2VUMK

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
b'MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule tags Transferase
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2vumK00
2WB1L 5IP9K 2VUMC 3H3VL 1TWHK 4MQ9A 3I4NK 3M4OC 3PO3K 4A93C 4A3LC 5C4JK 2O5JA 3HKZD 2VUMK 1HQMA 5M3MK 1Y1VC 5C3EC 4A93K 4A3DK 1TWCC 1I6VA 4KN7A 4QIWL 1I6HC 5C3EK 1Y1VK 1TWGC 4YFKA 1TWCK 3GTMC 4G7HA 3GTKC 1TWGK 3GTMK 5M5WK 4YFNA 4A3BK 3PO2C 4OIRA 3GTKK 1XPPA 4MEYA 2Y0SL 2E2HC 3PO2K 3M3YK 3S14C 3HOVC 5IYBK 4QJVB 2E2HK 3S14K 4YFXA 3HOVK 2B63C 1I3QC 4KN4A 4LLGA 3S16K 5M5XK 3H0GC 3S2HK 3HKZL 1YNJA 3GTQC 1K83C 3HOXC 1Y1WC 3S17C 5M5YK 4AYBD 4OIPA 2NVYC 2E2IK 1K83K 5FLMK 2JA5C 3GTLK 2A6EA 3FKIK 1Y1WK 3GTOC 5FJ8K 4A3IK 2NVTC 3S17K 4A3LK 2NVYK 4XLNA 3M4OK 4QJVA 2JA5K 3GTOK 4X6AC 2NVTK 4A3JC 4A3FC 4Q5SA 4C3IK 4X6AK 4YG2A 2JA8C 3HOZC 5M3FK 1I6HK 1WCMC 4A3JK 3K7AC 2YU9C 3GTGC 3HOYC 3RZOC 2JA8K 3HOZK 1SMYA 3K7AK 2YU9K 3GTGK 1ZYRA 3HOYK 3GTPC 2NVQC 4G7OA 3GTLC 4A3CC 4LK0A 1IW7A 3GTPK 1SFOC 3S1NC 2NVQK 4A3CK 2NVXC 4GZYA 4A3EC 1SFOK 4AYBL 2E2JC 3I4MC 4MEXA 4XSZA 2NVXK 1I3QK 2B63K 2PPBA 3H0GK 3I4MK 4BY7C 2O5IA 4Q4ZA 3GTQK 1BDFA 4OIQA 4BY7K 3HOXK 2JA7C 4G7ZA 3CQZC 5TMCA 3CQZK 1I50C 5D4DA 2R92C 4BXXC 1R9TC 4A3FK 3S1QC 2BE5A 4C2MK 4XLPA 2JA6C 4BBSC 4BXXK 1R9TK 3HOWC 5C4XC 1WCMK 3EQLA 3S1QK 4A3GC 3S15C 2WAQD 4LJZA 3RZOK 5C4XK 3HOWK 4BY1C 4A3MC 3S15K 2PA8L 1TWHC 4OIOA 1TWAC 5TMFA 3S1NK 4A3DC 1TWAK 3DXJA 2PA8D 3HOUC 4A3EK 3WODA 3RZDC 3S2DK 2A6HA 2E2JK 4XSXA 4Y7NC 2WB1D 3HOUK 3H3VD 4A3MK 3RZDK 4JK1A 4NOIA 3GTJC 5C44C 4Y7NK 2R93C 4KMUA 5IYCC 4A3BC 2R7ZC 2JA7K 4QIWD 4ZH4A 5C44K 3GTJK 2R93K 5IYCK 3M3YC 2A69A 2R7ZK 5IYBC 2WAQL 4BBRC 2PMZL 4Y52C 1I50K 2R92K 1YNNA 3S16C 3S1RC 2A68A 4BBRK 2CW0A 4C3JK 4Y52K 4BBSK 4A3KK 2JA6K 3S2HC 2Y0SD 2PMZD 5IYDC 3S1RK 4OINA 4C3HK 3S1MC 5IP7C 1TWFC 4LK1A 4A3KC 3S2DC 4A3GK 5IP9C 3S1MK 3I4NC 5IYDK 2E2IC 3PO3C 4BY1K 5FLMC 5IP7K 1TWFK 5C4JC 3FKIC 4A3IC
chains in the Genus database with same CATH superfamily
1C0AA 2JA5A 1J98A 1TWHK 3HXAA 2P5MA 4GTCA 2RGRA 1O27A 5CHPA 2VUMK 1HQMA 4A3DK 4A93K 5C3EK 1WOSA 1TWCK 1WCMA 1RU0A 3IPJA 3GTMK 4KB2A 3GTPA 3PO2C 4OIRA 1XXBA 2E2HC 1DD5A 3LAPA 5IYBK 4QJVB 3A8IA 3CAGA 3HOVK 2B63C 3GEIA 1XZQB 3H0GC 3GEEA 1IL2A 3S17C 1USMA 2NVYC 3GTLK 3GTOC 2A6EA 2D6FC 4A3IK 4LOWA 4X6AC 1J6WA 1I50A 2NVTK 4A3JC 4C3IK 2RH6A 3N3YA 5TJ3A 2JA8K 3HOZK 1SMYA 3GTGK 1ZYRA 4G7OA 1TWHA 5HL8A 2NVQK 4A3EC 3NUHA 4XSZA 2B63K 2ZUFA 3H0GK 3I4MK 3A8JA 3GSIA 1BDFA 4OIQA 4BY7K 4G7ZA 2R7ZA 1VGXA 3FOEA 2XCQA 2R92C 4BXXC 3V4GA 1IBAA 2BE5A 2JA6C 1R9TK 5C4XC 1O2BA 1JQWA 4LJZA 1TWFA 3HOWK 3Q3QA 4G0UA 1JVIA 2PA8L 3GTLA 1UV7A 4LR2A 1B4BA 1TWAK 3DXJA 4A3EK 3RZDK 4GTAA 5IOTA 4Y7NK 2R93C 4A3BC 3GTJK 4ZH4A 1WORA 3M3YC 4KMDA 4KM8A 2E2HA 3L4KA 2PMZL 4Y52C 3BP3A 2R92K 3OPFA 3S16C 2CW0A 4C3HC 2B63A 3AQPA 3H0GA 2JA6K 4OINA 1USOA 4A3KC 5JVOA 2P8TA 3TFHA 5FLMC 2NVYA 2Y3PA 2VUMC 3GTOA 3H3VL 4A3LC 4MQ9A 3M4OC 3PO3K 1PJ7A 4A93C 5C3EC 1TWCC 4KN7A 1Y1VK 4KMAA 1V5VA 5IOSA 3GTMC 5EGHA 5M5WK 4YFNA 4A3BK 1XPPA 4MEYA 3M3YK 3HOVC 3S16K 3LAJA 5M5XK 2FQOA 1WOOA 1YNJA 3AD8C 3GEHA 1ISEA 2XCRB 5FLMK 5FJ8K 2NVTC 4A3LK 4GTDA 1L0WA 3M4OK 4C3IC 4BLAA 5JFEA 3T02A 2R92A 2KWAA 3JSTA 3BP8C 4Q5SA 2JA8C 3HOZC 5M3FK 2JA6A 3GTGC 1EQRA 3HOYK 2YU9K 2NVQC 1WQGA 1PJ6A 2CFAA 4KASA 2GAGC 1O26A 4A3CK 1WOPA 4GZYA 1SFOK 3G4CA 4AYBL 1BS2A 3I4MC 4MEXA 2NVXK 4KC6A 3TFJA 4BY7C 2O5IA 4Q4ZA 3TTGA 2R93A 1WSRA 4FZBA 2JA7C 1O2AA 1J6XA 1IQ0A 2ZFZA 3CQZK 5D4DA 1EFWA 1R9TC 2V6TA 5IORA 4XLPA 4BBSC 3HOWC 3AD7C 3S15K 4XCHA 4OIOA 4LQYA 1TWAC 4G0VA 2VUMA 1DCOA 1KQ4A 1TWCA 3RZDC 4Y7NC 5IOQA 3H3VD 3GTMA 4NOIA 3GTJC 4KAWX 3TFIA 4PABA 4GTFA 2JA7K 3GIRA 4KDDA 5IYCK 3AD9C 3BUEA 2W7VA 3A8KA 1YNNA 4GFQA 2A68A 4C3JK 2ZUEA 3VA7A 4BBSK 3S2HC 1EK8A 4WJ4A 3S1RK 1ZBSA 5IYDK 3PO3C 3FKIC 3S2DK 2WB1L 3N0BA 5IP9K 3I4NK 2O5JA 3L4JA 5C4JK 5M3MK 1Y1VC 4P5AA 1I6HC 4GTLA 3GTGA 4KATA 4G7HA 4J3NA 1F7UA 1TWGK 3GTKK 4KMHA 3G4AA 2Y0SL 4AH6A 1EH1A 1B4AA 4WJ3M 3S14K 4YFXA 1I3QC 3LPXA 4RMFA 3FOFA 3S2HK 3ADAC 3HKZL 1WIHA 1X31C 3OEPA 3HOXC 3S0XA 2JA7A 4AYBD 4OIPA 1K83K 3FKIK 1Y1WK 3SZYA 4WILA 1F93A 2CFAB 4XLNA 2V6UA 1YCLA 2JA5K 4M1XA 4A3FC 2XCOA 1R9TA 4C2MC 1I6HK 4GTEA 1F7VA 2YU9C 3HOYC 3QX3A 4G0WA 3RZOC 4P9SA 1BJTA 3K7AK 2GSOA 2EBBA 4A3CC 1IW7A 3GTPK 1TWAA 1SFOC 2NVXC 2PHCB 1I3QK 1XZPA 1GE9A 3GTJA 1VH2A 3HOXK 1F9NA 1EI6A 3CQZC 1VLOA 4A3FK 4C2MK 3S1QK 3EQLA 4A3GC 3S15C 3RZOK 1O25A 3MMLB 5EGEA 1K83A 3FKIA 1JOEA 3ERED 1Y1VA 2PA8D 3WODA 1O28A 4XSXA 2WB1D 3HOUK 1ZVUA 1ZXOA 4PAAA 4KMUA 5IYCC 4KM9A 5C44K 1J6VA 2GSNA 4GT9A 2R7ZK 1HI9A 1YX2A 2WAQL 4C3JC 4P5BA 5L46A 1VRQC 4DDQA 3S1RC 4BBRK 1I3QA 2Y0SD 2PMZD 5IYDC 2GAHC 1WQFA 4A3GK 4LK1A 1O24A 3S2DC 5IP9C 3S1MK 3I4NC 2E2IC 5IP7K 1TWFK 5C4JC 1DCPA 1AB4A 3HKZD 4ILDA 1I6VA 1WSVA 4QIWL 1TWGC 4YFKA 2YU9A 3GTKC 3N0CA 1BGWA 3PO2K 3S14C 1SFOA 3AH5A 3FHZA 3GDZA 2E2HK 4C45A 2NVXA 3SZZA 4KN4A 4LLGA 3GTQC 1K83C 3T01A 1Y1WC 5M5YK 2E2IK 3CQZA 2JA5C 3S17K 2NVYK 4QJVA 3GTOK 1ZQ1C 4X6AK 1XZQA 4YG2A 4O2DA 4BKWA 1WCMC 5CJ9A 3K7AC 4A3JK 1XXCA 4KB4A 1XZPB 3GTPC 3GTLC 4LK0A 4FM9A 3S1NC 2GSUA 2FQTA 2E2JC 3OREA 3T00A 1VJEA 2PPBA 2JH3A 1O2FB 3GTQK 4KARA 1WQHA 5TMCA 1DCHA 1I50C 1O29A 1IS1A 1G51A 3S1QC 4BXXK 1WCMK 2WAQD 1IE0A 5C4XK 4BY1C 4A3MC 4GTBA 2E2IA 1TWHC 5TMFA 3S1NK 4A3DC 3AQOA 3HOUC 2A6HA 2E2JK 1XXAA 1TWGA 4JK1A 3GTKA 5C44C 1INNA 2R7ZC 4QIWD 4BLBA 2R93K 2A69A 5E68A 5IYBC 4BBRC 1I50K 2V6SA 4Y52K 3S1MC 4C3HK 5IP7C 1TWFC 1PJ5A 3GTQA 1Y1WA 4BY1K 4A3MK 4A3KK 4A3IC
chains in the Genus database with same CATH topology
2WB1L 5IP9K 2VUMC 3H3VL 1TWHK 4MQ9A 3I4NK 3M4OC 3PO3K 4A93C 4A3LC 5C4JK 2O5JA 3HKZD 2VUMK 1HQMA 5M3MK 1Y1VC 5C3EC 4A93K 4A3DK 1TWCC 1I6VA 4KN7A 4QIWL 1I6HC 5C3EK 1Y1VK 1TWGC 4YFKA 1TWCK 3GTMC 4G7HA 3GTKC 1TWGK 3GTMK 5M5WK 4YFNA 4A3BK 3PO2C 4OIRA 3GTKK 1XPPA 4MEYA 2Y0SL 2E2HC 3PO2K 3M3YK 3S14C 3HOVC 5IYBK 4QJVB 2E2HK 3S14K 4YFXA 3HOVK 2B63C 1I3QC 4KN4A 4LLGA 3S16K 5M5XK 3H0GC 3S2HK 3HKZL 1YNJA 3GTQC 1K83C 3HOXC 1Y1WC 3S17C 5M5YK 4AYBD 4OIPA 2NVYC 2E2IK 1K83K 5FLMK 2JA5C 3GTLK 2A6EA 3FKIK 1Y1WK 3GTOC 5FJ8K 4A3IK 2NVTC 3S17K 4A3LK 2NVYK 4XLNA 3M4OK 4QJVA 2JA5K 3GTOK 4X6AC 2NVTK 4A3JC 4A3FC 4Q5SA 4C3IK 4X6AK 4YG2A 2JA8C 3HOZC 5M3FK 1I6HK 1WCMC 4A3JK 3K7AC 2YU9C 3GTGC 3HOYC 3RZOC 2JA8K 3HOZK 1SMYA 3K7AK 2YU9K 3GTGK 1ZYRA 3HOYK 3GTPC 2NVQC 4G7OA 3GTLC 4A3CC 4LK0A 1IW7A 3GTPK 1SFOC 3S1NC 2NVQK 4A3CK 2NVXC 4GZYA 4A3EC 1SFOK 4AYBL 2E2JC 3I4MC 4MEXA 4XSZA 2NVXK 1I3QK 2B63K 2PPBA 3H0GK 3I4MK 4BY7C 2O5IA 4Q4ZA 3GTQK 1BDFA 4OIQA 4BY7K 3HOXK 2JA7C 4G7ZA 3CQZC 5TMCA 3CQZK 1I50C 5D4DA 2R92C 4BXXC 1R9TC 4A3FK 3S1QC 2BE5A 4C2MK 4XLPA 2JA6C 4BBSC 4BXXK 1R9TK 3HOWC 5C4XC 1WCMK 3EQLA 3S1QK 4A3GC 3S15C 2WAQD 4LJZA 3RZOK 5C4XK 3HOWK 4BY1C 4A3MC 3S15K 2PA8L 1TWHC 4OIOA 1TWAC 5TMFA 3S1NK 4A3DC 1TWAK 3DXJA 2PA8D 3HOUC 4A3EK 3WODA 3RZDC 3S2DK 2A6HA 2E2JK 4XSXA 4Y7NC 2WB1D 3HOUK 3H3VD 4A3MK 3RZDK 4JK1A 4NOIA 3GTJC 5C44C 4Y7NK 2R93C 4KMUA 5IYCC 4A3BC 2R7ZC 2JA7K 4QIWD 4ZH4A 5C44K 3GTJK 2R93K 5IYCK 3M3YC 2A69A 2R7ZK 5IYBC 2WAQL 4BBRC 2PMZL 4Y52C 1I50K 2R92K 1YNNA 3S16C 3S1RC 2A68A 4BBRK 2CW0A 4C3JK 4Y52K 4BBSK 4A3KK 2JA6K 3S2HC 2Y0SD 2PMZD 5IYDC 3S1RK 4OINA 4C3HK 3S1MC 5IP7C 1TWFC 4LK1A 4A3KC 3S2DC 4A3GK 5IP9C 3S1MK 3I4NC 5IYDK 2E2IC 3PO3C 4BY1K 5FLMC 5IP7K 1TWFK 5C4JC 3FKIC 4A3IC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WB1 L;  5IP9 K;  2VUM C;  3H3V L;  1TWH K;  4MQ9 A;  3I4N K;  3M4O C;  3PO3 K;  4A93 C;  4A3L C;  5C4J K;  2O5J A;  3HKZ D;  2VUM K;  1HQM A;  5M3M K;  1Y1V C;  5C3E C;  4A93 K;  4A3D K;  1TWC C;  1I6V A;  4KN7 A;  4QIW L;  1I6H C;  5C3E K;  1Y1V K;  1TWG C;  4YFK A;  1TWC K;  3GTM C;  4G7H A;  3GTK C;  1TWG K;  3GTM K;  5M5W K;  4YFN A;  4A3B K;  3PO2 C;  4OIR A;  3GTK K;  1XPP A;  4MEY A;  2Y0S L;  2E2H C;  3PO2 K;  3M3Y K;  3S14 C;  3HOV C;  5IYB K;  4QJV B;  2E2H K;  3S14 K;  4YFX A;  3HOV K;  2B63 C;  1I3Q C;  4KN4 A;  4LLG A;  3S16 K;  5M5X K;  3H0G C;  3S2H K;  3HKZ L;  1YNJ A;  3GTQ C;  1K83 C;  3HOX C;  1Y1W C;  3S17 C;  5M5Y K;  4AYB D;  4OIP A;  2NVY C;  2E2I K;  1K83 K;  5FLM K;  2JA5 C;  3GTL K;  2A6E A;  3FKI K;  1Y1W K;  3GTO C;  5FJ8 K;  4A3I K;  2NVT C;  3S17 K;  4A3L K;  2NVY K;  4XLN A;  3M4O K;  4QJV A;  2JA5 K;  3GTO K;  4X6A C;  2NVT K;  4A3J C;  4A3F C;  4Q5S A;  4C3I K;  4X6A K;  4YG2 A;  2JA8 C;  3HOZ C;  5M3F K;  1I6H K;  1WCM C;  4A3J K;  3K7A C;  2YU9 C;  3GTG C;  3HOY C;  3RZO C;  2JA8 K;  3HOZ K;  1SMY A;  3K7A K;  2YU9 K;  3GTG K;  1ZYR A;  3HOY K;  3GTP C;  2NVQ C;  4G7O A;  3GTL C;  4A3C C;  4LK0 A;  1IW7 A;  3GTP K;  1SFO C;  3S1N C;  2NVQ K;  4A3C K;  2NVX C;  4GZY A;  4A3E C;  1SFO K;  4AYB L;  2E2J C;  3I4M C;  4MEX A;  4XSZ A;  2NVX K;  1I3Q K;  2B63 K;  2PPB A;  3H0G K;  3I4M K;  4BY7 C;  2O5I A;  4Q4Z A;  3GTQ K;  1BDF A;  4OIQ A;  4BY7 K;  3HOX K;  2JA7 C;  4G7Z A;  3CQZ C;  5TMC A;  3CQZ K;  1I50 C;  5D4D A;  2R92 C;  4BXX C;  1R9T C;  4A3F K;  3S1Q C;  2BE5 A;  4C2M K;  4XLP A;  2JA6 C;  4BBS C;  4BXX K;  1R9T K;  3HOW C;  5C4X C;  1WCM K;  3EQL A;  3S1Q K;  4A3G C;  3S15 C;  2WAQ D;  4LJZ A;  3RZO K;  5C4X K;  3HOW K;  4BY1 C;  4A3M C;  3S15 K;  2PA8 L;  1TWH C;  4OIO A;  1TWA C;  5TMF A;  3S1N K;  4A3D C;  1TWA K;  3DXJ A;  2PA8 D;  3HOU C;  4A3E K;  3WOD A;  3RZD C;  3S2D K;  2A6H A;  2E2J K;  4XSX A;  4Y7N C;  2WB1 D;  3HOU K;  3H3V D;  4A3M K;  3RZD K;  4JK1 A;  4NOI A;  3GTJ C;  5C44 C;  4Y7N K;  2R93 C;  4KMU A;  5IYC C;  4A3B C;  2R7Z C;  2JA7 K;  4QIW D;  4ZH4 A;  5C44 K;  3GTJ K;  2R93 K;  5IYC K;  3M3Y C;  2A69 A;  2R7Z K;  5IYB C;  2WAQ L;  4BBR C;  2PMZ L;  4Y52 C;  1I50 K;  2R92 K;  1YNN A;  3S16 C;  3S1R C;  2A68 A;  4BBR K;  2CW0 A;  4C3J K;  4Y52 K;  4BBS K;  4A3K K;  2JA6 K;  3S2H C;  2Y0S D;  2PMZ D;  5IYD C;  3S1R K;  4OIN A;  4C3H K;  3S1M C;  5IP7 C;  1TWF C;  4LK1 A;  4A3K C;  3S2D C;  4A3G K;  5IP9 C;  3S1M K;  3I4N C;  5IYD K;  2E2I C;  3PO3 C;  4BY1 K;  5FLM C;  5IP7 K;  1TWF K;  5C4J C;  3FKI C;  4A3I C; 
#chains in the Genus database with same CATH topology
 1C0A A;  2JA5 A;  1J98 A;  1TWH K;  3HXA A;  2P5M A;  4GTC A;  2RGR A;  1O27 A;  5CHP A;  2VUM K;  1HQM A;  4A3D K;  4A93 K;  5C3E K;  1WOS A;  1TWC K;  1WCM A;  1RU0 A;  3IPJ A;  3GTM K;  4KB2 A;  3GTP A;  3PO2 C;  4OIR A;  1XXB A;  2E2H C;  1DD5 A;  3LAP A;  5IYB K;  4QJV B;  3A8I A;  3CAG A;  3HOV K;  2B63 C;  3GEI A;  1XZQ B;  3H0G C;  3GEE A;  1IL2 A;  3S17 C;  1USM A;  2NVY C;  3GTL K;  3GTO C;  2A6E A;  2D6F C;  4A3I K;  4LOW A;  4X6A C;  1J6W A;  1I50 A;  2NVT K;  4A3J C;  4C3I K;  2RH6 A;  3N3Y A;  5TJ3 A;  2JA8 K;  3HOZ K;  1SMY A;  3GTG K;  1ZYR A;  4G7O A;  1TWH A;  5HL8 A;  2NVQ K;  4A3E C;  3NUH A;  4XSZ A;  2B63 K;  2ZUF A;  3H0G K;  3I4M K;  3A8J A;  3GSI A;  1BDF A;  4OIQ A;  4BY7 K;  4G7Z A;  2R7Z A;  1VGX A;  3FOE A;  2XCQ A;  2R92 C;  4BXX C;  3V4G A;  1IBA A;  2BE5 A;  2JA6 C;  1R9T K;  5C4X C;  1O2B A;  1JQW A;  4LJZ A;  1TWF A;  3HOW K;  3Q3Q A;  4G0U A;  1JVI A;  2PA8 L;  3GTL A;  1UV7 A;  4LR2 A;  1B4B A;  1TWA K;  3DXJ A;  4A3E K;  3RZD K;  4GTA A;  5IOT A;  4Y7N K;  2R93 C;  4A3B C;  3GTJ K;  4ZH4 A;  1WOR A;  3M3Y C;  4KMD A;  4KM8 A;  2E2H A;  3L4K A;  2PMZ L;  4Y52 C;  3BP3 A;  2R92 K;  3OPF A;  3S16 C;  2CW0 A;  4C3H C;  2B63 A;  3AQP A;  3H0G A;  2JA6 K;  4OIN A;  1USO A;  4A3K C;  5JVO A;  2P8T A;  3TFH A;  5FLM C;  2NVY A;  2Y3P A;  2VUM C;  3GTO A;  3H3V L;  4A3L C;  4MQ9 A;  3M4O C;  3PO3 K;  1PJ7 A;  4A93 C;  5C3E C;  1TWC C;  4KN7 A;  1Y1V K;  4KMA A;  1V5V A;  5IOS A;  3GTM C;  5EGH A;  5M5W K;  4YFN A;  4A3B K;  1XPP A;  4MEY A;  3M3Y K;  3HOV C;  3S16 K;  3LAJ A;  5M5X K;  2FQO A;  1WOO A;  1YNJ A;  3AD8 C;  3GEH A;  1ISE A;  2XCR B;  5FLM K;  5FJ8 K;  2NVT C;  4A3L K;  4GTD A;  1L0W A;  3M4O K;  4C3I C;  4BLA A;  5JFE A;  3T02 A;  2R92 A;  2KWA A;  3JST A;  3BP8 C;  4Q5S A;  2JA8 C;  3HOZ C;  5M3F K;  2JA6 A;  3GTG C;  1EQR A;  3HOY K;  2YU9 K;  2NVQ C;  1WQG A;  1PJ6 A;  2CFA A;  4KAS A;  2GAG C;  1O26 A;  4A3C K;  1WOP A;  4GZY A;  1SFO K;  3G4C A;  4AYB L;  1BS2 A;  3I4M C;  4MEX A;  2NVX K;  4KC6 A;  3TFJ A;  4BY7 C;  2O5I A;  4Q4Z A;  3TTG A;  2R93 A;  1WSR A;  4FZB A;  2JA7 C;  1O2A A;  1J6X A;  1IQ0 A;  2ZFZ A;  3CQZ K;  5D4D A;  1EFW A;  1R9T C;  2V6T A;  5IOR A;  4XLP A;  4BBS C;  3HOW C;  3AD7 C;  3S15 K;  4XCH A;  4OIO A;  4LQY A;  1TWA C;  4G0V A;  2VUM A;  1DCO A;  1KQ4 A;  1TWC A;  3RZD C;  4Y7N C;  5IOQ A;  3H3V D;  3GTM A;  4NOI A;  3GTJ C;  4KAW X;  3TFI A;  4PAB A;  4GTF A;  2JA7 K;  3GIR A;  4KDD A;  5IYC K;  3AD9 C;  3BUE A;  2W7V A;  3A8K A;  1YNN A;  4GFQ A;  2A68 A;  4C3J K;  2ZUE A;  3VA7 A;  4BBS K;  3S2H C;  1EK8 A;  4WJ4 A;  3S1R K;  1ZBS A;  5IYD K;  3PO3 C;  3FKI C;  3S2D K;  2WB1 L;  3N0B A;  5IP9 K;  3I4N K;  2O5J A;  3L4J A;  5C4J K;  5M3M K;  1Y1V C;  4P5A A;  1I6H C;  4GTL A;  3GTG A;  4KAT A;  4G7H A;  4J3N A;  1F7U A;  1TWG K;  3GTK K;  4KMH A;  3G4A A;  2Y0S L;  4AH6 A;  1EH1 A;  1B4A A;  4WJ3 M;  3S14 K;  4YFX A;  1I3Q C;  3LPX A;  4RMF A;  3FOF A;  3S2H K;  3ADA C;  3HKZ L;  1WIH A;  1X31 C;  3OEP A;  3HOX C;  3S0X A;  2JA7 A;  4AYB D;  4OIP A;  1K83 K;  3FKI K;  1Y1W K;  3SZY A;  4WIL A;  1F93 A;  2CFA B;  4XLN A;  2V6U A;  1YCL A;  2JA5 K;  4M1X A;  4A3F C;  2XCO A;  1R9T A;  4C2M C;  1I6H K;  4GTE A;  1F7V A;  2YU9 C;  3HOY C;  3QX3 A;  4G0W A;  3RZO C;  4P9S A;  1BJT A;  3K7A K;  2GSO A;  2EBB A;  4A3C C;  1IW7 A;  3GTP K;  1TWA A;  1SFO C;  2NVX C;  2PHC B;  1I3Q K;  1XZP A;  1GE9 A;  3GTJ A;  1VH2 A;  3HOX K;  1F9N A;  1EI6 A;  3CQZ C;  1VLO A;  4A3F K;  4C2M K;  3S1Q K;  3EQL A;  4A3G C;  3S15 C;  3RZO K;  1O25 A;  3MML B;  5EGE A;  1K83 A;  3FKI A;  1JOE A;  3ERE D;  1Y1V A;  2PA8 D;  3WOD A;  1O28 A;  4XSX A;  2WB1 D;  3HOU K;  1ZVU A;  1ZXO A;  4PAA A;  4KMU A;  5IYC C;  4KM9 A;  5C44 K;  1J6V A;  2GSN A;  4GT9 A;  2R7Z K;  1HI9 A;  1YX2 A;  2WAQ L;  4C3J C;  4P5B A;  5L46 A;  1VRQ C;  4DDQ A;  3S1R C;  4BBR K;  1I3Q A;  2Y0S D;  2PMZ D;  5IYD C;  2GAH C;  1WQF A;  4A3G K;  4LK1 A;  1O24 A;  3S2D C;  5IP9 C;  3S1M K;  3I4N C;  2E2I C;  5IP7 K;  1TWF K;  5C4J C;  1DCP A;  1AB4 A;  3HKZ D;  4ILD A;  1I6V A;  1WSV A;  4QIW L;  1TWG C;  4YFK A;  2YU9 A;  3GTK C;  3N0C A;  1BGW A;  3PO2 K;  3S14 C;  1SFO A;  3AH5 A;  3FHZ A;  3GDZ A;  2E2H K;  4C45 A;  2NVX A;  3SZZ A;  4KN4 A;  4LLG A;  3GTQ C;  1K83 C;  3T01 A;  1Y1W C;  5M5Y K;  2E2I K;  3CQZ A;  2JA5 C;  3S17 K;  2NVY K;  4QJV A;  3GTO K;  1ZQ1 C;  4X6A K;  1XZQ A;  4YG2 A;  4O2D A;  4BKW A;  1WCM C;  5CJ9 A;  3K7A C;  4A3J K;  1XXC A;  4KB4 A;  1XZP B;  3GTP C;  3GTL C;  4LK0 A;  4FM9 A;  3S1N C;  2GSU A;  2FQT A;  2E2J C;  3ORE A;  3T00 A;  1VJE A;  2PPB A;  2JH3 A;  1O2F B;  3GTQ K;  4KAR A;  1WQH A;  5TMC A;  1DCH A;  1I50 C;  1O29 A;  1IS1 A;  1G51 A;  3S1Q C;  4BXX K;  1WCM K;  2WAQ D;  1IE0 A;  5C4X K;  4BY1 C;  4A3M C;  4GTB A;  2E2I A;  1TWH C;  5TMF A;  3S1N K;  4A3D C;  3AQO A;  3HOU C;  2A6H A;  2E2J K;  1XXA A;  1TWG A;  4JK1 A;  3GTK A;  5C44 C;  1INN A;  2R7Z C;  4QIW D;  4BLB A;  2R93 K;  2A69 A;  5E68 A;  5IYB C;  4BBR C;  1I50 K;  2V6S A;  4Y52 K;  3S1M C;  4C3H K;  5IP7 C;  1TWF C;  1PJ5 A;  3GTQ A;  1Y1W A;  4BY1 K;  4A3M K;  4A3K K;  4A3I C; 
#chains in the Genus database with same CATH homology
 2WB1 L;  5IP9 K;  2VUM C;  3H3V L;  1TWH K;  4MQ9 A;  3I4N K;  3M4O C;  3PO3 K;  4A93 C;  4A3L C;  5C4J K;  2O5J A;  3HKZ D;  2VUM K;  1HQM A;  5M3M K;  1Y1V C;  5C3E C;  4A93 K;  4A3D K;  1TWC C;  1I6V A;  4KN7 A;  4QIW L;  1I6H C;  5C3E K;  1Y1V K;  1TWG C;  4YFK A;  1TWC K;  3GTM C;  4G7H A;  3GTK C;  1TWG K;  3GTM K;  5M5W K;  4YFN A;  4A3B K;  3PO2 C;  4OIR A;  3GTK K;  1XPP A;  4MEY A;  2Y0S L;  2E2H C;  3PO2 K;  3M3Y K;  3S14 C;  3HOV C;  5IYB K;  4QJV B;  2E2H K;  3S14 K;  4YFX A;  3HOV K;  2B63 C;  1I3Q C;  4KN4 A;  4LLG A;  3S16 K;  5M5X K;  3H0G C;  3S2H K;  3HKZ L;  1YNJ A;  3GTQ C;  1K83 C;  3HOX C;  1Y1W C;  3S17 C;  5M5Y K;  4AYB D;  4OIP A;  2NVY C;  2E2I K;  1K83 K;  5FLM K;  2JA5 C;  3GTL K;  2A6E A;  3FKI K;  1Y1W K;  3GTO C;  5FJ8 K;  4A3I K;  2NVT C;  3S17 K;  4A3L K;  2NVY K;  4XLN A;  3M4O K;  4QJV A;  2JA5 K;  3GTO K;  4X6A C;  2NVT K;  4A3J C;  4A3F C;  4Q5S A;  4C3I K;  4X6A K;  4YG2 A;  2JA8 C;  3HOZ C;  5M3F K;  1I6H K;  1WCM C;  4A3J K;  3K7A C;  2YU9 C;  3GTG C;  3HOY C;  3RZO C;  2JA8 K;  3HOZ K;  1SMY A;  3K7A K;  2YU9 K;  3GTG K;  1ZYR A;  3HOY K;  3GTP C;  2NVQ C;  4G7O A;  3GTL C;  4A3C C;  4LK0 A;  1IW7 A;  3GTP K;  1SFO C;  3S1N C;  2NVQ K;  4A3C K;  2NVX C;  4GZY A;  4A3E C;  1SFO K;  4AYB L;  2E2J C;  3I4M C;  4MEX A;  4XSZ A;  2NVX K;  1I3Q K;  2B63 K;  2PPB A;  3H0G K;  3I4M K;  4BY7 C;  2O5I A;  4Q4Z A;  3GTQ K;  1BDF A;  4OIQ A;  4BY7 K;  3HOX K;  2JA7 C;  4G7Z A;  3CQZ C;  5TMC A;  3CQZ K;  1I50 C;  5D4D A;  2R92 C;  4BXX C;  1R9T C;  4A3F K;  3S1Q C;  2BE5 A;  4C2M K;  4XLP A;  2JA6 C;  4BBS C;  4BXX K;  1R9T K;  3HOW C;  5C4X C;  1WCM K;  3EQL A;  3S1Q K;  4A3G C;  3S15 C;  2WAQ D;  4LJZ A;  3RZO K;  5C4X K;  3HOW K;  4BY1 C;  4A3M C;  3S15 K;  2PA8 L;  1TWH C;  4OIO A;  1TWA C;  5TMF A;  3S1N K;  4A3D C;  1TWA K;  3DXJ A;  2PA8 D;  3HOU C;  4A3E K;  3WOD A;  3RZD C;  3S2D K;  2A6H A;  2E2J K;  4XSX A;  4Y7N C;  2WB1 D;  3HOU K;  3H3V D;  4A3M K;  3RZD K;  4JK1 A;  4NOI A;  3GTJ C;  5C44 C;  4Y7N K;  2R93 C;  4KMU A;  5IYC C;  4A3B C;  2R7Z C;  2JA7 K;  4QIW D;  4ZH4 A;  5C44 K;  3GTJ K;  2R93 K;  5IYC K;  3M3Y C;  2A69 A;  2R7Z K;  5IYB C;  2WAQ L;  4BBR C;  2PMZ L;  4Y52 C;  1I50 K;  2R92 K;  1YNN A;  3S16 C;  3S1R C;  2A68 A;  4BBR K;  2CW0 A;  4C3J K;  4Y52 K;  4BBS K;  4A3K K;  2JA6 K;  3S2H C;  2Y0S D;  2PMZ D;  5IYD C;  3S1R K;  4OIN A;  4C3H K;  3S1M C;  5IP7 C;  1TWF C;  4LK1 A;  4A3K C;  3S2D C;  4A3G K;  5IP9 C;  3S1M K;  3I4N C;  5IYD K;  2E2I C;  3PO3 C;  4BY1 K;  5FLM C;  5IP7 K;  1TWF K;  5C4J C;  3FKI C;  4A3I C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...