  3GTG B;  1K8G A;  1B8A A;  4DV2 L;  1HNW H;  1SN8 A;  4JV1 A;  1BBU A;  1PRT B;  4IUQ A;  1A6X A;  4C1N K;  1PV4 A;  5LP6 F;  1RDP D;  4O3O A;  2ZM6 L;  1HFG A;  1MHW C;  4KD3 A;  5CB4 F;  4KJN A;  4AQY H;  5LMU H;  1T36 A;  2YS6 A;  2PZU A;  4KHP Q;  1IYU A;  3SDZ A;  3PIO A;  3VYR A;  1VBG A;  4TV9 F;  5KNC A;  4F4W A;  2F52 A;  4PDB A;  4O2D A;  1V4Y A;  4RGO S;  4FF2 A;  2UVW A;  1WTQ A;  3AU7 A;  3G6Y A;  2UVR A;  4J1M A;  5CAE B;  1JMC A;  3VPC A;  4KV6 A;  1J6Q A;  2YCH A;  4U6P A;  4WJW A;  1ONL A;  4NMZ A;  3V05 A;  3IRB A;  4XT1 B;  5K36 G;  3PIP A;  4PZ8 A;  2K32 A;  4GN4 B;  1IBK Q;  1C8C A;  4JW0 A;  2NB0 A;  1XPO A;  2R7Z B;  1VAJ A;  1EFI D;  4CC5 A;  2ASB A;  1AZP A;  3EA6 A;  3J7A V;  3S17 H;  5DG8 A;  2VNU D;  3Q8P B;  5IWA H;  3NEN A;  4MV3 A;  2R8I A;  3PVX A;  4NXN Q;  2EYL A;  4QWD A;  3CME A;  1HNZ H;  1S3O A;  1F2Y A;  4ZAI A;  1AEX A;  2PW7 A;  4MA5 A;  4FM9 A;  1MSG A;  2LXK A;  4DNR B;  2ZDQ A;  4IR9 A;  2M9V A;  4JI7 L;  5C3E B;  2WIN B;  4LF4 H;  4ZHQ F;  4AYB E;  4A3M B;  2ZTE A;  3T4A C;  1C7Y A;  2V4Q A;  3CP0 A;  4LWC A;  2K6A A;  1S5C D;  1RJR A;  4Q45 A;  1XNR Q;  2R7Z G;  3CXC A;  2GVB A;  1ZYR D;  3CQZ B;  2SCU B;  4C3I G;  4DAV A;  2R7K A;  3S9W A;  1BGW A;  5H80 A;  4IWY A;  3S1Q H;  3MR5 A;  3A54 A;  4A3F H;  2PZT A;  5M3M H;  1WH2 A;  3Q8Q B;  3I73 A;  1S10 A;  3K0Y A;  2CQO A;  2MQH A;  3I4N G;  3CCL A;  3BZK A;  2K5W A;  4A3D H;  3OW7 A;  1CE8 A;  2ATW A;  3PN1 A;  5C0X H;  1S0N A;  4LF6 Q;  5C3E G;  1H9R A;  2HT1 A;  3I55 A;  4O3S A;  3Q22 A;  1LTG D;  1JIH A;  2E74 C;  4X3T A;  1VKZ A;  1CT1 D;  1ZYR C;  3DXJ C;  4F87 A;  2E2J B;  3J80 E;  4YB8 B;  1HZ9 A;  2RSN A;  2UXD Q;  5C3E H;  1NAP A;  3UI2 A;  5GAG C;  4A3G B;  2NVX H;  2JA7 H;  4A3I H;  5EZY F;  1WTX A;  4LAA A;  4JG2 A;  1E22 A;  2A73 B;  3MJF A;  4MHE A;  1GOZ A;  4L6T B;  3M4O B;  3GTJ A;  2I07 B;  3T16 A;  3TQY A;  5KKN B;  3ZYY X;  4L63 B;  5LA6 F;  3TSS A;  4Q0F A;  1X55 A;  5C44 B;  3H09 A;  1WD0 A;  1L1O C;  4DA2 A;  4DR7 H;  1HA5 A;  5J39 A;  1O7L A;  4MV8 A;  4O0A A;  4EBE A;  4DU9 A;  3MWE A;  1XX8 A;  2K01 A;  4MV6 A;  2F3V A;  2JN4 A;  2PZW A;  3HS0 C;  5CV7 A;  2FE3 A;  1JX4 A;  2N49 A;  2WKD A;  4XYM B;  3F8N A;  4ETS A;  1Y8N B;  2UVU A;  3EBE A;  4F4Y A;  3TP5 A;  4P71 A;  1W6J A;  1I7L A;  3A7A B;  4AYB B;  3PW7 A;  4C2M B;  4BWG B;  2EYM A;  2LFN A;  4C2M A;  4K5V A;  1K8M A;  3GTK H;  2KEC A;  4J9L A;  1R4P B;  3M3Y B;  1YNJ C;  1PZI D;  2QA4 A;  2NVX A;  1VS0 A;  3X3N A;  4ID6 A;  4UDU C;  5EJW A;  2C2E A;  1EYA A;  3T1H L;  1TWG H;  5C5J A;  1CKN B;  2I8C A;  5M3M B;  3VMM A;  2SOB A;  4ULL A;  1CQJ B;  3BJY A;  3CCM A;  4B3M H;  1Y1W G;  3OWE B;  4GKJ Q;  2FKL A;  2PVP A;  3CHB D;  3W3A A;  1II3 A;  4YY3 L;  3WO1 A;  1YBY A;  3NXW A;  1A0I A;  3E5S A;  5D3I B;  5LMN H;  4PG3 A;  3V4S A;  4MA0 A;  5DQH A;  1Y1V B;  1YNN C;  3X3M A;  2J4X A;  2XNA C;  3BZD B;  1OXV A;  1S5E D;  1HR0 L;  4Y52 H;  3EPI A;  4XT3 B;  2ZJT A;  4A3I B;  2JA9 A;  1UC9 A;  2K04 A;  5CMD A;  2UUA Q;  3W5O A;  3HOZ B;  5JPN C;  3RB6 A;  2Q2I A;  2R61 A;  4JI3 L;  1PHJ A;  2NN6 G;  2JA7 G;  4F8M A;  3OWF A;  3E9H A;  4YWM A;  1GHK A;  4DR4 H;  2F1M A;  4QIW A;  1U0L A;  1LUZ A;  1TR5 A;  2PQA B;  4GLA C;  4RZQ A;  4IOC A;  2FLP A;  4JUZ A;  4DXF A;  2EYF A;  3NHH A;  4LF4 L;  4LF5 H;  5DGA A;  1FVI A;  1G91 A;  3L9A X;  1SYB A;  1S40 A;  5F9L A;  1KEE A;  4RAU C;  2J7Z A;  1GGO A;  3QR8 A;  2FMA A;  5HGT A;  2XN9 C;  4G3I A;  2Y0S B;  1IKM A;  1Q86 C;  4DK1 A;  2K5V A;  3ORQ A;  2EJM A;  4Q43 A;  1FR3 A;  4CKE A;  3PO3 B;  4IRK A;  3M4Q A;  3U4Z A;  4R7R A;  3NEL A;  2I46 A;  4YP3 A;  1IBM L;  4A3J H;  1EEF D;  1XMO Q;  4RB0 A;  4C3I B;  1DXM A;  3HOY H;  1TWF B;  3LGJ A;  5I6Y A;  5KFP A;  1Z47 A;  3E9I A;  5BN5 A;  1O7I A;  2R7F A;  3R2T A;  2VPS A;  4IUV A;  1BCP C;  4UY8 C;  2XIW A;  3E0E A;  5I4D A;  4FF3 A;  4ALP A;  2KQ3 A;  2IHE A;  2B2T A;  5JJI A;  1PH7 A;  4GC7 A;  2B8G A;  2AQ2 B;  5JVG 3;  2RDF A;  1YHQ A;  3K59 A;  4POF A;  4ED7 A;  1A15 A;  3UE0 A;  2BCO A;  3RBD A;  4CDE C;  1BOS A;  4EQO A;  3TQ1 A;  4U67 3;  4EG0 A;  5JJK A;  2F0M A;  2EOT A;  2OTL A;  1GSO A;  4TUY F;  2ZM6 H;  1ZKO A;  3KF6 A;  1JR0 D;  1BDO A;  3JAM W;  1V9P A;  4CKB A;  2JA5 H;  2BH2 A;  1I50 A;  1IKL A;  4L1K A;  2ICI A;  4C3H B;  5IWA L;  4QCL A;  4IRD A;  2K75 A;  1AUX A;  4KY5 A;  1CA6 A;  3HBL A;  4IPG A;  3Q8S B;  1FNU A;  4UCR A;  1LT6 D;  3OMG A;  5KEE A;  2R6G A;  2DLN A;  1PXU A;  3M9M B;  2JP1 A;  1NTG A;  4OX9 Q;  1CQF A;  1J9O A;  2RCF A;  4LFB H;  1RL2 A;  5BN3 A;  5LL6 S;  3J80 i;  1GUT A;  3UE1 A;  3N6R A;  2K7V A;  3QJY A;  1G6Z A;  1S5D D;  2D0P A;  2X6L A;  1I3Q A;  1I3Q B;  1GD7 A;  1PMR A;  3Q1K A;  4QIW B;  3A56 A;  2Q8T A;  3VR5 A;  4A3K H;  2X6G A;  2SNS A;  3F2D A;  1NR2 A;  1Y14 B;  1KD1 C;  1HRJ A;  2VS1 A;  4M7E A;  2LKV A;  4FXG C;  4RWS C;  1M6V A;  4ZCK A;  2KJX A;  3AEV A;  2TSS A;  3OOC A;  4QL5 A;  1SYG A;  5T1I A;  5KX5 F;  3QB3 A;  2NZH A;  1R9T H;  1Q1E A;  1CKO A;  1SNO A;  3DLL A;  3HOX G;  4DUZ L;  1XMO L;  1PYB A;  3HOY G;  4DR6 Q;  3R23 A;  4RHS A;  3PF4 A;  4DL6 A;  2O5I C;  3HB9 A;  4Z9C B;  1RTN A;  3L7Z C;  2EJG C;  4YHH H;  1KC8 C;  1UEB A;  1JDB B;  5KNB A;  2RHQ B;  2IHF A;  5CV8 A;  3GTM H;  4GZY C;  5D3D A;  3H0G G;  4A93 H;  2VQE Q;  1U4R A;  3GIK A;  4DR2 H;  2YU9 A;  2JA8 G;  3VR4 A;  3NTI A;  4I4T F;  2F0T A;  4BY7 G;  2HIX A;  2XTI A;  5AJ3 L;  4F50 A;  4R4C A;  1V1O A;  1TWF H;  3AB9 A;  5EDW A;  1KDC A;  3C46 A;  1EY0 A;  4M8A A;  3EQL C;  2WB1 A;  1K83 H;  4C5B A;  2OF1 A;  3I4M B;  4L5S A;  4YIJ A;  1CSP A;  3HOU G;  3CAM A;  2W9B A;  1IW7 D;  2W9B B;  1TS3 A;  3MEH A;  3CCU A;  3SE7 A;  5KFY A;  4JI8 H;  3HOZ G;  5GAE C;  4J8Q A;  5EKK A;  5JQW A;  1LAB A;  5H1S E;  3CC4 A;  4J9N A;  3TS0 A;  5KFH A;  1CHP D;  1B33 N;  4MZ9 A;  2CVR A;  4KI0 A;  3TME A;  4V19 0;  3H4B A;  3BU2 A;  3GV6 A;  4A3D G;  4HYK A;  1V43 A;  3HEJ A;  5GRO A;  5EBD A;  5GQO A;  1QUQ A;  2WV6 D;  5DNF A;  5C4J H;  1E4G T;  4JI5 H;  2A68 C;  2QYZ A;  2Z0S A;  4X65 H;  2FLN A;  1KLG D;  1EIF A;  3NWS A;  1KRT A;  2NUA B;  4IOA A;  3QG1 A;  1HR0 Q;  1HUM A;  4POG A;  1EIY B;  1SNQ A;  3C0F B;  1TWH H;  2EYP A;  4B3T L;  2QF7 A;  3MWM A;  1F9R A;  4DLK A;  3OIQ A;  1VQB A;  4RB3 C;  1TVX A;  2ALY B;  3I4M H;  1BUV T;  4DFA A;  2H5X A;  3BDL A;  4KY6 A;  1EQQ A;  1G2S A;  3D8G A;  1XMQ L;  1V1P B;  4K0K H;  2N8N A;  2F0E A;  1I5F A;  2F0V A;  3CMA A;  4OO1 G;  3DUZ A;  2F0L A;  5L37 A;  5FJ8 H;  3GTM A;  1K8O A;  3S15 H;  1JB3 A;  2AUJ D;  1A2U A;  2Z4I A;  2VQE H;  1IBL H;  2JEG A;  3EJI A;  2A5H A;  1QZG A;  1A9X A;  1F2Z A;  3S1M B;  4LFA H;  2MFI A;  2NVY A;  3GTQ H;  1I6V C;  4JYA H;  3SXH A;  1VQ8 A;  1J8I A;  3H4D A;  1XPU A;  1SCU B;  1OXS C;  2WP8 J;  1NNX A;  4QF4 A;  1B3Q A;  2JEB I;  4JI5 L;  4FS1 A;  2NU7 B;  1AP0 A;  4JOI A;  3I56 A;  2D5D A;  3S16 B;  4KY7 A;  3GTJ B;  4DR1 H;  3PO2 G;  1JWU D;  5IGB A;  5D14 A;  1UE1 A;  4HSV A;  1K83 B;  3P20 A;  1P8L A;  3PW5 A;  2ZJR A;  4DR4 Q;  3RIZ A;  3NE5 B;  1JB7 A;  5EWF A;  4OWW B;  1EFW A;  1BCP B;  2UXD L;  1BNZ A;  1VQJ A;  1FNV A;  3H0G H;  2NYZ D;  4IUR A;  1TWC B;  3WNZ A;  4EGQ A;  1PH3 A;  4JI4 H;  3UDI A;  4UCT A;  1I94 Q;  4FYD A;  2K14 A;  4QWE A;  4DR3 Q;  2V5A A;  2F03 A;  4DGZ A;  2NVT H;  2PPB C;  1UEA B;  4BY1 G;  2UUB L;  1Q12 A;  2CKZ B;  4B9W A;  4ED1 A;  1W96 A;  1STH A;  3NWT A;  4LF4 Q;  4G57 A;  2OQ0 A;  2B3G A;  3PO3 H;  5BPH A;  3RNU A;  4N9T A;  3OUZ A;  4F4Z A;  1A63 A;  1RJQ A;  2D62 A;  4K6D A;  1TA8 A;  4LMY A;  2Z6K C;  5KYL A;  3JAM E;  1IBK H;  4Q8E A;  3CC7 A;  1VQA A;  1HPC A;  2LXJ A;  4WJ4 A;  3L0O A;  1GUN A;  4PMW A;  3RGX A;  1KHI A;  3MXP A;  5FLM G;  3BQ0 A;  3MFY A;  1JOR A;  3N8D A;  4CJ1 B;  5A2Q L;  4DUY L;  2XSC A;  1S4Z A;  4A3E H;  3CCR A;  1VQM A;  5KT2 A;  4JV2 A;  3BJU A;  4RH6 A;  3K6O A;  2L11 A;  3B6Y A;  1PK8 A;  1LYL A;  3UDG A;  2JSO A;  2B63 A;  4JI6 Q;  1X65 A;  2SNM A;  3AFQ A;  1BBX C;  1TQO A;  1L1O A;  1QVC A;  3DEP A;  4IO9 A;  1EZ1 A;  2JEA I;  4JBK A;  1NE3 A;  5ELC A;  3GIL A;  2CW7 A;  4K5X A;  4OO1 H;  4JI4 Q;  4KKT A;  1SYD A;  5FO8 B;  1SRU A;  3H3V C;  2PMZ A;  3WWV A;  4K5W A;  2VUM B;  1VMC A;  1EY5 A;  4C5C A;  3I90 A;  2ICE C;  4DV5 H;  1S0O A;  1E7Z A;  5BR8 H;  1C0A A;  2W9A A;  3KF8 B;  2VY3 A;  1QZH A;  4DV4 H;  4MNO A;  2B8F A;  4X3U A;  1MJC A;  1SRO A;  4WOR A;  2K4K A;  2ZM6 Q;  1GSH A;  1TWA B;  4BXX H;  4FF1 A;  1ENF A;  2VPQ A;  5A2Q E;  1ENC A;  1DCZ A;  1M8A A;  1D5Z C;  3PCO B;  4RNO A;  3PR4 A;  2B2V A;  2F0O A;  1TII D;  1N34 Q;  1RIP A;  1H9K A;  4PQX A;  5C4H A;  2Y0S A;  4BBS G;  4B3R L;  4DK3 C;  1EHI A;  1B7Y B;  1I7N A;  2E76 C;  4RU9 A;  3PW4 A;  5G3L D;  4XYO A;  2RCN A;  2R87 A;  3RBE A;  1HUN A;  5LXT F;  5KFV A;  4N8F A;  4MTE A;  2PI2 E;  2R84 A;  5LHY 1;  1VQC A;  1N36 H;  1KAB A;  4DR1 L;  1KXL A;  1OXX K;  4A3B H;  2BQU A;  1N56 A;  1U5K A;  5IYB H;  1I4Q A;  3BAB A;  3GTO A;  3ND9 A;  1JDE A;  4OEL B;  1B3A A;  5L1L A;  2C35 B;  1PH5 A;  2E5L Q;  3PR5 B;  5DG9 A;  2N3S A;  3DM1 A;  5C3W A;  1Q7Y C;  5JEA G;  1N33 H;  1IYV A;  1C48 A;  3HOW B;  4TQS A;  1DZ1 A;  4ZKB B;  5C1O A;  2B29 A;  4ECZ A;  2JQO A;  1SNC A;  4DV7 L;  2FHT A;  3FPU B;  4GOP C;  1STG A;  3RAQ A;  4NB3 A;  3N52 A;  3KDF A;  1X6O A;  4GOP A;  1NSN S;  4GS3 A;  3STB D;  3T5K A;  2ATL A;  4V0B A;  3W1G A;  3GV5 B;  3ERS X;  1D2B A;  3RB0 A;  2CQA A;  2JA6 B;  4MV1 A;  5G3L F;  5LMU Q;  4DV0 L;  1SFO H;  5DLQ E;  1LTS D;  1VQP A;  2A68 D;  2F4V Q;  3HOV H;  4MTD A;  1HR0 H;  2R93 G;  1L0Y B;  2DNE A;  2HJW A;  1HHV A;  2W6Q A;  5E1F A;  4O4H F;  1VQF A;  3BS1 A;  4IUP A;  3V4Z A;  2F4V L;  1S5B D;  1SEB D;  3D3R A;  1VQG A;  3A55 A;  5DEH A;  5FK9 C;  3CCS A;  4IUU A;  2R92 G;  3GTQ B;  2KSW A;  4WJ3 M;  3A5U A;  4ECY A;  1O80 A;  2KOL A;  3G6J B;  4DL3 A;  3S17 B;  2SDF A;  3OMC A;  2AMC B;  1I4X A;  1XNQ H;  4A3B B;  3S1N H;  1CM9 A;  3S2H H;  2HGS A;  3M7G A;  1G8Z D;  1TT2 A;  2PNR C;  5CBA E;  4C56 C;  3ULJ A;  4X65 Q;  1BVS A;  4DV7 Q;  4NXM Q;  1PTO D;  4L5R C;  1C9O A;  1B1Z A;  2OLS A;  1GSA A;  5ELD A;  1RJP A;  3U50 C;  3K5O A;  4EQN A;  3OTO Q;  4X3K A;  3HOW H;  3DF7 A;  1K0S A;  1P16 A;  2HVR A;  5AFW A;  4IR1 A;  1SLJ A;  1YHA A;  1TU2 B;  2HD3 A;  2IP4 A;  4HJ8 A;  1T5X D;  2RDH A;  2P0A A;  2ZXO A;  2A6E D;  1NR4 A;  1R4Q B;  3I70 A;  3A8K E;  3MVV A;  4DR7 L;  4QUC A;  3CD6 A;  1EOT A;  4A3B G;  2L1B A;  2GPW A;  4YAJ B;  2BE5 C;  3SE0 A;  1PRT D;  1O7Z A;  3PV0 A;  4O42 A;  3STB C;  1ROD A;  1PVO A;  3RLN A;  1J5E L;  1PYS B;  3GV8 B;  3TRZ A;  1ZXT A;  1K73 C;  2RQX A;  1TWH A;  5IIF A;  1BKB A;  1TS5 A;  1FD7 D;  1NCV A;  4P72 A;  4HCS A;  4A3L H;  4FO2 A;  3I72 A;  3TS2 A;  1RCV D;  2JA8 H;  2I5H A;  3JC6 6;  3MR6 A;  3AYH B;  4K2K A;  3DM3 A;  2JA5 B;  1LTR D;  4LFC L;  1EY8 A;  5L1J A;  1RKN A;  3KDF B;  1OO9 B;  2WAQ A;  1LV9 A;  4S3S A;  2R8G A;  3MXN B;  4KK7 A;  1WTP A;  5ELO A;  4BY1 B;  3VPB A;  1DGS A;  3S14 H;  3R2I A;  2A6H D;  1ENA A;  2C00 A;  3PUZ A;  4DNI A;  4TQU S;  4HJ7 A;  1ULZ A;  3SI8 A;  3RB3 A;  5JJL A;  4X66 Q;  1SEI A;  5FLX E;  4APM A;  5COR A;  2MPM A;  5M3F G;  1PA6 A;  1SR3 A;  5IYD H;  3A5Z B;  1RK5 A;  5BPF A;  3TQT A;  1ZHS A;  3GQB A;  2F0H A;  2PBZ A;  1CS0 A;  5CA1 F;  2HCI A;  2N55 A;  4MTK A;  3RLO A;  4A76 A;  1XMQ Q;  1SMY D;  3Q2O A;  1ET9 A;  1GO3 E;  2LSS A;  4XTC S;  4A3K B;  2ES2 A;  4IUT A;  1LTB D;  4PWQ A;  4LF8 H;  4DR7 Q;  1TWF A;  3U9O A;  3JAM L;  5KG6 A;  1SFO A;  4ZRZ A;  4XQJ A;  2CQY A;  3H40 A;  4MAM A;  2NU8 B;  4ED3 A;  1MZB A;  1SDF A;  3HFZ B;  4EVO A;  3HKZ B;  4LFC Q;  5EKL A;  4X62 L;  4DR5 L;  3OSN A;  1I4R A;  3GTP A;  5JPM C;  1B04 A;  1QWY A;  4CDF C;  4ECU A;  3G4S A;  2VXW A;  1IYJ B;  2NWG A;  1JJC B;  2H1E A;  1L2F A;  2I0Q A;  1QUQ B;  3UFX B;  4EFB A;  4HNV A;  4YHH Q;  3VR3 A;  5JEA H;  2E2H A;  3DWQ A;  5LL6 X;  3FRP B;  2I5M X;  5C5M A;  4HR7 B;  1RYS A;  3Q6S A;  3Q24 A;  4HJ9 A;  2UUC H;  1EWI A;  3MHB A;  4FNF A;  3IG0 A;  3R8B A;  3HG9 A;  1HQR D;  1T5E A;  3OHX C;  2VW9 A;  1EZ8 A;  3GV7 B;  1GKH A;  5DG7 A;  2YRX A;  3HKZ E;  1XWE A;  3J7A F;  1UNS A;  3T1H Q;  4UCV A;  1VBH A;  3KAL A;  3L2P A;  5K5P A;  5HV6 A;  2GN5 A;  2QIL A;  2D0O A;  2I80 A;  3CRL C;  3MC0 B;  1WFQ A;  1W93 A;  1BR9 A;  4X62 H;  3ITP A;  3M7N A;  4AQY L;  4R8N A;  3I4N H;  3EIV A;  4RA8 A;  1DV1 A;  3ULL A;  4XYL B;  4DAY A;  2O5J C;  4UP9 A;  1V1P A;  2E8G A;  5C4X B;  1KIX A;  4I55 F;  4DR3 L;  1JKJ B;  2JA5 A;  1I4G A;  2HCC A;  3NP8 A;  4Q44 A;  3ER0 A;  2V59 A;  2HVS A;  1M0W A;  2DY7 A;  2I87 A;  4DV1 Q;  4A3D B;  3CKI B;  3GO5 A;  2V1C C;  4XX0 B;  4A3L G;  4R9W A;  4CJ0 B;  1X3P A;  1B9M A;  4JI7 Q;  4DF7 A;  1ML0 D;  1N36 Q;  4AQY Q;  4WD3 A;  5KT4 A;  4H02 A;  3HP3 A;  1HNZ Q;  4YCW A;  4NXN H;  3R93 A;  4A3I G;  1UAP A;  5COY A;  3PZP A;  3A8I E;  1M90 C;  1M4V A;  4ME3 A;  4JYA Q;  5KFR A;  4RGT A;  4J9P A;  3NK9 A;  1Z2N X;  3J81 E;  1DIK A;  2PCF B;  4LFC H;  4A3M G;  2F0F A;  1S03 G;  2MNA A;  2VA3 A;  2WKC A;  3T51 B;  3VPD A;  2EY6 A;  4NPS A;  1LTA D;  1JOQ A;  1UWV A;  2L4N A;  1Q81 C;  3GD7 A;  1S97 A;  3K8A A;  4PNY A;  1WTV A;  1J5E H;  4K0K Q;  5J2T F;  4IPC A;  4FDB A;  2JA7 B;  4NDX A;  4BBR B;  1M1K C;  4TVA B;  2UUC Q;  2I5L X;  3D4D A;  1G2T A;  4IRC A;  4DPG A;  5JVL A;  4NLG A;  3ULP A;  2E2H B;  3Q23 A;  1WYD A;  3FKI A;  5FD6 A;  1KTK A;  1TKW B;  2UVV A;  5EPL A;  5CYU A;  2OCE A;  1QJO A;  2WAC A;  4LFA Q;  2BDN A;  2E2J H;  1DYQ A;  4IFD I;  5KFB A;  2JEI A;  3BDC A;  2UXB H;  4ED2 A;  2P5Z X;  1IL2 A;  2UXC H;  1WOC A;  2EJF C;  2WFW A;  2Y0S E;  1H9S A;  2XD4 A;  1S0M A;  3OHB A;  2VA2 A;  3PQI A;  2E2D C;  2AHO B;  2SEB D;  4DR1 Q;  3QFF A;  4MV4 A;  3E6Z X;  4UCS A;  2W7O A;  4O4I F;  4RAY A;  2K52 A;  3OIP A;  3CRK C;  1JOK A;  4HED A;  5DQG A;  5EWE A;  3G6X A;  5D65 A;  1TY2 A;  3KHR A;  4KD4 A;  2W9C B;  1OXT A;  4RKL A;  2HHH H;  2VUM G;  5I9P A;  3MA2 B;  3MAQ A;  1N33 L;  3PW2 A;  1BF4 A;  2OEO A;  5D1P A;  1C30 A;  4QWA A;  4GKK Q;  5L9X A;  4JI0 L;  2AQ4 A;  2M00 A;  1O78 A;  4IPD A;  4YCU A;  3HOU H;  4LW1 A;  4AH6 A;  3D31 A;  2NTT A;  1TAE A;  4JI6 H;  1TY0 A;  4QUF A;  1KL9 A;  4TRD A;  3M3Y H;  3CC2 A;  1N36 L;  1N32 H;  5C0X I;  3H94 A;  3ICE A;  1ZQ7 A;  2RSO A;  4PZ7 A;  5J3B A;  4X64 L;  4DV0 H;  4XQQ A;  5EOY A;  4K6L A;  3N44 B;  4EBC A;  1T3N A;  2A69 C;  4RNM A;  2UU9 Q;  3T1Y Q;  4A93 B;  1TWH B;  2F0G A;  2DNC A;  3MWD A;  1Z9F A;  4GOP B;  3LNN A;  2YZM A;  4UHV A;  4ECS A;  4DV3 L;  5KFT A;  5ISR A;  5LMN Q;  3PIP 3;  1A3T A;  3PGZ A;  2DPJ A;  4O3N A;  3OTO L;  1TWC A;  1PZJ D;  1LT5 D;  1QNU A;  1KJI A;  5BR8 Q;  1VQK A;  1Y69 U;  2Q2U A;  4BBR H;  2ZTD A;  4MIU A;  4IJH A;  4DV5 L;  2UXC Q;  1A3U A;  2BE5 D;  1EYD A;  1K1Q A;  2RBM A;  1PH1 A;  4C3I H;  3HOY B;  1D8L A;  2F0W A;  4KLK A;  4OON A;  3RN5 A;  3CCE A;  1I6U A;  4ECW A;  4EQP A;  5KFO A;  1KAW A;  3BYT B;  2J9G A;  2AUK A;  4YWK A;  3I91 A;  5C0X J;  2V4R A;  2R92 H;  5M5Y B;  1SE3 A;  1S5F D;  4O2B F;  1HFN A;  4EYI B;  3RR5 A;  5M5X H;  3KLW A;  1HTP A;  2C22 A;  4ILW A;  1CI3 M;  4DR2 Q;  2JA6 G;  5IWA Q;  4DR5 Q;  1UNN C;  1IL8 A;  3TZU A;  2W8K A;  4K8I A;  1BXR A;  3RUZ A;  3S16 H;  1SBB B;  3HOV G;  3HKZ A;  1I50 B;  4IAJ A;  4ECV A;  5KG1 A;  2HIV A;  5J22 A;  1WTH A;  4DXG A;  4O3P A;  4C3J B;  3H3V I;  1BBW A;  2EE1 A;  1EY9 A;  2CWA A;  1HA6 A;  1TWG A;  4MN3 A;  5DGB A;  2OQK A;  3NUC A;  2B63 B;  2Z8L A;  4CKC A;  3LML A;  2F0S A;  2N88 A;  3KYH C;  3JZI A;  1K83 A;  1WCM B;  1QE6 A;  1HJP A;  2PMZ E;  1VDZ A;  4C2M H;  5D1O B;  2BQ3 A;  5EAY A;  2JJQ A;  4QQB X;  3HOU B;  3ERO A;  3I4O A;  3K80 C;  5D1O A;  2IA6 A;  4HQ6 A;  2F0J A;  3I3C A;  1YNJ D;  2Q8R E;  2AU0 A;  2VQF L;  4A3E G;  3F1Z A;  3L4J A;  5KFF A;  3M9B A;  3MEF A;  4X66 L;  2DY8 A;  2XGQ A;  3E0J A;  4C3H H;  5FLM H;  1B44 D;  3KTM A;  2FMM A;  4J9O A;  2WAQ E;  2UUB H;  2L0C A;  2NUC A;  5LL6 b;  1IXR A;  4J9Q A;  2DJG C;  2RGV A;  4K2L A;  1T94 A;  3BG3 A;  4ZLT F;  5A35 A;  5CBE E;  4R8U A;  3GTJ H;  3H91 A;  3GP7 A;  1WCM G;  2F0D A;  3RZD B;  3TII A;  3DWP A;  3HOX H;  2UXD H;  5C3X A;  5EWG A;  1BXT A;  4E4T A;  2JYO A;  4A3E B;  4M9U A;  3K7A H;  1SE2 A;  3OYY A;  1WCM H;  3TIG A;  4ABN A;  2XIG A;  1WI5 A;  1RK6 A;  2W57 A;  2PYK A;  3G8C A;  4ED6 A;  1K9M C;  1XNR L;  1EU3 A;  3SEB A;  1I3Q H;  1G29 1;  2CHB D;  2G5D A;  2RDG A;  2YU9 B;  1KAA A;  4JOI C;  3KBX A;  4JI3 Q;  2VB3 X;  2R93 B;  4X3S A;  4CHT B;  4OWX B;  1U4L A;  4ED0 A;  4IWX A;  3G48 A;  1M7J A;  1GUW A;  4BA2 I;  4B08 A;  2W6P A;  3JAM c;  1XXG A;  3N6X A;  3H20 A;  1U4M A;  1BCP D;  1STY A;  2B39 A;  5KIX A;  5M5W H;  4J15 A;  2EZV A;  1JJG A;  1D1I A;  3FDS A;  1F2M A;  1SNP A;  3MR2 A;  2K33 A;  5IE8 A;  4RAZ A;  5C44 G;  4I7Z C;  1JCK B;  1Z6H A;  3FKI H;  4I65 A;  2ZJP A;  5IT9 L;  1FNW A;  1SAP A;  3BDO A;  3I8Z A;  2GA4 B;  5DM7 3;  4A3M H;  4DUZ Q;  1AZQ A;  1AH9 A;  2L12 A;  4ECX A;  1B9N A;  4HN7 A;  1YZ6 A;  5EKI A;  3TEH B;  3PO2 B;  1N32 L;  5JOB A;  1B6R A;  3AQQ A;  3JRX A;  3LP8 A;  2F0N A;  4JI6 L;  3TP7 A;  4JI1 Q;  4ZUI A;  1PFM A;  4HCE A;  4UP7 A;  2IWH A;  4DAY B;  5K2M A;  4KHP L;  2A1A A;  1ASZ A;  4ECR A;  4JPB W;  1YVC A;  3RV4 A;  2EDG A;  2HHH L;  2VUG A;  2D2C C;  2R6F A;  3ND8 A;  4HAE A;  1JXL A;  5KGU A;  5C1P A;  2C28 A;  4F4X A;  2AWN A;  4GKJ H;  1E2W A;  3GTQ A;  4XQN A;  1FL0 A;  2UUC L;  1KJ8 A;  2KEE A;  3NPP A;  3HGB A;  1HQM C;  3NTH A;  1GUO A;  5CV9 A;  4C1N I;  4FBU A;  4HJA A;  2Q2T A;  1PH8 A;  2YTV A;  1VQ5 A;  4YBZ B;  4DV4 Q;  3U9T A;  1PTO C;  3GTG A;  3LWU A;  4RG1 A;  4JCV E;  4HIM A;  4BA1 I;  4JI2 H;  4IZ8 A;  1FGU A;  2NVT B;  2HVQ A;  5KND A;  4B3T H;  5C4X G;  3J7Z C;  1YHB A;  2WB1 B;  4EEY A;  1Q82 C;  4L8J A;  5KFL A;  4EGJ A;  1NMF A;  1DOL A;  3WOE A;  3K3P A;  2PO4 A;  1DM0 B;  1HZC A;  4ZI7 F;  3FVQ A;  4QY7 A;  3HOW G;  1X3G A;  3H0G B;  4YHH L;  4ZQI A;  2JE6 I;  1Q1B A;  4LF8 L;  2N78 A;  3BQ2 A;  1YJW A;  4FU0 A;  2UU9 H;  4BY7 H;  2L55 A;  3GTK B;  1D1K A;  4UPA A;  2FIN B;  4DK0 A;  1MKH A;  2EQS A;  1QB5 D;  2W71 A;  4DNT B;  4LF5 Q;  1GYF A;  5I2Y A;  5I6W A;  4A3G H;  3UQ8 A;  3FKI B;  4JI8 L;  1X3E A;  2XCP A;  3MZ5 A;  4ZQ3 A;  4DV6 Q;  3HXL A;  3T5J A;  2J6T A;  1OTC A;  2DWC A;  4XIG S;  4LH6 A;  2L9H A;  4JC0 A;  3S2D H;  3N40 P;  3JAM i;  4XDX A;  2YTY A;  4OWT B;  1E24 A;  2W8L A;  3HZX A;  2RDI A;  3GLK A;  1PFS A;  5IT9 c;  2BA0 A;  3NTK A;  3GV3 A;  2WAQ B;  3GTP H;  3C2P A;  5IYZ F;  2Z6K A;  2XCL A;  3URY A;  5ELE A;  4JV0 A;  1HH2 P;  4E6I A;  4L5Q A;  1E2V A;  5FPO A;  4DR2 L;  1LTL A;  2WII B;  3R5X A;  2KVM A;  3AMU A;  4N9P A;  2AKW B;  4C3J H;  2B2T C;  3J80 W;  1RF2 D;  2VOB A;  5J2U F;  1SSO A;  3IN5 A;  1QVF A;  4PZ6 A;  2Q8I B;  1CFM A;  1TWC H;  2ASJ A;  2DPI A;  1D6E C;  4EYH B;  3FKI G;  4BWS C;  2EYH A;  3P7J A;  4OHJ A;  2ZXP A;  2YS7 A;  1FYC A;  3JRW A;  1JE4 A;  2CCZ A;  4IFD G;  2A6H C;  4GN3 B;  2ALZ A;  1PH4 A;  4X62 Q;  2WE6 A;  2F0U A;  5KFC A;  3BQ1 A;  2GPS A;  4EFE A;  2PW5 A;  4KJO A;  2QKI C;  4L5T A;  3KLS A;  4Y7N H;  4FP5 D;  1TWA H;  1SMY C;  4YY3 Q;  2JA7 A;  3GTP B;  2B2U A;  4GKJ L;  3VA5 A;  2JA6 A;  4XZ3 B;  1XNQ Q;  5FLX L;  4IFD J;  1ET6 A;  2R85 A;  5KFJ A;  1Z2P X;  3RFC A;  4LFB Q;  1S68 A;  4HIK A;  1RYR A;  4FBT A;  2K5Q A;  1ILQ A;  5IGD A;  2DN8 A;  4AIM A;  2FLL A;  4QGU A;  4HMI A;  4FF4 A;  1KC7 A;  2CZG A;  4P74 A;  3K7A B;  1WD1 A;  5JAV A;  1VQ7 A;  4WFN 3;  5IYC G;  4NXM H;  3NBI A;  2UUB Q;  1CQI B;  2Y0S G;  3DWA A;  1AN7 A;  1B6S A;  4HNT A;  2UXB Q;  5KFU A;  1SNM A;  5NUC A;  1GVP A;  3C1F A;  1MGS A;  5L1I A;  1JE5 A;  4LUO A;  3CCV A;  2R7Z H;  3A0J A;  4IQZ A;  1A8V A;  5CV4 A;  2DIK A;  2YYZ A;  1D5X C;  3NBH B;  4RCN A;  1YJN A;  4PV1 C;  5DQI A;  5KRU A;  4DR4 L;  1SJH D;  2AWO A;  2F3W A;  4NW2 A;  4YR3 A;  3RZO B;  3V6K A;  3J7A K;  5F9N A;  3Q0A A;  4M1U B;  4LMQ D;  1CQV A;  2KED A;  1QNK A;  2CFM A;  4DV7 H;  5IGE A;  1ICW A;  4B3S L;  2FPI B;  1WSC A;  3PMF A;  4HID A;  4HNU A;  4A3K G;  3F2U A;  2KHI A;  3FEW X;  3ZJY C;  4GLX A;  2R93 H;  2EIF A;  4IAL A;  2NVQ B;  4DV6 H;  1I4P A;  3F8T A;  3LWB A;  4CC6 A;  3FDT A;  1VQ9 A;  4OEM B;  3RGZ A;  3CQZ H;  2ZDG A;  4JI8 Q;  3CCQ A;  1GHJ A;  4RMF A;  4LUV A;  4I50 F;  4YY3 H;  4MTN A;  2QK4 A;  4PMC A;  2IL8 A;  3QZ7 A;  1SJE D;  1F9P A;  3U4V A;  1F77 A;  5HGQ A;  1WR2 A;  2RDJ A;  1GLV A;  3K58 A;  4LF8 Q;  1ICF B;  2CW8 A;  3RJ0 A;  2BH8 A;  1XTC D;  2EY1 A;  4KN7 C;  3GIM A;  3FMC A;  1JOO A;  3V96 A;  3OPO A;  1A62 A;  3HKS A;  5IT9 E;  1SYC A;  4APV A;  3S1R B;  1KBL A;  3OSP A;  4YAK B;  4LUZ A;  3TZD A;  1AFP A;  1S9F A;  2R8J A;  2ZJQ A;  4C3J G;  1DON A;  3TDQ A;  2EXD A;  1I6H B;  4O4L F;  4B3S Q;  1S72 A;  2IX1 A;  1TXY A;  3VR2 A;  5BR8 L;  5JH7 F;  2WTF A;  1N34 H;  4YJ2 F;  2VQF H;  4NP5 A;  4KN4 C;  2AGQ A;  2QGQ A;  3J81 L;  3GIP A;  5IP7 H;  4HTH A;  1CA5 A;  1SE4 A;  2KEN A;  5CGK A;  3RTX A;  4B3M L;  3ORR A;  3T1Y L;  3T1H H;  3NBH A;  2MCT A;  5KT7 A;  2KCM A;  2QEJ C;  2XRQ D;  3RAX A;  2E5L H;  2R8H A;  5HBR B;  2MGS A;  3VA7 A;  1ZHQ A;  3I7F A;  2HQL A;  3PUW A;  2DGY A;  2A74 C;  1BJT A;  1GUG A;  4U68 A;  3S14 B;  1A3V A;  3DEO A;  4ZOL F;  1VQ4 A;  5C6A A;  4JVZ A;  5IYB G;  3BAA A;  1F9S A;  1JC7 A;  1JWS D;  5E4X A;  2QW7 A;  4JBW A;  4F88 A;  4H7B A;  1H95 A;  4NKL A;  3S24 A;  1JQY D;  4BBS B;  4IN3 A;  5J1Z A;  1CTM A;  3M4P A;  1EIG A;  5JEA J;  5FKA C;  4JI7 H;  5CA0 F;  3M4I A;  4IFD H;  1VMP A;  3S2D B;  1HXY D;  1PYW D;  3SGI A;  4CGY B;  2OWO A;  5KG3 A;  1VQN A;  2IW3 A;  1D5M C;  2W6O A;  4TV8 F;  4A75 A;  3WOF A;  3OTO H;  3J81 W;  3MXN A;  2R8K A;  2V4D A;  4GN5 A;  4H13 C;  2R7L A;  3S15 B;  4JV5 Q;  3LX0 A;  1FJG L;  3S1R H;  2F4I A;  2IY5 B;  4A3C H;  5GAD C;  2FMC A;  3K7U C;  3CQZ A;  3KAJ A;  4RB2 C;  2W9C A;  1DOM A;  2R86 A;  1PDQ A;  2LS0 1;  3O13 A;  4GNX B;  4MV7 A;  1A2T A;  2AQ1 B;  5I9O A;  4X64 H;  2R93 A;  2E75 C;  1NUC A;  1E3P A;  2YV5 A;  2XGT A;  5E3F A;  4LF7 L;  3G7L A;  1W3S A;  2F0K A;  2EPB A;  3SK8 A;  4OL7 A;  2O4X A;  5CC4 A;  5KFD A;  1Q3L A;  1PTO B;  2KCT A;  2F3I A;  3IFT A;  3J80 L;  1AN8 A;  3BZC A;  1E4E A;  4Y7N B;  2RF4 A;  1FKA H;  4J9K A;  1N9W A;  1TS4 A;  2K5N A;  5KYI A;  4RB1 A;  2R7Z A;  4I7H A;  1LTT D;  3I2Z A;  1IBL L;  1O7Y A;  3MFG A;  5KFI A;  4DV3 H;  1BNC A;  3KUP A;  3N42 B;  1IZ6 A;  3K5L A;  5BMV F;  4YQW A;  1XDN A;  5FLX c;  5TSS A;  4O3Q A;  1XMQ H;  2M2L A;  5IOC A;  1EQT A;  3GTL B;  3H0G A;  2FJZ A;  2YZN A;  1Y1V G;  2CW0 D;  3SK5 A;  2UXB L;  2IX3 A;  5KFA A;  2K5D A;  2BR0 A;  1Q8K A;  4GKK H;  2MUY A;  5C0X G;  1DD2 A;  1EYG A;  1IOV A;  3OW2 A;  1X56 A;  2EYJ A;  5JUM A;  2IT1 A;  5IP9 H;  4JV5 H;  3PSI A;  1RHP A;  4EGV A;  2NVX B;  3K5M A;  5M5X B;  1EL0 A;  3EYY A;  2RHS B;  3D4W A;  2FK3 A;  4UFZ A;  3M4O H;  1Y1W A;  4X65 L;  3QOJ A;  2DUD A;  3M9O B;  5KFG A;  5JVH 3;  3H6M A;  1Y1V H;  3GTO B;  1H9S B;  2J6S A;  2B2W A;  2QDB A;  5L1K A;  1LM0 A;  4DKA C;  1XJV A;  1HTL D;  2HHH Q;  1HNW L;  4UCU A;  4DV2 H;  4LSX A;  3AFP A;  4C3H G;  1VQE A;  1PTO H;  1T9H A;  3VYS A;  2ZDH A;  1WTO A;  1IOW A;  3BA9 A;  1PFN A;  1WTW A;  4LF9 L;  5KFE A;  2G9H D;  3A74 A;  2VZA A;  2A19 A;  3GTL H;  4DL7 A;  5KFN A;  5KT5 A;  2XWJ B;  5IT9 W;  3SK4 A;  4MV9 A;  4JI1 L;  4IUN A;  3CU7 A;  4NXN L;  1L0W A;  4JI0 Q;  2JA5 G;  4A2A A;  2R3Z A;  2YYA A;  2NZO A;  4QJF A;  2MHV A;  1W2B A;  2BOS A;  3KXY T;  1LLR D;  4DV3 Q;  4LF9 H;  2FK1 A;  1EY7 A;  3K81 C;  1JT8 A;  1VF7 A;  2PI2 A;  2JXM B;  3U9S A;  4KKU A;  4X6A H;  3RV3 A;  4QW8 A;  5I2X A;  2C9O A;  2CH4 A;  5CR3 A;  3HOZ H;  2KCC A;  4A4I A;  3NQT A;  1E1O A;  3GTO H;  4IHJ F;  1AW7 A;  2PMZ B;  1WTR A;  1I94 H;  4ME6 A;  3BYY B;  5FO9 B;  4JBM A;  1VF5 C;  2JA8 B;  3RB4 A;  2VL6 A;  1CKM A;  4H0L C;  1C3O A;  1F2L A;  4IJL A;  3ONA B;  5IYD G;  5M3F H;  4O3R A;  2R92 A;  1VQI A;  2AQ3 B;  1CSQ A;  2QCP X;  4LFA L;  3I4M G;  4IPH A;  5AJ3 Q;  2RVL A;  1I6H H;  5KFW A;  4DV6 L;  3GID A;  3MXG A;  2VQE L;  4LJZ C;  3RD4 A;  1E0B A;  1GXD C;  1TWA A;  3VDY A;  4B3S H;  4GKK L;  4KHZ A;  3V6H A;  3E5N A;  2A6E C;  4P75 A;  3J7A 5;  2ENB A;  4K0K L;  3OHA A;  1YEZ A;  1Y8O B;  1PH2 A;  3H3V H;  2BA1 A;  1QG7 A;  2XVS A;  4R8I A;  1EY4 A;  1JLL B;  4EBD A;  5FOB B;  1G6P A;  3QOL A;  3FP9 A;  1YIJ A;  4DR5 H;  2NU9 B;  1MD2 D;  1ESR A;  3IKJ A;  2J6U A;  2MO0 A;  1WJJ A;  1CKN A;  5JJZ A;  2WB1 E;  1DOK A;  4J6H A;  4DR3 H;  1YNN D;  2IBK A;  3RZD H;  1AE3 A;  3G71 A;  2YRW A;  4DAM A;  2K5H A;  1SYE A;  2HUG A;  1B70 B;  3TN2 A;  5BN4 A;  4RKB A;  3A8J E;  1EEI D;  1JWM D;  1Y1V A;  2KHJ A;  4TQR A;  2VR1 A;  2O03 A;  3PO2 H;  4K14 A;  2C2D A;  4UP8 A;  4LF7 H;  3H15 A;  5M9O A;  1JJ2 A;  2K03 A;  4DV1 L;  4DN4 M;  2KA7 A;  2EY2 A;  2F0I A;  3E3X A;  4GNX C;  4CDD C;  1CUK A;  3SR1 A;  1Z2O X;  1N8R C;  4LNQ A;  4HSP A;  2A69 D;  3KK7 A;  1IBM H;  3V6J A;  2L5T A;  1RJT A;  2K50 A;  2X69 A;  3CW2 C;  4YWL A;  3N41 B;  3MFH A;  2ASL A;  2E2I H;  2OH2 A;  3KLR A;  1FJG H;  5IGF A;  5EBC A;  1EU4 A;  1LTI D;  2FP4 B;  3L4K A;  3FHW A;  5KT6 A;  2PQA A;  1B4O A;  3QWN A;  3BA8 A;  1KQS A;  4HIO A;  1I50 H;  4WRD A;  1ESF A;  1MJE A;  4R4I A;  4YJ3 F;  5KG4 A;  1N32 Q;  5M3F B;  2KBN A;  5M5Y H;  2R92 B;  3MWY W;  1Q90 A;  4TKO B;  4DUY Q;  1TS2 A;  2F0P A;  3KOJ A;  5E4W C;  2M05 A;  5KFX A;  1SFO B;  1NJI C;  3T53 B;  1Q46 A;  2W6M A;  1PX2 A;  2BDO A;  1XMO H;  1HZB A;  3QZ8 A;  4DUZ H;  2B2Y C;  2YL2 A;  4FXD A;  4RZR A;  1MI2 A;  3T13 A;  3K57 A;  4KTA A;  3NSW A;  3R5H A;  3ERQ A;  4DL4 A;  2FXQ A;  4BBR G;  4JI3 H;  5I47 A;  4KKS A;  2LY7 A;  1EWC A;  3D4R A;  5FLX W;  4LK1 C;  1WCM A;  3IFD A;  4R4O A;  1HNX Q;  2XWB B;  4HJ5 A;  2HDL A;  3K5N A;  2E5L L;  4Q5V A;  4DAP A;  3S2H B;  3W1B A;  1KLU D;  4G7O C;  5IGC A;  2W6Z A;  1VQH A;  4LFB L;  4KMU C;  4ECT A;  1GUS A;  2XRS D;  1L0X B;  1XNQ L;  2UU9 L;  2FJ2 A;  1QIL A;  2YTX A;  4IZO A;  2G9D A;  3T1Y H;  1KDB A;  2TMP A;  4RFB A;  3KFU A;  1HR0 W;  2NVY H;  2VQD A;  3KF6 B;  3G6E A;  2UUA L;  3W2D A;  1G51 A;  5ELF A;  3BG5 A;  4N8X 1;  2KUM A;  3GIJ A;  1IBL Q;  1ILP A;  4A3J G;  1IBM Q;  3TBI B;  3J80 c;  1JIC A;  1N34 L;  3PUY A;  4JI2 L;  2GVA A;  2FK2 A;  4QB4 A;  5C4J B;  4LF6 H;  1MSH A;  4RGN A;  3VYU A;  3FPP A;  4JI2 Q;  2BQR A;  2OT2 A;  1N33 Q;  3I4L A;  1B53 A;  3GDE A;  3TRE A;  2EVB A;  3M4Y A;  2K28 A;  3QIA A;  4ZUJ A;  4LF7 Q;  1PH9 A;  5KFZ A;  3NGD A;  2WAQ G;  1UE5 A;  2VQF Q;  5M5W B;  4U7C A;  4ECQ A;  4DR6 H;  1Q8I A;  3K5H A;  3PW0 A;  3T5L A;  1VQ6 A;  1OXU A;  4FVM A;  2W7P A;  3HOX B;  4O2A F;  5LYJ F;  1HZA A;  4YCV A;  1PRT F;  4RUC A;  4TSS A;  5JVD F;  1F9Q A;  1LO5 D;  2IJ0 A;  4CJ2 C;  3WO0 A;  2MO1 A;  2MJ8 A;  4GNX A;  2F4V H;  2NBF A;  2JEF A;  1UC8 A;  5C44 H;  3VYT A;  1E4E B;  4RNN A;  2B2Y A;  4LF5 L;  3M9N B;  2RA4 A;  1HNX H;  5C4Z A;  3F2B A;  1CZG A;  5KFM A;  3GTK A;  4OIK A;  5DM6 3;  3TP6 A;  2NVY B;  2FPP B;  2J0T D;  1KNE A;  2JK8 A;  4LF9 Q;  5KG2 A;  3WDN A;  5EPK A;  4B3R H;  1J5E Q;  1EYZ A;  3RMH A;  1X3F A;  2MP1 A;  4HR7 A;  5D8D A;  3T5H A;  4G4K A;  3ETH A;  3GTL A;  1B2T A;  1EUC B;  1EY6 A;  3EPG A;  5C4X H;  1XPR A;  4ZYS A;  2R7N A;  2YU9 H;  1KRS A;  1X54 A;  4A2B A;  2FB9 A;  1V1Q A;  3MXU A;  3J81 i;  4G7Z C;  2R82 A;  1VQD A;  4WBN F;  4LF6 L;  1HNX L;  4DV4 L;  5KFS A;  3HOV B;  1DJR D;  4DL2 A;  2NN6 I;  1H9J A;  1STN A;  1UE7 A;  1Z7T A;  4QMG A;  4ZKC B;  5LMN L;  2EXZ A;  2NZ1 D;  4A3F G;  1YIT A;  1X9N A;  1R9T B;  4BBS H;  2W6N A;  1XTD A;  4NXM L;  1Y8P B;  5C5L A;  3KJO A;  2UUA H;  3HRZ C;  3TP8 A;  4A3G G;  4AYB A;  2B63 G;  5DAU A;  4ZK9 B; 
#chains in the Genus database with same CATH homology
 4JBJ A;  2K75 A;  3ER0 A;  4R4Q A;  3Q8D A;  3CCL A;  5HGQ A;  4IPG A;  4B3M Q;  2Q2H A;  2B63 H;  2R6G A;  4DV1 Q;  4LF8 Q;  5GAH C;  2ID0 A;  3U58 A;  1NBW A;  1E1T A;  2BH8 A;  2V1C C;  1NTG A;  3GO5 A;  4OX9 Q;  4A3L G;  1RL2 A;  4DR6 L;  3J80 i;  3UE1 A;  4JI7 Q;  2D0P A;  1N36 Q;  1A62 A;  3HKS A;  4AQY Q;  4H02 A;  1HNZ Q;  4APV A;  4YCW A;  1GD7 A;  4A3I G;  4LUZ A;  1M90 C;  4ME3 A;  2ZJQ A;  4A3K H;  4OXP A;  4JYA Q;  2EXD A;  3F2D A;  1Y14 B;  2PNH A;  1KD1 C;  3KJP A;  2VS1 A;  4B3S Q;  1S72 A;  2IX1 A;  4A3M G;  5LMU L;  4DV0 Q;  1TXY A;  3AEV A;  5BR8 L;  2MNA A;  4P73 A;  4QL5 A;  4NPS A;  2NZH A;  1R9T H;  1Q1E A;  1CKO A;  3DLL A;  4DUZ L;  2QGQ A;  3HOX G;  1XMO L;  1PYB A;  3HOY G;  4DR6 Q;  5IP7 H;  3PF4 A;  2L15 A;  1YI2 A;  5FJ8 G;  1UWV A;  3K0X A;  3L7Z C;  1Q81 C;  2KEN A;  3GD7 A;  3K8A A;  1L1O B;  5M3M G;  1KC8 C;  1UEB A;  4K0K Q;  4IPC A;  4FDB A;  4B3M L;  2ZTC A;  1MIU A;  2RHQ B;  1M1K C;  2IHF A;  4TVA B;  3T1Y L;  2I5L X;  1NY4 A;  2UUC Q;  2NVQ H;  3GTM H;  3H0G G;  4DPG A;  4A93 H;  2VQE Q;  3ULP A;  2JA8 G;  4BY7 G;  2HIX A;  2XTI A;  5AJ3 L;  1WYD A;  5LMN W;  2OTJ A;  4R4C A;  1TWF H;  1FJG Q;  2KCM A;  5HY6 A;  2OCE A;  3D0F A;  4LFA Q;  1SMX A;  1VQL A;  2E2J H;  1K83 H;  1Y1W H;  4IFD I;  4L5S A;  3I7F A;  3HOU G;  1CSP A;  3CAM A;  1IL2 A;  2HQL A;  1WOC A;  3PUW A;  2DGY A;  2WFW A;  2Y0S E;  4B3T Q;  3CCU A;  2AHO B;  4DR1 Q;  1VQ4 A;  3HOZ G;  3CCJ A;  5IYB G;  5GAE C;  2R7D A;  2K52 A;  5H1S E;  3CC4 A;  3TS0 A;  4JBW A;  4GLV B;  4MZ9 A;  5IP9 G;  1H95 A;  4KI0 A;  3M85 A;  3S24 A;  3BU2 A;  4A3D G;  1OXT A;  1V43 A;  3PF5 A;  5GRO A;  5GQO A;  1IBK L;  1QUQ A;  2VUM G;  5C4J H;  1GM5 A;  3M4P A;  1N33 L;  2Z0S A;  3CPF A;  3J81 c;  5JEA J;  3RN2 A;  1EIF A;  1KRT A;  4GKK Q;  4IOA A;  1HR0 Q;  4POG A;  4JYA L;  4JI0 L;  1EIY B;  3CPW A;  1TWH H;  3SGI A;  2OWO A;  4B3T L;  1VQN A;  4IPD A;  4YCU A;  3HOU H;  4LW1 A;  4AH6 A;  3D31 A;  4A75 A;  1SE8 A;  1HNZ L;  1KL9 A;  4EQ5 A;  3CC2 A;  1N36 L;  1VQB A;  4GN5 A;  1YJ9 A;  3M3Y H;  5E7N A;  5C0X I;  4JV5 Q;  2CWP A;  1FJG L;  2ALY B;  3S1R H;  3ICE A;  3I4M H;  2IY5 B;  4PZ7 A;  5J3B A;  4X64 L;  2H5X A;  4A3C H;  5GAD C;  3K7U C;  1EQQ A;  3S1M H;  4JI4 L;  4A93 G;  1XMQ L;  2JA6 G;  2UU9 Q;  3T1Y Q;  2N8N A;  4GNX B;  1I5F A;  1Z9F A;  4GOP B;  3CMA A;  4OO1 G;  3RLF A;  4DV2 Q;  1E3P A;  2YV5 A;  2XGT A;  5FJ8 H;  4DV3 L;  3S15 H;  5IP7 G;  4LF7 L;  5LMN Q;  1W3S A;  3J81 j;  3PGZ A;  3OTO L;  3F2C A;  5BR8 Q;  1QZG A;  2KCT A;  3CF5 A;  1VQK A;  2MFI A;  2F3I A;  2Q2U A;  3GTQ H;  4BBR H;  1VQ8 A;  2ZTD A;  4IJH A;  4DV5 L;  2A8V A;  3BZC A;  2JA6 H;  2UXC Q;  1XPU A;  1OXS C;  1VCI A;  2WP8 J;  2RF4 A;  1PH1 A;  3EN2 A;  4C3I H;  1N9W A;  1PH6 A;  1D8L A;  2K5N A;  2JEB I;  4JI5 L;  1AE2 A;  1I94 L;  4KLK A;  4A3C G;  4OON A;  4BXX G;  3I2Z A;  3RN5 A;  3CCE A;  4JOI A;  3UDX A;  1IBL L;  4QIW E;  3I56 A;  2WB1 G;  1KAW A;  1ASY A;  3PO2 G;  3HKZ G;  1K3R A;  1UE1 A;  4YWK A;  1HNW Q;  1P8L A;  5C0X J;  2ZJR A;  4DR4 Q;  1IZ6 A;  2R92 H;  1QVG A;  1JB7 A;  4OX9 L;  3NEM A;  4OWW B;  4EX5 A;  3RR5 A;  5FLX c;  1EFW A;  5M5X H;  3KLW A;  2UXD L;  1VQJ A;  3H0G H;  3GTG H;  1PH3 A;  1K0R A;  3UDI A;  1YNX A;  1Y1V G;  4DV5 Q;  4DR2 Q;  5IWA Q;  4JI5 Q;  2IX0 A;  4DR5 Q;  1I94 Q;  2UXC L;  2UXB L;  2K14 A;  1Q8K A;  3S16 H;  4DR3 Q;  3HOV G;  5C0X G;  2NVT H;  1EYG A;  4BY1 G;  1UE6 A;  2HIV A;  1K8A C;  2UUB L;  3OW2 A;  1Q12 A;  1X56 A;  3H3V I;  2CKZ B;  1BBW A;  2IT1 A;  2CWA A;  5IP9 H;  3PSI A;  1D7Q A;  2OQK A;  4LF4 Q;  2OQ0 A;  2B3G A;  2RHS B;  5ELN A;  3PO3 H;  3RNU A;  3KYH C;  3M4O H;  2QEX A;  1HJP A;  2PMZ E;  4X65 L;  1VQO A;  1A63 A;  3PUV A;  4C2M H;  2D62 A;  2DUD A;  5EAY A;  2JJQ A;  4QQB X;  4OO1 I;  3I4O A;  2Z6K C;  1Y1V H;  3K80 C;  3RZO H;  1EQR A;  3CC7 A;  4X64 Q;  1VQA A;  4WJ4 A;  1LM0 A;  2LXJ A;  4DKA C;  2VQF L;  3L0O A;  4A3E G;  1XJV A;  2HHH Q;  1HNW L;  3F1Z A;  4PMW A;  3M9B A;  1KHI A;  3MEF A;  4X66 L;  5FLM G;  3AFP A;  1VQE A;  1T9H A;  3PUX A;  4C3H H;  5FLM H;  4JV5 L;  4DUY L;  4LF9 L;  2WAQ E;  4A3E H;  3A74 A;  5IY0 A;  2VZA A;  2A19 A;  3CCR A;  1VQM A;  3BJU A;  1IXR A;  3GTL H;  4DK6 C;  2E2H H;  3B6Y A;  1LYL A;  4JI1 L;  3UDG A;  4NXN L;  4R4T A;  1L0W A;  4AYB G;  1EOV A;  4JI0 Q;  4JI6 Q;  2JA5 G;  3GTJ H;  1X65 A;  3AFQ A;  1WCM G;  2NZO A;  2VUM H;  3PO3 G;  4QJF A;  1W2B A;  1NMG A;  3HOX H;  1L1O A;  1QVC A;  4IO9 A;  4DV3 Q;  5IYC H;  3K81 C;  1JT8 A;  1EUJ A;  2JEA I;  2PI2 A;  4BY1 H;  4JBK A;  4B3R Q;  4R1J A;  1NE3 A;  4X6A H;  3K7A H;  3OYY A;  1WCM H;  3UDF A;  1K8G A;  1B8A A;  4DV2 L;  3HOZ H;  1SN8 A;  1WI5 A;  4A4I A;  1BBU A;  4JI4 Q;  1E1O A;  3GTO H;  1SRU A;  1PV4 A;  3WWV A;  1K9M C;  1XNR L;  4JBM A;  2VL6 A;  1CKM A;  1I3Q H;  1G29 1;  2ZM6 L;  4IJL A;  4JOI C;  5IYD G;  1E7Z A;  5M3F H;  1VQI A;  4JI3 Q;  1C0A A;  1CSQ A;  3KF8 B;  4LFA L;  2VY3 A;  4IPH A;  1QZH A;  4MNO A;  4OWX B;  5AJ3 Q;  3I4M G;  5IYD H;  4A3D H;  3G48 A;  4KHP Q;  1MJC A;  3PIO A;  4BA2 I;  1SRO A;  1I6H H;  2K4K A;  2ZM6 Q;  2F52 A;  4DV6 L;  2VQE L;  4O2D A;  3JAM c;  4BXX H;  3VDY A;  4GKK L;  4KHZ A;  3PCO B;  1JJG A;  5M5W H;  4J15 A;  4P75 A;  1JMC A;  1N34 Q;  1J6Q A;  1RIP A;  3J7A 5;  4K0K L;  4BBS G;  5IE8 A;  1YEZ A;  3IRB A;  4B3R L;  5K36 G;  5C44 G;  1PH2 A;  4DK3 C;  3FKI H;  3PIP A;  4PZ8 A;  2ZJP A;  1B7Y B;  3H3V H;  2BA1 A;  4GN4 B;  1IBK Q;  1XPO A;  2RCN A;  2ASB A;  4A3M H;  4DUZ Q;  1AH9 A;  1YZ6 A;  3TEH B;  2PI2 E;  3S17 H;  2VNU D;  1G6P A;  3FP9 A;  1YIJ A;  1N32 L;  1VQC A;  4DR1 L;  3AQQ A;  3NEN A;  1OXX K;  4A3B H;  1KXL A;  2MO0 A;  1WJJ A;  1CKN A;  3CME A;  4JI6 L;  4NXN Q;  1U5K A;  1S3O A;  2WB1 E;  4JI1 Q;  5IYB H;  3RZD H;  2LXK A;  1AE3 A;  3G71 A;  4DAM A;  2C35 B;  2K5H A;  4UP7 A;  1PH5 A;  2E5L Q;  4JI7 L;  1B70 B;  4DAY B;  4KHP L;  2N3S A;  2A1A A;  1ASZ A;  1Q7Y C;  4AYB E;  2KHJ A;  5JEA G;  2ZTE A;  1YVC A;  1C7Y A;  3PO2 H;  2HHH L;  3CP0 A;  4UP8 A;  4LWC A;  2B29 A;  3H15 A;  1XNR Q;  2R7Z G;  3CXC A;  2GVB A;  2JQO A;  1JJ2 A;  4DV7 L;  4DV1 L;  2AWN A;  4GNX C;  4GOP C;  1FL0 A;  4NB3 A;  2UUC L;  1CUK A;  3S1Q H;  3KDF A;  1N8R C;  4LNQ A;  1X6O A;  4GOP A;  4A3F H;  5M3M H;  4GS3 A;  3STB D;  3W1G A;  4HJA A;  3ERS X;  2CQO A;  2MQH A;  1PH8 A;  2Q2T A;  3I4N G;  2K50 A;  2YTV A;  3BZK A;  3CW2 C;  5LMU Q;  4DV0 L;  5DLQ E;  4YWL A;  4DV4 Q;  1VQP A;  1SFO H;  1VQ5 A;  2E2I H;  4LF6 Q;  2ATW A;  2F4V Q;  5C3E G;  3HOV H;  2HT1 A;  2R93 G;  3FHW A;  4RG1 A;  3I55 A;  2PQA A;  4JCV E;  4HIM A;  4BA1 I;  1KQS A;  1FGU A;  4HIO A;  1I50 H;  5C4X G;  3J7Z C;  1HZ9 A;  4R4I A;  1YHB A;  1MJE A;  2UXD Q;  1Q82 C;  1N32 Q;  1VQF A;  2KBN A;  5M5Y H;  5C3E H;  5GAG C;  4DUY Q;  1NMF A;  2NVX H;  4A3I H;  2F4V L;  2JA7 H;  2R92 G;  1VQG A;  3KOJ A;  3CCS A;  1E22 A;  1HZC A;  4JG2 A;  3HOW G;  4QY7 A;  3A5U A;  1X3G A;  4YHH L;  1NJI C;  4WJ3 M;  1Q46 A;  2JE6 I;  1Q1B A;  3TQY A;  4LF8 L;  2N78 A;  1HZB A;  2AMC B;  1YJW A;  1X55 A;  3S1N H;  4BY7 H;  1L1O C;  3S2H H;  4UPA A;  1MKH A;  2EQS A;  4O0A A;  3ULJ A;  4X65 Q;  1BVS A;  4LF5 Q;  4DV7 Q;  2FXQ A;  4NXM Q;  2N49 A;  4BBR G;  4A3G H;  4L5R C;  1C9O A;  4JI8 L;  1X3E A;  4DV6 Q;  3U50 C;  3EBE A;  1OTC A;  4XIG S;  4JC0 A;  4P71 A;  3OTO Q;  3HOW H;  3S2D H;  3JAM i;  1P16 A;  2YTY A;  1SLJ A;  1YHA A;  4OWT B;  1E24 A;  4R4O A;  4HJ5 A;  1HNX Q;  2E5L L;  1PFS A;  5IT9 c;  2BA0 A;  3GTK H;  3W1B A;  4HJ8 A;  3GTP H;  2Z6K A;  2QA4 A;  1VQH A;  1VS0 A;  4LFB L;  4DR7 L;  1HH2 P;  3CD6 A;  4L5Q A;  4DR2 L;  1LTL A;  1XNQ L;  2UU9 L;  3T1H L;  2YTX A;  4A3B G;  1TWG H;  2AKW B;  4C3J H;  1CKN B;  3KFU A;  1HR0 W;  3PV0 A;  3CCM A;  3STB C;  2NVY H;  1PVO A;  3RLN A;  1Y1W G;  1J5E L;  4GKJ Q;  1PYS B;  3KF6 B;  3G6E A;  4PZ6 A;  2UUA L;  1QVF A;  3TRZ A;  1TWC H;  1G51 A;  4YY3 L;  1K73 C;  1YBY A;  3FKI G;  1A0I A;  1BKB A;  4PG3 A;  1IBL Q;  4P72 A;  4A3J G;  1IBM Q;  4A3L H;  3TS2 A;  3J80 c;  1N34 L;  2JA8 H;  2I5H A;  3JC6 6;  3PUY A;  3AYH B;  4JI2 L;  2GVA A;  3DM3 A;  1OXV A;  4LFC L;  2CCZ A;  4IFD G;  3KDF B;  1HR0 L;  4Y52 H;  4GN3 B;  1PH4 A;  4X62 Q;  3MXN B;  2JA9 A;  5ELO A;  4JI2 Q;  1DGS A;  3S14 H;  1N33 Q;  4L5T A;  3PUZ A;  4DNI A;  4TQU S;  4Y7N H;  4HJ7 A;  2UUA Q;  3GDE A;  3W5O A;  1TWA H;  5JJL A;  3TRE A;  4X66 Q;  4LF7 Q;  2Q2I A;  4JI3 L;  1PHJ A;  5M3F G;  2NN6 G;  1SR3 A;  2WAQ G;  3A5Z B;  4YY3 Q;  1PA6 A;  1PH9 A;  2JA7 G;  1UE5 A;  2VQF Q;  4GKJ L;  3E9H A;  4YWM A;  1XNQ Q;  4IFD J;  1VQ6 A;  1OXU A;  3RLO A;  4A76 A;  1U0L A;  4LFB Q;  4HIK A;  1XMQ Q;  1LUZ A;  2PQA B;  4XTC S;  1GO3 E;  1HZA A;  2LSS A;  4GLA C;  4YCV A;  2ES2 A;  4AIM A;  4IOC A;  4DR7 Q;  4QGU A;  4LF4 L;  4P74 A;  1VQ7 A;  2MO1 A;  1FVI A;  5IYC G;  4GNX A;  1S40 A;  2UUB Q;  5C44 H;  2Y0S G;  3HFZ B;  4LF5 L;  1Q86 C;  4LFC Q;  2UXB Q;  4X62 L;  2K5V A;  4DR5 L;  1GVP A;  3F2B A;  1JE5 A;  4LUO A;  3CCV A;  2R7Z H;  3A0J A;  3G4S A;  1IYJ B;  1A8V A;  3M4Q A;  2YYZ A;  3U4Z A;  1JJC B;  3NBH B;  2JK8 A;  4LF9 Q;  3NEL A;  1L2F A;  1YJN A;  1QUQ B;  2I0Q A;  1IBM L;  4YHH Q;  4A3J H;  4DR4 L;  2AWO A;  1XMO Q;  3HOY H;  1J5E Q;  2I5M X;  1X3F A;  3LGJ A;  4HJ9 A;  1Z47 A;  1EWI A;  3E9I A;  1O7I A;  2R7F A;  5C4X H;  1XPR A;  4UY8 C;  3E0E A;  2CFM A;  2VW9 A;  4B3S L;  1GKH A;  4ALP A;  2YU9 H;  2IHE A;  1KRS A;  3HKZ E;  5JJI A;  1PH7 A;  4HID A;  1X54 A;  4A3K G;  3T1H Q;  1V1Q A;  2KHI A;  3ZJY C;  4GLX A;  3J81 i;  3L2P A;  2EIF A;  2GN5 A;  1YHQ A;  4POF A;  2R93 H;  1VQD A;  2D0O A;  3F8T A;  3UE0 A;  1WFQ A;  4LF6 L;  1HNX L;  3M7N A;  4DV4 L;  4AQY L;  3I4N H;  3EIV A;  5JJK A;  1VQ9 A;  2NN6 I;  3ULL A;  2OTL A;  3CQZ H;  1UE7 A;  5LMN L;  4UP9 A;  1YIT A;  4JI8 Q;  4A3F G;  1X9N A;  3CCQ A;  2E8G A;  4BBS H;  3KF6 A;  4LUV A;  4RMF A;  1KIX A;  4DR3 L;  1XTD A;  4NXM L;  1V9P A;  4MTN A;  3KJO A;  2JA5 H;  2BH2 A;  4A3G G;  2B63 G;  3U4V A;  5IWA L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...