2VUMG

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
171
structure length
171
Chain Sequence
MFFIKDLSLNITLHPSFFGPRMKQYLKTKLLEEVEGSCTGKFGYILCVLDYDNIDIQRGRILPTDGSAEFNVKYRAVVFKPFKGEVVDGTVVSCSQHGFEVQVGPMKVFVTKHLMPQDLTFNAGSNPPSYQSSEDVITIKSRIRVKIEGCISQVSSIHAIGSIKEDYLGAI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule tags Transferase
total genus 26
structure length 171
sequence length 171
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF00575 S1 S1 RNA binding domain
G PF03876 SHS2_Rpb7-N SHS2 domain found in N terminus of Rpb7p/Rpc25p/MJ0397
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vumG02
3.30.1490.120 Alpha Beta 2-Layer Sandwich Dna Ligase; domain 1 RNA polymerase Rpb7-like, N-terminal domain 2vumG01
4B3MQ 2EQSA 1EIFA 5IYDH 1N33L 5FJ8H 1XMQL 1KQSA 4HJAA 1XPRA 4POGA 1KC8C 3KFUA 4LWCA 4LUOA 4IPDA 3I7FA 3EIVA 1V9PA 3I56A 3U4ZA 2JA6H 3NELA 1X3FA 2LXKA 3L0OA 5FLMH 3KF6A 4KI0A 3I55A 1PH8A 4A3IG 2IX0A 2QEXA 3A5UA 3S2DH 4O2DA 2DGYA 4XTCS 3CPWA 4KHPQ 1Y1WG 4A3CH 4OO1I 2UXDL 2WP8J 2N78A 3EBEA 4L5QA 1WCMG 1U5KA 4EQ5A 1NY4A 3A0JA 4GKKL 4TVAB 4DV4L 4AQYQ 1JT8A 3CCLA 2I5LX 1FL0A 4YCUA 2VQFL 3HOZG 1GD7A 1YBYA 3H0GH 1JB7A 4PZ6A 3KF6B 2UU9L 3K7AH 3UE0A 2BA0A 3JAMi 1L2FA 4QIWE 4DR5Q 1OXVA 2NZHA 4JI4Q 1HZAA 4L5TA 1ASYA 2N49A 5BR8Q 4XIGS 2JA9A 5IYBG 3I4NH 2PI2E 1YZ6A 2N8NA 1VCIA 3PGZA 4EX5A 2QA4A 3FKIG 5H1SE 1EWIA 1S40A 5ELNA 2NVXH 3JAMc 4JI7Q 4LF6Q 4DR4L 1Y1VG 2E2HH 4WJ4A 2F52A 4YWKA 3CCSA 1CUKA 3U4VA 4JI2Q 2OQKA 4OONA 1A62A 2XTIA 5LMUL 3F2CA 3HOWH 1QUQA 5IYCG 4DV2L 2OTJA 3I4MG 4C3JH 4GLXA 4A4IA 2I5HA 3MXNB 4HJ9A 3PO3H 3TS0A 2Y0SE 1HH2P 4IPCA 5LMNL 1M1KC 1NE3A 3CMAA 2ZJRA 4A3MH 2CCZA 4JI6Q 2GVAA 1HJPA 2R7FA 4IOAA 1N9WA 4JBJA 3M4PA 3PUVA 3H3VI 3TREA 1YNXA 5AJ3Q 4JI8Q 3STBC 4JI3L 2ALYB 3OTOQ 4GN3B 1HR0Q 3CCEA 3CAMA 1U0LA 4R4OA 3PF5A 2I0QA 1X54A 4HJ7A 3M7NA 4JBWA 4DV3Q 4HJ8A 3J7A5 4HIOA 2E5LL 3S2HH 2IT1A 1SFOH 2UXBL 2ZM6Q 4HIKA 3S1QH 4A3JG 4JOIC 2R6GA 2UUAL 1JMCA 3AFQA 1HNZL 4UPAA 4R4CA 3CC7A 1EFWA 2JA8G 3S1NH 4JV5Q 1E1TA 3RLOA 1PVOA 1C7YA 1B8AA 1XTDA 3TQYA 3S1MH 1MKHA 2N3SA 4X64Q 4LFAL 2V1CC 1PH6A 1LTLA 4IJLA 1VQHA 1NMGA 3J7ZC 4DV1Q 1SE8A 3U58A 4PZ7A 3UE1A 4NXNL 2MNAA 3CPFA 2BA1A 3UDGA 1R9TH 1LYLA 3I4OA 5EAYA 4OX9Q 3HOUG 3BZCA 3JC66 3HOYH 3M4OH 2YYZA 1V43A 4DV7Q 1VQAA 1VQMA 1X3GA 2VUMG 4C3HH 4A3GH 4LFBL 2R93G 3ULPA 2R92H 3RLFA 2AHOB 4Y7NH 4DV0Q 4KLKA 4GNXA 3G48A 1A8VA 2KHIA 4ME3A 2CWAA 5FLXc 4BBRG 3PO2G 2HIVA 4AH6A 2R93H 3GTPH 1UEBA 1JJ2A 4BXXG 1YHAA 2KENA 4B3RL 3K80C 2Z0SA 4DR2L 4FDBA 2B63H 1C9OA 4YWLA 1XNQL 2JK8A 4GOPB 3GTOH 5JJKA 1GKHA 3GTJH 1FJGQ 2RHQB 3UDXA 4KHZA 3W5OA 1PA6A 1RL2A 2UUBL 4GNXB 1UE5A 4DUZQ 1A63A 3B6YA 1S3OA 3RZOH 3RNUA 3S1RH 4IO9A 1CKMA 3PSIA 1VQIA 2D62A 2ZJQA 2K5VA 2Z6KC 4A76A 2R7ZG 4K0KL 4P73A 1VQDA 3HOVG 2PI2A 4DV5L 1VQ6A 3E9IA 2WFWA 5M3FG 1ASZA 3T1HL 1VS0A 4POFA 2PQAB 3BU2A 2HHHL 4DUYL 1TWCH 5IYDG 1K73C 3I2ZA 5FJ8G 3IRBA 4A75A 4B3SL 3S17H 4IPGA 1Q82C 5IP7H 2Y0SG 1I94L 3K0XA 3J81i 4IJHA 4AYBG 1EYGA 1IBLQ 2JA6G 4A93H 1HZ9A 3OW2A 5FLMG 2K5HA 1PHJA 4APVA 2OCEA 5M5YH 2D0OA 5IWAQ 1SRUA 2VZAA 4DR1Q 1J5EQ 1PH3A 4A3CG 1YJ9A 4DR6Q 3J81c 1VQJA 1YI2A 1CKOA 1W2BA 4JBMA 4YHHL 1OXUA 4ALPA 1KIXA 1JE5A 4KHPL 4RG1A 2F4VQ 3KJPA 4X66Q 1HNWQ 3H0GG 2Q2IA 3DLLA 4LF8Q 4LF5Q 2K5NA 1KRTA 4JI5L 4LFCQ 4A3LH 2MFIA 4QGUA 3RN5A 1IBML 4YCWA 1L1OA 4LF7Q 2ZTEA 3CP0A 5M5XH 2BH8A 3S24A 2LSSA 2IHEA 1XMQQ 1PH7A 4DNIA 3I4NG 2AKWB 2JJQA 2JA7H 4DR5L 2RF4A 3W1BA 5JEAJ 1G51A 1IYJB 1Q46A 1C0AA 5BR8L 1HZBA 5IT9c 2NN6G 1GO3E 4BBSH 1L1OB 1OTCA 3HOWG 4IFDI 1HZCA 5DLQE 3M4QA 1BVSA 2E8GA 1PH5A 1OXXK 4OWWB 4GKKQ 4DR3Q 4JI2L 3PO3G 2HIXA 1X56A 2FXQA 3CMEA 3D0FA 1VQ8A 4A3MG 4DV6Q 1K83H 1PH9A 3RN2A 2YU9H 2UU9Q 4PG3A 4PZ8A 4C2MH 1PFSA 4DR7L 4X62L 1NMFA 5M3MG 3LGJA 1QZGA 4JI6L 3F2BA 1KD1C 4AYBE 3H15A 4P75A 1BKBA 4YY3L 2WB1G 2LXJA 2AWNA 4P74A 4JI8L 3K7UC 5M3MH 3OTOL 1HR0L 1Q8KA 1N32Q 2K52A 4RMFA 1V1QA 1GVPA 1X55A 2MO1A 4UP7A 3STBD 4DR4Q 1AH9A 5IP9H 3ER0A 1UE1A 1JJCB 3CQZH 3D31A 4GN5A 3UDIA 1IBKL 5LMUQ 1D8LA 2GVBA 1UE6A 3PUXA 1YHQA 4GKJQ 3GTQH 5K36G 2VY3A 2BH2A 1TWFH 1TWGH 4TQUS 4JV5L 1WYDA 1XJVA 4UP8A 4QY7A 4A3FH 4A3KH 4H02A 1KAWA 1CKNB 4X64L 1VQNA 3Q8DA 1E3PA 1I50H 5C0XJ 4QQBX 1EQRA 1VQKA 3AYHB 4NPSA 4DK3C 4DV1L 1K9MC 3HOYG 1VQ4A 1T9HA 4JI0L 3SGIA 4IPHA 1XNRQ 4HJ5A 4A3GG 3WWVA 2R92G 4OX9L 3GO5A 5GROA 1Z9FA 1VQPA 1N36Q 4NXMQ 2NVTH 3GTKH 3HKZG 5JJLA 2E5LQ 1PV4A 1I3QH 1O7IA 2UXBQ 4MZ9A 4YWMA 1MJEA 1H95A 4GOPA 4DV0L 1HNZQ 3M85A 1Y14B 5C44H 4DK6C 2R7DA 1HNXL 2B63G 2UXCL 4X6AH 2ZTDA 1EUJA 5JEAG 4LF4L 4HIMA 1E7ZA 4GOPC 3K8AA 4GN4B 1B70B 1P16A 5C4XH 1G291 5C0XI 3CXCA 2VQEQ 4GNXC 1VQ9A 1XMOL 4LUVA 1Q1EA 1Q7YC 4NXNQ 1YJWA 2PQAA 2JE6I 1FVIA 1J6QA 4P72A 1N34Q 2WB1E 3KJOA 4BY1H 3T1YL 3NBHB 2ZTCA 1RIPA 1YEZA 2H5XA 2CFMA 2Q2TA 3M3YH 1FGUA 4MNOA 4X65Q 3BJUA 3E9HA 2IX1A 3U50C 5IP7G 4LF9Q 1D7QA 1JJGA 1PH1A 1BBUA 4JI1L 2NN6I 1KL9A 1SMXA 3FHWA 4A93G 1VQOA 1Q86C 3PIPA 5C3EH 4A3DG 1OXTA 4JYAL 2IY5B 4A3BH 4PMWA 1KXLA 3M9BA 4B3ML 4BY7H 3H3VH 2UUBQ 1QVFA 5IY0A 4LNQA 4NB3A 3PIOA 5LMNW 4B3TQ 3GTGH 1SN8A 4DR1L 2NVQH 1VQLA 1IXRA 1I5FA 4DAYB 3CCMA 3A5ZB 3AFPA 5GAGC 3ICEA 4DR6L 5GQOA 4DV5Q 3KLWA 1YJNA 3CF5A 2Q2HA 1EIYB 4A3LG 2VNUD 3HKZE 3J80i 3PF4A 2Q2UA 2NVYH 3T1HQ 4UY8C 2E2JH 3F8TA 4X66L 2HHHQ 5C0XG 2F4VL 4DUYQ 2EXDA 2CKZB 1HNWL 4LF8L 1K8AC 1X65A 4B3SQ 1WI5A 1A0IA 1IZ6A 3A74A 4DKAC 4AQYL 1NBWA 2UUCQ 2JA7G 2VW9A 2K14A 5ELOA 3J80c 1TWAH 3KF8B 3S15H 1LUZA 1N33Q 3MEFA 4R4TA 4R1JA 2GN5A 4UP9A 4BBSG 1IL2A 1P8LA 1SR3A 3BZKA 3EN2A 4QJFA 1PH4A 1L1OC 3RZDH 4JI4L 3GTLH 4OWXB 4R4IA 4YHHQ 5JJIA 2C35B 1Q1BA 3KDFB 2AWOA 3HKSA 4HIDA 2RHSB 1VQGA 2F3IA 2UXDQ 2DUDA 4JI7L 2HQLA 3K81C 4LF6L 5IE8A 4Y52H 4JI5Q 4DR3L 4IOCA 4A3IH 4DV4Q 2AMCB 3NEMA 1IBMQ 3G4SA 4L5SA 4QL5A 4DV6L 2VQFQ 1Y1WH 3F2DA 4P71A 1WCMH 1I6HH 4C3IH 1WFQA 1N8RC 3CW2C 1YITA 1W3SA 4A3EG 2JA5G 3TRZA 1Q81C 4LW1A 3HOZH 2CWPA 3S16H 4JCVE 1QVGA 1VQBA 1BBWA 2OQ0A 3S14H 5IP9G 4IFDG 5GADC 2D0PA 2VL6A 1PYBA 3ERSX 1N32L 4A3EH 1OXSC 1YVCA 3GDEA 5AJ3L 2JA5H 1TWHH 2EIFA 4GS3A 1CKNA 5IYBH 4DV3L 3FKIH 1M90C 4A3FG 4A3KG 4GKJL 2ZM6L 1X6OA 2IHFA 1AE3A 4DV2Q 3FP9A 3HFZB 1Y1VH 3RLNA 4OXPA 1UWVA 5J3BA 3L2PA 2KHJA 3UDFA 1PH2A 2ID0A 5LMNQ 4DR7Q 4X62Q 1UE7A 5IYCH 1PYSB 2JEAI 1B7YB 2NZOA 4AIMA 3I4MH 1VQ7A 1AE2A 2PNHA 3PCOB 4YY3Q 4OO1G 2K4KA 3KYHC 1KHIA 1QUQB 1NTGA 2MO0A 3KOJA 1XNRL 1QVCA 4GLVB 3PUWA 4JOIA 4JI3Q 1EOVA 2XGTA 4NXML 1N36L 2WAQG 3CCUA 3VDYA 1SROA 2YTXA 5C44G 1LM0A 1XPOA 1XPUA 2JEBI 2KBNA 1IBKQ 4DV7L 1VQEA 4O0AA 1E22A 3ULJA 1VQFA 3GD7A 2KCTA 3G71A 1G6PA 4L5RC 3HOXG 2UUAQ 2PMZE 1YIJA 5C4XG 3L7ZC 3NENA 4A3JH 1Q12A 1MJCA 1CSPA 2KCMA 2RCNA 4JC0A 4LFAQ 3HOXH 2OWOA 1WJJA 1K3RA 2YTVA 5HGQA 2VQEL 2HT1A 2JA8H 4OWTB 3CCVA 4WJ3M 4BY1G 4JI0Q 2L15A 3J81j 4BA1I 1FJGL 1K0RA 5M5WH 1N34L 4DUZL 4A3DH 4JBKA 1GM5A 2ES2A 3CC2A 4DPGA 2VS1A 4JG2A 4LFBQ 3AQQA 1L0WA 3HOUH 5C4JH 1X3EA 4X65L 2K50A 2MQHA 1EQQA 2K75A 2UXCQ 1HNXQ 1DGSA 3E0EA 5C3EG 4LF9L 4DAMA 2ZJPA 1X9NA 3GTMH 1WOCA 2VUMH 3RR5A 4IFDJ 4LF4Q 3ULLA 4YCVA 4A3BG 1E24A 1VQ5A 1E1OA 1QZHA 4BY7G 2ASBA 3PV0A 5E7NA 3ZJYC 3TS2A 4BA2I 2I5MX 2JQOA 4B3RQ 4DR2Q 4MTNA 1Z47A 4BBRH 2A8VA 1XMOQ 1XNQQ 2Z6KA 1S72A 3PO2H 1CSQA 3AEVA 4LUZA 2CQOA 1IBLL 4BXXH 5GAHC 3F1ZA 4B3TL 2OTLA 4R4QA 3T1YQ 2A1AA 2YV5A 5IWAL 1K8GA 1J5EL 2A19A 4K0KQ 3CC4A 2WAQE 3PUYA 3CD6A 3CCQA 5GAEC 1KRSA 2B3GA 3PUZA 1HR0W 1VQCA 4JI1Q 2B29A 2QGQA 3DM3A 3OYYA 4J15A 3TEHB 3W1GA 3G6EA 5HY6A 3CCJA 1SLJA 3CCRA 2R7ZH 1YHBA 4LF5L 3HOVH 1TXYA 2YTYA 4LFCL 2ATWA 2UUCL 5M3FH 4GLAC 1NJIC 2E2IH 4JYAQ 1I94Q 1MIUA 4LF7L 3KDFA
chains in the Genus database with same CATH superfamily
4B3MQ 3PN1A 3OHAA 1B44D 3S9WA 1XPRA 4LWCA 3NTKA 2CQYA 2A73B 1KBLA 4O4HF 2EYFA 2JA6H 3NBIA 3KF6A 3RB3A 1WTPA 2HCIA 4KHPQ 1H9SA 1Y1WG 2N78A 2OF1A 2W6OA 4BS9A 2AUKA 4EQ5A 1NY4A 4DA2A 1EY8A 4AQYQ 2E5LH 4FYDA 3G7LA 3RZDB 3QFFA 4I4TF 2UXBH 1HUNA 3H0GH 2UUAH 2JYOA 4YP3A 5IGBA 3K7AH 4QIWE 1B2TA 4DR5Q 4I65A 4ODGA 1XXGA 4HQ6A 4A3IB 1EEID 2FLLA 4MV7A 2W9CA 2N49A 4PMBA 2VQEH 3T5KA 4FF1A 2N8NA 2NTSA 1DD2A 5EKLA 2W6PA 4NXNH 5ELNA 2AQ2B 2BOSA 4N8X1 4ZKBB 1X32A 3JAMc 4LF6Q 1LABA 2AQ4A 2E2HH 5KFLA 4WJ4A 3HOZB 1CUKA 2F0FA 2NN6H 2V4RA 2OQKA 4GC6A 2I87A 2XTIA 3S14B 4GC7A 4DV2L 1VMCA 5LHY1 4C3JH 2A69C 1FNWA 2FKLA 3MXNB 4L63B 4MN3A 1L0XB 3TS0A 2Y0SE 3J80E 1HH2P 3PO3H 1KJIA 3HS0C 3BYYB 2WKCA 3K5NA 3CMAA 2ZJRA 4A3MH 3PW7A 2CCZA 2GVAA 5KG3A 1HJPA 4B3RH 4DL6A 4JBJA 3H3VI 3Q24A 2YS6A 2EJFC 4JI8Q 2IP4A 4JI3L 1HR0Q 4RZRA 4X3UA 3OSPA 2UUBH 1BF4A 2B2YC 1U0LA 5KFWA 3G6JB 4C1NK 3M7NA 1ZYRD 2FMMA 2W57A 2FLNA 4DV3Q 4DFAA 4HJ8A 4KKTA 4HIOA 3J7A5 2IT1A 1EWHA 4HIKA 3S1QH 3BQ2A 1BR9A 4ME6A 3CC7A 2O2LD 3N43B 4OEMB 4LFAL 5K36H 4B3SH 1JC7A 1LTLA 1J9OA 2LKVA 2XWJB 1VQHA 1JB3A 3P20A 4TV8F 4ZQIA 4QWCA 4IWYA 3U58A 5KFOA 1B9NA 3ETJA 1AFPA 1DZ1A 1FR3A 2SNMA 2BA1A 5FO9B 3UDGA 1LYLA 2MP1A 1BGWA 1CQJB 3F2UA 1HFNA 4K2KA 1B3QA 2YYZA 1V43A 1GYFA 3RFCA 4J9MA 2W9BA 4TUYF 2ALZA 1S03G 3R2IA 4Y7NH 3PZPA 3PW4A 1D5MC 2L12A 3NXWA 2FMAA 3ERQA 3G48A 4IURA 4ME3A 2KHIA 4BBRG 3PO2G 2HIVA 3MXUA 2R93H 4ZI7F 1STBA 1YHAA 4G4KA 1C9OA 2D5DA 1XNQL 3EROA 3GTOH 2C9OA 1R4QB 2ATLA 1PA6A 4GNXB 2NZ1D 1UE5A 4DUZQ 1K28A 2R93B 2R85A 4QIWA 2F0UA 1II3A 2ZJQA 4A76A 5BN4A 4CBVA 1CA5A 5DQHA 3HOVG 1SEIA 1X3PA 5K5PA 5E1FA 2NVYA 3E9IA 1TA8A 3T1HL 2IL8A 5BPHA 3BU2A 2MPMA 4DUYL 1TWCH 2ASJA 4RZQA 4IPGA 5IP7H 1LTRD 2Y0SG 3K0XA 1TWAA 4IJHA 1IBLQ 4A93H 1IKMA 5CC4A 1HZ9A 2Y0SA 5FLMG 1BDOA 2R8GA 2R7ZB 4DL7A 3KALA 4DR7H 1JKJB 2VZAA 3VMMA 1J5EQ 3N40P 3QJYA 1PH3A 4A3CG 5M3FB 1VQJA 1GUOA 1CKOA 2E2DC 4ALPA 1BNCA 2F3VA 2JEGA 2FPIB 1AN8A 4RG1A 2K5NA 4JI5L 4A3LH 4OIKA 3N52A 2KEEA 4O3OA 5JPMC 2VUGA 2K5QA 2LSSA 2IHEA 1PH7A 5KFUA 4DNIA 4CC5A 2JA7H 4MHEA 3NQIA 1EYZA 5JEAJ 4RHSA 1RJTA 1IYJB 2W70A 5L1IA 3W3AA 5EKIA 4KKUA 4BBSH 4J9KA 1L1OB 5C1PA 1NR2A 1OTCA 4J9NA 1S5BD 4ZRZA 5DLQE 3OHXC 1PH5A 3D4WA 4DR3Q 2HIXA 4HMJA 1VQ8A 3GV5B 2PW7A 3CRKC 1PH9A 2YU9H 2J9GA 4DV0H 4R8IA 4PZ8A 2ICEC 2NVXB 2Z9HA 1SNCA 4LF4H 2QCPX 1NMFA 4JI6L 4AYBE 3C46A 4MV6A 4EFBA 2K5WA 2F0HA 1GGOA 4C56C 1XMOH 2AWNA 4P74A 4FP5D 3K7UC 3J81E 3OTOL 1JOKA 1F2YA 2EYHA 4QWDA 4YB8B 5BPFA 3STBD 1GVPA 4UP7A 4OELB 2F0EA 3ER0A 3CQZH 4RNNA 2GVBA 2TMPA 4XZ3B 1GSHA 2W6MA 3H4DA 2DNEA 3OSOA 2PZTA 4UP8A 4A3FH 4A3KH 4X64L 5D65A 1WTRA 1E3PA 4QQBX 1MSGA 4DV1L 4U68A 4ED2A 1SYCA 2OXPA 3SK5A 2F0KA 4C3HG 3S1NB 3PR5B 1AUVA 5IT9E 2R92G 2F0SA 4BWGB 2O4XA 5KFJA 5KFRA 4TV9F 1AP0A 2NVTH 3GTKH 3HKZG 3S1MB 4DR1H 2YRXA 2IPKD 4M8AA 4YJ3F 1H95A 3J7AF 1W93A 4DR6H 2DIKA 1F2ZA 3OUZA 1KEEA 1HHVA 1KLGD 4X6AH 1HNXL 1SSOA 4FNFA 2JSOA 3ORRA 3ORQA 3MXPA 3M4OB 5JEAG 2NVTB 1E7ZA 4ID6A 4ECVA 1B70B 5ISRA 1P16A 3BG3A 5C0XI 1G291 3CXCA 2BQ3A 1QWYA 3DWQA 4N9PA 4GNXC 1VQ9A 1B6RA 4ECSA 4HCSA 5COYA 4CHTB 2L4NA 2DWCA 2PQAA 2JE6I 3GQBA 3V05A 4FF2A 5EWFA 3A55A 3T1YL 4BY1H 1K8OA 4RCNA 1ILQA 2QF7A 3A8KE 1YEZA 3NHHA 2CFMA 1JCKB 4YQWA 3BJUA 3E9HA 3GTJB 2IX1A 1DIKA 4LF9Q 4JI1L 1LLRD 4ECTA 1SMXA 5JJZA 3H4BA 1S9FA 3HEJA 4GZYC 1OXTA 2PW5A 4CKBA 3TBIB 1QVFA 5EPKA 2KA7A 3G6YA 4NB3A 5EBCA 4B3TQ 3GTGH 1SN8A 3NWTA 4AYBA 4DAYB 3CCMA 1CS0A 2JA6A 1SJED 5GQOA 1B9MA 3N44B 2VNUD 5L9XA 2D9UA 3J80i 4FF4A 3PF4A 1N32H 3T1HQ 2F4VL 5DQIA 4X66L 1JIHA 4DUYQ 1HNWL 2FHTA 3H91A 1X65A 5M5YB 5FLXE 5KIXA 2UUCQ 1RJPA 2RA4A 4ECYA 5ELOA 3H0GA 5D3DA 5LOVF 2F0MA 3VPCA 4IZ8A 1N33Q 3VA7A 1IOWA 2ZDHA 4R4TA 2C2EA 5CBAE 4R1JA 1IHZA 3T51B 4RNMA 1L1OC 4JI4L 4YIJA 3URYA 3PIP3 1PTOD 4UCOA 3QO2A 3G8CA 4ED1A 1S0OA 1XNRH 4QUFA 3KDFB 3HKSA 5FPOA 3K5OA 2E2HA 2DUDA 3K81C 2NUCA 4Y52H 3PIO3 4JI5Q 2RGVA 4IOCA 4DV7H 2X6LA 3G4SA 5E3FA 4K6LA 1Y1WH 4IN3A 4HN7A 3VYSA 1PTOH 2EY5A 1EUCB 2ZDGA 1WFQA 2KHSA 1N8RC 3KAKA 1YITA 1W3SA 2RVLA 1EY4A 1H9SB 4HYKA 4LW1A 2CWPA 4JCVE 3SVMA 1TQOA 1BBWA 1M0WA 3I8ZA 1YNND 4IFDG 1PYBA 1PTOB 4EFEA 3GV7B 4A3EH 1YVCA 3GDEA 5AJ3L 1FJGH 3OWEB 1I4HA 4RH6A 2ASDA 4L8JA 2SOBA 1N34H 5KKNB 3K6OA 1EUDB 4RB2C 1FGBD 5KT5A 3A8IE 4RU9A 3GTQA 4GKJL 3T53B 1AE3A 2W9CB 5DG9A 3RB6A 3BVZA 2HCCA 4A3EB 5D14A 5C6AA 1EOTA 1UWVA 2K7VA 2J6TA 4MTEA 3J7AK 3UDFA 3J80L 3RBDA 4X3TA 5LMNQ 1U4PA 2JEAI 5IGDA 2NZOA 5I6WA 4DU9A 3I90A 2MO0A 1DOMA 3MR2A 5BMVF 2XRQD 4NXML 1N36L 3CCUA 1XPUA 2JEBI 2KBNA 5IWAH 1WSCA 4LSXA 4F7XA 1VQFA 2F03A 4ZKCB 3VPBA 1G6PA 2EYPA 5FKAC 3RUPA 4ZK9B 2J0TD 1YIJA 1EQTA 2J4XA 2XSCA 4MV8A 4J9QA 1A3VA 1CSPA 1MJCA 3HOXH 4LFCH 5CV9A 4ECZA 1I3QB 2YTVA 1KC7A 4OWTB 3GTOA 1PRTD 2L15A 4BA1I 2C2RA 3Q2OA 5C44B 2K33A 3K5HA 1XMQH 2FINB 2ES2A 4DPGA 2VS1A 3V6HA 4J1MA 4LFBQ 5C4XB 1L0WA 2XRSD 3N41B 2R8KA 1X3EA 4X65L 5FK9C 2K50A 3P1HA 5F9LA 1JX4A 1HNXQ 1DGSA 3E0EA 2GA4B 5C3EG 3EFXD 2ASLA 3MJFA 1WOCA 3ULLA 1TWCA 1E24A 4BY7G 2QDBA 5E7NA 4DL2A 4MAMA 4GKKH 4DV4H 1LTTD 4DR2Q 1E4EA 2F1MA 4BBRH 3R5FA 3PO2H 2Z6KA 4ZQ3A 1WTVA 2VQFH 4LSAA 1PRTB 3PW5A 1T5EA 5GAHC 2UU9H 3F1ZA 2CHBD 3K59A 3MZ5A 5BN3A 1CT1D 1K1SA 3RV4A 3T1YQ 4JUZA 2EY6A 4G3IA 3MTSA 1TT2A 4K0KQ 2WAQE 3KF8A 4QMGA 3CD6A 5GAEC 2B3GA 1WTQA 3PUZA 1Z6HA 5KT4A 2QEJC 4JI1Q 4CKCA 3G6EA 3CCJA 3TEHB 3CVZA 3CCRA 5DG8A 3HOVH 4LF5L 2YTYA 1MI2A 2TSSA 4U7CA 3NGDA 1I94Q 1CQVA 1PFBA 2NVYB 3BG5A 4HJAA 2JA7A 4RA8A 4LUOA 2WE6A 2DN8A 2ZXPA 1DOLA 4CKEA 3I7FA 3CHBD 1NCVA 4G7ZC 3EIVA 1VF7A 1EYDA 5FLMH 2OEOA 4JPBW 1TWAB 1PH8A 4DL3A 1B3AA 2IX0A 2QEXA 3S2DH 4XTCS 5DGAA 1KAAA 3CPWA 1STGA 1ENFA 1SNDA 2UXDL 2EYOA 4A3CH 2WP8J 3EBEA 1WCMG 1NSNS 4YR3A 2JEJA 3M9OB 2YU9A 3HBLA 3N6RA 1ILPA 4HR7A 3M7GA 2PPBC 3UE0A 1SJHD 1U4RA 1JWSD 1OXVA 4JI4Q 1ASYA 4L5TA 5IYBG 5BR8Q 1PYWD 2FLPA 5I2XA 2JA5A 1VCIA 3PGZA 3MXGA 4EX5A 1EL0A 1TWHA 3FKIG 1I6HB 1QB5D 3NWSA 2PMZB 1SYXB 1Y1VG 4XQQA 3NP8A 3CQZA 3MFGA 1HFGA 4JI2Q 3S16B 4OL7A 3SEBA 3C3LA 3I4MG 2NWGA 4GLXA 2RBMA 4MV9A 1A3TA 4HJ9A 4IPCA 1RTOA 2JEFA 1M1KC 5KNCA 1AZQA 4XQNA 1OWTA 3IN5A 2L0CA 1YNNC 4IZOA 4FXKC 2Z8LA 4IOAA 2NU7B 3BDLA 1S10A 3TREA 3R23A 5AJ3Q 1TY0A 4KD4A 2ALYB 4ZAIA 3CCEA 2BCOA 3CAMA 3GTKA 2YZMA 4DF7A 2HVSA 1I6UA 3S2HH 2E5LL 1TR5A 3R3OA 2UXBL 3Q23A 5KFZA 2WAQA 4JOIC 1KDBA 3SHLA 4DV5H 2UUAL 3T16A 3VPDA 4R4CA 4JV5Q 1PVOA 4I7AA 1EHIA 3EYYA 1B8AA 1XTDA 3GLKA 1VDZA 2R8IA 1S5FD 2EZVA 2EJMA 2YYAA 5KG1A 1VF5C 4NXNL 2MNAA 4K2LA 3HOUG 5C3WA 3BZCA 5G3LD 4HMIA 4A3JB 4A2BA 1N48A 1VQAA 2VUMG 2V9WA 5D1OA 4C3HH 2NBFA 2JA8B 2VQDA 2R92H 3GTMA 4KLKA 1CTMA 2VUMA 1MBYA 1A8VA 1Y8PB 1J8IA 3RB4A 1B50A 3N8DA 1IL8A 2K28A 2N88A 3GTPH 2F0OA 1PRTC 4DK0A 4B3RL 3K80C 1IBMH 3Q22A 2XC9A 5C4JB 4XXEA 3D4DA 5JEAH 1O7ZA 3UDXA 2UUBL 5C4HA 3GTGA 1S0NA 1TAEA 1B04A 3V6JA 4DR5H 4IO9A 2D62A 3EPGA 3QZ8A 1HRJA 4J9OA 4ECUA 5LA6F 2KOLA 3T5JA 1VQ6A 1ASZA 5I4DA 2PQAB 4K14A 4B3SL 3IRBA 4A75A 5IGFA 2B8FA 4YAJB 1U4MA 4DNRB 3MHBA 1SNPA 1EY7A 2EOTA 1NR4A 4IRKA 5L1JA 3RBEA 4HTHA 3J80W 1EY0A 1CHQD 5JVLA 3M4YA 2OCEA 2D0OA 3BVGA 2AGPA 2FPGB 2UVUA 4X3SA 2E2IB 4YY3H 2Q8RE 1W2BA 3I12A 1KIXA 1HR0H 1UC8A 5A2QE 1RODA 4FS1A 3V96A 1BXRA 2Q2IA 4MIUA 4LF5Q 5FLXL 2MFIA 1GSOA 1IBKH 2JXMB 4AYBB 2JA6B 1Y1WA 5KFEA 3DHQA 3RIZA 5M5XH 5LP6F 3I4NG 2AKWB 5C1OA 2RF4A 3W1BA 1G51A 1Q46A 2J6UA 1HZBA 5KFSA 4ED6A 2B8GA 4JI0H 3L3OC 3H0GB 3BVMA 2R6FA 2DPIA 4IALA 3HOWG 3K7AB 2DNCA 3M4QA 1I4GA 1BCPF 2HVQA 1BVSA 1RJQA 4OWWB 1GUNA 1EWCA 1GOZA 4QW9A 1X56A 2F4IA 2FXQA 3MFHA 1O78A 1K83H 4DV6Q 3NTIA 1B1ZA 1V51A 1ZHQA 3H20A 4DR7L 4CJ1B 4IAJA 4O3RA 2E2HB 1ZHSA 3A7AB 2K5DA 1X3QA 4P75A 2JEIA 2WB1G 2LXJA 4C3JB 1EYAA 5M3MH 1V1PA 1PLFA 2K52A 4RGNA 3PO3B 2R87A 1V1QA 1BO0A 2HUGA 4A3MB 4IFDH 1SFOA 1IYUA 1I4XA 3D31A 3UDIA 3KAJA 1D8LA 3PUXA 2EJGC 1D1KA 4IR9A 4EGQA 2CVRA 3GTQH 2VY3A 1TWFH 1TWGH 4G57A 4TQUS 5M3MB 4EEYA 4EGVA 1XJVA 3R5HA 4QY7A 2R7LA 2XGPA 3SE7A 5FO7B 3G6VA 2EYMA 3HOYG 1K9MC 1W6KA 2IW3A 3AB9A 1VQ4A 3S1QB 3SGIA 3E3XA 3N6XA 4JYAH 2A6EC 4HJ5A 4A3GG 1JOOA 4OX9L 5GROA 1Z9FA 1JORA 5FD6A 1E2VA 5HBRB 2E5LQ 1O7IA 3VR2A 2UXBQ 4YWMA 1MJEA 2C28A 3I70A 4DV0L 3T5LA 3MWYW 4TRDA 3M85A 4R9WA 2B63G 4F4WA 1RK6A 4LF4L 1Z2NX 4HIMA 1KDCA 4Q0FA 3K8AA 4GN4B 2B63A 2E74C 5L1KA 1EIHA 2VQEQ 3BA8A 1I7NA 4Y7NB 2K1BA 1SMYD 1XMOL 4LUVA 1DONA 3K3VA 4NXNQ 1YJWA 2Q8TA 5KG5A 4PWQA 4UAIA 3T56B 3OOCA 4JV2A 1J6QA 4P72A 2B2TA 4IWXA 2Z4IA 3KJOA 4WBNF 1SYDA 2H5XA 3D4RA 3M3YH 1CFMA 1FGUA 3BAAA 2PZWA 5M9OA 1QOHA 3GTOB 1XX8A 4PMCA 4WORA 2O5IC 1PH1A 1BBUA 1G6ZA 4JI7H 4IUUA 1VQOA 3K3PA 4LMQD 1IW7D 4DR3H 1SE4A 2HDMA 3PIPA 2VXWA 5C3EH 1DCZA 1GUWA 2IY5B 1KXLA 2AU0A 1VAJA 2V58A 2Q8IB 4BY7H 1M7JA 3H3VH 1CM9A 2UUBQ 4FBUA 3PIOA 2WIIB 2PO4A 4F87A 1TWCB 3PMFA 4DR1L 1Z2OX 2NVQH 1PFMA 3ICEA 3AFPA 4DR6L 2GPSA 1S97A 2SCUB 4QUCA 3KLWA 1E4EB 1PRTF 1EIYB 1O7LA 3HKZE 1PXUA 2Q2UA 4A93B 3J81W 2E2JH 4EBEA 1SDFA 1PZID 1C4QA 2G9HD 4LF8L 5NUCA 4B3SQ 1LT5D 1IZ6A 5KFCA 3Q8RB 2A6HD 1NBWA 4R7RA 4IUQA 4O2AF 2ZM6H 3H6MA 3J80c 3KF8B 1TVXA 2M00A 1LUZA 3KXYT 2VB2X 3LWEA 4UP9A 2NU6B 4IUTA 4ECWA 3EN2A 1BJTA 3GTLH 1LO5D 2X0SA 5J39A 2C35B 3SE0A 1TU2B 5IT9W 2F3IA 5JOBA 4OX9H 2HQLA 2JA7B 1HA6A 3QOLA 3FDTA 1M0TA 2AMCB 1KJJA 3I91A 1Z7TA 2XD4A 1F77A 1WCMH 5C5MA 4BBSB 4C3IH 5CBEE 4C2MA 1Z2PX 2H1EA 2QDLA 2NUAB 5EWGA 2F0QA 1U9RA 3W2DA 1K1QA 2OQ0A 5EBDA 1PX2A 5GADC 2YU9B 1ENCA 4LK1C 1N32L 2W8KA 2JA5H 1TWHH 4HR7B 3VYTA 5IYBH 2WACA 4ETSA 1HXYD 1JLLB 3FKIH 1M90C 4XX0B 1E2ZA 2F0PA 1LTID 4DV2Q 3QIAA 5ELFA 3FP9A 1Y1VH 2JA5B 3NUCA 4OXPA 4LF9H 4O3QA 5D3IB 4DR7Q 3HXLA 1I50A 3I4MH 1B7YB 2B2YA 4AIMA 5HURA 5L37A 3CQZB 1AE2A 2F0LA 2MUYA 4I55F 4M9UA 5LYJF 4IRDA 3P7JA 3KLSA 1VKZA 3KOJA 1XNRL 5J2TF 1I4PA 3KLRA 3PUWA 1R4PB 3P75A 4JI3Q 1GSAA 2FE3A 1S5ED 2AQ1B 1ZYRC 4PV1C 4A3FB 4A3KB 5HV6A 1SROA 2YTXA 1XPOA 1LM0A 4OO1H 4B3TH 4DV7L 1ZEQX 3SK8A 4O0AA 1E22A 4KTAA 2R92A 3GD7A 2W71A 3K58A 3G71A 1A2UA 3HKZA 4YR0A 2R7KA 4QF4A 4H13C 5I6YA 1QNUA 1ULZA 3GTPA 3WDNA 1E4FT 3GTKB 5KFNA 1F9PA 2PZUA 1D5ZC 4LFAQ 4LF8H 5FLXW 1L2ZA 2OWOA 5HGQA 1K3RA 4IUPA 1A2TA 3WOFA 4WJ3M 3GIDA 5T14A 2WAQB 5CA1F 4LF7H 1FJGL 2CW8A 4WJWA 3JRWA 5M5WH 5JQWA 1N33H 1N34L 1SAPA 4A3DH 3EJIA 1GM5A 3CC2A 1V4YA 1XDNA 4NKLA 4CC6A 3AQQA 3TZDA 1G2TA 3HOUH 2AQ3B 2K75A 1RJRA 2AUJD 3GP7A 1UEAB 3GTMH 4RAZA 1K8MA 4RUAA 2VUMH 2OLSA 4IFDJ 4DL5A 5FO8B 4LF4Q 2B2UC 4YCVA 1MD2D 4A3BG 3D8GA 1QZHA 1KJ8A 4BY1B 1MSHA 1SMYC 4F4YA 3OWFA 5EJWA 5D1OB 3CKIB 1XMOQ 1S72A 2XIWA 1XNQQ 4O3PA 1CSQA 3AEVA 4LUZA 4H0LC 3GTMB 2NYZD 3KBXA 1LTBD 4R4QA 4X3KA 1SXTA 2HD3A 2K05A 2YV5A 5IWAL 1K8GA 4RB0A 5KFVA 2MJ8A 2A19A 5KG4A 1DYQA 2SDFA 3CC4A 1KNEA 2QW7A 3PUYA 3CCQA 2B39A 1WH2A 2M2LA 5CAEB 2B29A 3OYYA 3W1GA 1IW7C 3GTGB 4DR4H 1CZGA 4LFCL 3EQLC 4C5BA 3BDCA 5LMUH 5CORA 1S5DD 2ZXOA 2B2VC 1XMQL 2XGQA 1KQSA 4POGA 4N8FA 3KFUA 5LMNH 3A8JE 3PW2A 5DQGA 2RDJA 1S0MA 1V9PA 3U4ZA 1V1OA 3NELA 5CV6A 3KTMA 3I4LA 2LXKA 3L0OA 3E0JA 4KI0A 4OGQC 3I55A 1D2BA 4H44C 4A3IG 3ETHA 1ET9A 3KHHA 3A5UA 1T94A 2W9AA 5A2QL 5H80A 2KJXA 3WOEA 5GONF 4L5QA 2A6HC 1K3BC 4QCLA 1HUMA 3A0JA 4OIJA 4GKKL 4DV4L 3TN2A 1K83A 2VQFL 3HOZG 4QWEA 1GD7A 4QWBA 3Q8QB 3DXJC 1ONLA 1JB7A 4UCRA 3KF6B 2UU9L 1HNZH 3RGZA 3GIIA 4I50F 2BA0A 3EA6A 1L2FA 5DEHA 2NZHA 2KEDA 2X6GA 3IFDA 4RUCA 2XVSA 5L1LA 3BZDB 1IYVA 1RYRA 4APMA 3I4NH 4XIGS 2PI2E 1YZ6A 1Y1WB 2P5ZX 3MWDA 5KYIA 2QA4A 1LTGD 1S40A 5DM63 4UFZA 1IOVA 1JICA 4MV1A 2IJ0A 5EOYA 3ZYYX 4YWKA 3LMLA 3CCSA 5JAVA 3U4VA 5FOBB 4OONA 4LFBH 4EGJA 3HOWH 2BR0A 5IYCG 1TWFA 1TWGA 1VMPA 1YNJD 3PQIA 3GIPA 5KFGA 2UVWA 3FMCA 4JI6Q 2LY7A 2W6ZA 2ZDQA 4DR2H 3M9NB 3M4PA 1HCZA 1FNUA 1YNXA 2R8HA 4N9TA 1FYCA 3STBC 3OTOQ 4ECRA 4R4OA 3K57A 1A15A 5KG2A 1E2WA 1X54A 4HJ7A 2NTTA 4JBWA 1SFOH 4K0KH 4L6TB 5KG6A 5EQ0A 4IUVA 1JMCA 1EFWA 2RCFA 2OT2A 3RLOA 4DNTB 1V1PB 2HHHH 2MHVA 1ZQ7A 1MKHA 2N3SA 4X64Q 4Q0YA 5KT6A 4O3SA 2I80A 5IODA 5A35A 3AU7A 3J7ZC 4DV1Q 4PZ7A 4I7HA 1KNAA 1R9TH 2W7PA 3JC66 3HOYH 5J2UF 5KX5F 1L0YB 2FMCA 3RB0A 3NE5B 4DV7Q 1EZ8A 3HOXB 1Q3LA 4A3GH 2R93G 3ULPA 3RLFA 3OHBA 4GNXA 4YHHH 2FK2A 3QZ7A 2CWAA 5FLXc 1JDBB 2CW0D 2BE5D 4O1NA 5KFXA 5ELEA 1JJ2A 2ZXRA 4RGTA 2B63H 2Z0SA 4YWLA 2W9BB 2JK8A 1FJGQ 4KHZA 2O5JC 3B6YA 3SDZA 1S3OA 3RZOH 2I46A 3LP8A 3S1RH 4MTKA 1BQQT 5DG7A 1VQIA 2K5VA 2R7ZG 1SE2A 5LL6X 4BBRB 2PI2A 3LWUA 4DV5L 3OUUA 3PO2B 1STEA 3KUPA 3GV6A 2RDIA 3TDQA 5M3FG 1VS0A 4POFA 1RKNA 3TIIA 5IYDG 3WO0A 3I2ZA 5FJ8G 4LAAA 4QIWB 3S17H 4JI2H 1Q82C 5I2YA 2C2DA 1HQRD 3J81i 1KTKA 4KKSA 4RB1A 3OW2A 1H9MA 4XT1B 1SYBA 3HOVB 4X62H 5CA0F 3DUZA 4F4XA 5IWAQ 1SRUA 5KG7A 3GTLA 1YJ9A 1SYGA 1EY9A 2L5TA 1OXUA 2NU8B 2Z1CA 4KHPL 2KECA 3KJPA 4X66Q 2F4VQ 5ELCA 1HNWQ 4WD3A 3DLLA 2Y0SB 1LT6D 1KRTA 4LFCQ 3RN5A 1IBML 2E75C 4UDUC 1L1OA 3CP0A 1WCMA 1ZXTA 3GIKA 3S24A 1XMQQ 3S2DB 4JV5H 4JW0A 4NLGA 4FO2A 2JJQA 4Z9CB 4DK1A 4DR5L 2R7MA 1PTOC 1C0AA 5F9NA 1RDPD 3DWPA 1GO3E 4DN4M 1AN7A 4QB4A 5CR3A 3QR8A 1CA6A 2J7ZA 2E8GA 2WINB 5KEEA 4KJNA 3H09A 4GKKQ 1SEBD 3K5IA 3FKIA 5T1IA 4E4TA 3CMEA 1NNXA 3D0FA 1B6SA 3X3MA 4XYMB 4R8NA 3I3CA 4ZYSA 1Y1VA 4UCTA 2UXCH 3MR5A 2UU9Q 4PG3A 3IG0A 4C5AA 2A69D 4C2MH 1PFSA 3MWEA 4YJ2F 3LGJA 1QZGA 5CYUA 1KD1C 3H15A 4XQJA 1BKBA 2A68D 1LTSD 4YY3L 4FS2A 2SEBD 3VR4A 2L1BA 4JI8L 2R82A 3J81L 1HR0L 4J9RA 2YS7A 3TINA 1F2MA 1AH9A 1X55A 1GLVA 1IBKL 1JJCB 1RK5A 4RNOA 1UE6A 1YHQA 4GKJQ 1FKAH 1YNJC 2BH2A 1PMRA 1STYA 5KFHA 1JDEA 1WYDA 2VB3X 4S3SA 2IA6A 4H02A 1ENAA 1JE4A 2FPPB 2EXZA 3Q8DA 2K04A 1I50H 5C0XJ 3S2HB 4DLKA 1EQRA 1VQKA 3AYHB 4NPSA 1Y8NB 4RGMA 4K8IA 2FB9A 1T9HA 4JI0L 5DGBA 2F0DA 3WWVA 4B3MH 5EWEA 5IT9L 3TQTA 3GO5A 3NK9A 5E4WC 1N36Q 4NXMQ 4UCSA 4HNUA 3VYRA 3HG9A 4NMZA 4FU0A 5KFKA 5JJLA 3JAME 1PV4A 4GOPA 4CGYB 1Y14B 1BOSA 2R7DA 4A2AA 5A2QW 4KHPH 3BA9A 4MA0A 4J0MA 3QG1A 3H94A 4B9WA 3H40A 2DPJA 4C3HB 4ZCKA 4AQYH 4IQZA 4G7HC 2R92B 2WTFA 3N42B 3HKZB 4P2CB 4FVMA 5D1PA 5F2DA 3SR1A 3L4KA 2WB1E 1WTOA 3GTPB 1F9QA 2ZTCA 1RIPA 2Q2TA 2BDNA 4X65Q 4EVOA 1GXDC 2CW0C 4OHJA 3E5NA 2BE5C 3U50C 3IAYA 5C8YF 2VOBA 3R8BA 3MEHA 1ML0D 4B08A 1JJGA 4HEDA 5IYZF 5DAUA 5KFPA 4LF6H 2NN6I 1KL9A 4MTDA 4TKOB 5KT2A 4CJ2C 2QKIC 2A74C 4JYAL 1O7YA 3HZXA 4PMWA 4A3BH 3M9BA 1GJXA 1CQIB 3TQ1A 1HTLD 1WD0A 4LNQA 3FPPA 1EY5A 1SBBB 1CI3M 2IX3A 3NQTA 3ONAB 1IXRA 1I5FA 3A54A 4DXFA 1MZBA 1FNVA 4DV5Q 4UCVA 4QWAA 2K03A 4UY8C 4JI8H 3F8TA 2L11A 5C0XG 2CKZB 4J8QA 1K8AC 1Y8OB 1I6VC 5CGKA 3A74A 4RKBA 4DKAC 4DV3H 2IMWP 1TS2A 3GV8B 1EYCA 2K14A 3L9AX 2RSNA 5KGUA 1GHKA 3LWBA 3RF2A 1IL2A 1P8LA 3BZKA 3T13A 1PH4A 4PDBA 2EYLA 1A9XA 3RZDH 4EBDA 5CV5A 1Q1BA 5M5XB 1QCBD 2AWOA 2RHSB 4K5VA 3D6CA 2UXDQ 4DL4A 4JI7L 4JVZA 1SYFA 5IE8A 2L9HA 4DR3L 4A3IH 1IBMQ 2LMCB 4XDXA 4L5SA 1NAPA 1RD9D 3F2DA 1LV9A 2XCPA 3D6WA 2F0JA 5C5LA 3Q8PB 4A3EG 3OPOA 5EGTA 4CJ0B 2OH2A 1Q81C 5E4XA 3HOZH 4JV1A 2CH4A 2HDLA 1VQBA 3V4SA 3S14H 1JR0D 5KG0A 2SNSA 5IP9G 1K83B 3ERSX 3IKJA 1OXSC 2YL2A 2EIFA 1CKNA 2WB1A 4DUZH 1DJRD 2PCFB 2FK3A 3FMAA 3ND8A 1X6OA 2IHFA 3NTHA 5IGCA 2ZM6L 2HVRA 1ZKOA 1F9SA 1PTOF 1PZJD 3KLSX 3RLNA 1Q90A 1BNZA 1T5XD 5J3BA 1PH2A 2FK1A 5IYCH 1PYSB 2A68C 4KV6A 3I73A 1VQ7A 3M9MB 4YY3Q 4WRDA 3K0YA 3GTQB 1NTGA 1TWFB 1QVCA 1TWGB 4JOIA 1R9TA 1IBLH 4ED0A 4CDDC 3VDYA 4C5CA 3GIMA 5C44G 4RFBA 1IBKQ 2EY1A 4HNTA 1I3QA 4ED7A 1GUTA 1VQEA 1J5EH 4DAVA 5J22A 4L5RC 3HOXG 2UUAQ 2PMZE 2HJWA 5C4XG 3QOJA 3C1FA 3NBHA 1Q12A 1GUSA 4JC0A 3GQCA 5EPJA 1V8QA 1I7LA 3O13A 4JI0Q 2NU9B 1GHJA 4IRCA 5EDWA 2YW2A 2XCLA 2M05A 3BABA 3RAQA 2EY2A 4FF3A 2VR1A 5C5JA 1EQQA 3BS1A 1VBHA 5KT7A 4LF9L 4DAMA 2ZJPA 2V4QA 4KN4C 3RR5A 5CB4F 1M4VA 3MR6A 1VQ5A 1E1OA 3FEWX 2ASBA 3PV0A 3ZJYC 2MCTA 3TS2A 4MA5A 4ILWA 4R8UA 4O4IF 2I5MX 2JQOA 5KFIA 4B3RQ 1Z47A 4NW2A 1UAPA 3ND9A 5DNFA 3M3YB 2E76C 3GILA 1TIID 2PN1A 3RGXA 1RF2D 3EPIA 2JN4A 2V59A 4DGZA 1EEFD 4B3TL 2OTLA 4BWSC 1SNOA 2B2WA 2A1AA 1XTCD 4MV4A 3DMUA 5C3EB 2PQEA 3RMHA 1FD7D 3RD4A 1CZWA 1KRSA 4BY7B 2GLTA 3U9OA 1HR0W 2QGQA 4J15A 2R7ZH 2BQRA 1YHBA 2ZJTA 4RB3C 1TXYA 2NVQB 2FJ2A 2UUCL 5M3FH 4GLAC 4JYAQ 1MIUA 4LF7L 4DV2H 1G8ZD 4EYHB 2EQSA 1EIFA 5IYDH 1N33L 5FJ8H 3AMUA 2EE1A 2E2JB 3TP8A 1KC8C 2G9DA 3U9SA 2EVBA 2J6SA 1ICFB 4IPDA 4YBZB 3I56A 4C1NI 3GIJA 1X3FA 4K5WA 2GPWA 4O2DA 2DGYA 1PZKD 4JI3H 2WYOA 2Z4HA 4OO1I 1UNSA 1U5KA 2YZGA 4TVAB 1JT8A 2RKSA 1MGSA 1STNA 3GTLB 3CCLA 1T36A 1VBGA 2I5LX 1FL0A 4YCUA 3RUZA 4ZHQF 2PMZA 1YBYA 4PZ6A 2IBKA 4Q8FA 2CW7A 4E6IA 5KFFA 3JAMi 4J9LA 1XYIA 2KSWA 4K8JA 4LFAH 5KT3A 4HCEA 4UHVA 1OO9B 1HZAA 1ZETA 2JA9A 3DEOA 5KFBA 1WCMB 5H1SE 1EWIA 4C3IB 2NVXH 3NPPA 4ME5A 4JI7Q 4DR4L 3WO1A 3G6XA 1N56A 1EU3A 3MR3A 2F52A 2F0TA 3SI8A 4RAYA 3Q1KA 1A62A 1AW7A 5LMUL 3F2CA 1QUQA 3D3RA 2PVPA 4XYOA 2MGSA 5IIFA 2OTJA 4A4IA 1DOKA 2I5HA 1TWHB 5LMNL 3TIGA 1NE3A 1G91A 4KY6A 4F50A 3HRZC 3DWAA 3FKIB 2R7FA 5J1ZA 4ULLA 3PVXA 1N9WA 1XNQH 3PUVA 5DLGA 3OSNA 1UC9A 1Y1VB 5ELBA 2F0IA 4GN3B 3PF5A 1WTHA 2I0QA 1C30A 4EG0A 3F8NA 2W8LA 4FM9A 3I4MB 4NP5A 1DV2A 2ZM6Q 4J9SA 2K32A 4A3JG 4XYLB 2R6GA 3KHRA 3AFQA 1B53A 4UPAA 1HNZL 2JA8G 3S1NH 1C8CA 1E1TA 3C1EA 1JXLA 3T1HH 4KD3A 1C7YA 3TQYA 4ZUJA 4U673 5I47A 3S1MH 4DUYH 4ECXA 1BUVT 1A6XA 2V1CC 2F3WA 1PH6A 1M6VA 1KLUD 4IJLA 1NMGA 1CK1A 2UUCH 1ESRA 1SE8A 2R7NA 2X69A 3UE1A 1TS3A 3CPFA 3I4OA 2PNRC 5EAYA 4OX9Q 3M4OH 1CHPD 2VPQA 2CQAA 4TSSA 4EQPA 1QJOA 4LFBL 3JAML 1X3GA 3SK6A 1VQMA 5KYLA 1CQFA 4DAPA 1S68A 4O3NA 3SXHA 3J7YW 2AHOB 4DV0Q 4FXDA 3FRPB 2R86A 1F2LA 1RCVD 4JV0A 2UVVA 5IOCA 5M5WB 4HSVA 3BJYA 1D1IA 4AH6A 4A3DB 3MFYA 1UEBA 4LMYA 1C48A 4BXXG 4JI5H 2KENA 2R8JA 1H9RA 2I07B 4EQOA 4DR2L 3T5HA 4FDBA 3HOUB 1PDQA 4GOPB 1D6EC 5JJKA 1BBXC 1GKHA 3GTJH 4G7OC 4Q8EA 1WVLA 2RHQB 3CU7A 3W5OA 4TQSA 1EIGA 1RL2A 4PNYA 2VUMB 1A63A 4I7ZC 1E4GT 1UNNC 3RNUA 3LX0A 4L1KA 2PBZA 1CKMA 3PSIA 2LFNA 2Z6KC 3H3VC 4K0KL 4UCUA 4RHRA 4CDFC 4P73A 1VQDA 5HGTA 2K01A 1EZ6A 2WFWA 4Q43A 4EEQA 2HHHL 3TSSA 1KDAA 2VPSA 1K73C 5G3LF 5JPNC 2VA2A 2E2IA 1ESFA 5JH7F 1I94L 4ABNA 4KY7A 2BQUA 4AYBG 1EYGA 2JA6G 4ED8A 3MC0B 2QYZA 1BCPD 2K5HA 2R61A 2D2CC 4APVA 5M5YH 4DR1Q 2RDFA 1PHJA 5CV4A 4JI6H 5DM73 5KNBA 2AGOA 4DR6Q 3JRXA 3J81c 3Q0AA 2C00A 1YI2A 3V2TA 3QWNA 5I9PA 4JBMA 3MA2B 4YHHL 3M4IA 1JE5A 3OTOH 2UVRA 3FPUB 2RDHA 3H0GG 4LF8Q 3BYTB 3E5SA 4RGOS 3VR5A 4QGUA 2KCCA 1GUGA 4YCWA 4LF7Q 5C0XH 2ZTEA 3DEPA 5T1GA 1WTXA 2BH8A 4ED3A 5KFAA 5KFMA 1BCPB 3BQ1A 4X64H 2EDGA 3GIQA 1B33N 3OMCA 5BR8L 4DV1H 4J6HA 1JQYD 2N55A 5IT9c 2NN6G 4M7EA 4HNVA 5KFDA 3MXNA 1SYEA 3RJ0A 2WV6D 4EBCA 1HZCA 2PYKA 4C3JG 4KHVA 4Y8VB 3FDSA 1OXXK 5K2MA 5TSSA 4JI2L 1EQVA 3PO3G 2FP4B 4TQRA 3KHLA 2FJZA 3I4NB 4A3MG 4CDCC 3A56A 3RN2A 4FXGC 2DY8A 2DJFC 5KFQA 1HNXH 1UUPA 3ITPA 5BN5A 4X62L 5M3MG 1SE3A 4XYQA 4F8MA 3F2BA 4MV3A 1B4OA 3HOWB 2KCNA 5FD5A 1N32Q 1HA5A 3E6ZX 1Q8KA 1TS5A 4RMFA 1TS4A 2MO1A 4DR4Q 5IP9H 5JVH3 1UE1A 4GN5A 1HTPA 3T1YH 1S5CD 1HPCA 5LMUQ 1E0BA 5K36G 1QE6A 2IWHA 1SNQA 2ZT9C 4JV5L 4Q44A 1C3OA 2RQXA 4NDXA 4JI1H 1Y69U 1KAWA 1CKNB 2WB1B 4O42A 1VQNA 1G2SA 3HGBA 3HP3A 1SFOB 4DK3C 3SK4A 4DXGA 2FFKB 1LT3D 1I94H 4IPHA 1DM0B 1XNRQ 5KFYA 2YCHA 3TP7A 1VQPA 3X3NA 3C0FB 1QILA 3OIPA 1I3QH 4MZ9A 2L55A 1PK8A 1LACA 3R2TA 2C5CA 1HNZQ 2UXCL 4LJZC 4DK6C 5C44H 1R9TB 2ZTDA 5LL6b 2F4VH 1EUJA 4X66H 2R93A 3HOYB 1HNWH 4Q45A 5EPLA 1RTNA 1F9RA 4GOPC 5JUMA 3HB9A 4A3GB 1STHA 5C4XH 2RGRA 2BDOA 3QB3A 3K5LA 1W96A 3MFIA 4K6DA 1Q1EA 1Q7YC 2XIGA 1ICWA 1FVIA 1QNKA 1XWEA 1N34Q 4M1UB 4HSPA 1M8AA 3Q6SA 4EQNA 1TKWB 2R3ZA 2RDGA 4U6PA 1RYSA 1EY6A 3NBHB 2B2UA 4LH6A 1Q8IA 1IKLA 4JI4H 2B63B 5LL6S 4MNOA 5BR8H 5C3XA 3J7AV 2JP1A 5IP7G 1D7QA 1DXMA 2M9VA 2R7ZA 3R93A 2QILA 1JOQA 3JSLA 1A3UA 2KVMA 3FHWA 2KUMA 3RZOB 4ZUIA 3S1RB 1Q86C 2EYJA 4A93G 3KHGA 5KFTA 3C2PA 3I72A 3JZIA 2ENBA 4B3ML 3TP6A 2P0AA 5IY0A 3IL8A 5LMNW 5IGEA 1WR2A 3UI2A 3FVQA 1VQLA 3S17B 3A5ZB 4R8UB 5GAGC 3IFTA 1YJNA 4J9PA 3A7LA 2Q2HA 3CF5A 4A3LG 1TY2A 4V190 4O4LF 1T3NA 2NVYH 2B2VA 2HHHQ 2EXDA 3RTXA 4V0BA 1WI5A 3TP5A 3DM1A 3RAXA 1A0IA 2W6NA 4CDEC 2DJGC 4AQYL 3DF7A 4HAEA 2JA7G 2EPBA 1S4ZA 3EVQA 2VW9A 1WTWA 4GKJH 3R5XA 1TWAH 1BCPC 1CE8A 2WDTA 3S15H 3JSNA 3MEFA 5CV7A 3MWMA 3L4JA 2GN5A 4BBSG 5I9OA 1SR3A 4QJFA 1KJQA 4F4ZA 4EYIB 4OWXB 4R4IA 2NB0A 3KBGA 1EZ1A 4YHHQ 4F88A 1QG7A 5JJIA 3S15B 2QK4A 2NVXA 4HIDA 4KJOA 1VQGA 4NXMH 3LNNA 3KK7A 1RHPA 1AEXA 1U4LA 1STAA 4C3IG 1PFNA 4WFN3 4LF6L 3UQ8A 2V4DA 3MVVA 3PW0A 3MAQA 3NEMA 4DV4Q 3JAMW 3PR4A 2A5HA 4QL5A 3VR6A 2VQFQ 4DV6L 4P71A 1EFID 1I6HH 3CRLC 4K5XA 1EU4A 2KQ3A 3CW2C 1WD1A 2DLNA 2JA5G 3VR3A 3TRZA 2WKDA 3S16H 3TZUA 5JVG3 1QVGA 1JWUD 2CH4W 2G5DA 3TMEA 1I4RA 2YRWA 4PQXA 2D0PA 2VL6A 3BQ0A 5KNDA 3V4ZA 2W6QA 2I8CA 3U9TA 1I4QA 4GS3A 3VYUA 4C2MB 5CMDA 3T4AC 3UFXB 2Z6BA 4H7BA 4DV3L 2F0GA 4A3FG 1LTAD 4A3KG 2YZNA 1D5XC 2V5AA 2DZDA 4X65H 1O80A 3HFZB 5C4ZA 3NSWA 5KRUA 3L2PA 2KHJA 2ID0A 4ECQA 4X62Q 1UE7A 2PNHA 1BXTA 3PCOB 3K5MA 4OO1G 2HQEA 2K4KA 1KHIA 1QUQB 3KYHC 1K0SA 4GLVB 4IR1A 2A6ED 1EOVA 1H9KA 2XGTA 2WAQG 4O2BF 3VA5A 4FBTA 1I50B 4RWSC 3ULJA 4KY5A 2KCTA 4XT3B 2R84A 4KK7A 4RCOA 1H9JA 3GV3A 3L7ZC 1N36H 3NENA 4ZOLF 4A3JH 2F0VA 2KCMA 2RCNA 4LF5H 2HT1A 1WJJA 2JA8H 4A3DG 2VQEL 5DLFA 4KN7C 3CCVA 2RSOA 4BY1G 3GTJA 3OW7A 3J81j 4B9XA 1K0RA 5AFWA 5LXTF 4DUZL 4IHJF 4JBKA 3WNZA 2XCAA 4JG2A 2F0NA 2VA3A 3OIQA 2F0WA 5C4JH 1ET6A 4RAUC 2DY7A 2MQHA 4JK1C 2O03A 1DV1A 2UXCQ 2B2TC 2XN9C 4IUNA 1NUCA 1X9NA 1O75A 2W7OA 3V6KA 2H4OA 2UXDH 1SNMA 3RV3A 4RKLA 4DAYA 2HGSA 4YR2A 3Q8SB 4BA2I 1HQMC 4Q5VA 4MTNA 5EKKA 2A8VA 4YAKB 4DV6H 2LS01 5ELDA 2AGQA 1AUXA 2CQOA 1IBLL 4BXXH 2XNAC 1MHWC 1JWMD 2CZGA 1AZPA 3OMGA 1J5EL 4LH7A 1LT4D 4A3BB 1SCUB 4KMUC 4ZLTF 1KJ9A 1VQCA 2B2WC 2C22A 5EZYF 2XWBB 3DM3A 4IFDI 1W6JA 5HY6A 4QW8A 1SLJA 2K6AA 3BDOA 5CV8A 2ICIA 5D8DA 2ATWA 1KABA 5IGGA 1NJIC 2E2IH 5JVDF 3KDFA 5FPRA
chains in the Genus database with same CATH topology
4B3MQ 2EQSA 1EIFA 5IYDH 1N33L 5FJ8H 1XMQL 1KQSA 4HJAA 1XPRA 4POGA 1KC8C 3KFUA 4LWCA 4LUOA 4IPDA 3I7FA 3EIVA 1V9PA 3I56A 3U4ZA 2JA6H 3NELA 1X3FA 2LXKA 3L0OA 5FLMH 3KF6A 4KI0A 3I55A 1PH8A 4A3IG 2IX0A 2QEXA 3A5UA 3S2DH 4O2DA 2DGYA 4XTCS 3CPWA 4KHPQ 1Y1WG 4A3CH 4OO1I 2UXDL 2WP8J 2N78A 3EBEA 4L5QA 1WCMG 1U5KA 4EQ5A 1NY4A 3A0JA 4GKKL 4TVAB 4DV4L 4AQYQ 1JT8A 3CCLA 2I5LX 1FL0A 4YCUA 2VQFL 3HOZG 1GD7A 1YBYA 3H0GH 1JB7A 4PZ6A 3KF6B 2UU9L 3K7AH 3UE0A 2BA0A 3JAMi 1L2FA 4QIWE 4DR5Q 1OXVA 2NZHA 4JI4Q 1HZAA 4L5TA 1ASYA 2N49A 5BR8Q 4XIGS 2JA9A 5IYBG 3I4NH 2PI2E 1YZ6A 2N8NA 1VCIA 3PGZA 4EX5A 2QA4A 3FKIG 5H1SE 1EWIA 1S40A 5ELNA 2NVXH 3JAMc 4JI7Q 4LF6Q 4DR4L 1Y1VG 2E2HH 4WJ4A 2F52A 4YWKA 3CCSA 1CUKA 3U4VA 4JI2Q 2OQKA 4OONA 1A62A 2XTIA 5LMUL 3F2CA 3HOWH 1QUQA 5IYCG 4DV2L 2OTJA 3I4MG 4C3JH 4GLXA 4A4IA 2I5HA 3MXNB 4HJ9A 3PO3H 3TS0A 2Y0SE 1HH2P 4IPCA 5LMNL 1M1KC 1NE3A 3CMAA 2ZJRA 4A3MH 2CCZA 4JI6Q 2GVAA 1HJPA 2R7FA 4IOAA 1N9WA 4JBJA 3M4PA 3PUVA 3H3VI 3TREA 1YNXA 5AJ3Q 4JI8Q 3STBC 4JI3L 2ALYB 3OTOQ 4GN3B 1HR0Q 3CCEA 3CAMA 1U0LA 4R4OA 3PF5A 2I0QA 1X54A 4HJ7A 3M7NA 4JBWA 4DV3Q 4HJ8A 3J7A5 4HIOA 2E5LL 3S2HH 2IT1A 1SFOH 2UXBL 2ZM6Q 4HIKA 3S1QH 4A3JG 4JOIC 2R6GA 2UUAL 1JMCA 3AFQA 1HNZL 4UPAA 4R4CA 3CC7A 1EFWA 2JA8G 3S1NH 4JV5Q 1E1TA 3RLOA 1PVOA 1C7YA 1B8AA 1XTDA 3TQYA 3S1MH 1MKHA 2N3SA 4X64Q 4LFAL 2V1CC 1PH6A 1LTLA 4IJLA 1VQHA 1NMGA 3J7ZC 4DV1Q 1SE8A 3U58A 4PZ7A 3UE1A 4NXNL 2MNAA 3CPFA 2BA1A 3UDGA 1R9TH 1LYLA 3I4OA 5EAYA 4OX9Q 3HOUG 3BZCA 3JC66 3HOYH 3M4OH 2YYZA 1V43A 4DV7Q 1VQAA 1VQMA 1X3GA 2VUMG 4C3HH 4A3GH 4LFBL 2R93G 3ULPA 2R92H 3RLFA 2AHOB 4Y7NH 4DV0Q 4KLKA 4GNXA 3G48A 1A8VA 2KHIA 4ME3A 2CWAA 5FLXc 4BBRG 3PO2G 2HIVA 4AH6A 2R93H 3GTPH 1UEBA 1JJ2A 4BXXG 1YHAA 2KENA 4B3RL 3K80C 2Z0SA 4DR2L 4FDBA 2B63H 1C9OA 4YWLA 1XNQL 2JK8A 4GOPB 3GTOH 5JJKA 1GKHA 3GTJH 1FJGQ 2RHQB 3UDXA 4KHZA 3W5OA 1PA6A 1RL2A 2UUBL 4GNXB 1UE5A 4DUZQ 1A63A 3B6YA 1S3OA 3RZOH 3RNUA 3S1RH 4IO9A 1CKMA 3PSIA 1VQIA 2D62A 2ZJQA 2K5VA 2Z6KC 4A76A 2R7ZG 4K0KL 4P73A 1VQDA 3HOVG 2PI2A 4DV5L 1VQ6A 3E9IA 2WFWA 5M3FG 1ASZA 3T1HL 1VS0A 4POFA 2PQAB 3BU2A 2HHHL 4DUYL 1TWCH 5IYDG 1K73C 3I2ZA 5FJ8G 3IRBA 4A75A 4B3SL 3S17H 4IPGA 1Q82C 5IP7H 2Y0SG 1I94L 3K0XA 3J81i 4IJHA 4AYBG 1EYGA 1IBLQ 2JA6G 4A93H 1HZ9A 3OW2A 5FLMG 2K5HA 1PHJA 4APVA 2OCEA 5M5YH 2D0OA 5IWAQ 1SRUA 2VZAA 4DR1Q 1J5EQ 1PH3A 4A3CG 1YJ9A 4DR6Q 3J81c 1VQJA 1YI2A 1CKOA 1W2BA 4JBMA 4YHHL 1OXUA 4ALPA 1KIXA 1JE5A 4KHPL 4RG1A 2F4VQ 3KJPA 4X66Q 1HNWQ 3H0GG 2Q2IA 3DLLA 4LF8Q 4LF5Q 2K5NA 1KRTA 4JI5L 4LFCQ 4A3LH 2MFIA 4QGUA 3RN5A 1IBML 4YCWA 1L1OA 4LF7Q 2ZTEA 3CP0A 5M5XH 2BH8A 3S24A 2LSSA 2IHEA 1XMQQ 1PH7A 4DNIA 3I4NG 2AKWB 2JJQA 2JA7H 4DR5L 2RF4A 3W1BA 5JEAJ 1G51A 1IYJB 1Q46A 1C0AA 5BR8L 1HZBA 5IT9c 2NN6G 1GO3E 4BBSH 1L1OB 1OTCA 3HOWG 4IFDI 1HZCA 5DLQE 3M4QA 1BVSA 2E8GA 1PH5A 1OXXK 4OWWB 4GKKQ 4DR3Q 4JI2L 3PO3G 2HIXA 1X56A 2FXQA 3CMEA 3D0FA 1VQ8A 4A3MG 4DV6Q 1K83H 1PH9A 3RN2A 2YU9H 2UU9Q 4PG3A 4PZ8A 4C2MH 1PFSA 4DR7L 4X62L 1NMFA 5M3MG 3LGJA 1QZGA 4JI6L 3F2BA 1KD1C 4AYBE 3H15A 4P75A 1BKBA 4YY3L 2WB1G 2LXJA 2AWNA 4P74A 4JI8L 3K7UC 5M3MH 3OTOL 1HR0L 1Q8KA 1N32Q 2K52A 4RMFA 1V1QA 1GVPA 1X55A 2MO1A 4UP7A 3STBD 4DR4Q 1AH9A 5IP9H 3ER0A 1UE1A 1JJCB 3CQZH 3D31A 4GN5A 3UDIA 1IBKL 5LMUQ 1D8LA 2GVBA 1UE6A 3PUXA 1YHQA 4GKJQ 3GTQH 5K36G 2VY3A 2BH2A 1TWFH 1TWGH 4TQUS 4JV5L 1WYDA 1XJVA 4UP8A 4QY7A 4A3FH 4A3KH 4H02A 1KAWA 1CKNB 4X64L 1VQNA 3Q8DA 1E3PA 1I50H 5C0XJ 4QQBX 1EQRA 1VQKA 3AYHB 4NPSA 4DK3C 4DV1L 1K9MC 3HOYG 1VQ4A 1T9HA 4JI0L 3SGIA 4IPHA 1XNRQ 4HJ5A 4A3GG 3WWVA 2R92G 4OX9L 3GO5A 5GROA 1Z9FA 1VQPA 1N36Q 4NXMQ 2NVTH 3GTKH 3HKZG 5JJLA 2E5LQ 1PV4A 1I3QH 1O7IA 2UXBQ 4MZ9A 4YWMA 1MJEA 1H95A 4GOPA 4DV0L 1HNZQ 3M85A 1Y14B 5C44H 4DK6C 2R7DA 1HNXL 2B63G 2UXCL 4X6AH 2ZTDA 1EUJA 5JEAG 4LF4L 4HIMA 1E7ZA 4GOPC 3K8AA 4GN4B 1B70B 1P16A 5C4XH 1G291 5C0XI 3CXCA 2VQEQ 4GNXC 1VQ9A 1XMOL 4LUVA 1Q1EA 1Q7YC 4NXNQ 1YJWA 2PQAA 2JE6I 1FVIA 1J6QA 4P72A 1N34Q 2WB1E 3KJOA 4BY1H 3T1YL 3NBHB 2ZTCA 1RIPA 1YEZA 2H5XA 2CFMA 2Q2TA 3M3YH 1FGUA 4MNOA 4X65Q 3BJUA 3E9HA 2IX1A 3U50C 5IP7G 4LF9Q 1D7QA 1JJGA 1PH1A 1BBUA 4JI1L 2NN6I 1KL9A 1SMXA 3FHWA 4A93G 1VQOA 1Q86C 3PIPA 5C3EH 4A3DG 1OXTA 4JYAL 2IY5B 4A3BH 4PMWA 1KXLA 3M9BA 4B3ML 4BY7H 3H3VH 2UUBQ 1QVFA 5IY0A 4LNQA 4NB3A 3PIOA 5LMNW 4B3TQ 3GTGH 1SN8A 4DR1L 2NVQH 1VQLA 1IXRA 1I5FA 4DAYB 3CCMA 3A5ZB 3AFPA 5GAGC 3ICEA 4DR6L 5GQOA 4DV5Q 3KLWA 1YJNA 3CF5A 2Q2HA 1EIYB 4A3LG 2VNUD 3HKZE 3J80i 3PF4A 2Q2UA 2NVYH 3T1HQ 4UY8C 2E2JH 3F8TA 4X66L 2HHHQ 5C0XG 2F4VL 4DUYQ 2EXDA 2CKZB 1HNWL 4LF8L 1K8AC 1X65A 4B3SQ 1WI5A 1A0IA 1IZ6A 3A74A 4DKAC 4AQYL 1NBWA 2UUCQ 2JA7G 2VW9A 2K14A 5ELOA 3J80c 1TWAH 3KF8B 3S15H 1LUZA 1N33Q 3MEFA 4R4TA 4R1JA 2GN5A 4UP9A 4BBSG 1IL2A 1P8LA 1SR3A 3BZKA 3EN2A 4QJFA 1PH4A 1L1OC 3RZDH 4JI4L 3GTLH 4OWXB 4R4IA 4YHHQ 5JJIA 2C35B 1Q1BA 3KDFB 2AWOA 3HKSA 4HIDA 2RHSB 1VQGA 2F3IA 2UXDQ 2DUDA 4JI7L 2HQLA 3K81C 4LF6L 5IE8A 4Y52H 4JI5Q 4DR3L 4IOCA 4A3IH 4DV4Q 2AMCB 3NEMA 1IBMQ 3G4SA 4L5SA 4QL5A 4DV6L 2VQFQ 1Y1WH 3F2DA 4P71A 1WCMH 1I6HH 4C3IH 1WFQA 1N8RC 3CW2C 1YITA 1W3SA 4A3EG 2JA5G 3TRZA 1Q81C 4LW1A 3HOZH 2CWPA 3S16H 4JCVE 1QVGA 1VQBA 1BBWA 2OQ0A 3S14H 5IP9G 4IFDG 5GADC 2D0PA 2VL6A 1PYBA 3ERSX 1N32L 4A3EH 1OXSC 1YVCA 3GDEA 5AJ3L 2JA5H 1TWHH 2EIFA 4GS3A 1CKNA 5IYBH 4DV3L 3FKIH 1M90C 4A3FG 4A3KG 4GKJL 2ZM6L 1X6OA 2IHFA 1AE3A 4DV2Q 3FP9A 3HFZB 1Y1VH 3RLNA 4OXPA 1UWVA 5J3BA 3L2PA 2KHJA 3UDFA 1PH2A 2ID0A 5LMNQ 4DR7Q 4X62Q 1UE7A 5IYCH 1PYSB 2JEAI 1B7YB 2NZOA 4AIMA 3I4MH 1VQ7A 1AE2A 2PNHA 3PCOB 4YY3Q 4OO1G 2K4KA 3KYHC 1KHIA 1QUQB 1NTGA 2MO0A 3KOJA 1XNRL 1QVCA 4GLVB 3PUWA 4JOIA 4JI3Q 1EOVA 2XGTA 4NXML 1N36L 2WAQG 3CCUA 3VDYA 1SROA 2YTXA 5C44G 1LM0A 1XPOA 1XPUA 2JEBI 2KBNA 1IBKQ 4DV7L 1VQEA 4O0AA 1E22A 3ULJA 1VQFA 3GD7A 2KCTA 3G71A 1G6PA 4L5RC 3HOXG 2UUAQ 2PMZE 1YIJA 5C4XG 3L7ZC 3NENA 4A3JH 1Q12A 1MJCA 1CSPA 2KCMA 2RCNA 4JC0A 4LFAQ 3HOXH 2OWOA 1WJJA 1K3RA 2YTVA 5HGQA 2VQEL 2HT1A 2JA8H 4OWTB 3CCVA 4WJ3M 4BY1G 4JI0Q 2L15A 3J81j 4BA1I 1FJGL 1K0RA 5M5WH 1N34L 4DUZL 4A3DH 4JBKA 1GM5A 2ES2A 3CC2A 4DPGA 2VS1A 4JG2A 4LFBQ 3AQQA 1L0WA 3HOUH 5C4JH 1X3EA 4X65L 2K50A 2MQHA 1EQQA 2K75A 2UXCQ 1HNXQ 1DGSA 3E0EA 5C3EG 4LF9L 4DAMA 2ZJPA 1X9NA 3GTMH 1WOCA 2VUMH 3RR5A 4IFDJ 4LF4Q 3ULLA 4YCVA 4A3BG 1E24A 1VQ5A 1E1OA 1QZHA 4BY7G 2ASBA 3PV0A 5E7NA 3ZJYC 3TS2A 4BA2I 2I5MX 2JQOA 4B3RQ 4DR2Q 4MTNA 1Z47A 4BBRH 2A8VA 1XMOQ 1XNQQ 2Z6KA 1S72A 3PO2H 1CSQA 3AEVA 4LUZA 2CQOA 1IBLL 4BXXH 5GAHC 3F1ZA 4B3TL 2OTLA 4R4QA 3T1YQ 2A1AA 2YV5A 5IWAL 1K8GA 1J5EL 2A19A 4K0KQ 3CC4A 2WAQE 3PUYA 3CD6A 3CCQA 5GAEC 1KRSA 2B3GA 3PUZA 1HR0W 1VQCA 4JI1Q 2B29A 2QGQA 3DM3A 3OYYA 4J15A 3TEHB 3W1GA 3G6EA 5HY6A 3CCJA 1SLJA 3CCRA 2R7ZH 1YHBA 4LF5L 3HOVH 1TXYA 2YTYA 4LFCL 2ATWA 2UUCL 5M3FH 4GLAC 1NJIC 2E2IH 4JYAQ 1I94Q 1MIUA 4LF7L 3KDFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4B3M Q;  2EQS A;  1EIF A;  5IYD H;  1N33 L;  5FJ8 H;  1XMQ L;  1KQS A;  4HJA A;  1XPR A;  4POG A;  1KC8 C;  3KFU A;  4LWC A;  4LUO A;  4IPD A;  3I7F A;  3EIV A;  1V9P A;  3I56 A;  3U4Z A;  2JA6 H;  3NEL A;  1X3F A;  2LXK A;  3L0O A;  5FLM H;  3KF6 A;  4KI0 A;  3I55 A;  1PH8 A;  4A3I G;  2IX0 A;  2QEX A;  3A5U A;  3S2D H;  4O2D A;  2DGY A;  4XTC S;  3CPW A;  4KHP Q;  1Y1W G;  4A3C H;  4OO1 I;  2UXD L;  2WP8 J;  2N78 A;  3EBE A;  4L5Q A;  1WCM G;  1U5K A;  4EQ5 A;  1NY4 A;  3A0J A;  4GKK L;  4TVA B;  4DV4 L;  4AQY Q;  1JT8 A;  3CCL A;  2I5L X;  1FL0 A;  4YCU A;  2VQF L;  3HOZ G;  1GD7 A;  1YBY A;  3H0G H;  1JB7 A;  4PZ6 A;  3KF6 B;  2UU9 L;  3K7A H;  3UE0 A;  2BA0 A;  3JAM i;  1L2F A;  4QIW E;  4DR5 Q;  1OXV A;  2NZH A;  4JI4 Q;  1HZA A;  4L5T A;  1ASY A;  2N49 A;  5BR8 Q;  4XIG S;  2JA9 A;  5IYB G;  3I4N H;  2PI2 E;  1YZ6 A;  2N8N A;  1VCI A;  3PGZ A;  4EX5 A;  2QA4 A;  3FKI G;  5H1S E;  1EWI A;  1S40 A;  5ELN A;  2NVX H;  3JAM c;  4JI7 Q;  4LF6 Q;  4DR4 L;  1Y1V G;  2E2H H;  4WJ4 A;  2F52 A;  4YWK A;  3CCS A;  1CUK A;  3U4V A;  4JI2 Q;  2OQK A;  4OON A;  1A62 A;  2XTI A;  5LMU L;  3F2C A;  3HOW H;  1QUQ A;  5IYC G;  4DV2 L;  2OTJ A;  3I4M G;  4C3J H;  4GLX A;  4A4I A;  2I5H A;  3MXN B;  4HJ9 A;  3PO3 H;  3TS0 A;  2Y0S E;  1HH2 P;  4IPC A;  5LMN L;  1M1K C;  1NE3 A;  3CMA A;  2ZJR A;  4A3M H;  2CCZ A;  4JI6 Q;  2GVA A;  1HJP A;  2R7F A;  4IOA A;  1N9W A;  4JBJ A;  3M4P A;  3PUV A;  3H3V I;  3TRE A;  1YNX A;  5AJ3 Q;  4JI8 Q;  3STB C;  4JI3 L;  2ALY B;  3OTO Q;  4GN3 B;  1HR0 Q;  3CCE A;  3CAM A;  1U0L A;  4R4O A;  3PF5 A;  2I0Q A;  1X54 A;  4HJ7 A;  3M7N A;  4JBW A;  4DV3 Q;  4HJ8 A;  3J7A 5;  4HIO A;  2E5L L;  3S2H H;  2IT1 A;  1SFO H;  2UXB L;  2ZM6 Q;  4HIK A;  3S1Q H;  4A3J G;  4JOI C;  2R6G A;  2UUA L;  1JMC A;  3AFQ A;  1HNZ L;  4UPA A;  4R4C A;  3CC7 A;  1EFW A;  2JA8 G;  3S1N H;  4JV5 Q;  1E1T A;  3RLO A;  1PVO A;  1C7Y A;  1B8A A;  1XTD A;  3TQY A;  3S1M H;  1MKH A;  2N3S A;  4X64 Q;  4LFA L;  2V1C C;  1PH6 A;  1LTL A;  4IJL A;  1VQH A;  1NMG A;  3J7Z C;  4DV1 Q;  1SE8 A;  3U58 A;  4PZ7 A;  3UE1 A;  4NXN L;  2MNA A;  3CPF A;  2BA1 A;  3UDG A;  1R9T H;  1LYL A;  3I4O A;  5EAY A;  4OX9 Q;  3HOU G;  3BZC A;  3JC6 6;  3HOY H;  3M4O H;  2YYZ A;  1V43 A;  4DV7 Q;  1VQA A;  1VQM A;  1X3G A;  2VUM G;  4C3H H;  4A3G H;  4LFB L;  2R93 G;  3ULP A;  2R92 H;  3RLF A;  2AHO B;  4Y7N H;  4DV0 Q;  4KLK A;  4GNX A;  3G48 A;  1A8V A;  2KHI A;  4ME3 A;  2CWA A;  5FLX c;  4BBR G;  3PO2 G;  2HIV A;  4AH6 A;  2R93 H;  3GTP H;  1UEB A;  1JJ2 A;  4BXX G;  1YHA A;  2KEN A;  4B3R L;  3K80 C;  2Z0S A;  4DR2 L;  4FDB A;  2B63 H;  1C9O A;  4YWL A;  1XNQ L;  2JK8 A;  4GOP B;  3GTO H;  5JJK A;  1GKH A;  3GTJ H;  1FJG Q;  2RHQ B;  3UDX A;  4KHZ A;  3W5O A;  1PA6 A;  1RL2 A;  2UUB L;  4GNX B;  1UE5 A;  4DUZ Q;  1A63 A;  3B6Y A;  1S3O A;  3RZO H;  3RNU A;  3S1R H;  4IO9 A;  1CKM A;  3PSI A;  1VQI A;  2D62 A;  2ZJQ A;  2K5V A;  2Z6K C;  4A76 A;  2R7Z G;  4K0K L;  4P73 A;  1VQD A;  3HOV G;  2PI2 A;  4DV5 L;  1VQ6 A;  3E9I A;  2WFW A;  5M3F G;  1ASZ A;  3T1H L;  1VS0 A;  4POF A;  2PQA B;  3BU2 A;  2HHH L;  4DUY L;  1TWC H;  5IYD G;  1K73 C;  3I2Z A;  5FJ8 G;  3IRB A;  4A75 A;  4B3S L;  3S17 H;  4IPG A;  1Q82 C;  5IP7 H;  2Y0S G;  1I94 L;  3K0X A;  3J81 i;  4IJH A;  4AYB G;  1EYG A;  1IBL Q;  2JA6 G;  4A93 H;  1HZ9 A;  3OW2 A;  5FLM G;  2K5H A;  1PHJ A;  4APV A;  2OCE A;  5M5Y H;  2D0O A;  5IWA Q;  1SRU A;  2VZA A;  4DR1 Q;  1J5E Q;  1PH3 A;  4A3C G;  1YJ9 A;  4DR6 Q;  3J81 c;  1VQJ A;  1YI2 A;  1CKO A;  1W2B A;  4JBM A;  4YHH L;  1OXU A;  4ALP A;  1KIX A;  1JE5 A;  4KHP L;  4RG1 A;  2F4V Q;  3KJP A;  4X66 Q;  1HNW Q;  3H0G G;  2Q2I A;  3DLL A;  4LF8 Q;  4LF5 Q;  2K5N A;  1KRT A;  4JI5 L;  4LFC Q;  4A3L H;  2MFI A;  4QGU A;  3RN5 A;  1IBM L;  4YCW A;  1L1O A;  4LF7 Q;  2ZTE A;  3CP0 A;  5M5X H;  2BH8 A;  3S24 A;  2LSS A;  2IHE A;  1XMQ Q;  1PH7 A;  4DNI A;  3I4N G;  2AKW B;  2JJQ A;  2JA7 H;  4DR5 L;  2RF4 A;  3W1B A;  5JEA J;  1G51 A;  1IYJ B;  1Q46 A;  1C0A A;  5BR8 L;  1HZB A;  5IT9 c;  2NN6 G;  1GO3 E;  4BBS H;  1L1O B;  1OTC A;  3HOW G;  4IFD I;  1HZC A;  5DLQ E;  3M4Q A;  1BVS A;  2E8G A;  1PH5 A;  1OXX K;  4OWW B;  4GKK Q;  4DR3 Q;  4JI2 L;  3PO3 G;  2HIX A;  1X56 A;  2FXQ A;  3CME A;  3D0F A;  1VQ8 A;  4A3M G;  4DV6 Q;  1K83 H;  1PH9 A;  3RN2 A;  2YU9 H;  2UU9 Q;  4PG3 A;  4PZ8 A;  4C2M H;  1PFS A;  4DR7 L;  4X62 L;  1NMF A;  5M3M G;  3LGJ A;  1QZG A;  4JI6 L;  3F2B A;  1KD1 C;  4AYB E;  3H15 A;  4P75 A;  1BKB A;  4YY3 L;  2WB1 G;  2LXJ A;  2AWN A;  4P74 A;  4JI8 L;  3K7U C;  5M3M H;  3OTO L;  1HR0 L;  1Q8K A;  1N32 Q;  2K52 A;  4RMF A;  1V1Q A;  1GVP A;  1X55 A;  2MO1 A;  4UP7 A;  3STB D;  4DR4 Q;  1AH9 A;  5IP9 H;  3ER0 A;  1UE1 A;  1JJC B;  3CQZ H;  3D31 A;  4GN5 A;  3UDI A;  1IBK L;  5LMU Q;  1D8L A;  2GVB A;  1UE6 A;  3PUX A;  1YHQ A;  4GKJ Q;  3GTQ H;  5K36 G;  2VY3 A;  2BH2 A;  1TWF H;  1TWG H;  4TQU S;  4JV5 L;  1WYD A;  1XJV A;  4UP8 A;  4QY7 A;  4A3F H;  4A3K H;  4H02 A;  1KAW A;  1CKN B;  4X64 L;  1VQN A;  3Q8D A;  1E3P A;  1I50 H;  5C0X J;  4QQB X;  1EQR A;  1VQK A;  3AYH B;  4NPS A;  4DK3 C;  4DV1 L;  1K9M C;  3HOY G;  1VQ4 A;  1T9H A;  4JI0 L;  3SGI A;  4IPH A;  1XNR Q;  4HJ5 A;  4A3G G;  3WWV A;  2R92 G;  4OX9 L;  3GO5 A;  5GRO A;  1Z9F A;  1VQP A;  1N36 Q;  4NXM Q;  2NVT H;  3GTK H;  3HKZ G;  5JJL A;  2E5L Q;  1PV4 A;  1I3Q H;  1O7I A;  2UXB Q;  4MZ9 A;  4YWM A;  1MJE A;  1H95 A;  4GOP A;  4DV0 L;  1HNZ Q;  3M85 A;  1Y14 B;  5C44 H;  4DK6 C;  2R7D A;  1HNX L;  2B63 G;  2UXC L;  4X6A H;  2ZTD A;  1EUJ A;  5JEA G;  4LF4 L;  4HIM A;  1E7Z A;  4GOP C;  3K8A A;  4GN4 B;  1B70 B;  1P16 A;  5C4X H;  1G29 1;  5C0X I;  3CXC A;  2VQE Q;  4GNX C;  1VQ9 A;  1XMO L;  4LUV A;  1Q1E A;  1Q7Y C;  4NXN Q;  1YJW A;  2PQA A;  2JE6 I;  1FVI A;  1J6Q A;  4P72 A;  1N34 Q;  2WB1 E;  3KJO A;  4BY1 H;  3T1Y L;  3NBH B;  2ZTC A;  1RIP A;  1YEZ A;  2H5X A;  2CFM A;  2Q2T A;  3M3Y H;  1FGU A;  4MNO A;  4X65 Q;  3BJU A;  3E9H A;  2IX1 A;  3U50 C;  5IP7 G;  4LF9 Q;  1D7Q A;  1JJG A;  1PH1 A;  1BBU A;  4JI1 L;  2NN6 I;  1KL9 A;  1SMX A;  3FHW A;  4A93 G;  1VQO A;  1Q86 C;  3PIP A;  5C3E H;  4A3D G;  1OXT A;  4JYA L;  2IY5 B;  4A3B H;  4PMW A;  1KXL A;  3M9B A;  4B3M L;  4BY7 H;  3H3V H;  2UUB Q;  1QVF A;  5IY0 A;  4LNQ A;  4NB3 A;  3PIO A;  5LMN W;  4B3T Q;  3GTG H;  1SN8 A;  4DR1 L;  2NVQ H;  1VQL A;  1IXR A;  1I5F A;  4DAY B;  3CCM A;  3A5Z B;  3AFP A;  5GAG C;  3ICE A;  4DR6 L;  5GQO A;  4DV5 Q;  3KLW A;  1YJN A;  3CF5 A;  2Q2H A;  1EIY B;  4A3L G;  2VNU D;  3HKZ E;  3J80 i;  3PF4 A;  2Q2U A;  2NVY H;  3T1H Q;  4UY8 C;  2E2J H;  3F8T A;  4X66 L;  2HHH Q;  5C0X G;  2F4V L;  4DUY Q;  2EXD A;  2CKZ B;  1HNW L;  4LF8 L;  1K8A C;  1X65 A;  4B3S Q;  1WI5 A;  1A0I A;  1IZ6 A;  3A74 A;  4DKA C;  4AQY L;  1NBW A;  2UUC Q;  2JA7 G;  2VW9 A;  2K14 A;  5ELO A;  3J80 c;  1TWA H;  3KF8 B;  3S15 H;  1LUZ A;  1N33 Q;  3MEF A;  4R4T A;  4R1J A;  2GN5 A;  4UP9 A;  4BBS G;  1IL2 A;  1P8L A;  1SR3 A;  3BZK A;  3EN2 A;  4QJF A;  1PH4 A;  1L1O C;  3RZD H;  4JI4 L;  3GTL H;  4OWX B;  4R4I A;  4YHH Q;  5JJI A;  2C35 B;  1Q1B A;  3KDF B;  2AWO A;  3HKS A;  4HID A;  2RHS B;  1VQG A;  2F3I A;  2UXD Q;  2DUD A;  4JI7 L;  2HQL A;  3K81 C;  4LF6 L;  5IE8 A;  4Y52 H;  4JI5 Q;  4DR3 L;  4IOC A;  4A3I H;  4DV4 Q;  2AMC B;  3NEM A;  1IBM Q;  3G4S A;  4L5S A;  4QL5 A;  4DV6 L;  2VQF Q;  1Y1W H;  3F2D A;  4P71 A;  1WCM H;  1I6H H;  4C3I H;  1WFQ A;  1N8R C;  3CW2 C;  1YIT A;  1W3S A;  4A3E G;  2JA5 G;  3TRZ A;  1Q81 C;  4LW1 A;  3HOZ H;  2CWP A;  3S16 H;  4JCV E;  1QVG A;  1VQB A;  1BBW A;  2OQ0 A;  3S14 H;  5IP9 G;  4IFD G;  5GAD C;  2D0P A;  2VL6 A;  1PYB A;  3ERS X;  1N32 L;  4A3E H;  1OXS C;  1YVC A;  3GDE A;  5AJ3 L;  2JA5 H;  1TWH H;  2EIF A;  4GS3 A;  1CKN A;  5IYB H;  4DV3 L;  3FKI H;  1M90 C;  4A3F G;  4A3K G;  4GKJ L;  2ZM6 L;  1X6O A;  2IHF A;  1AE3 A;  4DV2 Q;  3FP9 A;  3HFZ B;  1Y1V H;  3RLN A;  4OXP A;  1UWV A;  5J3B A;  3L2P A;  2KHJ A;  3UDF A;  1PH2 A;  2ID0 A;  5LMN Q;  4DR7 Q;  4X62 Q;  1UE7 A;  5IYC H;  1PYS B;  2JEA I;  1B7Y B;  2NZO A;  4AIM A;  3I4M H;  1VQ7 A;  1AE2 A;  2PNH A;  3PCO B;  4YY3 Q;  4OO1 G;  2K4K A;  3KYH C;  1KHI A;  1QUQ B;  1NTG A;  2MO0 A;  3KOJ A;  1XNR L;  1QVC A;  4GLV B;  3PUW A;  4JOI A;  4JI3 Q;  1EOV A;  2XGT A;  4NXM L;  1N36 L;  2WAQ G;  3CCU A;  3VDY A;  1SRO A;  2YTX A;  5C44 G;  1LM0 A;  1XPO A;  1XPU A;  2JEB I;  2KBN A;  1IBK Q;  4DV7 L;  1VQE A;  4O0A A;  1E22 A;  3ULJ A;  1VQF A;  3GD7 A;  2KCT A;  3G71 A;  1G6P A;  4L5R C;  3HOX G;  2UUA Q;  2PMZ E;  1YIJ A;  5C4X G;  3L7Z C;  3NEN A;  4A3J H;  1Q12 A;  1MJC A;  1CSP A;  2KCM A;  2RCN A;  4JC0 A;  4LFA Q;  3HOX H;  2OWO A;  1WJJ A;  1K3R A;  2YTV A;  5HGQ A;  2VQE L;  2HT1 A;  2JA8 H;  4OWT B;  3CCV A;  4WJ3 M;  4BY1 G;  4JI0 Q;  2L15 A;  3J81 j;  4BA1 I;  1FJG L;  1K0R A;  5M5W H;  1N34 L;  4DUZ L;  4A3D H;  4JBK A;  1GM5 A;  2ES2 A;  3CC2 A;  4DPG A;  2VS1 A;  4JG2 A;  4LFB Q;  3AQQ A;  1L0W A;  3HOU H;  5C4J H;  1X3E A;  4X65 L;  2K50 A;  2MQH A;  1EQQ A;  2K75 A;  2UXC Q;  1HNX Q;  1DGS A;  3E0E A;  5C3E G;  4LF9 L;  4DAM A;  2ZJP A;  1X9N A;  3GTM H;  1WOC A;  2VUM H;  3RR5 A;  4IFD J;  4LF4 Q;  3ULL A;  4YCV A;  4A3B G;  1E24 A;  1VQ5 A;  1E1O A;  1QZH A;  4BY7 G;  2ASB A;  3PV0 A;  5E7N A;  3ZJY C;  3TS2 A;  4BA2 I;  2I5M X;  2JQO A;  4B3R Q;  4DR2 Q;  4MTN A;  1Z47 A;  4BBR H;  2A8V A;  1XMO Q;  1XNQ Q;  2Z6K A;  1S72 A;  3PO2 H;  1CSQ A;  3AEV A;  4LUZ A;  2CQO A;  1IBL L;  4BXX H;  5GAH C;  3F1Z A;  4B3T L;  2OTL A;  4R4Q A;  3T1Y Q;  2A1A A;  2YV5 A;  5IWA L;  1K8G A;  1J5E L;  2A19 A;  4K0K Q;  3CC4 A;  2WAQ E;  3PUY A;  3CD6 A;  3CCQ A;  5GAE C;  1KRS A;  2B3G A;  3PUZ A;  1HR0 W;  1VQC A;  4JI1 Q;  2B29 A;  2QGQ A;  3DM3 A;  3OYY A;  4J15 A;  3TEH B;  3W1G A;  3G6E A;  5HY6 A;  3CCJ A;  1SLJ A;  3CCR A;  2R7Z H;  1YHB A;  4LF5 L;  3HOV H;  1TXY A;  2YTY A;  4LFC L;  2ATW A;  2UUC L;  5M3F H;  4GLA C;  1NJI C;  2E2I H;  4JYA Q;  1I94 Q;  1MIU A;  4LF7 L;  3KDF A; 
#chains in the Genus database with same CATH topology
 4B3M Q;  3PN1 A;  3OHA A;  1B44 D;  3S9W A;  1XPR A;  4LWC A;  3NTK A;  2CQY A;  2A73 B;  1KBL A;  4O4H F;  2EYF A;  2JA6 H;  3NBI A;  3KF6 A;  3RB3 A;  1WTP A;  2HCI A;  4KHP Q;  1H9S A;  1Y1W G;  2N78 A;  2OF1 A;  2W6O A;  4BS9 A;  2AUK A;  4EQ5 A;  1NY4 A;  4DA2 A;  1EY8 A;  4AQY Q;  2E5L H;  4FYD A;  3G7L A;  3RZD B;  3QFF A;  4I4T F;  2UXB H;  1HUN A;  3H0G H;  2UUA H;  2JYO A;  4YP3 A;  5IGB A;  3K7A H;  4QIW E;  1B2T A;  4DR5 Q;  4I65 A;  4ODG A;  1XXG A;  4HQ6 A;  4A3I B;  1EEI D;  2FLL A;  4MV7 A;  2W9C A;  2N49 A;  4PMB A;  2VQE H;  3T5K A;  4FF1 A;  2N8N A;  2NTS A;  1DD2 A;  5EKL A;  2W6P A;  4NXN H;  5ELN A;  2AQ2 B;  2BOS A;  4N8X 1;  4ZKB B;  1X32 A;  3JAM c;  4LF6 Q;  1LAB A;  2AQ4 A;  2E2H H;  5KFL A;  4WJ4 A;  3HOZ B;  1CUK A;  2F0F A;  2NN6 H;  2V4R A;  2OQK A;  4GC6 A;  2I87 A;  2XTI A;  3S14 B;  4GC7 A;  4DV2 L;  1VMC A;  5LHY 1;  4C3J H;  2A69 C;  1FNW A;  2FKL A;  3MXN B;  4L63 B;  4MN3 A;  1L0X B;  3TS0 A;  2Y0S E;  3J80 E;  1HH2 P;  3PO3 H;  1KJI A;  3HS0 C;  3BYY B;  2WKC A;  3K5N A;  3CMA A;  2ZJR A;  4A3M H;  3PW7 A;  2CCZ A;  2GVA A;  5KG3 A;  1HJP A;  4B3R H;  4DL6 A;  4JBJ A;  3H3V I;  3Q24 A;  2YS6 A;  2EJF C;  4JI8 Q;  2IP4 A;  4JI3 L;  1HR0 Q;  4RZR A;  4X3U A;  3OSP A;  2UUB H;  1BF4 A;  2B2Y C;  1U0L A;  5KFW A;  3G6J B;  4C1N K;  3M7N A;  1ZYR D;  2FMM A;  2W57 A;  2FLN A;  4DV3 Q;  4DFA A;  4HJ8 A;  4KKT A;  4HIO A;  3J7A 5;  2IT1 A;  1EWH A;  4HIK A;  3S1Q H;  3BQ2 A;  1BR9 A;  4ME6 A;  3CC7 A;  2O2L D;  3N43 B;  4OEM B;  4LFA L;  5K36 H;  4B3S H;  1JC7 A;  1LTL A;  1J9O A;  2LKV A;  2XWJ B;  1VQH A;  1JB3 A;  3P20 A;  4TV8 F;  4ZQI A;  4QWC A;  4IWY A;  3U58 A;  5KFO A;  1B9N A;  3ETJ A;  1AFP A;  1DZ1 A;  1FR3 A;  2SNM A;  2BA1 A;  5FO9 B;  3UDG A;  1LYL A;  2MP1 A;  1BGW A;  1CQJ B;  3F2U A;  1HFN A;  4K2K A;  1B3Q A;  2YYZ A;  1V43 A;  1GYF A;  3RFC A;  4J9M A;  2W9B A;  4TUY F;  2ALZ A;  1S03 G;  3R2I A;  4Y7N H;  3PZP A;  3PW4 A;  1D5M C;  2L12 A;  3NXW A;  2FMA A;  3ERQ A;  3G48 A;  4IUR A;  4ME3 A;  2KHI A;  4BBR G;  3PO2 G;  2HIV A;  3MXU A;  2R93 H;  4ZI7 F;  1STB A;  1YHA A;  4G4K A;  1C9O A;  2D5D A;  1XNQ L;  3ERO A;  3GTO H;  2C9O A;  1R4Q B;  2ATL A;  1PA6 A;  4GNX B;  2NZ1 D;  1UE5 A;  4DUZ Q;  1K28 A;  2R93 B;  2R85 A;  4QIW A;  2F0U A;  1II3 A;  2ZJQ A;  4A76 A;  5BN4 A;  4CBV A;  1CA5 A;  5DQH A;  3HOV G;  1SEI A;  1X3P A;  5K5P A;  5E1F A;  2NVY A;  3E9I A;  1TA8 A;  3T1H L;  2IL8 A;  5BPH A;  3BU2 A;  2MPM A;  4DUY L;  1TWC H;  2ASJ A;  4RZQ A;  4IPG A;  5IP7 H;  1LTR D;  2Y0S G;  3K0X A;  1TWA A;  4IJH A;  1IBL Q;  4A93 H;  1IKM A;  5CC4 A;  1HZ9 A;  2Y0S A;  5FLM G;  1BDO A;  2R8G A;  2R7Z B;  4DL7 A;  3KAL A;  4DR7 H;  1JKJ B;  2VZA A;  3VMM A;  1J5E Q;  3N40 P;  3QJY A;  1PH3 A;  4A3C G;  5M3F B;  1VQJ A;  1GUO A;  1CKO A;  2E2D C;  4ALP A;  1BNC A;  2F3V A;  2JEG A;  2FPI B;  1AN8 A;  4RG1 A;  2K5N A;  4JI5 L;  4A3L H;  4OIK A;  3N52 A;  2KEE A;  4O3O A;  5JPM C;  2VUG A;  2K5Q A;  2LSS A;  2IHE A;  1PH7 A;  5KFU A;  4DNI A;  4CC5 A;  2JA7 H;  4MHE A;  3NQI A;  1EYZ A;  5JEA J;  4RHS A;  1RJT A;  1IYJ B;  2W70 A;  5L1I A;  3W3A A;  5EKI A;  4KKU A;  4BBS H;  4J9K A;  1L1O B;  5C1P A;  1NR2 A;  1OTC A;  4J9N A;  1S5B D;  4ZRZ A;  5DLQ E;  3OHX C;  1PH5 A;  3D4W A;  4DR3 Q;  2HIX A;  4HMJ A;  1VQ8 A;  3GV5 B;  2PW7 A;  3CRK C;  1PH9 A;  2YU9 H;  2J9G A;  4DV0 H;  4R8I A;  4PZ8 A;  2ICE C;  2NVX B;  2Z9H A;  1SNC A;  4LF4 H;  2QCP X;  1NMF A;  4JI6 L;  4AYB E;  3C46 A;  4MV6 A;  4EFB A;  2K5W A;  2F0H A;  1GGO A;  4C56 C;  1XMO H;  2AWN A;  4P74 A;  4FP5 D;  3K7U C;  3J81 E;  3OTO L;  1JOK A;  1F2Y A;  2EYH A;  4QWD A;  4YB8 B;  5BPF A;  3STB D;  1GVP A;  4UP7 A;  4OEL B;  2F0E A;  3ER0 A;  3CQZ H;  4RNN A;  2GVB A;  2TMP A;  4XZ3 B;  1GSH A;  2W6M A;  3H4D A;  2DNE A;  3OSO A;  2PZT A;  4UP8 A;  4A3F H;  4A3K H;  4X64 L;  5D65 A;  1WTR A;  1E3P A;  4QQB X;  1MSG A;  4DV1 L;  4U68 A;  4ED2 A;  1SYC A;  2OXP A;  3SK5 A;  2F0K A;  4C3H G;  3S1N B;  3PR5 B;  1AUV A;  5IT9 E;  2R92 G;  2F0S A;  4BWG B;  2O4X A;  5KFJ A;  5KFR A;  4TV9 F;  1AP0 A;  2NVT H;  3GTK H;  3HKZ G;  3S1M B;  4DR1 H;  2YRX A;  2IPK D;  4M8A A;  4YJ3 F;  1H95 A;  3J7A F;  1W93 A;  4DR6 H;  2DIK A;  1F2Z A;  3OUZ A;  1KEE A;  1HHV A;  1KLG D;  4X6A H;  1HNX L;  1SSO A;  4FNF A;  2JSO A;  3ORR A;  3ORQ A;  3MXP A;  3M4O B;  5JEA G;  2NVT B;  1E7Z A;  4ID6 A;  4ECV A;  1B70 B;  5ISR A;  1P16 A;  3BG3 A;  5C0X I;  1G29 1;  3CXC A;  2BQ3 A;  1QWY A;  3DWQ A;  4N9P A;  4GNX C;  1VQ9 A;  1B6R A;  4ECS A;  4HCS A;  5COY A;  4CHT B;  2L4N A;  2DWC A;  2PQA A;  2JE6 I;  3GQB A;  3V05 A;  4FF2 A;  5EWF A;  3A55 A;  3T1Y L;  4BY1 H;  1K8O A;  4RCN A;  1ILQ A;  2QF7 A;  3A8K E;  1YEZ A;  3NHH A;  2CFM A;  1JCK B;  4YQW A;  3BJU A;  3E9H A;  3GTJ B;  2IX1 A;  1DIK A;  4LF9 Q;  4JI1 L;  1LLR D;  4ECT A;  1SMX A;  5JJZ A;  3H4B A;  1S9F A;  3HEJ A;  4GZY C;  1OXT A;  2PW5 A;  4CKB A;  3TBI B;  1QVF A;  5EPK A;  2KA7 A;  3G6Y A;  4NB3 A;  5EBC A;  4B3T Q;  3GTG H;  1SN8 A;  3NWT A;  4AYB A;  4DAY B;  3CCM A;  1CS0 A;  2JA6 A;  1SJE D;  5GQO A;  1B9M A;  3N44 B;  2VNU D;  5L9X A;  2D9U A;  3J80 i;  4FF4 A;  3PF4 A;  1N32 H;  3T1H Q;  2F4V L;  5DQI A;  4X66 L;  1JIH A;  4DUY Q;  1HNW L;  2FHT A;  3H91 A;  1X65 A;  5M5Y B;  5FLX E;  5KIX A;  2UUC Q;  1RJP A;  2RA4 A;  4ECY A;  5ELO A;  3H0G A;  5D3D A;  5LOV F;  2F0M A;  3VPC A;  4IZ8 A;  1N33 Q;  3VA7 A;  1IOW A;  2ZDH A;  4R4T A;  2C2E A;  5CBA E;  4R1J A;  1IHZ A;  3T51 B;  4RNM A;  1L1O C;  4JI4 L;  4YIJ A;  3URY A;  3PIP 3;  1PTO D;  4UCO A;  3QO2 A;  3G8C A;  4ED1 A;  1S0O A;  1XNR H;  4QUF A;  3KDF B;  3HKS A;  5FPO A;  3K5O A;  2E2H A;  2DUD A;  3K81 C;  2NUC A;  4Y52 H;  3PIO 3;  4JI5 Q;  2RGV A;  4IOC A;  4DV7 H;  2X6L A;  3G4S A;  5E3F A;  4K6L A;  1Y1W H;  4IN3 A;  4HN7 A;  3VYS A;  1PTO H;  2EY5 A;  1EUC B;  2ZDG A;  1WFQ A;  2KHS A;  1N8R C;  3KAK A;  1YIT A;  1W3S A;  2RVL A;  1EY4 A;  1H9S B;  4HYK A;  4LW1 A;  2CWP A;  4JCV E;  3SVM A;  1TQO A;  1BBW A;  1M0W A;  3I8Z A;  1YNN D;  4IFD G;  1PYB A;  1PTO B;  4EFE A;  3GV7 B;  4A3E H;  1YVC A;  3GDE A;  5AJ3 L;  1FJG H;  3OWE B;  1I4H A;  4RH6 A;  2ASD A;  4L8J A;  2SOB A;  1N34 H;  5KKN B;  3K6O A;  1EUD B;  4RB2 C;  1FGB D;  5KT5 A;  3A8I E;  4RU9 A;  3GTQ A;  4GKJ L;  3T53 B;  1AE3 A;  2W9C B;  5DG9 A;  3RB6 A;  3BVZ A;  2HCC A;  4A3E B;  5D14 A;  5C6A A;  1EOT A;  1UWV A;  2K7V A;  2J6T A;  4MTE A;  3J7A K;  3UDF A;  3J80 L;  3RBD A;  4X3T A;  5LMN Q;  1U4P A;  2JEA I;  5IGD A;  2NZO A;  5I6W A;  4DU9 A;  3I90 A;  2MO0 A;  1DOM A;  3MR2 A;  5BMV F;  2XRQ D;  4NXM L;  1N36 L;  3CCU A;  1XPU A;  2JEB I;  2KBN A;  5IWA H;  1WSC A;  4LSX A;  4F7X A;  1VQF A;  2F03 A;  4ZKC B;  3VPB A;  1G6P A;  2EYP A;  5FKA C;  3RUP A;  4ZK9 B;  2J0T D;  1YIJ A;  1EQT A;  2J4X A;  2XSC A;  4MV8 A;  4J9Q A;  1A3V A;  1CSP A;  1MJC A;  3HOX H;  4LFC H;  5CV9 A;  4ECZ A;  1I3Q B;  2YTV A;  1KC7 A;  4OWT B;  3GTO A;  1PRT D;  2L15 A;  4BA1 I;  2C2R A;  3Q2O A;  5C44 B;  2K33 A;  3K5H A;  1XMQ H;  2FIN B;  2ES2 A;  4DPG A;  2VS1 A;  3V6H A;  4J1M A;  4LFB Q;  5C4X B;  1L0W A;  2XRS D;  3N41 B;  2R8K A;  1X3E A;  4X65 L;  5FK9 C;  2K50 A;  3P1H A;  5F9L A;  1JX4 A;  1HNX Q;  1DGS A;  3E0E A;  2GA4 B;  5C3E G;  3EFX D;  2ASL A;  3MJF A;  1WOC A;  3ULL A;  1TWC A;  1E24 A;  4BY7 G;  2QDB A;  5E7N A;  4DL2 A;  4MAM A;  4GKK H;  4DV4 H;  1LTT D;  4DR2 Q;  1E4E A;  2F1M A;  4BBR H;  3R5F A;  3PO2 H;  2Z6K A;  4ZQ3 A;  1WTV A;  2VQF H;  4LSA A;  1PRT B;  3PW5 A;  1T5E A;  5GAH C;  2UU9 H;  3F1Z A;  2CHB D;  3K59 A;  3MZ5 A;  5BN3 A;  1CT1 D;  1K1S A;  3RV4 A;  3T1Y Q;  4JUZ A;  2EY6 A;  4G3I A;  3MTS A;  1TT2 A;  4K0K Q;  2WAQ E;  3KF8 A;  4QMG A;  3CD6 A;  5GAE C;  2B3G A;  1WTQ A;  3PUZ A;  1Z6H A;  5KT4 A;  2QEJ C;  4JI1 Q;  4CKC A;  3G6E A;  3CCJ A;  3TEH B;  3CVZ A;  3CCR A;  5DG8 A;  3HOV H;  4LF5 L;  2YTY A;  1MI2 A;  2TSS A;  4U7C A;  3NGD A;  1I94 Q;  1CQV A;  1PFB A;  2NVY B;  3BG5 A;  4HJA A;  2JA7 A;  4RA8 A;  4LUO A;  2WE6 A;  2DN8 A;  2ZXP A;  1DOL A;  4CKE A;  3I7F A;  3CHB D;  1NCV A;  4G7Z C;  3EIV A;  1VF7 A;  1EYD A;  5FLM H;  2OEO A;  4JPB W;  1TWA B;  1PH8 A;  4DL3 A;  1B3A A;  2IX0 A;  2QEX A;  3S2D H;  4XTC S;  5DGA A;  1KAA A;  3CPW A;  1STG A;  1ENF A;  1SND A;  2UXD L;  2EYO A;  4A3C H;  2WP8 J;  3EBE A;  1WCM G;  1NSN S;  4YR3 A;  2JEJ A;  3M9O B;  2YU9 A;  3HBL A;  3N6R A;  1ILP A;  4HR7 A;  3M7G A;  2PPB C;  3UE0 A;  1SJH D;  1U4R A;  1JWS D;  1OXV A;  4JI4 Q;  1ASY A;  4L5T A;  5IYB G;  5BR8 Q;  1PYW D;  2FLP A;  5I2X A;  2JA5 A;  1VCI A;  3PGZ A;  3MXG A;  4EX5 A;  1EL0 A;  1TWH A;  3FKI G;  1I6H B;  1QB5 D;  3NWS A;  2PMZ B;  1SYX B;  1Y1V G;  4XQQ A;  3NP8 A;  3CQZ A;  3MFG A;  1HFG A;  4JI2 Q;  3S16 B;  4OL7 A;  3SEB A;  3C3L A;  3I4M G;  2NWG A;  4GLX A;  2RBM A;  4MV9 A;  1A3T A;  4HJ9 A;  4IPC A;  1RTO A;  2JEF A;  1M1K C;  5KNC A;  1AZQ A;  4XQN A;  1OWT A;  3IN5 A;  2L0C A;  1YNN C;  4IZO A;  4FXK C;  2Z8L A;  4IOA A;  2NU7 B;  3BDL A;  1S10 A;  3TRE A;  3R23 A;  5AJ3 Q;  1TY0 A;  4KD4 A;  2ALY B;  4ZAI A;  3CCE A;  2BCO A;  3CAM A;  3GTK A;  2YZM A;  4DF7 A;  2HVS A;  1I6U A;  3S2H H;  2E5L L;  1TR5 A;  3R3O A;  2UXB L;  3Q23 A;  5KFZ A;  2WAQ A;  4JOI C;  1KDB A;  3SHL A;  4DV5 H;  2UUA L;  3T16 A;  3VPD A;  4R4C A;  4JV5 Q;  1PVO A;  4I7A A;  1EHI A;  3EYY A;  1B8A A;  1XTD A;  3GLK A;  1VDZ A;  2R8I A;  1S5F D;  2EZV A;  2EJM A;  2YYA A;  5KG1 A;  1VF5 C;  4NXN L;  2MNA A;  4K2L A;  3HOU G;  5C3W A;  3BZC A;  5G3L D;  4HMI A;  4A3J B;  4A2B A;  1N48 A;  1VQA A;  2VUM G;  2V9W A;  5D1O A;  4C3H H;  2NBF A;  2JA8 B;  2VQD A;  2R92 H;  3GTM A;  4KLK A;  1CTM A;  2VUM A;  1MBY A;  1A8V A;  1Y8P B;  1J8I A;  3RB4 A;  1B50 A;  3N8D A;  1IL8 A;  2K28 A;  2N88 A;  3GTP H;  2F0O A;  1PRT C;  4DK0 A;  4B3R L;  3K80 C;  1IBM H;  3Q22 A;  2XC9 A;  5C4J B;  4XXE A;  3D4D A;  5JEA H;  1O7Z A;  3UDX A;  2UUB L;  5C4H A;  3GTG A;  1S0N A;  1TAE A;  1B04 A;  3V6J A;  4DR5 H;  4IO9 A;  2D62 A;  3EPG A;  3QZ8 A;  1HRJ A;  4J9O A;  4ECU A;  5LA6 F;  2KOL A;  3T5J A;  1VQ6 A;  1ASZ A;  5I4D A;  2PQA B;  4K14 A;  4B3S L;  3IRB A;  4A75 A;  5IGF A;  2B8F A;  4YAJ B;  1U4M A;  4DNR B;  3MHB A;  1SNP A;  1EY7 A;  2EOT A;  1NR4 A;  4IRK A;  5L1J A;  3RBE A;  4HTH A;  3J80 W;  1EY0 A;  1CHQ D;  5JVL A;  3M4Y A;  2OCE A;  2D0O A;  3BVG A;  2AGP A;  2FPG B;  2UVU A;  4X3S A;  2E2I B;  4YY3 H;  2Q8R E;  1W2B A;  3I12 A;  1KIX A;  1HR0 H;  1UC8 A;  5A2Q E;  1ROD A;  4FS1 A;  3V96 A;  1BXR A;  2Q2I A;  4MIU A;  4LF5 Q;  5FLX L;  2MFI A;  1GSO A;  1IBK H;  2JXM B;  4AYB B;  2JA6 B;  1Y1W A;  5KFE A;  3DHQ A;  3RIZ A;  5M5X H;  5LP6 F;  3I4N G;  2AKW B;  5C1O A;  2RF4 A;  3W1B A;  1G51 A;  1Q46 A;  2J6U A;  1HZB A;  5KFS A;  4ED6 A;  2B8G A;  4JI0 H;  3L3O C;  3H0G B;  3BVM A;  2R6F A;  2DPI A;  4IAL A;  3HOW G;  3K7A B;  2DNC A;  3M4Q A;  1I4G A;  1BCP F;  2HVQ A;  1BVS A;  1RJQ A;  4OWW B;  1GUN A;  1EWC A;  1GOZ A;  4QW9 A;  1X56 A;  2F4I A;  2FXQ A;  3MFH A;  1O78 A;  1K83 H;  4DV6 Q;  3NTI A;  1B1Z A;  1V51 A;  1ZHQ A;  3H20 A;  4DR7 L;  4CJ1 B;  4IAJ A;  4O3R A;  2E2H B;  1ZHS A;  3A7A B;  2K5D A;  1X3Q A;  4P75 A;  2JEI A;  2WB1 G;  2LXJ A;  4C3J B;  1EYA A;  5M3M H;  1V1P A;  1PLF A;  2K52 A;  4RGN A;  3PO3 B;  2R87 A;  1V1Q A;  1BO0 A;  2HUG A;  4A3M B;  4IFD H;  1SFO A;  1IYU A;  1I4X A;  3D31 A;  3UDI A;  3KAJ A;  1D8L A;  3PUX A;  2EJG C;  1D1K A;  4IR9 A;  4EGQ A;  2CVR A;  3GTQ H;  2VY3 A;  1TWF H;  1TWG H;  4G57 A;  4TQU S;  5M3M B;  4EEY A;  4EGV A;  1XJV A;  3R5H A;  4QY7 A;  2R7L A;  2XGP A;  3SE7 A;  5FO7 B;  3G6V A;  2EYM A;  3HOY G;  1K9M C;  1W6K A;  2IW3 A;  3AB9 A;  1VQ4 A;  3S1Q B;  3SGI A;  3E3X A;  3N6X A;  4JYA H;  2A6E C;  4HJ5 A;  4A3G G;  1JOO A;  4OX9 L;  5GRO A;  1Z9F A;  1JOR A;  5FD6 A;  1E2V A;  5HBR B;  2E5L Q;  1O7I A;  3VR2 A;  2UXB Q;  4YWM A;  1MJE A;  2C28 A;  3I70 A;  4DV0 L;  3T5L A;  3MWY W;  4TRD A;  3M85 A;  4R9W A;  2B63 G;  4F4W A;  1RK6 A;  4LF4 L;  1Z2N X;  4HIM A;  1KDC A;  4Q0F A;  3K8A A;  4GN4 B;  2B63 A;  2E74 C;  5L1K A;  1EIH A;  2VQE Q;  3BA8 A;  1I7N A;  4Y7N B;  2K1B A;  1SMY D;  1XMO L;  4LUV A;  1DON A;  3K3V A;  4NXN Q;  1YJW A;  2Q8T A;  5KG5 A;  4PWQ A;  4UAI A;  3T56 B;  3OOC A;  4JV2 A;  1J6Q A;  4P72 A;  2B2T A;  4IWX A;  2Z4I A;  3KJO A;  4WBN F;  1SYD A;  2H5X A;  3D4R A;  3M3Y H;  1CFM A;  1FGU A;  3BAA A;  2PZW A;  5M9O A;  1QOH A;  3GTO B;  1XX8 A;  4PMC A;  4WOR A;  2O5I C;  1PH1 A;  1BBU A;  1G6Z A;  4JI7 H;  4IUU A;  1VQO A;  3K3P A;  4LMQ D;  1IW7 D;  4DR3 H;  1SE4 A;  2HDM A;  3PIP A;  2VXW A;  5C3E H;  1DCZ A;  1GUW A;  2IY5 B;  1KXL A;  2AU0 A;  1VAJ A;  2V58 A;  2Q8I B;  4BY7 H;  1M7J A;  3H3V H;  1CM9 A;  2UUB Q;  4FBU A;  3PIO A;  2WII B;  2PO4 A;  4F87 A;  1TWC B;  3PMF A;  4DR1 L;  1Z2O X;  2NVQ H;  1PFM A;  3ICE A;  3AFP A;  4DR6 L;  2GPS A;  1S97 A;  2SCU B;  4QUC A;  3KLW A;  1E4E B;  1PRT F;  1EIY B;  1O7L A;  3HKZ E;  1PXU A;  2Q2U A;  4A93 B;  3J81 W;  2E2J H;  4EBE A;  1SDF A;  1PZI D;  1C4Q A;  2G9H D;  4LF8 L;  5NUC A;  4B3S Q;  1LT5 D;  1IZ6 A;  5KFC A;  3Q8R B;  2A6H D;  1NBW A;  4R7R A;  4IUQ A;  4O2A F;  2ZM6 H;  3H6M A;  3J80 c;  3KF8 B;  1TVX A;  2M00 A;  1LUZ A;  3KXY T;  2VB2 X;  3LWE A;  4UP9 A;  2NU6 B;  4IUT A;  4ECW A;  3EN2 A;  1BJT A;  3GTL H;  1LO5 D;  2X0S A;  5J39 A;  2C35 B;  3SE0 A;  1TU2 B;  5IT9 W;  2F3I A;  5JOB A;  4OX9 H;  2HQL A;  2JA7 B;  1HA6 A;  3QOL A;  3FDT A;  1M0T A;  2AMC B;  1KJJ A;  3I91 A;  1Z7T A;  2XD4 A;  1F77 A;  1WCM H;  5C5M A;  4BBS B;  4C3I H;  5CBE E;  4C2M A;  1Z2P X;  2H1E A;  2QDL A;  2NUA B;  5EWG A;  2F0Q A;  1U9R A;  3W2D A;  1K1Q A;  2OQ0 A;  5EBD A;  1PX2 A;  5GAD C;  2YU9 B;  1ENC A;  4LK1 C;  1N32 L;  2W8K A;  2JA5 H;  1TWH H;  4HR7 B;  3VYT A;  5IYB H;  2WAC A;  4ETS A;  1HXY D;  1JLL B;  3FKI H;  1M90 C;  4XX0 B;  1E2Z A;  2F0P A;  1LTI D;  4DV2 Q;  3QIA A;  5ELF A;  3FP9 A;  1Y1V H;  2JA5 B;  3NUC A;  4OXP A;  4LF9 H;  4O3Q A;  5D3I B;  4DR7 Q;  3HXL A;  1I50 A;  3I4M H;  1B7Y B;  2B2Y A;  4AIM A;  5HUR A;  5L37 A;  3CQZ B;  1AE2 A;  2F0L A;  2MUY A;  4I55 F;  4M9U A;  5LYJ F;  4IRD A;  3P7J A;  3KLS A;  1VKZ A;  3KOJ A;  1XNR L;  5J2T F;  1I4P A;  3KLR A;  3PUW A;  1R4P B;  3P75 A;  4JI3 Q;  1GSA A;  2FE3 A;  1S5E D;  2AQ1 B;  1ZYR C;  4PV1 C;  4A3F B;  4A3K B;  5HV6 A;  1SRO A;  2YTX A;  1XPO A;  1LM0 A;  4OO1 H;  4B3T H;  4DV7 L;  1ZEQ X;  3SK8 A;  4O0A A;  1E22 A;  4KTA A;  2R92 A;  3GD7 A;  2W71 A;  3K58 A;  3G71 A;  1A2U A;  3HKZ A;  4YR0 A;  2R7K A;  4QF4 A;  4H13 C;  5I6Y A;  1QNU A;  1ULZ A;  3GTP A;  3WDN A;  1E4F T;  3GTK B;  5KFN A;  1F9P A;  2PZU A;  1D5Z C;  4LFA Q;  4LF8 H;  5FLX W;  1L2Z A;  2OWO A;  5HGQ A;  1K3R A;  4IUP A;  1A2T A;  3WOF A;  4WJ3 M;  3GID A;  5T14 A;  2WAQ B;  5CA1 F;  4LF7 H;  1FJG L;  2CW8 A;  4WJW A;  3JRW A;  5M5W H;  5JQW A;  1N33 H;  1N34 L;  1SAP A;  4A3D H;  3EJI A;  1GM5 A;  3CC2 A;  1V4Y A;  1XDN A;  4NKL A;  4CC6 A;  3AQQ A;  3TZD A;  1G2T A;  3HOU H;  2AQ3 B;  2K75 A;  1RJR A;  2AUJ D;  3GP7 A;  1UEA B;  3GTM H;  4RAZ A;  1K8M A;  4RUA A;  2VUM H;  2OLS A;  4IFD J;  4DL5 A;  5FO8 B;  4LF4 Q;  2B2U C;  4YCV A;  1MD2 D;  4A3B G;  3D8G A;  1QZH A;  1KJ8 A;  4BY1 B;  1MSH A;  1SMY C;  4F4Y A;  3OWF A;  5EJW A;  5D1O B;  3CKI B;  1XMO Q;  1S72 A;  2XIW A;  1XNQ Q;  4O3P A;  1CSQ A;  3AEV A;  4LUZ A;  4H0L C;  3GTM B;  2NYZ D;  3KBX A;  1LTB D;  4R4Q A;  4X3K A;  1SXT A;  2HD3 A;  2K05 A;  2YV5 A;  5IWA L;  1K8G A;  4RB0 A;  5KFV A;  2MJ8 A;  2A19 A;  5KG4 A;  1DYQ A;  2SDF A;  3CC4 A;  1KNE A;  2QW7 A;  3PUY A;  3CCQ A;  2B39 A;  1WH2 A;  2M2L A;  5CAE B;  2B29 A;  3OYY A;  3W1G A;  1IW7 C;  3GTG B;  4DR4 H;  1CZG A;  4LFC L;  3EQL C;  4C5B A;  3BDC A;  5LMU H;  5COR A;  1S5D D;  2ZXO A;  2B2V C;  1XMQ L;  2XGQ A;  1KQS A;  4POG A;  4N8F A;  3KFU A;  5LMN H;  3A8J E;  3PW2 A;  5DQG A;  2RDJ A;  1S0M A;  1V9P A;  3U4Z A;  1V1O A;  3NEL A;  5CV6 A;  3KTM A;  3I4L A;  2LXK A;  3L0O A;  3E0J A;  4KI0 A;  4OGQ C;  3I55 A;  1D2B A;  4H44 C;  4A3I G;  3ETH A;  1ET9 A;  3KHH A;  3A5U A;  1T94 A;  2W9A A;  5A2Q L;  5H80 A;  2KJX A;  3WOE A;  5GON F;  4L5Q A;  2A6H C;  1K3B C;  4QCL A;  1HUM A;  3A0J A;  4OIJ A;  4GKK L;  4DV4 L;  3TN2 A;  1K83 A;  2VQF L;  3HOZ G;  4QWE A;  1GD7 A;  4QWB A;  3Q8Q B;  3DXJ C;  1ONL A;  1JB7 A;  4UCR A;  3KF6 B;  2UU9 L;  1HNZ H;  3RGZ A;  3GII A;  4I50 F;  2BA0 A;  3EA6 A;  1L2F A;  5DEH A;  2NZH A;  2KED A;  2X6G A;  3IFD A;  4RUC A;  2XVS A;  5L1L A;  3BZD B;  1IYV A;  1RYR A;  4APM A;  3I4N H;  4XIG S;  2PI2 E;  1YZ6 A;  1Y1W B;  2P5Z X;  3MWD A;  5KYI A;  2QA4 A;  1LTG D;  1S40 A;  5DM6 3;  4UFZ A;  1IOV A;  1JIC A;  4MV1 A;  2IJ0 A;  5EOY A;  3ZYY X;  4YWK A;  3LML A;  3CCS A;  5JAV A;  3U4V A;  5FOB B;  4OON A;  4LFB H;  4EGJ A;  3HOW H;  2BR0 A;  5IYC G;  1TWF A;  1TWG A;  1VMP A;  1YNJ D;  3PQI A;  3GIP A;  5KFG A;  2UVW A;  3FMC A;  4JI6 Q;  2LY7 A;  2W6Z A;  2ZDQ A;  4DR2 H;  3M9N B;  3M4P A;  1HCZ A;  1FNU A;  1YNX A;  2R8H A;  4N9T A;  1FYC A;  3STB C;  3OTO Q;  4ECR A;  4R4O A;  3K57 A;  1A15 A;  5KG2 A;  1E2W A;  1X54 A;  4HJ7 A;  2NTT A;  4JBW A;  1SFO H;  4K0K H;  4L6T B;  5KG6 A;  5EQ0 A;  4IUV A;  1JMC A;  1EFW A;  2RCF A;  2OT2 A;  3RLO A;  4DNT B;  1V1P B;  2HHH H;  2MHV A;  1ZQ7 A;  1MKH A;  2N3S A;  4X64 Q;  4Q0Y A;  5KT6 A;  4O3S A;  2I80 A;  5IOD A;  5A35 A;  3AU7 A;  3J7Z C;  4DV1 Q;  4PZ7 A;  4I7H A;  1KNA A;  1R9T H;  2W7P A;  3JC6 6;  3HOY H;  5J2U F;  5KX5 F;  1L0Y B;  2FMC A;  3RB0 A;  3NE5 B;  4DV7 Q;  1EZ8 A;  3HOX B;  1Q3L A;  4A3G H;  2R93 G;  3ULP A;  3RLF A;  3OHB A;  4GNX A;  4YHH H;  2FK2 A;  3QZ7 A;  2CWA A;  5FLX c;  1JDB B;  2CW0 D;  2BE5 D;  4O1N A;  5KFX A;  5ELE A;  1JJ2 A;  2ZXR A;  4RGT A;  2B63 H;  2Z0S A;  4YWL A;  2W9B B;  2JK8 A;  1FJG Q;  4KHZ A;  2O5J C;  3B6Y A;  3SDZ A;  1S3O A;  3RZO H;  2I46 A;  3LP8 A;  3S1R H;  4MTK A;  1BQQ T;  5DG7 A;  1VQI A;  2K5V A;  2R7Z G;  1SE2 A;  5LL6 X;  4BBR B;  2PI2 A;  3LWU A;  4DV5 L;  3OUU A;  3PO2 B;  1STE A;  3KUP A;  3GV6 A;  2RDI A;  3TDQ A;  5M3F G;  1VS0 A;  4POF A;  1RKN A;  3TII A;  5IYD G;  3WO0 A;  3I2Z A;  5FJ8 G;  4LAA A;  4QIW B;  3S17 H;  4JI2 H;  1Q82 C;  5I2Y A;  2C2D A;  1HQR D;  3J81 i;  1KTK A;  4KKS A;  4RB1 A;  3OW2 A;  1H9M A;  4XT1 B;  1SYB A;  3HOV B;  4X62 H;  5CA0 F;  3DUZ A;  4F4X A;  5IWA Q;  1SRU A;  5KG7 A;  3GTL A;  1YJ9 A;  1SYG A;  1EY9 A;  2L5T A;  1OXU A;  2NU8 B;  2Z1C A;  4KHP L;  2KEC A;  3KJP A;  4X66 Q;  2F4V Q;  5ELC A;  1HNW Q;  4WD3 A;  3DLL A;  2Y0S B;  1LT6 D;  1KRT A;  4LFC Q;  3RN5 A;  1IBM L;  2E75 C;  4UDU C;  1L1O A;  3CP0 A;  1WCM A;  1ZXT A;  3GIK A;  3S24 A;  1XMQ Q;  3S2D B;  4JV5 H;  4JW0 A;  4NLG A;  4FO2 A;  2JJQ A;  4Z9C B;  4DK1 A;  4DR5 L;  2R7M A;  1PTO C;  1C0A A;  5F9N A;  1RDP D;  3DWP A;  1GO3 E;  4DN4 M;  1AN7 A;  4QB4 A;  5CR3 A;  3QR8 A;  1CA6 A;  2J7Z A;  2E8G A;  2WIN B;  5KEE A;  4KJN A;  3H09 A;  4GKK Q;  1SEB D;  3K5I A;  3FKI A;  5T1I A;  4E4T A;  3CME A;  1NNX A;  3D0F A;  1B6S A;  3X3M A;  4XYM B;  4R8N A;  3I3C A;  4ZYS A;  1Y1V A;  4UCT A;  2UXC H;  3MR5 A;  2UU9 Q;  4PG3 A;  3IG0 A;  4C5A A;  2A69 D;  4C2M H;  1PFS A;  3MWE A;  4YJ2 F;  3LGJ A;  1QZG A;  5CYU A;  1KD1 C;  3H15 A;  4XQJ A;  1BKB A;  2A68 D;  1LTS D;  4YY3 L;  4FS2 A;  2SEB D;  3VR4 A;  2L1B A;  4JI8 L;  2R82 A;  3J81 L;  1HR0 L;  4J9R A;  2YS7 A;  3TIN A;  1F2M A;  1AH9 A;  1X55 A;  1GLV A;  1IBK L;  1JJC B;  1RK5 A;  4RNO A;  1UE6 A;  1YHQ A;  4GKJ Q;  1FKA H;  1YNJ C;  2BH2 A;  1PMR A;  1STY A;  5KFH A;  1JDE A;  1WYD A;  2VB3 X;  4S3S A;  2IA6 A;  4H02 A;  1ENA A;  1JE4 A;  2FPP B;  2EXZ A;  3Q8D A;  2K04 A;  1I50 H;  5C0X J;  3S2H B;  4DLK A;  1EQR A;  1VQK A;  3AYH B;  4NPS A;  1Y8N B;  4RGM A;  4K8I A;  2FB9 A;  1T9H A;  4JI0 L;  5DGB A;  2F0D A;  3WWV A;  4B3M H;  5EWE A;  5IT9 L;  3TQT A;  3GO5 A;  3NK9 A;  5E4W C;  1N36 Q;  4NXM Q;  4UCS A;  4HNU A;  3VYR A;  3HG9 A;  4NMZ A;  4FU0 A;  5KFK A;  5JJL A;  3JAM E;  1PV4 A;  4GOP A;  4CGY B;  1Y14 B;  1BOS A;  2R7D A;  4A2A A;  5A2Q W;  4KHP H;  3BA9 A;  4MA0 A;  4J0M A;  3QG1 A;  3H94 A;  4B9W A;  3H40 A;  2DPJ A;  4C3H B;  4ZCK A;  4AQY H;  4IQZ A;  4G7H C;  2R92 B;  2WTF A;  3N42 B;  3HKZ B;  4P2C B;  4FVM A;  5D1P A;  5F2D A;  3SR1 A;  3L4K A;  2WB1 E;  1WTO A;  3GTP B;  1F9Q A;  2ZTC A;  1RIP A;  2Q2T A;  2BDN A;  4X65 Q;  4EVO A;  1GXD C;  2CW0 C;  4OHJ A;  3E5N A;  2BE5 C;  3U50 C;  3IAY A;  5C8Y F;  2VOB A;  3R8B A;  3MEH A;  1ML0 D;  4B08 A;  1JJG A;  4HED A;  5IYZ F;  5DAU A;  5KFP A;  4LF6 H;  2NN6 I;  1KL9 A;  4MTD A;  4TKO B;  5KT2 A;  4CJ2 C;  2QKI C;  2A74 C;  4JYA L;  1O7Y A;  3HZX A;  4PMW A;  4A3B H;  3M9B A;  1GJX A;  1CQI B;  3TQ1 A;  1HTL D;  1WD0 A;  4LNQ A;  3FPP A;  1EY5 A;  1SBB B;  1CI3 M;  2IX3 A;  3NQT A;  3ONA B;  1IXR A;  1I5F A;  3A54 A;  4DXF A;  1MZB A;  1FNV A;  4DV5 Q;  4UCV A;  4QWA A;  2K03 A;  4UY8 C;  4JI8 H;  3F8T A;  2L11 A;  5C0X G;  2CKZ B;  4J8Q A;  1K8A C;  1Y8O B;  1I6V C;  5CGK A;  3A74 A;  4RKB A;  4DKA C;  4DV3 H;  2IMW P;  1TS2 A;  3GV8 B;  1EYC A;  2K14 A;  3L9A X;  2RSN A;  5KGU A;  1GHK A;  3LWB A;  3RF2 A;  1IL2 A;  1P8L A;  3BZK A;  3T13 A;  1PH4 A;  4PDB A;  2EYL A;  1A9X A;  3RZD H;  4EBD A;  5CV5 A;  1Q1B A;  5M5X B;  1QCB D;  2AWO A;  2RHS B;  4K5V A;  3D6C A;  2UXD Q;  4DL4 A;  4JI7 L;  4JVZ A;  1SYF A;  5IE8 A;  2L9H A;  4DR3 L;  4A3I H;  1IBM Q;  2LMC B;  4XDX A;  4L5S A;  1NAP A;  1RD9 D;  3F2D A;  1LV9 A;  2XCP A;  3D6W A;  2F0J A;  5C5L A;  3Q8P B;  4A3E G;  3OPO A;  5EGT A;  4CJ0 B;  2OH2 A;  1Q81 C;  5E4X A;  3HOZ H;  4JV1 A;  2CH4 A;  2HDL A;  1VQB A;  3V4S A;  3S14 H;  1JR0 D;  5KG0 A;  2SNS A;  5IP9 G;  1K83 B;  3ERS X;  3IKJ A;  1OXS C;  2YL2 A;  2EIF A;  1CKN A;  2WB1 A;  4DUZ H;  1DJR D;  2PCF B;  2FK3 A;  3FMA A;  3ND8 A;  1X6O A;  2IHF A;  3NTH A;  5IGC A;  2ZM6 L;  2HVR A;  1ZKO A;  1F9S A;  1PTO F;  1PZJ D;  3KLS X;  3RLN A;  1Q90 A;  1BNZ A;  1T5X D;  5J3B A;  1PH2 A;  2FK1 A;  5IYC H;  1PYS B;  2A68 C;  4KV6 A;  3I73 A;  1VQ7 A;  3M9M B;  4YY3 Q;  4WRD A;  3K0Y A;  3GTQ B;  1NTG A;  1TWF B;  1QVC A;  1TWG B;  4JOI A;  1R9T A;  1IBL H;  4ED0 A;  4CDD C;  3VDY A;  4C5C A;  3GIM A;  5C44 G;  4RFB A;  1IBK Q;  2EY1 A;  4HNT A;  1I3Q A;  4ED7 A;  1GUT A;  1VQE A;  1J5E H;  4DAV A;  5J22 A;  4L5R C;  3HOX G;  2UUA Q;  2PMZ E;  2HJW A;  5C4X G;  3QOJ A;  3C1F A;  3NBH A;  1Q12 A;  1GUS A;  4JC0 A;  3GQC A;  5EPJ A;  1V8Q A;  1I7L A;  3O13 A;  4JI0 Q;  2NU9 B;  1GHJ A;  4IRC A;  5EDW A;  2YW2 A;  2XCL A;  2M05 A;  3BAB A;  3RAQ A;  2EY2 A;  4FF3 A;  2VR1 A;  5C5J A;  1EQQ A;  3BS1 A;  1VBH A;  5KT7 A;  4LF9 L;  4DAM A;  2ZJP A;  2V4Q A;  4KN4 C;  3RR5 A;  5CB4 F;  1M4V A;  3MR6 A;  1VQ5 A;  1E1O A;  3FEW X;  2ASB A;  3PV0 A;  3ZJY C;  2MCT A;  3TS2 A;  4MA5 A;  4ILW A;  4R8U A;  4O4I F;  2I5M X;  2JQO A;  5KFI A;  4B3R Q;  1Z47 A;  4NW2 A;  1UAP A;  3ND9 A;  5DNF A;  3M3Y B;  2E76 C;  3GIL A;  1TII D;  2PN1 A;  3RGX A;  1RF2 D;  3EPI A;  2JN4 A;  2V59 A;  4DGZ A;  1EEF D;  4B3T L;  2OTL A;  4BWS C;  1SNO A;  2B2W A;  2A1A A;  1XTC D;  4MV4 A;  3DMU A;  5C3E B;  2PQE A;  3RMH A;  1FD7 D;  3RD4 A;  1CZW A;  1KRS A;  4BY7 B;  2GLT A;  3U9O A;  1HR0 W;  2QGQ A;  4J15 A;  2R7Z H;  2BQR A;  1YHB A;  2ZJT A;  4RB3 C;  1TXY A;  2NVQ B;  2FJ2 A;  2UUC L;  5M3F H;  4GLA C;  4JYA Q;  1MIU A;  4LF7 L;  4DV2 H;  1G8Z D;  4EYH B;  2EQS A;  1EIF A;  5IYD H;  1N33 L;  5FJ8 H;  3AMU A;  2EE1 A;  2E2J B;  3TP8 A;  1KC8 C;  2G9D A;  3U9S A;  2EVB A;  2J6S A;  1ICF B;  4IPD A;  4YBZ B;  3I56 A;  4C1N I;  3GIJ A;  1X3F A;  4K5W A;  2GPW A;  4O2D A;  2DGY A;  1PZK D;  4JI3 H;  2WYO A;  2Z4H A;  4OO1 I;  1UNS A;  1U5K A;  2YZG A;  4TVA B;  1JT8 A;  2RKS A;  1MGS A;  1STN A;  3GTL B;  3CCL A;  1T36 A;  1VBG A;  2I5L X;  1FL0 A;  4YCU A;  3RUZ A;  4ZHQ F;  2PMZ A;  1YBY A;  4PZ6 A;  2IBK A;  4Q8F A;  2CW7 A;  4E6I A;  5KFF A;  3JAM i;  4J9L A;  1XYI A;  2KSW A;  4K8J A;  4LFA H;  5KT3 A;  4HCE A;  4UHV A;  1OO9 B;  1HZA A;  1ZET A;  2JA9 A;  3DEO A;  5KFB A;  1WCM B;  5H1S E;  1EWI A;  4C3I B;  2NVX H;  3NPP A;  4ME5 A;  4JI7 Q;  4DR4 L;  3WO1 A;  3G6X A;  1N56 A;  1EU3 A;  3MR3 A;  2F52 A;  2F0T A;  3SI8 A;  4RAY A;  3Q1K A;  1A62 A;  1AW7 A;  5LMU L;  3F2C A;  1QUQ A;  3D3R A;  2PVP A;  4XYO A;  2MGS A;  5IIF A;  2OTJ A;  4A4I A;  1DOK A;  2I5H A;  1TWH B;  5LMN L;  3TIG A;  1NE3 A;  1G91 A;  4KY6 A;  4F50 A;  3HRZ C;  3DWA A;  3FKI B;  2R7F A;  5J1Z A;  4ULL A;  3PVX A;  1N9W A;  1XNQ H;  3PUV A;  5DLG A;  3OSN A;  1UC9 A;  1Y1V B;  5ELB A;  2F0I A;  4GN3 B;  3PF5 A;  1WTH A;  2I0Q A;  1C30 A;  4EG0 A;  3F8N A;  2W8L A;  4FM9 A;  3I4M B;  4NP5 A;  1DV2 A;  2ZM6 Q;  4J9S A;  2K32 A;  4A3J G;  4XYL B;  2R6G A;  3KHR A;  3AFQ A;  1B53 A;  4UPA A;  1HNZ L;  2JA8 G;  3S1N H;  1C8C A;  1E1T A;  3C1E A;  1JXL A;  3T1H H;  4KD3 A;  1C7Y A;  3TQY A;  4ZUJ A;  4U67 3;  5I47 A;  3S1M H;  4DUY H;  4ECX A;  1BUV T;  1A6X A;  2V1C C;  2F3W A;  1PH6 A;  1M6V A;  1KLU D;  4IJL A;  1NMG A;  1CK1 A;  2UUC H;  1ESR A;  1SE8 A;  2R7N A;  2X69 A;  3UE1 A;  1TS3 A;  3CPF A;  3I4O A;  2PNR C;  5EAY A;  4OX9 Q;  3M4O H;  1CHP D;  2VPQ A;  2CQA A;  4TSS A;  4EQP A;  1QJO A;  4LFB L;  3JAM L;  1X3G A;  3SK6 A;  1VQM A;  5KYL A;  1CQF A;  4DAP A;  1S68 A;  4O3N A;  3SXH A;  3J7Y W;  2AHO B;  4DV0 Q;  4FXD A;  3FRP B;  2R86 A;  1F2L A;  1RCV D;  4JV0 A;  2UVV A;  5IOC A;  5M5W B;  4HSV A;  3BJY A;  1D1I A;  4AH6 A;  4A3D B;  3MFY A;  1UEB A;  4LMY A;  1C48 A;  4BXX G;  4JI5 H;  2KEN A;  2R8J A;  1H9R A;  2I07 B;  4EQO A;  4DR2 L;  3T5H A;  4FDB A;  3HOU B;  1PDQ A;  4GOP B;  1D6E C;  5JJK A;  1BBX C;  1GKH A;  3GTJ H;  4G7O C;  4Q8E A;  1WVL A;  2RHQ B;  3CU7 A;  3W5O A;  4TQS A;  1EIG A;  1RL2 A;  4PNY A;  2VUM B;  1A63 A;  4I7Z C;  1E4G T;  1UNN C;  3RNU A;  3LX0 A;  4L1K A;  2PBZ A;  1CKM A;  3PSI A;  2LFN A;  2Z6K C;  3H3V C;  4K0K L;  4UCU A;  4RHR A;  4CDF C;  4P73 A;  1VQD A;  5HGT A;  2K01 A;  1EZ6 A;  2WFW A;  4Q43 A;  4EEQ A;  2HHH L;  3TSS A;  1KDA A;  2VPS A;  1K73 C;  5G3L F;  5JPN C;  2VA2 A;  2E2I A;  1ESF A;  5JH7 F;  1I94 L;  4ABN A;  4KY7 A;  2BQU A;  4AYB G;  1EYG A;  2JA6 G;  4ED8 A;  3MC0 B;  2QYZ A;  1BCP D;  2K5H A;  2R61 A;  2D2C C;  4APV A;  5M5Y H;  4DR1 Q;  2RDF A;  1PHJ A;  5CV4 A;  4JI6 H;  5DM7 3;  5KNB A;  2AGO A;  4DR6 Q;  3JRX A;  3J81 c;  3Q0A A;  2C00 A;  1YI2 A;  3V2T A;  3QWN A;  5I9P A;  4JBM A;  3MA2 B;  4YHH L;  3M4I A;  1JE5 A;  3OTO H;  2UVR A;  3FPU B;  2RDH A;  3H0G G;  4LF8 Q;  3BYT B;  3E5S A;  4RGO S;  3VR5 A;  4QGU A;  2KCC A;  1GUG A;  4YCW A;  4LF7 Q;  5C0X H;  2ZTE A;  3DEP A;  5T1G A;  1WTX A;  2BH8 A;  4ED3 A;  5KFA A;  5KFM A;  1BCP B;  3BQ1 A;  4X64 H;  2EDG A;  3GIQ A;  1B33 N;  3OMC A;  5BR8 L;  4DV1 H;  4J6H A;  1JQY D;  2N55 A;  5IT9 c;  2NN6 G;  4M7E A;  4HNV A;  5KFD A;  3MXN A;  1SYE A;  3RJ0 A;  2WV6 D;  4EBC A;  1HZC A;  2PYK A;  4C3J G;  4KHV A;  4Y8V B;  3FDS A;  1OXX K;  5K2M A;  5TSS A;  4JI2 L;  1EQV A;  3PO3 G;  2FP4 B;  4TQR A;  3KHL A;  2FJZ A;  3I4N B;  4A3M G;  4CDC C;  3A56 A;  3RN2 A;  4FXG C;  2DY8 A;  2DJF C;  5KFQ A;  1HNX H;  1UUP A;  3ITP A;  5BN5 A;  4X62 L;  5M3M G;  1SE3 A;  4XYQ A;  4F8M A;  3F2B A;  4MV3 A;  1B4O A;  3HOW B;  2KCN A;  5FD5 A;  1N32 Q;  1HA5 A;  3E6Z X;  1Q8K A;  1TS5 A;  4RMF A;  1TS4 A;  2MO1 A;  4DR4 Q;  5IP9 H;  5JVH 3;  1UE1 A;  4GN5 A;  1HTP A;  3T1Y H;  1S5C D;  1HPC A;  5LMU Q;  1E0B A;  5K36 G;  1QE6 A;  2IWH A;  1SNQ A;  2ZT9 C;  4JV5 L;  4Q44 A;  1C3O A;  2RQX A;  4NDX A;  4JI1 H;  1Y69 U;  1KAW A;  1CKN B;  2WB1 B;  4O42 A;  1VQN A;  1G2S A;  3HGB A;  3HP3 A;  1SFO B;  4DK3 C;  3SK4 A;  4DXG A;  2FFK B;  1LT3 D;  1I94 H;  4IPH A;  1DM0 B;  1XNR Q;  5KFY A;  2YCH A;  3TP7 A;  1VQP A;  3X3N A;  3C0F B;  1QIL A;  3OIP A;  1I3Q H;  4MZ9 A;  2L55 A;  1PK8 A;  1LAC A;  3R2T A;  2C5C A;  1HNZ Q;  2UXC L;  4LJZ C;  4DK6 C;  5C44 H;  1R9T B;  2ZTD A;  5LL6 b;  2F4V H;  1EUJ A;  4X66 H;  2R93 A;  3HOY B;  1HNW H;  4Q45 A;  5EPL A;  1RTN A;  1F9R A;  4GOP C;  5JUM A;  3HB9 A;  4A3G B;  1STH A;  5C4X H;  2RGR A;  2BDO A;  3QB3 A;  3K5L A;  1W96 A;  3MFI A;  4K6D A;  1Q1E A;  1Q7Y C;  2XIG A;  1ICW A;  1FVI A;  1QNK A;  1XWE A;  1N34 Q;  4M1U B;  4HSP A;  1M8A A;  3Q6S A;  4EQN A;  1TKW B;  2R3Z A;  2RDG A;  4U6P A;  1RYS A;  1EY6 A;  3NBH B;  2B2U A;  4LH6 A;  1Q8I A;  1IKL A;  4JI4 H;  2B63 B;  5LL6 S;  4MNO A;  5BR8 H;  5C3X A;  3J7A V;  2JP1 A;  5IP7 G;  1D7Q A;  1DXM A;  2M9V A;  2R7Z A;  3R93 A;  2QIL A;  1JOQ A;  3JSL A;  1A3U A;  2KVM A;  3FHW A;  2KUM A;  3RZO B;  4ZUI A;  3S1R B;  1Q86 C;  2EYJ A;  4A93 G;  3KHG A;  5KFT A;  3C2P A;  3I72 A;  3JZI A;  2ENB A;  4B3M L;  3TP6 A;  2P0A A;  5IY0 A;  3IL8 A;  5LMN W;  5IGE A;  1WR2 A;  3UI2 A;  3FVQ A;  1VQL A;  3S17 B;  3A5Z B;  4R8U B;  5GAG C;  3IFT A;  1YJN A;  4J9P A;  3A7L A;  2Q2H A;  3CF5 A;  4A3L G;  1TY2 A;  4V19 0;  4O4L F;  1T3N A;  2NVY H;  2B2V A;  2HHH Q;  2EXD A;  3RTX A;  4V0B A;  1WI5 A;  3TP5 A;  3DM1 A;  3RAX A;  1A0I A;  2W6N A;  4CDE C;  2DJG C;  4AQY L;  3DF7 A;  4HAE A;  2JA7 G;  2EPB A;  1S4Z A;  3EVQ A;  2VW9 A;  1WTW A;  4GKJ H;  3R5X A;  1TWA H;  1BCP C;  1CE8 A;  2WDT A;  3S15 H;  3JSN A;  3MEF A;  5CV7 A;  3MWM A;  3L4J A;  2GN5 A;  4BBS G;  5I9O A;  1SR3 A;  4QJF A;  1KJQ A;  4F4Z A;  4EYI B;  4OWX B;  4R4I A;  2NB0 A;  3KBG A;  1EZ1 A;  4YHH Q;  4F88 A;  1QG7 A;  5JJI A;  3S15 B;  2QK4 A;  2NVX A;  4HID A;  4KJO A;  1VQG A;  4NXM H;  3LNN A;  3KK7 A;  1RHP A;  1AEX A;  1U4L A;  1STA A;  4C3I G;  1PFN A;  4WFN 3;  4LF6 L;  3UQ8 A;  2V4D A;  3MVV A;  3PW0 A;  3MAQ A;  3NEM A;  4DV4 Q;  3JAM W;  3PR4 A;  2A5H A;  4QL5 A;  3VR6 A;  2VQF Q;  4DV6 L;  4P71 A;  1EFI D;  1I6H H;  3CRL C;  4K5X A;  1EU4 A;  2KQ3 A;  3CW2 C;  1WD1 A;  2DLN A;  2JA5 G;  3VR3 A;  3TRZ A;  2WKD A;  3S16 H;  3TZU A;  5JVG 3;  1QVG A;  1JWU D;  2CH4 W;  2G5D A;  3TME A;  1I4R A;  2YRW A;  4PQX A;  2D0P A;  2VL6 A;  3BQ0 A;  5KND A;  3V4Z A;  2W6Q A;  2I8C A;  3U9T A;  1I4Q A;  4GS3 A;  3VYU A;  4C2M B;  5CMD A;  3T4A C;  3UFX B;  2Z6B A;  4H7B A;  4DV3 L;  2F0G A;  4A3F G;  1LTA D;  4A3K G;  2YZN A;  1D5X C;  2V5A A;  2DZD A;  4X65 H;  1O80 A;  3HFZ B;  5C4Z A;  3NSW A;  5KRU A;  3L2P A;  2KHJ A;  2ID0 A;  4ECQ A;  4X62 Q;  1UE7 A;  2PNH A;  1BXT A;  3PCO B;  3K5M A;  4OO1 G;  2HQE A;  2K4K A;  1KHI A;  1QUQ B;  3KYH C;  1K0S A;  4GLV B;  4IR1 A;  2A6E D;  1EOV A;  1H9K A;  2XGT A;  2WAQ G;  4O2B F;  3VA5 A;  4FBT A;  1I50 B;  4RWS C;  3ULJ A;  4KY5 A;  2KCT A;  4XT3 B;  2R84 A;  4KK7 A;  4RCO A;  1H9J A;  3GV3 A;  3L7Z C;  1N36 H;  3NEN A;  4ZOL F;  4A3J H;  2F0V A;  2KCM A;  2RCN A;  4LF5 H;  2HT1 A;  1WJJ A;  2JA8 H;  4A3D G;  2VQE L;  5DLF A;  4KN7 C;  3CCV A;  2RSO A;  4BY1 G;  3GTJ A;  3OW7 A;  3J81 j;  4B9X A;  1K0R A;  5AFW A;  5LXT F;  4DUZ L;  4IHJ F;  4JBK A;  3WNZ A;  2XCA A;  4JG2 A;  2F0N A;  2VA3 A;  3OIQ A;  2F0W A;  5C4J H;  1ET6 A;  4RAU C;  2DY7 A;  2MQH A;  4JK1 C;  2O03 A;  1DV1 A;  2UXC Q;  2B2T C;  2XN9 C;  4IUN A;  1NUC A;  1X9N A;  1O75 A;  2W7O A;  3V6K A;  2H4O A;  2UXD H;  1SNM A;  3RV3 A;  4RKL A;  4DAY A;  2HGS A;  4YR2 A;  3Q8S B;  4BA2 I;  1HQM C;  4Q5V A;  4MTN A;  5EKK A;  2A8V A;  4YAK B;  4DV6 H;  2LS0 1;  5ELD A;  2AGQ A;  1AUX A;  2CQO A;  1IBL L;  4BXX H;  2XNA C;  1MHW C;  1JWM D;  2CZG A;  1AZP A;  3OMG A;  1J5E L;  4LH7 A;  1LT4 D;  4A3B B;  1SCU B;  4KMU C;  4ZLT F;  1KJ9 A;  1VQC A;  2B2W C;  2C22 A;  5EZY F;  2XWB B;  3DM3 A;  4IFD I;  1W6J A;  5HY6 A;  4QW8 A;  1SLJ A;  2K6A A;  3BDO A;  5CV8 A;  2ICI A;  5D8D A;  2ATW A;  1KAB A;  5IGG A;  1NJI C;  2E2I H;  5JVD F;  3KDF A;  5FPR A; 
#chains in the Genus database with same CATH homology
 4B3M Q;  2EQS A;  1EIF A;  5IYD H;  1N33 L;  5FJ8 H;  1XMQ L;  1KQS A;  4HJA A;  1XPR A;  4POG A;  1KC8 C;  3KFU A;  4LWC A;  4LUO A;  4IPD A;  3I7F A;  3EIV A;  1V9P A;  3I56 A;  3U4Z A;  2JA6 H;  3NEL A;  1X3F A;  2LXK A;  3L0O A;  5FLM H;  3KF6 A;  4KI0 A;  3I55 A;  1PH8 A;  4A3I G;  2IX0 A;  2QEX A;  3A5U A;  3S2D H;  4O2D A;  2DGY A;  4XTC S;  3CPW A;  4KHP Q;  1Y1W G;  4A3C H;  4OO1 I;  2UXD L;  2WP8 J;  2N78 A;  3EBE A;  4L5Q A;  1WCM G;  1U5K A;  4EQ5 A;  1NY4 A;  3A0J A;  4GKK L;  4TVA B;  4DV4 L;  4AQY Q;  1JT8 A;  3CCL A;  2I5L X;  1FL0 A;  4YCU A;  2VQF L;  3HOZ G;  1GD7 A;  1YBY A;  3H0G H;  1JB7 A;  4PZ6 A;  3KF6 B;  2UU9 L;  3K7A H;  3UE0 A;  2BA0 A;  3JAM i;  1L2F A;  4QIW E;  4DR5 Q;  1OXV A;  2NZH A;  4JI4 Q;  1HZA A;  4L5T A;  1ASY A;  2N49 A;  5BR8 Q;  4XIG S;  2JA9 A;  5IYB G;  3I4N H;  2PI2 E;  1YZ6 A;  2N8N A;  1VCI A;  3PGZ A;  4EX5 A;  2QA4 A;  3FKI G;  5H1S E;  1EWI A;  1S40 A;  5ELN A;  2NVX H;  3JAM c;  4JI7 Q;  4LF6 Q;  4DR4 L;  1Y1V G;  2E2H H;  4WJ4 A;  2F52 A;  4YWK A;  3CCS A;  1CUK A;  3U4V A;  4JI2 Q;  2OQK A;  4OON A;  1A62 A;  2XTI A;  5LMU L;  3F2C A;  3HOW H;  1QUQ A;  5IYC G;  4DV2 L;  2OTJ A;  3I4M G;  4C3J H;  4GLX A;  4A4I A;  2I5H A;  3MXN B;  4HJ9 A;  3PO3 H;  3TS0 A;  2Y0S E;  1HH2 P;  4IPC A;  5LMN L;  1M1K C;  1NE3 A;  3CMA A;  2ZJR A;  4A3M H;  2CCZ A;  4JI6 Q;  2GVA A;  1HJP A;  2R7F A;  4IOA A;  1N9W A;  4JBJ A;  3M4P A;  3PUV A;  3H3V I;  3TRE A;  1YNX A;  5AJ3 Q;  4JI8 Q;  3STB C;  4JI3 L;  2ALY B;  3OTO Q;  4GN3 B;  1HR0 Q;  3CCE A;  3CAM A;  1U0L A;  4R4O A;  3PF5 A;  2I0Q A;  1X54 A;  4HJ7 A;  3M7N A;  4JBW A;  4DV3 Q;  4HJ8 A;  3J7A 5;  4HIO A;  2E5L L;  3S2H H;  2IT1 A;  1SFO H;  2UXB L;  2ZM6 Q;  4HIK A;  3S1Q H;  4A3J G;  4JOI C;  2R6G A;  2UUA L;  1JMC A;  3AFQ A;  1HNZ L;  4UPA A;  4R4C A;  3CC7 A;  1EFW A;  2JA8 G;  3S1N H;  4JV5 Q;  1E1T A;  3RLO A;  1PVO A;  1C7Y A;  1B8A A;  1XTD A;  3TQY A;  3S1M H;  1MKH A;  2N3S A;  4X64 Q;  4LFA L;  2V1C C;  1PH6 A;  1LTL A;  4IJL A;  1VQH A;  1NMG A;  3J7Z C;  4DV1 Q;  1SE8 A;  3U58 A;  4PZ7 A;  3UE1 A;  4NXN L;  2MNA A;  3CPF A;  2BA1 A;  3UDG A;  1R9T H;  1LYL A;  3I4O A;  5EAY A;  4OX9 Q;  3HOU G;  3BZC A;  3JC6 6;  3HOY H;  3M4O H;  2YYZ A;  1V43 A;  4DV7 Q;  1VQA A;  1VQM A;  1X3G A;  2VUM G;  4C3H H;  4A3G H;  4LFB L;  2R93 G;  3ULP A;  2R92 H;  3RLF A;  2AHO B;  4Y7N H;  4DV0 Q;  4KLK A;  4GNX A;  3G48 A;  1A8V A;  2KHI A;  4ME3 A;  2CWA A;  5FLX c;  4BBR G;  3PO2 G;  2HIV A;  4AH6 A;  2R93 H;  3GTP H;  1UEB A;  1JJ2 A;  4BXX G;  1YHA A;  2KEN A;  4B3R L;  3K80 C;  2Z0S A;  4DR2 L;  4FDB A;  2B63 H;  1C9O A;  4YWL A;  1XNQ L;  2JK8 A;  4GOP B;  3GTO H;  5JJK A;  1GKH A;  3GTJ H;  1FJG Q;  2RHQ B;  3UDX A;  4KHZ A;  3W5O A;  1PA6 A;  1RL2 A;  2UUB L;  4GNX B;  1UE5 A;  4DUZ Q;  1A63 A;  3B6Y A;  1S3O A;  3RZO H;  3RNU A;  3S1R H;  4IO9 A;  1CKM A;  3PSI A;  1VQI A;  2D62 A;  2ZJQ A;  2K5V A;  2Z6K C;  4A76 A;  2R7Z G;  4K0K L;  4P73 A;  1VQD A;  3HOV G;  2PI2 A;  4DV5 L;  1VQ6 A;  3E9I A;  2WFW A;  5M3F G;  1ASZ A;  3T1H L;  1VS0 A;  4POF A;  2PQA B;  3BU2 A;  2HHH L;  4DUY L;  1TWC H;  5IYD G;  1K73 C;  3I2Z A;  5FJ8 G;  3IRB A;  4A75 A;  4B3S L;  3S17 H;  4IPG A;  1Q82 C;  5IP7 H;  2Y0S G;  1I94 L;  3K0X A;  3J81 i;  4IJH A;  4AYB G;  1EYG A;  1IBL Q;  2JA6 G;  4A93 H;  1HZ9 A;  3OW2 A;  5FLM G;  2K5H A;  1PHJ A;  4APV A;  2OCE A;  5M5Y H;  2D0O A;  5IWA Q;  1SRU A;  2VZA A;  4DR1 Q;  1J5E Q;  1PH3 A;  4A3C G;  1YJ9 A;  4DR6 Q;  3J81 c;  1VQJ A;  1YI2 A;  1CKO A;  1W2B A;  4JBM A;  4YHH L;  1OXU A;  4ALP A;  1KIX A;  1JE5 A;  4KHP L;  4RG1 A;  2F4V Q;  3KJP A;  4X66 Q;  1HNW Q;  3H0G G;  2Q2I A;  3DLL A;  4LF8 Q;  4LF5 Q;  2K5N A;  1KRT A;  4JI5 L;  4LFC Q;  4A3L H;  2MFI A;  4QGU A;  3RN5 A;  1IBM L;  4YCW A;  1L1O A;  4LF7 Q;  2ZTE A;  3CP0 A;  5M5X H;  2BH8 A;  3S24 A;  2LSS A;  2IHE A;  1XMQ Q;  1PH7 A;  4DNI A;  3I4N G;  2AKW B;  2JJQ A;  2JA7 H;  4DR5 L;  2RF4 A;  3W1B A;  5JEA J;  1G51 A;  1IYJ B;  1Q46 A;  1C0A A;  5BR8 L;  1HZB A;  5IT9 c;  2NN6 G;  1GO3 E;  4BBS H;  1L1O B;  1OTC A;  3HOW G;  4IFD I;  1HZC A;  5DLQ E;  3M4Q A;  1BVS A;  2E8G A;  1PH5 A;  1OXX K;  4OWW B;  4GKK Q;  4DR3 Q;  4JI2 L;  3PO3 G;  2HIX A;  1X56 A;  2FXQ A;  3CME A;  3D0F A;  1VQ8 A;  4A3M G;  4DV6 Q;  1K83 H;  1PH9 A;  3RN2 A;  2YU9 H;  2UU9 Q;  4PG3 A;  4PZ8 A;  4C2M H;  1PFS A;  4DR7 L;  4X62 L;  1NMF A;  5M3M G;  3LGJ A;  1QZG A;  4JI6 L;  3F2B A;  1KD1 C;  4AYB E;  3H15 A;  4P75 A;  1BKB A;  4YY3 L;  2WB1 G;  2LXJ A;  2AWN A;  4P74 A;  4JI8 L;  3K7U C;  5M3M H;  3OTO L;  1HR0 L;  1Q8K A;  1N32 Q;  2K52 A;  4RMF A;  1V1Q A;  1GVP A;  1X55 A;  2MO1 A;  4UP7 A;  3STB D;  4DR4 Q;  1AH9 A;  5IP9 H;  3ER0 A;  1UE1 A;  1JJC B;  3CQZ H;  3D31 A;  4GN5 A;  3UDI A;  1IBK L;  5LMU Q;  1D8L A;  2GVB A;  1UE6 A;  3PUX A;  1YHQ A;  4GKJ Q;  3GTQ H;  5K36 G;  2VY3 A;  2BH2 A;  1TWF H;  1TWG H;  4TQU S;  4JV5 L;  1WYD A;  1XJV A;  4UP8 A;  4QY7 A;  4A3F H;  4A3K H;  4H02 A;  1KAW A;  1CKN B;  4X64 L;  1VQN A;  3Q8D A;  1E3P A;  1I50 H;  5C0X J;  4QQB X;  1EQR A;  1VQK A;  3AYH B;  4NPS A;  4DK3 C;  4DV1 L;  1K9M C;  3HOY G;  1VQ4 A;  1T9H A;  4JI0 L;  3SGI A;  4IPH A;  1XNR Q;  4HJ5 A;  4A3G G;  3WWV A;  2R92 G;  4OX9 L;  3GO5 A;  5GRO A;  1Z9F A;  1VQP A;  1N36 Q;  4NXM Q;  2NVT H;  3GTK H;  3HKZ G;  5JJL A;  2E5L Q;  1PV4 A;  1I3Q H;  1O7I A;  2UXB Q;  4MZ9 A;  4YWM A;  1MJE A;  1H95 A;  4GOP A;  4DV0 L;  1HNZ Q;  3M85 A;  1Y14 B;  5C44 H;  4DK6 C;  2R7D A;  1HNX L;  2B63 G;  2UXC L;  4X6A H;  2ZTD A;  1EUJ A;  5JEA G;  4LF4 L;  4HIM A;  1E7Z A;  4GOP C;  3K8A A;  4GN4 B;  1B70 B;  1P16 A;  5C4X H;  1G29 1;  5C0X I;  3CXC A;  2VQE Q;  4GNX C;  1VQ9 A;  1XMO L;  4LUV A;  1Q1E A;  1Q7Y C;  4NXN Q;  1YJW A;  2PQA A;  2JE6 I;  1FVI A;  1J6Q A;  4P72 A;  1N34 Q;  2WB1 E;  3KJO A;  4BY1 H;  3T1Y L;  3NBH B;  2ZTC A;  1RIP A;  1YEZ A;  2H5X A;  2CFM A;  2Q2T A;  3M3Y H;  1FGU A;  4MNO A;  4X65 Q;  3BJU A;  3E9H A;  2IX1 A;  3U50 C;  5IP7 G;  4LF9 Q;  1D7Q A;  1JJG A;  1PH1 A;  1BBU A;  4JI1 L;  2NN6 I;  1KL9 A;  1SMX A;  3FHW A;  4A93 G;  1VQO A;  1Q86 C;  3PIP A;  5C3E H;  4A3D G;  1OXT A;  4JYA L;  2IY5 B;  4A3B H;  4PMW A;  1KXL A;  3M9B A;  4B3M L;  4BY7 H;  3H3V H;  2UUB Q;  1QVF A;  5IY0 A;  4LNQ A;  4NB3 A;  3PIO A;  5LMN W;  4B3T Q;  3GTG H;  1SN8 A;  4DR1 L;  2NVQ H;  1VQL A;  1IXR A;  1I5F A;  4DAY B;  3CCM A;  3A5Z B;  3AFP A;  5GAG C;  3ICE A;  4DR6 L;  5GQO A;  4DV5 Q;  3KLW A;  1YJN A;  3CF5 A;  2Q2H A;  1EIY B;  4A3L G;  2VNU D;  3HKZ E;  3J80 i;  3PF4 A;  2Q2U A;  2NVY H;  3T1H Q;  4UY8 C;  2E2J H;  3F8T A;  4X66 L;  2HHH Q;  5C0X G;  2F4V L;  4DUY Q;  2EXD A;  2CKZ B;  1HNW L;  4LF8 L;  1K8A C;  1X65 A;  4B3S Q;  1WI5 A;  1A0I A;  1IZ6 A;  3A74 A;  4DKA C;  4AQY L;  1NBW A;  2UUC Q;  2JA7 G;  2VW9 A;  2K14 A;  5ELO A;  3J80 c;  1TWA H;  3KF8 B;  3S15 H;  1LUZ A;  1N33 Q;  3MEF A;  4R4T A;  4R1J A;  2GN5 A;  4UP9 A;  4BBS G;  1IL2 A;  1P8L A;  1SR3 A;  3BZK A;  3EN2 A;  4QJF A;  1PH4 A;  1L1O C;  3RZD H;  4JI4 L;  3GTL H;  4OWX B;  4R4I A;  4YHH Q;  5JJI A;  2C35 B;  1Q1B A;  3KDF B;  2AWO A;  3HKS A;  4HID A;  2RHS B;  1VQG A;  2F3I A;  2UXD Q;  2DUD A;  4JI7 L;  2HQL A;  3K81 C;  4LF6 L;  5IE8 A;  4Y52 H;  4JI5 Q;  4DR3 L;  4IOC A;  4A3I H;  4DV4 Q;  2AMC B;  3NEM A;  1IBM Q;  3G4S A;  4L5S A;  4QL5 A;  4DV6 L;  2VQF Q;  1Y1W H;  3F2D A;  4P71 A;  1WCM H;  1I6H H;  4C3I H;  1WFQ A;  1N8R C;  3CW2 C;  1YIT A;  1W3S A;  4A3E G;  2JA5 G;  3TRZ A;  1Q81 C;  4LW1 A;  3HOZ H;  2CWP A;  3S16 H;  4JCV E;  1QVG A;  1VQB A;  1BBW A;  2OQ0 A;  3S14 H;  5IP9 G;  4IFD G;  5GAD C;  2D0P A;  2VL6 A;  1PYB A;  3ERS X;  1N32 L;  4A3E H;  1OXS C;  1YVC A;  3GDE A;  5AJ3 L;  2JA5 H;  1TWH H;  2EIF A;  4GS3 A;  1CKN A;  5IYB H;  4DV3 L;  3FKI H;  1M90 C;  4A3F G;  4A3K G;  4GKJ L;  2ZM6 L;  1X6O A;  2IHF A;  1AE3 A;  4DV2 Q;  3FP9 A;  3HFZ B;  1Y1V H;  3RLN A;  4OXP A;  1UWV A;  5J3B A;  3L2P A;  2KHJ A;  3UDF A;  1PH2 A;  2ID0 A;  5LMN Q;  4DR7 Q;  4X62 Q;  1UE7 A;  5IYC H;  1PYS B;  2JEA I;  1B7Y B;  2NZO A;  4AIM A;  3I4M H;  1VQ7 A;  1AE2 A;  2PNH A;  3PCO B;  4YY3 Q;  4OO1 G;  2K4K A;  3KYH C;  1KHI A;  1QUQ B;  1NTG A;  2MO0 A;  3KOJ A;  1XNR L;  1QVC A;  4GLV B;  3PUW A;  4JOI A;  4JI3 Q;  1EOV A;  2XGT A;  4NXM L;  1N36 L;  2WAQ G;  3CCU A;  3VDY A;  1SRO A;  2YTX A;  5C44 G;  1LM0 A;  1XPO A;  1XPU A;  2JEB I;  2KBN A;  1IBK Q;  4DV7 L;  1VQE A;  4O0A A;  1E22 A;  3ULJ A;  1VQF A;  3GD7 A;  2KCT A;  3G71 A;  1G6P A;  4L5R C;  3HOX G;  2UUA Q;  2PMZ E;  1YIJ A;  5C4X G;  3L7Z C;  3NEN A;  4A3J H;  1Q12 A;  1MJC A;  1CSP A;  2KCM A;  2RCN A;  4JC0 A;  4LFA Q;  3HOX H;  2OWO A;  1WJJ A;  1K3R A;  2YTV A;  5HGQ A;  2VQE L;  2HT1 A;  2JA8 H;  4OWT B;  3CCV A;  4WJ3 M;  4BY1 G;  4JI0 Q;  2L15 A;  3J81 j;  4BA1 I;  1FJG L;  1K0R A;  5M5W H;  1N34 L;  4DUZ L;  4A3D H;  4JBK A;  1GM5 A;  2ES2 A;  3CC2 A;  4DPG A;  2VS1 A;  4JG2 A;  4LFB Q;  3AQQ A;  1L0W A;  3HOU H;  5C4J H;  1X3E A;  4X65 L;  2K50 A;  2MQH A;  1EQQ A;  2K75 A;  2UXC Q;  1HNX Q;  1DGS A;  3E0E A;  5C3E G;  4LF9 L;  4DAM A;  2ZJP A;  1X9N A;  3GTM H;  1WOC A;  2VUM H;  3RR5 A;  4IFD J;  4LF4 Q;  3ULL A;  4YCV A;  4A3B G;  1E24 A;  1VQ5 A;  1E1O A;  1QZH A;  4BY7 G;  2ASB A;  3PV0 A;  5E7N A;  3ZJY C;  3TS2 A;  4BA2 I;  2I5M X;  2JQO A;  4B3R Q;  4DR2 Q;  4MTN A;  1Z47 A;  4BBR H;  2A8V A;  1XMO Q;  1XNQ Q;  2Z6K A;  1S72 A;  3PO2 H;  1CSQ A;  3AEV A;  4LUZ A;  2CQO A;  1IBL L;  4BXX H;  5GAH C;  3F1Z A;  4B3T L;  2OTL A;  4R4Q A;  3T1Y Q;  2A1A A;  2YV5 A;  5IWA L;  1K8G A;  1J5E L;  2A19 A;  4K0K Q;  3CC4 A;  2WAQ E;  3PUY A;  3CD6 A;  3CCQ A;  5GAE C;  1KRS A;  2B3G A;  3PUZ A;  1HR0 W;  1VQC A;  4JI1 Q;  2B29 A;  2QGQ A;  3DM3 A;  3OYY A;  4J15 A;  3TEH B;  3W1G A;  3G6E A;  5HY6 A;  3CCJ A;  1SLJ A;  3CCR A;  2R7Z H;  1YHB A;  4LF5 L;  3HOV H;  1TXY A;  2YTY A;  4LFC L;  2ATW A;  2UUC L;  5M3F H;  4GLA C;  1NJI C;  2E2I H;  4JYA Q;  1I94 Q;  1MIU A;  4LF7 L;  3KDF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...