2VUMK

Alpha-amanitin inhibited complete rna polymerase ii elongation complex
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
114
structure length
114
Chain Sequence
MNAPDRFELFLLGEGESKLKIDPDTKAPNAVVITFEKEDHTLGNLIRAELLNDRKVLFAAYKVEHPFFARFKLRIQTTEGYDPKDALKNACNSIINKLGALKTNFETEWNLQTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription Inhibition by Alpha-Amanitin and Implications for RNA Polymerase II Translocation.
pubmed doi rcsb
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
molecule tags Transferase
total genus 26
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF13656 RNA_pol_L_2 RNA polymerase Rpb3/Rpb11 dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.10 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 RNA polymerase, RBP11-like subunit 2vumK00
2E2IK 3HOWC 3H0GK 2E2JC 3HOVK 5M3MK 4GZYA 1I6HK 4A3LC 4BBRC 5IYDC 4G7OA 5FJ8K 1YNNA 3HOUK 3RZDC 2NVXK 3I4MK 3H3VL 3S17C 3PO3K 4C3HK 3CQZC 2VUMC 1I6VA 4XLNA 4A3MC 4C3JK 2WAQD 3S2HC 3S14K 4A3JK 5IYCK 4OINA 5C4JC 3M4OC 4A93K 5TMFA 4A3IK 3GTPK 2R93K 1I50K 1TWHC 3GTQK 5M5WK 1K83C 2PMZD 1Y1VK 3FKIC 5C4XK 4A3KC 3GTOK 3S16C 4MEYA 4Y7NC 4AYBL 3S1NK 1I3QK 5C3EK 2JA5C 3HOYC 4X6AC 3RZOK 4YFNA 2YU9C 4BY1C 4AYBD 4A3FC 3GTMK 5IP7C 1IW7A 2R92K 3HKZL 4A3DK 3HOXC 3PO2K 4MQ9A 3GTGC 3GTKC 1XPPA 1TWAK 3M3YC 3S1QC 5FLMK 4OIRA 4C2MK 4YFXA 2Y0SL 2NVQK 3S15K 4A3BC 3HKZD 2E2IC 4C3IK 3S1MK 3H0GC 2A69A 3K7AK 2WB1L 3HOVC 2NVYK 2O5JA 4LJZA 3S1RK 4Q5SA 2Y0SD 1I6HC 1R9TK 5IP9K 3GTJK 4KMUA 4A3GK 4LLGA 2JA6K 1BDFA 2JA7K 3H3VD 3HOUC 2A6EA 2NVXC 3I4MC 3PO3C 4BXXK 1YNJA 2JA8K 2PA8L 5M5XK 4NOIA 4A3JC 5IYCC 3S14C 5D4DA 4A3EK 4JK1A 4A93C 4Y52K 4YG2A 4A3IC 3GTPC 2R93C 1I50C 3GTQC 5C44K 3GTOC 4BY7K 1Y1VC 3S1NC 5C4XC 1ZYRA 2CW0A 4QJVB 1WCMK 2PPBA 3HOZK 1I3QC 2A68A 5C3EC 4MEXA 3S2DC 4Q4ZA 5IYBK 2E2HK 3RZOC 3EQLA 1Y1WK 1SFOK 2B63K 1TWFK 3GTLK 3GTMC 2NVTK 2R92C 2R7ZK 4A3DC 3DXJA 1SMYA 3PO2C 4LK1A 1TWAC 5FLMC 1TWCK 3S15C 4G7ZA 2NVQC 4A3CK 4ZH4A 3S1MC 2WB1D 1TWGK 3K7AC 3HOXK 3WODA 3HOWK 2NVYC 2BE5A 4OIQA 2E2JK 4KN7A 3S1RC 4XSXA 1R9TC 5IP9C 4A3LK 3GTJC 4BBRK 4A3GC 5M3FK 2JA6C 5IYDK 2JA7C 3I4NK 2A6HA 4KN4A 4BXXC 3RZDK 3S17K 4LK0A 2O5IA 2PA8D 2JA8C 3CQZK 2VUMK 4A3EC 4A3MK 3S2HK 4G7HA 2WAQL 4Y52C 5C4JK 4OIPA 3M4OK 3I4NC 4BBSK 4QIWL 5C44C 4BY7C 1TWHK 4XLPA 1K83K 3FKIK 4OIOA 1WCMC 2PMZL 5M5YK 4A3KK 3HOZC 4Y7NK 3S16K 3S2DK 4BBSC 5TMCA 4QIWD 5IYBC 2E2HC 2JA5K 3HOYK 1Y1WC 1SFOC 4X6AK 2B63C 4YFKA 1TWFC 3GTLC 4BY1K 2YU9K 2NVTC 2R7ZC 4A3FK 1HQMA 5IP7K 4QJVA 3GTGK 1TWCC 3GTKK 4A3CC 3S1QK 3M3YK 4A3BK 4XSZA 1TWGC
chains in the Genus database with same CATH superfamily
5JVOA 3HOWC 3GTPA 3N0BA 2XCOA 4GZYA 1Y1VA 3TTGA 5CHPA 2ZUFA 5FJ8K 2FQTA 2NVXK 3H3VL 5IOQA 2VUMC 3GTMA 4XLNA 4A3MC 2ZUEA 1EH1A 4A3JK 5IYCK 4LQYA 4KMHA 3GTPK 1SFOA 3GTQK 2V6UA 1GE9A 1Y1VK 3FKIC 3S1NK 3S2DC 2P5MA 1O26A 1I3QK 2NVYA 3T02A 3GTMK 1IW7A 2R92K 3HKZL 4GTFA 4MQ9A 1TWAK 3S15K 4C2MK 4YFXA 4P5BA 4C3IK 2ZFZA 3K7AK 1VJEA 1X31C 2NVYK 4WILA 4Q5SA 4KMUA 3GIRA 3I4MC 4BXXK 1IE0A 1XXAA 3GTLA 3FKIA 4C3JC 4WJ4A 4NOIA 3N3YA 4A3EK 4Y52K 1BGWA 4BLBA 4A3IC 1TWCA 5C44K 1KQ4A 1XZPA 1USOA 2GAHC 2CW0A 4G0VA 4Q4ZA 5IYBK 2E2HK 1XZQA 2B63K 1TWFK 3GTLK 4A3DC 2R7ZK 3PO2C 1EQRA 1BS2A 1TWCK 4G7ZA 4ZH4A 3S0XA 4OIQA 3S1RC 4FM9A 1EI6A 1R9TC 3GTJC 2EBBA 3I4NK 2JH3A 4KN4A 4GFQA 1VGXA 1WOOA 5L46A 3S17K 2PA8D 3CQZK 3MMLB 4KM9A 3S2HK 1VH2A 4BBSK 5C4JK 5IORA 1XXBA 3BP8C 4KARA 4BY7C 1TWHK 1O2FB 3OEPA 4XLPA 3FHZA 4OIOA 3HOZC 3H0GA 4Y7NK 2JA5K 3HOYK 1Y1WC 4X6AK 4YFKA 5IOSA 4A3FK 1HQMA 1WIHA 4A3CC 3FOFA 1R9TA 5HL8A 3GTJA 1DCHA 3H0GK 3TFHA 1UV7A 1J6WA 3HOVK 2R93A 2V6TA 3N0CA 1WQHA 5CJ9A 4BBRC 4G0WA 5IYDC 3IPJA 3AQPA 3HOUK 4ILDA 1I6VA 4AH6A 3S14K 4GTDA 1O24A 2R93K 1I50K 3AH5A 2P8TA 2D6FC 3GTOK 4A3KC 1BJTA 1USMA 4AYBL 5EGEA 1ZXOA 1VLOA 4BLAA 4BY1C 4GTAA 2JA6A 5TJ3A 1F93A 4P9SA 3GTGC 3S1QC 4A3BC 2Y0SL 2NVQK 3BP3A 2E2IC 3S1MK 2O5JA 1I6HC 5IP9K 4A3GK 2JA6K 1BDFA 3AD8C 3AQOA 2RH6A 1O2AA 3AD9C 3PO3C 1DCOA 4C3HC 2JA8K 1JOEA 2PA8L 1WOSA 4A93C 3QX3A 5C4XC 4QJVB 5C3EC 2A68A 3A8JA 4KC6A 1C0AA 3GTGA 3RZOC 1SFOK 4O2DA 1F9NA 2E2IA 1SMYA 2GSUA 4LK1A 5FLMC 2VUMA 2WB1D 3HOWK 2BE5A 2GAGC 3LPXA 3A8IA 1WSRA 4KB2A 4GT9A 2JA7C 1INNA 2O5IA 2VUMK 4A3MK 1B4BA 3I4NC 4OIPA 1ZVUA 4QIWL 3FKIK 3S2DK 1WCMC 3ADAC 4BBSC 1WQGA 1IQ0A 1AB4A 2NVTC 3CAGA 3TFJA 3L4JA 1TWGC 3HOXC 2Y3PA 3G4CA 1WORA 2JA7A 2E2JC 1HI9A 4A3LC 3ERED 3V4GA 1EFWA 3RZDC 3I4MK 4GTCA 1O25A 1WCMA 2WAQD 4C3JK 3GSIA 3M4OC 5TMFA 4A3IK 4KM8A 1K83C 2PMZD 3S16C 2V6SA 1PJ6A 3HXAA 2GSOA 4LOWA 2YU9C 1TWGA 5IP7C 4A3DK 3PO2K 3GTKC 3M3YC 3T01A 4OIRA 3GEIA 1WOPA 1IS1A 3HKZD 4KAWX 2CFAB 3L4KA 2WB1L 2XCRB 4WJ3M 4LJZA 4RMFA 3S1RK 1R9TK 2FQOA 3GTJK 4KASA 2NVXC 1Y1WA 1F7UA 5M5XK 4A3JC 5IYCC 4JK1A 2PHCB 4YG2A 3GTPC 3VA7A 3GTQC 4BY7K 1Y1VC 3S1NC 2KWAA 2PPBA 1RU0A 3GEEA 3HOZK 1I3QC 4MEXA 1WQFA 1Y1WK 4GTLA 1VRQC 3GTMC 2R92C 1YX2A 1PJ7A 1TWAC 1ZBSA 3S15C 4C2MC 4A3CK 4C3IC 1EK8A 3K7AC 3GEHA 2NVYC 2NVXA 4KMDA 4KN7A 4P5AA 4XSXA 4PAAA 1PJ5A 4BBRK 5M3FK 5IYDK 2GSNA 4BXXC 4LK0A 1L0WA 4BKWA 4XCHA 5EGHA 3GTQA 1J98A 4A3EC 1J6XA 2WAQL 4Y52C 1I3QA 4G7HA 5C44C 3OREA 1XXCA 5M5YK 1O28A 2PMZL 4A3KK 2R92A 3OPFA 3TFIA 5IYBC 2E2HC 1YCLA 1TWAA 2B63C 1O29A 1TWFC 3GTLC 4BY1K 2R7ZC 5IOTA 4PABA 4QJVA 1V5VA 3SZYA 3GTGK 1TWCC 4KMAA 3S1QK 4GTBA 4A3BK 1B4AA 2E2IK 1WSVA 1O27A 5M3MK 1I6HK 4G7OA 1YNNA 1XZPB 3S17C 3PO3K 4C3HK 3CQZC 1JVIA 3S2HC 4M1XA 3Q3QA 1XZQB 5C4JC 4OINA 4A93K 3NUHA 2E2HA 1TWHC 5M5WK 2B63A 1TWFA 5C4XK 4MEYA 4Y7NC 2R7ZA 5C3EK 3AD7C 2JA5C 3HOYC 4X6AC 4C45A 3RZOK 4YFNA 4AYBD 4FZBA 4A3FC 3A8KA 1XPPA 1ZQ1C 5FLMK 3LAJA 1IBAA 1F7VA 3H0GC 2A69A 3HOVC 4LR2A 2Y0SD 3CQZA 4KB4A 4LLGA 4KDDA 2JA7K 3H3VD 3HOUC 2A6EA 4DDQA 1TWHA 1JQWA 1YNJA 1G51A 3S14C 5D4DA 2XCQA 2JA5A 2R93C 1I50C 1ISEA 3GTOC 1ZYRA 1WCMK 3EQLA 3G4AA 2NVTK 3DXJA 4KATA 4G0UA 2W7VA 2NVQC 3S1MC 1TWGK 3HOXK 1O2BA 3WODA 2E2JK 4J3NA 5IP9C 1K83A 4A3LK 4A3GC 1DD5A 2JA6C 2A6HA 2CFAA 1DCPA 1I50A 3RZDK 1J6VA 3GTOA 2JA8C 2YU9A 3LAPA 2RGRA 3SZZA 1IL2A 3M4OK 3GTKA 1K83K 5E68A 3S16K 5TMCA 3GDZA 4QIWD 3FOEA 1SFOC 5JFEA 2YU9K 4GTEA 5IP7K 3JSTA 3T00A 3GTKK 3BUEA 3M3YK 4XSZA
chains in the Genus database with same CATH topology
2E2IK 3HOWC 3H0GK 2E2JC 3HOVK 5M3MK 4GZYA 1I6HK 4A3LC 4BBRC 5IYDC 4G7OA 5FJ8K 1YNNA 3HOUK 3RZDC 2NVXK 3I4MK 3H3VL 3S17C 3PO3K 4C3HK 3CQZC 2VUMC 1I6VA 4XLNA 4A3MC 4C3JK 2WAQD 3S2HC 3S14K 4A3JK 5IYCK 4OINA 5C4JC 3M4OC 4A93K 5TMFA 4A3IK 3GTPK 2R93K 1I50K 1TWHC 3GTQK 5M5WK 1K83C 2PMZD 1Y1VK 3FKIC 5C4XK 4A3KC 3GTOK 3S16C 4MEYA 4Y7NC 4AYBL 3S1NK 1I3QK 5C3EK 2JA5C 3HOYC 4X6AC 3RZOK 4YFNA 2YU9C 4BY1C 4AYBD 4A3FC 3GTMK 5IP7C 1IW7A 2R92K 3HKZL 4A3DK 3HOXC 3PO2K 4MQ9A 3GTGC 3GTKC 1XPPA 1TWAK 3M3YC 3S1QC 5FLMK 4OIRA 4C2MK 4YFXA 2Y0SL 2NVQK 3S15K 4A3BC 3HKZD 2E2IC 4C3IK 3S1MK 3H0GC 2A69A 3K7AK 2WB1L 3HOVC 2NVYK 2O5JA 4LJZA 3S1RK 4Q5SA 2Y0SD 1I6HC 1R9TK 5IP9K 3GTJK 4KMUA 4A3GK 4LLGA 2JA6K 1BDFA 2JA7K 3H3VD 3HOUC 2A6EA 2NVXC 3I4MC 3PO3C 4BXXK 1YNJA 2JA8K 2PA8L 5M5XK 4NOIA 4A3JC 5IYCC 3S14C 5D4DA 4A3EK 4JK1A 4A93C 4Y52K 4YG2A 4A3IC 3GTPC 2R93C 1I50C 3GTQC 5C44K 3GTOC 4BY7K 1Y1VC 3S1NC 5C4XC 1ZYRA 2CW0A 4QJVB 1WCMK 2PPBA 3HOZK 1I3QC 2A68A 5C3EC 4MEXA 3S2DC 4Q4ZA 5IYBK 2E2HK 3RZOC 3EQLA 1Y1WK 1SFOK 2B63K 1TWFK 3GTLK 3GTMC 2NVTK 2R92C 2R7ZK 4A3DC 3DXJA 1SMYA 3PO2C 4LK1A 1TWAC 5FLMC 1TWCK 3S15C 4G7ZA 2NVQC 4A3CK 4ZH4A 3S1MC 2WB1D 1TWGK 3K7AC 3HOXK 3WODA 3HOWK 2NVYC 2BE5A 4OIQA 2E2JK 4KN7A 3S1RC 4XSXA 1R9TC 5IP9C 4A3LK 3GTJC 4BBRK 4A3GC 5M3FK 2JA6C 5IYDK 2JA7C 3I4NK 2A6HA 4KN4A 4BXXC 3RZDK 3S17K 4LK0A 2O5IA 2PA8D 2JA8C 3CQZK 2VUMK 4A3EC 4A3MK 3S2HK 4G7HA 2WAQL 4Y52C 5C4JK 4OIPA 3M4OK 3I4NC 4BBSK 4QIWL 5C44C 4BY7C 1TWHK 4XLPA 1K83K 3FKIK 4OIOA 1WCMC 2PMZL 5M5YK 4A3KK 3HOZC 4Y7NK 3S16K 3S2DK 4BBSC 5TMCA 4QIWD 5IYBC 2E2HC 2JA5K 3HOYK 1Y1WC 1SFOC 4X6AK 2B63C 4YFKA 1TWFC 3GTLC 4BY1K 2YU9K 2NVTC 2R7ZC 4A3FK 1HQMA 5IP7K 4QJVA 3GTGK 1TWCC 3GTKK 4A3CC 3S1QK 3M3YK 4A3BK 4XSZA 1TWGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E2I K;  3HOW C;  3H0G K;  2E2J C;  3HOV K;  5M3M K;  4GZY A;  1I6H K;  4A3L C;  4BBR C;  5IYD C;  4G7O A;  5FJ8 K;  1YNN A;  3HOU K;  3RZD C;  2NVX K;  3I4M K;  3H3V L;  3S17 C;  3PO3 K;  4C3H K;  3CQZ C;  2VUM C;  1I6V A;  4XLN A;  4A3M C;  4C3J K;  2WAQ D;  3S2H C;  3S14 K;  4A3J K;  5IYC K;  4OIN A;  5C4J C;  3M4O C;  4A93 K;  5TMF A;  4A3I K;  3GTP K;  2R93 K;  1I50 K;  1TWH C;  3GTQ K;  5M5W K;  1K83 C;  2PMZ D;  1Y1V K;  3FKI C;  5C4X K;  4A3K C;  3GTO K;  3S16 C;  4MEY A;  4Y7N C;  4AYB L;  3S1N K;  1I3Q K;  5C3E K;  2JA5 C;  3HOY C;  4X6A C;  3RZO K;  4YFN A;  2YU9 C;  4BY1 C;  4AYB D;  4A3F C;  3GTM K;  5IP7 C;  1IW7 A;  2R92 K;  3HKZ L;  4A3D K;  3HOX C;  3PO2 K;  4MQ9 A;  3GTG C;  3GTK C;  1XPP A;  1TWA K;  3M3Y C;  3S1Q C;  5FLM K;  4OIR A;  4C2M K;  4YFX A;  2Y0S L;  2NVQ K;  3S15 K;  4A3B C;  3HKZ D;  2E2I C;  4C3I K;  3S1M K;  3H0G C;  2A69 A;  3K7A K;  2WB1 L;  3HOV C;  2NVY K;  2O5J A;  4LJZ A;  3S1R K;  4Q5S A;  2Y0S D;  1I6H C;  1R9T K;  5IP9 K;  3GTJ K;  4KMU A;  4A3G K;  4LLG A;  2JA6 K;  1BDF A;  2JA7 K;  3H3V D;  3HOU C;  2A6E A;  2NVX C;  3I4M C;  3PO3 C;  4BXX K;  1YNJ A;  2JA8 K;  2PA8 L;  5M5X K;  4NOI A;  4A3J C;  5IYC C;  3S14 C;  5D4D A;  4A3E K;  4JK1 A;  4A93 C;  4Y52 K;  4YG2 A;  4A3I C;  3GTP C;  2R93 C;  1I50 C;  3GTQ C;  5C44 K;  3GTO C;  4BY7 K;  1Y1V C;  3S1N C;  5C4X C;  1ZYR A;  2CW0 A;  4QJV B;  1WCM K;  2PPB A;  3HOZ K;  1I3Q C;  2A68 A;  5C3E C;  4MEX A;  3S2D C;  4Q4Z A;  5IYB K;  2E2H K;  3RZO C;  3EQL A;  1Y1W K;  1SFO K;  2B63 K;  1TWF K;  3GTL K;  3GTM C;  2NVT K;  2R92 C;  2R7Z K;  4A3D C;  3DXJ A;  1SMY A;  3PO2 C;  4LK1 A;  1TWA C;  5FLM C;  1TWC K;  3S15 C;  4G7Z A;  2NVQ C;  4A3C K;  4ZH4 A;  3S1M C;  2WB1 D;  1TWG K;  3K7A C;  3HOX K;  3WOD A;  3HOW K;  2NVY C;  2BE5 A;  4OIQ A;  2E2J K;  4KN7 A;  3S1R C;  4XSX A;  1R9T C;  5IP9 C;  4A3L K;  3GTJ C;  4BBR K;  4A3G C;  5M3F K;  2JA6 C;  5IYD K;  2JA7 C;  3I4N K;  2A6H A;  4KN4 A;  4BXX C;  3RZD K;  3S17 K;  4LK0 A;  2O5I A;  2PA8 D;  2JA8 C;  3CQZ K;  2VUM K;  4A3E C;  4A3M K;  3S2H K;  4G7H A;  2WAQ L;  4Y52 C;  5C4J K;  4OIP A;  3M4O K;  3I4N C;  4BBS K;  4QIW L;  5C44 C;  4BY7 C;  1TWH K;  4XLP A;  1K83 K;  3FKI K;  4OIO A;  1WCM C;  2PMZ L;  5M5Y K;  4A3K K;  3HOZ C;  4Y7N K;  3S16 K;  3S2D K;  4BBS C;  5TMC A;  4QIW D;  5IYB C;  2E2H C;  2JA5 K;  3HOY K;  1Y1W C;  1SFO C;  4X6A K;  2B63 C;  4YFK A;  1TWF C;  3GTL C;  4BY1 K;  2YU9 K;  2NVT C;  2R7Z C;  4A3F K;  1HQM A;  5IP7 K;  4QJV A;  3GTG K;  1TWC C;  3GTK K;  4A3C C;  3S1Q K;  3M3Y K;  4A3B K;  4XSZ A;  1TWG C; 
#chains in the Genus database with same CATH topology
 5JVO A;  3HOW C;  3GTP A;  3N0B A;  2XCO A;  4GZY A;  1Y1V A;  3TTG A;  5CHP A;  2ZUF A;  5FJ8 K;  2FQT A;  2NVX K;  3H3V L;  5IOQ A;  2VUM C;  3GTM A;  4XLN A;  4A3M C;  2ZUE A;  1EH1 A;  4A3J K;  5IYC K;  4LQY A;  4KMH A;  3GTP K;  1SFO A;  3GTQ K;  2V6U A;  1GE9 A;  1Y1V K;  3FKI C;  3S1N K;  3S2D C;  2P5M A;  1O26 A;  1I3Q K;  2NVY A;  3T02 A;  3GTM K;  1IW7 A;  2R92 K;  3HKZ L;  4GTF A;  4MQ9 A;  1TWA K;  3S15 K;  4C2M K;  4YFX A;  4P5B A;  4C3I K;  2ZFZ A;  3K7A K;  1VJE A;  1X31 C;  2NVY K;  4WIL A;  4Q5S A;  4KMU A;  3GIR A;  3I4M C;  4BXX K;  1IE0 A;  1XXA A;  3GTL A;  3FKI A;  4C3J C;  4WJ4 A;  4NOI A;  3N3Y A;  4A3E K;  4Y52 K;  1BGW A;  4BLB A;  4A3I C;  1TWC A;  5C44 K;  1KQ4 A;  1XZP A;  1USO A;  2GAH C;  2CW0 A;  4G0V A;  4Q4Z A;  5IYB K;  2E2H K;  1XZQ A;  2B63 K;  1TWF K;  3GTL K;  4A3D C;  2R7Z K;  3PO2 C;  1EQR A;  1BS2 A;  1TWC K;  4G7Z A;  4ZH4 A;  3S0X A;  4OIQ A;  3S1R C;  4FM9 A;  1EI6 A;  1R9T C;  3GTJ C;  2EBB A;  3I4N K;  2JH3 A;  4KN4 A;  4GFQ A;  1VGX A;  1WOO A;  5L46 A;  3S17 K;  2PA8 D;  3CQZ K;  3MML B;  4KM9 A;  3S2H K;  1VH2 A;  4BBS K;  5C4J K;  5IOR A;  1XXB A;  3BP8 C;  4KAR A;  4BY7 C;  1TWH K;  1O2F B;  3OEP A;  4XLP A;  3FHZ A;  4OIO A;  3HOZ C;  3H0G A;  4Y7N K;  2JA5 K;  3HOY K;  1Y1W C;  4X6A K;  4YFK A;  5IOS A;  4A3F K;  1HQM A;  1WIH A;  4A3C C;  3FOF A;  1R9T A;  5HL8 A;  3GTJ A;  1DCH A;  3H0G K;  3TFH A;  1UV7 A;  1J6W A;  3HOV K;  2R93 A;  2V6T A;  3N0C A;  1WQH A;  5CJ9 A;  4BBR C;  4G0W A;  5IYD C;  3IPJ A;  3AQP A;  3HOU K;  4ILD A;  1I6V A;  4AH6 A;  3S14 K;  4GTD A;  1O24 A;  2R93 K;  1I50 K;  3AH5 A;  2P8T A;  2D6F C;  3GTO K;  4A3K C;  1BJT A;  1USM A;  4AYB L;  5EGE A;  1ZXO A;  1VLO A;  4BLA A;  4BY1 C;  4GTA A;  2JA6 A;  5TJ3 A;  1F93 A;  4P9S A;  3GTG C;  3S1Q C;  4A3B C;  2Y0S L;  2NVQ K;  3BP3 A;  2E2I C;  3S1M K;  2O5J A;  1I6H C;  5IP9 K;  4A3G K;  2JA6 K;  1BDF A;  3AD8 C;  3AQO A;  2RH6 A;  1O2A A;  3AD9 C;  3PO3 C;  1DCO A;  4C3H C;  2JA8 K;  1JOE A;  2PA8 L;  1WOS A;  4A93 C;  3QX3 A;  5C4X C;  4QJV B;  5C3E C;  2A68 A;  3A8J A;  4KC6 A;  1C0A A;  3GTG A;  3RZO C;  1SFO K;  4O2D A;  1F9N A;  2E2I A;  1SMY A;  2GSU A;  4LK1 A;  5FLM C;  2VUM A;  2WB1 D;  3HOW K;  2BE5 A;  2GAG C;  3LPX A;  3A8I A;  1WSR A;  4KB2 A;  4GT9 A;  2JA7 C;  1INN A;  2O5I A;  2VUM K;  4A3M K;  1B4B A;  3I4N C;  4OIP A;  1ZVU A;  4QIW L;  3FKI K;  3S2D K;  1WCM C;  3ADA C;  4BBS C;  1WQG A;  1IQ0 A;  1AB4 A;  2NVT C;  3CAG A;  3TFJ A;  3L4J A;  1TWG C;  3HOX C;  2Y3P A;  3G4C A;  1WOR A;  2JA7 A;  2E2J C;  1HI9 A;  4A3L C;  3ERE D;  3V4G A;  1EFW A;  3RZD C;  3I4M K;  4GTC A;  1O25 A;  1WCM A;  2WAQ D;  4C3J K;  3GSI A;  3M4O C;  5TMF A;  4A3I K;  4KM8 A;  1K83 C;  2PMZ D;  3S16 C;  2V6S A;  1PJ6 A;  3HXA A;  2GSO A;  4LOW A;  2YU9 C;  1TWG A;  5IP7 C;  4A3D K;  3PO2 K;  3GTK C;  3M3Y C;  3T01 A;  4OIR A;  3GEI A;  1WOP A;  1IS1 A;  3HKZ D;  4KAW X;  2CFA B;  3L4K A;  2WB1 L;  2XCR B;  4WJ3 M;  4LJZ A;  4RMF A;  3S1R K;  1R9T K;  2FQO A;  3GTJ K;  4KAS A;  2NVX C;  1Y1W A;  1F7U A;  5M5X K;  4A3J C;  5IYC C;  4JK1 A;  2PHC B;  4YG2 A;  3GTP C;  3VA7 A;  3GTQ C;  4BY7 K;  1Y1V C;  3S1N C;  2KWA A;  2PPB A;  1RU0 A;  3GEE A;  3HOZ K;  1I3Q C;  4MEX A;  1WQF A;  1Y1W K;  4GTL A;  1VRQ C;  3GTM C;  2R92 C;  1YX2 A;  1PJ7 A;  1TWA C;  1ZBS A;  3S15 C;  4C2M C;  4A3C K;  4C3I C;  1EK8 A;  3K7A C;  3GEH A;  2NVY C;  2NVX A;  4KMD A;  4KN7 A;  4P5A A;  4XSX A;  4PAA A;  1PJ5 A;  4BBR K;  5M3F K;  5IYD K;  2GSN A;  4BXX C;  4LK0 A;  1L0W A;  4BKW A;  4XCH A;  5EGH A;  3GTQ A;  1J98 A;  4A3E C;  1J6X A;  2WAQ L;  4Y52 C;  1I3Q A;  4G7H A;  5C44 C;  3ORE A;  1XXC A;  5M5Y K;  1O28 A;  2PMZ L;  4A3K K;  2R92 A;  3OPF A;  3TFI A;  5IYB C;  2E2H C;  1YCL A;  1TWA A;  2B63 C;  1O29 A;  1TWF C;  3GTL C;  4BY1 K;  2R7Z C;  5IOT A;  4PAB A;  4QJV A;  1V5V A;  3SZY A;  3GTG K;  1TWC C;  4KMA A;  3S1Q K;  4GTB A;  4A3B K;  1B4A A;  2E2I K;  1WSV A;  1O27 A;  5M3M K;  1I6H K;  4G7O A;  1YNN A;  1XZP B;  3S17 C;  3PO3 K;  4C3H K;  3CQZ C;  1JVI A;  3S2H C;  4M1X A;  3Q3Q A;  1XZQ B;  5C4J C;  4OIN A;  4A93 K;  3NUH A;  2E2H A;  1TWH C;  5M5W K;  2B63 A;  1TWF A;  5C4X K;  4MEY A;  4Y7N C;  2R7Z A;  5C3E K;  3AD7 C;  2JA5 C;  3HOY C;  4X6A C;  4C45 A;  3RZO K;  4YFN A;  4AYB D;  4FZB A;  4A3F C;  3A8K A;  1XPP A;  1ZQ1 C;  5FLM K;  3LAJ A;  1IBA A;  1F7V A;  3H0G C;  2A69 A;  3HOV C;  4LR2 A;  2Y0S D;  3CQZ A;  4KB4 A;  4LLG A;  4KDD A;  2JA7 K;  3H3V D;  3HOU C;  2A6E A;  4DDQ A;  1TWH A;  1JQW A;  1YNJ A;  1G51 A;  3S14 C;  5D4D A;  2XCQ A;  2JA5 A;  2R93 C;  1I50 C;  1ISE A;  3GTO C;  1ZYR A;  1WCM K;  3EQL A;  3G4A A;  2NVT K;  3DXJ A;  4KAT A;  4G0U A;  2W7V A;  2NVQ C;  3S1M C;  1TWG K;  3HOX K;  1O2B A;  3WOD A;  2E2J K;  4J3N A;  5IP9 C;  1K83 A;  4A3L K;  4A3G C;  1DD5 A;  2JA6 C;  2A6H A;  2CFA A;  1DCP A;  1I50 A;  3RZD K;  1J6V A;  3GTO A;  2JA8 C;  2YU9 A;  3LAP A;  2RGR A;  3SZZ A;  1IL2 A;  3M4O K;  3GTK A;  1K83 K;  5E68 A;  3S16 K;  5TMC A;  3GDZ A;  4QIW D;  3FOE A;  1SFO C;  5JFE A;  2YU9 K;  4GTE A;  5IP7 K;  3JST A;  3T00 A;  3GTK K;  3BUE A;  3M3Y K;  4XSZ A; 
#chains in the Genus database with same CATH homology
 2E2I K;  3HOW C;  3H0G K;  2E2J C;  3HOV K;  5M3M K;  4GZY A;  1I6H K;  4A3L C;  4BBR C;  5IYD C;  4G7O A;  5FJ8 K;  1YNN A;  3HOU K;  3RZD C;  2NVX K;  3I4M K;  3H3V L;  3S17 C;  3PO3 K;  4C3H K;  3CQZ C;  2VUM C;  1I6V A;  4XLN A;  4A3M C;  4C3J K;  2WAQ D;  3S2H C;  3S14 K;  4A3J K;  5IYC K;  4OIN A;  5C4J C;  3M4O C;  4A93 K;  5TMF A;  4A3I K;  3GTP K;  2R93 K;  1I50 K;  1TWH C;  3GTQ K;  5M5W K;  1K83 C;  2PMZ D;  1Y1V K;  3FKI C;  5C4X K;  4A3K C;  3GTO K;  3S16 C;  4MEY A;  4Y7N C;  4AYB L;  3S1N K;  1I3Q K;  5C3E K;  2JA5 C;  3HOY C;  4X6A C;  3RZO K;  4YFN A;  2YU9 C;  4BY1 C;  4AYB D;  4A3F C;  3GTM K;  5IP7 C;  1IW7 A;  2R92 K;  3HKZ L;  4A3D K;  3HOX C;  3PO2 K;  4MQ9 A;  3GTG C;  3GTK C;  1XPP A;  1TWA K;  3M3Y C;  3S1Q C;  5FLM K;  4OIR A;  4C2M K;  4YFX A;  2Y0S L;  2NVQ K;  3S15 K;  4A3B C;  3HKZ D;  2E2I C;  4C3I K;  3S1M K;  3H0G C;  2A69 A;  3K7A K;  2WB1 L;  3HOV C;  2NVY K;  2O5J A;  4LJZ A;  3S1R K;  4Q5S A;  2Y0S D;  1I6H C;  1R9T K;  5IP9 K;  3GTJ K;  4KMU A;  4A3G K;  4LLG A;  2JA6 K;  1BDF A;  2JA7 K;  3H3V D;  3HOU C;  2A6E A;  2NVX C;  3I4M C;  3PO3 C;  4BXX K;  1YNJ A;  2JA8 K;  2PA8 L;  5M5X K;  4NOI A;  4A3J C;  5IYC C;  3S14 C;  5D4D A;  4A3E K;  4JK1 A;  4A93 C;  4Y52 K;  4YG2 A;  4A3I C;  3GTP C;  2R93 C;  1I50 C;  3GTQ C;  5C44 K;  3GTO C;  4BY7 K;  1Y1V C;  3S1N C;  5C4X C;  1ZYR A;  2CW0 A;  4QJV B;  1WCM K;  2PPB A;  3HOZ K;  1I3Q C;  2A68 A;  5C3E C;  4MEX A;  3S2D C;  4Q4Z A;  5IYB K;  2E2H K;  3RZO C;  3EQL A;  1Y1W K;  1SFO K;  2B63 K;  1TWF K;  3GTL K;  3GTM C;  2NVT K;  2R92 C;  2R7Z K;  4A3D C;  3DXJ A;  1SMY A;  3PO2 C;  4LK1 A;  1TWA C;  5FLM C;  1TWC K;  3S15 C;  4G7Z A;  2NVQ C;  4A3C K;  4ZH4 A;  3S1M C;  2WB1 D;  1TWG K;  3K7A C;  3HOX K;  3WOD A;  3HOW K;  2NVY C;  2BE5 A;  4OIQ A;  2E2J K;  4KN7 A;  3S1R C;  4XSX A;  1R9T C;  5IP9 C;  4A3L K;  3GTJ C;  4BBR K;  4A3G C;  5M3F K;  2JA6 C;  5IYD K;  2JA7 C;  3I4N K;  2A6H A;  4KN4 A;  4BXX C;  3RZD K;  3S17 K;  4LK0 A;  2O5I A;  2PA8 D;  2JA8 C;  3CQZ K;  2VUM K;  4A3E C;  4A3M K;  3S2H K;  4G7H A;  2WAQ L;  4Y52 C;  5C4J K;  4OIP A;  3M4O K;  3I4N C;  4BBS K;  4QIW L;  5C44 C;  4BY7 C;  1TWH K;  4XLP A;  1K83 K;  3FKI K;  4OIO A;  1WCM C;  2PMZ L;  5M5Y K;  4A3K K;  3HOZ C;  4Y7N K;  3S16 K;  3S2D K;  4BBS C;  5TMC A;  4QIW D;  5IYB C;  2E2H C;  2JA5 K;  3HOY K;  1Y1W C;  1SFO C;  4X6A K;  2B63 C;  4YFK A;  1TWF C;  3GTL C;  4BY1 K;  2YU9 K;  2NVT C;  2R7Z C;  4A3F K;  1HQM A;  5IP7 K;  4QJV A;  3GTG K;  1TWC C;  3GTK K;  4A3C C;  3S1Q K;  3M3Y K;  4A3B K;  4XSZ A;  1TWG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...