2VVFA

Crystal structure of the major capsid protein p2 from bacteriophage pm2
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
269
structure length
269
Chain Sequence
MRSFLNLNSIPNVAAGNSCSIKLPIGQTYEVIDLRYSGVTPSQIKNVRVELDGRLLSTYKTLNDLILENTRHKRKIKAGVVSFHFVRPEMKGVNVTDLVQQRMFALGTVGLTTCEIKFDIDEAAAGPKLSAIAQKSVGTAPSWLTMRRNFFKQLNNGTTEIADLPRPVGYRIAAIHIKAAGVDAVEFQIDGTKWRDLLKKADNDYILEQYGKAVLDNTYTIDFMLEGDVYQSVLLDQMIQDLRLKIDSTMDEQAEIIVEYMGVWSRNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Insights Into Virus Evolution and Membrane Biogenesis from the Structure of the Marine Lipid-Containing Bacteriophage Pm2.
pubmed doi rcsb
molecule tags Viral protein
molecule keywords MAJOR CAPSID PROTEIN P2
total genus 65
structure length 269
sequence length 269
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18628 P2_N Viral coat protein P2 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.730 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vvfA01
2.60.120.730 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vvfA02
2VVFA
chains in the Genus database with same CATH superfamily
1F15A 1OT5A 3E5UA 5LEJA 4P08A 5A1AA 1EUTA 3AK0A 4X6QB 3WCRA 3NNJA 3C7FA 2LS6A 3J7MA 5IVBA 1RJ7A 3MZHA 2Y8KA 4CUBA 3KQRA 1APNA 2BOJA 1PGW2 4PBOA 5DN2A 1JOPA 1VBB2 3ZMNA 4YGDA 4DO0A 4EN0A 1AX2A 3OF1A 1QJZA 4XJZA 4OI0A 1H6YA 1RC6A 4IERA 4AVBA 1H9WA 5DPNA 3VZJA 1JMUB 1RITA 4G9SB 4RQPB 4PLOA 1POV1 1UXXX 2ZXQA 3WX5A 4AAPA 3DXUA 2HH9A 3V65A 1LR5A 3HPNA 4HLTA 4EJRA 2XKPA 5JSPA 2WUHA 1D4M2 2R0HA 3GJAA 1H9PA 2CY6A 4KGQA 4MXWB 3T4VA 2JEMA 1WBLA 2QTWB 1YCIA 3WQ7A 4E4HA 5J96B 2G9ZA 1PZ8A 1QQP3 1UOGA 3C7HA 2XLGA 1ODNA 1ULOA 3UKVA 5DXDA 1YWKA 3POFA 3IPVB 1CD3G 2YDEA 5LBEA 3WNPA 5A3NA 1MPXA 2VZ1A 4XBQA 4IE5A 2GZWA 3UGGA 2FDGA 3Q8CA 3IMMA 3LE0A 3NWKA 4URTA 2VXJA 3OUHA 5BUVA 2R1DA 1LHNA 1LTEA 2QFEA 4IEPA 4JC1A 3WCSA 3GXUA 1NZCA 2RM22 2UYAA 4PHZA 1XU1A 4D3WA 2JWPA 3PU3A 4I3GA 2JDAA 1UZWA 1SG3A 3QBQA 4CXWA 3D0SA 1PX3A 4JGZC 1S0IA 2YZ4A 2XXZA 4OZOA 4FPOB 4PIXA 1JUIA 4RGAA 4NHKA 3SKVA 3MO4A 5I0SA 4Q4W3 2ZX3A 4LOSA 4PQ9A 3Q9OA 3S57A 5GJ6A 1GNYA 2NMNA 4CPBA 2HWD1 3TN91 5BNNC 4DXZA 1LU1A 5FPBA 1GZTA 5T55A 3AKQA 1RUD1 1OVPA 4O61A 3VKLA 3WEZA 2BUKA 2GC2A 3T1LA 2JICA 3GNEA 5FYTA 1AYN3 1RUE3 4YVWC 4RN5A 4D7TA 4KQ7A 1EV12 2DBIA 5A3WA 3M3IA 1MZ6A 5DAQA 2W9XA 4N43B 1LENA 2ZEWA 4FPEA 3E97A 4ATFA 3SISA 1AR82 2AREA 2HWF3 1XE7A 2GAUA 2W47A 1GP5A 1OA2A 3UYJA 4LLFA 2A3YA 1UU6A 4SBVA 1W6QA 4CDQC 4ZHNA 1BQPA 1W9SA 3NAPB 4XQWA 3MW2A 3ORJA 3RRDA 5IFPA 5F2WA 3AC0A 5K0UB 1UF2C 2A6VA 4JKMA 5FMCA 5A32B 2QDNA 2YU1A 1D0GA 4LULA 4Y20A 1OPOA 5DUWA 1HB3A 1DZQA 4J6GA 3ZFGA 3ZIWA 3WQ1A 4YZ2A 1NCQC 3RDIA 3VDDA 2QBXA 3VBSA 4ES9A 5C4WA 5A1LA 5HXMA 1R092 4MG2A 3WT3A 2VUJA 2VJXA 4UYBA 3VBUC 4OFGA 3D0JA 4CVUA 2BBAA 4P9LA 4AK3A 1RB8G 2J1VA 3FX3A 2JE8A 3VD5A 5BNOB 3POSA 4QX7A 4YW2A 1AR61 3RZZA 2J1EA 1JOJA 1UIKA 4XACA 4QPWA 5FZOA 2YROA 2P6HA 2WZR1 1XSRA 2QUOA 3WG4A 2A75A 2ORZA 5SV5A 4RS5A 5LA9A 1MR5A 2B5HA 2VOTA 4JHZA 2VOWA 2XHNA 3HEIA 3NJYA 4YW5A 5C3SA 2BP6A 3DPRB 1H8TA 3GZEA 2EIGA 3JQXA 3M2MA 4A42A 1F5FA 1XE8A 1CIYA 2VR4A 4QKNA 4QXKA 2IUWA 1IG3A 2PXJA 2B45X 4IL7A 4JRAA 5FKCA 4LO4B 2ZMKA 4PDWC 1QNYA 1UXZA 4XF9A 3S6PA 2OZJA 1OVSA 2W68A 1W2AX 3KCYA 4INDA 1EAH1 3KVAA 5F5IA 3U10A 5BNPC 4UW3A 2ARBA 4XILA 3PVOA 2RR13 3FWEA 4BB3A 1HJGA 5FP3A 4YFWA 3ABZA 5DG2A 4CDWA 3RVHA 3M70A 3FE5A 1LOBA 3SMHA 2DVBA 3ZSKA 5LWBA 2EXIA 4GJZA 2YPJA 4JTOA 2B9UA 1BMV2 3WF3A 3A0KA 1CQ9A 3APBA 5EXOA 1HN1A 4ZU5A 5FP8A 4OHWA 3H8OA 3N7LA 1M4WA 5C71A 3O0XA 1QH7A 5LW9A 5LASA 5GALA 3U4XA 3ACLA 3SHRA 2C6SA 1QKQA 4Y5SA 3E5QA 4IEWA 1ZNPA 2DCKA 3NW4A 2PHWA 1IKQA 5LRRA 5KC5A 4CYDA 1FOD1 1PMIA 4P02B 3CU7A 5F3EA 1U5ZA 4XMIA 3BIWE 1C8M1 4HN0A 3ZO0B 2G1MA 3OD0A 2D6MA 3JB4C 2BYVE 2CNAA 4H7LA 1DQ2A 5C3RA 2ZGRA 3ACIA 1W2TA 4IGQA 3CZUA 2Y38A 4Y1YA 4ATEA 1RUG2 5C70A 2VZOA 1LEDA 1FMD1 5LATA 5L7OB 4AHWA 1S0BA 1J3QA 2C1FA 4XHBA 4AFMA 4HPKA 2E7TA 4ZS3A 1QXRA 2R16A 5JVVA 4Y5Z0 1OA3A 5FZ1A 1CAXB 2K0GA 2BZDA 1MZFA 2VMIA 3AX4A 1W0PA 4RHV1 5GLUA 1Z7S2 2YG0A 3I49A 3RZKA 4CDUA 4NIDA 2Z2SB 4S2HA 5BXXA 5JCTA 5EIYB 2VGDA 4LE4A 2WA3A 3T3YA 3V56A 4C91A 3AP9A 1J1LA 1ULPA 5EFUA 2BPA2 2XJUA 2DV9A 1NLSA 3OBZA 4CUCA 2E53A 2JDNA 5F8PA 1KEXA 3ZXDA 1VIWB 4H55A 4H7MA 2YBPA 3MEPA 2Q8CA 1RUC3 2ZHLA 3V0BA 4UFHA 3S30A 3GDBA 1HB4A 1AYM1 1SPPB 3ALQA 4JDMA 2WN3A 1HQLA 4TLGA 4DXRA 3O1SA 3VZNA 3Q8EA 3U4SA 4OUEA 3WNNA 4LK6A 4TN7A 5FPZA 4ZXKA 5C8WA 1GANA 5LRSA 4LHLA 3WP5A 4WM7C 3SCGA 1CESA 3JBG1 3O1VA 4B29A 4QXHA 3AZXA 4IESA 5FWJA 4NIHA 3BALA 4YLZA 4DMIA 3RZHA 1VMJA 4MOAA 1RYYA 2JDMA 4M01A 1NCQA 2ZX4A 3ZYRA 1PZ9A 1RUD3 1ZZCA 3VB9A 2VZVA 3ATGA 2Y33A 4K3UA 3HT1A 4GH4C 1YUDA 5APAA 1OI6A 3Q8AA 4GB31 2V4AA 3POYA 3T4HB 5DQ0A 2O14A 4K6BA 4AXOA 1UOBA 2W1QA 3AYDA 4K8FA 4QGMA 4V2WA 2FDKA 4OHYA 1UY3A 2ZGTA 2QVSB 2H0VA 2G19A 1B35C 5F1RA 5E8AA 2DURA 5F3CA 1PVC2 5FXXA 3ZYJB 2WNEA 4HKWA 4XFAA 3JBG3 2W94A 5AC93 2KXLA 1W90A 1BYHA 1UMIA 1ZRIA 3I2DA 3A23A 1DYOA 1TMF1 4GAZA 1I5PA 2PFWA 4IEVA 2HWC1 5J7MA 2FQPA 2J1TA 3HQRA 3NJZA 2WO3A 2VMDA 5DAWA 2XJTA 3WDUA 5FZ4A 2DTYA 3MIBA 5CFDC 4IXLA 4RYDA 3SCFA 1S0EA 2D3RA 4META 1SDWA 4FXKB 3H1YA 3VBHA 4CA9A 5FZIA 2FDFA 2JDZA 1SQ4A 2MEV2 4QD2A 4AEKA 4D69A 1QH6A 2PHDA 1DZRA 1HV0A 3THCA 5C3QA 2VNOA 4UOJA 4IV3C 2R062 2TBVA 2P17A 3B9CA 4LE3A 1ND3B 1UN1A 1V6NA 2F17A 1V9U2 4QKDA 2DYCA 1GOFA 1AJKA 4R9CA 1BEV2 4ZONA 5FPXA 3JU9A 1BBT1 1MEC3 2HYXA 1DQ0A 4D0QA 2VY0A 3W58A 1AXZA 5JOZA 2EXKA 3U07A 2R041 1D4M3 1FT9A 4Z2AA 2JXAA 2WABA 2GMMA 2RS11 1XE0A 1TVGA 2RS53 2JB8A 1E5SA 3W20A 2RS52 3IT8A 2GP3A 3AMNA 3WSOA 4CTEA 4NIAA 1JUHA 4HONA 2JD9A 3AP7A 5L9BA 1JZ3A 3ME2A 2UWAA 4MXVA 2QQMA 3J8F1 4QPIB 4SLIA 4FAGA 2WAOA 1J1TA 1RMU1 1EP0A 2XVGA 1GWKA 1WW7A 1ZZBA 4TLFA 5D1IA 5FK8A 5IAXA 1RUF3 4UBGA 3L2HA 4Y20B 4YYOA 4BMEA 2WS92 4A7YA 3KT1A 1YIFA 1K5MA 1RGSA 1UX7A 2GMEA 3AM2A 5E6HA 5T50A 4XIOA 1TZOA 2B8MA 3USSA 4YARA 1RTVA 4ES8A 5HCAA 1WMDA 2RS32 5FYUA 3GZUC 2WQ4A 4QDSA 1Y4WA 4BISA 2WNVC 2VG9A 1CAUA 4AQ2A 4XFCA 5CU1A 4IEYA 2CDOA 5FY0A 4PIZA 1QJX2 3KQ4B 1IGOA 1X50A 3WNLA 4HSJA 1HLCA 1Z78A 3J8F3 4AEDC 4RGGA 1PK6A 1FV3A 5ABJC 4CUAA 1SLBA 2B46X 3EJKA 3H3ZA 3GZTB 5BNNB 2AACA 4O9EA 1IPKA 3J4UH 1AR93 2VUDA 3LWCA 5JI7A 1CZSA 1H2NA 2Y6HA 4YM2A 3AMHA 1COV2 1GOGA 4YVWB 4JGZB 1R1A3 2PHTA 3OCPA 2BNOA 4P9YA 4S2FA 5CVRA 4AVSA 3WG2A 3WZ1A 3R4DB 2QQWA 2R043 4BDVB 5LCWL 1B09A 1KFXL 3K48A 4UI9L 4QQOA 3THTA 1SLIA 4AVTA 2ZA9A 1HX6A 3UGHA 1QWRA 4RHV3 2YBKA 3SH3A 4GMP3 4Y1VA 4B4PA 2QQVA 4AZZA 2ZX1A 1W8FA 1ASJ3 5DAVA 1J3RA 4MGQA 2WNUA 4QDRA 3IPVA 3NAPC 2IXKA 3KV9A 4R52A 3VD9A 2ZPXA 1SFPA 4IE6A 3IBMA 4A44A 2X8KA 3BN6A 3S0MA 1YI7A 1R1A1 3HVDA 5FZCA 5A3PA 3I2IA 1HXS2 4E4SA 1MS1A 4NRMA 1UZZA 1W04A 4QHZA 1U12A 2VTXA 5HI0A 1FAYA 2Z69A 1AX1A 4XUPA 5EYYA 1LB2A 1MS3A 2XBO1 1F5JA 1WBFA 4KL1A 1QY4A 4AFDA 4N8MA 2BW8A 1MVQA 4CEYB 1OUXA 2H6BA 2DTWA 1Q3EA 1DIWA 2PLV1 2D3PA 2P3IA 3AJYA 1OOPA 2TNFA 3OBTA 4P9JA 5FXWA 3H7JA 5FQ0B 3RJ2X 4RSUA 5DZFA 1WMEA 4NHYA 5CAZA 4XJAA 3JCIA 4UT5A 5JPMB 1JODA 2P34A 2CSGA 2R073 3VL9A 4FQ4A 4GWJA 2LALA 3HOBA 3ILRA 2BV4A 3K46A 3PUHA 1K5JA 1R082 3PVNA 4KG0A 4W8JA 4UW6A 3IAPA 4AEJA 1RUI1 4W4ZA 1HKDA 4AL9A 1AR63 1EAH3 1YO8A 3VDDC 4M3CF 5I91A 1NCRC 4HVQA 3TEYA 1K5MC 2PLV3 3HQUA 1CPNA 3KGZA 2D40A 5I0DA 2FDHA 4NUBA 1ZM1A 3BYWA 3O1PA 4ONUA 1PIV2 2VCBA 3C7GA 2NN8A 2RMU3 3ETPA 1SLCA 3OY8B 2AUYA 5FMBA 4DXTA 5H9QA 2W92A 4U2AA 2DUOA 4BLJA 4XUQA 1VBD1 1BVVA 3M3QA 1WCDJ 1RUOA 1ZBE3 4KGGA 3QH7A 2J42A 1N3QA 5H9SA 4ZU4A 2XJVA 3AXEA 3I3DA 1YI9A 1GYKA 2AH2A 5FAXA 4LHSA 2AEZA 1W8WA 1O8SA 2C4XA 1DGRN 2Q4SA 4XFHA 2F6BA 5FUIA 5FYVA 4EZHA 1MQTA 5KHKA 1PIV3 5BNOA 4D6SA 4TXWA 5LY2A 2HWB1 3CJIC 3LOBA 4IV1B 5FCCA 4AHZA 1V6IA 1IZ3A 5JR7B 2ZAHA 1B35B 2ADDA 1NT0A 1PO23 2SBAA 4UFMA 4AI0A 1VPHA 4WM8B 1GZCA 3RYPA 4B7KA 2BVVA 2HKXA 2WLQA 1Q43A 3VKFC 3F95A 4YSFA 4QX2A 4DUXA 4UW5A 5IK8A 1W9FA 5BNNA 5AFEA 2R7EB 1ZBA2 3ZXFA 4BK5A 1RHI1 3RMXA 2HWF1 4Q4X2 3O5SA 4QWNA 4XCAA 4JGYA 4YW1A 4DEVA 1XRUA 3EXUA 4ZU7A 4IEQA 4ARYA 5KXBA 4CRQA 5JZGB 4L11A 1KXGA 2I2SA 3TBDA 1N1TA 2XWJB 1GUIA 3H3UA 2HWE2 1N47A 2WO2A 1QOOA 5C4WC 3T30A 2IFWA 1C3HA 3Q8FA 2UWBA 2XUMA 3N35A 5JZGA 4K40A 1DG6A 1QOSA 1IS4A 1MZ5A 5ABJB 2A6XA 3U1XA 5JOXA 3LIGA 2CV6A 1POQA 1LNSA 2EF6A 1WCSA 4YVSC 3WNXA 4QPGB 4XXPA 5L73A 1BJQA 2K9ZA 3ILNA 2Q5TA 5DAXA 4BH9A 5IHRA 1E57A 4A7ZA 3MUY1 3ZLIA 3ZVXA 4N43C 2O8QA 3SITA 3OEAA 2PQSA 3RGBA 3HNYM 2CYFA 1KS4A 4Y24A 3I4IA 4BQYA 4YW7A 2BGPA 3KSCA 2J1UA 4OZXA 3VBSB 3IDBB 1W3XA 2BWAA 2EXJA 3SH4A 5AC92 1A3KA 1RUC1 4K20A 4GKYA 5I8TA 4KMQA 4LUMA 3I97A 3DYPA 2ZZJA 3GHMA 4W6XA 1RUE2 4B3NA 4BLIA 5SV8A 5IK4A 2BFUL 3FUQA 1AR71 4MUVA 1QXJA 4N53A 1Q8QA 3KT7A 1VAMA 4IEXA 4LPLA 5FZ8A 1ULFA 3A0NA 2P3KA 3RYKA 1ND2B 3ST7A 1OOPC 3JZVA 3SKJE 4CCLA 4UFIA 2GALA 5ISLA 1D4VB 1SACA 3ZYFA 4FCAA 1Y9MA 4BIOA 2PYTA 4R9DA 4YZ3A 1ZRFA 4FPKA 5T52A 1H6XA 3AZYA 3WF0A 4OMCA 4DS0A 1T6BX 1QMJA 2WNVB 5A7QA 2VW2A 1TME1 1CGPA 3H8RA 4Q29A 1NA1C 3N9NA 5FY4A 4AI8A 1W8UA 1VAKA 3MLKA 4NAOA 4P5HA 5BNPA 5EP9A 3P5BA 4BA6A 1TE1B 5ERLA 1JHJA 2VMEA 2Y0OA 3N9QA 1RL3A 4NO4A 3MV01 3ETQA 1C8M3 2IZWA 2LROA 1GWMA 5C8CA 4IV3B 1QJEA 4COWA 1QJY3 2WT0A 5HCHA 5EWSA 2AYHA 4Q0QA 2VCCA 1QDCA 5C3PA 1UKRA 2VQ0A 3AZWA 4E2SA 1PK6B 1QDOA 3CBNA 1W0NA 5CFCB 1K42A 3LFMA 1DU3D 1FNYA 5FYYA 4Y1XA 4CDUC 1I1EA 2WQZC 4ASKA 4D7SA 1Z7S3 3P6BA 4P00B 5M0TA 3U37A 2N7GA 3ZXJA 3RG0A 5FZMA 3BPZA 1KGYA 1OF3A 3H9AA 5FUPA 3WDVA 1WLDA 2ZS6B 4BJ0A 1UCXA 3OJBA 4BYYA 1HIXA 1HRV2 1W8NA 1W8ZA 1V70A 4Q5OA 4AHYA 2VZ3A 3PJQA 4XTMA 4CE8A 3E5XA 2P3YA 1C5HA 2RJKA 3NV1A 4MYEA 4DEQA 1VBC2 4XAEA 1XSQA 5KWRA 2P2KA 2X10A 3LDKA 4L8QA 1EUUA 2RR11 2Y6JA 2JDUA 3CF6E 1MEC2 4XFGA 4Q0PA 2EIEA 4XQ4A 3PIJA 2XMLA 3PNAA 3V0AA 3LOIA 4YGEA 1OOPB 4ISQA 4M00A 4BQ4A 5LA0A 1U5IA 1L7LA 1UYYA 3LEGA 4DOUA 1TNFA 2XOMA 2H0BA 4MGSA 1V0AA 4L2NA 2NM1A 1JYTA 5FR3A 3RNSA 3N7KA 1FPN3 3QOPA 5IT6A 3HAGA 1SFNA 2B42B 4UFLA 1E5RA 1RUI3 4WVZA 4YFZA 2WBKA 3IIIA 1NA1B 2WFF2 2X5IA 2FCUA 2TUNA 3B01A 2UWCA 4H2AA 3WQBA 5FDBA 4HANA 2ZAAA 2OT7A 5L9VA 1H1AA 3KMHA 3OPWA 2DWRA 5GKAC 1VB2A 4B1LA 2EXHA 5E1RA 3UJOA 4FSJA 2JG8B 2A3XA 4V1PA 1ZVFA 5IVJA 1F31A 2YXSA 1O3QA 3PTRB 3VL8A 2JKBA 1VBA1 1XJAA 3S5AA 1LEMA 3VDDB 4AG4A 1JZ2A 3MYXA 1Y9GA 1O4YA 3PHMA 4IV1A 1UZYA 2Y60A 4NR1A 1A8DA 1O8PA 4KI5M 1VRH3 5JOYA 1QJX3 1L7QA 4PT6A 5ACA2 3PVBB 1SEFA 1AR91 2DUQA 2QDRA 4L92A 2Z4FA 1CJPA 1ASJ1 1O91A 4OHXA 5D2AA 1AVBA 2KM2A 1FV2A 1DQ4A 1NG0A 4OLLA 4Y1UA 3BU0A 2FBEA 1W6MB 3NNGA 1QJU2 1OSGA 3DYMA 4WVWA 4B8EA 2QE3A 3GYDA 4MV2A 3ZKUA 4QX0A 5H9PA 3T2TA 4COUA 4C90A 5T54A 3EBRA 2XB6C 2E31A 2R30A 2BERA 3GZAA 4EROA 4NJ4A 2A5ZA 1J83A 3I2HA 4JDOA 3JD71 1BZWA 2W1SA 2QJVA 2UY8A 4XPVA 2JDKA 3ZXKA 5C33A 2H6CA 1SBFA 3J7HA 3N9MA 3NNLA 1WMXA 4XCBA 1W9YA 4XZUG 2WRAA 1UY2A 5GZFA 3T2QA 3HBKA 4IV1C 4AEMA 1UL9A 1W03A 4WVMA 2ET7A 1PGW1 4KBBA 3B5LB 4WV8A 2VVDA 1LU2A 3RQ0A 3JQWA 4JAAA 5T5OA 1C1FA 2R1BA 3LDRA 4KBZA 4N43A 1W06A 2RDSA 4EZ4A 1CX1A 4R9BA 1ZZ7A 3KGLA 1CZTA 3MGUA 4LMFA 5E16A 2PHRA 3T2PA 1JU4A 3LPFA 2ZX0A 3ZSEA 5CADA 2YMZA 5IWFA 3AYAA 5JIUA 1D4M1 1AF9A 3N36A 5IUQA 1TQ5A 2XJRA 3HBZA 5CIRA 3FLTA 4JGZA 3FC0A 3ZSJA 4AYUA 1ND3A 3OUIA 4LKFA 5CFCA 1KITA 4LNVA 2FCTA 3UKNA 5F7UA 1RUF1 3BPSA 3AZVA 3RWNA 4BHPA 1UMZA 2DF7A 3O1UA 2ZEZA 4P14A 4UW4A 2YC4A 4CCEA 5CKNA 5FZGA 2J1RA 5CG9A 4DFSA 3N7MA 3U78A 1DBNA 1OF4A 2YYOA 4HT1T 4Q4W2 5DUUA 5A7PA 1UPSA 4Z1VA 1JH5A 1H2MA 3VBHC 4QM9A 4NHXA 4JZRA 2KD7A 4OMDA 4YGCA 4QAWA 5DUVA 2F4LA 1XB9A 3V0AB 5CKMA 3KB5A 3WOGA 3ZN4A 1KDKA 4KWLA 3C7OA 4FPGA 4GD4A 3NV4A 1H8TB 2HWB3 2ZZQA 3PDQA 1VR3A 4IEOA 1XQNA 3HIFA 2D93A 4D7YA 1DYPA 2E32A 3UKTA 3VUOA 4A45A 1ND2A 2JDHA 2HWD2 4XOGA 5IK5A 5JWPA 2OS2A 3U75A 1D2QA 3AB0A 4GWMA 1RUD2 2VULA 4PI2A 3VBRB 5A6ZA 1OLME 1IHMA 1GWLA 2YC0A 1AL22 2IXLA 2X5IB 4XTPA 4D6RA 1PHMA 2AEYA 4QPIC 4DXSA 1WLWA 1OC1A 2IXIA 3AFGA 1ZBE1 4UFKA 1EV11 5CYYA 1EYBA 2ZX2A 5I8SA 5TSWA 2PELA 3WXPA 2P1BA 4RQPA 5EYXA 1PO11 1L7RA 3PUAA 1S2BA 4LIVA 1XNDA 1YRZA 4GXLA 3SCHA 3USUB 5A6XA 3O1OA 2QQPA 3LA3A 1OLMA 2VVFA 4FFIA 5DDJ1 3VZKA 3VBOC 2I07B 1S0FA 3AP6A 5JXJA 2V5DA 5GZDA 1JZ8A 3QH6A 2RMU2 3I2KA 2PHUA 3VBUB 2Y6LA 4E8CA 2B9VA 4FQZA 4FPLA 1RVF1 1CPMA 3MW4A 1W3VA 4MGYE 1MVEA 2SLIA 3WDTA 1C4RA 1IQDC 4AR2A 4XJWA 3VD3A 1J58A 4JCKA 2UYBA 4B1MA 3FN9A 4FI9A 2TEPA 4J25A 4GWNA 2JDYA 4YPJA 1OH3A 1WW4A 1YFWA 5GM0A 3ZFFA 4LBQA 2NP0A 5FZBA 1VBE2 4GKXA 5A3OA 1AR62 4DPNA 4EN8B 1UY0A 2ZEXA 2BGCA 3PUSA 1YFYA 1OHFA 4AVVA 2WZR3 2VAUA 2LTNA 3SEEA 3B69A 2WZR2 1GICA 3GCXA 4IQPA 4Q4Y3 4PF5A 4NHMA 4COYA 5J48A 2JG8A 3E6BA 3OGJA 2UU8A 4RD7A 1J59A 3LD8A 2GN3A 1YEWA 2DBNA 4HMZA 4QKBA 1VRH1 4CP2A 3ZSLA 4MGKE 2W95A 2CGOA 1G86A 4FOYA 4CP1A 1O6UA 4D8MA 2ORXA 4CP0A 1NY71 5K0UA 3CHXA 4FOWA 2VZUA 4MVTA 4XF1A 2CL2A 2NZ9A 1RUJ1 4DRVA 1J3PA 2VNVA 4DINB 4HG6B 5CEHA 2WNUC 3V0BB 1ZX5A 2X09A 3EO6A 2CTVA 1QEXA 1LGNA 4JHTA 4LBQD 5F3IA 1F4HA 4YZ5A 3OB8A 4HBNA 4Q4Y1 3OUJA 1U0AA 2R49A 3E1F1 5FJHA 5FREA 1G9FA 1ZYBA 3ES4A 4OULA 1MQTC 2VMCA 4XE9A 3WDXA 3T2OA 4RR3A 5FYIA 1W6PA 3TN93 3ZM8A 4E27A 5FYCA 3MHZA 2VXRA 4GULA 4HK8A 4LIUA 1AYN1 3FFQA 4P9GA 2BRTA 3ILFA 4BU2A 2BEOA 3POGA 4QQLA 3TEZA 4NN0A 1YYNA 2BNNA 4UF0B 2FZ1A 5LEKA 5FP9A 1OD3A 3AYCA 1C8M2 2YY1A 1YFUA 3MIDA 1UQXA 5FZ9A 4CEWA 4PDWA 2J1AA 1JZ4A 3H8XA 4ZPIA 3A22A 3W59A 1FMD2 3RZLA 1RIRA 1KFUL 1Q8VA 3J7NA 3H8UA 5KR7A 4CCKA 2VECA 4QGNA 5FZOB 2ZGOA 1HRV3 1YIPA 3W5MA 4OI2A 5LA2A 4E4ZA 1CAUB 3WF2A 5EZWA 5K4LA 5A32A 3ASIA 1W6NA 4RS5C 2DVFA 3L2YA 1RMU3 1ZRCA 1Z7S1 2Y6GA 3HR9A 4X6RB 2ZMNA 3VBHB 4L9BA 2ARCA 1R093 1X33A 3LQCA 5JIAA 2XLFA 3WW3A 3ZFFC 4M4PA 2OA2A 4BPZA 1C8NA 1AXKA 2D3SA 1ENQA 4TSVA 5A7SA 3QLQA 5BY5A 4TYSA 1VB4A 4AOCA 5ABJA 3CEWA 1I6XA 4GH4B 1AYM3 1RHI3 4JQRA 1A34A 3GBFA 2L9LA 1AYM2 2R6QA 3THDA 3WUCA 4CZSA 5CG8A 4RR3C 3VKNA 5DZEA 5A3LA 1V00A 1REFA 2ZEYA 3LZZA 2XKOA 1AZDA 4JVAA 3S7EA 3NKTA 3JBG2 4YRDA 3CJXA 4HKOA 1STMA 2HWC3 2YGLA 3WW1A 2BJSA 1UY1A 4BIFA 2ZHNA 4URAA 4LO5B 1W6QB 2Q8DA 4AEDA 3FHIB 4G4FA 4Q2FA 4FTEA 1LOAA 2WO1A 3WD5A 3VHRA 3CKHA 5FMOL 3W9AA 1CAXA 1ST8A 2ENRA 2AENA 4C0BA 1X7NA 3WDWA 3GGLA 4QPIA 4BWOA 4GB32 4GMP1 5C4WB 3EQEA 3RSJA 1ULCA 5FZAA 2ETEA 2W91A 1GP4A 2VO5A 1C1LA 2HJIA 3BTAA 4FOVA 1AHSA 1O7FA 2ZKLA 3PL0A 1REEA 4O9GA 3U0ZA 3ENRA 3D8CA 2JE9A 4OQ9A 3U11A 1BK0A 1FX5A 4MH0E 4LO8A 5FZ6A 1UNBA 5JLVA 2GH2A 4YG0A 1DQ6A 3WG1A 3EB7A 4FFFA 4CDUB 1XC6A 1YQ2A 4K7JA 2IFRA 2WKKA 4Q4V1 5L19A 2MEV1 4YZ4A 3T08A 1QIQA 4YW3A 4UWDA 2XWBB 1ENSA 2IXCA 3PIGA 1FATA 3ZR5A 1XPWA 4M3CA 4CU9A 2V09A 3ZR6A 5L7OA 1CVNA 3MI8A 3R4UA 4JQTA 4Q1RA 2BGOA 4AQSA 4YM3A 1Y9QA 1T2XA 4QU1A 2OKXA 5AFBA 5C6CA 5LZ6A 4JKLA 4CP9B 2VBBA 4XMAA 4OYUA 2Y64A 4XF0A 3POJA 3BTZA 1SFYA 2WSUA 2BDRA 1BKZA 1J84A 2QZ2A 4QQHA 3VHOA 1PX4A 4GJYA 4CDQB 1O5LA 3LGRA 1HB2A 1QJY1 4R8HA 1FPN2 3KV6A 4FPCA 4B4QA 4NIGA 4XHXA 3T09A 5L7OC 1BHGA 2W5FA 3WV6A 1VRBA 2A71A 2LUWA 4OI1A 3TNPB 5LK5A 1MQTB 3BU7A 4YM1A 4YVSA 3USUA 3W21A 3ZXLA 3WW4A 4R4XA 4F7ZA 3AL5A 2YUEA 4WM8C 2D6OX 5FZFA 4YW6A 1VMFA 4QB2A 3ZX7A 3POEA 3L9JT 3O0WA 4BQWA 3ACHA 4YZ1A 4DZGA 3C3VA 1ENRA 1NCRB 3FHAA 4EWEA 4FAHA 2Y6KA 2OQ6A 2CDPA 1P8JA 1ULGA 1N3PA 1L3JA 3B93A 1QQP1 1YQ8A 4FBFA 3OPZA 1JYXA 1VJ2A 1GU3A 1DF0A 3EHKA 4HK9A 4IE0A 4XUOA 3W5NA 3T0AA 1VBD3 3SQOA 1KJRA 4N7UA 2Y34A 5D8AC 2W0XA 1NLRA 4RFT0 5FO9B 1V6MA 3NRUA 5CA6A 5FKBA 4LORA 3ZOIA 4JRLA 1PO21 1WZXA 2AR6A 4AGGA 1H1MA 1SLLA 5DZGA 1TMF3 1UZVA 2Q1MA 3MIFA 3PURA 2VQAA 3AMMA 2PHLA 1ZZ8A 2UURA 5EJZB 4AI9A 1VBB3 1JYCA 4KWKA 4WM8A 4CEWC 2X5IC 1COV1 4N7IA 4EV0A 2LM3A 4E8DA 4KU7A 5JSRA 3CIHA 2WQ8A 4YNIA 3ACGA 4L99A 3H42B 2GDFA 3MUZ1 4YM0A 1WCQA 5A70A 1QU0A 4ASLA 4BOWA 1AL23 1OQEA 5T3NA 4AVAA 5LY1A 1F8VA 4AGVA 2P4EA 4LHKA 1VAVA 4BQ3A 2B4KA 2ZCWA 4D6QA 4CU7A 3K51A 3FBYA 4LJHA 3K3OA 3HWJA 5FZDA 4AI2A 1R64A 4NRQA 5EV7A 5F32A 1QJU3 1S0JA 4UF0A 3VN4A 3WHUA 2HBTA 2YPDA 4W6WA 1O3SA 2PHFA 4QT6A 2RJLA 4Q27A 1R1A2 3OPTA 2I74A 4L97A 5IK7A 1F35A 5G04L 3O0VA 3IDEA 1W6PB 4O7XA 1FXZA 4LQRA 1ZREA 3VHNA 1HB1A 2P3JA 4YGBA 4QPGA 4CDXC 3O1MA 4GH4A 3LB9A 4FT8A 1ZA4A 2XBO2 2JB4A 2WA4A 4CXXA 4I01A 3VDCA 3I2OA 1N1VA 5FV3A 4ZY9A 3VKOA 4LBOA 3WW2A 5FFOC 3ZDVA 2BQPA 2PLV2 4C1XA 3BUCA 2BNMA 4YW4A 5FYMA 1GNHA 2V5YA 2D7FA 2PAEA 3OYWB 4RL7A 3J9SA 1W6OB 2EAKA 3J26N 5H9RA 2G9GA 1S0CA 4RS5B 3BIEA 2QQOA 3C8XA 1N3OA 2WAAA 4B7EA 5G05L 4CDWB 2PA7A 5FYHA 3DYOA 2J1SA 2WFPA 1OQDA 4N53B 5C5TA 3LKJA 5CBLA 1R081 2ES3A 2IC1A 4C8DA 3LSDA 1S55A 1BK1A 1UAIA 3DF0A 2XLAA 3OGRA 1U5XA 4XFIA 4FTSA 4LA3A 4XEZA 2AZ5A 5JXHA 2FDJA 1RUJ3 3BB6A 1JU3A 2JECA 3LIHA 1GP6A 1HW5A 3KZ4C 3RZGA 3OBRA 3MF9A 1H8TC 2WWUA 2YC2A 4Y4YA 3FMGA 5HV4A 3ZPYA 3BOPA 1CZVA 1PIV1 1OQ1A 4I02A 5IVCA 4P9IA 3KHCA 1W39A 1LHVA 2EA7A 2E7QA 2V72A 3VZOA 4Z8BA 4GQ7A 4DIQA 3K4ZA 2VPVA 3RWKX 1RUH2 3WP4A 4LBLA 2HLEA 3LA2A 2BU9A 2VTXJ 5A33A 3IB3A 2VMHA 3AP4A 1H1IA 1PGL1 1AR83 3Q8BA 5CKQA 1X9TA 1G6NA 5HCBA 4HN1A 2E26A 1XXNA 2HEWF 1IOAA 1UZ0A 5KHIA 3D5OA 4LHNA 1LHWA 2XVKA 4LTAA 4S2GA 1G9BA 5LB6A 3M3CA 2Q8OA 4K9SA 1REDA 2MEV3 4AEDB 5LK7B 1GMMA 3D4KA 5JMOA 3HNBM 4CEYA 2DVDA 2LW8A 2DCTA 2Y6FA 1PNGA 1UY4A 1W8HA 2DVGA 2EALA 1ZRDA 4G3YC 5IATA 4KNCA 3NKGA 3CZJA 1BVP1 1LODA 4IUGA 2OYZA 5JOWA 4NPRA 1HRI2 2VOKA 4R4ZA 1CAWB 2XQXA 2ZGMA 1G9DA 5EQUA 2V73A 2QQJA 3KT4A 1JHNA 3OGGA 1OBNA 2GP5A 4QB6A 4Z07A 3WINE 4D94A 3ZYGA 1LGCA 2CWSA 2GC0A 5BNPB 2RS13 2ZKNA 2JG9A 2Z42A 1AX0A 2BOIA 4UXAA 5FPLA 4BQXA 4CPBD 5JDBA 3VDBA 3OBAA 3MLJA 4Z92B 2VMFA 2WFF3 2HWE1 4Q1PA 1ALYA 5DUXA 5FXZA 3NNMA 3AKSA 2R071 3PUIA 1DQ1A 5EJ3A 2OIIA 4AAXA 4MGZE 4QKFA 1RJ8A 1X9PA 1WCUA 3ZXAC 3O1TA 2D6LX 1NZIA 1VBE3 3ZFGB 2VW1A 3I3EA 4RR3B 1T6GC 5FOBB 2FZ2A 2JD4A 5IFTA 1FYUA 1GZ9A 3R0RA 3DGTA 3H1WA 4EWDA 1JZ6A 1DYKA 2ATFA 4M3CB 3ROUA 5FY1A 4QXCA 1ZRRA 3B9IA 1GZWB 1CAVB 1QJFA 2E9QA 2VCAA 3EMRA 2A7AA 3MW3A 2W52A 2WNUB 1TME3 1PNFA 2RDNA 5FO8B 1RUC2 3D3AA 1R1ZA 3POBA 4HFSA 3E6CC 2XJSA 1JYNA 5A3TA 1RUE1 2IVIB 3NV3A 4NHLA 4PCRA 5ANQA 1H0BA 1AR72 4LBQB 3RS6A 2ZGPA 3NO8A 4LEJA 3O12A 3AJZA 2OXBA 3FBMA 4OQ8A 3ZFEA 1HN0A 1US3A 5C9AB 1B35A 5FUNA 1H4HA 1OXCA 4LKSA 3WP6A 2MPFA 3FLPA 1ZZ9A 1O59A 1FI2A 1US2A 5HXVA 5E88A 5JSOA 1YC61 3LEIA 1TNRA 2WNOA 4NROA 2WLPA 3ZFEB 3PU8A 1E5IA 4PBPA 1RVF3 5GLVA 3FJSA 1VBB1 2AGSA 2A6YA 1NCRA 2W1WA 2LRPA 2ZGLA 3GBGA 3HD8B 3PMEA 4Q0UA 3B7MA 3BI3A 3T0DA 5KHGA 2VCMA 5BYNA 4QQPA 2GC3A 3KWVA 2WT2A 4QB1A 4QDQA 5B4XA 2ZGNA 3IDCB 5IVYA 5IVFA 4Z2WA 2OX0A 4NPLA 4AE2A 1W28A 4M0HA 1D2SA 1WWYA 2XHKA 3RYRA 4QM8A 3VBFC 4CSWA 1GKBA 4RQPC 3SNMA 4MGIE 4WBBA 2DCYA 4DUVA 2OUHA 2Y0IA 3AKRA 1SHWB 2ZHMA 3OD4A 3LEMA 4MHUA 2P37A 1YHFA 4E2GA 3GM8A 5A33B 5LBBA 4KWJA 2OVUA 4LO6B 4Q0VA 4EN6B 1OKQA 3CJIB 4EN9B 1GOHA 4ZZ8A 4Q4V3 2WJSA 5FLJA 4IETA 2RDRA 2XH6A 3ZXEA 2RS33 1HRV1 3PLQA 2K46A 3WNMA 3ZN6B 1PVXA 2CGPA 4Q8KA 4QQ2A 3CJIA 1VBC1 2RM21 3N7JA 1UD1A 2MHFA 1UYPA 5JAXA 4XYXA 3G6JB 3N9LA 2VC9A 2DU0A 1BBT3 1MEC1 3THPA 2OW4A 3B94A 2VZRA 5FY7A 2PHXA 4ZZ5A 1NKGA 3NSTA 1LKNA 1V6JA 5A80A 3DV8A 4CEYC 1G7YA 1KDMA 2VNRA 4W65A 2Y26A 4QX8A 2RDQA 4BCUA 3HT2A 1GQGA 4M4RA 3O1RA 4LR4A 5T5LA 3I59A 1AL0G 3WP3A 2W2IA 4BQ1A 2WR9A 3M3EA 3UL2A 1R083 2WZPP 1JXNA 3TN92 4ZS2A 3VBOB 4CCDA 3WF1A 1VALA 4PJYA 4OHVA 4TWTA 4MX3A 3T1MA 5J36A 3UV9A 2OQ7A 1F2NA 5D8AB 3ECQA 5JXGA 2F4PA 4H3WA 1UW8A 4XUTA 4BK4A 1BCXA 5FZKA 4IEUA 5J09A 1DGWA 1NQDA 2GNMA 3RZJA 4WVVA 3GHNA 1V6KA 2VVEA 2VQTA 3VBRA 4MHRA 1KD7A 5KHHA 1AR81 2C9KA 1RXFA 4A6SA 5FPUA 3NJXA 5HCFA 4Q4X3 5FBJA 1LECA 5L36A 2VU9A 1HJFA 3K2OA 3MIGA 2YBSA 2D5HA 3TAYA 1MS9A 1O4ZA 2NQYA 2WN2A 3KM5A 1CWPA 4AVCA 2B7YA 5A7WA 4AHXA 3H7YA 3I3QA 3ZYBA 1HXS3 4A2UA 3TEXA 4AQ6A 1W05A 4DY3A 1ASJ2 4LKEA 2CAUA 3RI8A 4HOOA 4QXBA 3VV1A 4FFGA 2X29A 1R091 2VUCA 5L9RA 1QJU1 3VD7A 4KU8A 1YQCA 3TYJA 3DKWA 4I0BA 3KF3A 3MV11 1S2EA 3OEBA 4OVEA 3QCWA 4UBHA 4OI4A 1UU4A 3D6EA 3KLSA 5DMYA 5EJ1B 1W9TA 3IWZA 5C8CB 2D97A 3JD73 1MZEA 5C7GA 2W3JA 3JD72 2VNGA 5JI9A 2ZJCA 5LBFA 5C3OA 3IDAA 5T5JA 2ILMA 3ZKYA 5GLWA 4CCJA 1D7PM 3WR0A 3AFKA 4LKDA 1W99A 2HEYF 2W46A 3FUOA 4GMP0 4A41A 3E6DA 1BLZA 2X53S 3OOXA 5FLIA 1XOYA 3POIA 1BXHA 2PTMA 1DHKB 1N1SA 1QOTA 3ZYHA 4X8NA 2DU1A 2VM9A 4Y4RA 4E4DX 4I0AA 1SLTA 2IWGB 1GQPA 1S2KA 1SDDB 4FVVA 1FNZA 4K8RB 1S4CA 2GH8A 4LLOA 2WC2A 3JUUA 1XBFA 4CDXB 1EAH2 4XF3A 4Y1ZA 3RZMA 2XPJA 1W2UA 4OUSA 2WNVA 3B3QE 5I0TA 1GR3A 4Y22A 1YJLA 1AUYA 1PGSA 3MF6A 1M06G 3KV4A 2BTVC 3LFIA 1BMV1 1RUH3 2VQUA 1RUF2 2VOXA 5EHDA 1UOJA 1JYVA 1JS9A 4JV4A 2FHRA 4CXYA 2IVJA 1Q5OA 2VBPA 2XR4A 4BXSV 4PQQA 5GZEA 4PDWB 1XU2A 2C26A 2D43A 2DUPA 4Y26A 3ZYPA 5LA1A 1V6OA 4XETA 5A7OA 1NA1A 2XVLA 1DP0A 1Q8OA 1UX6A 1WA6X 3HNMA 3KV5A 4Q4W1 4A7KA 1ZBA3 4LBMA 3CNAA 4OUMA 1FOD2 4PLNA 2C9AA 1QNWA 1Y43B 2CHHA 2GNDA 4L0PA 3TNQA 4FFHA 3K3NA 5JUVA 3DCQA 3ZPOA 2W39A 3LCPA 3SC7X 3ZXGA 5FZ7A 1Q56A 1RUG1 2C0ZA 3SEPA 2CAVA 1G9AA 3B02A 2D6NA 3CL1A 1DGRA 1YQ5A 4PLMA 1UYZA 3MPPG 2D98A 2XJQA 3TWIA 1S0DA 3IAQA 5I93A 4XXAA 1Q8PA 2XL7A 4CU6A 5LBCA 4CUGA 2JIJA 1TEIA 4RHV2 3ZIXA 1DZTA 2GU9A 1IS5A 2J7MA 1AL21 2RVAA 2VUAA 2YFZA 3LDBA 5D8AA 5FBZA 2J22A 3R4SA 3VGIA 1ZBE2 1N1YA 5F5CA 1DQ5A 2JKXA 4QU2A 1W6NB 3BOWA 3DL3A 1OPMA 2DFCA 2GC1A 2XBO3 4NWWA 5CB7A 2FCVA 1PO12 4O65A 5FLHA 1IKPA 1W2OA 3VZLA 4Z82A 1DLCA 4FP3A 3RI9A 5DDJ2 5A3UA 1JZ7A 2EAAA 2QNKA 1LAJA 1PM4A 2JJ6A 1W0OA 2A73B 5F3GA 4ZKTB 1JI6A 1ODMA 2RMU1 3MBWA 3ZYIB 4IGOA 5CISA 2RJ2A 4JX0A 2WDBA 1PVC3 2VZPA 5JR2A 4ET7A 1S0GA 1RVF2 3J7LA 1IPJA 3LF7A 3P3PA 4HKLA 5FMDA 1K45A 1YQ6A 3S5QA 4ARXA 5BV6A 1DGLA 2V4VA 1OA4A 4E2QA 3TB0A 3BODA 4AFAA 4AWDA 5FP4A 4CEWB 4A3ZA 2FD8A 1ULDA 1VBE1 2OPWA 1H2LA 3AMPA 3GJBA 4I09A 5K8SA 1D0HA 5KC6A 1JZ5A 2WO7A 5FZHA 2RG4A 1CIWA 5FYZA 3SXWA 1W6OA 4ISRA 4AGRA 2RHPA 2XL9A 4KWUA 2KA3A 1LULA 2W1UA 4XF4A 1PVC1 2ZHKA 4RFRB 5KBFA 2VH9A 1JOBA 3UK9A 2QQKA 1OFSA 3K4DA 4W6YA 3ITQA 3G7DA 5ACA3 3BTYA 4XFBA 3CQOA 1TMF2 1VRH2 3DN7A 4J1XA 1C5IA 3AP5A 1OD5A 4J1WA 2HWC2 5FYBA 5BNOC 2R32A 1V6LA 4FP2A 3ZN6A 4HVRA 3PTYA 2VBDA 1NY72 4FTBA 4XBLA 1QHDA 3WVJA 1OUSA 1W9WA 3ZDSA 4C1WA 3DKQA 3DPRA 3AZZA 3DXTA 1I5ZA 3BKZA 1RUJ2 4NVPA 3GF6A 1SMVA 4WZFA 4CP9A 1WKYA 3FLRA 3UESA 5FZ3A 4YWAA 3WLUA 2QCSB 4QX5A 1XYOA 3N3HA 4Q4Y2 4ZXEA 2R061 3CLPA 3WY6A 1POV0 2JG9B 5FPVA 2BBVA 1V9U1 1OKOA 2ZMLA 3I54A 2EIBA 2YV8A 5IJRA 2BFUS 1WLCA 1ZA7A 2CGNA 4IE4A 1WW5A 3UETA 1EV13 1BEV1 2PMWB 3NVCA 1OLRA 4E9KA 3ZMOA 5FIXA 1BBT2 1AYN2 4TTGA 2OPKA 2ZGSA 1WD3A 4CDWC 1LHOA 3O7OA 3LAGA 2R042 3KS7A 1CONA 2PN5A 1ONAA 1HRI3 2EVXA 3GALA 3KD4A 3SLIA 5FZ0A 2RS12 1AJOA 1GLHA 5DDJ3 4BE3A 4DUWA 2RS51 1NUKA 4I0WB 1QXPA 1IG0A 1WW6A 4Y33A 3I3BA 3ZFFB 1NOVA 1UYXA 1GZWA 2Q8EA 1PMHX 4LBJA 4Y3OA 5IVEA 1C57A 5A7NA 5KXDA 1JW6A 1NX9A 1KRIA 4LXLA 4K21A 4COZA 2VE1A 3J8F2 4XDQA 4JGYC 5FXVA 1G8WA 3I3MA 3VBFB 1RMU2 3BVCA 3MFCA 4XC9A 3TOJA 3ES1A 4FPHA 4YG6A 1WUVA 3A21A 3OTFA 5B4NA 3K75B 1XNBA 2WS91 1C28A 4ITCA 4QX3A 3X29B 3GBWA 5K7PA 1O3RA 1LESA 3NMBA 4CU8A 2ET1A 3FZ3A 2GMPA 5FQ0A 2RS31 1HV1A 1LOFA 3O14A 4CCOA 1GNZA 2E33A 4IGPA 4K1YA 3AXDA 3PJYA 1DGWX 2A70A 4GWIA 5T5PA 4XUNA 1QJX1 4V2VA 1G9CA 4A4AA 3POWA 2ZGQA 3OG2A 5F5AA 5K0UC 3WF4A 1IS6A 1EPWA 1LOGA 1RXGA 1W2NA 3NJVA 1FOD3 3RFRA 1WCKA 1LCLA 2JG9C 4P5YA 2FMYA 2GSYA 4XDOA 2KR2A 1H4GA 1UO9A 1YXWA 1UPIA 3MLLA 2A6WA 1I9RA 1NE6A 5FZLA 3JB8A 4RGKA 1JYWA 3CMGA 4CDQA 3NV2A 5K9YA 4AI1A 3R05A 1LJ7A 2HYKA 4ASMB 4FOQA 3NNFA 4IEZA 2ZTNA 2A1XA 2E6VA 2XGXA 3F2ZA 4F8AA 5DABA 1V9U3 1WGPA 2IXJA 2VL4A 2G9FA 1NAEA 3KF5A 3KCXA 5FRAA 4CDXA 1CX4A 4NIIA 4PIYA 2AC1A 3R6SA 4JKKA 4U36A 4DQAA 3VBUA 3IMNA 4NRPA 4AQTA 5CNAA 2E51A 1YNAA 1UIJA 4EYUA 2K2SA 3MFAA 4XW3A 1KJLA 1A78A 2WSVA 4LOTA 1HDKA 3VLBB 3IM0A 4N9IA 3ZFGC 4DB5A 3PUQA 1MS8A 3OGSA 5F5QA 1MS4A 1VP6A 1F9KA 5A3MA 2FDIA 1HXS1 4XJ9A 1IPSA 2JDPA 4EWAA 3TEWA 3CDZB 4GA9A 4I3PA 3A7QA 1XYNA 2XUEA 5FZEA 1SBDA 1IQAA 4AI3A 3QACA 4QHBA 1POV3 3H50A 4QMAA 2Q0AA 1UKGA 4NAMA 5KHJA 2YFUA 4YG3A 4NE9A 3KVBA 2OUJA 5JPNB 3FL7A 4LO7A 5KXCA 3MIEA 3LSEA 2O8OA 3GCWA 3M1HA 3OGVA 4HZFA 2HEVF 3I2GA 3NL1A 3VBSC 1XNTA 4X8PA 4Q4V2 4NWVA 3M3OA 4A6OA 1CJDA 5DG1A 3AKTA 4FPYA 4H14A 3C2UA 4XJ8A 1SBEA 4LA2A 3M4FA 5JMCA 2GNBA 2ZABA 2PAKA 3UJQA 1K3IA 1X8EA 2WYFA 3WDYA 2P6CA 5C8CC 3I2JA 1FMD3 3H3LA 3MIHA 1W8TA 2WS93 2R0FA 2WZ8A 2JX9A 1RUI2 2EICA 3I2FA 4PF1A 5CFDA 3RMYA 4P9XA 4FPJA 4GZ9A 3V64A 5C9AC 5GZCA 2RE9A 4XABA 4N9HA 4DNYA 5JZGC 2O0OA 4TZDA 4MADA 3HQXA 3A4UA 3RJRA 3MPBA 1WA4A 4F3JA 1SCSA 1I3HA 3U14A 1QJY2 1FPN1 2ARXA 2PQQA 1WLTA 4GIQA 2YHJA 2D6KA 1RUNA 1ND3C 3IZOA 5FOJB 2RM23 2VZTA 4N90A 1NLQA 4XDPA 1X82A 5HV0A 5FTTC 1VBD2 4QPGC 5IW0A 4QPYA 1GSLA 1WMFA 4MSVA 5A6YA 2VZSA 2BVBA 4XVHA 1X36A 2HWE3 2Q1ZB 2XQRA 4LK7A 2C5DA 2B39A 3I59B 1Y3TA 5FYSA 3WHTA 2HWD3 1PK6C 5E89A 4CCMA 1AR73 2G4IA 2WIIB 1QQP2 2HBUA 2ARAA 4DY5A 2D5FA 5GLTA 2MNGA 2HWB2 4IDZA 2E7AA 3OYWA 2R063 2VTFA 4XIKA 2FMDA 2VOVA 2Z79A 4IV3A 5I0RA 2QQUA 4FXGB 4NOTA 3H1MA 3N9OA 2QQNA 1LHUA 4LT5A 4XJUA 3K77A 3VDAA 4BMBA 4MGTA 3BCWA 1BEV3 3AVSA 4NMIA 1UWWA 4CCCA 5A1FA 1ND2C 1NQJA 1PO22 2WT1A 4XBNA 1DCSA 3KHBA 5F9TA 1IS3A 1H30A 5I0UA 1SPPA 2WZEA 3UGFA 4C0HA 3ACFA 1ZBA1 5I8YA 3AL6A 1NXMA 1RHI2 2HWF2 1PM7A 4Q4X1 4R9AA 2ERFA 4KG8A 4OCTA 2GN7A 4W50A 1RINA 5IVVA 3HN3A 1LOCA 2RV9A 3VBOA 3CO2A 1LOEA 1JYIA 4HL0A 3FFZA 2QKDA 4AW7A 2XG3A 2XONA 3I7DA 4HETA 1VBC3 2A3WA 5DAPA 3HN1A 3N4MA 4MXWA 5C5UA 4WM7A 1JBCA 1KS5A 1O4TA 1NCQB 1JN2P 1QF3A 1XNAA 2C24A 2QZ3A 3DECA 3M8LA 3OSDA 1YLLA 2VMGA 1YFXA 4XAAA 3AVRA 1EPZA 4KH9A 2Z5WA 1ZZ6A 2ZGKA 5KXEA 5EPAA 4BXFA 3WNOA 1OURA 1DLLA 1F4AA 3OY8A 3ZN5A 1MACA 4Q8LA 2X05A 5CFCC 1ENXA 4YVSB 5A7WB 2NYYA 4Q0SA 3ZFEC 2VZQA 3KCCA 4LITA 4IE7A 4Y5TA 5C9AA 4IW3A 4JDNA 5AC91 2E63A 2ADEA 4MZUA 4S2DA 5FWEA 4AFBA 3S7IA 1VBA3 1CAVA 3LPGA 1HQWA 3HMYA 1LRHA 1UMHA 1K12A 3UT0A 1NE4A 1GV9A 3B00A 4GALA 4UAPA 4XURA 3VZMA 4A3XA 3NQHA 3P1IA 4Q26A 2QQIA 4B4RA 5FY8A 1H2KA 1LGBA 4Y22B 1SZBA 2WWSA 2EIDA 1Q8SA 3VHPA 1GBGA 3AYEA 1O5UA 2CU5A 1Z0HA 4QHOA 3WQ0A 5F37A 2WL1A 1YJKA 5F6KA 4XZPA 2O1QA 2QQLA 5FO7B 3I8TA 1TME2 5HBAA 1ACCA 4AFCA 2UY9A 1OLQA 4P9WA 1GFF2 5FY5A 4JTNA 2WINB 2JIGA 3EYPA 2D6PA 3WNKA 4CCNA 1A6CA 3ON7A 3ZSMA 3VD4A 2IXHA 2ZGUA 3LEKA 3M7AA 1NXD1 2Q1FA 4K1ZA 4QGLA 1VLNA 2YB7A 5CZKA 4F83A 2NMOA 4BZ4A 1PMJX 4OHZA 3QD6A 2WYSA 3RPQA 3URFA 1HQNA 2VD7A 2DCZA 4RA0A 5FP7A 1OH4A 3D82A 1NYWA 4PI0A 2NLRA 1AXYA 3AKPA 1X8MA 1GQHA 2ZBJA 5IAVA 1RUH1 3IKWA 1W8OA 5AVAA 4EE2A 1MS5A 2YU2A 3TRSB 1PGL2 4XQDA 1RUG3 1SCRA 4M0NA 2YGMA 1DDLA 1QGLA 1XNCA 2JE7A 4MO3M 1UOFA 5ANNA 5A6QA 4HSLA 1K5MB 5J98B 2W08A 1PZ7A 1COV3 4LBKA 1KQRA 2ZACA 4M3CE 1LOFC 4UFJA 1E5HA 3DPRC 4MLOA 5FPAA 3INAA 2BWCA 2RR12 3WG3A 2Q30A 3ELNA 4JGYB 4LBNA 5JXIA 3MICA 2D44A 3JXSA 1Y7BA 3AMQA 1OFNA 4BQ2A 3LA7A 1CN1A 3P3NA 1W6MA 2JENA 3PVEA 1HRI1 1H8VA 1URXA 1VMHA 4BM8A 2ID4A 4FPFA 5FMOS 4HXCA 1XNKA 4YVWA 3BTXA 4I2OA 2DCJA 5BPXA 1XYPA 1EY2A 5J37A 4HVOA 2WFF1 1UU5A 1ULEA 4FO9A 3T0BA 4BQ5A 3IIAA 4WM7B 5IYYA 5GZGA 2R072 5AVPA 2A6ZA 5BNQA 3VBRC 1WD4A 4WVMB 3VKMA 3C7EA 3MDPA 2DDUA 3DEMA 4I30A 1OMIA 3UNPA 1VBA2 3DUIA 2DFBA 2NPIA 5B2GB 5FJKA 1VE0A 1A8MA 4EN7B 2VW0A 4HPKB 1O3TA 5HPOA 2XJPA 3BGAA 4XFFA 2CWMA 1S1AA 3NAPA 1TG7A 2PAMA 4NPMA 2DVAA 1DFQA 3SH5A 3WUDA 4QX1A 5ACA1 5CFDB 4ORFA 1AR92 1CR7A 4LUKA 4EQVA 4GB33 2OZ6A 3N9PA 5F2SA 2ZOEB 4COVA 1JTZX 3IN9A 5FK7A 1SLAA 5FY9A 2XDVA 5J1XA 2P5BA 1CAWA 2I45A 1PO13 2GNTA 2JG8C 2WWJA 3H0OA 5F39A 4AF9A 5F6LB 5D21A 3PMSA 3FHQA 4WZCA 1MS0A 1U5YA 2W87A 3K4AA 3HJRA 4N53C 5GLZA 4DRRA 5J3UA 3VBFA
chains in the Genus database with same CATH topology
3E5UA 5LEJA 3AK0A 4X6QB 3WCRA 3MZHA 1RJ7A 3KQRA 1APNA 1PGW2 4PBOA 1VBB2 3ZMNA 4YGDA 4EN0A 1AX2A 3OF1A 1QJZA 4XJZA 4OI0A 1RC6A 4IERA 4AVBA 1H9WA 3VZJA 1RITA 4G9SB 4RQPB 4PLOA 1POV1 3WX5A 3V65A 1LR5A 4HLTA 4EJRA 2XKPA 5JSPA 1D4M2 2R0HA 1H9PA 2CY6A 4KGQA 4MXWB 2JEMA 1WBLA 3WQ7A 1YCIA 5J96B 1PZ8A 1QQP3 3UKVA 2XLGA 5DXDA 1YWKA 3IPVB 1CD3G 2YDEA 4XBQA 2GZWA 3NWKA 4URTA 5BUVA 2R1DA 1LHNA 1LTEA 2QFEA 4IEPA 4JC1A 3WCSA 1NZCA 2RM22 2UYAA 1XU1A 4D3WA 4I3GA 3QBQA 3D0SA 4JGZC 1S0IA 2YZ4A 4PIXA 4FPOB 4RGAA 1JUIA 4NHKA 5I0SA 4Q4W3 2ZX3A 4PQ9A 3Q9OA 5GJ6A 2NMNA 2HWD1 3TN91 5BNNC 4DXZA 1LU1A 5T55A 3AKQA 1RUD1 3VKLA 2BUKA 2GC2A 3T1LA 2JICA 3GNEA 1AYN3 1RUE3 4YVWC 4D7TA 4KQ7A 1EV12 3M3IA 1MZ6A 4N43B 1LENA 4FPEA 3E97A 4ATFA 3SISA 1AR82 2AREA 2HWF3 1XE7A 2GAUA 1OA2A 4LLFA 2A3YA 1UU6A 4SBVA 1W6QA 4CDQC 1BQPA 3NAPB 4XQWA 3MW2A 3RRDA 5K0UB 1UF2C 2A6VA 5A32B 2QDNA 4LULA 1D0GA 4Y20A 5DUWA 1OPOA 3ZIWA 3ZFGA 1DZQA 4J6GA 4YZ2A 3WQ1A 1NCQC 3RDIA 3VDDA 3VBSA 4ES9A 5C4WA 1R092 3WT3A 2VUJA 3VBUC 4OFGA 3D0JA 4P9LA 4AK3A 1RB8G 3FX3A 5BNOB 3POSA 4YW2A 1AR61 3RZZA 1JOJA 1UIKA 2YROA 2WZR1 2QUOA 3WG4A 2A75A 5SV5A 4RS5A 1MR5A 2B5HA 4YW5A 2VOWA 3DPRB 1H8TA 2EIGA 3JQXA 3M2MA 1F5FA 1XE8A 4QXKA 2B45X 4IL7A 4JRAA 4LO4B 2ZMKA 4PDWC 1QNYA 4XF9A 3S6PA 2OZJA 2W68A 3KCYA 4INDA 1EAH1 5BNPC 3U10A 4UW3A 2ARBA 4XILA 3PVOA 2RR13 3FWEA 4YFWA 5DG2A 4CDWA 3M70A 3FE5A 1LOBA 3SMHA 2DVBA 3ZSKA 2EXIA 2YPJA 4JTOA 2B9UA 1BMV2 3A0KA 1CQ9A 3APBA 5EXOA 4ZU5A 4OHWA 3N7LA 1M4WA 3O0XA 1QH7A 5GALA 3U4XA 3ACLA 3SHRA 1QKQA 3E5QA 4IEWA 1ZNPA 2DCKA 3NW4A 2PHWA 1IKQA 5LRRA 5KC5A 4CYDA 1FOD1 1PMIA 3CU7A 1U5ZA 4XMIA 3BIWE 1C8M1 4HN0A 3ZO0B 3OD0A 2D6MA 3JB4C 2BYVE 2CNAA 4H7LA 1DQ2A 2ZGRA 2Y38A 4Y1YA 4ATEA 1RUG2 1LEDA 1FMD1 5L7OB 4AHWA 1S0BA 1J3QA 2C1FA 4XHBA 4AFMA 4HPKA 2E7TA 1QXRA 2R16A 5JVVA 4Y5Z0 1OA3A 3AX4A 1CAXB 2K0GA 1MZFA 2VMIA 4RHV1 1W0PA 5GLUA 1Z7S2 4CDUA 2Z2SB 4S2HA 5BXXA 5JCTA 2VGDA 4LE4A 2WA3A 4C91A 3V56A 3AP9A 1J1LA 5EFUA 2BPA2 2XJUA 2DV9A 1NLSA 2E53A 3ZXDA 1VIWB 4H55A 4H7MA 3MEPA 1RUC3 2ZHLA 3V0BA 3S30A 1AYM1 3ALQA 4JDMA 1HQLA 3VZNA 5C8WA 5LRSA 5FPZA 4ZXKA 1GANA 4LHLA 3WP5A 4WM7C 3SCGA 1CESA 3JBG1 4B29A 3AZXA 4IESA 3BALA 4YLZA 4M01A 1NCQA 2ZX4A 3ZYRA 1PZ9A 1RUD3 1ZZCA 4K3UA 3ATGA 3HT1A 4GH4C 1YUDA 1OI6A 4GB31 3POYA 4K6BA 4AXOA 3AYDA 4K8FA 4QGMA 4OHYA 2ZGTA 2QVSB 2H0VA 5F1RA 1B35C 5E8AA 2DURA 1PVC2 3ZYJB 2WNEA 4HKWA 4XFAA 3JBG3 5AC93 2KXLA 1BYHA 3I2DA 1TMF1 2PFWA 4IEVA 2HWC1 5J7MA 2FQPA 3NJZA 2XJTA 3WDUA 2DTYA 3MIBA 5CFDC 4IXLA 3SCFA 1S0EA 2D3RA 4META 1SDWA 4FXKB 3H1YA 3VBHA 2JDZA 1SQ4A 2MEV2 4QD2A 4AEKA 4D69A 2PHDA 1QH6A 1DZRA 1HV0A 2VNOA 4IV3C 2R062 2TBVA 2P17A 3B9CA 4LE3A 1ND3B 1UN1A 1V6NA 1V9U2 2DYCA 1AJKA 4R9CA 1BEV2 5FPXA 3JU9A 1BBT1 1MEC3 1DQ0A 2VY0A 3W58A 1AXZA 5JOZA 2EXKA 3U07A 2R041 1D4M3 1FT9A 2JXAA 2GMMA 2RS11 2RS53 2RS52 3IT8A 3AMNA 4CTEA 1JUHA 3AP7A 3ME2A 2UWAA 4MXVA 3J8F1 4QPIB 4SLIA 4FAGA 1J1TA 1RMU1 1EP0A 2XVGA 1WW7A 1ZZBA 4TLFA 5D1IA 1RUF3 4UBGA 3L2HA 4Y20B 4YYOA 4BMEA 2WS92 4A7YA 3KT1A 1YIFA 1K5MA 1RGSA 2GMEA 3AM2A 5T50A 4XIOA 2B8MA 3USSA 4YARA 1RTVA 4ES8A 5HCAA 1WMDA 2RS32 3GZUC 2WQ4A 2WNVC 2VG9A 1CAUA 4AQ2A 4XFCA 5CU1A 4IEYA 4PIZA 1QJX2 1IGOA 1X50A 4HSJA 1HLCA 1Z78A 3J8F3 4AEDC 4RGGA 1PK6A 1FV3A 5ABJC 1SLBA 2B46X 3EJKA 3H3ZA 3GZTB 5BNNB 4O9EA 1IPKA 3J4UH 1AR93 3LWCA 5JI7A 1H2NA 4YM2A 3AMHA 1COV2 4YVWB 4JGZB 1R1A3 2PHTA 3OCPA 2BNOA 4P9YA 4S2FA 5CVRA 4AVSA 3WG2A 3WZ1A 3R4DB 2R043 1B09A 1KFXL 3K48A 4QQOA 3THTA 1SLIA 4AVTA 2ZA9A 1HX6A 1QWRA 4RHV3 3SH3A 4GMP3 4Y1VA 4B4PA 2ZX1A 1ASJ3 1J3RA 2WNUA 3IPVA 3NAPC 2IXKA 4R52A 2ZPXA 3IBMA 2X8KA 3S0MA 1YI7A 1R1A1 1HXS2 4E4SA 1MS1A 5HI0A 1UZZA 1U12A 1FAYA 2Z69A 1AX1A 5EYYA 1LB2A 1MS3A 2XBO1 1F5JA 1WBFA 4KL1A 1QY4A 4AFDA 2BW8A 1MVQA 4CEYB 2H6BA 2PLV1 2DTWA 1Q3EA 1DIWA 2D3PA 2P3IA 3AJYA 1OOPA 2TNFA 3OBTA 4P9JA 3RJ2X 3H7JA 5FQ0B 3U0ZA 4RSUA 5DZFA 1WMEA 5CAZA 4XJAA 3JCIA 5JPMB 2P34A 2R073 3VL9A 4FQ4A 2LALA 3ILRA 3PVNA 1R082 4KG0A 4AEJA 4UW6A 1RUI1 1HKDA 1AR63 1EAH3 1YO8A 3VDDC 4M3CF 5I91A 1NCRC 4HVQA 1K5MC 2PLV3 1CPNA 3KGZA 2D40A 1ZM1A 4ONUA 1PIV2 2NN8A 2RMU3 1SLCA 3OY8B 2AUYA 5H9QA 4U2AA 2DUOA 4BLJA 1VBD1 1BVVA 3M3QA 1WCDJ 1RUOA 1ZBE3 4KGGA 3QH7A 1N3QA 5H9SA 4ZU4A 2XJVA 3AXEA 1YI9A 1GYKA 2AH2A 5FAXA 4XFHA 1DGRN 2Q4SA 5KHKA 2F6BA 1MQTA 1PIV3 5BNOA 2HWB1 3CJIC 3LOBA 4IV1B 5FCCA 4AHZA 1V6IA 1IZ3A 5JR7B 2ZAHA 1B35B 1PO23 2SBAA 4AI0A 4WM8B 1GZCA 3RYPA 4B7KA 2BVVA 2HKXA 2WLQA 1Q43A 3VKFC 4YSFA 4UW5A 5IK8A 5BNNA 5AFEA 3ZXFA 1ZBA2 1RHI1 3RMXA 2HWF1 4Q4X2 3O5SA 4JGYA 4YW1A 1XRUA 3EXUA 4ZU7A 4IEQA 5KXBA 4CRQA 5JZGB 4L11A 1KXGA 2I2SA 3TBDA 1N1TA 2XWJB 3H3UA 2HWE2 1N47A 1QOOA 5C4WC 2IFWA 1C3HA 2UWBA 2XUMA 3N35A 5JZGA 4K40A 1DG6A 1QOSA 1IS4A 1MZ5A 5ABJB 2A6XA 5JOXA 2CV6A 2EF6A 1WCSA 4YVSC 3WNXA 4QPGB 4XXPA 5L73A 1BJQA 2K9ZA 3ILNA 2Q5TA 4BH9A 1E57A 4A7ZA 3ZVXA 4N43C 2O8QA 3SITA 2CYFA 1KS4A 4Y24A 3I4IA 3KSCA 4OZXA 3VBSB 3IDBB 2BWAA 2EXJA 3SH4A 5AC92 1A3KA 1RUC1 4K20A 4GKYA 5I8TA 4LUMA 2ZZJA 3GHMA 4W6XA 1RUE2 4B3NA 4BLIA 5SV8A 5IK4A 2BFUL 3FUQA 1AR71 4MUVA 1QXJA 4N53A 1Q8QA 3KT7A 1VAMA 4IEXA 1ULFA 3A0NA 2P3KA 3RYKA 1ND2B 3ST7A 1OOPC 3JZVA 2GALA 1D4VB 1SACA 4FCAA 4BIOA 2PYTA 4R9DA 4YZ3A 1ZRFA 4FPKA 5T52A 3AZYA 4DS0A 1QMJA 2WNVB 2VW2A 1TME1 1CGPA 4Q29A 1NA1C 4AI8A 1VAKA 3MLKA 4P5HA 5BNPA 4BA6A 1TE1B 2Y0OA 1RL3A 4NO4A 3ETQA 1C8M3 2IZWA 5C8CA 4IV3B 4COWA 1QJY3 2WT0A 5EWSA 2AYHA 4Q0QA 1QDCA 1UKRA 2VQ0A 3AZWA 4E2SA 1PK6B 1QDOA 5CFCB 1DU3D 1FNYA 4CDUC 4Y1XA 1I1EA 2WQZC 4D7SA 1Z7S3 3ZXJA 2N7GA 3RG0A 3BPZA 3H9AA 3WDVA 1WLDA 2ZS6B 1UCXA 3OJBA 4BYYA 1HIXA 1HRV2 1V70A 4AHYA 4XTMA 3PJQA 3E5XA 4MYEA 1C5HA 2RJKA 3NV1A 1VBC2 5KWRA 2P2KA 4L8QA 2RR11 3CF6E 1MEC2 4XFGA 4Q0PA 4XQ4A 3PNAA 3V0AA 3LOIA 4YGEA 1OOPB 4ISQA 4M00A 1U5IA 4DOUA 1TNFA 2H0BA 4L2NA 2NM1A 3RNSA 3N7KA 1FPN3 3QOPA 5IT6A 3HAGA 1SFNA 2B42B 4YFZA 1RUI3 4WVZA 1NA1B 3B01A 2X5IA 2TUNA 2WFF2 5KXCA 2UWCA 5FDBA 4HANA 2ZAAA 1H1AA 3KMHA 2DWRA 5GKAC 1VB2A 2EXHA 5E1RA 3UJOA 4FSJA 2JG8B 2A3XA 4V1PA 1ZVFA 1O3QA 1F31A 2YXSA 3VL8A 2JKBA 1VBA1 1LEMA 3VDDB 4AG4A 3MYXA 1O4YA 3PHMA 4IV1A 1UZYA 4NR1A 1A8DA 1VRH3 5JOYA 1QJX3 5ACA2 3PVBB 1SEFA 1AR91 2DUQA 2QDRA 4L92A 1CJPA 1ASJ1 1O91A 4OHXA 1AVBA 2KM2A 1FV2A 1DQ4A 1NG0A 4OLLA 4Y1UA 2FBEA 1W6MB 1QJU2 1OSGA 4WVWA 4B8EA 2QE3A 3GYDA 4MV2A 5H9PA 3T2TA 4COUA 4C90A 5T54A 3EBRA 2XB6C 2R30A 3GZAA 4EROA 2A5ZA 4JDOA 3JD71 1BZWA 2QJVA 2UY8A 4XPVA 5C33A 3ZXKA 2H6CA 1SBFA 5GZFA 4AEMA 4IV1C 1UL9A 4WVMA 2ET7A 1PGW1 4KBBA 3B5LB 4WV8A 2VVDA 1LU2A 3RQ0A 3JQWA 4JAAA 5T5OA 1C1FA 2R1BA 4N43A 4R9BA 1ZZ7A 3KGLA 3MGUA 5E16A 2PHRA 2ZX0A 3ZSEA 5CADA 2YMZA 3AYAA 5JIUA 1D4M1 1AF9A 3N36A 5IUQA 1TQ5A 2XJRA 3HBZA 5CIRA 3FLTA 4JGZA 3FC0A 3ZSJA 4AYUA 1ND3A 5CFCA 1KITA 4LNVA 3UKNA 1RUF1 3AZVA 3RWNA 4BHPA 1UMZA 2DF7A 4P14A 4UW4A 5CG9A 4DFSA 3N7MA 1DBNA 2YYOA 4HT1T 4Q4W2 5DUUA 1UPSA 4Z1VA 1JH5A 1H2MA 3VBHC 4QM9A 4YGCA 5DUVA 3V0AB 3KB5A 3WOGA 3ZN4A 1KDKA 4KWLA 4FPGA 3NV4A 1H8TB 2HWB3 2ZZQA 4IEOA 1VR3A 1XQNA 3HIFA 2D93A 4D7YA 1DYPA 3UKTA 3VUOA 1ND2A 2HWD2 4XOGA 5IK5A 5JWPA 1D2QA 3AB0A 4GWMA 1RUD2 2VULA 3VBRB 1IHMA 2YC0A 4XTPA 1AL22 2IXLA 2X5IB 1PHMA 4QPIC 1WLWA 3AFGA 2IXIA 1ZBE1 1EV11 1EYBA 2ZX2A 5I8SA 5TSWA 2PELA 3WXPA 4RQPA 5EYXA 1PO11 1S2BA 1XNDA 1YRZA 4GXLA 3SCHA 3USUB 2QQPA 3LA3A 2VVFA 5DDJ1 3VZKA 3VBOC 2I07B 1S0FA 3AP6A 5GZDA 3QH6A 2RMU2 2PHUA 3VBUB 4FPLA 4FQZA 1RVF1 1CPMA 3MW4A 4MGYE 1MVEA 2SLIA 3WDTA 1C4RA 4XJWA 1J58A 4JCKA 2UYBA 2TEPA 4GWNA 1WW4A 1YFWA 5GM0A 3ZFFA 4LBQA 2NP0A 1VBE2 4GKXA 1AR62 4DPNA 4EN8B 2BGCA 1YFYA 1OHFA 4AVVA 2WZR3 2LTNA 3B69A 2WZR2 1GICA 4IQPA 4Q4Y3 4PF5A 4NHMA 4COYA 5J48A 2JG8A 3E6BA 3OGJA 2UU8A 4RD7A 1J59A 2GN3A 4HMZA 1VRH1 4CP2A 3ZSLA 4MGKE 4CP1A 2CGOA 1G86A 4FOYA 4CP0A 1NY71 5K0UA 4FOWA 4MVTA 4XF1A 2CL2A 2NZ9A 1RUJ1 4DRVA 1J3PA 4DINB 3V0BB 2WNUC 1ZX5A 3EO6A 2CTVA 1LGNA 4LBQD 4YZ5A 4HBNA 4Q4Y1 1U0AA 2R49A 5FREA 1G9FA 1ZYBA 3ES4A 4OULA 1MQTC 4XE9A 3WDXA 4RR3A 1W6PA 3TN93 4E27A 2VXRA 4GULA 4HK8A 1AYN1 3FFQA 4P9GA 3ILFA 2BEOA 4QQLA 4NN0A 1YYNA 2BNNA 2FZ1A 5LEKA 3AYCA 1C8M2 2YY1A 1YFUA 3MIDA 4CEWA 4PDWA 3W59A 1FMD2 1RIRA 1KFUL 1Q8VA 3H8UA 2VECA 4QGNA 2ZGOA 1HRV3 1YIPA 4OI2A 4E4ZA 1CAUB 5EZWA 5A32A 3ASIA 1W6NA 4RS5C 2DVFA 3L2YA 1RMU3 1ZRCA 1Z7S1 3HR9A 4X6RB 2ZMNA 3VBHB 4L9BA 1R093 1X33A 5JIAA 2XLFA 3WW3A 3ZFFC 2OA2A 4BPZA 1C8NA 1AXKA 2D3SA 1ENQA 4TSVA 3QLQA 5BY5A 4TYSA 1VB4A 5ABJA 3CEWA 1I6XA 4GH4B 1AYM3 1RHI3 4JQRA 3GBFA 1AYM2 2R6QA 3WUCA 4CZSA 5CG8A 4RR3C 3VKNA 5DZEA 5A3LA 1V00A 1REFA 4JVAA 3LZZA 2XKOA 1AZDA 3S7EA 3NKTA 3JBG2 4YRDA 3CJXA 4HKOA 2HWC3 2YGLA 3WW1A 4BIFA 2ZHNA 4LO5B 1W6QB 4AEDA 3FHIB 4G4FA 4Q2FA 4FTEA 1LOAA 3WD5A 3VHRA 5FMOL 3W9AA 1CAXA 4C0BA 2ENRA 2AENA 1X7NA 3WDWA 4BWOA 4QPIA 4GB32 4GMP1 5C4WB 3EQEA 3RSJA 1ULCA 2ETEA 1C1LA 2HJIA 3BTAA 4FOVA 1AHSA 1O7FA 2ZKLA 1REEA 4O9GA 3ENRA 3D8CA 2JE9A 3U11A 1FX5A 4MH0E 4LO8A 5JLVA 2GH2A 4YG0A 1DQ6A 3WG1A 4CDUB 4K7JA 2IFRA 2WKKA 4Q4V1 5L19A 2MEV1 4YZ4A 4YW3A 2XWBB 1ENSA 2IXCA 1FATA 4M3CA 2V09A 5L7OA 1CVNA 3MI8A 3R4UA 4Q1RA 4AQSA 4YM3A 1Y9QA 5AFBA 5C6CA 4XMAA 4XF0A 2WSUA 1SFYA 1BKZA 4QQHA 2QZ2A 3VHOA 4CDQB 1O5LA 3LGRA 1QJY1 4R8HA 1FPN2 4FPCA 4B4QA 4XHXA 5L7OC 3WV6A 2A71A 2LUWA 4OI1A 3TNPB 5LK5A 1MQTB 3BU7A 4YM1A 4YVSA 3USUA 3ZXLA 3WW4A 4R4XA 4F7ZA 2YUEA 4WM8C 2D6OX 3ZX7A 3L9JT 3O0WA 4YZ1A 4DZGA 3C3VA 1ENRA 1NCRB 4EWEA 4FAHA 3B93A 1ULGA 1N3PA 1L3JA 4FBFA 1QQP1 3OPZA 1VJ2A 1DF0A 3EHKA 4HK9A 1VBD3 1KJRA 4N7UA 5D8AC 2W0XA 1NLRA 4RFT0 5FO9B 1V6MA 5CA6A 4JRLA 1PO21 2AR6A 4AGGA 1H1MA 1SLLA 5DZGA 1TMF3 2Q1MA 3MIFA 2VQAA 3AMMA 2PHLA 1ZZ8A 2UURA 1VBB3 1JYCA 4KWKA 4WM8A 4CEWC 2X5IC 1COV1 4N7IA 4EV0A 2LM3A 4KU7A 5JSRA 4YNIA 4L99A 2GDFA 4YM0A 1QU0A 4ASLA 4BOWA 1AL23 1OQEA 5T3NA 4AVAA 1F8VA 4AGVA 4LHKA 1VAVA 2ZCWA 3K51A 3FBYA 3HWJA 4AI2A 5EV7A 3WHUA 1QJU3 1S0JA 3VN4A 4W6WA 1O3SA 2PHFA 4QT6A 2RJLA 4Q27A 1R1A2 2I74A 4L97A 5IK7A 3O0VA 3IDEA 1W6PB 1FXZA 1ZREA 3VHNA 2P3JA 4YGBA 4CDXC 4QPGA 4GH4A 3LB9A 4FT8A 1ZA4A 2XBO2 2WA4A 4I01A 1N1VA 3VKOA 4LBOA 3WW2A 5FFOC 4C1XA 2BQPA 2PLV2 2BNMA 4YW4A 1GNHA 2V5YA 2D7FA 2PAEA 3OYWB 4RL7A 3J9SA 1W6OB 2EAKA 3J26N 5H9RA 2G9GA 1S0CA 4RS5B 1N3OA 4B7EA 4CDWB 2PA7A 2WFPA 1OQDA 4N53B 3LKJA 5CBLA 1R081 2ES3A 2IC1A 3LSDA 1S55A 1BK1A 1UAIA 3DF0A 2XLAA 4XFIA 1U5XA 4FTSA 4LA3A 4XEZA 2AZ5A 1RUJ3 3BB6A 2JECA 1HW5A 3KZ4C 3OBRA 3MF9A 1H8TC 4Y4YA 3FMGA 3ZPYA 3BOPA 1PIV1 1OQ1A 4I02A 4P9IA 1W39A 1LHVA 2EA7A 2E7QA 3VZOA 4Z8BA 4GQ7A 2VPVA 3WP4A 1RUH2 4LBLA 3LA2A 5A33A 2VMHA 3AP4A 1H1IA 1PGL1 1AR83 1G6NA 5HCBA 4HN1A 1XXNA 2HEWF 1IOAA 5KHIA 3D5OA 4LHNA 1LHWA 2XVKA 4LTAA 4S2GA 1G9BA 3M3CA 2Q8OA 4K9SA 1REDA 2MEV3 4AEDB 5LK7B 3D4KA 4CEYA 2DVDA 2DCTA 1PNGA 2EALA 2DVGA 1ZRDA 4G3YC 4KNCA 3NKGA 1BVP1 1LODA 5JOWA 2OYZA 4NPRA 1HRI2 2VOKA 4R4ZA 1CAWB 2ZGMA 1G9DA 2V73A 3KT4A 1JHNA 3OGGA 4Z07A 3WINE 4D94A 3ZYGA 1LGCA 2CWSA 2GC0A 5BNPB 2RS13 2ZKNA 2JG9A 2Z42A 1AX0A 4UXAA 5JDBA 4Z92B 3MLJA 2WFF3 2HWE1 4Q1PA 1ALYA 5DUXA 3AKSA 2R071 1DQ1A 5EJ3A 2OIIA 4MGZE 1RJ8A 3ZXAC 2D6LX 1VBE3 3ZFGB 2VW1A 4RR3B 1T6GC 5FOBB 2FZ2A 2JD4A 1FYUA 1GZ9A 3R0RA 3DGTA 3H1WA 4EWDA 1DYKA 2ATFA 4M3CB 3ROUA 1ZRRA 3B9IA 1GZWB 1CAVB 2E9QA 2A7AA 3MW3A 2W52A 2WNUB 1TME3 1PNFA 5FO8B 1RUC2 3E6CC 1R1ZA 4HFSA 2XJSA 1RUE1 3NV3A 4NHLA 4PCRA 1H0BA 1AR72 4LBQB 3RS6A 2ZGPA 3NO8A 4LEJA 3O12A 3AJZA 3FBMA 3ZFEA 5C9AB 1B35A 1H4HA 3WP6A 2MPFA 3FLPA 1ZZ9A 1FI2A 5HXVA 5JSOA 5E88A 1TNRA 2WLPA 3ZFEB 4PBPA 1RVF3 5GLVA 3FJSA 1VBB1 2ZGLA 2AGSA 1NCRA 2A6YA 3GBGA 3HD8B 3PMEA 4Q0UA 3B7MA 5KHGA 5BYNA 4QQPA 2GC3A 2WT2A 2ZGNA 3IDCB 4Z2WA 4AE2A 4M0HA 1D2SA 2XHKA 3RYRA 4QM8A 3VBFC 1GKBA 4RQPC 3SNMA 4MGIE 4WBBA 2DCYA 2OUHA 2Y0IA 3AKRA 3OD4A 2ZHMA 2P37A 1YHFA 4E2GA 5A33B 4KWJA 2OVUA 4LO6B 4Q0VA 4EN6B 1OKQA 3CJIB 4EN9B 4Q4V3 2WJSA 5FLJA 4IETA 2XH6A 3ZXEA 2RS33 1HRV1 3PLQA 3ZN6B 1PVXA 2CGPA 4Q8KA 4QQ2A 3CJIA 1VBC1 2RM21 3N7JA 1UD1A 2MHFA 5JAXA 4XYXA 3G6JB 2DU0A 1BBT3 1MEC1 3THPA 2OW4A 3B94A 2PHXA 3NSTA 1LKNA 1V6JA 3DV8A 4CEYC 1G7YA 1KDMA 2VNRA 4W65A 2Y26A 4BCUA 3HT2A 1GQGA 4LR4A 5T5LA 3I59A 1AL0G 3WP3A 4BQ1A 3M3EA 3UL2A 1R083 2WZPP 1JXNA 3TN92 3VBOB 1VALA 4PJYA 4OHVA 4TWTA 4MX3A 3T1MA 5J36A 3UV9A 5D8AB 1F2NA 3ECQA 2F4PA 4H3WA 1UW8A 1BCXA 4IEUA 5J09A 1DGWA 1NQDA 2GNMA 4WVVA 3GHNA 1V6KA 2VVEA 3VBRA 1KD7A 5KHHA 1AR81 5HCFA 4Q4X3 1LECA 5L36A 2VU9A 3MIGA 2D5HA 3TAYA 1MS9A 1O4ZA 2NQYA 3KM5A 4AVCA 2B7YA 4AHXA 3H7YA 1HXS3 4A2UA 4AQ6A 4DY3A 1ASJ2 2CAUA 3RI8A 3VV1A 2X29A 1R091 1QJU1 4KU8A 3TYJA 3DKWA 4I0BA 4OVEA 3QCWA 4UBHA 4OI4A 1UU4A 3D6EA 3KLSA 3IWZA 5C8CB 2D97A 3JD73 1MZEA 3JD72 2VNGA 5JI9A 2ZJCA 5T5JA 2ILMA 5GLWA 3WR0A 3AFKA 2HEYF 3FUOA 4GMP0 3E6DA 5FLIA 2X53S 1BXHA 2PTMA 1DHKB 1N1SA 1QOTA 4X8NA 2DU1A 4E4DX 4I0AA 1SLTA 2IWGB 1S2KA 4FVVA 1FNZA 2GH8A 4LLOA 2WC2A 3JUUA 4CDXB 1EAH2 4XF3A 4Y1ZA 2XPJA 1W2UA 4OUSA 2WNVA 3B3QE 5I0TA 1GR3A 4Y22A 1YJLA 1AUYA 1PGSA 3MF6A 1M06G 2BTVC 1BMV1 1RUH3 1RUF2 2VOXA 4JV4A 2FHRA 1Q5OA 5GZEA 4PDWB 1XU2A 2D43A 2DUPA 4Y26A 3ZYPA 1V6OA 4XETA 2XVLA 1NA1A 1Q8OA 4Q4W1 1UX6A 4A7KA 4DMIA 1ZBA3 4LBMA 3CNAA 4OUMA 1FOD2 4PLNA 2C9AA 1QNWA 1Y43B 2GNDA 3TNQA 2W39A 3LCPA 3ZXGA 1Q56A 1RUG1 2C0ZA 2CAVA 1G9AA 3B02A 2D6NA 3CL1A 1DGRA 4PLMA 3MPPG 2D98A 2XJQA 3TWIA 1S0DA 5I93A 4XXAA 1Q8PA 2XL7A 1TEIA 4RHV2 3ZIXA 1DZTA 2GU9A 1IS5A 2VUAA 1AL21 5D8AA 5FBZA 3R4SA 3VGIA 1ZBE2 1N1YA 1DQ5A 4QU2A 1W6NB 3BOWA 3DL3A 1OPMA 2DFCA 2GC1A 2XBO3 4NWWA 5CB7A 1PO12 5FLHA 1IKPA 3VZLA 4Z82A 4FP3A 3RI9A 5DDJ2 2EAAA 2QNKA 2JJ6A 1W0OA 2A73B 4ZKTB 2RMU1 3ZYIB 1PVC3 1S0GA 1RVF2 1IPJA 3P3PA 4HKLA 5BV6A 1DGLA 1OA4A 4E2QA 3TB0A 3BODA 4AFAA 4AWDA 4CEWB 1ULDA 1VBE1 1H2LA 3AMPA 5K8SA 4I09A 5KC6A 1D0HA 1CIWA 3SXWA 1W6OA 4ISRA 4AGRA 2RHPA 2XL9A 2KA3A 1LULA 4XF4A 5KBFA 1PVC1 2ZHKA 2VH9A 3UK9A 1OFSA 4W6YA 3G7DA 5ACA3 4XFBA 1TMF2 1VRH2 3DN7A 4J1XA 1C5IA 3AP5A 1OD5A 4J1WA 2HWC2 5BNOC 2R32A 1V6LA