2VUOA

Crystal structure of the rabbit igg fc fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
215
structure length
215
Chain Sequence
b'PPPELLGGPSVFIFPPKPKDTLMISRTPEVTCVVVDVSQDDPEVQFTWYINNEQVRTARPPLREQQFNSTIRVVSTLPIAHQDWLRGKEFKCKVHNKALPAPIEKTISKARGQPLEPKVYTMGPPREELSSRSVSLTCMINGFYPSDISVEWEKNGKAEDNYKTTPAVLDSDGSYFLYSKLSVPTSEWQRGDVFTCSVMHEALHNHYTQKSISRS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IG GAMMA CHAIN C REGION
molecule tags Immune system
publication title The Crystal Structure of Rabbit Igg-Fc.
pubmed doi rcsb
total genus 41
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vuoA01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vuoA02
1V3LA 2O61A 5T1LA 2R2CA 4L3ED 1JPFA 2WMPA 5CFHA 4LRIA 1XF3B 3MRMB 1KLUB 3QDHA 2XXCB 3DX6B 4Z7VE 5EUOF 4H1LB 1CE1H 4PJBF 1FORH 4FFWC 2H32B 3C5SA 4DVRL 1KTLB 3FKUS 3QFJE 2R8SL 1QSFE 3ECBA 4XAKD 1FO0A 5BXFB 1HHGB 4PLNC 4Y5YC 5IT2L 1I8LA 1WQVT 3NCCB 3TNMA 1S7UA 3FOLA 4ZAKC 1U8QB 1NJ9B 3X11B 5SWZA 2IBGA 4I4WB 4MD5A 5H8DA 3QUYA 4X99B 4HIEA 1PKQE 4PJ5A 2YPVL 4UB0H 1H3XA 4WENB 2Q8AL 4R96B 3FMGL 2ZSWB 1CFNA 4XP1L 4NN7B 2Q7YB 4JPWL 1N8ZB 3EOAB 5BCAA 1IVLA 2IPTH 1KJ3H 2CRIA 2PR4L 4QWWC 1TETH 2PO6C 1CFSA 2GFBA 3GBML 3MRNA 4H26A 3O6MH 5D7SL 5CWSA 2MFNA 1W72A 2DTMH 5C6PB 4HS8L 2FECL 1AD9B 1BZ7B 4WW2C 5CWSB 1J8KA 1XGPB 4L8DB 5J12C 5J3HD 3D3VE 3C6LC 3JV6B 3NA9H 1BQLL 1NUGA 3O2DL 3KPNB 5DJCA 3CNKA 5FCSH 2CJUH 4MJIA 3BJ91 5ICXB 5IQ9B 4O4YH 4CNIA 4HXBH 3EFDH 5E4EC 4N9GA 4MJ5B 2IFGA 4B7IA 1SJHA 5KOMC 5KSVB 1E6OH 2AV1B 4LCYA 2W9DH 2VE6B 2UWEF 1C7SA 4KK5C 2P8MB 4BFIA 1X5FA 2BDNH 3IDXL 1A4JA 1SY6H 4QRPB 4FFWD 2ITCA 4R4ND 4R8WL 4GRLD 1J0HA 2A83A 2JELH 4XRCA 2A6KB 5I1EL 3FO1B 4FA8A 4XC1L 4U0QB 1F02I 1H3UA 3MJ9L 1OT1A 1F4YH 3W0WD 2YMXH 1IEBA 1K9TA 2EDHA 43CAB 5KVGH 2XOTA 5JPMA 4NC1C 4P2QD 2AXGA 3LMJL 5EA0L 4U1MB 4GLRH 1KB5B 5GSVA 3I50L 2W0LA 4ZYKB 4RX4A 2Y06H 3LD8B 1NUNB 4K7PL 3QCVL 3QG6B 3VXOA 2C7UB 4LNRB 2YSSA 5B4MD 2EE2A 2W59A 2FJFB 5E6ZA 4TTDD 1IM3B 5JXED 3PJSA 1S9XB 3SE8H 1IM3A 2R4RL 2VAJA 5HVFB 1JHLL 4U4BA 3KGRA 2ORBL 5FA4B 4L4VA 1EAPB 4HJ0D 5JNYA 3O6LH 2QKIA 2QQQA 3QXWA 1MWAA 3O3BA 3CVIH 2V6HA 4QRSA 4PJDB 3C5ZA 2R23A 3BD5A 2VQ1B 3D2UA 3SY0A 2I07B 3VFWB 4A6YL 4X5XB 3T2QA 4EI6A 1F4HA 1R24B 3HC0A 5DYOB 4X7CC 3CSBA 1F8TL 3PWUB 4M5YH 1OLZA 4OM0L 4FHBD 1K2DA 3GGWA 4RGND 4N1HB 1FSKC 2IANE 2EIBA 4D0CA 3ZE1F 4P4RA 1RIHH 5TDNB 3DROA 4HH9A 4IRSA 1MVUA 1KJVA 5IFHL 1U3YA 4BH7B 3ULSB 4ONFL 3VCLB 3CAFA 4FXGA 1MVUB 4LGPB 3EOYG 4I0PB 4QXGH 2VYRE 1BJMA 1P84K 4I18A 4JFPB 3T0DA 3LN4B 1SJVA 2P7TB 2VLMD 1ZS8B 2CGRL 5EBLB 2DQHH 1FHGA 5EO9A 3JTSB 3GGWB 1OAKH 2DN7A 3QI9A 1FAIH 1YQVL 4I9WD 5I73B 5DD1L 2A73A 3V5KA 3GK8H 4JHAL 4BZYA 2NY1B 1JGUL 3QUZB 4Y4KB 2N56A 1U42A 1T4KB 4YR6B 1N5YH 2WLYA 4U6HB 5C0GA 4JGJA 4AK1A 2D0FA 4HEPG 1I3GH 5M94B 4MJID 2LFGA 4QCIA 3ARBD 1D5ZA 4XP1H 2EYSB 5DZNA 2GJZA 5K9QI 4G7YL 2IPUK 1BP3B 2EICA 2VDOL 2YPKB 5I74B 2QKIB 1I9IH 3ROOB 5EO0B 1HYSD 4NGHH 3QPQD 4J7RA 2CKBL 5KVDL 3W81A 1OTTC 4QCIB 1Q9WB 3A67H 3BGMB 3NH7L 4XAKE 3BXNB 3IAPA 5JHDB 2AKRB 2B5IC 3TT3L 4Z78A 1QBLL 4PRHA 3VXUA 1DEDA 1JK8A 4JM2A 2XQYG 5CEZE 1OP5H 2BC4B 3V5KB 2ADJB 4IRSD 4OD2A 4JY5L 4ZS6C 4U1KB 4KZDH 3QEGL 1DCLA 4P2RE 4C56D 3OAUL 1UB6A 1K8IA 5F8RC 1F58L 2VLJA 3HZYA 4N5UA 3V79C 2CDGA 5CZVL 4OCYL 5D9SB 4PYHA 3SOBL 4YUEH 1F90L 3H9SE 5FCUL 2Z8SA 2APBA 3GIVB 4DZBA 4MAYB 1F11A 4RMVA 2NY6B 3PL6B 3EYVB 3RWDB 1MCBA 1MAJA 1JHTA 1S7TB 2HLAB 4ZTOH 2GSGB 1QBML 4JM4L 5D7KD 5DJ8A 5EC2A 1RHHB 4MZ3A 4QTIH 3G5YA 3U79A 3MLRL 2C1OA 3B2UC 4M1DH 3CVIL 4JFDB 1YYML 3BQUA 2VZ1A 1JF1A 4YBQD 3SCMC 3STLB 1U8NA 5ACZB 3PGDA 1CDHA 4MNGB 3BT2H 5F44A 3MV9E 4OZFH 4XZUB 3ZYZA 1U41A 2VL5A 5D7LB 1G7PA 2NXYD 5HI4C 3KYNB 7CGTA 4PRHD 3VXUD 3PP3H 1KTRL 4MNGA 3U4EA 3WE6A 3B9EA 5CZKA 2J4WL 4W81A 3BZFA 1EFQA 2AXFA 4F57H 3D5OF 1TJHH 3V4UL 4MDIA 3PABB 3S37X 4HWBH 1WGOA 1ORSA 3K2UL 1R5WB 1FVEB 3MYJB 3DYPA 3HZMA 3N50A 1IGJB 2XA8L 2XV6B 3PV6B 3NZHL 1F4YL 4PGCB 2HT2C 1U9KA 4G8GA 4G8IB 1A6VL 3RL1B 1JZ7A 3GI9H 4RGOH 3MLYL 5CEZL 1S7QB 3QDGE 5MEQA 1H15A 1CFQA 3WHE1 5EO1B 1G1CA 3T4AB 1RZJH 4ZD3L 3TPUB 1GC1H 4PB0H 1QHPA 5T1MA 4NCC1 5IK3B 1F00I 2EDWA 3IJYA 4GKNB 5KAQF 1P4BL 1E6OL 5F1IB 1BREA 1CIUA 1I75A 5B4MC 3TIDB 3SKNB 3LS5H 3DV6A 2P5WB 3VWKC 4APQB 2B4CC 2F58H 5D72H 2BFVL 1BZ9A 4JG0L 4DKFH 3SDXE 3SKMB 4L4TB 1Q94A 1DEEB 2J8UB 2A6DB 1S3KL 3BX7C 1M4KA 2EE9A 4OFPA 2DB8A 1NFDF 3M1BB 2ED8A 5KG9A 5F7YC 4QTIL 1MCOL 4AT6A 3FB5B 5I18L 4F3FB 3WNOA 4PRHE 5EN2B 3VXUE 2P42B 1WITA 4Q2ZA 4RWYL 2F53E 4Y4HD 4PY7A 4KAQH 1CG9A 1PD6A 1AP2B 4NHCH 1T5WB 3DBXA 1KENH 3X13B 5DTFB 3U83A 3V4PH 3GMOB 3ZTNL 5IMMA 4PREB 2X4OB 5TF1H 5T3XH 3MC0A 5BS0D 3MPCA 3KJ4B 4Z95H 2BVOA 3U82B 4EVNB 1EHNA 4Y1AA 1LO2L 2HWZH 1K8DB 2JJTC 5DS8B 3IU4H 3MOBL 1LHZA 3SCMB 4WFFE 4IMKA 5DMGC 1UZ8A 1F4WH 4RAHA 3WN5C 4OGZA 5HGAA 4IJ3B 5I66A 5D4QA 3H7BA 4I9WE 8FABB 1T1XA 2BCKA 4PY8J 1CD9B 2JKXA 5KS9E 3BE1L 3WL9B 3B2VH 3H3PH 1G9NC 1OW0A 3H7BB 3TV3L 5FA3A 4AMKH 4LPVA 4GH7B 4G8GD 3MUGA 4WW2A 3P73B 4R2GB 5SWZB 1KIPA 4N0YL 3VFGL 1E0OB 2AJZB 4E41D 4NQXA 1JMXA 4H25A 1NANH 1PJ9A 1RUMH 5FB8A 5I16A 5EU6E 1H5BC 1NGXA 4MXWL 1G9ML 4P3WA 4OLZL 2OR7A 2Q8BH 4Q7DA 2BRRL 4L3CB 3P9MB 5FYJH 2OK0H 2BSED 4ESKA 5CINH 1A7BA 4PY7B 2OI9B 3UX9B 4JG0H 1QO3B 4WUUE 2VLKE 3QCUH 5AYUL 2AJUH 4F7TA 2HFTA 2ZG1A 1TJIH 1OAXL 1XF3A 4M43L 2ICCA 3HI5H 4OB5H 1MFDH 4ZOCA 3B4NA 4U6TA 1ZLVH 1Y18A 3MBEA 1X4YA 1IRAY 1OAKL 3IFPA 3CDGB 1FBIH 4MCYB 2QHRL 3BAEL 3HNSL 1NBQA 4H8WL 3K8LA 2B7DT 3PP3K 4DJMA 3OSKA 3LKQA 4OCNC 4OGXH 4FQPA 1YEEH 2QADC 1J8HA 3SE4C 3P0VH 2XZZA 1GZPB 2ATKA 2C1PA 2NXZC 5B38A 1P7QB 2BNRB 4XCCH 3NACH 1WBXB 5LCVH 5DJXB 1BEYH 3NTCH 5A3ID 3RJDA 4WW2F 1QO3A 5IBUG 2V5YA 1FFOA 2CKBB 4JDVB 4PJHA 3QUXA 1ZHBA 3T77A 4A6YB 1TQCC 1U8MB 4ODSL 3Q5YA 4AEIH 2HRLA 2BVPB 4XP6H 1P1ZA 2DJSA 3FQRB 4ZQKB 2FYYA 3TT3H 4LSPH 4MQXD 4Y5VA 1DQJA 3MUGB 4KI5E 4HGWA 3K1DA 5I1LA 1UACH 4OCRH 1HEZA 3GMPA 4L9LC 3EGSB 4NRYA 3D18B 4YHPB 3MRQA 3X12A 3LHPH 2B20A 1RI8A 1JIBA 1OGTA 3C09C 2HT3D 1OAYL 3KS0J 5EBMA 4AENA 3QHFH 3ZE2F 2BHYA 3V4VL 1UCBH 2FZ3B 3S3SA 4R6UA 1YUHB 3DMMA 5F7WC 1S78D 1A3LH 1AD9A 2CRMA 4UINH 2BVUA 3CFDA 5EBMB 4AENB 4LARL 2IADA 5BOZG 3O4LA 3V6OA 3PXJA 2J6EA 5F1NB 3RVTD 2H8PA 4DN3L 1Z0NA 2R2EA 5JLZA 5DD1H 3LPFA 5JNYB 3HNSH 2DIBA 2YXFA 2Q6WA 4JKPL 4K94L 2ZUTA 3NCYS 5KSBE 5J3HC 2MKLC 4TSCL 1CF8L 1I85C 5DVLA 3ARGA 1LK2A 3D85B 4KQ4L 4LNRA 3HCVB 4AIZA 2KQNA 3FQRA 3TVMB 2GIYA 3S35H 4ERSH 4Y4FA 5CBAA 4PUBL 4YIQA 5FO7B 5C09A 3GZKA 3FO9B 5KAQG 3B5TA 1G6VK 3MLTA 1IKFL 1IEBB 4FQCL 4G42A 5KVDH 2FBOJ 5DGRA 2JCCB 1NFIB 4S0SD 1I8LC 2VXVL 1NFIA 4QXUL 2YHGA 4P4KD 2CRZA 3MRFB 3QH3A 5DJ6A 5MERA 4HIHB 4NBXB 4MX7A 3EO0B 5CD3B 2UWEA 4U7KA 1CFBA 3HR5A 4ZXBD 1G9NL 5GS3A 2VABB 3RWEA 2DKSA 4WHDA 4BKLB 4U6YB 3TT1H 1AO7A 1IGMH 5FO8B 2AV1A 4JO4H 4GRLA 4DN4L 5J6GA 1NLDH 1QNZH 3O2DA 3O8XD 4M7LH 5L8LB 5CGMA 1TCRB 4YXLL 4WEMB 4XBGA 2EE3A 4LSQH 1IAIH 1IFHH 1WV7T 1K5NB 3L3DA 3HS0A 3MRGA 3ZKQD 1LP9E 3LCYA 5CZXC 1BIIB 4U1HA 2Q1EA 5CMAB 1WSST 1T21A 3BKYL 4Z7VA 3MACH 5HHOE 4NDMB 3CFDB 4XPHL 4JR9L 4W6XB 4RX4D 4I5BA 3QZWG 1YEGH 4FNLH 5EBLA 3WYRA 3BDYL 3X3GH 5C8JB 2R0LL 1KG0A 5F9JA 4K71B 3I84A 4M62L 4UT7L 3TBYA 3UP1A 3IFOA 1VPOH 3HNTL 1NGQL 4O58L 4Q9CA 3V0WH 3P9WB 2HG5B 5DURD 2AJYL 3H42L 3VXSB 3DI3B 2X7LB 1MCDA 2EIDA 3CDFA 1AFVH 1BJ1J 5DRNB 4PD4K 1GC1L 5ID0B 3GMQB 1LEIA 5ACZA 3VCLA 4KQ3H 1RIVH 1JWUA 3OZ9L 5JQ6L 3CLEH 4RGOL 1VKXA 4KI5C 2EDQA 1JBJA 1FORL 3C5ZD 1E6JL 3PHOB 1N26A 2VN7A 1RJCA 1QSEA 4YEEA 3QHFL 4PJAA 4YHYC 3MSPA 1FYTB 2W0FB 4HULB 2A6IB 5DRZB 2C4FU 3L3GB 3O3EB 4R4NC 2XNAA 2OS7A 2VR4A 3BP6B 4PV9A 3F6LA 2B2XL 2I07A 4EI6B 2HP4A 1SM3H 1NMBH 3I02B 4M48L 5EOCL 5ALBH 1MHCB 5C8JA 4FTVB 2XKUA 1IAKB 3U7YL 3EHBC 2WBJA 4MJ2A 4KDVA 1ZHKA 2DQDH 1RU9L 4DGYH 2VZUA 3MROA 4Z7VF 5EUOE 3QCTL 2YEZB 1CGSH 1P53A 5IBTL 1ACYH 1VDGA 1ZANH 4UT9H 4K2UL 4MNQB 3RQ3A 4LU5H 2ED7A 4GOSA 1FNGB 2PR4H 4UBDC 1DN0A 3QJFA 3RTQD 4NCDA 5F6HI 3SDDA 3AM8C 1FDLL 3TH3T 1Y6KR 2MCG1 3EYUL 2WBJB 3GSNL 3ZL4H 4LLYA 5DK2B 1Q38A 3VWKA 1NBYA 4R8WH 4PJ8A 2VLJD 4LCUA 4QXTB 1G7IB 4OFKA 4NQEB 4OLYL 1A6TB 1FH5L 5IG7A 4H88L 1QFHA 2X70A 3P0YH 4PRIA 4LLMB 1D6EA 4IHOB 1OTUC 4Z76B 2OL3A 1NSNH 1X44A 4G8IA 1NDGA 1FFQA 1A0QL 3QZWB 5HHNB 5DDHB 7FABL 3TT1L 4UQ3B 3PHOA 5SX4I 4X6FB 1PKQA 1YPZF 4DZ8B 1E27A 3IF1A 4ZS6D 4J1UB 1KB5L 1CLZL 4Z0BH 2AJ3A 4KHXH 5BV7H 2E9JA 3DOSA 4H1LH 5A3IC 5I17B 2Q7NA 4QXUH 5IIEA 3QA3A 3ESVF 1T0MB 2Y36H 2ZUYA 4KUCD 1L6XA 2R0KL 4L29B 1S7RA 1G7QA 5C2UB 2FCBA 2IAMB 2I26N 4PLJC 2QR0B 3KLSA 1ZLVK 4CVXA 1JI1A 5LJYH 1EPFA 1MJUL 2H3NB 4U6XA 5FOJA 5I75C 1PZ5A 2PTVA 4X6CB 4RRPA 3GMRA 5HXMA 1CYGA 1O5DT 1A7RL 3H42H 4MA3B 3WKML 1G7QB 4U1SB 1KIQB 3LKNA 1FAIL 1YQVH 5DJ8B 3ARBC 5F7MC 3SDAD 4MS8C 1KCSH 2FBJL 5HHPB 4Y2DA 1RK0A 4WY7L 3EFFB 1F11B 1KFAH 4I77L 1R5IB 4OD1L 2VMFA 4CRPA 3LQAH 4GMTL 1MOEA 3MLUH 4KI5F 2PYFB 1KCUL 1JHKL 5A2FA 1U58B 2IFFH 3NCMA 2VB5A 3QDJA 1AI1L 1CDCA 4JDTH 2NY3B 3RUGB 4DW2H 4KRPC 2BY3A 5MEND 3VWJA 2VR5A 1FLRH 4LVOC 5DJ2A 1ZKAA 5GJSL 2DWDA 1A1NA 4N0UA 3TA3C 5C9KA 3ZTJH 1WFUA 3EDDA 3PWPB 4L5FH 1XGYH 3PWPA 1JK8B 3VWJD 5CD5C 1A1NB 3MLZL 4OZ4B 1SVCP 3CXDL 1T66C 2BVQB 5EZIH 3AS0A 3V95A 3BZDA 5KJRH 1WK0A 2W1NA 4LBEB 3AS2A 2LQRA 2YUWA 1H9VA 1HZHH 3H9YA 5B38B 2Y1VA 5T1LB 4LCWE 3IRZA 1J12A 1CXHA 1RZ8A 2EYTB 3GNMH 3HPLA 3NN8A 4XPFH 3QQ3A 3WHE0 4ALAL 1S78C 4PRAA 4Y2DB 2Q86B 1AGBA 3BPOC 1EHLL 5HHOA 5E94B 3W9DA 3FFCD 3VE0A 2DYPA 3VXQA 2QEJA 4JFOB 3WXWL 2EZ0D 1XEDA 3MV8B 4JKWA 3EYUH 2DJ4A 5FGCE 4TRPH 4P23B 4Z7UE 2BOBB 3S36H 2H3NA 4JFQB 2ERJC 3I6LE 1MHHA 4OGXL 4I48A 4NQUA 2NW3A 3BISA 5C0FA 3GIZL 1RUQL 3ZZ1A 4PRBB 1RJZB 2M1KA 4KI5D 3T1FB 1F3JA 1N2RA 4E5XA 3HMWH 3ORJA 4M62H 4MYWB 1J5OL 1MFEL 1AHWB 2Q76A 3HI6H 2D9QB 4Y5YA 3VXNB 2VDKL 4JM2F 1XCQB 3MRBA 5DHYA 1G7JA 2ARWA 5FB8B 3UTZA 3OL2A 1KXVC 1MWAH 4HG4J 3GSNB 5KN5B 3VXRB 4L9LB 4OM1H 4OLUL 2VXTL 3M17A 1DSFL 1BBDH 2MWCA 3M17B 1X5IA 2H9GB 3GSNA 5KN5A 1IAOA 1ZTXL 3BKCL 5A43C 2I25N 3X3FH 1MLBB 1OAZL 2AV7B 1SJEA 1FFOB 4FXLA 4JO4L 2QQNL 4LBEA 4PB0L 1MI5B 1ONQB 3M45A 3OJMB 4Q0XL 2CUIA 3QUKA 4R90H 5EC1A 4EVNA 5IVOA 1UH2A 4EIGB 3EZJB 3VFVB 1WBXA 5FM4A 3Q5TA 3GUTA 3T3MF 2C3VA 1J8HB 2DDQL 1J7VR 4XXCC 5DO2D 3SDAA 1KTLA 3E0GA 3O81A 4MD0B 3GMNA 5D2NB 4K8RC 4PJXB 4BSVA 1AIFA 1QFUH 5DRXB 1CXLA 1U8KB 4WFHE 3ZE0E 5CLTA 3OKOA 3TVMC 1KJ3L 3UPAA 1IL1A 2C5DC 4WHYH 2IWGA 4KHTL 2ESVB 4KJWC 2X05A 1FZMA 4XP4L 4DAGH 1DBJH 4AJ0A 1DN2A 3BH9A 3L9RB 3OG6B 4OZHA 2WV3A 1VCAA 4NPYA 4IS6B 5SX5H 5DRXA 4D9LL 3BW9A 2LVEA 4LGRB 1NCNA 4M6NL 1B0GB 1RV6X 3W11C 4ODWB 1DVFA 3VXMB 4WO4A 4L4VE 4K8RH 5SWQB 4L9DA 3TCLA 4L3CA 4JKLA 3DX9B 1JV5A 3RVXC 1INEL 1OY3B 1U3HB 3RAJL 4DN3H 2UV3A 1CL7H 3NFSL 2C26A 1P9MC 5FHAH 3VFVA 3MTRA 2HLFC 3VFOB 4NM4L 4EQ2A 5E5RB 1KULA 1SEBB 3WS3B 3MV01 2Z31B 5JMRA 1AGDB 4K3DH 4ZS7L 5AYQA 3P11L 2G75B 4YIQB 5C09B 1F45A 1FFPA 2FJGA 3VFTA 1A3RH 2G5BB 3U36A 4PGEB 4FG6C 1M71A 1LE9A 1L4IA 1BZQK 4ODXA 3AB0B 4MJ5A 5D2LA 4BUGA 1MELA 4LVHC 4NT6A 3DXAB 1I9EA 5I1CH 3KJ6H 2NZ9D 5ICXA 5C2BL 1LO4L 1IKFH 3P4NA 4DUWA 3CC5A 1XF4A 5LXGL 4X6BB 5FDWB 4QXGL 4JRXE 5C0RH 2MHAB 1AH1A 5MEPB 2EIZA 3IETB 1SEBA 1ZV5A 3B2VL 1U8LA 1C5BH 3K80A 4DEPB 4EXPX 1S5HB 1MJ8L 4MQ7B 2J88L 5I0DA 4MWFA 5L9DH 2XT1B 5ADOH 1CFSB 2GFBB 5DFVC 1MCPL 4GSDL 4ZO9A 1F4XL 5IHZB 1BVLA 1OB1B 1MEXH 3MFFB 4PJDA 1LQSR 1VA9A 5ELIA 2DDQH 1OD9A 5BVJB 1NGWB 2VXUH 1NUFA 1PVHA 5I2IA 1I7UA 2OR9L 4JFED 1CFNB 5KVEL 2YD9A 4G7YH 2W91A 1LE9B 2ZOKA 4JQXC 4G6ML 4U6VH 5EU3B 1I9JL 4UUJB 4TOYH 1A5FH 1P9MA 5F88A 1GCFA 4MCYA 1HWGB 4BZ2L 3DMMD 1QRNA 3ARRA 1JPSL 4Q6IC 5MERB 4LU5L 1BFVH 3ZYOA 3L3JA 1D9KA 5J11B 2YD2A 4FRWA 4QO1A 3RWFB 3FT2A 4FMKA 3E2HC 5SWSD 3HHRB 3C2AL 5FFLA 4KROB 5HGHB 4X7TB 3RWFA 3NCYP 3VGBA 5HYSA 4NO5A 1D9KB 1N64H 5FYJL 2OK0L 1UFUA 2NYYD 3O3UN 3ARGC 4ODSH 1UWGL 2ICWI 3JUZA 1QSEB 1LK2B 2PTUA 2EH8L 4N0FA 1Q9WA 3SE3A 1CFVH 2SEBA 4O02L 2OJEB 2VLJE 1IT9L 3QNYA 5B8CA 1EEZB 2VXQH 3SKJH 1MREH 3V6ZA 3GMQA 3AAZA 4KRLB 3F7YA 4GAJH 2O5YL 1XIWC 2BNUB 3UTSA 3N85H 1BVLB 1FNSH 4O9HL 3IFOB 3CVHA 2R39A 5EU6D 2RCSH 5I71B 4YWGL 2ILLA 3MODH 3U7WH 5C0GB 1VACB 3VA2C 1RJLB 2BNUA 5GS1C 4PJBB 3VRIB 3MNZB 2J6EH 3QUMB 2VDMH 1A3RL 4FXKA 5DUBB 2XTJE 4L29A 4S1QH 1EGJL 4RAVA 5FYLE 5L6YH 2D31B 1AXSA 4JQVA 3DRQA 1QD0A 4JO1L 4Q9BA 2VL4A 2OLDA 5EORL 4N0CD 2P8PA 3MGTB 4NUJB 1N6UA 4XPGL 3SDDD 3K8MA 1KV3A 1R0AL 5IEHB 3NIDF 2PUQT 5ID0A 4C56A 1HSBB 3DX8B 4JVUA 2ZUQC 3RWCA 1QR1B 1UH4A 2UZIL 2QADD 3IDYB 4H20L 5E6ID 4EKXA 2EDRA 1JNLL 1P2CA 4YQXH 4N68A 3GSRB 4UQ3A 3I6LD 2K7PA 3PF2A 2D3VA 1M7DB 1D6VL 2X5PA 2XYCA 5FV2A 5D6DA 5C0BA 3SE9H 4GKOA 2X4UB 2BC4A 4CVWA 4NQDE 5IKCB 4NN6B 2ITDA 4PB9L 1U36A 4LIQE 2H32H 4FQJH 4DGVL 1A7QL 1A7QH 3D1MC 1K85A 2AK1H 1JRHI 1A7RH 2J5LC 4L4VD 4QRRD 2R4SL 3PGFL 4WV1A 3IRPX 1BQUA 1AE6L 3E2HB 4HKZB 1N5AB 4G7VL 3TJHC 4GG6A 4HC1L 4NBYB 4WV1B 4TQEH 1AJ7L 1U3JA 1D5ZB 2VDNH 2EYRA 3D25B 2DQTH 1MCHA 3AY4C 1EHAA 4U1SA 1CICC 4MDIB 1JYXA 5IMOA 1G7MB 5BS0E 2DOCA 2FEDD 2DRUA 4LMQE 4EXKA 1KIRA 2DQEH 2ID5A 3SKNA 3D69A 4NO2B 4LPXA 5FYKE 3SBWC 3K7UA 3MV7E 4K9EC 1BECA 2QR0A 2VISA 3MRJA 3OKNA 1M05A 2BMKB 2GTWA 2W07A 1T1ZB 1JF6A 2I9LA 4UU9B 4U1LB 4K3DL 1AO7E 3QHZH 4IMKC 4TNWF 4L1HA 3MLUL 3GMLB 1BFSA 3QFJA 5C08B 3VFUA 4L8SB 2DJUA 2ADIB 2DWEA 3HI6L 4K8RL 5FHBH 3ZKXB 1ED3B 4LLVA 3VG0H 4DZ8A 1CZ8L 3HC4H 4Y19B 1KNOA 1QHOA 5FYJD 1KIQA 4BFGA 2CK2A 1YPZE 3DURB 5JA9A 4P5MA 3TZVD 4OZFB 1DLFH 1EK3A 3FQXB 2XTLA 3GMLA 2UYLA 1UXSB 3QQ9C 5FCUH 1U6AH 5IMMB 1CT8A 3KYNA 3HG1E 3CX5K 2NR6C 1K6QH 4OLWH 4FQ2H 3TWCH 3OKNB 1A6PA 3BGFC 2DD8H 3WO4C 4GSDH 2R1XB 3IDYC 1JE6A 1L0QA 4G80A 3AY4A 1CGSL 3QCTH 5TGBB 1CLYL 2AKRA 4DVBB 5GGVH 2XG5A 3RJQB 4KMQA 4N8CH 1YEEL 1ES0B 2YA2A 4N8CL 4DK6A 1BPVA 1C5CL 4KTDL 1BZ9B 3CMGA 4LKXB 5DWUL 5J57B 5F6IB 3IU3B 4TPRL 5HHOD 5B21A 1FIGH 1OGAE 5MP6L 2EXYC 4C54A 4ELMA 4CVUA 4P5KB 3NIDE 4QLRA 3GUTB 4OFYA 1T2QL 1PKOA 2A0LC 1S7XA 3KYOA 5CILH 3VGGA 2XN9D 3UYOD 5DMJB 2XXMB 3FZUC 5F1IA 3OXRA 4QRQB 1WLHA 1B4JL 4BZ2H 2E7MA 1T80A 1EEQA 1MPAH 2HMIC 3QUZC 4Y4KC 3BN9C 4P5TD 1UH3A 1TVDA 3EZ8A 3DV4B 1NC2D 2ZCLL 4XNMB 4HFUH 4N0UB 3GHBH 3MA7A 1FNFA 3NCBB 3OR6A 4P3DA 3GSUB 4P9HC 2FATH 5E99L 1YEIL 2X10A 1RAMA 3VGAC 5GS2D 4CN1A 2PYFA 3S5LA 1OSZA 3SO5A 3VFMB 3UTQB 5F6HJ 4WW1A 4XVSH 3C08H 4M7JH 4IOIB 3RZCB 1RURL 3I2CH 1PGRB 1UEYA 2AJUL 3GM8A 3VGFA 8FABA 1F13A 3C60B 4KHTH 3DJ9A 2B5IB 1AGCA 2PYED 2YOCA 5HVWA 5C0BE 2EKSA 1RJZA 2CK0L 3B9DA 4QKXB 5CINL 1UZ8B 4Z7WF 1HK6A 4LSQL 1FGVH 1DE4A 4M61B 3O6FB 5I1CL 5C0AE 4MXWH 1MHHB 5F6IC 1FP5A 4GXVH 4M7LL 4WDIA 1EVTC 4Y5VC 5L8JB 3WS6A 2BOBA 4HWZA 4NFCA 1XGQA 3TJHD 4YHIB 4NNPL 1FZKB 4ENED 4GXUM 3VXTA 3MV7A 1HOCB 3Q48A 1XF4B 2E9IA 1KIPB 1G7LA 4OSUL 2X9YA 2RFXB 5E00A 3QUXC 1I1FB 3V5DA 5J13B 1UXWB 2NY6C 3HPLB 3NN8B 3ZE0F 1N5YL 4KDTC 4WVRA 3M1BA 4UNVA 1QUNA 5EU7C 3BRDA 1OTSD 5ABDE 3WDHA 1OF2A 3TIEA 4MD5B 1NGYA 1MH5B 4Q58C 3QQ4A 3MOBH 3IU4L 1IMHC 4YFDB 1LDSA 1IC7L 1T1YB 3ZKMD 1MVFA 5HGGS 4FZ8H 4FZ8L 5T5FL 4PFEA 4Q74A 4JHWL 4EN3B 3VW3H 1FE8L 4QOKA 4TSBH 4EUPH 3ZE1E 3K74B 5GS0L 4PJCA 5INDA 4WO4B 3U9UB 3ZMRA 5E99H 2FATL 1EAJA 4AT6B 1D5BA 4WHYG 3CVHH 1RZIA 4QTHB 5DJXA 5ITFA 1F3DH 1S5IH 3QIWA 3PGCB 1GZPA 3OJDB 2JIXA 2HLFD 2XKNB 1YN6B 5IB4A 1JPGB 2PXYB 3TN0D 4U3CA 3GFUA 1H3WM 1PEZA 4P2RD 3WJJA 4BFIB 4C56E 5J7CC 3BWUC 5FECB 1WCBB 2DMBA 1U8PA 5FUZH 3CUPA 2EH8H 2I5YH 1YN6A 5L2KB 4FMFA 4HBCL 2VZTA 3HUJE 1TJHL 2IADB 4ZDHA 2HT2D 3QIWB 4G43A 4JFYB 4IEFB 5LWYH 3HFMH 4DKEH 3FO2B 4IMLA 4HPOL 43CAA 5FYJE 5CUSL 5DFWH 4GAJL 1ADQH 2ZWLT 2KPNA 1BQLH 3NA9L 2APTA 4LHUA 3GI9L 4MQ7A 2BERA 4XP5L 1WBZB 5I1JH 3NFNA 4KQ4H 4MLIA 2QSTA 3TVMA 4EBQH 1FV1A 3ZE2E 2BP3A 2CSPA 4UMGA 5E08L 2A83B 5IFJB 3Q6GL 3QUMH 1MH5A 1NGYB 2DTSA 1CLOL 5IROC 4OZIA 3L5XL 2E7LA 2DQJL 1NCTA 2YD5A 5D5MF 1TDQA 1SJHB 3NACL 1EFXA 2F19L 1XIWB 2W9LA 3MNZA 5CGTA 1U8MA 3TA3D 2BJMH 4G6FB 4ZXBA 3QUXB 2OTUA 3NIFE 5HYQA 1R3LB 3AMKA 5E24E 2E27H 5F7EH 1Z5LB 3SJVB 5H35A 3VFOA 5CEXA 3VJ6B 4HX1B 3KR3L 4OGYL 2I24N 1J1PL 1P7QA 2WBJC 2BVEA 4JKKA 3MLRH 1U2CA 2PF6A 1X9QA 3QDGD 3VI4F 4DN4H 5B22A 1MJUH 3U4AA 3FFCE 1I3VA 4JHBA 5FECA 1SBSL 1FRGL 2D7NA 2M2DA 2DAVA 2J1KA 4HGWB 4AZ8A 3EOAA 1NDMA 2DI8A 5EZLB 2FX9L 4G8EB 1CI5A 5J6HA 3UPCA 3QSKB 4Z7QF 2WSKA 2CIIA 1FN4B 3QG6A 5FGBC 2CKBH 3CFBB 2EDFA 5I9QC 5JW3H 3LN9A 2DQEL 2XN9E 1UVQA 4FFYH 3O8XA 4JZJC 2AXGB 5MEOA 3GB7B 1BHGA 1GH7A 1ORQB 1T2XA 3PHQB 5DVNA 3S6CA 4M93C 3TFKC 4BSJA 1U8JA 4E0RB 7FABH 1H3PL 4NM8L 1U3ZA 2UVFA 5D93B 1I1AD 1MJ7L 2JCCA 4WFEE 4P48A 3AB0C 4ZUVB 3MO1B 5FK9B 2FLBT 3SJVA 5D1XA 5CJXA 1S7WA 1R3KA 1P2CB 1T7VA 3FO9A 1SEQL 1NL0H 2R2HB 5GIRA 2P5EB 1A4JB 5F7FA 4UDTA 4RAUA 5HDQH 3HE7D 3QEHB 2ZKHH 1KPRA 1RZKC 1WAAA 5D7JB 5ESAB 1EFXB 4PJCE 2X4NB 2P8PB 1I7UB 4HJJL 3H9SD 2VR9A 1OGAD 4G6KL 5DRNA 4KUZL 2BVTA 3I3DA 5TDNA 4NZRL 5F3BB 1A14H 4KVNL 3TBYB 4LSSH 3V7AG 4Z8FL 1J1OH 1ZXQA 4AEHH 1Q1JH 1NCAL 3R1GH 4Y16C 4LEXL 4M4RA 2GI7A 5GISL 3V8OA 3P4OB 4KKAC 4QHUB 5F21B 1BIIA 4UBDD 3TM6A 3F5WB 1S9WA 4OCRL 3T0EB 4LVOB 2VDNL 2VL5B 1CGXA 5D7LA 3WV0A 1S9KC 5I30L 3GRWH 4K8RD 3ULUH 1RZ7H 2VDML 1MRCL 1ZSDB 43C9B 4WWKC 4I0PA 3IT8D 4PJHE 1HDMA 1J1XL 5DHVH 4PJ7E 3R8BB 3FQXA 2X4NA 4YPGA 1DJSA 1HH6A 2X4SB 4LVEA 3VXPB 1XF1A 2VN4A 1EGJA 4M1GH 4XNUH 2Y5TB 1Q0XL 2HVKA 3QIBA 4RZCA 5TJWK 4DUXA 1KBGH 3SGDH 3MRLB 3OMZA 5FGSA 4NRXB 3F7QA 1WTLA 3NABH 2A6JA 1YMMA 5TQ2L 4ODBD 1ZT1A 5C0BD 1NFDB 1T7YA 4LPWA 4ZTPH 1PSKL 4OAWA 3ARBA 3VU2A 4LLMA 2NMSA 1CGWA 3VFRA 4F58H 1D9KC 1BX2B 4KQ3L 4Y2DC 2DM7A 5ITBL 4Q0XH 4OT1L 3KVQA 2R1WA 3BVNB 5F7LB 4KWUA 1UB6B 4K7PX 3QIUA 4H20H 1CLOH 1GIGL 4X6CF 5T1MB 3H6JA 3TN0C 3HMXA 2BY2A 3JWOC 4KGJA 3W2DL 4JM2B 1OWRM 4IRJC 5ESQA 2P24A 5JHDA 4BYHA 1KIUA 1MQKL 3B9KD 3C5JA 1GGBL 4NRXA 1T0PB 4MA8L 3PE9A 4HWEL 3LKSB 5EOCH 3VGAB 4LPUA 3RNKA 4W6YB 4EDWH 3BT2L 5DQDH 2WW8A 2EIEA 2FHBA 2IEPA 3O6KH 3E6HB 1N4XL 5TGBA 1CGTA 4NKIH 3ALPA 3P77A 4JRXD 3ELAT 4CDHA 3C60C 4EDXA 2VDQL 4HZAA 4Z7UA 5F3HB 1ZOXA 2WWMC 3NCJH 5CSGA 1YY9C 2VUYA 2MMXA 3ULUL 25C8H 5JOFA 1EJOH 2H2PC 4X4XB 3TPUA 3MBXL 1V8HA 1MREL 3MOAH 1JTPA 1OOAA 2UYLB 3QAZC 2BK8A 5E8DH 1CK0L 4GRWE 4NKOB 1UYWL 2LAGB 5FXCH 4CVXB 4WWKD 4JFDA 3IDXH 4GXVL 3QWOB 1KBGL 2ICWJ 3MLVL 4AG4H 3HZMB 4JFFE 2HLAA 1OPGL 4OF6A 3DTXB 1CS6A 3QXTA 4DW2L 3C8KB 5DHXB 1UWGH 2DQCL 1T22A 5C0AD 5D5MB 1EO5A 4POUB 2EDDA 1NMAH 3KPOB 4L8SA 4Y16D 2WAHA 1WZMA 4LASL 1VFAA 5T1DH 2IMMA 2VRAA 2DBLH 3G04B 4CN6A 5DEGB 4X6FA 5I1KL 3KJ6L 4DWHA 4LFHD 4ODHL 1YEIH 3KPMB 3LZFL 3C2SA 2QTEA 3RBSA 3IJHB 3FTGB 3KPSB 2IBZX 1KIRB 2QL1A 1I7RA 1NC4D 3MV8A 2IPTL 1XGUB 1A14L 2OQJA 3MRIA 5J13C 3HE7C 1TENA 4JG1L 4LLYB 5DK2A 4PGBB 5D72L 4F7PA 5HJ3A 3UO1H 4JPIB 5IGXH 1JGLL 4YUEL 2J6EL 5SV4A 3TLRA 1QFWH 4LDLB 4R9HA 3OKLA 2J7LA 1OSZB 3QPXH 3QEQE 3F62A 4JQIH 5E8PA 1FGVL 1T7ZA 2WWMD 2LU4A 1DQDL 5D2LF 1IGYB 1MJ7H 3OQ3B 1WWBX 3SDYH 4R7NA 2HT3C 4LCCB 1Y6MR 3KPSA 4WO4C 3CFIC 1UEMA 4R3SA 3QT2A 5CGYD 2EXYD 2OL3H 3A6CH 5GRZA 3I6KA 1G0DA 5FM5M 1DQDH 5KSBF 4OF7A 2XZCL 5L7XH 3CX2A 1II4E 5DJ2B 2AJZA 3NCFB 2B39A 2HFEB 1A6UH 1ZA3A 3V9FA 2YA0A 2D7QA 3BO8A 4BH8A 2VDOH 1JMZA 1VFAB 3O9WB 1WTGT 1A6WL 4F33A 5DRWA 2BCKB 1N0LA 3FQTB 4P46C 1TPXB 5K93A 4F7PB 3C2AH 4AL8H 2ZJSL 2Y07L 2YD4A 4X8JA 1N3NA 3VXRA 3FHQA 4PJ5D 4F15B 1QFPA 2MPAH 3QXAB 1MCWM 3NGBB 1MQ8A 4UT9L 1JL8A 4UIKL 1F3DJ 4Y5YB 2B1HL 1FZOB 3RIAK 4LP4A 1RU9H 3NIFF 2AABL 1X7QB 2R4RH 3S4SG 3H7LA 5I1DB 5CBEB 4PRBA 4F7MB 3UTPD 5IB1B 3S88H 4RQQA 4HPYH 2XACC 1AGCB 3IKCB 3OV6A 4NQDD 2E9BA 2BNQA 3SGEI 2HFGH 3IGAB 4BFEA 4JRYB 5HGBB 4XPAH 2HVJA 4ZO6A 3VDCA 1X5KA 3ZDZF 3KLAA 5DLMH 1UT9A 2HMID 3GIZH 4ZUSA 5E08H 1VENA 5F96L 3OKDB 2VITB 2FYYB 4NNXB 3U6RA 4UTBH 5B3JF 4JN1L 1K3ZA 2IF7A 3D0VB 2XKNA 4YFLF 3MV7D 1RSFA 3E8UL 1OP3H 5ISZE 1KCVL 3ARXA 2NX5A 1WBZA 3GDBA 3DRTA 5GRXG 2X6MA 3C5ZC 5DK3A 2M8XA 3G9AB 3TNNA 4YHNB 2F8VA 4RFNC 3K2UH 1W0WA 2W9DL 1F4WL 4LKCB 4XMPL 3NPZB 3STZA 2FGWH 1YEGL 2FEEL 3SEPA 2C1PB 3ULUF 4J23A 3ECBB 5E4EB 1WBYB 2VIRB 4P57A 4B5EA 3BP5A 1DVFB 5FDYA 3C5SB 4OV5A 1T20A 5EZIL 2NY0C 4H1LA 1Z9LA 3P9LA 1NEZG 3RA7L 3JWDC 1GGUA 3QISA 5GS1B 1UJ3A 1I1AC 1DUZB 4IRSC 3T0XA 5GQBA 5C71A 3NAAL 3MBEB 4B50A 4LFHG 1YNTA 3BRFA 4UIKH 1BMGA 5E2TH 3MV9D 4UAOB 2HN7A 5J1AA 3LMJH 3QBTB 4XXDA 1MF2L 5BVJA 3F8UB 4AH2B 1NLDL 1CE6B 2IH3A 4KK6D 2PW2A 4WJ5B 5D2NA 3JV6A 2EC9T 3IDJA 4KUZH 4G6MH 1HYSC 5C0CB 4QOKB 3O4LB 3F58H 4R26L 2A38A 1S5HA 4V1DA 2I9TB 2FJHA 3ARED 5E8EA 1N59A 2IQAB 2NY0D 3L6FA 2MHAA 1MI5A 1KEML 4K3GA 1I7TA 2NLJA 3MLVH 4XGZB 4YGVB 4JPKH 4ZOEA 2OMNA 5H37H 4ENEC 4LCYB 1BJ8A 1UYWH 1XAUA 5D2LB 2XZQH 3FFDA 5T3XL 3ARTA 4HUVB 3H0TB 2L0DA 1D6VH 1F2XK 1JFQL 1FFPB 3BSZH 4U3XA 3U0PB 2V2TA 4UTBL 4XGZA 2P5EA 1UM6H 3IXTA 12E8H 1JJUA 4LHJB 3BIKB 2XA8H 5D1XB 4JY6B 4XNXH 1P1ZB 4J3VA 1V7NH 2EC8A 3BUTA 3W0WB 2FJHB 1AY1H 3T77B 4N8VG 2MQ0A 5HYSB 4AEHL 1R6VA 4P0DA 4P2QB 2JJUA 4OFVA 4FOMA 4P2OB 2K1MA 2D7PA 1F2QA 1CICB 4DUVA 4NQDA 3IS0X 1RUPL 1XZ0B 4OZIF 1IZKA 2OSLB 1NLBL 3BKML 4M6ML 4DOHB 5E7FA 1NGPH 4NSKA 1Q0YH 1UVQB 3QO0B 3BRGC 1RK1A 1C5DA 2IBBA 4BSWB 4NZDA 3KS0H 4Y1AE 1EAPA 5C07D 4W68A 2GHWB 4P3CH 5HI5D 1KLGA 5ISZA 5HHQA 1XF5B 1S7WB 4D9QE 1DANT 4Q6YA 3VD5A 1IKNC 2DKMA 4MX7B 4U6HA 3FZUD 1HHKA 4WCYH 4IOFC 5EU7E 4ZUVA 3INUL 4PJGA 4AEFA 2CO7B 2XWJA 3O11B 5FYKD 4LCWD 4CU7A 4JDZA 4S1SH 2CQVA 5I0ZA 4X0KB 4WGWB 3JWNC 3T2NH 1KJ2B 4UAOC 4XCNB 4XC3L 1OM3L 1BVKA 4GAFB 4AG4L 4OD3L 4KKCC 2D7TH 2FIKA 4X7DC 3GJFH 4RGNB 1W2KT 1G6RL 1NFDA 1NQBA 5EUKA 4XCCL 1RFDL 3D85A 1BLNB 1KB9K 3KWWB 1EA9C 1H8NA 1NDMB 2V2TB 2P8MA 1A1OB 1BFOB 3QIBB 4RZCB 4RMWA 1FG9C 1CZ8H 5T1KA 4OIIH 4GG8A 4K3JL 1J0KA 3SDCA 5F9DC 1S9VB 4KKLD 4X5WB 4MJ6B 4LF3B 3HG1D 3ALXA 3WFHA 3GHEL 5CKAA 3NZ8A 3O45B 4OZHE 5DQDL 1JGVH 4IOFD 2OXGA 4WUUD 1JGLH 1JGEB 2OX5A 5TE4H 2N4IA 3LS4H 1LMKA 2VISB 3MCG1 3UTSB 3O0RH 2H1PL 4QRSB 2QQLL 2GK0A 4S2SA 1FC2D 3NZ8B 1T21B 4Z7VB 4GLRI 2VLKA 3STLA 5HY9A 2WIMA 2YPVH 3E6HA 2V2WA 1G7HB 3GK8L 4JHAH 4W4NA 4H8WH 3VRLF 2C4FT 2W60A 3MRGB 1YDPA 1QSFB 3D25A 4QHNB 1EUUA 3EJZD 2A1WH 4PRPD 3WKMH 5HI3D 4O2EA 1QPXA 4MAYA 2LVCA 5IBTH 4YDLB 5JW4N 5IESH 2V9TA 1DBJL 5D7JA 5BQ7A 5TQ2H 1XH3B 2CDGB 4JAMA 3QP3A 5IMKB 1JZ8A 4J1UA 1B0RB 3OKKB 1IGTA 4DKEL 5DQJB 4N1CA 2E6JA 2COQA 1KT2B 1B2WH 1BF2A 4FFVC 3HE7A 4IRZH 5T3ZL 3QFDA 3GKWL 1SBBA 1I8MA 2HTKD 1VGKB 4CU8A 2OL3B 2IGFH 4FQXC 3D69B 3VFRB 4CMMA 1ERNA 1OAQH 3ARVA 1I8MB 1AR1D 4N0YH 1YMMB 2NY4C 3SE9L 2X4RB 5ID1A 3B6SA 2FDBP 1KENL 1FYHB 4GG6F 1LP9F 1IGTB 5I1GL 3S96B 3CXDH 3RDTB 3X17A 1JNLH 4YQXL 4PJ9B 3SGKA 4Y5XC 1XH3A 4JAMB 3V0VB 4OCLC 3ARPA 1YNKL 2G9HA 1CFTB 4HWNA 3ROOA 1NEUA 3BYYA 3MV11 3T0WA 1J0ZA 1U8OB 2GJZB 3O6KL 4N5ED 2C3HA 1QA9B 4FQQA 4PB9H 1K4CB 2DBJA 2X42A 4RAVB 1I3RB 4KVNH 3TFKD 3THMH 1JTOA 5GZNC 1JHLH 3RVUC 4PJEA 5CP3A 1A64A 2ITDB 3VW3L 4F15C 4EJ1C 2BFVH 3MGAA 5JW4Q 3BZFB 3KLHC 1X5HA 4G3YH 2YBRA 4XMLL 3MNVA 1D5IH 1BD2E 4JREC 3U4EB 3WE6B 4YDKL 3SDDC 4RWYH 2DMCA 4F80A 1CTNA 3KPMA 5ALCH 1MFEH 3SQOH 4MD4A 3ARFD 3NFPA 4NNYA 5JW5A 4HSQA 1CT8B 3G5ZB 4WWKA 1RUQH 2F5AH 3SDXA 5IHUH 3WFDL 1HILA 2EDYA 5ENWA 4TN9A 5C0EB 2R29L 3HI1B 1WF5A 2JCCF 4H0GA 1ZEAL 4XP5H 4YDVB 4ZFGL 4FQXA 2C1OB 4YK4C 3GI8L 3GSXB 3D0LB 2NNAB 5CUSH 4MAUH 5CP3H 5I73C 4K9EL 3EOTH 2PYEE 2EYTA 5FIEA 3REWB 2X70B 4P9ML 4NKQB 1IAII 4Z77A 1B9ZA 3DV4A 4D8PB 5KZCB 5BV7L 1T5WA 3DBXB 3X13A 2QSCH 4I3RH 2I9LB 4P9HH 4PUBH 4XCFL 2CJUL 5EN2A 4D9QD 1Y6NR 5ILTH 3BZ4B 4WFED 5IJKA 2P5WD 1I1YB 4APQD 4JFQA 5E1HB 3WS6C 3OZ9H 5EIIB 2AP2A 4IOIA 4Q9QL 4ZPTB 1ITBB 2AJVH 2DWDB 2OTWB 3JXAA 4OCXH 4JJ5B 4L4TD 4PRIE 1WWAX 5JQHC 4J4PA 4PJ7A 4LKXA 3GBMH 4OLWL 1K6QL 1QA9A 4FQQB 4Z7QE 3MNWB 3AC0A 4GW5B 3MBEC 4Z7OE 3EJJX 2P5WA 1I9JH 4TOYL 1W0VB 1RUKL 3G5VB 3WNMA 4ELKB 4EUPG 4P59H 2OR9H 1P4LA 1BF8A 4I77H 1IBGH 3CZJA 3QDAA 4NN7C 3RKDC 3LKNB 1PYWB 3IDNB 2OI9C 2NY5C 4RWHA 4PG2C 4MQXC 3OXRB 4QRQA 3T4AA 4S10A 2AEIT 3KAAA 3LV3A 4Z77B 2AV7A 5GGRB 3IJHA 3BP4A 4GW1A 3ZKND 1NGXB 4AM0A 2CO6B 2BSSB 4O4YL 1F6AB 1KYOJ 1TVHB 2YWZA 2W9EH 5KSAD 2PKDA 2YKLH 3OBAA 2R8SH 2R56H 4WW2B 3MYJA 4DGIH 1C1EH 2Z8WC 3KLAB 2E5EA 3C6LB 3VGHA 4O2CB 3DLQR 4CW1B 4XPTL 4MXVE 1EO8H 1V7NL 3IGAA 3C6LA 1VEPA 4JLRB 3RVUD 1F3JB 4KTYA 3K0WA 3BI9X 5C0DB 1FVDB 3VH8A 3TYFB 3K1KC 1U92B 5TPWL 2VWEE 4F9LA 2YD8A 5I1DA 3ZDYF 2DF3A 3WNKA 2I60H 4JB9L 5JQ6H 1SYVB 4FQLH 1K4DB 2AK4B 3T3PF 1U3HA 1S5IL 4PRDA 1I9RL 1IEAA 3ZHLA 3BZEB 2AGJL 1ZT7A 2VH5L 3DYMA 1FL6A 2YRPA 3S37L 1AXTH 3Q1SL 3UAJC 3V6OC 1MFBH 4N0RA 3QXVA 4UIMA 3FB7B 4CVZB 5IB2B 1W0VA 2ZSWA 4OI8A 3JV5A 4HFWA 2A6DA 1TJIL 5F9OH 4PGEA 5ITFB 4JG1H 1HEZB 3GMPB 4WWID 5CKGA 5C0NC 2RB8A 5F7HA 5JO5B 4HXAH 5DXWA 5HTSA 1Q72H 4OV5B 1MCOH 3L3IB 2PETA 5DHVB 1L0YA 3EDKA 4P57B 4D2NA 4OF5A 4ZPVB 3OHXB 4U1MA 3DX9A 5HYJD 3UTTD 1MHEA 4DTGH 4OSUH 3L3IA 1KB5H 1EGJH 2H32A 1JFQH 4LHUD 2R56L 1ADQL 4WHTB 4MNHB 3IFNH 5JO5A 3UC0L 1W72H 4MNGE 1JI2A 1QEWB 1MLBA 4GAYB 4ZFZA 3KPLB 4P4KA 1MFNA 4Z7NF 1OP5K 3T0EC 2CIIB 2D7TL 4P46A 3GKZA 3AS3A 2VITA 3U6RB 1H0DB 3OKOB 5DUPH 4QRPA 4WI6A 4W70A 4PJXA 1G7LB 1BD2A 1AO7D 1W8OA 1UM5H 4UUJA 4RISH 4YXKL 4MLSA 4TVPL 1Z2KA 5EOQL 3SDXF 1AR2A 5DGQA 1XF2A 2ZUUA 5HHVH 1QZ1A 4H5SB 1ZE3C 3IDMA 4HX1A 5E2VH 1TZIB 4WCYL 4GW4A 4JZJA 2O5XH 3MR9A 4P3CL 3S97C 4HHAA 1GPOH 1R3LA 4RFOL 1FO0H 1LD9B 4WUKL 4H5SA 3IDGB 3UZEA 2GEEA 3BP7A 3MJGX 3FRPG 3JWDL 3VMNA 4M6OH 2C3XA 2ORBH 3MRHA 1JTTA 4OKDA 3DVFA 1MCJA 5MENE 2BNQD 3RY4A 2DLFH 3QDMB 4ZODA 3JWOL 3S7GA 3WXWH 3RZCC 1R3JB 5HYJA 1H5BB 5GRVL 4RFNB 4M6OL 5D70L 2UZXB 1MIML 3GJFB 5CJ8A 1BFVL 4NWUH 4I0PC 3O2VH 4L4TE 1FL5A 4IOSD 1E4KA 2VZ3A 2J8UE 2UWEB 1UM6L 3RNQB 4O00A 4NFBA 2ZSVB 3H8NA 3JSSA 3MRFA 1Z0MA 5KS9F 5GGSY 2NY1C 2R0ZL 5DT1L 4ZDHB 3ARGD 1FFRA 3S5LG 4E0RA 1F3RB 4HKBB 5L2KA 4X6EA 3WFBL 2VLRB 4PJ5E 1KLGB 5GJSH 3GB7A 1HINH 3ZTJG 4MXQC 4JVWA 4NPYB 2ZCHH 4PJFE 3S36X 3T09A 3MRKA 1WCQA 3QIUC 2X4QB 5HHMB 5BJTA 4AIZB 4NO0B 1IAMA 1RZ7L 5GSVB 1V3MA 5F70A 3RU8H 1Z9OA 1Z9MA 5HGHA 3QO1B 3M8OL 2W60B 1DBKL 3B9VA 3U46B 1REIA 3QH3B 3BP6A 4PV9B 2XICA 4FZEL 4WFGD 4C4KT 4BJLA 1NAKL 3UTPE 1XGTA 5SWZE 1IQWL 1FAKT 3GEWB 4EUPA 4LARH 1OHQA 2AW2A 4G42B 2YN5A 4S1RH 4EOWL 3W5MA 3RWJA 4HXAL 1QRNB 3JUYA 1MCKA 3FO0L 1PG7X 2J8UF 4NJ9L 1UB5A 2HT4C 4QY8A 5ISZD 1T83A 4PRID 3VXPA 4KY1L 3KXFD 4M00A 1FPTL 3MRRA 2Z91B 5ETUA 2FH6A 1ITCA 3QFJB 1IKNA 1KN2L 3F65A 5C08A 5HDQL 4QRPD 2FX8L 3FRUB 2LU7A 4J3SA 2XPGA 1NBVL 1FG2B 1DL7L 2Z8VC 1FIGL 2HG5A 4UV7L 3TBVA 3VFGH 5DMYA 5D7IB 1UACL 1P84J 1DUYB 3LN5B 4JANB 4RBPH 4QT5B 1XGTB 2RIKA 1L6ZA 3QEQA 4QT5A 1G7IA 1VACA 4WFHD 2NY5L 2V5MA 4M7LT 2ADFL 4PJEB 2VAAB 2GJ6B 4LIQL 1IGCH 3FHAA 1KB9J 3L5WA 4WNQA 1NCCL 5D1QD 1BOGA 1P5UA 4LCIL 5C6TH 1V7ML 1FNAA 4JFFD 5EULV 4HKZA 2VWEC 5F8QC 1INDL 5JXEA 3G5YB 5L88H 2HJFB 3RNKB 2QQKH 1I1CA 1CDIA 4QY8B 1ZLUH 5GRVK 4DQOL 1RZKL 2R2HA 1J0JA 1Q9OB 3NCJL 2DL2A 3KWWA 3B6SB 3BIBX 1TXKA 2DM4A 3D3VB 5HHNA 2JJSC 4NWUL 3HB3C 1ETZA 4GBXB 4NKIL 1ODAA 5ESVA 3FN3A 1TZHA 1UKQA 1C08A 2JK5B 1MRFH 5GGUA 1YJDL 3AVEA 1FNLA 4FTVA 4Y4FD 4AQ1B 5D1ZB 4D9LH 3RHWK 3OKKA 1MWAL 3FQUB 1DQLH 1ZHLB 3QWQB 2F54D 1HN1A 4WTXA 4U7SA 2IG2L 3VD4A 4QRPE 3REWA 1JYWA 4UT6H 5JIKA 5DJZA 3D3VA 4LLUB 4GQ9L 5A16B 1J11A 5JORB 1CTOA 1HKFA 1FNGA 3QEQD 4QGYA 4XNQA 4L8CB 4YDVA 4YBLB 4F58L 1VEOA 3HI1A 3CU7A 4CL7A 1A6VH 1T5XB 4TVPH 4LGSB 3UJIH 1CQKA 2OCFD 4O5LH 3BZ4A 4HKJA 4I13B 1SY6L 3BMWA 3FOMA 4YFEA 2B2XH 2J8HA 3RX7A 2P45B 4XPFL 4HDIB 3WFEH 3SQOL 1VB9A 2PTTB 5GS0H 4ONGL 4YLQT 3SGJC 5FEBA 4WDIB 4JR9H 4P23A 3T3PE 4KXZI 5IWLA 5EO9B 1WC7B 1NLBH 3BKMH 4ORGB 3DWTA 5D71H 4P99A 1ED3A 2DQUH 4LLVB 1JHTB 4MDJB 4PJDE 5ERWB 5E8OA 2V5TA 3QA3B 3WFDH 1ZGLP 3TBTA 1RUAH 5C0EA 1JGUH 1AKJB 1J5OH 1XCQA 4OF0A 3N06B 4KVCH 5J9PB 2Q76B 1FLRL 3TP4A 1V3KA 3BQUD 2CMRH 2Z4QA 2Y7QB 3MLSH 4R2GC 1ZT4B 2DQIH 2HFEA 5E2WH 4ZAKB 1OTTD 2XQYK 2ZUQB 3KPRD 5I6XC 4WEBL 5D1ZA 4OF3A 3WLBB 5IM7B 2WANA 1A3QA 5HYFA 1RIUH 3EO1B 2IANB 4OIBA 3DV6B 3H3PL 4ZTPL 4GMTH 4R3SB 1JPST 1NMAL 5DSCA 4Z7OF 1UM5L 2AJSL 4R7NB 3BFOA 1QP1A 4GKNA 2R15A 1CG9B 1MCRA 1PG7W 1LP9B 1DANU 2DYPB 2R1YA 1LO3L 3REVA 4EI5C 4KZDL 5T1LD 2H6PB 5D8JH 5KG9B 2BNQE 1U91B 4TNVF 3EFDL 5DD5L 3WIFB 1YNKH 4XXCA 1XMWA 4JE4B 3U0WL 4YE4L 3D48R 4GS7C 4KKAD 4NQVB 2J8UA 1CFTA 1W72L 1MSPA 3MLYH 5K9JL 3SGJA 1U91A 3A6BL 1FZJB 2XI9A 2X1OA 4QNPF 4MNHA 5JXAH 1EVUA 4MD0A 1CFVL 4XMKH 2OQJB 2OTWA 2H2SD 2Z92A 1R3HB 3LQAC 1BBJA 3SN6N 4I2XA 4ZO7A 2F8OA 4HK3J 1KGCE 4DKDC 1ZLUK 4OZGF 3CH1A 4NC1E 3WLBA 2QQLH 4PJIB 4OQTH 4F7MA 2DQFA 3RGHA 3RUGA 5DMKA 3P73A 2EEBA 1PY9A 4OI9A 5FA3B 2CIKA 1YECH 2Z35B 2Y06L 5FM5O 3V4VH 3FFCA 1ZAGA 2AJXL 4U3HA 2PCPB 1KXQE 4P2OC 1CR9L 5JHDE 1QFWM 5IB2A 2H9GA 4M7KL 2E8ZA 4OIIL 4ODVH 5DD3L 3CD4A 4H0HB 5IVXE 1AD0A 5TQ0H 3GHBL 3WIHL 1JUFA 5BVPL 5E56A 3VMOA 2PCPA 4EI5A 3S8WA 1FZKA 4U6VL 4PG2A 4V1DB 5JIIA 1A6WH 4HJ0C 4PGDB 2KBGA 3ES6B 5EOTB 3GM0A 5EOCJ 5IB1A 4HMCA 3TYFA 3VI3F 4KZEH 3FAXA 4RIRB 4I48B 4IS6A 2YWYA 1EO8L 3TO4C 4M5YL 4OM0H 1KPVB 1OTUD 2AI0L 1HZHL 3PP4H 1EZVX 4Q6IA 3EGSA 1UADC 4NZUL 1SJXA 3T0VA 1EMTH 1GGIL 1D5XB 4HLJA 5SWSE 5B39B 1SM3L 1AGBB 1VADA 3QG7H 1IM9D 1RPQA 1BD2D 1A9BA 3QQ9D 5D7LE 1YJDH 5GGTH 4MA1B 5L2JA 4J2XA 5GISH 5GSRB 4KKBD 3DETD 2I5YL 3O3DB 4NQCD 3AXLB 1MCQA 3G6JE 2CKBA 4JDVA 4OB5L 1XR8B 3HI5L 4I4WA 1Q1JL 3IDIB 3DSNA 5H37G 1CIDA 2IALA 4KDTA 3QDJD 2DLFL 3WUWA 3D39D 2WP3T 1T2JA 5E9DA 1RUKH 3TNMB 1HH9B 2Z31D 2D0HA 5F7DB 1FO0B 5I16B 1EXUA 1WIOA 4Y89A 1BGXH 1INEH 3B9AA 4ODVL 4Z7WA 3I3EA 5FYKH 2RBLA 1KCSL 2FBJH 3ABZA 4ZUSB 2E8YA 3OAUH 1UKSA 5HPMB 3MRMA 4TSBL 1NCDH 4JZNA 3QI9C 5I8EA 4FQ1H 2DQGL 2K9UA 3RVVC 3CFBA 4FFZH 5HGBA 1D3CA 3MLPA 3BP7B 1GXEA 4RMRA 2F74B 3PNWA 5EZLA 5IFHH 3MFFA 1I8KA 3AFLA 1NUDA 2Q6WB 4HUXB 2VQUA 2EC9U 4ONOA 4YDLC 5C2BH 5IVZA 1AGFA 3EYOA 2R2EB 1ZA6A 1O7SA 4OZHF 5BOPA 4JQVC 5DJAB 3RUGE 1W72B 5LGJA 5CEXB 5FUZL 3FQNB 4DFIA 5KTEL 2DQTL 4Z7UF 1MRCH 3F58L 2KUTA 4GMSL 5EUOA 3CDYA 1G84A 4PJXF 3PWPE 4JFEB 3U0PA 2JIXD 3DXAA 2W0PA 3G6DH 4XBGB 3RP1A 4P46B 3EUUA 2CMRL 4I3GA 2F53B 4BZ1L 4XNZB 1E4XI 2BOCA 5I19H 3P4MA 3MRQB 1SY6A 2HJKB 4FZEH 3AS1A 4GG8B 4GO6B 4GAYA 4ZFZB 5M95B 3O6ML 4JCLA 3EYFB 1T03H 3QWRA 1QLRB 1T89A 5BMFL 3O6LL 5HPMA 1BQHG 1S9XA 2V7NA 2NXZB 4UZGA 1TIUA 1JN6A 3QXDB 3LRSA 1KG0B 4WI8A 3SPVB 5FK9A 1JHKH 5DJ6B 4X5LA 2HTLC 2V5RA 2CR3A 2ZOLB 1XFPA 5GZOC 3K4AA 4YAQA 3NFNB 4QEGA 5DC9B 4HUMB 2P49B 1M1SA 5D6CA 3TCLB 4R0LC 4MAYC 2DQIL 3GSWB 3MRDB 1YEFL 3BOVA 3HAEA 5JPMB 5KSAC 2CRYA 5FF6A 4YEFA 3R06B 4HV8B 4KVCL 5FO7A 5IBLD 3WFBH 1H3GA 1Z3GL 3ILPB 1RZJL 2HRPL 4U1GC 5CP7B 4NO0A 5TE6L 3FO1A 2JB6A 2CDEB 3SGKC 3VWKD 2ZCLH 3N1PC 4PJGB 1EBPA 3O0RL 3DO7B 3WKNA 1MPAL 3DARA 4O51B 3RWEB 4LOUD 3T2PA 4O51A 2FJFA 4J3TA 2VLRA 3S4SA 1C5DB 4BSWA 1MCEA 2R2BA 5EWIL 2VLKB 4XAWL 1ZHKB 2DL9A 4CNIB 4S2SB 4ACPA 3DGGA 5A2KH 3JTSA 3QI9B 1J1XH 3MLTB 2P7TA 2O5YH 1OGAA 3BPNC 1YUHA 3UJIL 1X5YA 2K7QA 5GGVL 1NCBL 4RA3A 1G9MC 1FJ1A 3E8UH 4PTUA 1BX2A 3FONB 4Y8AA 3ILQC 4OKVB 3J7HA 1KEGH 5IOPA 2A6KA 1H3TA 3SDCB 1HHJA 2A6JB 3LN5A 4JANA 4FQHA 4IRSB 2FO4A 3CSYA 2AJYH 1FL3B 3DHJA 1IC4H 4P4RB 5F3BA 4ZFOL 4FNLL 3GSNH 4XPAL 4DEPC 1K2DB 1RJYA 4S1SL 3T3ME 4I8DA 2Z91A 4YPGB 4U1GB 1X6LA 4WEUD 5KANG 3D9AH 4MJIB 1ZHNA 3LEVH 4QRTB 4BA8A 1AXIB 1CQYA 2ESVE 1R3KB 2DLIA 4JJHA 5CIPB 2FL5A 4ELME 2MNUA 1FIEA 5IQ7L 5FHBL 1SEQH 3C8HA 3MO1A 3PWLB 4BQBA 2AQ3A 4EUPB 4C83B 4G5ZL 4H1LG 4QHUA 3O45A 4F8QA 4EBQL 2AGJH 3TBWB 5I75B 4NDMA 1N6QH 1Z6JT 1T5XA 2VJXA 4IRJD 4Z78B 5MENA 4JCMA 3QG7L 1VERA 3VXME 3BXNA 4L4VB 2FGZA 1HI6B 4Y16A 4WIQA 1A1OA 3HZKB 4DVRH 3KPRE 5D7LD 3O8XB 1OQXA 1CLYH 3B8YA 3VFNB 2R0KH 1OSPL 4HJGB 4ISVB 4K7FB 4NNPH 2VTFA 2YPKA 3HC3H 1RUML 3QJHB 2OP4H 2FIKB 3U9PL 5I6XB 3VFPB 3KLHD 1QFWL 4LIQH 3SGEH 1H8OA 3WDJA 4M02A 4JY4B 1IAKA 4XHQA 4RA0C 3ALWA 2BHUA 3ESUF 1OVZA 3I02A 2X4RA 4P2CG 3A6BH 4UNUA 5HYEA 4HQQH 1UCTA 1C5BL 4JFXA 5FKPA 5LGHH 4J4PC 3BIAX 4Z5RB 2NY6D 2A73B 2OTPA 4LSUH 2A6IA 5J4MA 1KFAL 3A67L 4OUUB 5ICYA 1NCDL 3IJYB 1AXTL 3Q1SH 3O41A 1TMCB 4XCYB 5F89A 5DZLA 4M7KH 5A1AA 4NGHL 2FRGP 3KYOB 1M7IB 5J9PA 1U58A 4O2FB 3LB6D 4YX2H 1NEZB 4X9FA 5F9AC 3EOBA 1EBAA 4WHCA 3BKYH 3KPOA 3QB7C 2JJSA 4U2YA 1T22B 3OKMA 4Y4HA 1RUPH 1T1WB 4MDJA 1RK0B 4NHUB 3DTXA 3V5HB 1IE5A 4PGBA 3MRPA 1N6VA 3G08A 4V2BA 3QEUA 4OCSL 1YNLH 4RSVA 4Y0GA 4DVBA 3RAJH 2AXFB 1R3IH 2YRZA 3LZFH 3D39E 1RVFH 4Q9QH 3LKPB 2YPLB 4YZFF 1UM4L 2FX9H 3RWHA 2YUVA 4RGNC 1VFUA 3PWJA 3G04A 4LAQH 3OKMB 4Y4HB 4ZUWB 2JB5L 5A40E 4XP6L 2VXVH 1U8NB 4ZNCD 4ONGH 3PGFH 1DBML 4GBXC 3UXFA 4LPCA 5JIPA 3EOBB 1DEEA 1HINL 4JFOA 3UEZA 5HYSG 1OP9A 4L8CA 4D0DA 3RTQB 4Y19A 5HHOB 1YY9D 5E1AA 4PBXA 3V6BR 3OX8A 5CLWA 5ID1B 3MA9H 2DWEB 4G8FA 5TH2B 5E6IC 3QZWA 3KPPA 3CMOL 1QSEE 3EYQD 5HYJE 4XNMA 2CIKB 1RIUL 1A6ZB 4UDUA 3GSQA 4KAQL 4KKLC 2X4OA 3BO8B 4Y2OA 5BVPH 2GCYB 2VLJB 3ARYA 2VDKH 5J1TC 1Z3GH 4WUKH 4NQED 1PYWA 1UG9A 3IDNA 1QYGH 4N9OB 1M05B 2BMKA 5IWLC 2BVQA 5FYKL 4PP2A 3FB5A 3V4UH 2GCYA 5AZEH 3X3FL 3OKEB 1L7IL 2RAMA 2YRLA 2EDJA 1RZFH 2QSVA 5ACMA 3HPJB 5EORH 4XPHH 4R4FL 2OXHA 5BZWB 2Q87A 4C59B 2CLRB 1S7VB 3PIQA 4YJZL 4TVSa 3TO4D 1FYTE 4G8FB 4GW5A 4KK8C 3HAEG 5FUOH 2GSIB 3N1GC 4P5TA 1LDPH 4EIZC 1GC1C 3CDCA 4XCFH 5C0IA 1ORSB 4FABL 3OJ2C 2BDNL 3LS5L 1KLFA 1ZLWK 4WTWA 3UJTL 1S7VA 3PIQB 2XTJB 3PGCA 3F12B 4K94C 5E5MA 5EFIA 3HZVB 1I1YA 4X6DE 5L0QB 5GS0D 1GIGH 4OI7A 5HI5C 3RTQC 1E6JH 5DC0A 1EMTL 1GGIH 4YHNA 1RULL 1ZT7B 2FHFA 3UTTE 4MNQE 4QHLA 35C8H 4PGDA 2X89D 5EIQA 4UDUB 4HWZB 5ANMA 5BV7C 5C6WH 3ME0A 1KPUA 4G8GB 2BNRD 1QVOB 1JUFB 5SWZD 1FCGA 4ALAH 3GKWH 4ZUUB 4E41B 1VPOL 2NY4D 1T66D 3QQ4B 1I7ZB 2GY5A 3VDAA 4KRMB 3HLAA 5C07E 4ZQKA 4XWGH 5BS0A 3RZCA 5LCVL 2X89A 4BM7A 4LLAA 1A1MB 2CXKA 4N8VA 3UC0H 3V6FA 1WISA 2GT9A 3LQAL 4X7FC 3QNZB 3SO3C 3GJFK 1ZA3B 2PO6D 1CD1B 4DTGL 2XA3A 3EKCA 1U8QA 5E2WL 3BAEH 4Z7WB 3RVWD 1HXMA 1TVHA 1ZVYA 3S35X 1D5MB 1RVFL 4KI1A 3RVVD 4I2XB 2AVGA 3GMMB 3IYLW 5JOPD 3ARDD 2W38A 4PREA 1C16A 1RMFH 5C0CA 3O6FA 5FGBA 4FP8L 1NH6A 2K3TA 1U8PB 2H1PH 5IB3B 2UY7A 4EI5D 4PS4L 4S1DC 3HMXH 3ZDXF 4HJJH 1P4LB 4ZNEE 3BKJL 2F74A 1J88A 3IFPB 1P7QD 4OLZH 1TFHA 5E5MB 5J1AB 1A7OL 3G6AB 4G9FD 4NO3B 3G6AA 1QEWA 1RZIB 4QTHA 1OAUH 2NY2B 3QUYB 4GUPA 4ODTH 4X6CE 5JXAL 1T20B 5L2KD 1GGTA 2J88H 3W39B 4Q6IB 3CIQA 4PJAE 4E9LA 4F7CB 2C3VB 1WWCA 5F7DA 3GJEA 1UA6L 2E3VA 4JZOB 4Y19E 2EXWC 3UYRH 5FYLD 1T6WA 5E9DB 1TLKA 2Y23A 5DHVA 1HXMB 1MCSA 4TSCH 3LPWA 1JN6B 3QXDA 3TNNB 3GRWA 4ZOBA 4Q9RL 3KXFE 3MZGB 3T2NL 1SJEB 3V7MA 3EYFA 3LEVL 1JPFB 3LKOB 4P2RA 5DR5L 5LQBL 1F8TH 2F54E 1BEYL 3NTCL 3ZKSD 4P49A 1XIWA 2L4OA 1NGZA 3HCVA 4M4PA 5T3XE 5BRZB 1QLFA 1UXWA 1DQML 5ICZB 1HHHB 2A74A 5B39A 3O6FC 4LQFL 1XIWD 4KJYA 3QUML 3Q6GH 1KUMA 1MRFL 2H8PB 1S9YA 5JA8B 3C9NA 4X6DF 4ZSOA 5JUEH 3IJSB 4L3EA 1MCNA 3BKCH 1ZTXH 3HN3A 4HS3A 5D93C 1B6UA 3SJVD 1AQKL 2YD7A 4I18C 1HE7A 3EYOB 3ZYIA 1LDPL 1U8IB 3MR9B 3QHZL 4ZTOL 1OQOA 4WU5B 5K9KB 2FSEA 3D85D 4RMSA 4LASH 4L3EB 2F19H 1HHIA 2X1QA 5D2NC 5I76A 1V5JA 4TUKL 4YXHH 4MA1C 1V7MH 2WINA 1E28A 3KYMB 4XAWH 4YHOH 5FGCB 2H26B 1OW0C 3I9GL 3MODL 3U7WL 4X6BA 5FDWA 4X7EC 4OZIB 2VDLH 3G6JA 2DKUA 2FX7H 4B0MM 1Y0LA 4PRPE 5EUKB 3CSGA 3VGEA 2GTZA 2APWA 4P4KB 5ESAA 2VXQL 3CU1A 3FONA 3ZDXE 1KXTB 1JZ6A 3STZB 5I8OL 3VFTB 4KRPD 2OMBA 2F8XC 4L8BA 2RR3A 4WV1C 2F9BT 5DLML 3FO2A 5C07A 3D6GA 4P2YA 4XNUL 5AWNH 1KEMH 3C5ZB 1FBIL 4P9MH 2OM5A 4MXVF 2L7JA 2VZOA 4RMQA 1JV5B 2BRQA 3CXHK 3MACL 1HHKB 4CAGA 5C09D 4MS8D 3JWOH 1B3JA 4LCWA 1X5JA 5JR1L 5MEOB 4KH2A 5D7JD 1WZ1L 4X9HA 3CLEL 3G5XA 1T89C 4IRJA 2VE6A 1HSBA 3DX8A 4FTVD 3TYGL 1WWWX 5KSVA 3SBWA 5BJTB 3PG2A 3P4MB 1AFVL 1A7PH 3QO0A 4MVBC 4KK9D 1L7TL 2XY1A 1UWXK 2D03H 2ICES 1J1OL 3DRQB 1X4XA 1HIMH 5IB5B 3R0MA 4PJ7F 3WIIL 2GQHA 1MJJB 4DKFL 4HEME 3QUMA 2GW5A 4N5EC 5D6CB 2GKIA 1YEDB 2MCPH 1EV2E 1GJIA 4QHKI 2JELL 3L3GA 4N0CC 1NFKA 3E6FB 2AXHA 1J9CT 3Q0HA 1O7VA 4XNZC 3EDEA 1A2YB 3IETA 5FO9B 1TJGL 3QEUB 1ADQA 5CS7A 4KMTL 4FQJL 4DGVH 5ADOL 1FG2A 4JN2B 4WU7B 3PUCA 3RWCB 1QR1A 1FNSL 4O9HH 3N85L 4TUOB 3N1FC 2OL3L 3V6ZB 3F7VA 3LEXB 4YDIH 1S9VA 3ULSA 4B7LA 3LKRB 4R26H 3SKJL 5EBWA 1NAML 1LEIB 4PJCF 2B0SL 1KJVB 3GSVB 3MOAL 3SDYL 4LQ1A 3RVWC 4KDWA 2AJ3B 2X7LA 1MCIA 1FVCB 1MFCL 2FO4B 1J0YA 3CSYB 4NQCE 5I18H 4LLUA 1HHJB 4I3SL 1A2YA 4OGAC 4JKPH 4K94H 5LVEA 3QPXL 4OIAA 4OKVA 2ADJA 3QDJE 3QULB 3WJJC 1T04A 3WIHA 4UT6L 4X4XA 1IJ9A 3S34L 1G0XA 1WZ1H 3HS0B 5IF0B 3CLFH 4OLUH 3LH2L 4UV4L 1F97A 1A0QH 4LP5A 4MMXC 2ARJA 1J1PH 4WUUA 5CILL 4P23C 1N6QL 4QRRA 5K59F 3RIFF 4P5KA 5JPNA 1QRKA 2NPLX 2NY1D 4LHUG 3QUZD 1KPRB 4Y4KD 4PJGF 3FT4B 6CGTA 4Y4FC 5ANME 5H2BA 5T1KD 2BX5A 3OPZH 2R0WL 4PV8A 1LEKA 3HRZB 3RY6A 5F89B 2HJFA 5EU6A 4YHKH 2GJJA 2YK1L 1LVEA 2XZAL 4LLWA 5I8OH 4NWTL 3S36L 4XP4H 4DAGL 3PP4L 5I1EH 2Y72A 3EO1A 3KJ4C 4U1JA 3BJLA 5TPWH 1IGFL 3FQUA 5IF0A 1NBZB 2GJ6A 3GSRA 4KTEL 1NCCH 1IEHA 2ZP0T 5D7JC 1MHPH 4OZ4A 3HE6D 4K2UH 4PJ8D 4BQ9A 1T04B 2ZCKH 3KXFA 5IR1B 3MXWL 5C3LD 3IXAA 1IGFH 3QJHA 1M7XA 1AKJA 2N1KA 2O5ZL 1MJ8H 5D96B 1FYTA 1YY8A 2W0FA 3U2SB 3H9HB 4URTB 3SJVE 3KYKL 4QRUB 1UZ6F 3F6IA 3RGVD 1RZGA 4GKZA 1KNOB 3CFCH 2IAMD 2Z0BA 4G9FE 1WAAF 1YN7A 3HZKA 1CXEA 4UOJA 3HFML 2NR6D 4HIJB 2D2OA 1FL3A 3RTQA 1HI6A 4Y16B 2X41A 3HA0A 4ORGA 2O5ZH 3KNBB 1JRHL 5LG1A 4X4ME 3DVGA 3RPKA 1CGUA 4R7DA 3VFUB 5KOVC 2NY7L 1MIMH 5CZXD 4JEGB 3VD7A 2PTTA 3A0OA 1CVSC 2R1XA 2NX5E 5HHPA 2V7HA 3PL6D 1G9EA 1KGCD 2GTWB 4UV4H 4JDTL 1GGCL 2NW3B 4QXWA 1HXYA 3TBSA 1DQMH 3RX8A 3KPRA 2CLZB 3O8XC 3P0VL 5GHWL 1NC4B 1PZ5B 5CCKH 3F12A 3PGDB 3MV8D 1SYVA 2Q8AH 3I50H 4P23D 4OZFA 3KDMB 5TDOA 5CZVH 5IMOB 1RHHA 2RHEA 4OLXL 2GYSA 1GOHA 1K4CA 4NKDA 5FKAA 5AZ2H 5J06A 2O5XL 5EPMA 2GSIA 2A9NL 3WNPA 2NXYB 3GBNL 4XVTL 3GIVA 1AQDB 1S8DA 4D94A 5F7UA 2BSRA 3W9EA 1KTDB 5K9JH 3DYOA 3RGVA 3H2WA 5GRJL 4JFZH 3U0TB 5D96C 4YBQC 4FFVD 1AE6H 1WIUA 4J3OC 4XWGL 4HPOH 3SKMA 2AEPL 1F42A 1Q9LB 4PJBE 4PTTA 4K07A 3THML 1FSKB 2ZCHL 1PKQB 5LAXA 2R1YB 2XN9A 2AK1L 4RDQG 3CH1B 4U1KA 5F97E 1BQSA 3MA7B 2R1WB 3BVNA 4PRNA 4FFYL 3CK0H 3MGOA 3SE4A 3BESR 1QNZL 4QHMA 3BP4B 4L4JA 1SHMA 3TIDA 4ZPVA 2VKXA 5JW3L 5FKPB 2PW1A 3H3BC 1G7MA 3JZ7A 3O2WL 5I8KL 4KPHH 3V4PL 1AGEA 3FO0H 2W9EL 3DNKA 4NYLA 2EDTA 1EIBA 5E95B 1RIVL 3AM8A 3OB0H 1HIML 2DM2A 1FFNB 1JYVA 3PDGA 3ULVL 1FH5H 5SX4H 4PLJD 1R0AH 4KV5E 4K3EH 5HBBA 2F5BL 3L3OB 2P4AB 4U1NB 2R0LH 4PJ7B 4XVUC 2DICA 4L9LA 2VQTA 4IM8A 3UPRB 2NZ9C 4G6KH 3UTZB 2HVJB 2OYPA 4J3UA 4CJ0A 4IDLA 3GO1H 4AQOA 2FLRT 1PBYA 3ARDA 3S37H 3AMLA 4RIRA 2EDLA 1GRWA 4M61A 1D5MA 5K9QG 2DQJH 4RQQB 1NFDE 4OQ1A 3VH8B 1G0YR 1EO7A 1MF2H 3NIGE 3ES6A 2Y7QA 5EOTA 1TCMA 1LEGA 1I4FA 3WXVH 3KPQB 3C6SB 5MI0C 4U1IA 3VFMA 5BS0B 3DX7A 4FQXD 2ICWB 4HWBA 3VXQB 4OCWH 1NPUA 1WICA 4L3AA 4X8JB 3QDMA 1IT9H 3W11D 3MV7B 1CD0A 5DFTA 5IJVB 2HA1A 3VFSB 1UGNA 4NQCA 4OFYD 4BQ8A 1Q0XH 2V9QA 3MRBB 5DHYB 4A6YA 2VC2L 4GW1B 4HBCH 4Y1AD 2LE9A 4HAFA 3GMOA 1LEGB 3TJEH 3UBXA 1FNHA 1N2RB 3L95A 4KTDH 5F7KC 3EJZC 4HS6B 4G9DA 3PDDA 2R9HC 4PR5A 4JZJB 4OBSA 5EU4A 2IH3B 5IESL 1UWXH 3C60A 1NSNL 3AXLA 4XX1G 4AEIL 4XXDB 3WHXA 4YHLH 5I1HL 2ATKB 1FZMB 4NRZA 2O61B 2O26U 5JUEL 4MHHG 3UJJH 3W39A 3L5JA 1GZQB 4L4TA 1WIPA 4GQ9H 4XVJL 2IPKB 4FQ2L 3TWCL 1SMOA 3BN9D 4P5TC 4YNYA 3VXMD 1H0DA 5DD6B 3VWJC 1GZQA 2ZNXA 5KVFH 1EXUB 3SDCC 1DR9A 3C60D 5E8NB 1KPVA 3PQYB 2XKSA 3SCMD 3KHQA 4PJFF 3MXVL 5EU4B 3ARZA 5DJ0A 2NY3C 1QACA 2J8OA 3O6FD 4G9DB 3U9UA 5GGSA 3MRDA 3BZEA 1T03L 4P2QA 2WUBL 1ZANL 2OTUB 4OFDA 1ZLWH 4J8RB 4XI5D 3EO9H 1DBMH 1I9RH 3BPLC 3NBNA 5J8OA 2NX5D 1T1YA 2A77H 3LEYH 4GG6E 4YHZH 3BIKA 1KJ2H 5KSAA 1R3JA 1VADB 3P4NB 1FNEB 3T0BA 5FV1L 3NH7H 4YHMH 3W5NA 1JNNL 1TVBA 2Q20A 1HQ4A 3UTTA 3FFDB 4Z18A 3VG9B 2BOCB 3QWRD 3ZKMC 2IH1B 1D9KD 1XT5A 2CLVB 4HUKB 4L5FL 5CGYC 5JMOC 1HHIB 5D1XD 1OD7A 2A9MH 2FJGB 4IJ3C 5DD0H 1I7TB 2NLJB 2X40A 4YGVA 3QEGH 5DMIL 4JO3L 3QHTC 1U93B 1EJ6A 4HIIB 3PHSA 4IMLB 3T0EA 2Z31A 3IVKA 1XGPA 3DUSA 3S35L 3FQNA 1QTYT 5CEYA 5DJAA 1MAKA 1JGDB 4ZSOB 4P2OD 2ERJB 4FQ1L 4OZGE 3NFSH 3AUVA 5GRUL 4X4YA 3CUPB 1U93A 4ZFOB 3IAQA 2C3GA 3V8CA 1DFBH 3DMMB 1XR9B 3L5IA 3L3DB 4HZLA 5I8CA 4ORZC 2E27L 4JHZA 1FLTX 5IW1B 5M7QA 3DSFH 2XIDA 3TN0B 1SYSB 2MCPL 1YNTB 4M6MH 1E4WH 4FQLL 4P2RB 1DUZA 4J12A 3G5XB 3QEHA 5I1LB 4U6YA 4WTZA 5DC4B 3WMSA 5C0JA 2Q8BL 1IQWH 5INCA 4X6EB 3QIWD 1UCBL 4QGTA 4LSVL 4YO0A 3HNVL 3P3YA 3LHPL 2ZOLA 3TVMD 4LAJH 3OAZK 1U8JB 5L6YL 1BVKB 4DGIL 4QYOB 4LRIC 2QADB 3DGCR 3LQMA 3OR7A 3TPKA 5DQ9B 2FHCA 3L9RA 5FYLH 4RBPK 4HKXB 2HJKA 3O11A 1F6FB 2VLLA 3EHBD 4NUJA 2YC1B 1DQTA 3HRPA 3QIBD 3LQZA 4HGMA 4Y4HC 1DZBA 2CDFA 4I0CC 3RWGA 4FXKB 4JRYE 5T33H 6FABL 2VXTH 1DQQA 1T4KA 4QRRB 3J8F7 4YR6A 4XVSL 2YEZA 3VRIA 2DQGH 2LU3A 4A6YH 1WFNA 5JHDD 3PWNA 1LD9A 2OBGA 2XZAH 43C9A 1RJLA 2UVEA 2ATPB 4ZO8A 3W2DH 5LGKA 3LRGA 5J12B 2JE8A 5D1QA 5F9JB 1U95A 4LDOB 2NCMA 5EB9A 3OGCB 1YEJH 1P7KB 3QDGB 1L7TH 3MJ8A 5CHNA 3RDTC 4C56B 2CD0A 1DQQB 4HMDA 1NGPL 3WFZA 2AQ1A 4X9BA 5MEPA 2V2XB 4G3YL 4HMEA 3HUJB 3QCUL 5AYUH 5JHLL 5B3JE 2ZG2A 2D31A 5TE4L 4YPJA 4LMQI 4MAYD 4K3HA 2VERN 4KFZC 4N0FB 4K7PH 3RKDD 2V2XA 4D9RD 3T1WA 4Z0XB 1TCRA 3WD5H 1NDGB 4ZFFB 2XFXB 1JVKA 3MRRB 4M1GL 3ZDZE 3I85A 3EYQC 4JFDD 5IR1A 4NO5B 5C08D 1M7IA 2ZUVA 1JRHH 4MGXA 3SDXB 4X7TA</