2VUMG

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 26
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vumG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2vumG01
2ZTDA 4NXNL 4NXMQ 3I2ZA 3BZCA 2UXCQ 1B7YB 2RCNA 3M4QA 4LF7Q 2K50A 2HIXA 4H02A 3I56A 2UUCQ 2R93H 1Q1EA 2ALYB 3L7ZC 1TXYA 5IP9G 4DV0Q 1VS0A 2WFWA 3J7ZC 2L15A 1A62A 4DK6C 4R4CA 3W1BA 2ZTCA 5M3MG 2VS1A 1IBLL 2Q2TA 3RZOH 4A3JH 3K8AA 4A3BG 4EX5A 3UE0A 1XNQL 1PA6A 4X64L 1QVGA 1VQ7A 2E2IH 1YJ9A 5C4XG 4LF8L 4BA1I 1XNRQ 1VQOA 3PUZA 4L5RC 4DV3L 1Q81C 2RHSB 2A19A 1I6HH 1X56A 2AWNA 2VY3A 4JI8L 3ZJYC 3CCSA 4DV5L 1EIYB 2UU9L 1MJEA 3OYYA 4P71A 1X3EA 1IZ6A 1LUZA 1V1QA 1I94Q 2ZM6L 2XGTA 2IX1A 3PCOB 3CPFA 1HR0W 4YY3Q 2OTLA 3NEMA 5GADC 3PGZA 3KDFA 4A3MH 1YITA 4OWTB 4L5SA 4LF6Q 3PIPA 2YTVA 2HHHQ 4LF5Q 1V43A 2NVYH 1I5FA 2E2HH 4OWXB 5IP7H 2E2JH 4DPGA 5FLMG 2JA9A 5AJ3Q 1KQSA 4P75A 3MXNB 4DR5L 4IPDA 4UP8A 4A3BH 4GOPA 1TWAH 2NVXH 1NMGA 1AE2A 4HJ7A 3PF5A 1N34Q 2RF4A 3RNUA 4PZ6A 4LF6L 4DR1Q 4A3FG 2UUBQ 2HT1A 3TEHB 4GKKQ 3UDFA 1YJWA 3I4MG 4UPAA 4JBKA 2ZJQA 4RG1A 2ZM6Q 1FL0A 2R7ZG 3CXCA 4LFBQ 1KD1C 4IO9A 4C3HH 1WCMG 3KYHC 2QEXA 4LW1A 4DV5Q 2IY5B 1VQDA 3PV0A 2UXBL 4JI0Q 3M85A 1Z47A 2MFIA 2NZHA 4JYAL 1L1OB 1QUQA 2MO0A 4PZ7A 1YJNA 1TWGH 2OCEA 1XNQQ 5IWAL 1N9WA 4JV5L 5FLXc 4QGUA 5LMNQ 1CKOA 1Q82C 2Q2HA 4IOCA 2BH8A 2UXDL 2EIFA 2QGQA 1VQGA 4DV1Q 3J81c 2GN5A 1PH3A 3L2PA 2N8NA 4DAYB 4ALPA 3H15A 3J81j 2F3IA 4DR3L 3GD7A 4X62L 5IYBG 3PIOA 2OQKA 1NMFA 2EXDA 4HJAA 3RZDH 2OTJA 1JMCA 3J7A5 2KCMA 2UXCL 4B3SQ 4GLXA 2HQLA 4JI5L 3CPWA 4NXML 1GD7A 2NVQH 4LUVA 4GKJL 3F2DA 1HNWL 3HOVG 1YBYA 2BA0A 2WAQG 3AFPA 1PH6A 1EFWA 3PUXA 3ULPA 4A3MG 1H95A 2QA4A 1KC8C 4IPCA 2NZOA 3RLOA 3JAMi 3HFZB 4A3DG 2LXJA 3CCMA 3S1RH 1XTDA 4JOIC 3T1YQ 3EBEA 4AH6A 1ASYA 5C4JH 1IBMQ 4DR7L 4QIWE 4A93G 1TWCH 1OXUA 3U58A 1WI5A 2VQFL 1EWIA 4YHHL 5C0XG 1K9MC 1BBUA 3AYHB 1YHQA 2JA7H 1J6QA 4A76A 2YU9H 1HNXQ 1FJGL 1AE3A 2I5MX 4GS3A 4P73A 1XMOQ 1E3PA 4HJ5A 5K36G 3HKZG 3T1YL 1LTLA 2JA8G 1JT8A 1K3RA 3HOXG 4DR6Q 4C2MH 5E7NA 5C0XJ 1W2BA 3FKIG 4B3ML 4KI0A 5M5YH 2I0QA 3W1GA 3CMEA 4A3IG 2D62A 3G71A 1LYLA 3G48A 2KHIA 4DV4Q 2K52A 4A3IH 3EN2A 4IFDG 2NN6I 3B6YA 2B3GA 1E22A 1CKMA 2AWOA 1VQ9A 4JI6L 1GKHA 3G6EA 4A3FH 4GKJQ 1HNWQ 2Q2UA 4JI5Q 4B3TL 5GAHC 2UUAQ 1VQIA 4DUYQ 1UE7A 2GVBA 4WJ3M 3JAMc 2JA7G 3RN2A 2Q2IA 2F4VQ 4HJ8A 2K5HA 3HOWG 1PVOA 5LMUQ 5H1SE 3KF6B 4L5TA 4DV1L 1XMQQ 3HOZH 1IBKQ 4IPGA 5C3EH 3HOYH 1HR0L 3TS2A 1WJJA 2ID0A 1EIFA 1CKNA 1B70B 3W5OA 5BR8Q 3J80i 3FKIH 3DLLA 1GO3E 2K14A 4C3JH 1N8RC 1HZ9A 4A3GG 2R7DA 2JE6I 1MKHA 3I4NH 3S15H 3HOUH 4GOPC 3CCVA 3KLWA 4DR4Q 5HGQA 1E7ZA 5JEAJ 3GO5A 4YWLA 1A8VA 1CKNB 3STBD 1X9NA 3ULJA 2JEAI 3S1NH 3RN5A 1PYBA 1BKBA 3S14H 1BVSA 1J5EL 3ICEA 3S17H 3UDGA 2JK8A 3F1ZA 4KHZA 3S2DH 3F8TA 3BJUA 3IRBA 4JI3L 1JJCB 2CFMA 3K7UC 4GKKL 2UUBL 3ERSX 4LWCA 3E0EA 3WWVA 1PFSA 4POGA 4GN3B 5M3MH 2OWOA 1QVCA 5LMNW 4IFDI 1Y14B 1O7IA 3PF4A 3H3VI 1CUKA 1SROA 1NBWA 5GAGC 1OTCA 4DR5Q 3KJPA 2E5LL 5IYCH 1VQKA 4JBMA 1N36Q 2WB1G 4LFAL 3HOXH 4MZ9A 2K5NA 1C0AA 4KLKA 1IYJB 1Q1BA 1N36L 3LGJA 4K0KL 4LFAQ 2YYZA 4A3DH 1VQFA 4MNOA 4P72A 3STBC 1M90C 2E5LQ 4JI2L 4DNIA 4DR2L 1IXRA 1RL2A 1P16A 4X65Q 4YWMA 4YY3L 1YVCA 2Y0SG 1VQ4A 1UE6A 1BBWA 1NJIC 3S1QH 1I94L 1KL9A 1X55A 4A3KH 4JI3Q 3VDYA 4DV7L 3HOZG 1GVPA 3GTJH 2R7ZH 5GQOA 3KF6A 4JI8Q 1R9TH 2IX0A 3CP0A 1M1KC 4UY8C 5JEAG 4HIMA 4DV3Q 3PO3G 1G6PA 3A5UA 1CSQA 4IOAA 4A3CG 4DR4L 5JJIA 2F52A 1VQPA 4GN4B 2WP8J 4DUZL 2JA5G 1U0LA 4R1JA 2Z6KC 3K81C 2XTIA 1Q86C 4O2DA 1XPUA 1VQJA 1HR0Q 1E1OA 2KCTA 4DV6Q 3GDEA 1X3GA 3I4NG 2R7FA 4R4IA 2DUDA 2UUCL 4BBRH 5LMUL 3M7NA 4OWWB 4GNXB 4JI1Q 5HY6A 2D0OA 4JBWA 1FVIA 3KDFB 5J3BA 4NXNQ 4A93H 2HHHL 1C9OA 1V9PA 1T9HA 1SN8A 3UE1A 5C3EG 1JJ2A 4LF9Q 1UE5A 4L5QA 1P8LA 4OO1I 2WAQE 4Y7NH 2JJQA 4JI6Q 3CCLA 2KHJA 3NBHB 4LFCQ 2VQEL 1N33L 1HZBA 1X54A 5DLQE 2JA8H 1KXLA 1HZAA 1OXTA 1HZCA 2EQSA 2IT1A 1N32Q 5IYDH 2CQOA 3TQYA 2Z6KA 2AMCB 1HNZQ 4JI4L 2CWPA 3E9IA 1QVFA 3KOJA 1TWFH 4OX9Q 4EQ5A 3GTGH 1VQBA 1EQRA 3CC7A 1W3SA 1NE3A 1KHIA 2K5VA 4JI7Q 4TVAB 5M5XH 3RR5A 4JI7L 2K4KA 4PG3A 2ES2A 1WOCA 4DV2Q 2MQHA 3HKZE 4LF4Q 1QZHA 4XTCS 4IFDJ 1SFOH 1VQAA 1L1OA 4JI4Q 4BA2I 3T1HL 2B63H 1UE1A 1SMXA 1K8GA 2PQAB 1NY4A 4GNXC 4HIKA 1JE5A 1PH7A 1K8AC 4A75A 3CCQA 3GTKH 2Z0SA 4LFCL 3AFQA 5JJLA 1KAWA 4NPSA 3CC4A 1X6OA 4P74A 3TRZA 4BXXG 4KHPL 2JA6G 4A4IA 1PH9A 3Q8DA 2RHQB 1LM0A 2DGYA 3MEFA 5IYBH 4OO1G 2JA6H 3FHWA 3K80C 4DV2L 1ASZA 5JJKA 3CW2C 1K73C 4AYBE 5M5WH 1PH5A 4BY1H 1D7QA 2ZJPA 1X3FA 1SR3A 1DGSA 4X62Q 3H3VH 1AH9A 1D8LA 1PYSB 2BH2A 4TQUS 3HOWH 1JJGA 1VQ5A 1MJCA 3S16H 4OX9L 4FDBA 3CCRA 3PUWA 1HNZL 3GTPH 3EIVA 3CC2A 5LMNL 4GN5A 4BY7H 4JV5Q 4UP9A 4HIDA 1PV4A 3UDXA 1X65A 1JB7A 2IHFA 3L0OA 4JYAQ 2VQEQ 3BU2A 1Q8KA 2PMZE 2VZAA 1VQLA 3CQZH 1YI2A 4JI0L 1B8AA 2VL6A 1SLJA 4LF9L 4LUZA 3I4MH 4DV7Q 2JEBI 4YCVA 2E8GA 2OQ0A 4BBRG 3OTOQ 1EQQA 3GTOH 1VQEA 4LFBL 3CMAA 1WYDA 2PI2A 4JI1L 3F2BA 4BY1G 4JCVE 4QJFA 5IP9H 5C0XI 1QZGA 3ER0A 3J80c 4X65L 4DR1L 2YV5A 4JI2Q 4DV6L 3U4VA 1OXSC 3TS0A 3S1MH 1L0WA 4K0KQ 1N34L 4ME3A 2WB1E 3JC66 3RLNA 3CCUA 4A3EG 4PZ8A 3DM3A 4X6AH 2R6GA 1YIJA 4IPHA 4DUZQ 1Y1VH 5AJ3L 1VQ6A 1TWHH 4LUOA 1SRUA 4LF5L 2Y0SE 3FP9A 5GROA 1WFQA 3GTMH 1KRSA 2NN6G 2AKWB 4APVA 4GLAC 2ZTEA 1EOVA 2ZJRA 2CCZA 1OXVA 5C44G 3KFUA 2UU9Q 1NTGA 1G51A 1Q12A 3AQQA 5C44H 3F2CA 1OXXK 4WJ4A 4GLVB 1KIXA 1HJPA 1EUJA 2N49A 4DR2Q 3CD6A 5FLMH 3A5ZB 3NENA 2V1CC 1XNRL 4GNXA 1YZ6A 3BZKA 4LF8Q 2VUMH 1I50H 4X64Q 1L1OC 4BBSG 2CWAA 3D0FA 5FJ8H 4A3GH 5IE8A 5BR8L 4J15A 4R4OA 1IBLQ 1VQNA 1MIUA 4BBSH 4O0AA 2YTXA 3PUYA 1YHBA 1Y1WG 5EAYA 1IBKL 3A0JA 4IJHA 4R4TA 1XMQL 1PH2A 4QL5A 5C4XH 3KF8B 4DV0L 3M4OH 2GVAA 3PO2H 2LXKA 3RLFA 1PH4A 5M3FH 1HH2P 1CSPA 3OTOL 1VQMA 4LF7L 4IJLA 1Q46A 2YTYA 2UUAL 2K75A 4B3TQ 1J5EQ 3E9HA 3M3YH 1WCMH 3G4SA 2BA1A 1G291 2H5XA 3I55A 4C3IH 3NELA 4MTNA 3S24A 2C35B 2LSSA 3OW2A 3AEVA 3PSIA 2ASBA 1VQCA 2PI2E 5IP7G 3GTLH 2I5HA 1E1TA 5IYDG 4B3MQ 3PUVA 3CAMA 2CKZB 2KBNA 1SE8A 4DR6L 1I3QH 4OONA 1IL2A 1XMOL 1XPOA 1L2FA 4JBJA 1HNXL 1PH8A 5M3FG 1S3OA 3GTQH 2R92H 4QQBX 1VQ8A 3HKSA 4A3LH 4DKAC 4YHHQ 5IT9c 2F4VL 2R92G 3M9BA 4YCUA 1U5KA 1K0RA 1QUQB 3K7AH 3D31A 2VW9A 4DUYL 3HOVH 1YHAA 4AIMA 4X66L 2B63G 4B3RL 4KHPQ 3KJOA 4BY7G 5ELOA 2R93G 5IY0A 1A0IA 3I7FA 3H0GG 3HOYG 4JC0A 4A3CH 4YWKA 4LNQA 3A74A 2IHEA 2D0PA 4AQYQ 1C7YA 4DV4L 1FGUA 1Y1WH 3U4ZA 1KRTA 4PMWA 4AQYL 4XIGS 4BXXH 3T1HQ 2MO1A 1Y1VG 4DAMA 4DK3C 2HIVA 3M4PA 4NB3A 4POFA 4A3KG 4LF4L 2B29A 4X66Q 4B3RQ 3J81i 2AHOB 2A8VA 1FJGQ 4A3LG 4B3SL 4AYBG 4HIOA 1UWVA 1XJVA 2ATWA 3S2HH 4DR3Q 3PO2G 2A1AA 2VQFQ 1YNXA 2N3SA 1VQHA 3SGIA 3CCJA 1Z9FA 4YCWA 3CCEA 4DR7Q 4R4QA 1S72A 1IBML 2UXDQ 1UEBA 2JQOA 4A3EH 5IYCG 3ULLA 2I5LX 5GAEC 3CF5A 4OXPA 3H0GH 5FJ8G 2KENA 1VCIA 5IWAQ 4A3JG 3PO3H 3HOUG 1RIPA 1N32L 2VUMG 1PHJA 2PNHA 3K0XA 3UDIA 2N78A 1XPRA 1Q7YC 1PH1A 1N33Q 4JOIA 2UXBQ 4HJ9A 4GOPB 4UP7A 3U50C 2MNAA 1S40A 1EYGA 2JA5H 2VNUD 4RMFA 1K83H 4QY7A 1GM5A 2FXQA 5ELNA 2NVTH 1A63A 4JG2A 2PQAA 1YEZA 3I4OA 3TREA 1E24A 4Y52H
chains in the Genus database with same CATH superfamily
2YZMA 3I2ZA 2UXCQ 4ECQA 2WTFA 3BQ0A 2RCNA 1H9RA 3E5NA 1WTRA 1SSOA 1Q1EA 4LFAH 2M00A 1TXYA 3EPIA 2WFWA 2EY1A 4R8UB 3W1BA 3P20A 3RUZA 5IGGA 4YAJB 2XRQD 4GZYC 2XCPA 4RZQA 5L9XA 2HD3A 2E2IH 5C4XG 3UFXB 4LF8L 4DNTB 5HGTA 2AGQA 2YRXA 3E3XA 5FO9B 3RIZA 3PUZA 1F2LA 2VY3A 1TWHB 1V8QA 5I9OA 3K3PA 4LH6A 3RV3A 3FRPB 3RGZA 2ZM6L 5A2QW 2XGTA 3G7LA 3N8DA 3PGZA 1DOKA 3KDFA 1YITA 2D9UA 4IN3A 2A68D 4LF5Q 2C00A 4A3IB 2E2HH 5EPLA 4ECTA 5FLMG 3OOCA 4LMYA 5AJ3Q 5FLXW 1T3NA 4DR5L 3T5KA 1J5EH 5M5XB 2W57A 4PZ6A 2DLNA 4DUYH 3VMMA 2JA7B 1ULZA 2BDNA 2R61A 1RKNA 4JBKA 1HTLD 5CGKA 4C3HH 1WCMG 4O4LF 4FF4A 4WBNF 2QEXA 2F0GA 4ZK9B 3BVMA 4JI3H 4RGOS 2UXBL 3P7JA 5KEEA 3KTMA 1FJGH 1SYBA 4I50F 1QUQA 1TWGH 4CKBA 1XNQQ 1F2ZA 2F0NA 2B39A 5C3EB 4JV5L 3LWUA 3DUZA 3UQ8A 2P0AA 2E75C 1BXTA 4ZQIA 5KG2A 1D1KA 2VR1A 1BUVT 4IUQA 4RB3C 4ZAIA 3J81c 1PH3A 2KCCA 3J81j 1C30A 2F3IA 4GC7A 3PIOA 1A6XA 4ED0A 4HJAA 1SYCA 2KCMA 2UXCL 2B63A 3HGBA 2FE3A 1IW7D 3CPWA 4NXML 3FKIA 3KHGA 4BY1B 1HNWL 3HOVG 2RDIA 1STAA 3M7GA 2I07B 4K6DA 4EFEA 2BA0A 5DGAA 3AFPA 4HNUA 1BCPB 3PUXA 4A3MG 2FPGB 4Y8VB 1CZWA 1RJQA 4C5CA 4IPCA 2LMCB 3RLOA 3JAMi 2KEDA 4J9OA 3HFZB 1V4YA 3T1YQ 3Q8RB 4K2LA 1QNKA 4KKTA 4AH6A 1VMCA 5C4JH 1JIHA 5LOVF 5LYJF 3GIIA 4DR7L 4A93G 3V6KA 5C0XG 4QW8A 3JRXA 4A76A 5JUMA 1QB5D 1FJGL 3Q0AA 4G57A 1E3PA 1W93A 3T1YL 1ZXTA 3HOXG 2R8GA 5C0XJ 1W2BA 3NXWA 1U4MA 5G3LD 4KY7A 3W1GA 4A3IG 1PYWD 5HV6A 5EGTA 2K52A 3T5HA 2X6GA 5D3IB 1TWCA 1U4LA 4X3KA 1CKMA 4XX0B 1GKHA 1ENAA 2Z4HA 3G6EA 5GAHC 1EZ6A 3RN2A 1IOWA 2F0EA 1PVOA 1HFNA 3MFHA 4F7XA 2PPBC 2FK2A 3HOZH 1IBKQ 2EDGA 2F1MA 5C3EH 1HR0L 4EFBA 5JAVA 4JV1A 4PDBA 2ID0A 2IJ0A 1CKNA 3V05A 4MV9A 3TZDA 3W5OA 5KFRA 1N8RC 1HZ9A 2NB0A 4KD3A 2Y0SA 3PIO3 5CV6A 1QOHA 3S15H 4HQ6A 3TINA 3D3RA 1RF2D 3NPPA 2NZ1D 3NGDA 3KLWA 3R5HA 4FBTA 5C3XA 2I87A 4OELB 3STBD 5C0XH 1X9NA 3S1NH 5DG8A 4IR1A 4FS1A 1S5BD 4ETSA 2JK8A 4KHZA 3S2DH 4GKKL 3K7UC 3ERSX 2J7ZA 3E0EA 4K5VA 2R7MA 4C1NI 5IGFA 5LMNW 4IFDI 1CUKA 4UAIA 5JVG3 1SROA 4M1UB 3X3MA 5GAGC 4DR5Q 4JBMA 1Z2PX 3OHXC 5KFXA 1PXUA 2WB1G 4MZ9A 3OW7A 1WD0A 4O3QA 4JI6H 2K5NA 3FMAA 3IL8A 3F8NA 1Q1BA 3N43B 3SK8A 3LGJA 4K0KL 4LFAQ 1VQFA 2SOBA 4MNOA 4JI2L 1IXRA 1I4HA 2R8JA 4YY3L 3OIQA 1STHA 1RJTA 1BBWA 1UE6A 3GP7A 1I94L 4JI3Q 1GVPA 1EY6A 1D2BA 2VPQA 3VYUA 1R9TH 1BJTA 2Z8LA 4KJNA 4DV3Q 3LMLA 3RAQA 2FK1A 4APMA 4IOAA 3OHBA 5NUCA 4UCTA 4GN4B 3ETJA 4DUZL 5D14A 3D6CA 1O75A 4O3PA 4XYMB 3ETHA 1BQQT 2XTIA 2BDOA 1B9MA 4QF4A 1W6KA 1ENCA 5KFLA 1HR0Q 1F9PA 2R7FA 3OHAA 3M7NA 4O2AF 1LLRD 1HPCA 3DXJC 5IIFA 4GNXB 4NXNQ 4A93H 1T9HA 2HDMA 5L1IA 1UE5A 4RB1A 1G8ZD 1LTGD 1G91A 2V4QA 4JI6Q 4R7RA 1H9SB 2KHJA 5I2YA 3U9OA 1ZHQA 4L1KA 1N33L 1X54A 4IRKA 5IT9E 1KXLA 3T51B 1RODA 2CQOA 5T1GA 3NTIA 2Z6KA 5LL6S 3RAXA 5KFSA 3KOJA 3GTGH 4CGYB 5KFAA 1NE3A 1KHIA 3N42B 4JI7Q 4KV6A 3R3OA 1PTOF 1DJRD 3OSPA 4DV2Q 2MQHA 4A3KB 5KT5A 1S0OA 1KLUD 4IFDJ 1SFOH 2W7OA 5CR3A 4EQNA 3SK6A 4XQJA 2KECA 3IFTA 4ED8A 2PQAB 5C5LA 2J4XA 1F9SA 1EZ8A 1K8AC 3D4DA 3JAMW 4RHRA 3AFQA 2AQ4A 5ELDA 5JJLA 3AU7A 3CC4A 2ICEC 1RJRA 2BOSA 1PDQA 4A4IA 2JA6G 1PH9A 3CU7A 1B1ZA 1ET9A 1PK8A 3U9TA 5KFDA 1KDCA 2F0VA 3RFCA 2XNAC 1K73C 2R84A 4BY1H 4C5BA 4IUUA 2NVYB 3M4YA 1X3FA 1SR3A 4MHEA 2BH2A 2YZGA 4TQUS 3E0JA 4H0LC 4DV4H 2EY2A 3HB9A 4OX9L 1G2TA 1A3VA 3CC2A 2WE6A 4X66H 1JXLA 4GN5A 4BY7H 5FO8B 2IWHA 3KAJA 3QWNA 4YB8B 1EIGA 2IHFA 4J1MA 2D2CC 3FVQA 2B2YA 2PMZE 5LXTF 3J7AK 2A6EC 1SLJA 2VL6A 1VBHA 3T5JA 3I4MH 3NWSA 2FHTA 4DV7Q 1FNUA 3M3YB 5GONF 1VF5C 2OQ0A 4YCVA 3GTOH 5TSSA 3GTLA 3CMAA 4JI1L 3F2BA 2CW7A 4ED3A 1QZGA 2W70A 2F0LA 1SFOA 4X65L 2QCPX 2A69C 1LACA 3FPUB 1LTTD 1GUSA 4K0KQ 2WB1E 3JC66 1LTID 2XIGA 4I4TF 4PZ8A 1A3UA 1S0MA 3I8ZA 3EYYA 2VQEH 5AJ3L 3BABA 2W9AA 1TWHH 3QOJA 2RGRA 1SXTA 4LF5L 3GTMH 3LWBA 3GIKA 3M9NB 4DL7A 1E4EB 2UXCH 3V4SA 2AKWB 1GUGA 4GLAC 4DV7H 4K14A 2XCAA 5C44B 2ZJRA 5KFCA 2J6UA 1I50A 4H44C 3SE0A 3QZ7A 1QNUA 5EPJA 4C2MA 4RU9A 5KFEA 3PIP3 3F2UA 1GGOA 3VR6A 1KIXA 3DMUA 4IURA 2N49A 4J9LA 4JV5H 3CD6A 5FLMH 3NENA 5FK9C 4GNXA 4DR1H 3KF8A 3BZKA 4DL3A 3D4WA 4PV1C 4EVOA 2SCUB 1L1OC 4U6PA 1M8AA 3D0FA 4IZ8A 4ZKBB 2JA6A 5BR8L 4DV5H 4R4OA 4QW9A 4QIWB 1B53A 3A0JA 4IJHA 1PTOC 1FNVA 1XMQL 2I46A 4QL5A 3GTMA 4GKKH 2K32A 2LXKA 3BG3A 1TWAA 1HH2P 3OTOL 1WTQA 4B3RH 1F77A 1SYDA 2YTYA 4JW0A 1AN8A 2K75A 3PW7A 2HVSA 4B3TQ 4KHVA 4TQRA 4TV8F 3NELA 5ELCA 2C35B 2LSSA 3AEVA 3N6RA 5J1ZA 1VQCA 4TKOB 5T1IA 1SFOB 1L2ZA 2F3VA 5KT2A 5IP7G 3TQ1A 4J6HA 3V6HA 2W6ZA 1O7LA 5CV9A 2KBNA 1SE8A 1I3QH 4U673 2M05A 4L63B 5M3FB 5KT4A 1I94H 3R5XA 3PW0A 1XXGA 2R92H 5FO7B 3GTGB 4DKAC 4A3LH 4YHHQ 1DV2A 1KTKA 5BPFA 4OX9H 1I4GA 2LS01 3C1EA 2PYKA 4ZYSA 3D31A 1EQTA 5M9OA 2VW9A 4FXKC 3KJOA 4FNFA 5ELOA 1A0IA 4X3UA 3H0GG 2VXWA 1U9RA 4JC0A 1D6EC 2D0PA 1I3QB 1KRTA 3WO1A 4AYBA 2B8FA 2IL8A 2MO1A 5LMUH 4RNOA 4ECSA 1TKWB 2HIVA 1RCVD 4B3RQ 3BS1A 3R5FA 4MV7A 3J81i 5M5WB 1FJGQ 2R7ZB 3K3VA 2L12A 2ATWA 1NSNS 2CH4A 4CJ0B 3S2HH 1ENFA 2L55A 4O1NA 2A1AA 4DR3Q 4JUZA 3RV4A 4DL5A 2E2HA 2K01A 2UXBH 3CCJA 4CJ2C 2A6HD 4RKLA 4IHJF 5KFTA 5J2UF 4A3EH 4HNVA 1GUWA 3VPBA 3CKIB 3ULLA 2I5LX 5KFGA 1N48A 3HKZA 2KENA 1VCIA 1BO0A 1AZQA 3HOUG 1RIPA 4Q44A 5KFNA 2VUMG 4R8NA 2PNHA 3K0XA 1SMYC 1XPRA 1Q7YC 1D5MC 2AUKA 4JOIA 5KG7A 3R2IA 1S40A 3GV7B 1PTOD 4DU9A 1CQFA 4R8IA 4DR5H 4J9KA 1E24A 4MA0A 1K28A 2ZTDA 4EYHB 5F2DA 5DGBA 3BZCA 3RJ0A 3LWEA 2B2VC 2F0KA 5C4ZA 2MP1A 4C3IG 5JPMC 1LTBD 1H9SA 4C3HB 3KAKA 1A62A 2OEOA 1C8CA 3QB3A 2VS1A 4TSSA 1IBLL 2Q2TA 3KHRA 4TQSA 3KLRA 1ICWA 4A3BG 4F88A 2O5JC 1XNQL 1QVGA 2N88A 4BS9A 2DJFC 4BBRB 1YJ9A 4B3MH 4BA1I 1XNRQ 5CB4F 2R92A 4DV3L 5LHY1 2K7VA 3G8CA 3ZJYC 3CCSA 5L1JA 4OL7A 1T94A 1UUPA 2UU9L 1DD2A 1BF4A 4RWSC 1V1QA 1I94Q 2XCLA 1QILA 1DOLA 1A9XA 5KFHA 1W96A 3CPFA 2ZXPA 2K5WA 3O13A 4YY3Q 2JA8B 3J81W 3VR2A 2PQEA 4A3MH 1DV1A 4OWTB 3T16A 4IR9A 4EEQA 3PIPA 1SCUB 3NQTA 2NVYH 4YAKB 2W6NA 4OWXB 3PQIA 4DPGA 1JICA 2JA9A 1UC9A 3H3VC 4P75A 2NUCA 3MXNB 2WB1B 3WOFA 2P5ZX 1LT6D 3DWQA 4A3BH 1HUNA 1JR0D 1TWAH 4E6IA 4HJ7A 3PF5A 1N34Q 3ORRA 2W8LA 3RNUA 4J9QA 1JC7A 1AFPA 2AGOA 4GKKQ 1YJWA 1SE2A 2NN6H 4O42A 1SE3A 4RG1A 3NP8A 4MIUA 2R7ZG 3W3AA 1JOOA 2F0TA 4LW1A 5EQ0A 5C1OA 4DV5Q 2IY5B 3PV0A 2BQRA 2NWGA 4JI0Q 1DCZA 1A2UA 1LABA 1TVXA 2MFIA 5K36H 1L1OB 2MO0A 2OCEA 4EBCA 4MA5A 3TP6A 1Q82C 2Q2HA 4IOCA 2K03A 2UXDL 2EIFA 2K28A 1VQGA 2PZTA 4HTHA 4RB0A 3FMCA 3H15A 1BOSA 3H4BA 4DFAA 5IYBG 2EXDA 1SEIA 4HEDA 2BQ3A 2HQLA 4JI5L 4M8AA 3VA7A 3N52A 4MTEA 1YBYA 2FPPB 1EFWA 3ULPA 1H95A 3KK7A 4K8JA 5A35A 2RDJA 3S1MB 1FGBD 3PW4A 3DF7A 2LXJA 1GSHA 2FB9A 1SNOA 3S1RH 2EZVA 2I8CA 2MPMA 4JOIC 4DN4M 3ND9A 3J80L 4M7EA 5CBAE 1ASYA 4WRDA 1JDBB 1S10A 1VF7A 1EOTA 4J9MA 1MSGA 4YHHL 5KFFA 1YHQA 2PZUA 1J6QA 1HHVA 1AE3A 1V1PA 2I5MX 2DY7A 3H91A 3TP8A 4HJ5A 1XMOQ 1JT8A 3HKZG 1E0BA 3HZXA 2JA8G 4YR3A 2R3ZA 3EQLC 3QO2A 3N44B 4B3ML 5ELBA 5M5YH 2I0QA 4MV8A 1LYLA 1JX4A 4KKUA 2UXDH 2KHIA 4DV4Q 4IUTA 4RHSA 2WYOA 2X0SA 3EN2A 4O3SA 5IOCA 3B6YA 4RKBA 1UNSA 3J7AV 2AWOA 1L0YB 4JI6L 4A3FH 1Z2OX 2Q2UA 4JI5Q 4B3TL 2UUAQ 1UE7A 4Y7NB 3JAMc 4ECXA 2F0DA 4N8FA 2A73B 1XDNA 5HURA 2XWJB 5LMUQ 2UU9H 5H1SE 3KF6B 1CK1A 1GUOA 4L5TA 4DV1L 3RB0A 1SNPA 1WJJA 3MXUA 3T56B 2JEGA 1STBA 1B70B 3GIQA 4QCLA 1WCMA 4ME5A 4RAUC 2K14A 3M9OB 5DM63 2JE6I 1MKHA 4BY7B 5CV4A 4OHJA 1E7ZA 4YWLA 5E4XA 4YHHH 1EZ1A 2XWBB 2O4XA 2V59A 3RN5A 5DEHA 3ICEA 1J5EL 1TS5A 3F8TA 4OO1H 2QEJC 2EYLA 1JJCB 3IRBA 3HP3A 5KG1A 4POGA 1HQRD 1PFSA 2DY8A 3WOEA 3WWVA 4NXNH 2MHVA 4Q8FA 2LKVA 4FF1A 2YS6A 2FJ2A 5BN3A 1GYFA 1O7IA 3H3VI 2K5QA 5DQHA 1RHPA 2JP1A 1OTCA 2OTJA 2RQXA 2Q8TA 2KUMA 4J0MA 1K1QA 4ECYA 1CHPD 4LF9H 1MHWC 5DLFA 1IYJB 1K8MA 1K83A 3MWEA 2YYZA 4A3DH 1M90C 2HDLA 4DNIA 4DR2L 4X65Q 2FLLA 3P75A 4YWMA 1YVCA 2WKCA 3S1QH 4EEYA 3H94A 2R8IA 1X55A 4A3KH 3A8IE 4YR0A 5I2XA 3HOZG 4HSPA 2KQ3A 2R7ZH 1EY0A 1F9RA 3KF6A 2N55A 5KFMA 5JEAG 2ZM6H 1CSQA 3Q6SA 3NTKA 4A3JB 4NLGA 1SYXB 4A3CG 4DR4L 5JJIA 3HKZB 2HCIA 3K57A 2VOBA 5J2TF 3PMFA 3ITPA 5C3WA 1WVLA 3K5HA 4DV3H 5C4JB 3N40P 1SJHD 4O2DA 2AGPA 3C1FA 3GIDA 4DV6Q 3I4NG 3GDEA 2DUDA 4OWWB 4JI1Q 3BJYA 1FVIA 1EYAA 1I6HB 3GIMA 2E5LH 3KBXA 2ZXOA 5KX5F 1JJ2A 4OO1I 2WAQB 2JJQA 4YBZB 2C28A 1N56A 3TBIB 3NBHB 4R8UA 2RSNA 2VQEL 1J8IA 3QFFA 3D6WA 3TQYA 4QUCA 3TIIA 1B44D 4K2KA 1VBGA 1V1OA 1HNZQ 2KVMA 3E9IA 2H1EA 4OX9Q 1DIKA 2XIWA 3CC7A 1W3SA 5KG5A 4TVAB 3M9MB 1II3A 4ME6A 1WTHA 4RCNA 5IGDA 3QZ8A 2K4KA 4PG3A 2ES2A 2K6AA 4Q0FA 4F4WA 5CORA 3HKZE 2UUCH 3H0GA 4XTCS 2R7NA 1VQAA 2F0SA 3K5OA 1UE1A 1SMXA 4I7AA 1K8GA 4DL4A 1JE5A 4NKLA 1PH7A 3CCQA 2X69A 4QMGA 4LFCL 1ZHSA 5IT9L 2EY5A 1ML0D 2R87A 5FD5A 1TT2A 4RFBA 5KFUA 2V9WA 3Q8DA 2NBFA 5EJWA 2DGYA 5IYBH 3Q2OA 3FHWA 3K80C 5ISRA 5JJKA 5EPKA 4QB4A 4J8QA 1D7QA 2IX3A 3A55A 3HS0C 3TIGA 3H3VH 1AH9A 5T14A 3A56A 3PO2B 1C3OA 2EXZA 1KNEA 4F8MA 1JJGA 5KFKA 4CHTB 3RZDB 3S16H 2EYHA 2SDFA 3CCRA 3PUWA 3NUCA 5LMNL 4LF5H 4N9PA 4UP9A 3MFIA 1S5FD 4C3IB 3N41B 3BAAA 2VUMB 1W6JA 1CS0A 3OIPA 3DEOA 1Q8KA 4B9XA 2VZAA 1VQLA 3CQZH 1X32A 3NBIA 1YI2A 4DAYA 1AW7A 4LUZA 1BNZA 1STNA 4OIKA 2K05A 4YQWA 4BBRG 1R4PB 1E4EA 3OTOQ 4IWXA 3FDTA 1VQEA 4LFBL 4X3TA 4UFZA 2PI2A 2I80A 4BY1G 4JCVE 5IP9H 5D1OA 5C8YF 1EFID 5I6WA 1K0SA 5L1KA 3J80c 3BG5A 1S68A 2YV5A 4JI2Q 4B9WA 1OXSC 3KUPA 3J80E 2DJGC 2PW5A 2WV6D 5EBDA 4G7HC 1KJ9A 3K5IA 1VDZA 3K58A 3QJYA 1STYA 1JB3A 1YIJA 4IPHA 4DUZQ 1B6SA 2YL2A 2RKSA 2B2WC 4LUOA 2KSWA 1WFQA 3V96A 5FPRA 1HA5A 2HHHH 2CCZA 4IRDA 4DV6H 1IBKH 3VYTA 3ERQA 2UU9Q 3Q8QB 1PRTB 4M9UA 1Q12A 3AQQA 3HOXB 1HJPA 3T53B 5CV7A 1SNDA 2EY6A 4DR2Q 1EYCA 3A5ZB 5EKKA 2V1CC 4O4IF 3RGXA 5EWGA 2F0QA 1YZ6A 4UDUC 1I50H 1GUTA 4H7BA 2W6OA 4JI0H 1NR2A 2B2TA 1VQNA 3IN5A 1AEXA 1HXYD 1SYEA 4XYOA 1Y1WG 1YHBA 4DAPA 5FPOA 4P2CB 5C4XH 1HRJA 3K59A 3KF8B 4DV0L 1VAJA 2RDGA 3RTXA 2GVAA 2KOLA 3RLFA 1PH4A 1KLGD 2Z6BA 5M3FH 4ZI7F 1CSPA 3PZPA 5D3DA 3EROA 4IJLA 3TN2A 1J5EQ 1B50A 1S03G 1G291 2H5XA 1F9QA 4MTNA 1DM0B 2PNRC 1BNCA 2BE5D 3KHLA 2F4IA 2ASBA 1RYSA 3OPOA 4QWDA 2PI2E 4KHPH 2I5HA 5IYDG 1M6VA 1XMOL 4WJWA 2RA4A 5KYLA 1S3OA 2XVSA 3GV5B 1E4FT 3OUZA 2F4VL 2R92G 3M9BA 1YNJD 2VQDA 1Q3LA 4TUYF 1U5KA 1K0RA 4LF7H 5L37A 3SDZA 4XYQA 2R93G 2K33A 4NXMH 1N32H 3I7FA 3HOYG 1H9JA 1R4QB 4CJ1B 4A3CH 4LNQA 1EHIA 2E74C 3A74A 1C7YA 5IGCA 2AQ3B 4DV4L 1WSCA 3PO3B 1DONA 3DEPA 1S4ZA 4RH6A 3T1HQ 2NU6B 4DK3C 4C56C 3NK9A 3LP8A 4UCUA 1I7NA 2W6QA 4A3KG 2AHOB 1EWHA 4A3LG 3ORQA 3GV6A 2PMZB 1K83B 4CDEC 2NVTB 2W9CB 1WCMB 5LL6X 2YW2A 1RYRA 4DR7H 1KAAA 2XGQA 2IMWP 2Z1CA 1F2YA 1B3AA 2N3SA 2XRSD 4V0BA 2F3WA 2BE5C 2NTTA 2L11A 5C5MA 1S72A 1UEBA 4EQOA 5IYCG 1JOKA 2TMPA 2R7ZA 5GAEC 3PO3H 4A3JG 3GTOA 3H0GH 2ZT9C 5IWAQ 1AN7A 3UDIA 1N33Q 2N78A 2DZDA 3J80W 1TWFA 1ZKOA 4HR7B 2B2WA 5I9PA 3U50C 2MNAA 2JA5H 1CE8A 4RB2C 1K83H 4QY7A 2NVTH 5KFIA 2PN1A 2PQAA 1YEZA 4NDXA 2R7LA 3TREA 4RAYA 4ECUA 4NXNL 3DHQA 1PFNA 2R8HA 4JI4H 1WH2A 1B7YB 4MV6A 2ATLA 4LF7Q 3M4QA 4UCVA 4H02A 2HIXA 4IAJA 4LF4H 2F0MA 2IW3A 2R93H 3L7ZC 2HVRA 2B2VA 2F0HA 5IP9G 1I4QA 4DV0Q 5KFZA 3VA5A 3J7ZC 2RGVA 2L15A 3J7YW 4FU0A 4DK6C 3JRWA 1IKLA 2EYMA 4AQYH 1TU2B 1JLLB 4IFDH 1RJPA 2R93A 5DLGA 3C2PA 1UNNC 1VQOA 2PVPA 2VPSA 4L5RC 1Q81C 2R7KA 3PR5B 2A19A 1I6HH 2NU9B 1EIYB 4DV5L 1U4PA 4CC6A 4P71A 1X3EA 3MTSA 1XMQH 4K5XA 2QW7A 4V190 2IX1A 4QWAA 4RGTA 1HCZA 3MZ5A 1HR0W 2R92B 2Y0SB 2EYPA 3NEMA 4C3JB 4JI1H 2A69D 5IP7H 3HOYB 3MWYW 1BR9A 4UP8A 2KHSA 4GOPA 5J39A 5CV8A 4B3TH 2NVXH 2A6ED 3DWPA 2PMZA 4LF8H 1I4PA 4DR1Q 4A3FG 4LF6L 1SYFA 3TEHB 2X6LA 2CW8A 3I4MG 4TV9F 3VPDA 1EYDA 2ZM6Q 1EUDB 1JDEA 2BCOA 4IO9A 4JI8H 2ZJTA 3S17B 2AQ2B 1VQDA 4NW2A 3OMCA 5KFOA 4X64H 1EL0A 4TRDA 1Z47A 2NZHA 3K7AB 4RAZA 4JYAL 2W9BB 3OSNA 4PZ7A 1K3BC 2YU9A 5JPNC 3HBLA 1TWAB 1N9WA 1SJED 5FLXc 2O03A 1KNAA 5LMNQ 1CKOA 4DUZH 3MAQA 2BH8A 3SE7A 2QGQA 4MAMA 3BDLA 2GN5A 4G4KA 3L2PA 3SEBA 4ALPA 3KLSX 4CBVA 3I4NB 4OGQC 2JXMB 1TQOA 1NUCA 1JMCA 3FEWX 4J9NA 4B3SQ 2XGPA 2AQ1B 1GD7A 4EGVA 2NVQH 4LUVA 4GKJL 1YNNC 3H0GB 2CQYA 2D5DA 2BQUA 2WAQG 3H09A 1CQJB 4ED6A 3AB9A 5F9LA 2ZDHA 4DV1H 1B6RA 2NZOA 5KT7A 2NYZD 2GPWA 1CQVA 5DM73 4DF7A 4G7ZC 3EBEA 5FD6A 1Y8NB 2XN9C 1O7ZA 2CQAA 3NWTA 3RB6A 3NTHA 4QIWE 4IZOA 4LH7A 2F03A 1K9MC 4QWEA 1QWYA 3NBHA 2JA7H 2RCFA 4PNYA 2YU9H 1HNXQ 2VUMA 4GS3A 5K36G 3FDSA 1LTLA 3VR5A 4C2MH 5E7NA 2UUAH 4KI0A 1SNMA 2YU9B 3SVMA 3CMEA 5JVLA 5E3FA 3C3LA 2Q8IB 1Z7TA 2R86A 2F0JA 3K5MA 4A3IH 1CI3M 2E2HB 4IFDG 4X62H 2YS7A 2CVRA 1EY9A 2CH4W 2JEFA 3KBGA 2EYFA 3TSSA 4F87A 2W6PA 2ZDGA 3V2TA 1CT1D 4HMJA 4DGZA 2M2LA 4DUYQ 3S9WA 2JA7G 1IHZA 2K5HA 4ED1A 3T1HH 4C3HG 4O4HF 1TA8A 1XMQQ 4CDDC 4XQQA 4IPGA 5JVDF 2NVQB 1TY0A 4L8JA 2E76C 3J80i 4Z9CB 1GO3E 3HXLA 5IT9W 3WNZA 5D1OB 1HUMA 2FLPA 4A3GG 1Y69U 3I4NH 2E2JB 4GOPC 3OUUA 4DR4Q 3GLKA 5JEAJ 3P1HA 5H80A 3ULJA 2JEAI 1BKBA 3S14H 1WD1A 1BVSA 4F4YA 3S17H 1Z2NX 3F1ZA 4JI2H 3BJUA 4JI3L 2CFMA 4DR4H 1IL8A 4LWCA 2EYOA 3BDCA 2OF1A 5KT6A 4GN3B 5M3MH 2VUGA 4XZ3B 1Y14B 3UI2A 1NBWA 2MJ8A 3E6ZX 2E5LL 3KJPA 4LFCH 1S9FA 3MA2B 2EE1A 3HOXH 1LTSD 1RD9D 1UC8A 4FS2A 1D5ZC 2B2UC 4KLKA 1N36L 2C2EA 3N6XA 1KABA 4P72A 2E5LQ 3STBC 2VA3A 3RB4A 4Q5VA 3TDQA 4FF3A 4HN7A 1NAPA 1Y1VB 3SHLA 4DA2A 3JSNA 3Q1KA 1S97A 1G2SA 3KLSA 1VQ4A 1NJIC 1WR2A 4L6TB 3VDYA 4DV7L 3GTJH 3CRKC 5GQOA 5FLXL 4JI8Q 1M1KC 4UY8C 4HIMA 1GOZA 1G6PA 3A5UA 2NVYA 3EA6A 1R9TA 1LT4D 3OSOA 5KNBA 1EQVA 4KY6A 1JWMD 2FMAA 2WP8J 4EQPA 2FFKB 2JA5G 2FMMA 4ZRZA 4R1JA 2Z6KC 1Q86C 2PO4A 5BN5A 1PRTC 2CHBD 3Q8PB 4OIJA 1XPUA 1VQJA 2HJWA 2KCTA 1X3GA 4ECVA 1E4GT 4R4IA 2UUCL 5LMUL 2KJXA 2D0OA 4JBWA 3PN1A 4YP3A 5J3BA 3I73A 3L9AX 1C9OA 4F50A 3T1YH 5BPHA 1AUVA 3UE1A 1KJJA 4LF9Q 2SEBD 4L5QA 2WAQE 1EEFD 4I7ZC 5BMVF 1O78A 3CCLA 3QG1A 1M4VA 2W7PA 4LFCQ 3K5NA 1ZYRC 5DLQE 2JA8H 1JKJB 3WO0A 3X3NA 1HZAA 1OXTA 2EQSA 2IT1A 1HTPA 1N32Q 5IYDH 4WD3A 2A5HA 3R2TA 3BYYB 4H13C 5CA1F 4N8X1 3IG0A 4JI4L 4IQZA 4JPBW 4QUFA 4A3GB 3GTLB 4B3SH 1TWFH 4EQ5A 3AMUA 1PZID 2J6SA 3GV3A 1SMYD 5M5XH 2O5IC 2F0WA 4JI7L 3Q23A 2H4OA 3I70A 1WOCA 1TY2A 2QKIC 1WTVA 1QZHA 5C1PA 1L1OA 3BQ1A 4JI4Q 1YNND 2Z4IA 2A6HC 2JYOA 4CKEA 3K5LA 3T1HL 4BBSB 1IW7C 3NQIA 4HIKA 1EY5A 3MXNA 2V5AA 2QDBA 1A2TA 1PLFA 4BXXG 2YCHA 2V4DA 3NE5B 5KKNB 4ED7A 2L9HA 5IWAH 4YR2A 3S2HB 3RB3A 3MEFA 1D1IA 2JA6H 2E2DC 2C9OA 4DV2L 1ASZA 4A3FB 2ASJA 3CW2C 5M5WH 1PH5A 4ZQ3A 3MWMA 3I4MB 3K6OA 4RGNA 2ZJPA 3VYRA 1TWGA 1DGSA 3HOWH 1OO9B 4JVZA 3MEHA 3RMHA 3I91A 1MJCA 3MR5A 3GIJA 2Z9HA 5IGEA 2VA2A 4KN7C 3BVGA 4LSAA 4HIDA 1HQMC 4ECZA 1X65A 1XMOH 3L0OA 4JYAQ 3NHHA 3BU2A 3LX0A 4JI0L 3DM1A 1B8AA 1N36H 3V4ZA 4LF9L 2JEBI 4IRCA 1QJOA 2E8GA 5C4XB 5KFBA 1ZEQX 4NP5A 1WYDA 4IUVA 4QJFA 2K1BA 3ER0A 4DR1L 4EGJA 2HUGA 3U4VA 3IFDA 4K5WA 3TS0A 1L0WA 3S1MH 1NR4A 2HQEA 4ME3A 1N34L 2JSOA 3RLNA 3EFXD 3CCUA 2SNSA 4K0KH 1GJXA 3TQTA 5D8DA 1Y1VH 2GA4B 1VQ6A 4F4XA 2ZXRA 4FXGC 4YIJA 3FP9A 1XNQH 2Q8RE 2FKLA 3OTOH 1KRSA 3U9SA 1UAPA 2ZTEA 1I7LA 2FPIB 1OXVA 4ZOLF 5C44G 3KFUA 4QWCA 1BDOA 1H9KA 1G51A 1OXXK 2MUYA 1EUJA 4S3SA 1ILPA 2JA7A 5G3LF 1XNRL 2UUBH 4G3IA 4BBSG 2F0PA 2W9BA 4MN3A 2WACA 3GTQA 2EJFC 1T5EA 2LFNA 1IBLQ 1TWCB 4O0AA 3H40A 3PUYA 5EAYA 2NVXA 1QG7A 2B2UA 1Z6HA 4EG0A 1Y8OB 3M4OH 2RDFA 4LJZC 4ZKCB 1VQMA 1PFMA 1E2ZA 1XX8A 1EY8A 3QIAA 2UUAL 3A8JE 1M0TA 5LP6F 3E9HA 3I90A 3C0FB 3VR3A 3G4SA 1XTCD 5I6YA 1SBBB 4C3IH 3S24A 4XYLB 2K04A 1TWGB 3PW2A 4KJOA 4LK1C 3PSIA 4EGQA 2WKDA 3VR4A 5EKIA 5CBEE 1L0XB 4UCRA 1H9MA 3S16B 3RD4A 3GTLH 2QYZA 4B3MQ 4HAEA 1WTPA 2EOTA 3CAMA 3MHBA 4MV4A 1KDAA 1TR5A 5KIXA 5CA0F 4DV2H 2CW0D 2DWCA 4MTKA 2UVWA 2E2IA 1L2FA 2L0CA 4JBJA 4KMUC 5EZYF 1PH8A 5M3FG 5KG0A 1VQ8A 3HKSA 1MSHA 1IYVA 1TWFB 2ASLA 1ILQA 1E2VA 1SNCA 4XDXA 5IT9c 1KJQA 3CRLC 2AUJD 1QUQB 5COYA 4X66L 2L1BA 3MXPA 4I55F 2A74C 4BY7G 5IY0A 1KDBA 2VB2X 2FMCA 3RF2A 2IBKA 3TZUA 2DIKA 1MD2D 4YWKA 1JE4A 5AFWA 4AQYQ 2IHEA 5CYUA 1Y1WH 3MVVA 3U4ZA 2OLSA 4PMWA 1KEEA 2RVLA 4AQYL 1Q90A 2VB3X 4BXXH 4RNNA 5DNFA 1BCPD 4DAMA 1EUCB 2JA5A 3M4PA 3TMEA 4POFA 4LF4L 2B29A 3BVZA 4X66Q 2A8VA 5C5JA 1PTOB 1PZKD 1S5CD 3HOZB 5IGBA 1UWVA 3BA8A 1SDFA 4RUCA 1B3QA 1GHKA 4CC5A 3A54A 3PO2G 5IODA 3PVXA 4FO2A 4IALA 1I6VC 2FINB 3S1NB 1VQHA 3J81L 4CDFC 1CQIB 4DR3H 1BGWA 1IBML 2UXDQ 2XD4A 3GTJA 1KJ8A 3CF5A 5FJ8G 3RUPA 1N34H 1LO5D 2B2TC 4DK1A 4J9PA 3HRZC 5KFVA 4JV0A 3RZOB 5HBRB 3Q24A 1JCKB 1I4XA 2BR0A 1D5XC 1GM5A 4KN4C 4Q0YA 2W9CA 5ELNA 1A63A 4QIWA 4JG2A 1EEID 1FKAH 3I4OA 3GQCA 4ILWA 2HHHQ 4Y52H 4UHVA 4NXMQ 2IPKD 4X65H 3T4AC 2K50A 2UUCQ 3I56A 1ZYRD 1EY4A 2ALYB 1CM9A 1WTXA 4LMQD 4Q43A 1VS0A 1XWEA 4R4CA 3K0YA 2WDTA 2ZTCA 5M3MG 4FF2A 3HG9A 3RZOH 4A3JH 2F0UA 3K8AA 5D65A 5M3MB 4MV1A 4EX5A 4IUPA 3UE0A 3MR3A 4C3JG 1PA6A 4X64L 2RBMA 4ZLTF 1VQ7A 2R8KA 1M7JA 2XSCA 2PZWA 4I65A 1PZJD 2RHSB 5JQWA 1DYQA 1PMRA 1PFBA 1X56A 2AWNA 1Y8PB 1PRTD 4JI8L 3C46A 2XC9A 3MFGA 3HOVB 4DK0A 3MR6A 1SAPA 1MJEA 3OYYA 5JEAH 1IZ6A 1LUZA 1XYIA 4XQNA 2QILA 4XT3B 5EWFA 4A2BA 3PCOB 1Q8IA 2OTLA 5GADC 4L5SA 3S1QB 4LF6Q 4ZHQF 2YTVA 1MGSA 4DLKA 1MI2A 2EYJA 1V43A 2UVUA 1I5FA 5CC4A 3D8GA 2E2JH 3T13A 2DNCA 2GPSA 5DQIA 4GKJH 5FKAC 1KQSA 1RK6A 2J0TD 4IPDA 2FK3A 1PTOH 1IBLH 5D1PA 4BWSC 1NMGA 1AE2A 4KY5A 2RF4A 4PMBA 3TP5A 2HT1A 2UUBQ 4N9TA 2JA5B 3UDFA 4DR2H 4JI5H 4UPAA 2ZJQA 3HOWB 1FL0A 3I12A 3CXCA 4LFBQ 1KD1C 2L4NA 3KYHC 2VQFH 4BWGB 5DG7A 5LL6b 4PMCA 4O2BF 4XXEA 1Y1WB 3M85A 1A15A 5DG9A 1YJNA 3EVQA 4DAVA 5IWAL 3VPCA 3FPPA 4QGUA 3HEJA 1FD7D 4DV1Q 2N8NA 4DAYB 4DXFA 1EU3A 4UCOA 2QF7A 5A2QE 4DR3L 3GD7A 4X62L 2OQKA 1NMFA 3RZDH 3KALA 2C2DA 1EYZA 4HSVA 3J7A5 3URYA 2L5TA 4GLXA 5A2QL 3Q8SB 2K5DA 3F2DA 3SR1A 4IWYA 4CDCC 1TS2A 3MC0B 5EOYA 4ECRA 1PH6A 3H6MA 2B2YC 4KK7A 2QA4A 1KC8C 3OMGA 4J9RA 1J9OA 1LT3D 4A3DG 4RUAA 3CCMA 1MBYA 1NCVA 1XTDA 3M4OB 3W2DA 2DPJA 3GTOB 1QE6A 1C48A 2W8KA 3QOLA 1IBMQ 3M4IA 2F0OA 3DWAA 1TWCH 1OXUA 3U58A 1WI5A 1BBXC 2VQFL 1EU4A 1EWIA 4GC6A 1BBUA 5DQGA 3AYHB 4EBEA 1ESRA 1B2TA 4A3EB 5M5YB 2ZDQA 1LT5D 2WAQA 1STEA 1JORA 4P73A 4HMIA 1EIHA 1JQYD 3OWFA 2FJZA 1K3RA 4DR6Q 3FKIG 4O3NA 3OWEB 4U68A 2D62A 3G71A 3G48A 3S1RB 4G7OC 2G9DA 1CTMA 1ZQ7A 5KFWA 2NN6I 2B3GA 2TSSA 1E22A 1VQ9A 1HNWQ 4GKJQ 3MXGA 2KCNA 1LV9A 1RTOA 5KG4A 1VQIA 1AUXA 3G6YA 2GVBA 4WJ3M 4FXDA 2W6MA 5KT3A 2Q2IA 2F0IA 2F4VQ 2R6FA 4HJ8A 3HOWG 5C4HA 1KC7A 3LNNA 1GUNA 1F2MA 2UVVA 3EJIA 3HOYH 3TS2A 2EPBA 1WTOA 1EIFA 1CA6A 3JAML 1TIID 2M9VA 2RDHA 1DOMA 5BR8Q 1IOVA 3FKIH 3DLLA 4ECWA 1UEAB 4C3JH 2G9HD 4FYDA 3JAME 3L4KA 4DL6A 3SXHA 1GSOA 2R7DA 3JZIA 2JEIA 3HOUH 3BZDB 2DPIA 3CCVA 5KNCA 1IYUA 5HGQA 3GO5A 4ZUIA 1A8VA 1CKNB 5KG6A 4JI7H 1TS4A 5KFQA 1PYBA 3TP7A 4C1NK 3G6XA 4WFN3 4CKCA 3UDGA 4ED2A 3IAYA 2EVBA 2UUBL 1M0WA 1SEBD 1XNRH 1B33N 3J7AF 2OWOA 4A93B 1DZ1A 2W71A 1QVCA 4E4TA 1V51A 3PF4A 3SK4A 2NU8B 5BR8H 5KFPA 4LFAL 5IYCH 1PRTF 2B8GA 1N36Q 1VQKA 4YJ2F 2C22A 2WIIB 1ZETA 4FBUA 2PCFB 1C0AA 3MWDA 3GTQB 5LMNH 1RL2A 1FNWA 1GXDC 1P16A 5C6AA 2YZNA 1KBLA 1O80A 2Y0SG 4Q45A 1R9TB 3CQZB 1K1SA 3JSLA 3GTMB 1KL9A 3A7AB 2R93B 3BQ2A 2C5CA 3R8BA 1HR0H 3I3CA 4JK1C 1RDPD 2HCCA 2IX0A 3CP0A 1JOQA 2UVRA 5CV5A 3PO3G 3PW5A 4I7HA 2JN4A 3R93A 1AZPA 1G6ZA 2F52A 1VQPA 5JH7F 1U4RA 2NUAB 1B4OA 1U0LA 3K81C 1LTRD 4ID6A 4HR7A 1SE4A 1E1OA 2IA6A 2FP4B 5DAUA 2YYAA 4BBRH 4RGMA 5HY6A 4QWBA 2OXPA 3G6VA 1IBMH 3KDFB 1CZGA 4YY3H 2JEJA 2HHHL 5CAEB 1V9PA 2SNMA 1B04A 1SN8A 2J6TA 5J22A 5C3EG 1P8LA 4Y7NH 3ND8A 3GQBA 5KFJA 1HZBA 1HZCA 2LY7A 1HNZH 3G6JB 4KKSA 2HGSA 1MZBA 2AMCB 3BDOA 2CWPA 1QVFA 3S2DB 4RNMA 4J9SA 2MCTA 4DL2A 1VQBA 1EQRA 2F0FA 2K5VA 3CHBD 3GILA 1I3QA 4KD4A 3GIPA 3RR5A 5JVH3 2AU0A 4ODGA 3L4JA 4O3OA 3GTKA 4ABNA 4LF4Q 2F4VH 4BA2I 4R9WA 2B63H 1WTWA 5JOBA 5FLXE 1VKZA 1NY4A 4GNXC 2NTSA 1JWUD 1HNWH 4A75A 3GTKH 5EKLA 4MV3A 5JJZA 2Z0SA 1KAWA 4NPSA 1X6OA 1B9NA 4P74A 3TRZA 4KHPL 3CQZA 1N33H 1A3TA 2ENBA 2RHQB 3SI8A 2RSOA 3GV8B 5KGUA 1LM0A 5CMDA 4OO1G 1FYCA 1ONLA 1S5DD 3NSWA 3ZYYX 2J9GA 4DR6H 1GSAA 2R82A 4AYBE 3QR8A 3GTPB 5KRUA 4X62Q 1I6UA 1D8LA 1PYSB 3L3OC 3S14B 1VQ5A 3Q22A 1I50B 4OEMB 4FDBA 1K8OA 5EDWA 4Q8EA 1HNZL 3GTPH 4NMZA 5KFYA 3EIVA 1YNJC 1E2WA 3WDNA 4JV5Q 5EBCA 1PV4A 4K8IA 4XT1B 3UDXA 1JB7A 4DXGA 4U7CA 5EWEA 2VQEQ 2C2RA 3A8KE 5F9NA 2CW0C 4A3BB 4YJ3F 3MFYA 4A3DB 2ICIA 5KG3A 2KA7A 4LAAA 1EQQA 2O2LD 2FLNA 1STGA 4B08A 1X3QA 1T5XD 5C0XI 1RTNA 2B63B 1SNQA 2A68C 1I4RA 1CHQD 4DV6L 5L1LA 5E4WC 1IKMA 1FR3A 3GTKB 2CZGA 3KXYT 3A7LA 4A3EG 4X6AH 3DM3A 5BN4A 2V58A 3MR2A 2R6GA 1OWTA 3V6JA 4EBDA 1CA5A 2QDLA 1SRUA 2Y0SE 5GROA 3BYTB 3PR4A 2PBZA 2NN6G 4EYIB 3RBEA 4APVA 1Y1WA 1EOVA 5ELEA 4KTAA 4A3MB 1QCBD 3GTPA 1BXRA 4ZUJA 2JA6B 3I72A 1LTAD 1NTGA 3EPGA 5C44H 3F2CA 4WJ4A 4LFBH 4GLVB 4X3SA 2OH2A 2WINB 5I4DA 3ONAB 4LF8Q 2VUMH 4X64Q 1C4QA 2CWAA 1V1PB 4FP5D 5FJ8H 4C2MB 5IE8A 1O7YA 4A3GH 4J15A 4DNRB 1MIUA 4BBSH 2YTXA 1IBKL 4R4TA 1TWHA 1PH2A 4ZCKA 2PW7A 3H20A 4LSXA 3PO2H 3H4DA 4F4ZA 3I4LA 4JV2A 4LF6H 4LF7L 1Q46A 4RCOA 3M3YH 3SK5A 3RBDA 1WCMH 5IYZF 2HVQA 2BA1A 2WB1A 3I55A 5LA6F 2DN8A 1DXMA 3OW2A 2E2IB 3VYSA 2V4RA 5E1FA 4UCSA 2R85A 1S0NA 4IUNA 1E1TA 3PUVA 2CKZB 4DR6L 4OONA 1IL2A 1NNXA 1XPOA 1ESFA 1HNXL 3S15B 4A2AA 1BCPC 3T5LA 1EWCA 3J81E 3GTQH 4QQBX 4O3RA 4DV0H 4YCUA 2YRWA 1RK5A 1CFMA 4RZRA 4DUYL 3K7AH 4HCSA 1T36A 3HOVH 1YHAA 1HA6A 4AIMA 2B63G 4B3RL 4KHPQ 2IP4A 3KHHA 4PWQA 4HCEA 1ET6A 2NVXB 3CVZA 2ALZA 1FGUA 5ELFA 4HYKA 2DNEA 3R23A 4JYAH 4XIGS 1GHJA 3IKJA 1Y1VG 1HFGA 3FKIB 5FOBB 4NB3A 1SYGA 1X3PA 3HOUB 1Y1VA 1GLVA 4B3SL 3GTJB 4FM9A 4AYBG 5KNDA 1PX2A 1EY7A 5K5PA 4HIOA 1XJVA 2ASDA 2EJGC 3E5SA 1TAEA 4AYBB 1VMPA 4FVMA 1BCPF 2G5DA 3D4RA 1YNXA 4WORA 3SGIA 2VQFQ 1Z9FA 4YCWA 3CCEA 4PQXA 4DR7Q 5K2MA 4ULLA 3BA9A 4R4QA 4HNTA 2JQOA 2KEEA 1ICFB 1S5ED 4K6LA 1TS3A 4OXPA 2MGSA 1JWSD 1N32L 1PHJA 1AP0A 1PH1A 1KJIA 1HNXH 5I47A 2GLTA 3GTGA 2UXBQ 4HJ9A 4GOPB 4RA8A 4UP7A 2VNUD 2QK4A 1EYGA 4C5AA 2OT2A 4RMFA 3MJFA 2FXQA 5KYIA 4MTDA 2EJMA 2NU7B
chains in the Genus database with same CATH topology
2ZTDA 4NXNL 4NXMQ 3I2ZA 3BZCA 2UXCQ 1B7YB 2RCNA 3M4QA 4LF7Q 2K50A 2HIXA 4H02A 3I56A 2UUCQ 2R93H 1Q1EA 2ALYB 3L7ZC 1TXYA 5IP9G 4DV0Q 1VS0A 2WFWA 3J7ZC 2L15A 1A62A 4DK6C 4R4CA 3W1BA 2ZTCA 5M3MG 2VS1A 1IBLL 2Q2TA 3RZOH 4A3JH 3K8AA 4A3BG 4EX5A 3UE0A 1XNQL 1PA6A 4X64L 1QVGA 1VQ7A 2E2IH 1YJ9A 5C4XG 4LF8L 4BA1I 1XNRQ 1VQOA 3PUZA 4L5RC 4DV3L 1Q81C 2RHSB 2A19A 1I6HH 1X56A 2AWNA 2VY3A 4JI8L 3ZJYC 3CCSA 4DV5L 1EIYB 2UU9L 1MJEA 3OYYA 4P71A 1X3EA 1IZ6A 1LUZA 1V1QA 1I94Q 2ZM6L 2XGTA 2IX1A 3PCOB 3CPFA 1HR0W 4YY3Q 2OTLA 3NEMA 5GADC 3PGZA 3KDFA 4A3MH 1YITA 4OWTB 4L5SA 4LF6Q 3PIPA 2YTVA 2HHHQ 4LF5Q 1V43A 2NVYH 1I5FA 2E2HH 4OWXB 5IP7H 2E2JH 4DPGA 5FLMG 2JA9A 5AJ3Q 1KQSA 4P75A 3MXNB 4DR5L 4IPDA 4UP8A 4A3BH 4GOPA 1TWAH 2NVXH 1NMGA 1AE2A 4HJ7A 3PF5A 1N34Q 2RF4A 3RNUA 4PZ6A 4LF6L 4DR1Q 4A3FG 2UUBQ 2HT1A 3TEHB 4GKKQ 3UDFA 1YJWA 3I4MG 4UPAA 4JBKA 2ZJQA 4RG1A 2ZM6Q 1FL0A 2R7ZG 3CXCA 4LFBQ 1KD1C 4IO9A 4C3HH 1WCMG 3KYHC 2QEXA 4LW1A 4DV5Q 2IY5B 1VQDA 3PV0A 2UXBL 4JI0Q 3M85A 1Z47A 2MFIA 2NZHA 4JYAL 1L1OB 1QUQA 2MO0A 4PZ7A 1YJNA 1TWGH 2OCEA 1XNQQ 5IWAL 1N9WA 4JV5L 5FLXc 4QGUA 5LMNQ 1CKOA 1Q82C 2Q2HA 4IOCA 2BH8A 2UXDL 2EIFA 2QGQA 1VQGA 4DV1Q 3J81c 2GN5A 1PH3A 3L2PA 2N8NA 4DAYB 4ALPA 3H15A 3J81j 2F3IA 4DR3L 3GD7A 4X62L 5IYBG 3PIOA 2OQKA 1NMFA 2EXDA 4HJAA 3RZDH 2OTJA 1JMCA 3J7A5 2KCMA 2UXCL 4B3SQ 4GLXA 2HQLA 4JI5L 3CPWA 4NXML 1GD7A 2NVQH 4LUVA 4GKJL 3F2DA 1HNWL 3HOVG 1YBYA 2BA0A 2WAQG 3AFPA 1PH6A 1EFWA 3PUXA 3ULPA 4A3MG 1H95A 2QA4A 1KC8C 4IPCA 2NZOA 3RLOA 3JAMi 3HFZB 4A3DG 2LXJA 3CCMA 3S1RH 1XTDA 4JOIC 3T1YQ 3EBEA 4AH6A 1ASYA 5C4JH 1IBMQ 4DR7L 4QIWE 4A93G 1TWCH 1OXUA 3U58A 1WI5A 2VQFL 1EWIA 4YHHL 5C0XG 1K9MC 1BBUA 3AYHB 1YHQA 2JA7H 1J6QA 4A76A 2YU9H 1HNXQ 1FJGL 1AE3A 2I5MX 4GS3A 4P73A 1XMOQ 1E3PA 4HJ5A 5K36G 3HKZG 3T1YL 1LTLA 2JA8G 1JT8A 1K3RA 3HOXG 4DR6Q 4C2MH 5E7NA 5C0XJ 1W2BA 3FKIG 4B3ML 4KI0A 5M5YH 2I0QA 3W1GA 3CMEA 4A3IG 2D62A 3G71A 1LYLA 3G48A 2KHIA 4DV4Q 2K52A 4A3IH 3EN2A 4IFDG 2NN6I 3B6YA 2B3GA 1E22A 1CKMA 2AWOA 1VQ9A 4JI6L 1GKHA 3G6EA 4A3FH 4GKJQ 1HNWQ 2Q2UA 4JI5Q 4B3TL 5GAHC 2UUAQ 1VQIA 4DUYQ 1UE7A 2GVBA 4WJ3M 3JAMc 2JA7G 3RN2A 2Q2IA 2F4VQ 4HJ8A 2K5HA 3HOWG 1PVOA 5LMUQ 5H1SE 3KF6B 4L5TA 4DV1L 1XMQQ 3HOZH 1IBKQ 4IPGA 5C3EH 3HOYH 1HR0L 3TS2A 1WJJA 2ID0A 1EIFA 1CKNA 1B70B 3W5OA 5BR8Q 3J80i 3FKIH 3DLLA 1GO3E 2K14A 4C3JH 1N8RC 1HZ9A 4A3GG 2R7DA 2JE6I 1MKHA 3I4NH 3S15H 3HOUH 4GOPC 3CCVA 3KLWA 4DR4Q 5HGQA 1E7ZA 5JEAJ 3GO5A 4YWLA 1A8VA 1CKNB 3STBD 1X9NA 3ULJA 2JEAI 3S1NH 3RN5A 1PYBA 1BKBA 3S14H 1BVSA 1J5EL 3ICEA 3S17H 3UDGA 2JK8A 3F1ZA 4KHZA 3S2DH 3F8TA 3BJUA 3IRBA 4JI3L 1JJCB 2CFMA 3K7UC 4GKKL 2UUBL 3ERSX 4LWCA 3E0EA 3WWVA 1PFSA 4POGA 4GN3B 5M3MH 2OWOA 1QVCA 5LMNW 4IFDI 1Y14B 1O7IA 3PF4A 3H3VI 1CUKA 1SROA 1NBWA 5GAGC 1OTCA 4DR5Q 3KJPA 2E5LL 5IYCH 1VQKA 4JBMA 1N36Q 2WB1G 4LFAL 3HOXH 4MZ9A 2K5NA 1C0AA 4KLKA 1IYJB 1Q1BA 1N36L 3LGJA 4K0KL 4LFAQ 2YYZA 4A3DH 1VQFA 4MNOA 4P72A 3STBC 1M90C 2E5LQ 4JI2L 4DNIA 4DR2L 1IXRA 1RL2A 1P16A 4X65Q 4YWMA 4YY3L 1YVCA 2Y0SG 1VQ4A 1UE6A 1BBWA 1NJIC 3S1QH 1I94L 1KL9A 1X55A 4A3KH 4JI3Q 3VDYA 4DV7L 3HOZG 1GVPA 3GTJH 2R7ZH 5GQOA 3KF6A 4JI8Q 1R9TH 2IX0A 3CP0A 1M1KC 4UY8C 5JEAG 4HIMA 4DV3Q 3PO3G 1G6PA 3A5UA 1CSQA 4IOAA 4A3CG 4DR4L 5JJIA 2F52A 1VQPA 4GN4B 2WP8J 4DUZL 2JA5G 1U0LA 4R1JA 2Z6KC 3K81C 2XTIA 1Q86C 4O2DA 1XPUA 1VQJA 1HR0Q 1E1OA 2KCTA 4DV6Q 3GDEA 1X3GA 3I4NG 2R7FA 4R4IA 2DUDA 2UUCL 4BBRH 5LMUL 3M7NA 4OWWB 4GNXB 4JI1Q 5HY6A 2D0OA 4JBWA 1FVIA 3KDFB 5J3BA 4NXNQ 4A93H 2HHHL 1C9OA 1V9PA 1T9HA 1SN8A 3UE1A 5C3EG 1JJ2A 4LF9Q 1UE5A 4L5QA 1P8LA 4OO1I 2WAQE 4Y7NH 2JJQA 4JI6Q 3CCLA 2KHJA 3NBHB 4LFCQ 2VQEL 1N33L 1HZBA 1X54A 5DLQE 2JA8H 1KXLA 1HZAA 1OXTA 1HZCA 2EQSA 2IT1A 1N32Q 5IYDH 2CQOA 3TQYA 2Z6KA 2AMCB 1HNZQ 4JI4L 2CWPA 3E9IA 1QVFA 3KOJA 1TWFH 4OX9Q 4EQ5A 3GTGH 1VQBA 1EQRA 3CC7A 1W3SA 1NE3A 1KHIA 2K5VA 4JI7Q 4TVAB 5M5XH 3RR5A 4JI7L 2K4KA 4PG3A 2ES2A 1WOCA 4DV2Q 2MQHA 3HKZE 4LF4Q 1QZHA 4XTCS 4IFDJ 1SFOH 1VQAA 1L1OA 4JI4Q 4BA2I 3T1HL 2B63H 1UE1A 1SMXA 1K8GA 2PQAB 1NY4A 4GNXC 4HIKA 1JE5A 1PH7A 1K8AC 4A75A 3CCQA 3GTKH 2Z0SA 4LFCL 3AFQA 5JJLA 1KAWA 4NPSA 3CC4A 1X6OA 4P74A 3TRZA 4BXXG 4KHPL 2JA6G 4A4IA 1PH9A 3Q8DA 2RHQB 1LM0A 2DGYA 3MEFA 5IYBH 4OO1G 2JA6H 3FHWA 3K80C 4DV2L 1ASZA 5JJKA 3CW2C 1K73C 4AYBE 5M5WH 1PH5A 4BY1H 1D7QA 2ZJPA 1X3FA 1SR3A 1DGSA 4X62Q 3H3VH 1AH9A 1D8LA 1PYSB 2BH2A 4TQUS 3HOWH 1JJGA 1VQ5A 1MJCA 3S16H 4OX9L 4FDBA 3CCRA 3PUWA 1HNZL 3GTPH 3EIVA 3CC2A 5LMNL 4GN5A 4BY7H 4JV5Q 4UP9A 4HIDA 1PV4A 3UDXA 1X65A 1JB7A 2IHFA 3L0OA 4JYAQ 2VQEQ 3BU2A 1Q8KA 2PMZE 2VZAA 1VQLA 3CQZH 1YI2A 4JI0L 1B8AA 2VL6A 1SLJA 4LF9L 4LUZA 3I4MH 4DV7Q 2JEBI 4YCVA 2E8GA 2OQ0A 4BBRG 3OTOQ 1EQQA 3GTOH 1VQEA 4LFBL 3CMAA 1WYDA 2PI2A 4JI1L 3F2BA 4BY1G 4JCVE 4QJFA 5IP9H 5C0XI 1QZGA 3ER0A 3J80c 4X65L 4DR1L 2YV5A 4JI2Q 4DV6L 3U4VA 1OXSC 3TS0A 3S1MH 1L0WA 4K0KQ 1N34L 4ME3A 2WB1E 3JC66 3RLNA 3CCUA 4A3EG 4PZ8A 3DM3A 4X6AH 2R6GA 1YIJA 4IPHA 4DUZQ 1Y1VH 5AJ3L 1VQ6A 1TWHH 4LUOA 1SRUA 4LF5L 2Y0SE 3FP9A 5GROA 1WFQA 3GTMH 1KRSA 2NN6G 2AKWB 4APVA 4GLAC 2ZTEA 1EOVA 2ZJRA 2CCZA 1OXVA 5C44G 3KFUA 2UU9Q 1NTGA 1G51A 1Q12A 3AQQA 5C44H 3F2CA 1OXXK 4WJ4A 4GLVB 1KIXA 1HJPA 1EUJA 2N49A 4DR2Q 3CD6A 5FLMH 3A5ZB 3NENA 2V1CC 1XNRL 4GNXA 1YZ6A 3BZKA 4LF8Q 2VUMH 1I50H 4X64Q 1L1OC 4BBSG 2CWAA 3D0FA 5FJ8H 4A3GH 5IE8A 5BR8L 4J15A 4R4OA 1IBLQ 1VQNA 1MIUA 4BBSH 4O0AA 2YTXA 3PUYA 1YHBA 1Y1WG 5EAYA 1IBKL 3A0JA 4IJHA 4R4TA 1XMQL 1PH2A 4QL5A 5C4XH 3KF8B 4DV0L 3M4OH 2GVAA 3PO2H 2LXKA 3RLFA 1PH4A 5M3FH 1HH2P 1CSPA 3OTOL 1VQMA 4LF7L 4IJLA 1Q46A 2YTYA 2UUAL 2K75A 4B3TQ 1J5EQ 3E9HA 3M3YH 1WCMH 3G4SA 2BA1A 1G291 2H5XA 3I55A 4C3IH 3NELA 4MTNA 3S24A 2C35B 2LSSA 3OW2A 3AEVA 3PSIA 2ASBA 1VQCA 2PI2E 5IP7G 3GTLH 2I5HA 1E1TA 5IYDG 4B3MQ 3PUVA 3CAMA 2CKZB 2KBNA 1SE8A 4DR6L 1I3QH 4OONA 1IL2A 1XMOL 1XPOA 1L2FA 4JBJA 1HNXL 1PH8A 5M3FG 1S3OA 3GTQH 2R92H 4QQBX 1VQ8A 3HKSA 4A3LH 4DKAC 4YHHQ 5IT9c 2F4VL 2R92G 3M9BA 4YCUA 1U5KA 1K0RA 1QUQB 3K7AH 3D31A 2VW9A 4DUYL 3HOVH 1YHAA 4AIMA 4X66L 2B63G 4B3RL 4KHPQ 3KJOA 4BY7G 5ELOA 2R93G 5IY0A 1A0IA 3I7FA 3H0GG 3HOYG 4JC0A 4A3CH 4YWKA 4LNQA 3A74A 2IHEA 2D0PA 4AQYQ 1C7YA 4DV4L 1FGUA 1Y1WH 3U4ZA 1KRTA 4PMWA 4AQYL 4XIGS 4BXXH 3T1HQ 2MO1A 1Y1VG 4DAMA 4DK3C 2HIVA 3M4PA 4NB3A 4POFA 4A3KG 4LF4L 2B29A 4X66Q 4B3RQ 3J81i 2AHOB 2A8VA 1FJGQ 4A3LG 4B3SL 4AYBG 4HIOA 1UWVA 1XJVA 2ATWA 3S2HH 4DR3Q 3PO2G 2A1AA 2VQFQ 1YNXA 2N3SA 1VQHA 3SGIA 3CCJA 1Z9FA 4YCWA 3CCEA 4DR7Q 4R4QA 1S72A 1IBML 2UXDQ 1UEBA 2JQOA 4A3EH 5IYCG 3ULLA 2I5LX 5GAEC 3CF5A 4OXPA 3H0GH 5FJ8G 2KENA 1VCIA 5IWAQ 4A3JG 3PO3H 3HOUG 1RIPA 1N32L 2VUMG 1PHJA 2PNHA 3K0XA 3UDIA 2N78A 1XPRA 1Q7YC 1PH1A 1N33Q 4JOIA 2UXBQ 4HJ9A 4GOPB 4UP7A 3U50C 2MNAA 1S40A 1EYGA 2JA5H 2VNUD 4RMFA 1K83H 4QY7A 1GM5A 2FXQA 5ELNA 2NVTH 1A63A 4JG2A 2PQAA 1YEZA 3I4OA 3TREA 1E24A 4Y52H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZTD A;  4NXN L;  4NXM Q;  3I2Z A;  3BZC A;  2UXC Q;  1B7Y B;  2RCN A;  3M4Q A;  4LF7 Q;  2K50 A;  2HIX A;  4H02 A;  3I56 A;  2UUC Q;  2R93 H;  1Q1E A;  2ALY B;  3L7Z C;  1TXY A;  5IP9 G;  4DV0 Q;  1VS0 A;  2WFW A;  3J7Z C;  2L15 A;  1A62 A;  4DK6 C;  4R4C A;  3W1B A;  2ZTC A;  5M3M G;  2VS1 A;  1IBL L;  2Q2T A;  3RZO H;  4A3J H;  3K8A A;  4A3B G;  4EX5 A;  3UE0 A;  1XNQ L;  1PA6 A;  4X64 L;  1QVG A;  1VQ7 A;  2E2I H;  1YJ9 A;  5C4X G;  4LF8 L;  4BA1 I;  1XNR Q;  1VQO A;  3PUZ A;  4L5R C;  4DV3 L;  1Q81 C;  2RHS B;  2A19 A;  1I6H H;  1X56 A;  2AWN A;  2VY3 A;  4JI8 L;  3ZJY C;  3CCS A;  4DV5 L;  1EIY B;  2UU9 L;  1MJE A;  3OYY A;  4P71 A;  1X3E A;  1IZ6 A;  1LUZ A;  1V1Q A;  1I94 Q;  2ZM6 L;  2XGT A;  2IX1 A;  3PCO B;  3CPF A;  1HR0 W;  4YY3 Q;  2OTL A;  3NEM A;  5GAD C;  3PGZ A;  3KDF A;  4A3M H;  1YIT A;  4OWT B;  4L5S A;  4LF6 Q;  3PIP A;  2YTV A;  2HHH Q;  4LF5 Q;  1V43 A;  2NVY H;  1I5F A;  2E2H H;  4OWX B;  5IP7 H;  2E2J H;  4DPG A;  5FLM G;  2JA9 A;  5AJ3 Q;  1KQS A;  4P75 A;  3MXN B;  4DR5 L;  4IPD A;  4UP8 A;  4A3B H;  4GOP A;  1TWA H;  2NVX H;  1NMG A;  1AE2 A;  4HJ7 A;  3PF5 A;  1N34 Q;  2RF4 A;  3RNU A;  4PZ6 A;  4LF6 L;  4DR1 Q;  4A3F G;  2UUB Q;  2HT1 A;  3TEH B;  4GKK Q;  3UDF A;  1YJW A;  3I4M G;  4UPA A;  4JBK A;  2ZJQ A;  4RG1 A;  2ZM6 Q;  1FL0 A;  2R7Z G;  3CXC A;  4LFB Q;  1KD1 C;  4IO9 A;  4C3H H;  1WCM G;  3KYH C;  2QEX A;  4LW1 A;  4DV5 Q;  2IY5 B;  1VQD A;  3PV0 A;  2UXB L;  4JI0 Q;  3M85 A;  1Z47 A;  2MFI A;  2NZH A;  4JYA L;  1L1O B;  1QUQ A;  2MO0 A;  4PZ7 A;  1YJN A;  1TWG H;  2OCE A;  1XNQ Q;  5IWA L;  1N9W A;  4JV5 L;  5FLX c;  4QGU A;  5LMN Q;  1CKO A;  1Q82 C;  2Q2H A;  4IOC A;  2BH8 A;  2UXD L;  2EIF A;  2QGQ A;  1VQG A;  4DV1 Q;  3J81 c;  2GN5 A;  1PH3 A;  3L2P A;  2N8N A;  4DAY B;  4ALP A;  3H15 A;  3J81 j;  2F3I A;  4DR3 L;  3GD7 A;  4X62 L;  5IYB G;  3PIO A;  2OQK A;  1NMF A;  2EXD A;  4HJA A;  3RZD H;  2OTJ A;  1JMC A;  3J7A 5;  2KCM A;  2UXC L;  4B3S Q;  4GLX A;  2HQL A;  4JI5 L;  3CPW A;  4NXM L;  1GD7 A;  2NVQ H;  4LUV A;  4GKJ L;  3F2D A;  1HNW L;  3HOV G;  1YBY A;  2BA0 A;  2WAQ G;  3AFP A;  1PH6 A;  1EFW A;  3PUX A;  3ULP A;  4A3M G;  1H95 A;  2QA4 A;  1KC8 C;  4IPC A;  2NZO A;  3RLO A;  3JAM i;  3HFZ B;  4A3D G;  2LXJ A;  3CCM A;  3S1R H;  1XTD A;  4JOI C;  3T1Y Q;  3EBE A;  4AH6 A;  1ASY A;  5C4J H;  1IBM Q;  4DR7 L;  4QIW E;  4A93 G;  1TWC H;  1OXU A;  3U58 A;  1WI5 A;  2VQF L;  1EWI A;  4YHH L;  5C0X G;  1K9M C;  1BBU A;  3AYH B;  1YHQ A;  2JA7 H;  1J6Q A;  4A76 A;  2YU9 H;  1HNX Q;  1FJG L;  1AE3 A;  2I5M X;  4GS3 A;  4P73 A;  1XMO Q;  1E3P A;  4HJ5 A;  5K36 G;  3HKZ G;  3T1Y L;  1LTL A;  2JA8 G;  1JT8 A;  1K3R A;  3HOX G;  4DR6 Q;  4C2M H;  5E7N A;  5C0X J;  1W2B A;  3FKI G;  4B3M L;  4KI0 A;  5M5Y H;  2I0Q A;  3W1G A;  3CME A;  4A3I G;  2D62 A;  3G71 A;  1LYL A;  3G48 A;  2KHI A;  4DV4 Q;  2K52 A;  4A3I H;  3EN2 A;  4IFD G;  2NN6 I;  3B6Y A;  2B3G A;  1E22 A;  1CKM A;  2AWO A;  1VQ9 A;  4JI6 L;  1GKH A;  3G6E A;  4A3F H;  4GKJ Q;  1HNW Q;  2Q2U A;  4JI5 Q;  4B3T L;  5GAH C;  2UUA Q;  1VQI A;  4DUY Q;  1UE7 A;  2GVB A;  4WJ3 M;  3JAM c;  2JA7 G;  3RN2 A;  2Q2I A;  2F4V Q;  4HJ8 A;  2K5H A;  3HOW G;  1PVO A;  5LMU Q;  5H1S E;  3KF6 B;  4L5T A;  4DV1 L;  1XMQ Q;  3HOZ H;  1IBK Q;  4IPG A;  5C3E H;  3HOY H;  1HR0 L;  3TS2 A;  1WJJ A;  2ID0 A;  1EIF A;  1CKN A;  1B70 B;  3W5O A;  5BR8 Q;  3J80 i;  3FKI H;  3DLL A;  1GO3 E;  2K14 A;  4C3J H;  1N8R C;  1HZ9 A;  4A3G G;  2R7D A;  2JE6 I;  1MKH A;  3I4N H;  3S15 H;  3HOU H;  4GOP C;  3CCV A;  3KLW A;  4DR4 Q;  5HGQ A;  1E7Z A;  5JEA J;  3GO5 A;  4YWL A;  1A8V A;  1CKN B;  3STB D;  1X9N A;  3ULJ A;  2JEA I;  3S1N H;  3RN5 A;  1PYB A;  1BKB A;  3S14 H;  1BVS A;  1J5E L;  3ICE A;  3S17 H;  3UDG A;  2JK8 A;  3F1Z A;  4KHZ A;  3S2D H;  3F8T A;  3BJU A;  3IRB A;  4JI3 L;  1JJC B;  2CFM A;  3K7U C;  4GKK L;  2UUB L;  3ERS X;  4LWC A;  3E0E A;  3WWV A;  1PFS A;  4POG A;  4GN3 B;  5M3M H;  2OWO A;  1QVC A;  5LMN W;  4IFD I;  1Y14 B;  1O7I A;  3PF4 A;  3H3V I;  1CUK A;  1SRO A;  1NBW A;  5GAG C;  1OTC A;  4DR5 Q;  3KJP A;  2E5L L;  5IYC H;  1VQK A;  4JBM A;  1N36 Q;  2WB1 G;  4LFA L;  3HOX H;  4MZ9 A;  2K5N A;  1C0A A;  4KLK A;  1IYJ B;  1Q1B A;  1N36 L;  3LGJ A;  4K0K L;  4LFA Q;  2YYZ A;  4A3D H;  1VQF A;  4MNO A;  4P72 A;  3STB C;  1M90 C;  2E5L Q;  4JI2 L;  4DNI A;  4DR2 L;  1IXR A;  1RL2 A;  1P16 A;  4X65 Q;  4YWM A;  4YY3 L;  1YVC A;  2Y0S G;  1VQ4 A;  1UE6 A;  1BBW A;  1NJI C;  3S1Q H;  1I94 L;  1KL9 A;  1X55 A;  4A3K H;  4JI3 Q;  3VDY A;  4DV7 L;  3HOZ G;  1GVP A;  3GTJ H;  2R7Z H;  5GQO A;  3KF6 A;  4JI8 Q;  1R9T H;  2IX0 A;  3CP0 A;  1M1K C;  4UY8 C;  5JEA G;  4HIM A;  4DV3 Q;  3PO3 G;  1G6P A;  3A5U A;  1CSQ A;  4IOA A;  4A3C G;  4DR4 L;  5JJI A;  2F52 A;  1VQP A;  4GN4 B;  2WP8 J;  4DUZ L;  2JA5 G;  1U0L A;  4R1J A;  2Z6K C;  3K81 C;  2XTI A;  1Q86 C;  4O2D A;  1XPU A;  1VQJ A;  1HR0 Q;  1E1O A;  2KCT A;  4DV6 Q;  3GDE A;  1X3G A;  3I4N G;  2R7F A;  4R4I A;  2DUD A;  2UUC L;  4BBR H;  5LMU L;  3M7N A;  4OWW B;  4GNX B;  4JI1 Q;  5HY6 A;  2D0O A;  4JBW A;  1FVI A;  3KDF B;  5J3B A;  4NXN Q;  4A93 H;  2HHH L;  1C9O A;  1V9P A;  1T9H A;  1SN8 A;  3UE1 A;  5C3E G;  1JJ2 A;  4LF9 Q;  1UE5 A;  4L5Q A;  1P8L A;  4OO1 I;  2WAQ E;  4Y7N H;  2JJQ A;  4JI6 Q;  3CCL A;  2KHJ A;  3NBH B;  4LFC Q;  2VQE L;  1N33 L;  1HZB A;  1X54 A;  5DLQ E;  2JA8 H;  1KXL A;  1HZA A;  1OXT A;  1HZC A;  2EQS A;  2IT1 A;  1N32 Q;  5IYD H;  2CQO A;  3TQY A;  2Z6K A;  2AMC B;  1HNZ Q;  4JI4 L;  2CWP A;  3E9I A;  1QVF A;  3KOJ A;  1TWF H;  4OX9 Q;  4EQ5 A;  3GTG H;  1VQB A;  1EQR A;  3CC7 A;  1W3S A;  1NE3 A;  1KHI A;  2K5V A;  4JI7 Q;  4TVA B;  5M5X H;  3RR5 A;  4JI7 L;  2K4K A;  4PG3 A;  2ES2 A;  1WOC A;  4DV2 Q;  2MQH A;  3HKZ E;  4LF4 Q;  1QZH A;  4XTC S;  4IFD J;  1SFO H;  1VQA A;  1L1O A;  4JI4 Q;  4BA2 I;  3T1H L;  2B63 H;  1UE1 A;  1SMX A;  1K8G A;  2PQA B;  1NY4 A;  4GNX C;  4HIK A;  1JE5 A;  1PH7 A;  1K8A C;  4A75 A;  3CCQ A;  3GTK H;  2Z0S A;  4LFC L;  3AFQ A;  5JJL A;  1KAW A;  4NPS A;  3CC4 A;  1X6O A;  4P74 A;  3TRZ A;  4BXX G;  4KHP L;  2JA6 G;  4A4I A;  1PH9 A;  3Q8D A;  2RHQ B;  1LM0 A;  2DGY A;  3MEF A;  5IYB H;  4OO1 G;  2JA6 H;  3FHW A;  3K80 C;  4DV2 L;  1ASZ A;  5JJK A;  3CW2 C;  1K73 C;  4AYB E;  5M5W H;  1PH5 A;  4BY1 H;  1D7Q A;  2ZJP A;  1X3F A;  1SR3 A;  1DGS A;  4X62 Q;  3H3V H;  1AH9 A;  1D8L A;  1PYS B;  2BH2 A;  4TQU S;  3HOW H;  1JJG A;  1VQ5 A;  1MJC A;  3S16 H;  4OX9 L;  4FDB A;  3CCR A;  3PUW A;  1HNZ L;  3GTP H;  3EIV A;  3CC2 A;  5LMN L;  4GN5 A;  4BY7 H;  4JV5 Q;  4UP9 A;  4HID A;  1PV4 A;  3UDX A;  1X65 A;  1JB7 A;  2IHF A;  3L0O A;  4JYA Q;  2VQE Q;  3BU2 A;  1Q8K A;  2PMZ E;  2VZA A;  1VQL A;  3CQZ H;  1YI2 A;  4JI0 L;  1B8A A;  2VL6 A;  1SLJ A;  4LF9 L;  4LUZ A;  3I4M H;  4DV7 Q;  2JEB I;  4YCV A;  2E8G A;  2OQ0 A;  4BBR G;  3OTO Q;  1EQQ A;  3GTO H;  1VQE A;  4LFB L;  3CMA A;  1WYD A;  2PI2 A;  4JI1 L;  3F2B A;  4BY1 G;  4JCV E;  4QJF A;  5IP9 H;  5C0X I;  1QZG A;  3ER0 A;  3J80 c;  4X65 L;  4DR1 L;  2YV5 A;  4JI2 Q;  4DV6 L;  3U4V A;  1OXS C;  3TS0 A;  3S1M H;  1L0W A;  4K0K Q;  1N34 L;  4ME3 A;  2WB1 E;  3JC6 6;  3RLN A;  3CCU A;  4A3E G;  4PZ8 A;  3DM3 A;  4X6A H;  2R6G A;  1YIJ A;  4IPH A;  4DUZ Q;  1Y1V H;  5AJ3 L;  1VQ6 A;  1TWH H;  4LUO A;  1SRU A;  4LF5 L;  2Y0S E;  3FP9 A;  5GRO A;  1WFQ A;  3GTM H;  1KRS A;  2NN6 G;  2AKW B;  4APV A;  4GLA C;  2ZTE A;  1EOV A;  2ZJR A;  2CCZ A;  1OXV A;  5C44 G;  3KFU A;  2UU9 Q;  1NTG A;  1G51 A;  1Q12 A;  3AQQ A;  5C44 H;  3F2C A;  1OXX K;  4WJ4 A;  4GLV B;  1KIX A;  1HJP A;  1EUJ A;  2N49 A;  4DR2 Q;  3CD6 A;  5FLM H;  3A5Z B;  3NEN A;  2V1C C;  1XNR L;  4GNX A;  1YZ6 A;  3BZK A;  4LF8 Q;  2VUM H;  1I50 H;  4X64 Q;  1L1O C;  4BBS G;  2CWA A;  3D0F A;  5FJ8 H;  4A3G H;  5IE8 A;  5BR8 L;  4J15 A;  4R4O A;  1IBL Q;  1VQN A;  1MIU A;  4BBS H;  4O0A A;  2YTX A;  3PUY A;  1YHB A;  1Y1W G;  5EAY A;  1IBK L;  3A0J A;  4IJH A;  4R4T A;  1XMQ L;  1PH2 A;  4QL5 A;  5C4X H;  3KF8 B;  4DV0 L;  3M4O H;  2GVA A;  3PO2 H;  2LXK A;  3RLF A;  1PH4 A;  5M3F H;  1HH2 P;  1CSP A;  3OTO L;  1VQM A;  4LF7 L;  4IJL A;  1Q46 A;  2YTY A;  2UUA L;  2K75 A;  4B3T Q;  1J5E Q;  3E9H A;  3M3Y H;  1WCM H;  3G4S A;  2BA1 A;  1G29 1;  2H5X A;  3I55 A;  4C3I H;  3NEL A;  4MTN A;  3S24 A;  2C35 B;  2LSS A;  3OW2 A;  3AEV A;  3PSI A;  2ASB A;  1VQC A;  2PI2 E;  5IP7 G;  3GTL H;  2I5H A;  1E1T A;  5IYD G;  4B3M Q;  3PUV A;  3CAM A;  2CKZ B;  2KBN A;  1SE8 A;  4DR6 L;  1I3Q H;  4OON A;  1IL2 A;  1XMO L;  1XPO A;  1L2F A;  4JBJ A;  1HNX L;  1PH8 A;  5M3F G;  1S3O A;  3GTQ H;  2R92 H;  4QQB X;  1VQ8 A;  3HKS A;  4A3L H;  4DKA C;  4YHH Q;  5IT9 c;  2F4V L;  2R92 G;  3M9B A;  4YCU A;  1U5K A;  1K0R A;  1QUQ B;  3K7A H;  3D31 A;  2VW9 A;  4DUY L;  3HOV H;  1YHA A;  4AIM A;  4X66 L;  2B63 G;  4B3R L;  4KHP Q;  3KJO A;  4BY7 G;  5ELO A;  2R93 G;  5IY0 A;  1A0I A;  3I7F A;  3H0G G;  3HOY G;  4JC0 A;  4A3C H;  4YWK A;  4LNQ A;  3A74 A;  2IHE A;  2D0P A;  4AQY Q;  1C7Y A;  4DV4 L;  1FGU A;  1Y1W H;  3U4Z A;  1KRT A;  4PMW A;  4AQY L;  4XIG S;  4BXX H;  3T1H Q;  2MO1 A;  1Y1V G;  4DAM A;  4DK3 C;  2HIV A;  3M4P A;  4NB3 A;  4POF A;  4A3K G;  4LF4 L;  2B29 A;  4X66 Q;  4B3R Q;  3J81 i;  2AHO B;  2A8V A;  1FJG Q;  4A3L G;  4B3S L;  4AYB G;  4HIO A;  1UWV A;  1XJV A;  2ATW A;  3S2H H;  4DR3 Q;  3PO2 G;  2A1A A;  2VQF Q;  1YNX A;  2N3S A;  1VQH A;  3SGI A;  3CCJ A;  1Z9F A;  4YCW A;  3CCE A;  4DR7 Q;  4R4Q A;  1S72 A;  1IBM L;  2UXD Q;  1UEB A;  2JQO A;  4A3E H;  5IYC G;  3ULL A;  2I5L X;  5GAE C;  3CF5 A;  4OXP A;  3H0G H;  5FJ8 G;  2KEN A;  1VCI A;  5IWA Q;  4A3J G;  3PO3 H;  3HOU G;  1RIP A;  1N32 L;  2VUM G;  1PHJ A;  2PNH A;  3K0X A;  3UDI A;  2N78 A;  1XPR A;  1Q7Y C;  1PH1 A;  1N33 Q;  4JOI A;  2UXB Q;  4HJ9 A;  4GOP B;  4UP7 A;  3U50 C;  2MNA A;  1S40 A;  1EYG A;  2JA5 H;  2VNU D;  4RMF A;  1K83 H;  4QY7 A;  1GM5 A;  2FXQ A;  5ELN A;  2NVT H;  1A63 A;  4JG2 A;  2PQA A;  1YEZ A;  3I4O A;  3TRE A;  1E24 A;  4Y52 H; 
#chains in the Genus database with same CATH topology
 2YZM A;  3I2Z A;  2UXC Q;  4ECQ A;  2WTF A;  3BQ0 A;  2RCN A;  1H9R A;  3E5N A;  1WTR A;  1SSO A;  1Q1E A;  4LFA H;  2M00 A;  1TXY A;  3EPI A;  2WFW A;  2EY1 A;  4R8U B;  3W1B A;  3P20 A;  3RUZ A;  5IGG A;  4YAJ B;  2XRQ D;  4GZY C;  2XCP A;  4RZQ A;  5L9X A;  2HD3 A;  2E2I H;  5C4X G;  3UFX B;  4LF8 L;  4DNT B;  5HGT A;  2AGQ A;  2YRX A;  3E3X A;  5FO9 B;  3RIZ A;  3PUZ A;  1F2L A;  2VY3 A;  1TWH B;  1V8Q A;  5I9O A;  3K3P A;  4LH6 A;  3RV3 A;  3FRP B;  3RGZ A;  2ZM6 L;  5A2Q W;  2XGT A;  3G7L A;  3N8D A;  3PGZ A;  1DOK A;  3KDF A;  1YIT A;  2D9U A;  4IN3 A;  2A68 D;  4LF5 Q;  2C00 A;  4A3I B;  2E2H H;  5EPL A;  4ECT A;  5FLM G;  3OOC A;  4LMY A;  5AJ3 Q;  5FLX W;  1T3N A;  4DR5 L;  3T5K A;  1J5E H;  5M5X B;  2W57 A;  4PZ6 A;  2DLN A;  4DUY H;  3VMM A;  2JA7 B;  1ULZ A;  2BDN A;  2R61 A;  1RKN A;  4JBK A;  1HTL D;  5CGK A;  4C3H H;  1WCM G;  4O4L F;  4FF4 A;  4WBN F;  2QEX A;  2F0G A;  4ZK9 B;  3BVM A;  4JI3 H;  4RGO S;  2UXB L;  3P7J A;  5KEE A;  3KTM A;  1FJG H;  1SYB A;  4I50 F;  1QUQ A;  1TWG H;  4CKB A;  1XNQ Q;  1F2Z A;  2F0N A;  2B39 A;  5C3E B;  4JV5 L;  3LWU A;  3DUZ A;  3UQ8 A;  2P0A A;  2E75 C;  1BXT A;  4ZQI A;  5KG2 A;  1D1K A;  2VR1 A;  1BUV T;  4IUQ A;  4RB3 C;  4ZAI A;  3J81 c;  1PH3 A;  2KCC A;  3J81 j;  1C30 A;  2F3I A;  4GC7 A;  3PIO A;  1A6X A;  4ED0 A;  4HJA A;  1SYC A;  2KCM A;  2UXC L;  2B63 A;  3HGB A;  2FE3 A;  1IW7 D;  3CPW A;  4NXM L;  3FKI A;  3KHG A;  4BY1 B;  1HNW L;  3HOV G;  2RDI A;  1STA A;  3M7G A;  2I07 B;  4K6D A;  4EFE A;  2BA0 A;  5DGA A;  3AFP A;  4HNU A;  1BCP B;  3PUX A;  4A3M G;  2FPG B;  4Y8V B;  1CZW A;  1RJQ A;  4C5C A;  4IPC A;  2LMC B;  3RLO A;  3JAM i;  2KED A;  4J9O A;  3HFZ B;  1V4Y A;  3T1Y Q;  3Q8R B;  4K2L A;  1QNK A;  4KKT A;  4AH6 A;  1VMC A;  5C4J H;  1JIH A;  5LOV F;  5LYJ F;  3GII A;  4DR7 L;  4A93 G;  3V6K A;  5C0X G;  4QW8 A;  3JRX A;  4A76 A;  5JUM A;  1QB5 D;  1FJG L;  3Q0A A;  4G57 A;  1E3P A;  1W93 A;  3T1Y L;  1ZXT A;  3HOX G;  2R8G A;  5C0X J;  1W2B A;  3NXW A;  1U4M A;  5G3L D;  4KY7 A;  3W1G A;  4A3I G;  1PYW D;  5HV6 A;  5EGT A;  2K52 A;  3T5H A;  2X6G A;  5D3I B;  1TWC A;  1U4L A;  4X3K A;  1CKM A;  4XX0 B;  1GKH A;  1ENA A;  2Z4H A;  3G6E A;  5GAH C;  1EZ6 A;  3RN2 A;  1IOW A;  2F0E A;  1PVO A;  1HFN A;  3MFH A;  4F7X A;  2PPB C;  2FK2 A;  3HOZ H;  1IBK Q;  2EDG A;  2F1M A;  5C3E H;  1HR0 L;  4EFB A;  5JAV A;  4JV1 A;  4PDB A;  2ID0 A;  2IJ0 A;  1CKN A;  3V05 A;  4MV9 A;  3TZD A;  3W5O A;  5KFR A;  1N8R C;  1HZ9 A;  2NB0 A;  4KD3 A;  2Y0S A;  3PIO 3;  5CV6 A;  1QOH A;  3S15 H;  4HQ6 A;  3TIN A;  3D3R A;  1RF2 D;  3NPP A;  2NZ1 D;  3NGD A;  3KLW A;  3R5H A;  4FBT A;  5C3X A;  2I87 A;  4OEL B;  3STB D;  5C0X H;  1X9N A;  3S1N H;  5DG8 A;  4IR1 A;  4FS1 A;  1S5B D;  4ETS A;  2JK8 A;  4KHZ A;  3S2D H;  4GKK L;  3K7U C;  3ERS X;  2J7Z A;  3E0E A;  4K5V A;  2R7M A;  4C1N I;  5IGF A;  5LMN W;  4IFD I;  1CUK A;  4UAI A;  5JVG 3;  1SRO A;  4M1U B;  3X3M A;  5GAG C;  4DR5 Q;  4JBM A;  1Z2P X;  3OHX C;  5KFX A;  1PXU A;  2WB1 G;  4MZ9 A;  3OW7 A;  1WD0 A;  4O3Q A;  4JI6 H;  2K5N A;  3FMA A;  3IL8 A;  3F8N A;  1Q1B A;  3N43 B;  3SK8 A;  3LGJ A;  4K0K L;  4LFA Q;  1VQF A;  2SOB A;  4MNO A;  4JI2 L;  1IXR A;  1I4H A;  2R8J A;  4YY3 L;  3OIQ A;  1STH A;  1RJT A;  1BBW A;  1UE6 A;  3GP7 A;  1I94 L;  4JI3 Q;  1GVP A;  1EY6 A;  1D2B A;  2VPQ A;  3VYU A;  1R9T H;  1BJT A;  2Z8L A;  4KJN A;  4DV3 Q;  3LML A;  3RAQ A;  2FK1 A;  4APM A;  4IOA A;  3OHB A;  5NUC A;  4UCT A;  4GN4 B;  3ETJ A;  4DUZ L;  5D14 A;  3D6C A;  1O75 A;  4O3P A;  4XYM B;  3ETH A;  1BQQ T;  2XTI A;  2BDO A;  1B9M A;  4QF4 A;  1W6K A;  1ENC A;  5KFL A;  1HR0 Q;  1F9P A;  2R7F A;  3OHA A;  3M7N A;  4O2A F;  1LLR D;  1HPC A;  3DXJ C;  5IIF A;  4GNX B;  4NXN Q;  4A93 H;  1T9H A;  2HDM A;  5L1I A;  1UE5 A;  4RB1 A;  1G8Z D;  1LTG D;  1G91 A;  2V4Q A;  4JI6 Q;  4R7R A;  1H9S B;  2KHJ A;  5I2Y A;  3U9O A;  1ZHQ A;  4L1K A;  1N33 L;  1X54 A;  4IRK A;  5IT9 E;  1KXL A;  3T51 B;  1ROD A;  2CQO A;  5T1G A;  3NTI A;  2Z6K A;  5LL6 S;  3RAX A;  5KFS A;  3KOJ A;  3GTG H;  4CGY B;  5KFA A;  1NE3 A;  1KHI A;  3N42 B;  4JI7 Q;  4KV6 A;  3R3O A;  1PTO F;  1DJR D;  3OSP A;  4DV2 Q;  2MQH A;  4A3K B;  5KT5 A;  1S0O A;  1KLU D;  4IFD J;  1SFO H;  2W7O A;  5CR3 A;  4EQN A;  3SK6 A;  4XQJ A;  2KEC A;  3IFT A;  4ED8 A;  2PQA B;  5C5L A;  2J4X A;  1F9S A;  1EZ8 A;  1K8A C;  3D4D A;  3JAM W;  4RHR A;  3AFQ A;  2AQ4 A;  5ELD A;  5JJL A;  3AU7 A;  3CC4 A;  2ICE C;  1RJR A;  2BOS A;  1PDQ A;  4A4I A;  2JA6 G;  1PH9 A;  3CU7 A;  1B1Z A;  1ET9 A;  1PK8 A;  3U9T A;  5KFD A;  1KDC A;  2F0V A;  3RFC A;  2XNA C;  1K73 C;  2R84 A;  4BY1 H;  4C5B A;  4IUU A;  2NVY B;  3M4Y A;  1X3F A;  1SR3 A;  4MHE A;  2BH2 A;  2YZG A;  4TQU S;  3E0J A;  4H0L C;  4DV4 H;  2EY2 A;  3HB9 A;  4OX9 L;  1G2T A;  1A3V A;  3CC2 A;  2WE6 A;  4X66 H;  1JXL A;  4GN5 A;  4BY7 H;  5FO8 B;  2IWH A;  3KAJ A;  3QWN A;  4YB8 B;  1EIG A;  2IHF A;  4J1M A;  2D2C C;  3FVQ A;  2B2Y A;  2PMZ E;  5LXT F;  3J7A K;  2A6E C;  1SLJ A;  2VL6 A;  1VBH A;  3T5J A;  3I4M H;  3NWS A;  2FHT A;  4DV7 Q;  1FNU A;  3M3Y B;  5GON F;  1VF5 C;  2OQ0 A;  4YCV A;  3GTO H;  5TSS A;  3GTL A;  3CMA A;  4JI1 L;  3F2B A;  2CW7 A;  4ED3 A;  1QZG A;  2W70 A;  2F0L A;  1SFO A;  4X65 L;  2QCP X;  2A69 C;  1LAC A;  3FPU B;  1LTT D;  1GUS A;  4K0K Q;  2WB1 E;  3JC6 6;  1LTI D;  2XIG A;  4I4T F;  4PZ8 A;  1A3U A;  1S0M A;  3I8Z A;  3EYY A;  2VQE H;  5AJ3 L;  3BAB A;  2W9A A;  1TWH H;  3QOJ A;  2RGR A;  1SXT A;  4LF5 L;  3GTM H;  3LWB A;  3GIK A;  3M9N B;  4DL7 A;  1E4E B;  2UXC H;  3V4S A;  2AKW B;  1GUG A;  4GLA C;  4DV7 H;  4K14 A;  2XCA A;  5C44 B;  2ZJR A;  5KFC A;  2J6U A;  1I50 A;  4H44 C;  3SE0 A;  3QZ7 A;  1QNU A;  5EPJ A;  4C2M A;  4RU9 A;  5KFE A;  3PIP 3;  3F2U A;  1GGO A;  3VR6 A;  1KIX A;  3DMU A;  4IUR A;  2N49 A;  4J9L A;  4JV5 H;  3CD6 A;  5FLM H;  3NEN A;  5FK9 C;  4GNX A;  4DR1 H;  3KF8 A;  3BZK A;  4DL3 A;  3D4W A;  4PV1 C;  4EVO A;  2SCU B;  1L1O C;  4U6P A;  1M8A A;  3D0F A;  4IZ8 A;  4ZKB B;  2JA6 A;  5BR8 L;  4DV5 H;  4R4O A;  4QW9 A;  4QIW B;  1B53 A;  3A0J A;  4IJH A;  1PTO C;  1FNV A;  1XMQ L;  2I46 A;  4QL5 A;  3GTM A;  4GKK H;  2K32 A;  2LXK A;  3BG3 A;  1TWA A;  1HH2 P;  3OTO L;  1WTQ A;  4B3R H;  1F77 A;  1SYD A;  2YTY A;  4JW0 A;  1AN8 A;  2K75 A;  3PW7 A;  2HVS A;  4B3T Q;  4KHV A;  4TQR A;  4TV8 F;  3NEL A;  5ELC A;  2C35 B;  2LSS A;  3AEV A;  3N6R A;  5J1Z A;  1VQC A;  4TKO B;  5T1I A;  1SFO B;  1L2Z A;  2F3V A;  5KT2 A;  5IP7 G;  3TQ1 A;  4J6H A;  3V6H A;  2W6Z A;  1O7L A;  5CV9 A;  2KBN A;  1SE8 A;  1I3Q H;  4U67 3;  2M05 A;  4L63 B;  5M3F B;  5KT4 A;  1I94 H;  3R5X A;  3PW0 A;  1XXG A;  2R92 H;  5FO7 B;  3GTG B;  4DKA C;  4A3L H;  4YHH Q;  1DV2 A;  1KTK A;  5BPF A;  4OX9 H;  1I4G A;  2LS0 1;  3C1E A;  2PYK A;  4ZYS A;  3D31 A;  1EQT A;  5M9O A;  2VW9 A;  4FXK C;  3KJO A;  4FNF A;  5ELO A;  1A0I A;  4X3U A;  3H0G G;  2VXW A;  1U9R A;  4JC0 A;  1D6E C;  2D0P A;  1I3Q B;  1KRT A;  3WO1 A;  4AYB A;  2B8F A;  2IL8 A;  2MO1 A;  5LMU H;  4RNO A;  4ECS A;  1TKW B;  2HIV A;  1RCV D;  4B3R Q;  3BS1 A;  3R5F A;  4MV7 A;  3J81 i;  5M5W B;  1FJG Q;  2R7Z B;  3K3V A;  2L12 A;  2ATW A;  1NSN S;  2CH4 A;  4CJ0 B;  3S2H H;  1ENF A;  2L55 A;  4O1N A;  2A1A A;  4DR3 Q;  4JUZ A;  3RV4 A;  4DL5 A;  2E2H A;  2K01 A;  2UXB H;  3CCJ A;  4CJ2 C;  2A6H D;  4RKL A;  4IHJ F;  5KFT A;  5J2U F;  4A3E H;  4HNV A;  1GUW A;  3VPB A;  3CKI B;  3ULL A;  2I5L X;  5KFG A;  1N48 A;  3HKZ A;  2KEN A;  1VCI A;  1BO0 A;  1AZQ A;  3HOU G;  1RIP A;  4Q44 A;  5KFN A;  2VUM G;  4R8N A;  2PNH A;  3K0X A;  1SMY C;  1XPR A;  1Q7Y C;  1D5M C;  2AUK A;  4JOI A;  5KG7 A;  3R2I A;  1S40 A;  3GV7 B;  1PTO D;  4DU9 A;  1CQF A;  4R8I A;  4DR5 H;  4J9K A;  1E24 A;  4MA0 A;  1K28 A;  2ZTD A;  4EYH B;  5F2D A;  5DGB A;  3BZC A;  3RJ0 A;  3LWE A;  2B2V C;  2F0K A;  5C4Z A;  2MP1 A;  4C3I G;  5JPM C;  1LTB D;  1H9S A;  4C3H B;  3KAK A;  1A62 A;  2OEO A;  1C8C A;  3QB3 A;  2VS1 A;  4TSS A;  1IBL L;  2Q2T A;  3KHR A;  4TQS A;  3KLR A;  1ICW A;  4A3B G;  4F88 A;  2O5J C;  1XNQ L;  1QVG A;  2N88 A;  4BS9 A;  2DJF C;  4BBR B;  1YJ9 A;  4B3M H;  4BA1 I;  1XNR Q;  5CB4 F;  2R92 A;  4DV3 L;  5LHY 1;  2K7V A;  3G8C A;  3ZJY C;  3CCS A;  5L1J A;  4OL7 A;  1T94 A;  1UUP A;  2UU9 L;  1DD2 A;  1BF4 A;  4RWS C;  1V1Q A;  1I94 Q;  2XCL A;  1QIL A;  1DOL A;  1A9X A;  5KFH A;  1W96 A;  3CPF A;  2ZXP A;  2K5W A;  3O13 A;  4YY3 Q;  2JA8 B;  3J81 W;  3VR2 A;  2PQE A;  4A3M H;  1DV1 A;  4OWT B;  3T16 A;  4IR9 A;  4EEQ A;  3PIP A;  1SCU B;  3NQT A;  2NVY H;  4YAK B;  2W6N A;  4OWX B;  3PQI A;  4DPG A;  1JIC A;  2JA9 A;  1UC9 A;  3H3V C;  4P75 A;  2NUC A;  3MXN B;  2WB1 B;  3WOF A;  2P5Z X;  1LT6 D;  3DWQ A;  4A3B H;  1HUN A;  1JR0 D;  1TWA H;  4E6I A;  4HJ7 A;  3PF5 A;  1N34 Q;  3ORR A;  2W8L A;  3RNU A;  4J9Q A;  1JC7 A;  1AFP A;  2AGO A;  4GKK Q;  1YJW A;  1SE2 A;  2NN6 H;  4O42 A;  1SE3 A;  4RG1 A;  3NP8 A;  4MIU A;  2R7Z G;  3W3A A;  1JOO A;  2F0T A;  4LW1 A;  5EQ0 A;  5C1O A;  4DV5 Q;  2IY5 B;  3PV0 A;  2BQR A;  2NWG A;  4JI0 Q;  1DCZ A;  1A2U A;  1LAB A;  1TVX A;  2MFI A;  5K36 H;  1L1O B;  2MO0 A;  2OCE A;  4EBC A;  4MA5 A;  3TP6 A;  1Q82 C;  2Q2H A;  4IOC A;  2K03 A;  2UXD L;  2EIF A;  2K28 A;  1VQG A;  2PZT A;  4HTH A;  4RB0 A;  3FMC A;  3H15 A;  1BOS A;  3H4B A;  4DFA A;  5IYB G;  2EXD A;  1SEI A;  4HED A;  2BQ3 A;  2HQL A;  4JI5 L;  4M8A A;  3VA7 A;  3N52 A;  4MTE A;  1YBY A;  2FPP B;  1EFW A;  3ULP A;  1H95 A;  3KK7 A;  4K8J A;  5A35 A;  2RDJ A;  3S1M B;  1FGB D;  3PW4 A;  3DF7 A;  2LXJ A;  1GSH A;  2FB9 A;  1SNO A;  3S1R H;  2EZV A;  2I8C A;  2MPM A;  4JOI C;  4DN4 M;  3ND9 A;  3J80 L;  4M7E A;  5CBA E;  1ASY A;  4WRD A;  1JDB B;  1S10 A;  1VF7 A;  1EOT A;  4J9M A;  1MSG A;  4YHH L;  5KFF A;  1YHQ A;  2PZU A;  1J6Q A;  1HHV A;  1AE3 A;  1V1P A;  2I5M X;  2DY7 A;  3H91 A;  3TP8 A;  4HJ5 A;  1XMO Q;  1JT8 A;  3HKZ G;  1E0B A;  3HZX A;  2JA8 G;  4YR3 A;  2R3Z A;  3EQL C;  3QO2 A;  3N44 B;  4B3M L;  5ELB A;  5M5Y H;  2I0Q A;  4MV8 A;  1LYL A;  1JX4 A;  4KKU A;  2UXD H;  2KHI A;  4DV4 Q;  4IUT A;  4RHS A;  2WYO A;  2X0S A;  3EN2 A;  4O3S A;  5IOC A;  3B6Y A;  4RKB A;  1UNS A;  3J7A V;  2AWO A;  1L0Y B;  4JI6 L;  4A3F H;  1Z2O X;  2Q2U A;  4JI5 Q;  4B3T L;  2UUA Q;  1UE7 A;  4Y7N B;  3JAM c;  4ECX A;  2F0D A;  4N8F A;  2A73 B;  1XDN A;  5HUR A;  2XWJ B;  5LMU Q;  2UU9 H;  5H1S E;  3KF6 B;  1CK1 A;  1GUO A;  4L5T A;  4DV1 L;  3RB0 A;  1SNP A;  1WJJ A;  3MXU A;  3T56 B;  2JEG A;  1STB A;  1B70 B;  3GIQ A;  4QCL A;  1WCM A;  4ME5 A;  4RAU C;  2K14 A;  3M9O B;  5DM6 3;  2JE6 I;  1MKH A;  4BY7 B;  5CV4 A;  4OHJ A;  1E7Z A;  4YWL A;  5E4X A;  4YHH H;  1EZ1 A;  2XWB B;  2O4X A;  2V59 A;  3RN5 A;  5DEH A;  3ICE A;  1J5E L;  1TS5 A;  3F8T A;  4OO1 H;  2QEJ C;  2EYL A;  1JJC B;  3IRB A;  3HP3 A;  5KG1 A;  4POG A;  1HQR D;  1PFS A;  2DY8 A;  3WOE A;  3WWV A;  4NXN H;  2MHV A;  4Q8F A;  2LKV A;  4FF1 A;  2YS6 A;  2FJ2 A;  5BN3 A;  1GYF A;  1O7I A;  3H3V I;  2K5Q A;  5DQH A;  1RHP A;  2JP1 A;  1OTC A;  2OTJ A;  2RQX A;  2Q8T A;  2KUM A;  4J0M A;  1K1Q A;  4ECY A;  1CHP D;  4LF9 H;  1MHW C;  5DLF A;  1IYJ B;  1K8M A;  1K83 A;  3MWE A;  2YYZ A;  4A3D H;  1M90 C;  2HDL A;  4DNI A;  4DR2 L;  4X65 Q;  2FLL A;  3P75 A;  4YWM A;  1YVC A;  2WKC A;  3S1Q H;  4EEY A;  3H94 A;  2R8I A;  1X55 A;  4A3K H;  3A8I E;  4YR0 A;  5I2X A;  3HOZ G;  4HSP A;  2KQ3 A;  2R7Z H;  1EY0 A;  1F9R A;  3KF6 A;  2N55 A;  5KFM A;  5JEA G;  2ZM6 H;  1CSQ A;  3Q6S A;  3NTK A;  4A3J B;  4NLG A;  1SYX B;  4A3C G;  4DR4 L;  5JJI A;  3HKZ B;  2HCI A;  3K57 A;  2VOB A;  5J2T F;  3PMF A;  3ITP A;  5C3W A;  1WVL A;  3K5H A;  4DV3 H;  5C4J B;  3N40 P;  1SJH D;  4O2D A;  2AGP A;  3C1F A;  3GID A;  4DV6 Q;  3I4N G;  3GDE A;  2DUD A;  4OWW B;  4JI1 Q;  3BJY A;  1FVI A;  1EYA A;  1I6H B;  3GIM A;  2E5L H;  3KBX A;  2ZXO A;  5KX5 F;  1JJ2 A;  4OO1 I;  2WAQ B;  2JJQ A;  4YBZ B;  2C28 A;  1N56 A;  3TBI B;  3NBH B;  4R8U A;  2RSN A;  2VQE L;  1J8I A;  3QFF A;  3D6W A;  3TQY A;  4QUC A;  3TII A;  1B44 D;  4K2K A;  1VBG A;  1V1O A;  1HNZ Q;  2KVM A;  3E9I A;  2H1E A;  4OX9 Q;  1DIK A;  2XIW A;  3CC7 A;  1W3S A;  5KG5 A;  4TVA B;  3M9M B;  1II3 A;  4ME6 A;  1WTH A;  4RCN A;  5IGD A;  3QZ8 A;  2K4K A;  4PG3 A;  2ES2 A;  2K6A A;  4Q0F A;  4F4W A;  5COR A;  3HKZ E;  2UUC H;  3H0G A;  4XTC S;  2R7N A;  1VQA A;  2F0S A;  3K5O A;  1UE1 A;  1SMX A;  4I7A A;  1K8G A;  4DL4 A;  1JE5 A;  4NKL A;  1PH7 A;  3CCQ A;  2X69 A;  4QMG A;  4LFC L;  1ZHS A;  5IT9 L;  2EY5 A;  1ML0 D;  2R87 A;  5FD5 A;  1TT2 A;  4RFB A;  5KFU A;  2V9W A;  3Q8D A;  2NBF A;  5EJW A;  2DGY A;  5IYB H;  3Q2O A;  3FHW A;  3K80 C;  5ISR A;  5JJK A;  5EPK A;  4QB4 A;  4J8Q A;  1D7Q A;  2IX3 A;  3A55 A;  3HS0 C;  3TIG A;  3H3V H;  1AH9 A;  5T14 A;  3A56 A;  3PO2 B;  1C3O A;  2EXZ A;  1KNE A;  4F8M A;  1JJG A;  5KFK A;  4CHT B;  3RZD B;  3S16 H;  2EYH A;  2SDF A;  3CCR A;  3PUW A;  3NUC A;  5LMN L;  4LF5 H;  4N9P A;  4UP9 A;  3MFI A;  1S5F D;  4C3I B;  3N41 B;  3BAA A;  2VUM B;  1W6J A;  1CS0 A;  3OIP A;  3DEO A;  1Q8K A;  4B9X A;  2VZA A;  1VQL A;  3CQZ H;  1X32 A;  3NBI A;  1YI2 A;  4DAY A;  1AW7 A;  4LUZ A;  1BNZ A;  1STN A;  4OIK A;  2K05 A;  4YQW A;  4BBR G;  1R4P B;  1E4E A;  3OTO Q;  4IWX A;  3FDT A;  1VQE A;  4LFB L;  4X3T A;  4UFZ A;  2PI2 A;  2I80 A;  4BY1 G;  4JCV E;  5IP9 H;  5D1O A;  5C8Y F;  1EFI D;  5I6W A;  1K0S A;  5L1K A;  3J80 c;  3BG5 A;  1S68 A;  2YV5 A;  4JI2 Q;  4B9W A;  1OXS C;  3KUP A;  3J80 E;  2DJG C;  2PW5 A;  2WV6 D;  5EBD A;  4G7H C;  1KJ9 A;  3K5I A;  1VDZ A;  3K58 A;  3QJY A;  1STY A;  1JB3 A;  1YIJ A;  4IPH A;  4DUZ Q;  1B6S A;  2YL2 A;  2RKS A;  2B2W C;  4LUO A;  2KSW A;  1WFQ A;  3V96 A;  5FPR A;  1HA5 A;  2HHH H;  2CCZ A;  4IRD A;  4DV6 H;  1IBK H;  3VYT A;  3ERQ A;  2UU9 Q;  3Q8Q B;  1PRT B;  4M9U A;  1Q12 A;  3AQQ A;  3HOX B;  1HJP A;  3T53 B;  5CV7 A;  1SND A;  2EY6 A;  4DR2 Q;  1EYC A;  3A5Z B;  5EKK A;  2V1C C;  4O4I F;  3RGX A;  5EWG A;  2F0Q A;  1YZ6 A;  4UDU C;  1I50 H;  1GUT A;  4H7B A;  2W6O A;  4JI0 H;  1NR2 A;  2B2T A;  1VQN A;  3IN5 A;  1AEX A;  1HXY D;  1SYE A;  4XYO A;  1Y1W G;  1YHB A;  4DAP A;  5FPO A;  4P2C B;  5C4X H;  1HRJ A;  3K59 A;  3KF8 B;  4DV0 L;  1VAJ A;  2RDG A;  3RTX A;  2GVA A;  2KOL A;  3RLF A;  1PH4 A;  1KLG D;  2Z6B A;  5M3F H;  4ZI7 F;  1CSP A;  3PZP A;  5D3D A;  3ERO A;  4IJL A;  3TN2 A;  1J5E Q;  1B50 A;  1S03 G;  1G29 1;  2H5X A;  1F9Q A;  4MTN A;  1DM0 B;  2PNR C;  1BNC A;  2BE5 D;  3KHL A;  2F4I A;  2ASB A;  1RYS A;  3OPO A;  4QWD A;  2PI2 E;  4KHP H;  2I5H A;  5IYD G;  1M6V A;  1XMO L;  4WJW A;  2RA4 A;  5KYL A;  1S3O A;  2XVS A;  3GV5 B;  1E4F T;  3OUZ A;  2F4V L;  2R92 G;  3M9B A;  1YNJ D;  2VQD A;  1Q3L A;  4TUY F;  1U5K A;  1K0R A;  4LF7 H;  5L37 A;  3SDZ A;  4XYQ A;  2R93 G;  2K33 A;  4NXM H;  1N32 H;  3I7F A;  3HOY G;  1H9J A;  1R4Q B;  4CJ1 B;  4A3C H;  4LNQ A;  1EHI A;  2E74 C;  3A74 A;  1C7Y A;  5IGC A;  2AQ3 B;  4DV4 L;  1WSC A;  3PO3 B;  1DON A;  3DEP A;  1S4Z A;  4RH6 A;  3T1H Q;  2NU6 B;  4DK3 C;  4C56 C;  3NK9 A;  3LP8 A;  4UCU A;  1I7N A;  2W6Q A;  4A3K G;  2AHO B;  1EWH A;  4A3L G;  3ORQ A;  3GV6 A;  2PMZ B;  1K83 B;  4CDE C;  2NVT B;  2W9C B;  1WCM B;  5LL6 X;  2YW2 A;  1RYR A;  4DR7 H;  1KAA A;  2XGQ A;  2IMW P;  2Z1C A;  1F2Y A;  1B3A A;  2N3S A;  2XRS D;  4V0B A;  2F3W A;  2BE5 C;  2NTT A;  2L11 A;  5C5M A;  1S72 A;  1UEB A;  4EQO A;  5IYC G;  1JOK A;  2TMP A;  2R7Z A;  5GAE C;  3PO3 H;  4A3J G;  3GTO A;  3H0G H;  2ZT9 C;  5IWA Q;  1AN7 A;  3UDI A;  1N33 Q;  2N78 A;  2DZD A;  3J80 W;  1TWF A;  1ZKO A;  4HR7 B;  2B2W A;  5I9P A;  3U50 C;  2MNA A;  2JA5 H;  1CE8 A;  4RB2 C;  1K83 H;  4QY7 A;  2NVT H;  5KFI A;  2PN1 A;  2PQA A;  1YEZ A;  4NDX A;  2R7L A;  3TRE A;  4RAY A;  4ECU A;  4NXN L;  3DHQ A;  1PFN A;  2R8H A;  4JI4 H;  1WH2 A;  1B7Y B;  4MV6 A;  2ATL A;  4LF7 Q;  3M4Q A;  4UCV A;  4H02 A;  2HIX A;  4IAJ A;  4LF4 H;  2F0M A;  2IW3 A;  2R93 H;  3L7Z C;  2HVR A;  2B2V A;  2F0H A;  5IP9 G;  1I4Q A;  4DV0 Q;  5KFZ A;  3VA5 A;  3J7Z C;  2RGV A;  2L15 A;  3J7Y W;  4FU0 A;  4DK6 C;  3JRW A;  1IKL A;  2EYM A;  4AQY H;  1TU2 B;  1JLL B;  4IFD H;  1RJP A;  2R93 A;  5DLG A;  3C2P A;  1UNN C;  1VQO A;  2PVP A;  2VPS A;  4L5R C;  1Q81 C;  2R7K A;  3PR5 B;  2A19 A;  1I6H H;  2NU9 B;  1EIY B;  4DV5 L;  1U4P A;  4CC6 A;  4P71 A;  1X3E A;  3MTS A;  1XMQ H;  4K5X A;  2QW7 A;  4V19 0;  2IX1 A;  4QWA A;  4RGT A;  1HCZ A;  3MZ5 A;  1HR0 W;  2R92 B;  2Y0S B;  2EYP A;  3NEM A;  4C3J B;  4JI1 H;  2A69 D;  5IP7 H;  3HOY B;  3MWY W;  1BR9 A;  4UP8 A;  2KHS A;  4GOP A;  5J39 A;  5CV8 A;  4B3T H;  2NVX H;  2A6E D;  3DWP A;  2PMZ A;  4LF8 H;  1I4P A;  4DR1 Q;  4A3F G;  4LF6 L;  1SYF A;  3TEH B;  2X6L A;  2CW8 A;  3I4M G;  4TV9 F;  3VPD A;  1EYD A;  2ZM6 Q;  1EUD B;  1JDE A;  2BCO A;  4IO9 A;  4JI8 H;  2ZJT A;  3S17 B;  2AQ2 B;  1VQD A;  4NW2 A;  3OMC A;  5KFO A;  4X64 H;  1EL0 A;  4TRD A;  1Z47 A;  2NZH A;  3K7A B;  4RAZ A;  4JYA L;  2W9B B;  3OSN A;  4PZ7 A;  1K3B C;  2YU9 A;  5JPN C;  3HBL A;  1TWA B;  1N9W A;  1SJE D;  5FLX c;  2O03 A;  1KNA A;  5LMN Q;  1CKO A;  4DUZ H;  3MAQ A;  2BH8 A;  3SE7 A;  2QGQ A;  4MAM A;  3BDL A;  2GN5 A;  4G4K A;  3L2P A;  3SEB A;  4ALP A;  3KLS X;  4CBV A;  3I4N B;  4OGQ C;  2JXM B;  1TQO A;  1NUC A;  1JMC A;  3FEW X;  4J9N A;  4B3S Q;  2XGP A;  2AQ1 B;  1GD7 A;  4EGV A;  2NVQ H;  4LUV A;  4GKJ L;  1YNN C;  3H0G B;  2CQY A;  2D5D A;  2BQU A;  2WAQ G;  3H09 A;  1CQJ B;  4ED6 A;  3AB9 A;  5F9L A;  2ZDH A;  4DV1 H;  1B6R A;  2NZO A;  5KT7 A;  2NYZ D;  2GPW A;  1CQV A;  5DM7 3;  4DF7 A;  4G7Z C;  3EBE A;  5FD6 A;  1Y8N B;  2XN9 C;  1O7Z A;  2CQA A;  3NWT A;  3RB6 A;  3NTH A;  4QIW E;  4IZO A;  4LH7 A;  2F03 A;  1K9M C;  4QWE A;  1QWY A;  3NBH A;  2JA7 H;  2RCF A;  4PNY A;  2YU9 H;  1HNX Q;  2VUM A;  4GS3 A;  5K36 G;  3FDS A;  1LTL A;  3VR5 A;  4C2M H;  5E7N A;  2UUA H;  4KI0 A;  1SNM A;  2YU9 B;  3SVM A;  3CME A;  5JVL A;  5E3F A;  3C3L A;  2Q8I B;  1Z7T A;  2R86 A;  2F0J A;  3K5M A;  4A3I H;  1CI3 M;  2E2H B;  4IFD G;  4X62 H;  2YS7 A;  2CVR A;  1EY9 A;  2CH4 W;  2JEF A;  3KBG A;  2EYF A;  3TSS A;  4F87 A;  2W6P A;  2ZDG A;  3V2T A;  1CT1 D;  4HMJ A;  4DGZ A;  2M2L A;  4DUY Q;  3S9W A;  2JA7 G;  1IHZ A;  2K5H A;  4ED1 A;  3T1H H;  4C3H G;  4O4H F;  1TA8 A;  1XMQ Q;  4CDD C;  4XQQ A;  4IPG A;  5JVD F;  2NVQ B;  1TY0 A;  4L8J A;  2E76 C;  3J80 i;  4Z9C B;  1GO3 E;  3HXL A;  5IT9 W;  3WNZ A;  5D1O B;  1HUM A;  2FLP A;  4A3G G;  1Y69 U;  3I4N H;  2E2J B;  4GOP C;  3OUU A;  4DR4 Q;  3GLK A;  5JEA J;  3P1H A;  5H80 A;  3ULJ A;  2JEA I;  1BKB A;  3S14 H;  1WD1 A;  1BVS A;  4F4Y A;  3S17 H;  1Z2N X;  3F1Z A;  4JI2 H;  3BJU A;  4JI3 L;  2CFM A;  4DR4 H;  1IL8 A;  4LWC A;  2EYO A;  3BDC A;  2OF1 A;  5KT6 A;  4GN3 B;  5M3M H;  2VUG A;  4XZ3 B;  1Y14 B;  3UI2 A;  1NBW A;  2MJ8 A;  3E6Z X;  2E5L L;  3KJP A;  4LFC H;  1S9F A;  3MA2 B;  2EE1 A;  3HOX H;  1LTS D;  1RD9 D;  1UC8 A;  4FS2 A;  1D5Z C;  2B2U C;  4KLK A;  1N36 L;  2C2E A;  3N6X A;  1KAB A;  4P72 A;  2E5L Q;  3STB C;  2VA3 A;  3RB4 A;  4Q5V A;  3TDQ A;  4FF3 A;  4HN7 A;  1NAP A;  1Y1V B;  3SHL A;  4DA2 A;  3JSN A;  3Q1K A;  1S97 A;  1G2S A;  3KLS A;  1VQ4 A;  1NJI C;  1WR2 A;  4L6T B;  3VDY A;  4DV7 L;  3GTJ H;  3CRK C;  5GQO A;  5FLX L;  4JI8 Q;  1M1K C;  4UY8 C;  4HIM A;  1GOZ A;  1G6P A;  3A5U A;  2NVY A;  3EA6 A;  1R9T A;  1LT4 D;  3OSO A;  5KNB A;  1EQV A;  4KY6 A;  1JWM D;  2FMA A;  2WP8 J;  4EQP A;  2FFK B;  2JA5 G;  2FMM A;  4ZRZ A;  4R1J A;  2Z6K C;  1Q86 C;  2PO4 A;  5BN5 A;  1PRT C;  2CHB D;  3Q8P B;  4OIJ A;  1XPU A;  1VQJ A;  2HJW A;  2KCT A;  1X3G A;  4ECV A;  1E4G T;  4R4I A;  2UUC L;  5LMU L;  2KJX A;  2D0O A;  4JBW A;  3PN1 A;  4YP3 A;  5J3B A;  3I73 A;  3L9A X;  1C9O A;  4F50 A;  3T1Y H;  5BPH A;  1AUV A;  3UE1 A;  1KJJ A;  4LF9 Q;  2SEB D;  4L5Q A;  2WAQ E;  1EEF D;  4I7Z C;  5BMV F;  1O78 A;  3CCL A;  3QG1 A;  1M4V A;  2W7P A;  4LFC Q;  3K5N A;  1ZYR C;  5DLQ E;  2JA8 H;  1JKJ B;  3WO0 A;  3X3N A;  1HZA A;  1OXT A;  2EQS A;  2IT1 A;  1HTP A;  1N32 Q;  5IYD H;  4WD3 A;  2A5H A;  3R2T A;  3BYY B;  4H13 C;  5CA1 F;  4N8X 1;  3IG0 A;  4JI4 L;  4IQZ A;  4JPB W;  4QUF A;  4A3G B;  3GTL B;  4B3S H;  1TWF H;  4EQ5 A;  3AMU A;  1PZI D;  2J6S A;  3GV3 A;  1SMY D;  5M5X H;  2O5I C;  2F0W A;  4JI7 L;  3Q23 A;  2H4O A;  3I70 A;  1WOC A;  1TY2 A;  2QKI C;  1WTV A;  1QZH A;  5C1P A;  1L1O A;  3BQ1 A;  4JI4 Q;  1YNN D;  2Z4I A;  2A6H C;  2JYO A;  4CKE A;  3K5L A;  3T1H L;  4BBS B;  1IW7 C;  3NQI A;  4HIK A;  1EY5 A;  3MXN A;  2V5A A;  2QDB A;  1A2T A;  1PLF A;  4BXX G;  2YCH A;  2V4D A;  3NE5 B;  5KKN B;  4ED7 A;  2L9H A;  5IWA H;  4YR2 A;  3S2H B;  3RB3 A;  3MEF A;  1D1I A;  2JA6 H;  2E2D C;  2C9O A;  4DV2 L;  1ASZ A;  4A3F B;  2ASJ A;  3CW2 C;  5M5W H;  1PH5 A;  4ZQ3 A;  3MWM A;  3I4M B;  3K6O A;  4RGN A;  2ZJP A;  3VYR A;  1TWG A;  1DGS A;  3HOW H;  1OO9 B;  4JVZ A;  3MEH A;  3RMH A;  3I91 A;  1MJC A;  3MR5 A;  3GIJ A;  2Z9H A;  5IGE A;  2VA2 A;  4KN7 C;  3BVG A;  4LSA A;  4HID A;  1HQM C;  4ECZ A;  1X65 A;  1XMO H;  3L0O A;  4JYA Q;  3NHH A;  3BU2 A;  3LX0 A;  4JI0 L;  3DM1 A;  1B8A A;  1N36 H;  3V4Z A;  4LF9 L;  2JEB I;  4IRC A;  1QJO A;  2E8G A;  5C4X B;  5KFB A;  1ZEQ X;  4NP5 A;  1WYD A;  4IUV A;  4QJF A;  2K1B A;  3ER0 A;  4DR1 L;  4EGJ A;  2HUG A;  3U4V A;  3IFD A;  4K5W A;  3TS0 A;  1L0W A;  3S1M H;  1NR4 A;  2HQE A;  4ME3 A;  1N34 L;  2JSO A;  3RLN A;  3EFX D;  3CCU A;  2SNS A;  4K0K H;  1GJX A;  3TQT A;  5D8D A;  1Y1V H;  2GA4 B;  1VQ6 A;  4F4X A;  2ZXR A;  4FXG C;  4YIJ A;  3FP9 A;  1XNQ H;  2Q8R E;  2FKL A;  3OTO H;  1KRS A;  3U9S A;  1UAP A;  2ZTE A;  1I7L A;  2FPI B;  1OXV A;  4ZOL F;  5C44 G;  3KFU A;  4QWC A;  1BDO A;  1H9K A;  1G51 A;  1OXX K;  2MUY A;  1EUJ A;  4S3S A;  1ILP A;  2JA7 A;  5G3L F;  1XNR L;  2UUB H;  4G3I A;  4BBS G;  2F0P A;  2W9B A;  4MN3 A;  2WAC A;  3GTQ A;  2EJF C;  1T5E A;  2LFN A;  1IBL Q;  1TWC B;  4O0A A;  3H40 A;  3PUY A;  5EAY A;  2NVX A;  1QG7 A;  2B2U A;  1Z6H A;  4EG0 A;  1Y8O B;  3M4O H;  2RDF A;  4LJZ C;  4ZKC B;  1VQM A;  1PFM A;  1E2Z A;  1XX8 A;  1EY8 A;  3QIA A;  2UUA L;  3A8J E;  1M0T A;  5LP6 F;  3E9H A;  3I90 A;  3C0F B;  3VR3 A;  3G4S A;  1XTC D;  5I6Y A;  1SBB B;  4C3I H;  3S24 A;  4XYL B;  2K04 A;  1TWG B;  3PW2 A;  4KJO A;  4LK1 C;  3PSI A;  4EGQ A;  2WKD A;  3VR4 A;  5EKI A;  5CBE E;  1L0X B;  4UCR A;  1H9M A;  3S16 B;  3RD4 A;  3GTL H;  2QYZ A;  4B3M Q;  4HAE A;  1WTP A;  2EOT A;  3CAM A;  3MHB A;  4MV4 A;  1KDA A;  1TR5 A;  5KIX A;  5CA0 F;  4DV2 H;  2CW0 D;  2DWC A;  4MTK A;  2UVW A;  2E2I A;  1L2F A;  2L0C A;  4JBJ A;  4KMU C;  5EZY F;  1PH8 A;  5M3F G;  5KG0 A;  1VQ8 A;  3HKS A;  1MSH A;  1IYV A;  1TWF B;  2ASL A;  1ILQ A;  1E2V A;  1SNC A;  4XDX A;  5IT9 c;  1KJQ A;  3CRL C;  2AUJ D;  1QUQ B;  5COY A;  4X66 L;  2L1B A;  3MXP A;  4I55 F;  2A74 C;  4BY7 G;  5IY0 A;  1KDB A;  2VB2 X;  2FMC A;  3RF2 A;  2IBK A;  3TZU A;  2DIK A;  1MD2 D;  4YWK A;  1JE4 A;  5AFW A;  4AQY Q;  2IHE A;  5CYU A;  1Y1W H;  3MVV A;  3U4Z A;  2OLS A;  4PMW A;  1KEE A;  2RVL A;  4AQY L;  1Q90 A;  2VB3 X;  4BXX H;  4RNN A;  5DNF A;  1BCP D;  4DAM A;  1EUC B;  2JA5 A;  3M4P A;  3TME A;  4POF A;  4LF4 L;  2B29 A;  3BVZ A;  4X66 Q;  2A8V A;  5C5J A;  1PTO B;  1PZK D;  1S5C D;  3HOZ B;  5IGB A;  1UWV A;  3BA8 A;  1SDF A;  4RUC A;  1B3Q A;  1GHK A;  4CC5 A;  3A54 A;  3PO2 G;  5IOD A;  3PVX A;  4FO2 A;  4IAL A;  1I6V C;  2FIN B;  3S1N B;  1VQH A;  3J81 L;  4CDF C;  1CQI B;  4DR3 H;  1BGW A;  1IBM L;  2UXD Q;  2XD4 A;  3GTJ A;  1KJ8 A;  3CF5 A;  5FJ8 G;  3RUP A;  1N34 H;  1LO5 D;  2B2T C;  4DK1 A;  4J9P A;  3HRZ C;  5KFV A;  4JV0 A;  3RZO B;  5HBR B;  3Q24 A;  1JCK B;  1I4X A;  2BR0 A;  1D5X C;  1GM5 A;  4KN4 C;  4Q0Y A;  2W9C A;  5ELN A;  1A63 A;  4QIW A;  4JG2 A;  1EEI D;  1FKA H;  3I4O A;  3GQC A;  4ILW A;  2HHH Q;  4Y52 H;  4UHV A;  4NXM Q;  2IPK D;  4X65 H;  3T4A C;  2K50 A;  2UUC Q;  3I56 A;  1ZYR D;  1EY4 A;  2ALY B;  1CM9 A;  1WTX A;  4LMQ D;  4Q43 A;  1VS0 A;  1XWE A;  4R4C A;  3K0Y A;  2WDT A;  2ZTC A;  5M3M G;  4FF2 A;  3HG9 A;  3RZO H;  4A3J H;  2F0U A;  3K8A A;  5D65 A;  5M3M B;  4MV1 A;  4EX5 A;  4IUP A;  3UE0 A;  3MR3 A;  4C3J G;  1PA6 A;  4X64 L;  2RBM A;  4ZLT F;  1VQ7 A;  2R8K A;  1M7J A;  2XSC A;  2PZW A;  4I65 A;  1PZJ D;  2RHS B;  5JQW A;  1DYQ A;  1PMR A;  1PFB A;  1X56 A;  2AWN A;  1Y8P B;  1PRT D;  4JI8 L;  3C46 A;  2XC9 A;  3MFG A;  3HOV B;  4DK0 A;  3MR6 A;  1SAP A;  1MJE A;  3OYY A;  5JEA H;  1IZ6 A;  1LUZ A;  1XYI A;  4XQN A;  2QIL A;  4XT3 B;  5EWF A;  4A2B A;  3PCO B;  1Q8I A;  2OTL A;  5GAD C;  4L5S A;  3S1Q B;  4LF6 Q;  4ZHQ F;  2YTV A;  1MGS A;  4DLK A;  1MI2 A;  2EYJ A;  1V43 A;  2UVU A;  1I5F A;  5CC4 A;  3D8G A;  2E2J H;  3T13 A;  2DNC A;  2GPS A;  5DQI A;  4GKJ H;  5FKA C;  1KQS A;  1RK6 A;  2J0T D;  4IPD A;  2FK3 A;  1PTO H;  1IBL H;  5D1P A;  4BWS C;  1NMG A;  1AE2 A;  4KY5 A;  2RF4 A;  4PMB A;  3TP5 A;  2HT1 A;  2UUB Q;  4N9T A;  2JA5 B;  3UDF A;  4DR2 H;  4JI5 H;  4UPA A;  2ZJQ A;  3HOW B;  1FL0 A;  3I12 A;  3CXC A;  4LFB Q;  1KD1 C;  2L4N A;  3KYH C;  2VQF H;  4BWG B;  5DG7 A;  5LL6 b;  4PMC A;  4O2B F;  4XXE A;  1Y1W B;  3M85 A;  1A15 A;  5DG9 A;  1YJN A;  3EVQ A;  4DAV A;  5IWA L;  3VPC A;  3FPP A;  4QGU A;  3HEJ A;  1FD7 D;  4DV1 Q;  2N8N A;  4DAY B;  4DXF A;  1EU3 A;  4UCO A;  2QF7 A;  5A2Q E;  4DR3 L;  3GD7 A;  4X62 L;  2OQK A;  1NMF A;  3RZD H;  3KAL A;  2C2D A;  1EYZ A;  4HSV A;  3J7A 5;  3URY A;  2L5T A;  4GLX A;  5A2Q L;  3Q8S B;  2K5D A;  3F2D A;  3SR1 A;  4IWY A;  4CDC C;  1TS2 A;  3MC0 B;  5EOY A;  4ECR A;  1PH6 A;  3H6M A;  2B2Y C;  4KK7 A;  2QA4 A;  1KC8 C;  3OMG A;  4J9R A;  1J9O A;  1LT3 D;  4A3D G;  4RUA A;  3CCM A;  1MBY A;  1NCV A;  1XTD A;  3M4O B;  3W2D A;  2DPJ A;  3GTO B;  1QE6 A;  1C48 A;  2W8K A;  3QOL A;  1IBM Q;  3M4I A;  2F0O A;  3DWA A;  1TWC H;  1OXU A;  3U58 A;  1WI5 A;  1BBX C;  2VQF L;  1EU4 A;  1EWI A;  4GC6 A;  1BBU A;  5DQG A;  3AYH B;  4EBE A;  1ESR A;  1B2T A;  4A3E B;  5M5Y B;  2ZDQ A;  1LT5 D;  2WAQ A;  1STE A;  1JOR A;  4P73 A;  4HMI A;  1EIH A;  1JQY D;  3OWF A;  2FJZ A;  1K3R A;  4DR6 Q;  3FKI G;  4O3N A;  3OWE B;  4U68 A;  2D62 A;  3G71 A;  3G48 A;  3S1R B;  4G7O C;  2G9D A;  1CTM A;  1ZQ7 A;  5KFW A;  2NN6 I;  2B3G A;  2TSS A;  1E22 A;  1VQ9 A;  1HNW Q;  4GKJ Q;  3MXG A;  2KCN A;  1LV9 A;  1RTO A;  5KG4 A;  1VQI A;  1AUX A;  3G6Y A;  2GVB A;  4WJ3 M;  4FXD A;  2W6M A;  5KT3 A;  2Q2I A;  2F0I A;  2F4V Q;  2R6F A;  4HJ8 A;  3HOW G;  5C4H A;  1KC7 A;  3LNN A;  1GUN A;  1F2M A;  2UVV A;  3EJI A;  3HOY H;  3TS2 A;  2EPB A;  1WTO A;  1EIF A;  1CA6 A;  3JAM L;  1TII D;  2M9V A;  2RDH A;  1DOM A;  5BR8 Q;  1IOV A;  3FKI H;  3DLL A;  4ECW A;  1UEA B;  4C3J H;  2G9H D;  4FYD A;  3JAM E;  3L4K A;  4DL6 A;  3SXH A;  1GSO A;  2R7D A;  3JZI A;  2JEI A;  3HOU H;  3BZD B;  2DPI A;  3CCV A;  5KNC A;  1IYU A;  5HGQ A;  3GO5 A;  4ZUI A;  1A8V A;  1CKN B;  5KG6 A;  4JI7 H;  1TS4 A;  5KFQ A;  1PYB A;  3TP7 A;  4C1N K;  3G6X A;  4WFN 3;  4CKC A;  3UDG A;  4ED2 A;  3IAY A;  2EVB A;  2UUB L;  1M0W A;  1SEB D;  1XNR H;  1B33 N;  3J7A F;  2OWO A;  4A93 B;  1DZ1 A;  2W71 A;  1QVC A;  4E4T A;  1V51 A;  3PF4 A;  3SK4 A;  2NU8 B;  5BR8 H;  5KFP A;  4LFA L;  5IYC H;  1PRT F;  2B8G A;  1N36 Q;  1VQK A;  4YJ2 F;  2C22 A;  2WII B;  1ZET A;  4FBU A;  2PCF B;  1C0A A;  3MWD A;  3GTQ B;  5LMN H;  1RL2 A;  1FNW A;  1GXD C;  1P16 A;  5C6A A;  2YZN A;  1KBL A;  1O80 A;  2Y0S G;  4Q45 A;  1R9T B;  3CQZ B;  1K1S A;  3JSL A;  3GTM B;  1KL9 A;  3A7A B;  2R93 B;  3BQ2 A;  2C5C A;  3R8B A;  1HR0 H;  3I3C A;  4JK1 C;  1RDP D;  2HCC A;  2IX0 A;  3CP0 A;  1JOQ A;  2UVR A;  5CV5 A;  3PO3 G;  3PW5 A;  4I7H A;  2JN4 A;  3R93 A;  1AZP A;  1G6Z A;  2F52 A;  1VQP A;  5JH7 F;  1U4R A;  2NUA B;  1B4O A;  1U0L A;  3K81 C;  1LTR D;  4ID6 A;  4HR7 A;  1SE4 A;  1E1O A;  2IA6 A;  2FP4 B;  5DAU A;  2YYA A;  4BBR H;  4RGM A;  5HY6 A;  4QWB A;  2OXP A;  3G6V A;  1IBM H;  3KDF B;  1CZG A;  4YY3 H;  2JEJ A;  2HHH L;  5CAE B;  1V9P A;  2SNM A;  1B04 A;  1SN8 A;  2J6T A;  5J22 A;  5C3E G;  1P8L A;  4Y7N H;  3ND8 A;  3GQB A;  5KFJ A;  1HZB A;  1HZC A;  2LY7 A;  1HNZ H;  3G6J B;  4KKS A;  2HGS A;  1MZB A;  2AMC B;  3BDO A;  2CWP A;  1QVF A;  3S2D B;  4RNM A;  4J9S A;  2MCT A;  4DL2 A;  1VQB A;  1EQR A;  2F0F A;  2K5V A;  3CHB D;  3GIL A;  1I3Q A;  4KD4 A;  3GIP A;  3RR5 A;  5JVH 3;  2AU0 A;  4ODG A;  3L4J A;  4O3O A;  3GTK A;  4ABN A;  4LF4 Q;  2F4V H;  4BA2 I;  4R9W A;  2B63 H;  1WTW A;  5JOB A;  5FLX E;  1VKZ A;  1NY4 A;  4GNX C;  2NTS A;  1JWU D;  1HNW H;  4A75 A;  3GTK H;  5EKL A;  4MV3 A;  5JJZ A;  2Z0S A;  1KAW A;  4NPS A;  1X6O A;  1B9N A;  4P74 A;  3TRZ A;  4KHP L;  3CQZ A;  1N33 H;  1A3T A;  2ENB A;  2RHQ B;  3SI8 A;  2RSO A;  3GV8 B;  5KGU A;  1LM0 A;  5CMD A;  4OO1 G;  1FYC A;  1ONL A;  1S5D D;  3NSW A;  3ZYY X;  2J9G A;  4DR6 H;  1GSA A;  2R82 A;  4AYB E;  3QR8 A;  3GTP B;  5KRU A;  4X62 Q;  1I6U A;  1D8L A;  1PYS B;  3L3O C;  3S14 B;  1VQ5 A;  3Q22 A;  1I50 B;  4OEM B;  4FDB A;  1K8O A;  5EDW A;  4Q8E A;  1HNZ L;  3GTP H;  4NMZ A;  5KFY A;  3EIV A;  1YNJ C;  1E2W A;  3WDN A;  4JV5 Q;  5EBC A;  1PV4 A;  4K8I A;  4XT1 B;  3UDX A;  1JB7 A;  4DXG A;  4U7C A;  5EWE A;  2VQE Q;  2C2R A;  3A8K E;  5F9N A;  2CW0 C;  4A3B B;  4YJ3 F;  3MFY A;  4A3D B;  2ICI A;  5KG3 A;  2KA7 A;  4LAA A;  1EQQ A;  2O2L D;  2FLN A;  1STG A;  4B08 A;  1X3Q A;  1T5X D;  5C0X I;  1RTN A;  2B63 B;  1SNQ A;  2A68 C;  1I4R A;  1CHQ D;  4DV6 L;  5L1L A;  5E4W C;  1IKM A;  1FR3 A;  3GTK B;  2CZG A;  3KXY T;  3A7L A;  4A3E G;  4X6A H;  3DM3 A;  5BN4 A;  2V58 A;  3MR2 A;  2R6G A;  1OWT A;  3V6J A;  4EBD A;  1CA5 A;  2QDL A;  1SRU A;  2Y0S E;  5GRO A;  3BYT B;  3PR4 A;  2PBZ A;  2NN6 G;  4EYI B;  3RBE A;  4APV A;  1Y1W A;  1EOV A;  5ELE A;  4KTA A;  4A3M B;  1QCB D;  3GTP A;  1BXR A;  4ZUJ A;  2JA6 B;  3I72 A;  1LTA D;  1NTG A;  3EPG A;  5C44 H;  3F2C A;  4WJ4 A;  4LFB H;  4GLV B;  4X3S A;  2OH2 A;  2WIN B;  5I4D A;  3ONA B;  4LF8 Q;  2VUM H;  4X64 Q;  1C4Q A;  2CWA A;  1V1P B;  4FP5 D;  5FJ8 H;  4C2M B;  5IE8 A;  1O7Y A;  4A3G H;  4J15 A;  4DNR B;  1MIU A;  4BBS H;  2YTX A;  1IBK L;  4R4T A;  1TWH A;  1PH2 A;  4ZCK A;  2PW7 A;  3H20 A;  4LSX A;  3PO2 H;  3H4D A;  4F4Z A;  3I4L A;  4JV2 A;  4LF6 H;  4LF7 L;  1Q46 A;  4RCO A;  3M3Y H;  3SK5 A;  3RBD A;  1WCM H;  5IYZ F;  2HVQ A;  2BA1 A;  2WB1 A;  3I55 A;  5LA6 F;  2DN8 A;  1DXM A;  3OW2 A;  2E2I B;  3VYS A;  2V4R A;  5E1F A;  4UCS A;  2R85 A;  1S0N A;  4IUN A;  1E1T A;  3PUV A;  2CKZ B;  4DR6 L;  4OON A;  1IL2 A;  1NNX A;  1XPO A;  1ESF A;  1HNX L;  3S15 B;  4A2A A;  1BCP C;  3T5L A;  1EWC A;  3J81 E;  3GTQ H;  4QQB X;  4O3R A;  4DV0 H;  4YCU A;  2YRW A;  1RK5 A;  1CFM A;  4RZR A;  4DUY L;  3K7A H;  4HCS A;  1T36 A;  3HOV H;  1YHA A;  1HA6 A;  4AIM A;  2B63 G;  4B3R L;  4KHP Q;  2IP4 A;  3KHH A;  4PWQ A;  4HCE A;  1ET6 A;  2NVX B;  3CVZ A;  2ALZ A;  1FGU A;  5ELF A;  4HYK A;  2DNE A;  3R23 A;  4JYA H;  4XIG S;  1GHJ A;  3IKJ A;  1Y1V G;  1HFG A;  3FKI B;  5FOB B;  4NB3 A;  1SYG A;  1X3P A;  3HOU B;  1Y1V A;  1GLV A;  4B3S L;  3GTJ B;  4FM9 A;  4AYB G;  5KND A;  1PX2 A;  1EY7 A;  5K5P A;  4HIO A;  1XJV A;  2ASD A;  2EJG C;  3E5S A;  1TAE A;  4AYB B;  1VMP A;  4FVM A;  1BCP F;  2G5D A;  3D4R A;  1YNX A;  4WOR A;  3SGI A;  2VQF Q;  1Z9F A;  4YCW A;  3CCE A;  4PQX A;  4DR7 Q;  5K2M A;  4ULL A;  3BA9 A;  4R4Q A;  4HNT A;  2JQO A;  2KEE A;  1ICF B;  1S5E D;  4K6L A;  1TS3 A;  4OXP A;  2MGS A;  1JWS D;  1N32 L;  1PHJ A;  1AP0 A;  1PH1 A;  1KJI A;  1HNX H;  5I47 A;  2GLT A;  3GTG A;  2UXB Q;  4HJ9 A;  4GOP B;  4RA8 A;  4UP7 A;  2VNU D;  2QK4 A;  1EYG A;  4C5A A;  2OT2 A;  4RMF A;  3MJF A;  2FXQ A;  5KYI A;  4MTD A;  2EJM A;  2NU7 B; 
#chains in the Genus database with same CATH homology
 2ZTD A;  4NXN L;  4NXM Q;  3I2Z A;  3BZC A;  2UXC Q;  1B7Y B;  2RCN A;  3M4Q A;  4LF7 Q;  2K50 A;  2HIX A;  4H02 A;  3I56 A;  2UUC Q;  2R93 H;  1Q1E A;  2ALY B;  3L7Z C;  1TXY A;  5IP9 G;  4DV0 Q;  1VS0 A;  2WFW A;  3J7Z C;  2L15 A;  1A62 A;  4DK6 C;  4R4C A;  3W1B A;  2ZTC A;  5M3M G;  2VS1 A;  1IBL L;  2Q2T A;  3RZO H;  4A3J H;  3K8A A;  4A3B G;  4EX5 A;  3UE0 A;  1XNQ L;  1PA6 A;  4X64 L;  1QVG A;  1VQ7 A;  2E2I H;  1YJ9 A;  5C4X G;  4LF8 L;  4BA1 I;  1XNR Q;  1VQO A;  3PUZ A;  4L5R C;  4DV3 L;  1Q81 C;  2RHS B;  2A19 A;  1I6H H;  1X56 A;  2AWN A;  2VY3 A;  4JI8 L;  3ZJY C;  3CCS A;  4DV5 L;  1EIY B;  2UU9 L;  1MJE A;  3OYY A;  4P71 A;  1X3E A;  1IZ6 A;  1LUZ A;  1V1Q A;  1I94 Q;  2ZM6 L;  2XGT A;  2IX1 A;  3PCO B;  3CPF A;  1HR0 W;  4YY3 Q;  2OTL A;  3NEM A;  5GAD C;  3PGZ A;  3KDF A;  4A3M H;  1YIT A;  4OWT B;  4L5S A;  4LF6 Q;  3PIP A;  2YTV A;  2HHH Q;  4LF5 Q;  1V43 A;  2NVY H;  1I5F A;  2E2H H;  4OWX B;  5IP7 H;  2E2J H;  4DPG A;  5FLM G;  2JA9 A;  5AJ3 Q;  1KQS A;  4P75 A;  3MXN B;  4DR5 L;  4IPD A;  4UP8 A;  4A3B H;  4GOP A;  1TWA H;  2NVX H;  1NMG A;  1AE2 A;  4HJ7 A;  3PF5 A;  1N34 Q;  2RF4 A;  3RNU A;  4PZ6 A;  4LF6 L;  4DR1 Q;  4A3F G;  2UUB Q;  2HT1 A;  3TEH B;  4GKK Q;  3UDF A;  1YJW A;  3I4M G;  4UPA A;  4JBK A;  2ZJQ A;  4RG1 A;  2ZM6 Q;  1FL0 A;  2R7Z G;  3CXC A;  4LFB Q;  1KD1 C;  4IO9 A;  4C3H H;  1WCM G;  3KYH C;  2QEX A;  4LW1 A;  4DV5 Q;  2IY5 B;  1VQD A;  3PV0 A;  2UXB L;  4JI0 Q;  3M85 A;  1Z47 A;  2MFI A;  2NZH A;  4JYA L;  1L1O B;  1QUQ A;  2MO0 A;  4PZ7 A;  1YJN A;  1TWG H;  2OCE A;  1XNQ Q;  5IWA L;  1N9W A;  4JV5 L;  5FLX c;  4QGU A;  5LMN Q;  1CKO A;  1Q82 C;  2Q2H A;  4IOC A;  2BH8 A;  2UXD L;  2EIF A;  2QGQ A;  1VQG A;  4DV1 Q;  3J81 c;  2GN5 A;  1PH3 A;  3L2P A;  2N8N A;  4DAY B;  4ALP A;  3H15 A;  3J81 j;  2F3I A;  4DR3 L;  3GD7 A;  4X62 L;  5IYB G;  3PIO A;  2OQK A;  1NMF A;  2EXD A;  4HJA A;  3RZD H;  2OTJ A;  1JMC A;  3J7A 5;  2KCM A;  2UXC L;  4B3S Q;  4GLX A;  2HQL A;  4JI5 L;  3CPW A;  4NXM L;  1GD7 A;  2NVQ H;  4LUV A;  4GKJ L;  3F2D A;  1HNW L;  3HOV G;  1YBY A;  2BA0 A;  2WAQ G;  3AFP A;  1PH6 A;  1EFW A;  3PUX A;  3ULP A;  4A3M G;  1H95 A;  2QA4 A;  1KC8 C;  4IPC A;  2NZO A;  3RLO A;  3JAM i;  3HFZ B;  4A3D G;  2LXJ A;  3CCM A;  3S1R H;  1XTD A;  4JOI C;  3T1Y Q;  3EBE A;  4AH6 A;  1ASY A;  5C4J H;  1IBM Q;  4DR7 L;  4QIW E;  4A93 G;  1TWC H;  1OXU A;  3U58 A;  1WI5 A;  2VQF L;  1EWI A;  4YHH L;  5C0X G;  1K9M C;  1BBU A;  3AYH B;  1YHQ A;  2JA7 H;  1J6Q A;  4A76 A;  2YU9 H;  1HNX Q;  1FJG L;  1AE3 A;  2I5M X;  4GS3 A;  4P73 A;  1XMO Q;  1E3P A;  4HJ5 A;  5K36 G;  3HKZ G;  3T1Y L;  1LTL A;  2JA8 G;  1JT8 A;  1K3R A;  3HOX G;  4DR6 Q;  4C2M H;  5E7N A;  5C0X J;  1W2B A;  3FKI G;  4B3M L;  4KI0 A;  5M5Y H;  2I0Q A;  3W1G A;  3CME A;  4A3I G;  2D62 A;  3G71 A;  1LYL A;  3G48 A;  2KHI A;  4DV4 Q;  2K52 A;  4A3I H;  3EN2 A;  4IFD G;  2NN6 I;  3B6Y A;  2B3G A;  1E22 A;  1CKM A;  2AWO A;  1VQ9 A;  4JI6 L;  1GKH A;  3G6E A;  4A3F H;  4GKJ Q;  1HNW Q;  2Q2U A;  4JI5 Q;  4B3T L;  5GAH C;  2UUA Q;  1VQI A;  4DUY Q;  1UE7 A;  2GVB A;  4WJ3 M;  3JAM c;  2JA7 G;  3RN2 A;  2Q2I A;  2F4V Q;  4HJ8 A;  2K5H A;  3HOW G;  1PVO A;  5LMU Q;  5H1S E;  3KF6 B;  4L5T A;  4DV1 L;  1XMQ Q;  3HOZ H;  1IBK Q;  4IPG A;  5C3E H;  3HOY H;  1HR0 L;  3TS2 A;  1WJJ A;  2ID0 A;  1EIF A;  1CKN A;  1B70 B;  3W5O A;  5BR8 Q;  3J80 i;  3FKI H;  3DLL A;  1GO3 E;  2K14 A;  4C3J H;  1N8R C;  1HZ9 A;  4A3G G;  2R7D A;  2JE6 I;  1MKH A;  3I4N H;  3S15 H;  3HOU H;  4GOP C;  3CCV A;  3KLW A;  4DR4 Q;  5HGQ A;  1E7Z A;  5JEA J;  3GO5 A;  4YWL A;  1A8V A;  1CKN B;  3STB D;  1X9N A;  3ULJ A;  2JEA I;  3S1N H;  3RN5 A;  1PYB A;  1BKB A;  3S14 H;  1BVS A;  1J5E L;  3ICE A;  3S17 H;  3UDG A;  2JK8 A;  3F1Z A;  4KHZ A;  3S2D H;  3F8T A;  3BJU A;  3IRB A;  4JI3 L;  1JJC B;  2CFM A;  3K7U C;  4GKK L;  2UUB L;  3ERS X;  4LWC A;  3E0E A;  3WWV A;  1PFS A;  4POG A;  4GN3 B;  5M3M H;  2OWO A;  1QVC A;  5LMN W;  4IFD I;  1Y14 B;  1O7I A;  3PF4 A;  3H3V I;  1CUK A;  1SRO A;  1NBW A;  5GAG C;  1OTC A;  4DR5 Q;  3KJP A;  2E5L L;  5IYC H;  1VQK A;  4JBM A;  1N36 Q;  2WB1 G;  4LFA L;  3HOX H;  4MZ9 A;  2K5N A;  1C0A A;  4KLK A;  1IYJ B;  1Q1B A;  1N36 L;  3LGJ A;  4K0K L;  4LFA Q;  2YYZ A;  4A3D H;  1VQF A;  4MNO A;  4P72 A;  3STB C;  1M90 C;  2E5L Q;  4JI2 L;  4DNI A;  4DR2 L;  1IXR A;  1RL2 A;  1P16 A;  4X65 Q;  4YWM A;  4YY3 L;  1YVC A;  2Y0S G;  1VQ4 A;  1UE6 A;  1BBW A;  1NJI C;  3S1Q H;  1I94 L;  1KL9 A;  1X55 A;  4A3K H;  4JI3 Q;  3VDY A;  4DV7 L;  3HOZ G;  1GVP A;  3GTJ H;  2R7Z H;  5GQO A;  3KF6 A;  4JI8 Q;  1R9T H;  2IX0 A;  3CP0 A;  1M1K C;  4UY8 C;  5JEA G;  4HIM A;  4DV3 Q;  3PO3 G;  1G6P A;  3A5U A;  1CSQ A;  4IOA A;  4A3C G;  4DR4 L;  5JJI A;  2F52 A;  1VQP A;  4GN4 B;  2WP8 J;  4DUZ L;  2JA5 G;  1U0L A;  4R1J A;  2Z6K C;  3K81 C;  2XTI A;  1Q86 C;  4O2D A;  1XPU A;  1VQJ A;  1HR0 Q;  1E1O A;  2KCT A;  4DV6 Q;  3GDE A;  1X3G A;  3I4N G;  2R7F A;  4R4I A;  2DUD A;  2UUC L;  4BBR H;  5LMU L;  3M7N A;  4OWW B;  4GNX B;  4JI1 Q;  5HY6 A;  2D0O A;  4JBW A;  1FVI A;  3KDF B;  5J3B A;  4NXN Q;  4A93 H;  2HHH L;  1C9O A;  1V9P A;  1T9H A;  1SN8 A;  3UE1 A;  5C3E G;  1JJ2 A;  4LF9 Q;  1UE5 A;  4L5Q A;  1P8L A;  4OO1 I;  2WAQ E;  4Y7N H;  2JJQ A;  4JI6 Q;  3CCL A;  2KHJ A;  3NBH B;  4LFC Q;  2VQE L;  1N33 L;  1HZB A;  1X54 A;  5DLQ E;  2JA8 H;  1KXL A;  1HZA A;  1OXT A;  1HZC A;  2EQS A;  2IT1 A;  1N32 Q;  5IYD H;  2CQO A;  3TQY A;  2Z6K A;  2AMC B;  1HNZ Q;  4JI4 L;  2CWP A;  3E9I A;  1QVF A;  3KOJ A;  1TWF H;  4OX9 Q;  4EQ5 A;  3GTG H;  1VQB A;  1EQR A;  3CC7 A;  1W3S A;  1NE3 A;  1KHI A;  2K5V A;  4JI7 Q;  4TVA B;  5M5X H;  3RR5 A;  4JI7 L;  2K4K A;  4PG3 A;  2ES2 A;  1WOC A;  4DV2 Q;  2MQH A;  3HKZ E;  4LF4 Q;  1QZH A;  4XTC S;  4IFD J;  1SFO H;  1VQA A;  1L1O A;  4JI4 Q;  4BA2 I;  3T1H L;  2B63 H;  1UE1 A;  1SMX A;  1K8G A;  2PQA B;  1NY4 A;  4GNX C;  4HIK A;  1JE5 A;  1PH7 A;  1K8A C;  4A75 A;  3CCQ A;  3GTK H;  2Z0S A;  4LFC L;  3AFQ A;  5JJL A;  1KAW A;  4NPS A;  3CC4 A;  1X6O A;  4P74 A;  3TRZ A;  4BXX G;  4KHP L;  2JA6 G;  4A4I A;  1PH9 A;  3Q8D A;  2RHQ B;  1LM0 A;  2DGY A;  3MEF A;  5IYB H;  4OO1 G;  2JA6 H;  3FHW A;  3K80 C;  4DV2 L;  1ASZ A;  5JJK A;  3CW2 C;  1K73 C;  4AYB E;  5M5W H;  1PH5 A;  4BY1 H;  1D7Q A;  2ZJP A;  1X3F A;  1SR3 A;  1DGS A;  4X62 Q;  3H3V H;  1AH9 A;  1D8L A;  1PYS B;  2BH2 A;  4TQU S;  3HOW H;  1JJG A;  1VQ5 A;  1MJC A;  3S16 H;  4OX9 L;  4FDB A;  3CCR A;  3PUW A;  1HNZ L;  3GTP H;  3EIV A;  3CC2 A;  5LMN L;  4GN5 A;  4BY7 H;  4JV5 Q;  4UP9 A;  4HID A;  1PV4 A;  3UDX A;  1X65 A;  1JB7 A;  2IHF A;  3L0O A;  4JYA Q;  2VQE Q;  3BU2 A;  1Q8K A;  2PMZ E;  2VZA A;  1VQL A;  3CQZ H;  1YI2 A;  4JI0 L;  1B8A A;  2VL6 A;  1SLJ A;  4LF9 L;  4LUZ A;  3I4M H;  4DV7 Q;  2JEB I;  4YCV A;  2E8G A;  2OQ0 A;  4BBR G;  3OTO Q;  1EQQ A;  3GTO H;  1VQE A;  4LFB L;  3CMA A;  1WYD A;  2PI2 A;  4JI1 L;  3F2B A;  4BY1 G;  4JCV E;  4QJF A;  5IP9 H;  5C0X I;  1QZG A;  3ER0 A;  3J80 c;  4X65 L;  4DR1 L;  2YV5 A;  4JI2 Q;  4DV6 L;  3U4V A;  1OXS C;  3TS0 A;  3S1M H;  1L0W A;  4K0K Q;  1N34 L;  4ME3 A;  2WB1 E;  3JC6 6;  3RLN A;  3CCU A;  4A3E G;  4PZ8 A;  3DM3 A;  4X6A H;  2R6G A;  1YIJ A;  4IPH A;  4DUZ Q;  1Y1V H;  5AJ3 L;  1VQ6 A;  1TWH H;  4LUO A;  1SRU A;  4LF5 L;  2Y0S E;  3FP9 A;  5GRO A;  1WFQ A;  3GTM H;  1KRS A;  2NN6 G;  2AKW B;  4APV A;  4GLA C;  2ZTE A;  1EOV A;  2ZJR A;  2CCZ A;  1OXV A;  5C44 G;  3KFU A;  2UU9 Q;  1NTG A;  1G51 A;  1Q12 A;  3AQQ A;  5C44 H;  3F2C A;  1OXX K;  4WJ4 A;  4GLV B;  1KIX A;  1HJP A;  1EUJ A;  2N49 A;  4DR2 Q;  3CD6 A;  5FLM H;  3A5Z B;  3NEN A;  2V1C C;  1XNR L;  4GNX A;  1YZ6 A;  3BZK A;  4LF8 Q;  2VUM H;  1I50 H;  4X64 Q;  1L1O C;  4BBS G;  2CWA A;  3D0F A;  5FJ8 H;  4A3G H;  5IE8 A;  5BR8 L;  4J15 A;  4R4O A;  1IBL Q;  1VQN A;  1MIU A;  4BBS H;  4O0A A;  2YTX A;  3PUY A;  1YHB A;  1Y1W G;  5EAY A;  1IBK L;  3A0J A;  4IJH A;  4R4T A;  1XMQ L;  1PH2 A;  4QL5 A;  5C4X H;  3KF8 B;  4DV0 L;  3M4O H;  2GVA A;  3PO2 H;  2LXK A;  3RLF A;  1PH4 A;  5M3F H;  1HH2 P;  1CSP A;  3OTO L;  1VQM A;  4LF7 L;  4IJL A;  1Q46 A;  2YTY A;  2UUA L;  2K75 A;  4B3T Q;  1J5E Q;  3E9H A;  3M3Y H;  1WCM H;  3G4S A;  2BA1 A;  1G29 1;  2H5X A;  3I55 A;  4C3I H;  3NEL A;  4MTN A;  3S24 A;  2C35 B;  2LSS A;  3OW2 A;  3AEV A;  3PSI A;  2ASB A;  1VQC A;  2PI2 E;  5IP7 G;  3GTL H;  2I5H A;  1E1T A;  5IYD G;  4B3M Q;  3PUV A;  3CAM A;  2CKZ B;  2KBN A;  1SE8 A;  4DR6 L;  1I3Q H;  4OON A;  1IL2 A;  1XMO L;  1XPO A;  1L2F A;  4JBJ A;  1HNX L;  1PH8 A;  5M3F G;  1S3O A;  3GTQ H;  2R92 H;  4QQB X;  1VQ8 A;  3HKS A;  4A3L H;  4DKA C;  4YHH Q;  5IT9 c;  2F4V L;  2R92 G;  3M9B A;  4YCU A;  1U5K A;  1K0R A;  1QUQ B;  3K7A H;  3D31 A;  2VW9 A;  4DUY L;  3HOV H;  1YHA A;  4AIM A;  4X66 L;  2B63 G;  4B3R L;  4KHP Q;  3KJO A;  4BY7 G;  5ELO A;  2R93 G;  5IY0 A;  1A0I A;  3I7F A;  3H0G G;  3HOY G;  4JC0 A;  4A3C H;  4YWK A;  4LNQ A;  3A74 A;  2IHE A;  2D0P A;  4AQY Q;  1C7Y A;  4DV4 L;  1FGU A;  1Y1W H;  3U4Z A;  1KRT A;  4PMW A;  4AQY L;  4XIG S;  4BXX H;  3T1H Q;  2MO1 A;  1Y1V G;  4DAM A;  4DK3 C;  2HIV A;  3M4P A;  4NB3 A;  4POF A;  4A3K G;  4LF4 L;  2B29 A;  4X66 Q;  4B3R Q;  3J81 i;  2AHO B;  2A8V A;  1FJG Q;  4A3L G;  4B3S L;  4AYB G;  4HIO A;  1UWV A;  1XJV A;  2ATW A;  3S2H H;  4DR3 Q;  3PO2 G;  2A1A A;  2VQF Q;  1YNX A;  2N3S A;  1VQH A;  3SGI A;  3CCJ A;  1Z9F A;  4YCW A;  3CCE A;  4DR7 Q;  4R4Q A;  1S72 A;  1IBM L;  2UXD Q;  1UEB A;  2JQO A;  4A3E H;  5IYC G;  3ULL A;  2I5L X;  5GAE C;  3CF5 A;  4OXP A;  3H0G H;  5FJ8 G;  2KEN A;  1VCI A;  5IWA Q;  4A3J G;  3PO3 H;  3HOU G;  1RIP A;  1N32 L;  2VUM G;  1PHJ A;  2PNH A;  3K0X A;  3UDI A;  2N78 A;  1XPR A;  1Q7Y C;  1PH1 A;  1N33 Q;  4JOI A;  2UXB Q;  4HJ9 A;  4GOP B;  4UP7 A;  3U50 C;  2MNA A;  1S40 A;  1EYG A;  2JA5 H;  2VNU D;  4RMF A;  1K83 H;  4QY7 A;  1GM5 A;  2FXQ A;  5ELN A;  2NVT H;  1A63 A;  4JG2 A;  2PQA A;  1YEZ A;  3I4O A;  3TRE A;  1E24 A;  4Y52 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...