2VVFA

Crystal structure of the major capsid protein p2 from bacteriophage pm2
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
269
structure length
269
Chain Sequence
b'MRSFLNLNSIPNVAAGNSCSIKLPIGQTYEVIDLRYSGVTPSQIKNVRVELDGRLLSTYKTLNDLILENTRHKRKIKAGVVSFHFVRPEMKGVNVTDLVQQRMFALGTVGLTTCEIKFDIDEAAAGPKLSAIAQKSVGTAPSWLTMRRNFFKQLNNGTTEIADLPRPVGYRIAAIHIKAAGVDAVEFQIDGTKWRDLLKKADNDYILEQYGKAVLDNTYTIDFMLEGDVYQSVLLDQMIQDLRLKIDSTMDEQAEIIVEYMGVWSRNGF'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MAJOR CAPSID PROTEIN P2
molecule tags Viral protein
publication title Insights Into Virus Evolution and Membrane Biogenesis from the Structure of the Marine Lipid-Containing Bacteriophage Pm2.
pubmed doi rcsb
total genus 65
structure length 269
sequence length 269
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2008-06-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18628 P2_N Viral coat protein P2 N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.730 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vvfA01
2.60.120.730 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 2vvfA02
2VVFA
chains in the Genus database with same CATH superfamily
4OI1A 1JN2P 5FAXA 3PTRB 1R082 4YVWC 1UY3A 2A6XA 3KB5A 1IKQA 4PHZA 1RXGA 3FZ3A 5JOWA 1ND3B 1W39A 1SLLA 1K5MC 3BIWE 3CEWA 5LEKA 3ETPA 2WO2A 1RUI3 2D7FA 2YGMA 2R042 4RQPB 4UW3A 5FPUA 1DGWA 1HJGA 1BK1A 3TWIA 5JUVA 2WABA 3K75B 4Y5TA 3UNPA 2BNNA 2O8OA 2RMU2 2ZGQA 3QOPA 4FFHA 3HIFA 1YQCA 3P1IA 4JGZB 4YG3A 3H0OA 3SHRA 3TEZA 2QE3A 2HWD1 4EV0A 5EYXA 1W6MB 3H8OA 3UT0A 4J1XA 4M3CE 4NE9A 1MS1A 2E7QA 4CCKA 1CPNA 2Q8DA 1E57A 2NYYA 4NHLA 3ZM8A 1I6XA 3VDDC 4Y1YA 5K8SA 2LRPA 1NY72 1PO13 1W6NB 4N7UA 4ASMB 5CFCB 3VDCA 1KRIA 5LATA 4XPVA 2ZS6B 5M0TA 1ACCA 1US2A 4GB31 1CAVA 3VD5A 1V6JA 3TBDA 4J6GA 1EPWA 3FWEA 3ZXAC 4YG0A 5FBJA 4QU1A 2WS93 5FZEA 1O3QA 5IVFA 1KDKA 1KFUL 3IDBB 4NWWA 3I3BA 1OKQA 1WW6A 1W6PA 4KBBA 2C9AA 2JG8B 5DUVA 1JZ6A 3ZMNA 1PIV2 5FO8B 2EIEA 4OCTA 5FYVA 4GWNA 3GJAA 1VMHA 2RJLA 2ZTNA 3BOWA 3K77A 4FCAA 3WX5A 2DFCA 1S0JA 3USUB 5IAXA 4B8EA 4TWTA 4XACA 3VKOA 4PF5A 4NWVA 3P6BA 3SQOA 3SEPA 3RZJA 1ZNPA 3WG3A 4YFZA 4GB32 2X53S 3GCWA 1KS5A 2GZWA 1LHUA 4P14A 1VBC2 4XXPA 3RZZA 1WD4A 2XHNA 1QMJA 1OQ1A 1GNYA 3E5XA 1QKQA 1L3JA 3WVJA 1UMIA 4ISRA 4RS5A 5LBEA 1RUI2 3D3AA 4X6RB 4KGGA 2JG9C 2RS51 4XJWA 5FMCA 5ACA3 4FPKA 1VAKA 4O9GA 3SCHA 3BTYA 3KT7A 4UFLA 1YHFA 2UWCA 3KV6A 2OX0A 4ES9A 1VAMA 4UFKA 4XAAA 3KZ4C 3HAGA 2VZOA 2BW8A 3MI8A 3V65A 2WNVB 2C24A 2QKDA 5FQ0A 5KHIA 1EY2A 3RYRA 4B29A 2XKPA 3SNMA 3WHTA 3NV3A 5L7OC 5FZDA 1X9TA 1NCQC 4QQHA 4OHWA 3PU8A 3VBSA 3X29B 3HJRA 2OZ6A 1OH4A 3GNEA 4CPBD 1ULCA 2YC4A 4UT5A 3IZOA 1O3SA 2HWF1 5JXIA 1W03A 1OLQA 2JENA 4XF9A 1JH5A 2P4EA 1JZ8A 4CCDA 4DRVA 5D8AB 3GYDA 1Y9MA 1OD3A 2C1FA 3PUSA 2HWF2 4CCJA 2WLPA 3J26N 3HQRA 4EZHA 2Q1FA 5CU1A 3RZGA 5IVBA 2W1SA 3FJSA 1BHGA 3HR9A 2QQMA 1YIPA 4WM7B 3ZXJA 1UZWA 3MPBA 4BH9A 3ELNA 1VBB1 1LB2A 1C5HA 3ALQA 1W9WA 4XCBA 4XUOA 1DGRA 1RC6A 4QX2A 2XBO2 5CAZA 4FXGB 1V6IA 3ZN6B 1UNBA 1OURA 4HOOA 2Y64A 3WT3A 3CU7A 4PI0A 4E8DA 1UZZA 1LHOA 5FRAA 2A71A 4AFMA 1OA3A 1OT5A 2JECA 3LB9A 3FBMA 5FIXA 2VW1A 2YFZA 3MUY1 5IUQA 1MZEA 3JQXA 3RFRA 4P5HA 2QQWA 5IFTA 1Q8OA 1SG3A 4PIYA 3EBRA 5HV4A 4OUSA 4COZA 3I2IA 4LIUA 4R9DA 5EPAA 4LBQD 4A7ZA 5BNPB 3FUQA 3RZLA 1S0BA 5T54A 4MXWB 2YPJA 5FTTC 2OYZA 1CAXA 1OFNA 1QJY3 1QDOA 1VBC1 1CX4A 4LBOA 1E5HA 2BBAA 2XG3A 5F1RA 2L9LA 1J58A 4Q26A 2Q8OA 5C7GA 2B9VA 3D0JA 3ZFFA 3ZYJB 5D2AA 3PL0A 3R4UA 5L7OB 2PHLA 1U5XA 2GP5A 1ZRIA 4FP3A 1PVXA 2QQLA 4AFDA 3C7EA 5I91A 4K6BA 4HXCA 3WF2A 4GH4C 3B3QE 2DVGA 1XYPA 1NA1B 2G9GA 4DY3A 3O14A 5FZ7A 2ZGNA 1QEXA 2R0FA 3AZVA 3ITQA 3MYXA 4JX0A 1BCXA 4NHXA 5CFDB 1FV2A 4Q4Y2 3EYPA 4WM7C 4XURA 3WLUA 4ZXKA 5IK7A 1H8TC 3POGA 4WZCA 4IERA 3JBG3 2HWB3 2ZEXA 2XUEA 3AMHA 5KHKA 1YWKA 1NX9A 1TME3 2VULA 1KEXA 1UMHA 2JE9A 2WN2A 2WRAA 3KV4A 5C3QA 2CNAA 2XKOA 4CP9B 4I09A 5FWJA 5JSPA 5A32A 1H2KA 3NAPB 2ARBA 2IXIA 2VCMA 2VZTA 5FXWA 5K0UB 3FLRA 4JDMA 1JUHA 4OHZA 4GWMA 4HG6B 1DYOA 3K48A 4K1ZA 3IMNA 5DDJ3 4CP1A 1W9TA 3JB8A 1GICA 2VW0A 1NZCA 4FPLA 3PMEA 3B9IA 2BGCA 3MICA 4TZDA 3AYCA 1WA4A 2C6SA 5FMOL 1YUDA 4AVCA 4Z2WA 1GKBA 2LW8A 1STMA 2PHTA 3DKWA 3MDPA 3OPTA 4HKWA 4LR4A 4W6YA 2AH2A 2RMU1 4FOVA 2E26A 1NUKA 4OQ9A 2BFUS 2D93A 2OQ7A 4KI5M 4W6WA 3OY8B 4GULA 4IEXA 2VO5A 4OZXA 2EF6A 4XCAA 1X9PA 1YFWA 3N9QA 2IXLA 4AQ2A 5J96B 4AVSA 2ZZQA 2GMEA 4QHOA 1RHI1 4JAAA 4QX0A 1U5IA 4H3WA 5F7UA 5JPNB 2ZGUA 4XMAA 3OYWA 4E2GA 1CPMA 1Z7S3 5C33A 4O61A 3QBQA 4RSUA 1YFXA 4CEYC 1UCXA 2G4IA 2JDZA 4QXBA 2QUOA 2HWC2 2XQXA 1PK6B 4CUGA 5AFEA 1PO12 1WLDA 4IDZA 4TLFA 3WP4A 4QX8A 4KG8A 5A3WA 2VNRA 4BQWA 2D40A 1QJU3 4HVQA 2UURA 5F3CA 4WM8B 1XE8A 1OPOA 5LWBA 4BK5A 3VZMA 2ZKNA 1VE0A 1OPMA 2OQ6A 2BGOA 1W6OB 2C4XA 3GZAA 4P00B 4JGZC 4QPIA 3HEIA 3OCPA 1VIWB 4JGYB 4JVAA 3IAQA 1N1SA 4PDWA 4GWIA 5J98B 5LB6A 3RQ0A 1VBD1 3SXWA 4XDPA 1FYUA 4DB5A 4BE3A 5AVPA 5F32A 4LBLA 4XVHA 1OF4A 4DINB 2BNMA 4G4FA 3WG4A 4XE9A 3TN92 4Z82A 4N43B 1JU4A 2BRTA 1RVF3 3AYEA 3D4KA 3T4VA 3WDYA 1L7LA 1SLTA 2J1UA 1WUVA 4D94A 1ULEA 3RMXA 1Y4WA 2JX9A 2FCUA 1H8TB 4R9AA 2O8QA 4XAEA 3ZIXA 2UY9A 1UPSA 3NMBA 4FQ4A 3I59A 1QJX1 2IXHA 2PHRA 4L9BA 5CFCC 5DZFA 3LA2A 1RUJ3 2VTXJ 2TEPA 4HPKB 1AYM1 3Q8EA 4R4XA 3LKJA 4FT8A 2Q8CA 1FMD3 5ISLA 1PZ8A 4MV2A 2GAUA 3PURA 5A3MA 4XYXA 4BCUA 1WW5A 4KWJA 4AHWA 1MZFA 4NVPA 2ARCA 1H2MA 3KT4A 2W08A 3O5SA 3C7HA 4AQTA 4YYOA 3VHNA 4LORA 2YBPA 4YW7A 5J3UA 3R4DB 1I3HA 4PIXA 1RUG3 4C91A 2YUEA 4MGZE 2Q30A 1LOAA 3A21A 2W94A 2DFBA 5IYYA 2Z79A 2WC2A 1G86A 1UOJA 4AF9A 4AEDA 1JYIA 3OGSA 3OBRA 5LBFA 2ZMKA 3S6PA 4ZKTB 4UW5A 1LOCA 4LHSA 4BQ5A 5E16A 4IETA 2QJVA 1W99A 1IPSA 3AC0A 5FP8A 3BTZA 2GALA 2GN7A 2XWJB 2DCYA 2HEYF 4AVVA 5I0TA 5EQUA 1GSLA 4LIVA 1VRH3 4CUBA 5GLTA 2OIIA 3A7QA 3JQWA 1ASJ3 1LNSA 4Q4V3 1KXGA 3TNPB 3KGLA 4LBQA 1HQWA 3SCFA 4QPIC 3ZSMA 3RYPA 2J7MA 1VALA 2EA7A 3MPPG 4L97A 1OA2A 1RUH1 4YM3A 1SCRA 1UOBA 3OD4A 5LK7B 3BPZA 3ILFA 1XOYA 3EJKA 4CVUA 3MBWA 1OD5A 2CV6A 2VVFA 4I0BA 4XETA 2OPKA 5KXDA 1YQ8A 2ZEYA 1JS9A 5GZCA 2B5HA 3U14A 3N35A 3Q8CA 1FPN1 4LKDA 4TN7A 3ZYFA 2I07B 2PYTA 3KM5A 1O59A 3A4UA 3VBRA 2C26A 2DDUA 2VH9A 1ASJ1 1WW7A 3RSJA 1MEC2 1NYWA 3AX4A 3ZDSA 2BWAA 1F35A 1V9U2 3IN9A 4Y1XA 4P9GA 4I0WB 1ENQA 1YO8A 1SCSA 1UAIA 1DCSA 5CG8A 2DUQA 4B7EA 1LESA 3GHMA 4X6QB 3POFA 4X8PA 5C71A 4HANA 2D3PA 2PTMA 4RHV3 2VOVA 4AI9A 1PHMA 4QM8A 2JG8C 5FLJA 4XBLA 2MHFA 1NCRC 1IS3A 1AL21 3N9NA 4O9EA 2BQPA 3AZZA 4XFFA 3H8UA 2R6QA 1UN1A 1FX5A 4AVBA 3CJIB 2GC3A 4P9XA 4FPFA 1F4HA 1L7RA 1X50A 3VBUA 4COYA 2YY1A 2FDFA 4IV3A 2MEV3 4UAPA 4XILA 5FY0A 5C8CC 2R041 3V0AB 2VOWA 1RUG1 2PN5A 3E6DA 3IPVA 2O0OA 4FQZA 4XUPA 2WFF2 2DWRA 4O7XA 4WZFA 1G9FA 2AGSA 3GZUC 3W20A 1MQTB 2Z4FA 3H1WA 3BB6A 5H9QA 2PAKA 4RYDA 2OZJA 4Q1RA 2BEOA 5BNNC 4IV3B 3AYDA 3IBMA 4XOGA 3H8XA 1NCRB 4IQPA 4W4ZA 3T0BA 5T52A 1Y9QA 4HPKA 2D44A 1G6NA 2Y34A 3WF4A 1AR61 5LRSA 3LFIA 5LCWL 2PA7A 1KQRA 1US3A 3M1HA 1W2AX 2P3KA 5GLWA 4AWDA 3RRDA 1GMMA 3TOJA 4BPZA 2HWE1 5C8WA 1NE6A 5FP4A 3N7KA 3OGGA 1R1A3 4IXLA 1EUTA 1HV0A 3LEGA 4QQOA 5CVRA 3W59A 4AXOA 3ES1A 3CZUA 4B1LA 1ND3C 1NXMA 3VHOA 2QFEA 2ZMNA 3KT1A 3PTYA 3FL7A 1JMUB 4KQ7A 4BZ4A 3FLPA 2RR11 1UQXA 2WFPA 4Z92B 3ACHA 2Y33A 3JD71 3LCPA 1JXNA 1MZ6A 1QH6A 1TNFA 1W2NA 3VBHA 1ZBE2 5TSWA 2WZPP 4EN0A 3PVBB 4QKBA 4A2UA 2RS52 2A6VA 1VBD3 3ZXDA 2JE7A 4NJ4A 1GNHA 2XL9A 4E4HA 1JHJA 4CDQC 4GB33 1DYKA 3ME2A 3D6EA 5BNNA 3I54A 5LBCA 4KBZA 4CDQA 1LAJA 1PM4A 1R64A 2D3SA 1XE7A 2FMYA 3DYPA 1H9WA 1B35C 3AP5A 1D2QA 3D0SA 1UKGA 5K4LA 3ZFFC 1OXCA 4F3JA 5FO7B 4W6XA 1V6KA 4Y20B 4M0HA 4NAMA 5HCBA 3WF1A 1YNAA 4P5YA 4AOCA 3RWKX 1XQNA 3HOBA 4COVA 5F5CA 1V6NA 1W8HA 1R093 4WVZA 1PVC3 4P08A 2GMPA 2ZA9A 1PM7A 3LA7A 4WV8A 5GZGA 4GXLA 3ON7A 5LA1A 4CCCA 5FO9B 1ZA7A 2LTNA 4RGAA 4XJZA 2G19A 2WAAA 2HWE3 1VBE2 3AVSA 3IAPA 4HBNA 2XR4A 5C4WC 4P02B 1NE4A 1W2UA 2ORZA 1PVC2 1UZ0A 2QQJA 2HEWF 1MVQA 1NKGA 1ZZCA 2EAKA 2I74A 3MO4A 2DCKA 2BZDA 3QACA 3MV11 4P9YA 3T3YA 4D6SA 5HCAA 4ZU5A 2HJIA 3WW3A 1K5MA 5FPVA 1MS0A 4Q4W1 2VU9A 5I93A 1UW8A 1RVF2 2AEZA 4IGOA 1EV12 5L73A 2B39A 1Z78A 3I2DA 2WQ4A 3DGTA 1OLME 2HBUA 3U11A 3VD3A 3VL8A 1S2BA 3PDQA 4CP9A 1RUJ2 2VCBA 2ZHKA 3VBOB 3NWKA 2RS33 4D7TA 2XOMA 1ZBE3 4C1XA 4NN0A 1RJ7A 3ZN6A 1BBT1 1HN1A 2OT7A 4C8DA 1CJPA 3IKWA 4N43A 4OI4A 3THPA 4D7YA 1LHWA 1UXXX 1CR7A 2JWPA 4DXTA 4XABA 4Y5Z0 3H1MA 3WF0A 5FYIA 1RUOA 1ULPA 4LITA 1RMU1 2JDNA 1QJU2 4LK6A 4CYDA 1ZBA2 2WSVA 2QTWB 3C8XA 3OBZA 4P9JA 2D97A 1JI6A 4GH4B 1QJFA 4ISQA 1HV1A 1UZVA 2QBXA 1SEFA 2DBIA 5B4NA 3DPRA 3SC7X 3WNNA 1WCKA 3RI8A 1S0CA 4JQTA 3OPWA 3JD72 4SLIA 3R0RA 4QQLA 5LA9A 4DPNA 5C3OA 1WCDJ 1JZ4A 2WZR1 4NRMA 4L8QA 5FBZA 3POIA 1SBDA 4D7SA 2QQVA 2XUMA 2IVIB 2J1EA 4FPEA 1GP6A 1F4AA 4K9SA 4MXWA 5FLHA 3JBG1 3I2JA 5FZIA 2Y6KA 4XC9A 5FZGA 1VRH1 4QQ2A 1FNZA 3CKHA 2VTFA 2V4AA 1YI9A 2P6CA 4K21A 4Q4X2 2IXKA 1TMF1 2W87A 2HWB2 1IPKA 5LA0A 1WMXA 1YFYA 1X7NA 5DZEA 3AYAA 1V00A 1FOD1 3FUOA 3H3ZA 5D21A 4LHLA 1FXZA 4I0AA 2VZUA 5C9AB 1ULDA 4GMP0 4XTMA 3VN4A 2GC0A 3OY8A 3SKVA 5FY9A 4YG6A 5DQ0A 3AL6A 3S5QA 2K0GA 3U10A 1ZRDA 2CTVA 2R071 3ZVXA 5FMBA 4WM7A 1OHFA 2ZPXA 5IFPA 3AP6A 3AJYA 4DO0A 4AGGA 4OHVA 5EWSA 1YJLA 1AX0A 4ZU4A 3USUA 1W3XA 2D6NA 4A44A 2J1SA 2X29A 3P3NA 4W65A 3UJQA 2LS6A 3MUZ1 4CDUA 5CEHA 4DUWA 3LD8A 5DAWA 2RS31 5DAXA 3WQBA 4DRRA 2QQNA 3LOIA 3O1UA 4CEWA 3O1VA 4NAOA 5DZGA 1NG0A 4LO8A 1Q8SA 2JEMA 1CZSA 2R061 2WZEA 3VBHB 2CHHA 5F8PA 4N9IA 5KBFA 4H2AA 5FQ0B 3H9AA 4WVVA 2K9ZA 2Y6LA 5CFDC 2IC1A 3THTA 5CG9A 4QHZA 5A80A 3IT8A 2WFF3 1IKPA 1MS4A 2WYSA 4HZFA 4Y1UA 3J8F3 4XZUG 3UL2A 1AHSA 2DCZA 2PLV3 2ZBJA 1C3HA 2TBVA 2V73A 3SISA 1HRI1 3ZFGB 5A1LA 1ULOA 1S0GA 1OKOA 1GZ9A 3N7JA 3SH4A 2J1VA 4MVTA 3QCWA 2Z42A 5AVAA 3PJYA 1AR82 2CYFA 3E1F1 5FUIA 3BTAA 1W05A 4E4ZA 1SPPA 2VNGA 4ATEA 3UV9A 1NZIA 1LEMA 4EWAA 3B94A 1R091 4YRDA 2DUPA 2GNBA 2PFWA 4BISA 2C5DA 4Q8KA 2FZ2A 1R1A2 4TYSA 4DXSA 4I30A 2CY6A 4MYEA 5AC93 5F3IA 1AR83 1R1A1 5A6ZA 2Y8KA 3H7YA 1ND3A 2XXZA 4YGBA 3I2FA 2HLEA 2VCCA 2ZGRA 1AVBA 1IS6A 2JG9A 4QX7A 4RL7A 3UESA 4UFJA 4CU8A 3APBA 4ZU7A 3NJXA 1YYNA 1HIXA 2QCSB 3POYA 5D8AC 1AR81 1W8TA 3LSDA 5T5PA 1LGBA 3AKQA 4JZRA 5HCHA 3WNPA 1G9DA 4XHBA 1QXJA 1J3PA 3VBFB 1DGWX 2H0VA 5CNAA 1TVGA 1BVP1 1QDCA 1F5JA 1COV1 1MPXA 2F4PA 3WW4A 3VBFC 4QB2A 2D43A 2ZGMA 3KCYA 1A3KA 5A3UA 1ZZ8A 1LECA 3CHXA 1YLLA 2KXLA 4F8AA 2A5ZA 3ZXGA 5JZGC 4LBMA 3VKNA 4GIQA 3ACGA 1SZBA 1IQDC 4BQYA 4NIDA 5C6CA 1G9BA 3TEYA 1GV9A 1XSQA 5KC6A 5C8CA 2XJUA 5FY5A 1J1LA 1LU2A 2R062 4BIFA 5KXCA 1SMVA 4FTSA 2VXJA 5KC5A 2V5YA 5EHDA 4DFSA 1QJX2 1JYTA 4ORFA 4EZ4A 3FE5A 4IESA 4LBQB 4RHV1 1UF2C 4HK9A 4KWLA 5JXGA 1CONA 1TME2 3GDBA 2Y38A 3K2OA 2VQ0A 3PMSA 4CXWA 1LENA 4YW1A 2RJ2A 5J37A 3U0ZA 4X8NA 2JJ6A 5T3NA 4I3PA 4RQPA 4Y4RA 1W2TA 2AC1A 1ZM1A 2JB4A 3OGJA 4JHZA 4R9CA 1AZDA 3UKVA 2C9KA 4BHPA 1NXD1 2EAAA 3W21A 5A3LA 2P5BA 1PGW1 3TEWA 2HWB1 1OLRA 1PGL2 1DHKB 2P2KA 2VBDA 4A45A 4XQDA 3T0AA 2YU1A 3KQRA 4META 2FBEA 1CN1A 1VRH2 1TZOA 3AJZA 4FPHA 4AEDB 4AVAA 3N4MA 1EP0A 2P6HA 2VMHA 2DF7A 2E53A 3VBOC 3WNOA 5FZCA 5JIUA 3NJZA 4OFGA 4Q4V2 3AKSA 1UY1A 4FPJA 1TMF2 2QNKA 1VB2A 2JXAA 2PMWB 5CZKA 5F3GA 5FXZA 4ZY9A 1Q43A 3U78A 3VZJA 4YARA 5BUVA 3H50A 4UOJA 2DU0A 4QM9A 2QQIA 3ECQA 4P9WA 2HWD3 1XBFA 2JDUA 4Q1PA 4CCLA 2Q5TA 2XLGA 2RM22 4CCMA 1W3VA 2VMCA 1WMFA 1S1AA 3TNQA 2AUYA 4UXAA 3ZPYA 3O1PA 2W46A 2V4VA 4LQRA 1UU4A 1SLBA 1MEC3 1EAH2 3FC0A 2YBSA 4DIQA 1BEV2 2JD4A 4LE3A 1Q8VA 4RR3C 3ZFGC 1C1FA 2VOXA 5F39A 1GUIA 1X33A 1RMU2 4Q4X3 4ET7A 4AK3A 4A7KA 2CGNA 3NNJA 3E5QA 3MW4A 5SV5A 3CO2A 4R52A 5FPXA 1GR3A 4I01A 2XH6A 4MXVA 4QX5A 1EAH3 1TNRA 4E9KA 1RUH3 1BBT2 3ILRA 2NMOA 3HD8B 4OYUA 3K4AA 2WNOA 1ENSA 4LPLA 3OBTA 3FBYA 1ENXA 1O8SA 1LJ7A 4D0QA 5EV7A 2R0HA 2BOJA 2CGPA 4HVRA 3B69A 5FWEA 1JHNA 5GALA 3OF1A 2W68A 1FMD1 1ZZ6A 5FCCA 3M3IA 2B8MA 5DAVA 1GQPA 2VPVA 3N9PA 2Q1ZB 2W1WA 4HKOA 1DLLA 3VZOA 3AVRA 1KGYA 1RYYA 5ABJB 1DQ5A 5FPZA 4BMBA 3IDAA 5ERLA 4WBBA 4WVMB 4HVOA 4LO4B 5GM0A 4NHYA 3O1OA 1DP0A 3FFQA 1DYPA 4MHRA 4RQPC 3CF6E 3POWA 4WM8A 4XFBA 2WT0A 2PQQA 1RVF1 3ZKUA 1TQ5A 5I8TA 3LOBA 3CBNA 1W8FA 1PVC1 3Q8BA 4ITCA 1QIQA 4C0HA 1R083 5FZFA 2ZGSA 3EO6A 1QQP3 5FKCA 3SLIA 2UYAA 1YXWA 2WQ8A 2JIJA 3KV5A 4EQVA 1EPZA 1PO23 3ST7A 2ZX2A 3JUUA 1QU0A 3RJ2X 3N9MA 2UY8A 4XFAA 1LU1A 3H8RA 2VVEA 1RL3A 4EYUA 4URAA 1LHNA 2RM23 3LQCA 1BQPA 2N7GA 1NLRA 2WINB 1UYXA 5FFOC 4RS5C 2FZ1A 4OMDA 3LDBA 2J42A 4CCOA 3H42B 3NV1A 4LO5B 3LSEA 4KWUA 5IVJA 4AQSA 2GNMA 2GC1A 4L0PA 4Y26A 3FHQA 4YWAA 5KXEA 4XF1A 3WNLA 1WGPA 2CAUA 1NQJA 4AAPA 4CP0A 1GZTA 3OOXA 4R8HA 1C8M1 4GALA 2YFUA 4GZ9A 4QX1A 3WCRA 1LTEA 4B1MA 5AFBA 2ZCWA 4W8JA 2DVDA 3NSTA 4QXKA 4KG0A 3U4SA 5A33B 2FHRA 1JW6A 2VMGA 3N9OA 2E31A 2HYKA 2I45A 1H30A 1HXS2 4RGKA 4UF0A 4CEYA 3J8F1 1RHI3 1WLWA 3OGRA 1BMV1 3EHKA 3ORJA 4OI2A 5F6KA 1BEV1 3LWCA 2EIBA 1W06A 1HRV1 1D7PM 1JU3A 3MF6A 3MIDA 5JOZA 1UPIA 4HL0A 5FREA 3I97A 3ZPOA 1S2EA 1YQ5A 1UIJA 4YW6A 3KV9A 4QKDA 3GZEA 5F2SA 5IVVA 2ZHNA 1FI2A 2QQUA 2YHJA 2EXIA 2DUOA 3N7MA 4RGGA 5AC91 2Q8EA 1I9RA 1POQA 3LZZA 2RVAA 4LMFA 2HWE2 1H6YA 1ODNA 3BTXA 4BYYA 1VMJA 2WBKA 4CRQA 2A70A 2ID4A 3ATGA 2CWSA 4N9HA 3LPFA 1AJKA 1SLAA 1RXFA 5A7WB 1UY2A 3MV01 4XBQA 1QQP1 1MS3A 4U36A 3KVBA 4CXYA 1QJEA 3WEZA 3CJIC 1DZTA 4RFT0 2YYOA 2R1BA 2BGPA 4AI0A 3I2GA 2NMNA 1H4GA 1O4YA 1Q8QA 2VOTA 4FFGA 1XSRA 2Y26A 5JXJA 2WDBA 1AR62 4INDA 1KDMA 1QH7A 1W0OA 4KGQA 3NKGA 1PGW2 2WFF1 3MIEA 1W8NA 2GU9A 3LDKA 4QHBA 3A22A 4XQ4A 4GWJA 2WN3A 1F5FA 2E7AA 1I5PA 3U1XA 1S55A 1ZA4A 3HWJA 2R7EB 3AFGA 3UGFA 1H0BA 5ACA2 4K20A 3IIIA 3J9SA 4IEZA 1AR63 4NMIA 3IB3A 3M2MA 4XFGA 1YI7A 4JRLA 4LO6B 3AP9A 3DYOA 2ZGPA 4ARXA 2RDNA 3C3VA 2WNEA 2B46X 2NP0A 1RUI1 4RA0A 4DMIA 5LZ6A 4Q0QA 2OW4A 4LBKA 4IEVA 1N47A 5IVYA 1HKDA 2A6YA 5FPAA 1JZ5A 1ND2C 1GZWA 1ZREA 1OVSA 1AXYA 4JTOA 2VZVA 3MHZA 1VLNA 4AFBA 4CDWB 2OPWA 1OBNA 1Y9GA 2VMDA 2WO7A 2YPDA 3LE0A 1UX6A 3PHMA 4M4RA 4QPGC 3E97A 1JOJA 4E2SA 3RVHA 1FPN2 1CESA 2EXHA 4M0NA 1LHVA 4AGRA 2ZHMA 1T2XA 5D8AA 4M3CA 4BLIA 2RDSA 1F2NA 5I8SA 4UF0B 1RUD2 2XBO3 2F17A 3VHPA 1D4VB 3FMGA 2ENRA 1PX4A 5CB7A 2XVKA 4D3WA 1MS5A 1XNTA 5IK8A 3AP7A 2A3XA 3VBSB 3CQOA 4AE2A 3DECA 1IS5A 2DVFA 2HKXA 5F6LB 3PVEA 3LIGA 3HPNA 4GD4A 5FP9A 5A7NA 5IHRA 2PAMA 2R1DA 3UKTA 3WY6A 4AEKA 4XBNA 5LY2A 1OOPC 1BK0A 4MGKE 1GZCA 1LOBA 1AF9A 2Y6HA 1HQLA 3AB0A 3ZFEA 5BNOC 3ZN4A 2IUWA 5HI0A 1GZWB 5BV6A 1CZTA 2XVLA 4JTNA 1CAUB 3MF9A 4RS5B 4CA9A 1OUXA 5FYZA 1HRI2 2VZPA 2ZKLA 2XONA 3WDWA 1ULGA 2FDIA 1U12A 1LODA 3O1SA 3NRUA 1JUIA 5FZ9A 2UYBA 3ZN5A 1LOGA 5FP7A 5LA2A 2LUWA 2WA3A 4EN9B 5A1FA 1CD3G 4ARYA 3FHIB 3FX3A 4K7JA 5F2WA 5GLVA 2RG4A 5T5OA 1X36A 3UJOA 4BMEA 3EQEA 1DIWA 4C0BA 1SQ4A 2VZSA 2BP6A 3WP6A 1ULFA 5DAQA 3S7IA 1N1VA 2FCTA 3SH3A 4E2QA 4N8MA 1HQNA 3HNBM 4FBFA 1UU6A 5B4XA 1JYVA 3WCSA 3USSA 3H3UA 3M70A 4NHMA 2DTYA 3WZ1A 1I1EA 4HT1T 2JG8A 3PIJA 5CYYA 2GNTA 1GBGA 3I8TA 4AVTA 1AYM2 3KCXA 1VBA1 1JOBA 3MW2A 5LRRA 5CISA 2CAVA 3NJVA 2O1QA 3M3EA 1OLMA 4YM1A 3RNSA 2D6MA 4I02A 3GBWA 1O7FA 5A3PA 1JZ2A 1DQ2A 1PNGA 5JR2A 1AYM3 1KJLA 4WM8C 5EFUA 5K9YA 1VR3A 2FCVA 3ABZA 4DXZA 3TN91 3R6SA 3SITA 3S7EA 1XJAA 4AEJA 4BXSV 1IHMA 3RZMA 3VBOA 2VW2A 1WCSA 1CZVA 2PQSA 5FLIA 1HB2A 3PUIA 2IXCA 4IEOA 4GA9A 1HXS3 2VUDA 4CEYB 2OS2A 4OVEA 3CDZB 3AZXA 1WBFA 2GDFA 1YIFA 3LFMA 4WVWA 1O91A 2GH8A 3BCWA 3I4IA 3QD6A 4QX3A 3ZYBA 1PGSA 2AENA 1VB4A 5LEJA 1H1AA 4Q8LA 5CKMA 5K0UA 4MLOA 4EN6B 5ABJC 1PNFA 3ACLA 3QLQA 3VDAA 2JDKA 2D6OX 1UYYA 2QZ3A 4BQXA 2QDRA 3ZOIA 4PT6A 3WV6A 3ILNA 4YW4A 4KL1A 4QD2A 4A41A 2YB7A 3C7FA 1GOHA 4H7MA 3BPSA 3O12A 4U2AA 4LXLA 4BIOA 5C5UA 3RI9A 1HRI3 2UWBA 4LNVA 2NN8A 3ZLIA 3POJA 2RS13 2DVBA 4RR3B 4ZZ8A 4NIIA 4Q4Y3 2Z69A 3GBFA 4UWDA 1WCUA 2ZMLA 4Y3OA 3WXPA 4AEDC 1QJU1 2ZGTA 4AHZA 3AKRA 4EJRA 2BPA2 5FYHA 1F15A 2H6BA 5FY7A 1RHI2 4LLOA 2NLRA 1WMEA 5DDJ1 4B3NA 1E5IA 2P1BA 2JE8A 2R063 2P3YA 2ERFA 3OGVA 2XB6C 3VHRA 2KA3A 3DF0A 1AX2A 3AMPA 4BQ2A 5C5TA 4BM8A 4K40A 4OUEA 1C5IA 4WVMA 1JOPA 3DN7A 2X5IB 1ND2A 4QDQA 1ZBA3 2ZX3A 3MIGA 4FFFA 5JIAA 3BVCA 1GWMA 4IEQA 4LTAA 4MSVA 4AFCA 3MFAA 1K5JA 4EE2A 4XJ8A 5BNPC 1V6MA 1EV11 4J25A 4K8FA 1MS9A 2ZGLA 2GMMA 2P34A 2B45X 1XB9A 1UXZA 4AFAA 5DPNA 1FNYA 4EWDA 2WNUB 5BXXA 2Y0OA 3J7MA 3T08A 4JDNA 3WG2A 4D6RA 1FPN3 2H0BA 5FJHA 3CMGA 2PHXA 3NV2A 3ZYHA 1LULA 1UMZA 3P3PA 2R043 1F31A 2P37A 4ES8A 2A7AA 1RUE3 3ENRA 2OVUA 4DEVA 3POBA 4LUKA 5IVCA 2Y60A 3HBZA 1H8VA 3ACFA 4EWEA 2NQYA 2BJSA 1QJY1 3N9LA 5IT6A 1VBE1 3RMYA 3WSOA 5C3PA 5JI7A 1RUD3 3GM8A 1NQDA 3AK0A 1WKYA 2WS92 3NKTA 2W52A 2VGDA 4BLJA 5BNOA 3L2YA 4XJAA 2E9QA 3OJBA 3WNXA 2BU9A 2XJPA 4QDRA 1CGPA 1W8UA 5A1AA 1C1LA 4ZPIA 2GSYA 3MEPA 4DY5A 2WZ8A 3MLLA 3RS6A 2BVBA 5A6YA 2WNVC 1QWRA 3KF5A 4PCRA 1KFXL 2XJTA 4PLMA 4BB3A 2KM2A 3K51A 1D0HA 5E8AA 4FSJA 4LKEA 2ZAAA 2PHDA 1D4M1 3BGAA 4XTPA 3BIEA 1VBC3 2DCTA 2W91A 2BNOA 2LALA 1SLIA 2G9FA 2LROA 4MGSA 3VZNA 4A6OA 4XIKA 1OVPA 4D8MA 1XNAA 1AJOA 1CAWA 5FZOA 4B7KA 2DURA 4BWOA 5FYMA 1SFNA 3EMRA 2WNUC 2R32A 2V72A 2WSUA 3CJXA 1H1IA 4JRAA 2ZEZA 3T30A 4AL9A 4MGTA 3LEMA 1O5LA 4JKLA 3NNLA 4H55A 3T2PA 3AZYA 1VBB2 3O1MA 2JDHA 4K3UA 3VBRB 4XJUA 2VBPA 4XIOA 3KLSA 4Z1VA 4YZ2A 5JDBA 5LW9A 4BDVB 1YEWA 5JPMB 3K4ZA 3GXUA 4L92A 4LKSA 2WYFA 3PVNA 5T55A 4E4SA 2E51A 3AM2A 4QGLA 3MGUA 4R9BA 1VBB3 3O1RA 3WW2A 1O5UA 3JZVA 4G9SB 4QPGB 5SV8A 3CL1A 1Y43B 2ATFA 2GN3A 3OUIA 3L2HA 1C4RA 3G6JB 2VQAA 4LA2A 4V2VA 3NQHA 4BA6A 4K1YA 2VR4A 1O3TA 2YU2A 3VUOA 1UIKA 2QQKA 3PJQA 2ADDA 1COV3 1B35A 2Q1MA 4FPYA 2HEVF 5AC92 2O14A 3Q9OA 1D0GA 3WP5A 4GJYA 2HWF3 5C9AA 1OUSA 1DLCA 1RUG2 3C7OA 1UOGA 2PHUA 1VMFA 2W1QA 1UU5A 1REFA 3FN9A 2QQOA 3PU3A 3VBFA 4NRQA 3N3HA 2XDVA 3WNMA 4AI1A 1BMV2 3J8F2 1ALYA 5A7QA 2WWSA 3VV1A 4AR2A 5EIYB 5T50A 1VP6A 2H6CA 3MIFA 1SDDB 5L36A 2CL2A 3VBUC 3WOGA 3J7NA 4URTA 1HB3A 4HMZA 2XGXA 3E5UA 4UI9L 5I0RA 3KHCA 2ETEA 3VDDB 2AR6A 3IWZA 2PHWA 1RUF1 3F2ZA 4IW3A 2JDAA 1OOPA 2WWUA 3GHNA 3INAA 1O3RA 2RS53 4PIZA 2BFUL 4YLZA 3C2UA 2VG9A 3RZKA 2DBNA 5B2GB 1PMJX 4Y4YA 1W2OA 3M8LA 1ASJ2 2WS91 1SPPB 3ZSLA 1W8ZA 3B00A 3VGIA 2VXRA 5BY5A 1ZRCA 2RE9A 1NCQB 1T6BX 3ZXKA 4CZSA 1S0DA 4W50A 1W6QA 1JYCA 3W9AA 3EB7A 1F9KA 1OQDA 1XXNA 1RUH2 2VUCA 3LIHA 4H7LA 4YVSA 3SEEA 3ZFGA 3BI3A 1J83A 1XNDA 3WQ7A 5BPXA 1N3PA 2W92A 2VTXA 1S0FA 5T5LA 4FO9A 1V9U3 1RIRA 5FOBB 1AXZA 4NUBA 1GFF2 4DUVA 1V6LA 3AMNA 4I2OA 3D8CA 2AEYA 2VM9A 2GP3A 1UKRA 1V6OA 1JBCA 1X8EA 2DU1A 3KMHA 2Z2SB 4IUGA 3S57A 2Y6JA 1B09A 3LGRA 4N53C 2XJVA 2D3RA 4TSVA 2B4KA 4JHTA 4PDWB 3NJYA 1NY71 2RHPA 4TLGA 4S2DA 1HN0A 5A7PA 4CEWB 1UX7A 4N53A 4COWA 2JG9B 4OQ8A 1ZX5A 3K3NA 4NR1A 4D69A 5HV0A 4QT6A 2VE1A 5EYYA 4I3GA 2XJQA 5CADA 4OMCA 4GAZA 1WA6X 3RG0A 2HWD2 3RDIA 2DV9A 1W9FA 5JZGA 5C9AC 3OD0A 3WDXA 1UL9A 3A23A 2RJKA 1QNWA 1AL23 3F95A 4M4PA 2W2IA 5J48A 1YFUA 2Q4SA 5FMOS 3TRSB 1FOD3 2VQTA 2W1UA 2BYVE 4HFSA 4YGCA 4YZ1A 1OI6A 1UWWA 3G7DA 5K7PA 4RFRB 2BBVA 1LOEA 3HT1A 4YW5A 3AKTA 1R081 4S2FA 3THCA 2UU8A 1URXA 5GKAC 2VZRA 4MUVA 4YZ5A 4KU8A 1EAH1 2YZ4A 2ARAA 5FZ1A 1QQP2 3OB8A 1J1TA 4XHXA 1WW4A 1BBT3 3QH6A 4NPLA 2EALA 3IIAA 4FOYA 4YFWA 5D1IA 4Y24A 4BQ1A 5G04L 3T4HB 3D82A 3DPRC 3VLBB 4MHUA 1WLTA 3RGBA 1SFPA 2D6KA 4MG2A 1YQ2A 5JAXA 3J7HA 4AI8A 2KR2A 4CCEA 1S4CA 2D5HA 2BV4A 4OUMA 4AHXA 1DG6A 1MACA 1D4M2 3DXUA 5C3SA 5JCTA 1VJ2A 1X8MA 2F6BA 3THDA 3BODA 4QDSA 4CDUB 3U4XA 2W3JA 5HXMA 1PGL1 3NAPA 3IM0A 2JIGA 5FMDA 5A32B 1V70A 5FJKA 5A7SA 1BZWA 5KHJA 4GKXA 5JVVA 3ZXLA 4MGYE 1DQ0A 2YBKA 1UD1A 5I0SA 5FYYA 4IEYA 2VMIA 3HQXA 4NPRA 4G3YC 5JR7B 4AW7A 1ZZBA 5DUUA 4PBPA 2WR9A 2SLIA 1VAVA 2JKBA 2GC2A 5ANQA 1GWLA 1VPHA 1YJKA 4JKKA 3IDCB 2HWC1 4YW2A 5CFDA 1RUC1 5G05L 4AG4A 3POEA 2Q0AA 1C57A 2VOKA 3NNFA 2B7YA 2VMFA 1ZYBA 2YMZA 3WR0A 5BYNA 1IGOA 1AR92 1W6QB 4JV4A 2WLQA 1N1TA 1NCQA 3LPGA 3VBSC 1BKZA 2J1RA 4KWKA 3LAGA 2WQZC 3A0KA 4QKNA 1GQGA 1OA4A 5LASA 1GQHA 1AR93 1QXRA 1K5MB 3KS7A 1UYZA 3HNMA 2V09A 4Y1VA 1ENRA 4ZS2A 1G9AA 1COV2 1O8PA 3IPVB 2ZXQA 4IV1C 1QXPA 2XPJA 4KH9A 5H9RA 3DPRB 5BNPA 4TTGA 1Z7S2 4QU2A 1H4HA 2A6WA 3CJIA 1QF3A 2A3WA 4GH4A 3I3MA 4CUCA 1XPWA 2ET7A 3I2HA 2VNVA 4IV3C 2VJXA 2YROA 3VZLA 1SACA 3JXSA 3B7MA 1TE1B 3ZFEC 1RUNA 4C1WA 3WINE 1REEA 3IMMA 2PXJA 4BQ3A 1AX1A 1W8WA 5DXDA 5FY8A 2WJSA 3DL3A 5EJZB 1B35B 2EXJA 1H2LA 2R16A 1P8JA 4ZONA 1KD7A 5EZWA 4LHNA 4Q4Y1 4A7YA 4RN5A 4QQPA 2CU5A 5JMCA 1PMHX 2RS11 1W04A 4C90A 1AYN1 3RYKA 1RB8G 4CDQB 4FPCA 2RDRA 3UGGA 5BNNB 4M3CF 3VBRC 5E89A 4YZ4A 1YQ6A 2JDMA 1R1ZA 1Q5OA 3PLQA 3T2QA 4AHYA 3GBGA 1H9PA 1UY4A 2AREA 5KHGA 5F9TA 3GZTB 5F5QA 3HMYA 1QOTA 3HNYM 4CDXB 3O0VA 4Q0PA 4PBOA 4YM2A 3ZYIB 4YNIA 2A73B 4BU2A 2JICA 2QDNA 2WNVA 4BQ4A 5FPLA 3KWVA 2MEV1 3UGHA 5JWPA 1QY4A 5FZBA 5JLVA 1TG7A 1XU2A 4QPWA 3VKLA 3VD7A 4QB6A 4UBGA 5F5AA 2YC2A 1GYKA 4XF3A 5FZOB 2XWBB 1DZQA 3BOPA 3H1YA 4KNCA 5GZEA 4Y33A 3TN93 3T09A 3OTFA 5KXBA 1RTVA 3CIHA 3EXUA 3ASIA 3DV8A 2F4LA 4Q27A 3MZHA 1ZZ9A 2MPFA 1S0EA 4MX3A 1RJ8A 1W90A 4N90A 2RMU3 4HONA 2K46A 4A4AA 2BVVA 2WKKA 3OBAA 4CEWC 2FDKA 1HW5A 1MQTC 3WDVA 2FDGA 4Y20A 1DF0A 4R4ZA 4Z2AA 1ONAA 1NAEA 3CNAA 2VBBA 2D5FA 5A7OA 4A3ZA 4S2HA 1MQTA 1YC61 5JZGB 2JDPA 4FPGA 4DQAA 1GP4A 2X8KA 5I8YA 1O4ZA 3O0XA 4IEWA 4J1WA 3ZIWA 4QPGA 2PLV1 3W5MA 1HLCA 4Y5SA 1FOD2 1VBA2 1NLQA 3ZSEA 3BALA 4HSLA 4LEJA 4O65A 4PDWC 1DQ6A 2R073 1J3QA 1PIV3 3T2TA 4N53B 1UO9A 1FT9A 1TME1 3T1LA 1M4WA 3AMMA 4IE7A 4MO3M 3U07A 3AKPA 4RHV2 4XF0A 1LKNA 2Y6GA 3GCXA 4L99A 3ZKYA 4CDUC 1F8VA 2G9ZA 1W6PB 1CQ9A 5KHHA 3M7AA 4CPBA 2E32A 1DZRA 1W9YA 2W39A 2Z5WA 2MEV2 5FP3A 1D2SA 3OEBA 4B4RA 4E4DX 1G7YA 5FYTA 4AYUA 4NIGA 5H9PA 4HKLA 2C0ZA 1S0IA 1CAWB 5FR3A 1EUUA 3S5AA 1UY0A 1MZ5A 3I2KA 1E5RA 1U5YA 2ZX0A 3ZDVA 1JYXA 2VD7A 3PUHA 4UW4A 4GMP3 1A8MA 2ORXA 2J1TA 1LGCA 1D4M3 2EIGA 4JGYA 4RD7A 4QGNA 2WO3A 4QPIB 3SMHA 3HBKA 4AI3A 4K8RB 4D6QA 3ZXEA 1NCRA 3ZSJA 1V0AA 1ND2B 4QWNA 3ROUA 1CJDA 1DFQA 4BXFA 4N43C 1ZRFA 4JGZA 1OF3A 4S2GA 3T2OA 5F3EA 2BUKA 1FATA 4KU7A 5CKQA 5LK5A 2K2SA 1Y3TA 3S30A 1LCLA 1QGLA 3U75A 2ADEA 1IZ3A 1TMF3 1RMU3 4NOTA 3WDTA 1OC1A 2AACA 3V0AA 4LKFA 2VC9A 4AZZA 3VBUB 1RUJ1 2WA4A 2ZJCA 4HK8A 2RV9A 4NO4A 3VDDA 3ZX7A 2VUAA 3Q8AA 3WQ0A 4MGQA 2JDYA 5JSOA 4XUQA 2RDQA 4JC1A 4XJ9A 5JXHA 1RUD1 1PIV1 2WO1A 4EN8B 1VRBA 2WZR3 1UYPA 5KWRA 3NL1A 4MOAA 3TAYA 4HLTA 1HX6A 2IFWA 2XMLA 3WD5A 1FAYA 3V56A 4LJHA 4PI2A 4F7ZA 1PK6C 1W28A 2TUNA 3NVCA 2QQPA 2VCAA 4UFMA 1QJZA 3VKMA 2WNUA 4COUA 4YGDA 1YCIA 5C3RA 5JOYA 2W0XA 1LR5A 4NIAA 3UK9A 4CDXA 2R30A 5A6QA 3K46A 4LO7A 2JB8A 4A6SA 5J36A 2VZ1A 3N36A 1A78A 1ZRRA 2Y6FA 2YC0A 1I5ZA 2IFRA 4PQQA 1H1MA 5H9SA 5FDBA 4ZZ5A 4NIHA 3NNGA 1DGLA 4EROA 2X5IA 1QJX3 3KHBA 3SKJE 1QOSA 1BLZA 3I59B 2QZ2A 4MGIE 3J7LA 1H8TA 2X10A 3M4FA 5T5JA 1VBE3 4PF1A 1OFSA 4V2WA 4YGEA 3B02A 1GNZA 5ANNA 1N1YA 4LT5A 3WHUA 5ACA1 1AR72 2YG0A 5CKNA 2VZ3A 4CU6A 2NPIA 5L9RA 3ZR5A 3T1MA 4OZOA 5A3TA 5IK4A 3JU9A 1G8WA 5FK7A 4A42A 3MLJA 1IG3A 5DMYA 4DS0A 2ET1A 5J09A 1NA1A 3BYWA 3HT2A 4JGYC 4OHXA 3WNKA 4Z07A 5L9BA 3E6BA 4AI2A 4Q4W3 5A6XA 3VB9A 1J59A 1OQEA 2ARXA 2YGLA 2XVGA 1PMIA 1X82A 1EV13 4IEUA 2ZZJA 4RR3A 1DGRN 5C70A 4FTBA 4FXKB 1YRZA 1JZ7A 3DEMA 3BN6A 3MFCA 3I7DA 1PO22 1ZZ7A 4Q0SA 5HCFA 5IWFA 5BNQA 2RM21 1POV0 2UWAA 1XNCA 2CDPA 5FZ4A 2RR12 5A3OA 4BJ0A 3JCIA 4HSJA 3SCGA 3WP3A 2PHFA 3URFA 1PO21 3V0BB 2A3YA 4YW3A 3DCQA 1ST8A 1RUE2 3OEAA 2IWGB 3ZYRA 3JD73 2VNOA 1C8NA 2RR13 1HRV2 3ACIA 4LUMA 3UYJA 5BNOB 3AL5A 3AP4A 2X09A 3B9CA 5EJ1B 3N7LA 3ZSKA 5DUWA 4CUAA 2XLAA 3M3QA 1Z0HA 3TEXA 1CIWA 1QOOA 1RUF3 4XQWA 2FQPA 1HXS1 3FHAA 3KD4A 4IE6A 4L2NA 4Q2FA 3VL9A 5F37A 1JYNA 2IZWA 1NA1C 5CBLA 2J1AA 3FLTA 3BKZA 2P3IA 3ZMOA 2GNDA 1SFYA 1AR71 4LA3A 1REDA 5IW0A 1C8M2 3WF3A 4B4QA 4NPMA 4V1PA 2KD7A 3OUJA 1RGSA 5DAPA 5FZHA 2ZABA 3KQ4B 1GOGA 4UW6A 5IK5A 2R49A 4M00A 1PZ7A 4NROA 3HVDA 3ZYGA 2TNFA 1BJQA 1W0NA 3HN1A 5HBAA 3PVOA 2IVJA 4FPOB 5DABA 1CIYA 1MS8A 2X5IC 4KMQA 2A75A 4JKMA 1XNKA 2D6LX 2DVAA 4LBJA 1DQ4A 1W6OA 2XJSA 4QXCA 4XEZA 4DEQA 3VD4A 1ZVFA 1OMIA 2VECA 2BOIA 4M3CB 4PLNA 1PZ9A 1PX3A 5EXOA 4HN0A 3MW3A 5GZDA 4GKYA 3V64A 4IV1A 3VZKA 2VL4A 1N3OA 3AXEA 4Q4W2 4QAWA 3ZR6A 4JDOA 1PK6A 1MEC1 1LRHA 3WUCA 3DXTA 3I3EA 5GJ6A 5DG2A 1JTZX 1HJFA 5IVEA 4FTEA 3M3OA 1QNYA 1HDKA 4LOTA 4SBVA 3WDUA 3KVAA 3OYWB 3HN3A 3PUAA 4FFIA 4P9IA 5GZFA 1CAUA 2BDRA 4OLLA 1VBA3 1GOFA 2DYCA 1IS4A 1DU3D 3DKQA 3LA3A 3VBHC 1O6UA 1XYOA 4PLOA 4OI0A 2HH9A 3NW4A 1FMD2 2E63A 2ZOEB 1JODA 4QB1A 5I0UA 3RWNA 3WG1A 4YM0A 1UOFA 3KGZA 1O4TA 5IJRA 3UKNA 4ZXEA 2BWCA 1SDWA 4IL7A 2PAEA 3K4DA 3J4UH 5FZ6A 5IAVA 4DOUA 5FXVA 4YPJA 4YSFA 3PUQA 2HWC3 2ZEWA 1Q3EA 1IG0A 1CAXB 1J3RA 1ODMA 1U5ZA 2FDJA 1RUF2 4N7IA 4QXHA 4ZHNA 2EVXA 4OHYA 1OSGA 4IGPA 1K3IA 4FP2A 4AQ6A 2WT1A 2E7TA 4A3XA 2W95A 3R05A 3WW1A 4QMAA 3T0DA 3W5NA 3VDBA 4QKFA 1A6CA 4OULA 4DNYA 2ZGOA 4XMIA 2DCJA 1XRUA 3LF7A 1KS4A 3PIGA 3UETA 1LOFA 2JD9A 2ZACA 2ZAHA 2OUJA 5FZKA 4DZGA 4IE0A 1L7QA 2GH2A 1N3QA 4ASLA 5FYSA 3PNAA 2A6ZA 4LULA 1K42A 1DBNA 4Y22A 3BUCA 1A34A 1TEIA 1SBFA 1QHDA 2G1MA 3B93A 5FZ3A 5DUXA 2Y0IA 5A70A 2LM3A 4Y22B 3O0WA 5HPOA 2VY0A 1DQ1A 2E33A 2MNGA 5FZ8A 4YVSB 1S2KA 2AYHA 3O7OA 1Q8PA 1A8DA 2ILMA 3HQUA 4Q4V1 4XUTA 4HN1A 1G9CA 1K12A 2WAOA 4AAXA 3FFZA 3NNMA 5L7OA 3C7GA 4IGQA 3ZO0B 4XFCA 1M06G 4DUXA 3ZFFB 3O1TA 1T6GC 2XQRA 2R072 2ZGKA 5CIRA 4BOWA 3GF6A 4LLFA 4PQ9A 3ETQA 5DG1A 5F5IA 1XYNA 2VZQA 1LGNA 3QH7A 1NOVA 2PLV2 3H3LA 1LEDA 2OKXA 3ZYPA 1OOPB 2XJRA 1XNBA 1Q56A 1OH3A 5EJ3A 4LBNA 2P3JA 3L9JT 3GJBA 3KCCA 1H6XA 5C4WA 5DN2A 4FAGA 4LE4A 4CTEA 2FD8A 3ES4A 4XDQA 5FZAA 3RPQA 4GJZA 1AL0G 2VUJA 4NHKA 5FY4A 4CDWC 1MR5A 5A7WA 5FYCA 3B5LB 5E6HA 2VAUA 4DXRA 2CWMA 2V5DA 1RITA 3OUHA 3ZFEB 4ONUA 1AL22 4EN7B 1WZXA 1HB1A 1C28A 2B42B 1J84A 1CVNA 1SLCA 2W47A 1POV3 3AZWA 5E1RA 3VD9A 3OSDA 4QGMA 2W9XA 1PO11 3I3DA 4ATFA 1AR73 1SBEA 4IV1B 5A3NA 5FV3A 3KF3A 2OA2A 1V9U1 4CSWA 3KSCA 1WBLA 3LEKA 3POSA 5FZ0A 3OPZA 2BERA 5ABJA 4IEPA 1NLSA 5IATA 5K0UC 3RJRA 1AUYA 2I2SA 5FYUA 1QJY2 1XU1A 4UFHA 4XW3A 1Y7BA 4JCKA 1POV1 2ZHLA 4Q5OA 2X05A 4Z8BA 5LBBA 3WUDA 1BXHA 2DTWA 4CXXA 3TYJA 4XDOA 5FPBA 4F83A 4E27A 2IXJA 1AYN2 1XC6A 1MVEA 2RS12 2EIDA 1EYBA 4XFHA 2YXSA 4FOQA 2FDHA 3E6CC 2OXBA 2XLFA 4YZ3A 1R092 1UZYA 3CZJA 4PJYA 2FMDA 2HBTA 5FY1A 3P5BA 4CDWA 1AXKA 2XL7A 4MH0E 1W6NA 2E6VA 1RINA 5CFCA 2B9UA 1AYN3 1WWYA 2WIIB 2HYXA 3BU0A 5JMOA 5J7MA 1BVVA 1HRV3 3DUIA 5KR7A 1WD3A 1BEV3 4BK4A 4XF4A 4ZS3A 2VQUA 2NM1A 3W58A 3I2OA 5JOXA 1U0AA 2J22A 2VMEA 5FYBA 1IPJA 2SBAA 1HB4A 3A0NA 3MIHA 4CU7A 1GANA 5LY1A 3H7JA 2WT2A 4FVVA 4JQRA 3TB0A 2XHKA 1K45A 1Z7S1 3V0BA 3LDRA 4Q0UA 4XXAA 4GQ7A 1C8M3 1RUC3 1NT0A 4CP2A 5DDJ2 1BYHA 4CU9A 1JZ3A 3MIBA 5GLZA 4LOSA 1CWPA 5L9VA 4LK7A 2ZX1A 4Q0VA 4LHKA 4HETA 4UYBA 2QVSB 5JSRA 5E88A 4YVWA 5FXXA 4CE8A 1RUC2 4MADA 2AZ5A 5FZMA 2RS32 3I3QA 4AEMA 5J1XA 4ASKA 3CLPA 1SHWB 3M3CA 1WLCA 3AMQA 4IE5A 1AR91 1W0PA 4FI9A 4UFIA 4XFIA 4FAHA 3S0MA 4UBHA 3JB4C 5FUPA 1KITA 2D98A 1GLHA 3ZXFA 4L11A 1FV3A 5HXVA 4XZPA 4E8CA 1CAVB 4CDXC 3MLKA 1CX1A 3K3OA 4Y1ZA 1XE0A 2YDEA 2VVDA 1JYWA 2ZX4A 2A1XA 3B01A 3NAPC 3OG2A 4CCNA 2YV8A 4YVSC 3NO8A 2PELA 3AFKA 5FK8A 2CDOA 3D5OA 4NRPA 1LOFC 1VBD2 1ZBE1 1WCQA 2EICA 3GGLA 4H14A 4IE4A 1W6MA 4Q4X1 5APAA 5FKBA 3WQ1A 5C8CB 5FOJB 5A33A 5GLUA 2BTVC 4MZUA 3IDEA 3BU7A 5L19A 4FOWA 1GU3A 1RUE1 1IQAA 2XBO1 3JBG2 4Q29A 1GP5A 2CSGA 3AXDA 1WMDA 4B4PA 1KJRA 1H2NA 2D6PA 2P17A 2WL1A 4XUNA 2OUHA 2WZR2 3DYMA 1IOAA 5JI9A 2NZ9A 4AGVA 1APNA 5I0DA 1DDLA 1W8OA 3Q8FA 3RZHA 1W9SA 3GALA 5FUNA 3SH5A 3I49A 2EXKA 4TXWA 4M01A 5FZLA 3U37A 3R4SA 2WWJA 1E5SA 2CGOA 3VKFC 4P9LA 5CA6A 2ES3A 2WUHA 3LEIA 3NV4A 2W5FA 1GWKA 1ZBA1 4GMP1 4QPYA 4YVWB 5EP9A 2JKXA 5C4WB
chains in the Genus database with same CATH topology
4OI1A 1JN2P 5FAXA 1R082 4YVWC 2A6XA 3KB5A 1IKQA 3FZ3A 5JOWA 1ND3B 1W39A 1SLLA 1K5MC 3BIWE 3CEWA 5LEKA 1RUI3 2D7FA 2YGMA 2R042 4RQPB 4UW3A 1DGWA 1BK1A 3TWIA 2BNNA 2O8OA 2RMU2 2ZGQA 3QOPA 5K0UB 3HIFA 3SHRA 4YG3A 4JGZB 3H0OA 2QE3A 2HWD1 4EV0A 5EYXA 1W6MB 4J1XA 4M3CE 1MS1A 2E7QA 1CPNA 1E57A 2NYYA 4NHLA 1I6XA 3VDDC 4Y1YA 5K8SA 1NY72 1PO13 1W6NB 4N7UA 4ASMB 5CFCB 1KRIA 4XPVA 2ZS6B 4GB31 1CAVA 1V6JA 3TBDA 4J6GA 1EPWA 3FWEA 3ZXAC 4YG0A 2WS93 1O3QA 1KDKA 1KFUL 3IDBB 4NWWA 1OKQA 1WW6A 1W6PA 4KBBA 2C9AA 2JG8B 5DUVA 3ZMNA 1PIV2 5FO8B 4GWNA 2RJLA 2ZTNA 3BOWA 4FCAA 3WX5A 2DFCA 1S0JA 3USUB 4B8EA 4TWTA 3VKOA 4PF5A 4NWVA 1ZNPA 3WG3A 4YFZA 4GB32 2X53S 1KS5A 2GZWA 1LHUA 4P14A 1VBC2 4XXPA 3RZZA 1WD4A 1QMJA 1OQ1A 3E5XA 1QKQA 1L3JA 3WVJA 4ISRA 4RS5A 1RUI2 4X6RB 4KGGA 2JG9C 2RS51 4XJWA 5ACA3 4FPKA 1VAKA 4O9GA 3SCHA 3KT7A 1YHFA 2UWCA 4ES9A 1VAMA 3KZ4C 3HAGA 3V65A 2BW8A 3MI8A 2WNVB 2QKDA 5FQ0A 5KHIA 1EY2A 3RYRA 4B29A 2XKPA 3SNMA 3WHTA 3NV3A 5L7OC 1NCQC 4QQHA 4OHWA 3VBSA 3X29B 2OZ6A 3GNEA 1ULCA 1O3SA 2HWF1 1OLQA 2JENA 4XF9A 1JH5A 4DRVA 5D8AB 3GYDA 2C1FA 2HWF2 2WLPA 3J26N 5CU1A 3FJSA 3HR9A 1YIPA 4WM7B 3ZXJA 3MPBA 4BH9A 3ELNA 1VBB1 1LB2A 1C5HA 3ALQA 1DGRA 1RC6A 2XBO2 5CAZA 4FXGB 1V6IA 3ZN6B 3WT3A 3CU7A 1UZZA 1LHOA 5FRAA 2A71A 4AFMA 1OA3A 2JECA 3LB9A 3FBMA 5IUQA 2VW1A 1MZEA 3JQXA 4P5HA 1Q8OA 4PIYA 3EBRA 4OUSA 4COZA 4R9DA 4LBQD 4A7ZA 5BNPB 3FUQA 1S0BA 5T54A 4MXWB 2YPJA 5FTTC 2OYZA 1CAXA 1OFNA 1QJY3 1QDOA 1VBC1 1CX4A 4LBOA 2XG3A 5F1RA 1J58A 4Q26A 2Q8OA 3D0JA 3ZFFA 3ZYJB 3R4UA 5L7OB 2PHLA 1U5XA 4FP3A 1PVXA 4AFDA 5I91A 4K6BA 4GH4C 3B3QE 2DVGA 1XYPA 1NA1B 2G9GA 4DY3A 3O14A 2ZGNA 2R0FA 3AZVA 3MYXA 5CFDB 1BCXA 1FV2A 4Q4Y2 4WM7C 3WLUA 4ZXKA 5IK7A 1H8TC 4WZCA 4IERA 3JBG3 2HWB3 3AMHA 5KHKA 1YWKA 1TME3 2VULA 2JE9A 2CNAA 2XKOA 5JSPA 4I09A 5A32A 1H2KA 3NAPB 2ARBA 2IXIA 3FLRA 4JDMA 1JUHA 4OHZA 4GWMA 4CP1A 3K48A 4K1ZA 5DDJ3 3IMNA 3JB8A 1GICA 2VW0A 1NZCA 4FPLA 3PMEA 3B9IA 2BGCA 3MICA 4TZDA 3AYCA 1WA4A 5FMOL 1YUDA 4AVCA 4Z2WA 1GKBA 2PHTA 3DKWA 3MDPA 4LR4A 4HKWA 4W6YA 2AH2A 2RMU1 4FOVA 2BFUS 2D93A 4W6WA 3OY8B 4GULA 4IEXA 4OZXA 2EF6A 1YFWA 2IXLA 4AQ2A 5J96B 4AVSA 2ZZQA 2GMEA 1RHI1 4JAAA 1U5IA 4H3WA 5JPNB 2ZGUA 4XMAA 3OYWA 4E2GA 1CPMA 1Z7S3 5C33A 3QBQA 4RSUA 1YFXA 4CEYC 1UCXA 2G4IA 2JDZA 2QUOA 2HWC2 1PK6B 5AFEA 1PO12 1WLDA 4TLFA 3WP4A 4KG8A 2VNRA 2D40A 1QJU3 4HVQA 2UURA 4WM8B 1XE8A 1OPOA 3VZMA 2ZKNA 1OPMA 3GZAA 1W6OB 4JGZC 4QPIA 3OCPA 1VIWB 4JGYB 4JVAA 1N1SA 4PDWA 5J98B 3RQ0A 1VBD1 3SXWA 1FYUA 4DB5A 4BE3A 5AVPA 4LBLA 4DINB 2BNMA 4G4FA 3WG4A 4XE9A 3TN92 4Z82A 4N43B 1RVF3 3AYEA 3D4KA 3WDYA 1SLTA 1WUVA 4D94A 1ULEA 3RMXA 2JX9A 1H8TB 4R9AA 2O8QA 3ZIXA 2UY9A 1UPSA 4FQ4A 3I59A 1QJX1 2IXHA 2PHRA 4L9BA 5CFCC 5DZFA 3LA2A 1RUJ3 4R4XA 2TEPA 4HPKB 1AYM1 3LKJA 4FT8A 1FMD3 1PZ8A 4MV2A 2GAUA 5A3MA 4XYXA 4BCUA 1WW5A 4KWJA 4AHWA 1MZFA 4NVPA 1H2MA 3KT4A 2W08A 3O5SA 4AQTA 4YYOA 3VHNA 5J3UA 3R4DB 1I3HA 4PIXA 1RUG3 4C91A 2YUEA 4MGZE 2Q30A 1LOAA 2DFBA 2Z79A 2WC2A 1G86A 4AF9A 4AEDA 1JYIA 3OBRA 2ZMKA 3S6PA 4ZKTB 4UW5A 1LOCA 5E16A 4IETA 2QJVA 2GALA 2GN7A 2XWJB 2DCYA 2HEYF 4AVVA 5I0TA 1GSLA 1VRH3 5GLTA 2OIIA 3JQWA 1ASJ3 4Q4V3 1KXGA 3TNPB 3KGLA 4LBQA 1HQWA 3SCFA 4QPIC 3ZSMA 3RYPA 1VALA 2EA7A 3MPPG 4L97A 1OA2A 1RUH1 4YM3A 1SCRA 5LK7B 3OD4A 3BPZA 3ILFA 3EJKA 1OD5A 2CV6A 2VVFA 4I0BA 4XETA 2OPKA 5KXDA 5GZCA 2B5HA 3N35A 1FPN1 2I07B 2PYTA 3KM5A 3A4UA 3VBRA 2VH9A 1ASJ1 1WW7A 3RSJA 1MEC2 1NYWA 3AX4A 3ZDSA 2BWAA 1V9U2 3IN9A 4Y1XA 4P9GA 4I0WB 1ENQA 1YO8A 1SCSA 1UAIA 5CG8A 2DUQA 4B7EA 1LESA 3GHMA 4X6QB 4X8PA 4HANA 2D3PA 2PTMA 4RHV3 2VOVA 1PHMA 4QM8A 2JG8C 5FLJA 4XBLA 1NCRC 2MHFA 1IS3A 1AL21 4O9EA 3AZZA 2BQPA 4XFFA 3H8UA 2R6QA 1UN1A 1FX5A 4AVBA 3CJIB 2GC3A 4P9XA 4FPFA 1X50A 4COYA 3VBUA 2YY1A 4IV3A 2MEV3 5C8CC 4XILA 3V0AB 2R041 2VOWA 1RUG1 2PN5A 3E6DA 3IPVA 2O0OA 4FQZA 2WFF2 2DWRA 4WZFA 1G9FA 2AGSA 3GZUC 1MQTB 3H1WA 3BB6A 5H9QA 2PAKA 2OZJA 4Q1RA 2BEOA 5BNNC 4IV3B 3AYDA 3IBMA 4XOGA 1NCRB 4IQPA 5T52A 1Y9QA 4HPKA 2D44A 1G6NA 1AR61 5LRSA 2PA7A 1KQRA 3M1HA 4AWDA 2P3KA 5GLWA 3RRDA 3TOJA 4BPZA 2HWE1 5C8WA 1NE6A 3N7KA 3OGGA 1R1A3 4IXLA 5CVRA 1HV0A 3W59A 4QQOA 4AXOA 3ES1A 1ND3C 1NXMA 3VHOA 2QFEA 2ZMNA 3KT1A 3PTYA 4KQ7A 4BZ4A 3FLPA 2RR11 2WFPA 4Z92B 3LCPA 3JD71 1JXNA 1MZ6A 1QH6A 1TNFA 3VBHA 1ZBE2 5TSWA 2WZPP 4EN0A 3PVBB 4A2UA 2RS52 2A6VA 1VBD3 3ZXDA 2JE7A 1GNHA 2XL9A 4CDQC 4GB33 1DYKA 3ME2A 3D6EA 5BNNA 3I54A 4CDQA 2D3SA 1XE7A 2FMYA 1H9WA 1B35C 3AP5A 1D2QA 3D0SA 1UKGA 3ZFFC 4F3JA 5FO7B 4W6XA 1V6KA 4Y20B 4M0HA 5HCBA 1YNAA 1XQNA 4COVA 1V6NA 4WVZA 1R093 1PVC3 2GMPA 2ZA9A 1PM7A 3LA7A 4WV8A 5GZGA 4GXLA 5FO9B 2LTNA 4RGAA 4XJZA 2HWE3 1VBE2 4HBNA 5C4WC 1NE4A 1W2UA 1PVC2 2HEWF 1MVQA 1ZZCA 2EAKA 2I74A 3QACA 2DCKA 4P9YA 5HCAA 4ZU5A 2HJIA 3WW3A 1K5MA 1MS0A 4Q4W1 2VU9A 5I93A 1UW8A 1RVF2 1EV12 5L73A 2B39A 1Z78A 3I2DA 2WQ4A 3DGTA 3U11A 3VL8A 1S2BA 1RUJ2 2ZHKA 3VBOB 3NWKA 2RS33 4D7TA 1ZBE3 4C1XA 4NN0A 1RJ7A 3ZN6A 1BBT1 1CJPA 3IKWA 4N43A 4OI4A 3THPA 4D7YA 1LHWA 1CR7A 4Y5Z0 3H1MA 1RUOA 1RMU1 1QJU2 4CYDA 1ZBA2 2WSVA 4P9JA 2D97A 4GH4B 4ISQA 1HV1A 1SEFA 3DPRA 1WCKA 3RI8A 1S0CA 4SLIA 3JD72 3R0RA 4QQLA 4DPNA 1WCDJ 2WZR1 4L8QA 5FBZA 4D7SA 1SBDA 2XUMA 4FPEA 4K9SA 5FLHA 4MXWA 3JBG1 1VRH1 4QQ2A 1FNZA 1YI9A 4K21A 4Q4X2 2IXKA 1TMF1 2HWB2 1IPKA 1YFYA 1X7NA 5DZEA 3AYAA 1V00A 1FOD1 3FUOA 3H3ZA 4LHLA 1FXZA 4I0AA 5C9AB 1ULDA 4GMP0 4XTMA 3VN4A 2GC0A 3OY8A 4YG6A 2K0GA 3U10A 1ZRDA 2CTVA 2R071 3ZVXA 4WM7A 1OHFA 2ZPXA 3AP6A 3AJYA 4AGGA 4OHVA 5EWSA 1YJLA 1AX0A 4ZU4A 3USUA 2D6NA 3P3NA 2X29A 4CDUA 4W65A 3UJQA 2RS31 4DRRA 3LOIA 4CEWA 5DZGA 1NG0A 4LO8A 1Q8SA 2JEMA 2R061 3VBHB 4N9IA 5KBFA 5FQ0B 3H9AA 4WVVA 2K9ZA 5CFDC 2IC1A 3THTA 5CG9A 3IT8A 2WFF3 1IKPA 1MS4A 4HZFA 4Y1UA 3J8F3 3UL2A 1AHSA 2DCZA 2PLV3 2ZBJA 1C3HA 2TBVA 2V73A 3SISA 1HRI1 3ZFGB 1S0GA 1GZ9A 3N7JA 3SH4A 4MVTA 3QCWA 2Z42A 5AVAA 3PJYA 1AR82 2CYFA 3BTAA 4E4ZA 2VNGA 4ATEA 3UV9A 1LEMA 4EWAA 3B94A 1R091 4YRDA 2DUPA 2GNBA 2PFWA 2C5DA 4Q8KA 2FZ2A 1R1A2 4TYSA 4I30A 2CY6A 4MYEA 5AC93 1AR83 1R1A1 3H7YA 1ND3A 4YGBA 2ZGRA 1AVBA 1IS6A 2JG9A 4RL7A 4ZU7A 3APBA 1YYNA 1HIXA 2QCSB 3POYA 5D8AC 1AR81 3LSDA 5T5PA 1LGBA 3AKQA 1G9DA 4XHBA 1QXJA 1J3PA 3VBFB 1DGWX 2H0VA 5CNAA 1BVP1 1QDCA 1F5JA 1COV1 3WW4A 2F4PA 3VBFC 2D43A 2ZGMA 3KCYA 1A3KA 1ZZ8A 1LECA 1YLLA 2KXLA 4F8AA 2A5ZA 3ZXGA 5JZGC 4LBMA 3VKNA 4GIQA 5C6CA 1G9BA 1GV9A 5KC6A 5C8CA 2XJUA 4BIFA 1J1LA 1LU2A 2R062 5KXCA 4FTSA 1SMVA 5KC5A 2V5YA 4DFSA 1QJX2 4ORFA 3FE5A 4IESA 4LBQB 4RHV1 1UF2C 4HK9A 4KWLA 1CONA 1TME2 2Y38A 3PMSA 2VQ0A 1LENA 4YW1A 5J37A 3U0ZA 4X8NA 2JJ6A 5T3NA 4I3PA 4RQPA 1ZM1A 3UKVA 3OGJA 4BHPA 4R9CA 1AZDA 1NXD1 2EAAA 5A3LA 1PGW1 2HWB1 1OLRA 1PGL2 1DHKB 2P2KA 4XQDA 3KQRA 4META 2FBEA 1CN1A 1VRH2 3AJZA 4FPHA 4AEDB 4AVAA 3N4MA 1EP0A 2VMHA 2DF7A 2E53A 3VBOC 5JIUA 3NJZA 4OFGA 4Q4V2 3AKSA 4FPJA 1TMF2 2QNKA 1VB2A 2JXAA 4YARA 3VZJA 1Q43A 5BUVA 3H50A 2DU0A 4QM9A 3ECQA 4P9WA 2HWD3 4Q1PA 2Q5TA 2XLGA 2RM22 1WMFA 1S1AA 3TNQA 2AUYA 4UXAA 3ZPYA 1UU4A 1SLBA 1MEC3 1EAH2 3FC0A 1BEV2 2JD4A 4LE3A 1Q8VA 4RR3C 3ZFGC 1C1FA 2VOXA 1X33A 1RMU2 4Q4X3 4AK3A 4A7KA 2CGNA 3E5QA 3MW4A 5SV5A 3CO2A 4R52A 5FPXA 1GR3A 4I01A 2XH6A 4MXVA 4QX5A 1EAH3 1TNRA 4E9KA 1RUH3 1BBT2 3ILRA 2NMOA 3HD8B 1ENSA 3OBTA 3FBYA 1ENXA 1LJ7A 5EV7A 2R0HA 2CGPA 4HVRA 3B69A 1JHNA 5GALA 3OF1A 2W68A 1FMD1 1ZZ6A 5FCCA 3M3IA 2B8MA 2VPVA 2Q1ZB 4HKOA 1DLLA 3VZOA 5ABJB 1DQ5A 5FPZA 4BMBA 4WBBA 4WVMB 4HVOA 4LO4B 5GM0A 3FFQA 1DYPA 4RQPC 3CF6E 3POWA 4WM8A 4XFBA 2WT0A 2PQQA 1RVF1 5I8TA 1TQ5A 3LOBA 1PVC1 4ITCA 4C0HA 1R083 2ZGSA 3EO6A 1QQP3 3SLIA 2UYAA 1YXWA 1EPZA 1PO23 3ST7A 2ZX2A 3JUUA 1QU0A 3RJ2X 2UY8A 4XFAA 1LU1A 2VVEA 1RL3A 1LHNA 2RM23 1BQPA 2N7GA 1NLRA 2WINB 5FFOC 4RS5C 2FZ1A 3NV1A 4LO5B 3LSEA 4AQSA 2GNMA 2GC1A 4Y26A 5KXEA 4XF1A 1WGPA 2CAUA 1NQJA 4CP0A 4R8HA 1C8M1 4GALA 3WCRA 1LTEA 5AFBA 2ZCWA 2DVDA 3NSTA 4QXKA 4KG0A 5A33B 2FHRA 1JW6A 2VMGA 2I45A 1H30A 1HXS2 2HYKA 4CEYA 3J8F1 1RHI3 1WLWA 1BMV1 3EHKA 4OI2A 5F6KA 1BEV1 3LWCA 1HRV1 3MF6A 5JOZA 3MIDA 1UPIA 4HL0A 5FREA 1UIJA 2ZHNA 1FI2A 3N7MA 2YHJA 2EXIA 2DUOA 4RGGA 5AC91 1I9RA 3LZZA 2HWE2 4BYYA 4CRQA 2A70A 3ATGA 2CWSA 4N9HA 1AJKA 1SLAA 4XBQA 1QQP1 1MS3A 4U36A 3CJIC 1DZTA 4RFT0 2YYOA 2R1BA 4AI0A 1H4GA 1O4YA 1Q8QA 2NMNA 1AR62 2Y26A 4INDA 1KDMA 1QH7A 1W0OA 4KGQA 3NKGA 1PGW2 2WFF1 3MIEA 2GU9A 4QHBA 4XQ4A 1F5FA 2E7AA 1S55A 1ZA4A 3HWJA 3AFGA 1H0BA 5ACA2 4K20A 3J9SA 4IEZA 1AR63 4XFGA 3M2MA 1YI7A 4JRLA 4LO6B 3AP9A 2ZGPA 3C3VA 2WNEA 2B46X 2NP0A 1RUI1 4RA0A 4DMIA 4Q0QA 2OW4A 4LBKA 4IEVA 1N47A 1HKDA 2A6YA 1ND2C 1GZWA 1ZREA 1AXYA 4JTOA 1VLNA 4AFBA 4CDWB 1UX6A 3PHMA 4QPGC 3E97A 1JOJA 4E2SA 1FPN2 1CESA 2EXHA 4M0NA 1LHVA 4AGRA 2ZHMA 5D8AA 4M3CA 4BLIA 1F2NA 5I8SA 1RUD2 2XBO3 3VHPA 1D4VB 3FMGA 2ENRA 5CB7A 2XVKA 4D3WA 1MS5A 5IK8A 3AP7A 2A3XA 3VBSB 4AE2A 1IS5A 2DVFA 2HKXA 5F6LB 3PVEA 2PAMA 2R1DA 3UKTA 3WY6A 4AEKA 4XBNA 1OOPC 4MGKE 1GZCA 1LOBA 1AF9A 1HQLA 3AB0A 3ZFEA 5BNOC 3ZN4A 5HI0A 1GZWB 5BV6A 4JTNA 2XVLA 4RS5B 1CAUB 3MF9A 2ZKLA 1HRI2 3WDWA 1ULGA 1U12A 1LODA 1JUIA 2UYBA 3ZN5A 1LOGA 2LUWA 2WA3A 4EN9B 1CD3G 3FHIB 3FX3A 4K7JA 5GLVA 5T5OA 4BMEA 1X36A 3UJOA 3EQEA 1DIWA 4C0BA 1SQ4A 3WP6A 1ULFA 3S7IA 1N1VA 4E2QA 3SH3A 1HQNA 4FBFA 1UU6A 3WCSA 3USSA 3H3UA 3M70A 4NHMA 2DTYA 3WZ1A 1I1EA 4HT1T 2JG8A 2GNTA 1GBGA 3I8TA 4AVTA 1AYM2 3KCXA 1VBA1 3MW2A 5LRRA 2CAVA 2O1QA 3M3EA 4YM1A 3RNSA 2D6MA 4I02A 3GBWA 1O7FA 1DQ2A 1PNGA 1AYM3 1KJLA 4WM8C 5EFUA 5K9YA 1VR3A 4DXZA 3TN91 3R6SA 3SITA 3S7EA 4AEJA 1IHMA 3VBOA 2VW2A 1WCSA 5FLIA 2IXCA 4IEOA 4GA9A 1HXS3 4CEYB 4OVEA 3AZXA 1WBFA 2GDFA 1YIFA 4WVWA 1O91A 2GH8A 3BCWA 3I4IA 3QD6A 5LEJA 1PGSA 2AENA 1VB4A 1H1AA 4Q8LA 5K0UA 4EN6B 4MLOA 5ABJC 1PNFA 3ACLA 3QLQA 2D6OX 2QZ3A 2QDRA 3WV6A 3ILNA 4YW4A 4KL1A 4QD2A 4H7MA 3O12A 4U2AA 4BIOA 3RI9A 1HRI3 2UWBA 4LNVA 2NN8A 2RS13 2DVBA 4RR3B 4Q4Y3 2Z69A 3GBFA 2ZMLA 3WXPA 4AEDC 1QJU1 2ZGTA 4AHZA 3AKRA 4EJRA 2BPA2 2H6BA 1RHI2 4LLOA 2NLRA 1WMEA 5DDJ1 4B3NA 2R063 2ERFA 3VHRA 2XB6C 2KA3A 3DF0A 1AX2A 3AMPA 4BM8A 4K40A 1C5IA 4WVMA 3DN7A 2X5IB 1ND2A 1ZBA3 2ZX3A 3MIGA 5JIAA 4IEQA 4LTAA 4MSVA 4AFCA 3MFAA 5BNPC 4XJ8A 1V6MA 1EV11 4K8FA 1MS9A 2ZGLA 2GMMA 2P34A 2B45X 4AFAA 4EWDA 1FNYA 2WNUB 5BXXA 2Y0OA 4JDNA 3WG2A 1FPN3 2H0BA 2PHXA 3NV2A 1LULA 1UMZA 3P3PA 2R043 1F31A 2P37A 4ES8A 2A7AA 1RUE3 3ENRA 2OVUA 4LUKA 3HBZA 4EWEA 1H8VA 2NQYA 1QJY1 5IT6A 1VBE1 3RMYA 5JI7A 1RUD3 1NQDA 3AK0A 2WS92 3NKTA 2W52A 2VGDA 4BLJA 5BNOA 3L2YA 4XJAA 2E9QA 3OJBA 3WNXA 2XJPA 1CGPA 1C1LA 2GSYA 3MEPA 4DY5A 3MLLA 3RS6A 2BVBA 2WNVC 1QWRA 4PCRA 1KFXL 2XJTA 4PLMA 2KM2A 3K51A 1D0HA 5E8AA 4FSJA 2ZAAA 2PHDA 1D4M1 4XTPA 1VBC3 2DCTA 3VZNA 2BNOA 2LALA 1SLIA 2G9FA 4XIKA 1AJOA 1CAWA 4B7KA 2DURA 4BWOA 1SFNA 2WNUC 2R32A 2WSUA 3CJXA 1H1IA 4JRAA 1O5LA 4H55A 3AZYA 1VBB2 4K3UA 3VBRB 4XJUA 4XIOA 3KLSA 4Z1VA 4YZ2A 5JDBA 5JPMB 4L92A 5T55A 3PVNA 4E4SA 2E51A 3AM2A 4QGLA 3MGUA 4R9BA 1VBB3 3WW2A 1O5UA 3JZVA 4G9SB 4QPGB 5SV8A 3CL1A 1Y43B 2ATFA 2GN3A 3L2HA 1C4RA 3G6JB 2VQAA 4LA2A 4BA6A 4K1YA 1O3TA 3VUOA 1UIKA 3PJQA 1COV3 1B35A 2Q1MA 4FPYA 2HEVF 5AC92 3Q9OA 1D0GA 3WP5A 5C9AA 2HWF3 1RUG2 2PHUA 1UU5A 1REFA 3VBFA 3N3HA 1BMV2 4AI1A 3J8F2 1ALYA 3VV1A 2WWSA 5T50A 1VP6A 2H6CA 3MIFA 5L36A 2CL2A 3VBUC 3WOGA 4URTA 4HMZA 2XGXA 3E5UA 5I0RA 2ETEA 3VDDB 2AR6A 3IWZA 2PHWA 1RUF1 1OOPA 3GHNA 3INAA 1O3RA 2RS53 4PIZA 2BFUL 4YLZA 3C2UA 2VG9A 5B2GB 4Y4YA 3M8LA 1ASJ2 2WS91 3ZSLA 3B00A 3VGIA 5BY5A 2VXRA 1ZRCA 2RE9A 1NCQB 3ZXKA 4CZSA 1S0DA 1W6QA 1JYCA 3W9AA 1F9KA 1OQDA 1XXNA 1RUH2 4H7LA 4YVSA 3ZFGA 1XNDA 3WQ7A 5BPXA 1N3PA 1S0FA 5T5LA 4FO9A 1V9U3 1RIRA 5FOBB 1AXZA 1GFF2 1V6LA 3AMNA 4I2OA 3D8CA 1UKRA 1V6OA 1JBCA 1X8EA 2DU1A 3KMHA 2Z2SB 1B09A 3LGRA 4N53C 2XJVA 2D3RA 4TSVA 4PDWB 4CEWB 1NY71 2RHPA 5HBAA 4S2DA 4COWA 4N53A 2JG9B 1ZX5A 4NR1A 4D69A 4QT6A 5EYYA 4I3GA 2XJQA 5CADA 3RG0A 2HWD2 3RDIA 2DV9A 5JZGA 5C9AC 3OD0A 3WDXA 1UL9A 2RJKA 1QNWA 1AL23 5J48A 1YFUA 2Q4SA 5FMOS 3TRSB 1FOD3 4YGCA 2BYVE 4HFSA 4YZ1A 1OI6A 3G7DA 5K7PA 2BBVA 1LOEA 3HT1A 4YW5A 3AKTA 1R081 4S2FA 2UU8A 1URXA 5GKAC 4MUVA 4YZ5A 4KU8A 1EAH1 2YZ4A 1QQP2 1J1TA 4XHXA 1WW4A 1BBT3 3QH6A 2EALA 3IIAA 4FOYA 4YFWA 5D1IA 4Y24A 4BQ1A 3D82A 3DPRC 3VLBB 1WLTA 2D6KA 5JAXA 4AI8A 2D5HA 4OUMA 4AHXA 1DG6A 1MACA 1D4M2 5JCTA 1VJ2A 1X8MA 2F6BA 3BODA 4CDUB 3U4XA 1PGL1 3NAPA 3IM0A 5A32B 1V70A 5KHJA 1BZWA 4GKXA 5JVVA 3ZXLA 4MGYE 1DQ0A 1UD1A 5I0SA 4IEYA 2VMIA 3HQXA 4NPRA 4G3YC 5JR7B 4AW7A 1ZZBA 5DUUA 4PBPA 2SLIA 1VAVA 2GC2A 2JKBA 1YJKA 4YW2A 3IDCB 2HWC1 5CFDA 1RUC1 4AG4A 2Q0AA 1C57A 2VOKA 2B7YA 1ZYBA 2YMZA 3WR0A 5BYNA 1IGOA 1AR92 1W6QB 4JV4A 2WLQA 1N1TA 1NCQA 3VBSC 1BKZA 4KWKA 3LAGA 3A0KA 2WQZC 1GQGA 1OA4A 1GQHA 1AR93 1QXRA 1K5MB 3KS7A 2V09A 4Y1VA 1ENRA 1G9AA 1COV2 3IPVB 4IV1C 1QXPA 2XPJA 4KH9A 5H9RA 3DPRB 5BNPA 1Z7S2 4QU2A 1H4HA 2A6WA 3CJIA 1QF3A 2A3WA 4GH4A 2ET7A 4IV3C 2YROA 3VZLA 1SACA 3B7MA 1TE1B 3ZFEC 1RUNA 4C1WA 3WINE 1REEA 1AX1A 5DXDA 2WJSA 3DL3A 1B35B 2EXJA 1H2LA 2R16A 1KD7A 5EZWA 4LHNA 4Q4Y1 4A7YA 4QQPA 5JMCA 2RS11 4C90A 1AYN1 3RYKA 1RB8G 4CDQB 4FPCA 5BNNB 4M3CF 3VBRC 5E89A 4YZ4A 1R1ZA 1Q5OA 3PLQA 4AHYA 3GBGA 1H9PA 2AREA 5KHGA 5F9TA 3GZTB 5F5QA 3HMYA 1QOTA 4CDXB 3O0VA 4Q0PA 4PBOA 4YM2A 3ZYIB 4YNIA 2A73B 2JICA 2QDNA 2WNVA 2MEV1 5JWPA 1QY4A 5JLVA 1XU2A 3VKLA 4UBGA 4XF3A 1GYKA 2XWBB 1DZQA 3BOPA 3H1YA 4KNCA 5GZEA 3TN93 3OTFA 5KXBA 1RTVA 3EXUA 3ASIA 3DV8A 4Q27A 3MZHA 1ZZ9A 2MPFA 1S0EA 4MX3A 1RJ8A 4N90A 2RMU3 2BVVA 2WKKA 4CEWC 1HW5A 1MQTC 3WDVA 4Y20A 1DF0A 4R4ZA 1ONAA 3CNAA 2D5FA 4S2HA 1MQTA 5JZGB 4FPGA 4DQAA 2X8KA 5I8YA 1O4ZA 3O0XA 4IEWA 4J1WA 3ZIWA 4QPGA 2PLV1 1HLCA 1FOD2 1VBA2 3ZSEA 3BALA 4HSLA 4LEJA 4PDWC 1DQ6A 2R073 1J3QA 1PIV3 3T2TA 4N53B 1FT9A 1TME1 3T1LA 1M4WA 3AMMA 3U07A 3AKPA 4RHV2 4XF0A 1LKNA 4L99A 4CDUC 1F8VA 1W6PB 1CQ9A 5KHHA 3M7AA 1DZRA 2W39A 2Z5WA 2MEV2 1D2SA 4B4RA 4E4DX 1G7YA 4AYUA 5H9PA 4HKLA 2C0ZA 1S0IA 1CAWB 1MZ5A 1U5YA 2ZX0A 4UW4A