2VVIA

Irisfp fluorescent protein in its green form, trans conformation
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
218
structure length
217
Chain Sequence
SAIKPDMKINLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVKEGGPLPFAFDILTTAFNRVFAEYPDHIQDYFKQSFPKGYSWERSLTFEDGGICIARNDITMEGDTFYNKVRFHGVNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDITMALLLEGNAHYRCDSRTTYKAKEKGVKLPGYHLVDHCIEILSHDKDYNKVKLYEHAVAHSGLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GREEN TO RED PHOTOCONVERTIBLE GPF-LIKE PROTEIN EOSFP
publication title Structural Characterization of Irisfp, an Optical Highlighter Undergoing Multiple Photo-Induced Transformations.
pubmed doi rcsb
source organism Lobophyllia hemprichii
molecule tags Fluorescent protein
total genus 58
structure length 217
sequence length 218
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01353 GFP Green fluorescent protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.155.10 Mainly Beta Beta Barrel Green Fluorescent Protein Green fluorescent protein 2vviA00
4XGYA 2WHSA 3IP2A 3NT3A 2GW4B 1H6RA 5EJUA 1MOUA 2AH8A 3DQKA 1W7SA 5EB6A 1HCJA 1ZGOA 1RMOA 4JGEA 1S6ZA 4Q7RA 3U0KA 2Q6PA 3SVSA 3DQJA 4J89A 2POXA 3SVUA 3UG0A 4W6NA 1JC0A 5BT0A 2DUIA 4W6MA 3SS0A 3SG6A 1CV7A 5HGEA 4U2VA 4EDOA 2V4EA 4W6CA 3U0MA 4PPKA 3W1CA 1EMMA 4DXNA 5HBDA 2A53B 2A50B 4W7RA 3E5TA 1C4FA 2G6YA 3VICA 3RWTA 3UFZA 2B3QA 2HQZA 5KTGA 4W74A 2FZUA 3ADFA 3EK8A 2DDDA 4L1IA 2VVHA 5DTZA 4W6IA 3NF0A 4W6AA 4B30B 3A8SA 4W6JA 3GJ1A 2WSOA 3EKJA 3SG5A 5DPGA 3DPXA 3KCSA 3M24A 5EXBA 1Q73A 3V3DA 1Z1QA 2H5PA 4KW4A 3DQ9A 5DRFA 2IB6A 4KF4A 1Q4BA 4RTCA 3K1KA 4W76A 2VADA 5LK4A 4R6BA 4OGSA 3LF3A 3BX9A 4LQTA 4IK3A 3CFFA 1H4UA 1YJFA 5HZOA 3DPWA 2QZ0A 2QT2A 3SG3A 3NT9A 5EXCI 3CGLA 2OKWA 2EMDA 4XVPA 4PFEA 3LSAA 3S05A 4W6KA 1XAEA 3DQ8A 2V4EB 3CD1A 4HQCA 4Z4MA 2H5OA 3DQIA 2Z6XA 3AKOA 4H3LA 4LQUA 4W7CA 3DQUA 1QYOA 1RMPA 3ZTFA 5FVGA 2QLHA 2Z6YA 2YFPA 2V4EC 4W6OA 3CFHA 3DQLA 4N3DA 3LF4B 4HQ9A 4W7DA 4OJ0A 4W69A 2AWJA 4W75A 3WLDA 4LJCA 5EXUA 4W6GA 3U0NA 3CB9A 4DKMA 2EMOA 3U8CA 1EMFA 2QLEA 2DUEA 2A54B 1YFPA 1EMGA 4ZF4A 5EHUA 1XSSA 5T3IA 4IK9A 3SRYA 3SVDA 3M22A 4EN1A 2EMNA 2QLIA 2Z1OA 5EBJA 2A46A 2DD9A 4LJBA 4IK4A 2G6XA 4IK5A 5DPJA 5DQBA 2AWLA 3TMRA 3DQMA 3LA1A 5BQLA 5DRGA 2YE1A 1KYPA 1YZWA 5BTTB 1KP5A 4ZFSA 4ZIOA 2GX2A 4W6DA 2A56B 3KCTA 3DQDA 3U8PA 2ZMUA 1YHHA 2OKYA 1KYRA 3DQHA 4DXMA 4DXQA 1EMAA 3LVCA 3EVVA 3GEXA 2G16B 3DQ3A 4KF5A 5EB7A 4TZAA 1GL4A 3GL4A 5LTPA 3SVRA 5LTQA 2HPWA 4Q7UA 2VVJA 3EVUA 5DQMA 4EULA 2DDCA 1EMBA 3SG7A 3ZULA 3DQ2A 5DU0A 4W6HA 2HQKA 3EVPA 2WURA 3OSRA 4TZGA 2G5ZB 3MGFA 3SSTA 4LW5A 4HVFA 4Z4KA 2Z6ZA 1Z1PA 3DQNA 3EK4A 3WCKA 5DTXA 2VVIA 2HRSA 1YHGA 4W6FA 2JADA 1OXDA 2Q57A 1QYFA 1ZGQA 5FHVA 4OHSA 2H6VA 1Q4EA 5DY6A 2A48A 4KPIA 3ZUFA 3DQ1A 5DTYA 1EMEA 3DQEA 3OSQA 3DQ4A 3TMTA 5FVIA 4ZF3A 2ZO7A 5AQBB 2DD7A 2OGRA 4AR7A 4Q9WA 1W7UA 5DPIA 1HUYA 4W7XA 3SSLA 3DQ5A 2WISA 1G7KA 2QRFA 4GOBA 4H3NA 4R6DA 3P8UA 4KGFA 4XL5A 3E5WA 4KEXA 4EDSA 2C9JA 1RM9A 5DTLA 2ZMWA 3O77A 2O24A 4NWSA 3VHTA 4W72A 3CFAA 4JRBA 2IB5A 2DUHA 4KF5C 3SVNA 3I19A 2BTJA 3O78A 1JC1A 3G9AA 1Q4CA 3ST3A 4GF6B 3U0LA 3E5VA 2OTBA 4KA9A 1MYWA 3IR8A 2FL1A 4OQWA 2GW3A 1Q4AA 4EMQA 4XOVA 3U8AA 2WHUA 1OXFA 5H87A 2G3OA 4W6SA 3SSHA 5DPHA 2H5RA 1ZGPA 4JF9A 2G2SB 2H8QA 1KYSA 2PXSA 2QU1A 3NEDA 2PXWA 2IE2A 3LVDA 5FVFA 3EKHA 1B9CA 2DUFA 2B3PA 3SSVA 5H88A 3ST4A 1XQMA 3ST0A 4DXPA 1MOVA 3DQFA 3ZUJA 3VHTB 4LJDA 4J8AA 1QXTA 4W6UA 1EMLA 4W6RA 4PPLA 4H3MA 4AS8A 2AHAA 5HW9A 2G3DB 4H48A 2YDZA 2WSNA 4BDUA 2C9IA 4HE4A 4ZINA 2FWQA 3SG2A 3SSKA 4B5YA 3PIBA 4W7EA 5HZTA 4W6TA 1GFLA 1XMZA 3SVEA 5LTRA 4P1QA 1EMCA 3W1DA 2WHTA 4KAGA 2HJOA 5H89A 1BFPA 1OXEA 1JBZA 3GJ2A 3BXCA 4ZF5A 4ZB1A 2AWKA 4RYWA 1YHIA 4GESB 2IOVA 2HCGA 1F0BA 2H9WA 2RH7A 3BXBA 4L12A 4ZBLA 4W6LA 3SV5A 3PJBA 4L13A 3WLCA 3DQCA 1Q4DA 4IK8A 2O2BA 4IK1A 2OJKA 4I2YA 2DUGA 3ST2A 1JBYA 3AI5A 2QLGA 4OY4A 2AWMA 3LVAA 4IZNA 3SG4A 3EK7A 4DXIA 4KW8A 3VK1A 4DXOA 4JFGA 3P28A 4J88A 3CD9A 3GB3A 4KGEA 4PPJA 4Q7TA 3AI4A 4W7AA 5J2OA 4ANJA 3EVRA 5BTTA 3PJ5A 4W6PA 2HGYA 3LS3A 3SSPA 1ZUXA 2ICRA 3H1RA 1XA9A 5HZUA 4LJDC 2VAEA 4HQ8A 1UISA 1RRXA 3DPZA 2Y0GA 2G6EA 2OTEA 2GX0A 4W73A 3CBEA 3DQ6A 1RMMA 4RYSA 4XOWA 4W6BA 3SVOA 4KW9A 2A52B 1YJ2A 3OGOA 2VZXA 2H5QA 2WIQA 1EMKA 4W77A 3DQOA 4Q9XA 4ORNA 3SVCA 3DQ7A 5F9GA 5HZSA 3SSYA 1F09A 1QY3A 2HFCA 4JEOA 4JC2A 3ED8A 4H47A 4DKNA 1QYQA 3NEZA 4W7FA 3H1OA 3DQAA 2O29A 2ARLA 2ZO6A 3BXAA 2QLGB 1GGXA 2HGDA 2A47A 2P4MA 1W7TA 2YE0A 4B30A 3SVBA 4P76A 3PJ7A 3RWAA 4UTSA
chains in the Genus database with same CATH superfamily
4XGYA 2WHSA 3IP2A 3NT3A 2GW4B 1H6RA 5EJUA 1MOUA 2AH8A 3DQKA 1W7SA 5EB6A 1HCJA 1ZGOA 1RMOA 4JGEA 1S6ZA 4Q7RA 3U0KA 2Q6PA 3SVSA 3DQJA 4J89A 2POXA 3SVUA 3UG0A 4W6NA 1JC0A 5BT0A 2DUIA 4W6MA 3SS0A 3SG6A 1CV7A 5HGEA 4U2VA 4EDOA 2V4EA 4W6CA 3U0MA 4PPKA 3W1CA 1EMMA 4DXNA 5HBDA 2A53B 2A50B 4W7RA 3E5TA 1C4FA 2G6YA 3VICA 3RWTA 3UFZA 2B3QA 2HQZA 5KTGA 4W74A 2FZUA 3ADFA 3EK8A 2DDDA 4L1IA 2VVHA 5DTZA 4W6IA 3NF0A 4W6AA 4B30B 3A8SA 4W6JA 3GJ1A 2WSOA 3EKJA 3SG5A 5DPGA 3DPXA 3KCSA 3M24A 5EXBA 1Q73A 3V3DA 1Z1QA 2H5PA 4KW4A 3DQ9A 5DRFA 2IB6A 4KF4A 1Q4BA 4RTCA 3K1KA 4W76A 2VADA 5LK4A 4R6BA 4OGSA 3LF3A 3BX9A 4LQTA 4IK3A 3CFFA 1H4UA 1YJFA 5HZOA 3DPWA 2QZ0A 2QT2A 3SG3A 3NT9A 5EXCI 3CGLA 2OKWA 2EMDA 4XVPA 4PFEA 3LSAA 3S05A 4W6KA 1XAEA 3DQ8A 2V4EB 3CD1A 4HQCA 4Z4MA 2H5OA 3DQIA 2Z6XA 3AKOA 4H3LA 4LQUA 4W7CA 3DQUA 1QYOA 1RMPA 3ZTFA 5FVGA 2QLHA 2Z6YA 2YFPA 2V4EC 4W6OA 3CFHA 3DQLA 4N3DA 3LF4B 4HQ9A 4W7DA 4OJ0A 4W69A 2AWJA 4W75A 3WLDA 4LJCA 5EXUA 4W6GA 3U0NA 3CB9A 4DKMA 2EMOA 3U8CA 1EMFA 2QLEA 2DUEA 2A54B 1YFPA 1EMGA 4ZF4A 5EHUA 1XSSA 5T3IA 4IK9A 3SRYA 3SVDA 3M22A 4EN1A 2EMNA 2QLIA 2Z1OA 5EBJA 2A46A 2DD9A 4LJBA 4IK4A 2G6XA 4IK5A 5DPJA 5DQBA 2AWLA 3TMRA 3DQMA 3LA1A 5BQLA 5DRGA 2YE1A 1KYPA 1YZWA 5BTTB 1KP5A 4ZFSA 4ZIOA 2GX2A 4W6DA 2A56B 3KCTA 3DQDA 3U8PA 2ZMUA 1YHHA 2OKYA 1KYRA 3DQHA 4DXMA 4DXQA 1EMAA 3LVCA 3EVVA 3GEXA 2G16B 3DQ3A 4KF5A 5EB7A 4TZAA 1GL4A 3GL4A 5LTPA 3SVRA 5LTQA 2HPWA 4Q7UA 2VVJA 3EVUA 5DQMA 4EULA 2DDCA 1EMBA 3SG7A 3ZULA 3DQ2A 5DU0A 4W6HA 2HQKA 3EVPA 2WURA 3OSRA 4TZGA 2G5ZB 3MGFA 3SSTA 4LW5A 4HVFA 4Z4KA 2Z6ZA 1Z1PA 3DQNA 3EK4A 3WCKA 5DTXA 2VVIA 2HRSA 1YHGA 4W6FA 2JADA 1OXDA 2Q57A 1QYFA 1ZGQA 5FHVA 4OHSA 2H6VA 1Q4EA 5DY6A 2A48A 4KPIA 3ZUFA 3DQ1A 5DTYA 1EMEA 3DQEA 3OSQA 3DQ4A 3TMTA 5FVIA 4ZF3A 2ZO7A 5AQBB 2DD7A 2OGRA 4AR7A 4Q9WA 1W7UA 5DPIA 1HUYA 4W7XA 3SSLA 3DQ5A 2WISA 1G7KA 2QRFA 4GOBA 4H3NA 4R6DA 3P8UA 4KGFA 4XL5A 3E5WA 4KEXA 4EDSA 2C9JA 1RM9A 5DTLA 2ZMWA 3O77A 2O24A 4NWSA 3VHTA 4W72A 3CFAA 4JRBA 2IB5A 2DUHA 4KF5C 3SVNA 3I19A 2BTJA 3O78A 1JC1A 3G9AA 1Q4CA 3ST3A 4GF6B 3U0LA 3E5VA 2OTBA 4KA9A 1MYWA 3IR8A 2FL1A 4OQWA 2GW3A 1Q4AA 4EMQA 4XOVA 3U8AA 2WHUA 1OXFA 5H87A 2G3OA 4W6SA 3SSHA 5DPHA 2H5RA 1ZGPA 4JF9A 2G2SB 2H8QA 1KYSA 2PXSA 2QU1A 3NEDA 2PXWA 2IE2A 3LVDA 5FVFA 3EKHA 1B9CA 2DUFA 2B3PA 3SSVA 5H88A 3ST4A 1XQMA 3ST0A 4DXPA 1MOVA 3DQFA 3ZUJA 3VHTB 4LJDA 4J8AA 1QXTA 4W6UA 1EMLA 4W6RA 4PPLA 4H3MA 4AS8A 2AHAA 5HW9A 2G3DB 4H48A 2YDZA 2WSNA 4BDUA 2C9IA 4HE4A 4ZINA 2FWQA 3SG2A 3SSKA 4B5YA 3PIBA 4W7EA 5HZTA 4W6TA 1GFLA 1XMZA 3SVEA 5LTRA 4P1QA 1EMCA 3W1DA 2WHTA 4KAGA 2HJOA 5H89A 1BFPA 1OXEA 1JBZA 3GJ2A 3BXCA 4ZF5A 4ZB1A 2AWKA 4RYWA 1YHIA 4GESB 2IOVA 2HCGA 1F0BA 2H9WA 2RH7A 3BXBA 4L12A 4ZBLA 4W6LA 3SV5A 3PJBA 4L13A 3WLCA 3DQCA 1Q4DA 4IK8A 2O2BA 4IK1A 2OJKA 4I2YA 2DUGA 3ST2A 1JBYA 3AI5A 2QLGA 4OY4A 2AWMA 3LVAA 4IZNA 3SG4A 3EK7A 4DXIA 4KW8A 3VK1A 4DXOA 4JFGA 3P28A 4J88A 3CD9A 3GB3A 4KGEA 4PPJA 4Q7TA 3AI4A 4W7AA 5J2OA 4ANJA 3EVRA 5BTTA 3PJ5A 4W6PA 2HGYA 3LS3A 3SSPA 1ZUXA 2ICRA 3H1RA 1XA9A 5HZUA 4LJDC 2VAEA 4HQ8A 1UISA 1RRXA 3DPZA 2Y0GA 2G6EA 2OTEA 2GX0A 4W73A 3CBEA 3DQ6A 1RMMA 4RYSA 4XOWA 4W6BA 3SVOA 4KW9A 2A52B 1YJ2A 3OGOA 2VZXA 2H5QA 2WIQA 1EMKA 4W77A 3DQOA 4Q9XA 4ORNA 3SVCA 3DQ7A 5F9GA 5HZSA 3SSYA 1F09A 1QY3A 2HFCA 4JEOA 4JC2A 3ED8A 4H47A 4DKNA 1QYQA 3NEZA 4W7FA 3H1OA 3DQAA 2O29A 2ARLA 2ZO6A 3BXAA 2QLGB 1GGXA 2HGDA 2A47A 2P4MA 1W7TA 2YE0A 4B30A 3SVBA 4P76A 3PJ7A 3RWAA 4UTSA
chains in the Genus database with same CATH topology
4XGYA 2WHSA 3IP2A 3NT3A 2GW4B 1H6RA 5EJUA 1MOUA 2AH8A 3DQKA 1W7SA 5EB6A 1HCJA 1ZGOA 1RMOA 4JGEA 1S6ZA 4Q7RA 3U0KA 2Q6PA 3SVSA 3DQJA 4J89A 2POXA 3SVUA 3UG0A 4W6NA 1JC0A 5BT0A 2DUIA 4W6MA 3SS0A 3SG6A 1CV7A 5HGEA 4U2VA 4EDOA 2V4EA 4W6CA 3U0MA 4PPKA 3W1CA 1EMMA 4DXNA 5HBDA 2A53B 2A50B 4W7RA 3E5TA 1C4FA 2G6YA 3VICA 3RWTA 3UFZA 2B3QA 2HQZA 5KTGA 4W74A 2FZUA 3ADFA 3EK8A 2DDDA 4L1IA 2VVHA 5DTZA 4W6IA 3NF0A 4W6AA 4B30B 3A8SA 4W6JA 3GJ1A 2WSOA 3EKJA 3SG5A 5DPGA 3DPXA 3KCSA 3M24A 5EXBA 1Q73A 3V3DA 1Z1QA 2H5PA 4KW4A 3DQ9A 5DRFA 2IB6A 4KF4A 1Q4BA 4RTCA 3K1KA 4W76A 2VADA 5LK4A 4R6BA 4OGSA 3LF3A 3BX9A 4LQTA 4IK3A 3CFFA 1H4UA 1YJFA 5HZOA 3DPWA 2QZ0A 2QT2A 3SG3A 3NT9A 5EXCI 3CGLA 2OKWA 2EMDA 4XVPA 4PFEA 3LSAA 3S05A 4W6KA 1XAEA 3DQ8A 2V4EB 3CD1A 4HQCA 4Z4MA 2H5OA 3DQIA 2Z6XA 3AKOA 4H3LA 4LQUA 4W7CA 3DQUA 1QYOA 1RMPA 3ZTFA 5FVGA 2QLHA 2Z6YA 2YFPA 2V4EC 4W6OA 3CFHA 3DQLA 4N3DA 3LF4B 4HQ9A 4W7DA 4OJ0A 4W69A 2AWJA 4W75A 3WLDA 4LJCA 5EXUA 4W6GA 3U0NA 3CB9A 4DKMA 2EMOA 3U8CA 1EMFA 2QLEA 2DUEA 2A54B 1YFPA 1EMGA 4ZF4A 5EHUA 1XSSA 5T3IA 4IK9A 3SRYA 3SVDA 3M22A 4EN1A 2EMNA 2QLIA 2Z1OA 5EBJA 2A46A 2DD9A 4LJBA 4IK4A 2G6XA 4IK5A 5DPJA 5DQBA 2AWLA 3TMRA 3DQMA 3LA1A 5BQLA 5DRGA 2YE1A 1KYPA 1YZWA 5BTTB 1KP5A 4ZFSA 4ZIOA 2GX2A 4W6DA 2A56B 3KCTA 3DQDA 3U8PA 2ZMUA 1YHHA 2OKYA 1KYRA 3DQHA 4DXMA 4DXQA 1EMAA 3LVCA 3EVVA 3GEXA 2G16B 3DQ3A 4KF5A 5EB7A 4TZAA 1GL4A 3GL4A 5LTPA 3SVRA 5LTQA 2HPWA 4Q7UA 2VVJA 3EVUA 5DQMA 4EULA 2DDCA 1EMBA 3SG7A 3ZULA 3DQ2A 5DU0A 4W6HA 2HQKA 3EVPA 2WURA 3OSRA 4TZGA 2G5ZB 3MGFA 3SSTA 4LW5A 4HVFA 4Z4KA 2Z6ZA 1Z1PA 3DQNA 3EK4A 3WCKA 5DTXA 2VVIA 2HRSA 1YHGA 4W6FA 2JADA 1OXDA 2Q57A 1QYFA 1ZGQA 5FHVA 4OHSA 2H6VA 1Q4EA 5DY6A 2A48A 4KPIA 3ZUFA 3DQ1A 5DTYA 1EMEA 3DQEA 3OSQA 3DQ4A 3TMTA 5FVIA 4ZF3A 2ZO7A 5AQBB 2DD7A 2OGRA 4AR7A 4Q9WA 1W7UA 5DPIA 1HUYA 4W7XA 3SSLA 3DQ5A 2WISA 1G7KA 2QRFA 4GOBA 4H3NA 4R6DA 3P8UA 4KGFA 4XL5A 3E5WA 4KEXA 4EDSA 2C9JA 1RM9A 5DTLA 2ZMWA 3O77A 2O24A 4NWSA 3VHTA 4W72A 3CFAA 4JRBA 2IB5A 2DUHA 4KF5C 3SVNA 3I19A 2BTJA 3O78A 1JC1A 3G9AA 1Q4CA 3ST3A 4GF6B 3U0LA 3E5VA 2OTBA 4KA9A 1MYWA 3IR8A 2FL1A 4OQWA 2GW3A 1Q4AA 4EMQA 4XOVA 3U8AA 2WHUA 1OXFA 5H87A 2G3OA 4W6SA 3SSHA 5DPHA 2H5RA 1ZGPA 4JF9A 2G2SB 2H8QA 1KYSA 2PXSA 2QU1A 3NEDA 2PXWA 2IE2A 3LVDA 5FVFA 3EKHA 1B9CA 2DUFA 2B3PA 3SSVA 5H88A 3ST4A 1XQMA 3ST0A 4DXPA 1MOVA 3DQFA 3ZUJA 3VHTB 4LJDA 4J8AA 1QXTA 4W6UA 1EMLA 4W6RA 4PPLA 4H3MA 4AS8A 2AHAA 5HW9A 2G3DB 4H48A 2YDZA 2WSNA 4BDUA 2C9IA 4HE4A 4ZINA 2FWQA 3SG2A 3SSKA 4B5YA 3PIBA 4W7EA 5HZTA 4W6TA 1GFLA 1XMZA 3SVEA 5LTRA 4P1QA 1EMCA 3W1DA 2WHTA 4KAGA 2HJOA 5H89A 1BFPA 1OXEA 1JBZA 3GJ2A 3BXCA 4ZF5A 4ZB1A 2AWKA 4RYWA 1YHIA 4GESB 2IOVA 2HCGA 1F0BA 2H9WA 2RH7A 3BXBA 4L12A 4ZBLA 4W6LA 3SV5A 3PJBA 4L13A 3WLCA 3DQCA 1Q4DA 4IK8A 2O2BA 4IK1A 2OJKA 4I2YA 2DUGA 3ST2A 1JBYA 3AI5A 2QLGA 4OY4A 2AWMA 3LVAA 4IZNA 3SG4A 3EK7A 4DXIA 4KW8A 3VK1A 4DXOA 4JFGA 3P28A 4J88A 3CD9A 3GB3A 4KGEA 4PPJA 4Q7TA 3AI4A 4W7AA 5J2OA 4ANJA 3EVRA 5BTTA 3PJ5A 4W6PA 2HGYA 3LS3A 3SSPA 1ZUXA 2ICRA 3H1RA 1XA9A 5HZUA 4LJDC 2VAEA 4HQ8A 1UISA 1RRXA 3DPZA 2Y0GA 2G6EA 2OTEA 2GX0A 4W73A 3CBEA 3DQ6A 1RMMA 4RYSA 4XOWA 4W6BA 3SVOA 4KW9A 2A52B 1YJ2A 3OGOA 2VZXA 2H5QA 2WIQA 1EMKA 4W77A 3DQOA 4Q9XA 4ORNA 3SVCA 3DQ7A 5F9GA 5HZSA 3SSYA 1F09A 1QY3A 2HFCA 4JEOA 4JC2A 3ED8A 4H47A 4DKNA 1QYQA 3NEZA 4W7FA 3H1OA 3DQAA 2O29A 2ARLA 2ZO6A 3BXAA 2QLGB 1GGXA 2HGDA 2A47A 2P4MA 1W7TA 2YE0A 4B30A 3SVBA 4P76A 3PJ7A 3RWAA 4UTSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XGY A;  2WHS A;  3IP2 A;  3NT3 A;  2GW4 B;  1H6R A;  5EJU A;  1MOU A;  2AH8 A;  3DQK A;  1W7S A;  5EB6 A;  1HCJ A;  1ZGO A;  1RMO A;  4JGE A;  1S6Z A;  4Q7R A;  3U0K A;  2Q6P A;  3SVS A;  3DQJ A;  4J89 A;  2POX A;  3SVU A;  3UG0 A;  4W6N A;  1JC0 A;  5BT0 A;  2DUI A;  4W6M A;  3SS0 A;  3SG6 A;  1CV7 A;  5HGE A;  4U2V A;  4EDO A;  2V4E A;  4W6C A;  3U0M A;  4PPK A;  3W1C A;  1EMM A;  4DXN A;  5HBD A;  2A53 B;  2A50 B;  4W7R A;  3E5T A;  1C4F A;  2G6Y A;  3VIC A;  3RWT A;  3UFZ A;  2B3Q A;  2HQZ A;  5KTG A;  4W74 A;  2FZU A;  3ADF A;  3EK8 A;  2DDD A;  4L1I A;  2VVH A;  5DTZ A;  4W6I A;  3NF0 A;  4W6A A;  4B30 B;  3A8S A;  4W6J A;  3GJ1 A;  2WSO A;  3EKJ A;  3SG5 A;  5DPG A;  3DPX A;  3KCS A;  3M24 A;  5EXB A;  1Q73 A;  3V3D A;  1Z1Q A;  2H5P A;  4KW4 A;  3DQ9 A;  5DRF A;  2IB6 A;  4KF4 A;  1Q4B A;  4RTC A;  3K1K A;  4W76 A;  2VAD A;  5LK4 A;  4R6B A;  4OGS A;  3LF3 A;  3BX9 A;  4LQT A;  4IK3 A;  3CFF A;  1H4U A;  1YJF A;  5HZO A;  3DPW A;  2QZ0 A;  2QT2 A;  3SG3 A;  3NT9 A;  5EXC I;  3CGL A;  2OKW A;  2EMD A;  4XVP A;  4PFE A;  3LSA A;  3S05 A;  4W6K A;  1XAE A;  3DQ8 A;  2V4E B;  3CD1 A;  4HQC A;  4Z4M A;  2H5O A;  3DQI A;  2Z6X A;  3AKO A;  4H3L A;  4LQU A;  4W7C A;  3DQU A;  1QYO A;  1RMP A;  3ZTF A;  5FVG A;  2QLH A;  2Z6Y A;  2YFP A;  2V4E C;  4W6O A;  3CFH A;  3DQL A;  4N3D A;  3LF4 B;  4HQ9 A;  4W7D A;  4OJ0 A;  4W69 A;  2AWJ A;  4W75 A;  3WLD A;  4LJC A;  5EXU A;  4W6G A;  3U0N A;  3CB9 A;  4DKM A;  2EMO A;  3U8C A;  1EMF A;  2QLE A;  2DUE A;  2A54 B;  1YFP A;  1EMG A;  4ZF4 A;  5EHU A;  1XSS A;  5T3I A;  4IK9 A;  3SRY A;  3SVD A;  3M22 A;  4EN1 A;  2EMN A;  2QLI A;  2Z1O A;  5EBJ A;  2A46 A;  2DD9 A;  4LJB A;  4IK4 A;  2G6X A;  4IK5 A;  5DPJ A;  5DQB A;  2AWL A;  3TMR A;  3DQM A;  3LA1 A;  5BQL A;  5DRG A;  2YE1 A;  1KYP A;  1YZW A;  5BTT B;  1KP5 A;  4ZFS A;  4ZIO A;  2GX2 A;  4W6D A;  2A56 B;  3KCT A;  3DQD A;  3U8P A;  2ZMU A;  1YHH A;  2OKY A;  1KYR A;  3DQH A;  4DXM A;  4DXQ A;  1EMA A;  3LVC A;  3EVV A;  3GEX A;  2G16 B;  3DQ3 A;  4KF5 A;  5EB7 A;  4TZA A;  1GL4 A;  3GL4 A;  5LTP A;  3SVR A;  5LTQ A;  2HPW A;  4Q7U A;  2VVJ A;  3EVU A;  5DQM A;  4EUL A;  2DDC A;  1EMB A;  3SG7 A;  3ZUL A;  3DQ2 A;  5DU0 A;  4W6H A;  2HQK A;  3EVP A;  2WUR A;  3OSR A;  4TZG A;  2G5Z B;  3MGF A;  3SST A;  4LW5 A;  4HVF A;  4Z4K A;  2Z6Z A;  1Z1P A;  3DQN A;  3EK4 A;  3WCK A;  5DTX A;  2VVI A;  2HRS A;  1YHG A;  4W6F A;  2JAD A;  1OXD A;  2Q57 A;  1QYF A;  1ZGQ A;  5FHV A;  4OHS A;  2H6V A;  1Q4E A;  5DY6 A;  2A48 A;  4KPI A;  3ZUF A;  3DQ1 A;  5DTY A;  1EME A;  3DQE A;  3OSQ A;  3DQ4 A;  3TMT A;  5FVI A;  4ZF3 A;  2ZO7 A;  5AQB B;  2DD7 A;  2OGR A;  4AR7 A;  4Q9W A;  1W7U A;  5DPI A;  1HUY A;  4W7X A;  3SSL A;  3DQ5 A;  2WIS A;  1G7K A;  2QRF A;  4GOB A;  4H3N A;  4R6D A;  3P8U A;  4KGF A;  4XL5 A;  3E5W A;  4KEX A;  4EDS A;  2C9J A;  1RM9 A;  5DTL A;  2ZMW A;  3O77 A;  2O24 A;  4NWS A;  3VHT A;  4W72 A;  3CFA A;  4JRB A;  2IB5 A;  2DUH A;  4KF5 C;  3SVN A;  3I19 A;  2BTJ A;  3O78 A;  1JC1 A;  3G9A A;  1Q4C A;  3ST3 A;  4GF6 B;  3U0L A;  3E5V A;  2OTB A;  4KA9 A;  1MYW A;  3IR8 A;  2FL1 A;  4OQW A;  2GW3 A;  1Q4A A;  4EMQ A;  4XOV A;  3U8A A;  2WHU A;  1OXF A;  5H87 A;  2G3O A;  4W6S A;  3SSH A;  5DPH A;  2H5R A;  1ZGP A;  4JF9 A;  2G2S B;  2H8Q A;  1KYS A;  2PXS A;  2QU1 A;  3NED A;  2PXW A;  2IE2 A;  3LVD A;  5FVF A;  3EKH A;  1B9C A;  2DUF A;  2B3P A;  3SSV A;  5H88 A;  3ST4 A;  1XQM A;  3ST0 A;  4DXP A;  1MOV A;  3DQF A;  3ZUJ A;  3VHT B;  4LJD A;  4J8A A;  1QXT A;  4W6U A;  1EML A;  4W6R A;  4PPL A;  4H3M A;  4AS8 A;  2AHA A;  5HW9 A;  2G3D B;  4H48 A;  2YDZ A;  2WSN A;  4BDU A;  2C9I A;  4HE4 A;  4ZIN A;  2FWQ A;  3SG2 A;  3SSK A;  4B5Y A;  3PIB A;  4W7E A;  5HZT A;  4W6T A;  1GFL A;  1XMZ A;  3SVE A;  5LTR A;  4P1Q A;  1EMC A;  3W1D A;  2WHT A;  4KAG A;  2HJO A;  5H89 A;  1BFP A;  1OXE A;  1JBZ A;  3GJ2 A;  3BXC A;  4ZF5 A;  4ZB1 A;  2AWK A;  4RYW A;  1YHI A;  4GES B;  2IOV A;  2HCG A;  1F0B A;  2H9W A;  2RH7 A;  3BXB A;  4L12 A;  4ZBL A;  4W6L A;  3SV5 A;  3PJB A;  4L13 A;  3WLC A;  3DQC A;  1Q4D A;  4IK8 A;  2O2B A;  4IK1 A;  2OJK A;  4I2Y A;  2DUG A;  3ST2 A;  1JBY A;  3AI5 A;  2QLG A;  4OY4 A;  2AWM A;  3LVA A;  4IZN A;  3SG4 A;  3EK7 A;  4DXI A;  4KW8 A;  3VK1 A;  4DXO A;  4JFG A;  3P28 A;  4J88 A;  3CD9 A;  3GB3 A;  4KGE A;  4PPJ A;  4Q7T A;  3AI4 A;  4W7A A;  5J2O A;  4ANJ A;  3EVR A;  5BTT A;  3PJ5 A;  4W6P A;  2HGY A;  3LS3 A;  3SSP A;  1ZUX A;  2ICR A;  3H1R A;  1XA9 A;  5HZU A;  4LJD C;  2VAE A;  4HQ8 A;  1UIS A;  1RRX A;  3DPZ A;  2Y0G A;  2G6E A;  2OTE A;  2GX0 A;  4W73 A;  3CBE A;  3DQ6 A;  1RMM A;  4RYS A;  4XOW A;  4W6B A;  3SVO A;  4KW9 A;  2A52 B;  1YJ2 A;  3OGO A;  2VZX A;  2H5Q A;  2WIQ A;  1EMK A;  4W77 A;  3DQO A;  4Q9X A;  4ORN A;  3SVC A;  3DQ7 A;  5F9G A;  5HZS A;  3SSY A;  1F09 A;  1QY3 A;  2HFC A;  4JEO A;  4JC2 A;  3ED8 A;  4H47 A;  4DKN A;  1QYQ A;  3NEZ A;  4W7F A;  3H1O A;  3DQA A;  2O29 A;  2ARL A;  2ZO6 A;  3BXA A;  2QLG B;  1GGX A;  2HGD A;  2A47 A;  2P4M A;  1W7T A;  2YE0 A;  4B30 A;  3SVB A;  4P76 A;  3PJ7 A;  3RWA A;  4UTS A; 
#chains in the Genus database with same CATH topology
 4XGY A;  2WHS A;  3IP2 A;  3NT3 A;  2GW4 B;  1H6R A;  5EJU A;  1MOU A;  2AH8 A;  3DQK A;  1W7S A;  5EB6 A;  1HCJ A;  1ZGO A;  1RMO A;  4JGE A;  1S6Z A;  4Q7R A;  3U0K A;  2Q6P A;  3SVS A;  3DQJ A;  4J89 A;  2POX A;  3SVU A;  3UG0 A;  4W6N A;  1JC0 A;  5BT0 A;  2DUI A;  4W6M A;  3SS0 A;  3SG6 A;  1CV7 A;  5HGE A;  4U2V A;  4EDO A;  2V4E A;  4W6C A;  3U0M A;  4PPK A;  3W1C A;  1EMM A;  4DXN A;  5HBD A;  2A53 B;  2A50 B;  4W7R A;  3E5T A;  1C4F A;  2G6Y A;  3VIC A;  3RWT A;  3UFZ A;  2B3Q A;  2HQZ A;  5KTG A;  4W74 A;  2FZU A;  3ADF A;  3EK8 A;  2DDD A;  4L1I A;  2VVH A;  5DTZ A;  4W6I A;  3NF0 A;  4W6A A;  4B30 B;  3A8S A;  4W6J A;  3GJ1 A;  2WSO A;  3EKJ A;  3SG5 A;  5DPG A;  3DPX A;  3KCS A;  3M24 A;  5EXB A;  1Q73 A;  3V3D A;  1Z1Q A;  2H5P A;  4KW4 A;  3DQ9 A;  5DRF A;  2IB6 A;  4KF4 A;  1Q4B A;  4RTC A;  3K1K A;  4W76 A;  2VAD A;  5LK4 A;  4R6B A;  4OGS A;  3LF3 A;  3BX9 A;  4LQT A;  4IK3 A;  3CFF A;  1H4U A;  1YJF A;  5HZO A;  3DPW A;  2QZ0 A;  2QT2 A;  3SG3 A;  3NT9 A;  5EXC I;  3CGL A;  2OKW A;  2EMD A;  4XVP A;  4PFE A;  3LSA A;  3S05 A;  4W6K A;  1XAE A;  3DQ8 A;  2V4E B;  3CD1 A;  4HQC A;  4Z4M A;  2H5O A;  3DQI A;  2Z6X A;  3AKO A;  4H3L A;  4LQU A;  4W7C A;  3DQU A;  1QYO A;  1RMP A;  3ZTF A;  5FVG A;  2QLH A;  2Z6Y A;  2YFP A;  2V4E C;  4W6O A;  3CFH A;  3DQL A;  4N3D A;  3LF4 B;  4HQ9 A;  4W7D A;  4OJ0 A;  4W69 A;  2AWJ A;  4W75 A;  3WLD A;  4LJC A;  5EXU A;  4W6G A;  3U0N A;  3CB9 A;  4DKM A;  2EMO A;  3U8C A;  1EMF A;  2QLE A;  2DUE A;  2A54 B;  1YFP A;  1EMG A;  4ZF4 A;  5EHU A;  1XSS A;  5T3I A;  4IK9 A;  3SRY A;  3SVD A;  3M22 A;  4EN1 A;  2EMN A;  2QLI A;  2Z1O A;  5EBJ A;  2A46 A;  2DD9 A;  4LJB A;  4IK4 A;  2G6X A;  4IK5 A;  5DPJ A;  5DQB A;  2AWL A;  3TMR A;  3DQM A;  3LA1 A;  5BQL A;  5DRG A;  2YE1 A;  1KYP A;  1YZW A;  5BTT B;  1KP5 A;  4ZFS A;  4ZIO A;  2GX2 A;  4W6D A;  2A56 B;  3KCT A;  3DQD A;  3U8P A;  2ZMU A;  1YHH A;  2OKY A;  1KYR A;  3DQH A;  4DXM A;  4DXQ A;  1EMA A;  3LVC A;  3EVV A;  3GEX A;  2G16 B;  3DQ3 A;  4KF5 A;  5EB7 A;  4TZA A;  1GL4 A;  3GL4 A;  5LTP A;  3SVR A;  5LTQ A;  2HPW A;  4Q7U A;  2VVJ A;  3EVU A;  5DQM A;  4EUL A;  2DDC A;  1EMB A;  3SG7 A;  3ZUL A;  3DQ2 A;  5DU0 A;  4W6H A;  2HQK A;  3EVP A;  2WUR A;  3OSR A;  4TZG A;  2G5Z B;  3MGF A;  3SST A;  4LW5 A;  4HVF A;  4Z4K A;  2Z6Z A;  1Z1P A;  3DQN A;  3EK4 A;  3WCK A;  5DTX A;  2VVI A;  2HRS A;  1YHG A;  4W6F A;  2JAD A;  1OXD A;  2Q57 A;  1QYF A;  1ZGQ A;  5FHV A;  4OHS A;  2H6V A;  1Q4E A;  5DY6 A;  2A48 A;  4KPI A;  3ZUF A;  3DQ1 A;  5DTY A;  1EME A;  3DQE A;  3OSQ A;  3DQ4 A;  3TMT A;  5FVI A;  4ZF3 A;  2ZO7 A;  5AQB B;  2DD7 A;  2OGR A;  4AR7 A;  4Q9W A;  1W7U A;  5DPI A;  1HUY A;  4W7X A;  3SSL A;  3DQ5 A;  2WIS A;  1G7K A;  2QRF A;  4GOB A;  4H3N A;  4R6D A;  3P8U A;  4KGF A;  4XL5 A;  3E5W A;  4KEX A;  4EDS A;  2C9J A;  1RM9 A;  5DTL A;  2ZMW A;  3O77 A;  2O24 A;  4NWS A;  3VHT A;  4W72 A;  3CFA A;  4JRB A;  2IB5 A;  2DUH A;  4KF5 C;  3SVN A;  3I19 A;  2BTJ A;  3O78 A;  1JC1 A;  3G9A A;  1Q4C A;  3ST3 A;  4GF6 B;  3U0L A;  3E5V A;  2OTB A;  4KA9 A;  1MYW A;  3IR8 A;  2FL1 A;  4OQW A;  2GW3 A;  1Q4A A;  4EMQ A;  4XOV A;  3U8A A;  2WHU A;  1OXF A;  5H87 A;  2G3O A;  4W6S A;  3SSH A;  5DPH A;  2H5R A;  1ZGP A;  4JF9 A;  2G2S B;  2H8Q A;  1KYS A;  2PXS A;  2QU1 A;  3NED A;  2PXW A;  2IE2 A;  3LVD A;  5FVF A;  3EKH A;  1B9C A;  2DUF A;  2B3P A;  3SSV A;  5H88 A;  3ST4 A;  1XQM A;  3ST0 A;  4DXP A;  1MOV A;  3DQF A;  3ZUJ A;  3VHT B;  4LJD A;  4J8A A;  1QXT A;  4W6U A;  1EML A;  4W6R A;  4PPL A;  4H3M A;  4AS8 A;  2AHA A;  5HW9 A;  2G3D B;  4H48 A;  2YDZ A;  2WSN A;  4BDU A;  2C9I A;  4HE4 A;  4ZIN A;  2FWQ A;  3SG2 A;  3SSK A;  4B5Y A;  3PIB A;  4W7E A;  5HZT A;  4W6T A;  1GFL A;  1XMZ A;  3SVE A;  5LTR A;  4P1Q A;  1EMC A;  3W1D A;  2WHT A;  4KAG A;  2HJO A;  5H89 A;  1BFP A;  1OXE A;  1JBZ A;  3GJ2 A;  3BXC A;  4ZF5 A;  4ZB1 A;  2AWK A;  4RYW A;  1YHI A;  4GES B;  2IOV A;  2HCG A;  1F0B A;  2H9W A;  2RH7 A;  3BXB A;  4L12 A;  4ZBL A;  4W6L A;  3SV5 A;  3PJB A;  4L13 A;  3WLC A;  3DQC A;  1Q4D A;  4IK8 A;  2O2B A;  4IK1 A;  2OJK A;  4I2Y A;  2DUG A;  3ST2 A;  1JBY A;  3AI5 A;  2QLG A;  4OY4 A;  2AWM A;  3LVA A;  4IZN A;  3SG4 A;  3EK7 A;  4DXI A;  4KW8 A;  3VK1 A;  4DXO A;  4JFG A;  3P28 A;  4J88 A;  3CD9 A;  3GB3 A;  4KGE A;  4PPJ A;  4Q7T A;  3AI4 A;  4W7A A;  5J2O A;  4ANJ A;  3EVR A;  5BTT A;  3PJ5 A;  4W6P A;  2HGY A;  3LS3 A;  3SSP A;  1ZUX A;  2ICR A;  3H1R A;  1XA9 A;  5HZU A;  4LJD C;  2VAE A;  4HQ8 A;  1UIS A;  1RRX A;  3DPZ A;  2Y0G A;  2G6E A;  2OTE A;  2GX0 A;  4W73 A;  3CBE A;  3DQ6 A;  1RMM A;  4RYS A;  4XOW A;  4W6B A;  3SVO A;  4KW9 A;  2A52 B;  1YJ2 A;  3OGO A;  2VZX A;  2H5Q A;  2WIQ A;  1EMK A;  4W77 A;  3DQO A;  4Q9X A;  4ORN A;  3SVC A;  3DQ7 A;  5F9G A;  5HZS A;  3SSY A;  1F09 A;  1QY3 A;  2HFC A;  4JEO A;  4JC2 A;  3ED8 A;  4H47 A;  4DKN A;  1QYQ A;  3NEZ A;  4W7F A;  3H1O A;  3DQA A;  2O29 A;  2ARL A;  2ZO6 A;  3BXA A;  2QLG B;  1GGX A;  2HGD A;  2A47 A;  2P4M A;  1W7T A;  2YE0 A;  4B30 A;  3SVB A;  4P76 A;  3PJ7 A;  3RWA A;  4UTS A; 
#chains in the Genus database with same CATH homology
 4XGY A;  2WHS A;  3IP2 A;  3NT3 A;  2GW4 B;  1H6R A;  5EJU A;  1MOU A;  2AH8 A;  3DQK A;  1W7S A;  5EB6 A;  1HCJ A;  1ZGO A;  1RMO A;  4JGE A;  1S6Z A;  4Q7R A;  3U0K A;  2Q6P A;  3SVS A;  3DQJ A;  4J89 A;  2POX A;  3SVU A;  3UG0 A;  4W6N A;  1JC0 A;  5BT0 A;  2DUI A;  4W6M A;  3SS0 A;  3SG6 A;  1CV7 A;  5HGE A;  4U2V A;  4EDO A;  2V4E A;  4W6C A;  3U0M A;  4PPK A;  3W1C A;  1EMM A;  4DXN A;  5HBD A;  2A53 B;  2A50 B;  4W7R A;  3E5T A;  1C4F A;  2G6Y A;  3VIC A;  3RWT A;  3UFZ A;  2B3Q A;  2HQZ A;  5KTG A;  4W74 A;  2FZU A;  3ADF A;  3EK8 A;  2DDD A;  4L1I A;  2VVH A;  5DTZ A;  4W6I A;  3NF0 A;  4W6A A;  4B30 B;  3A8S A;  4W6J A;  3GJ1 A;  2WSO A;  3EKJ A;  3SG5 A;  5DPG A;  3DPX A;  3KCS A;  3M24 A;  5EXB A;  1Q73 A;  3V3D A;  1Z1Q A;  2H5P A;  4KW4 A;  3DQ9 A;  5DRF A;  2IB6 A;  4KF4 A;  1Q4B A;  4RTC A;  3K1K A;  4W76 A;  2VAD A;  5LK4 A;  4R6B A;  4OGS A;  3LF3 A;  3BX9 A;  4LQT A;  4IK3 A;  3CFF A;  1H4U A;  1YJF A;  5HZO A;  3DPW A;  2QZ0 A;  2QT2 A;  3SG3 A;  3NT9 A;  5EXC I;  3CGL A;  2OKW A;  2EMD A;  4XVP A;  4PFE A;  3LSA A;  3S05 A;  4W6K A;  1XAE A;  3DQ8 A;  2V4E B;  3CD1 A;  4HQC A;  4Z4M A;  2H5O A;  3DQI A;  2Z6X A;  3AKO A;  4H3L A;  4LQU A;  4W7C A;  3DQU A;  1QYO A;  1RMP A;  3ZTF A;  5FVG A;  2QLH A;  2Z6Y A;  2YFP A;  2V4E C;  4W6O A;  3CFH A;  3DQL A;  4N3D A;  3LF4 B;  4HQ9 A;  4W7D A;  4OJ0 A;  4W69 A;  2AWJ A;  4W75 A;  3WLD A;  4LJC A;  5EXU A;  4W6G A;  3U0N A;  3CB9 A;  4DKM A;  2EMO A;  3U8C A;  1EMF A;  2QLE A;  2DUE A;  2A54 B;  1YFP A;  1EMG A;  4ZF4 A;  5EHU A;  1XSS A;  5T3I A;  4IK9 A;  3SRY A;  3SVD A;  3M22 A;  4EN1 A;  2EMN A;  2QLI A;  2Z1O A;  5EBJ A;  2A46 A;  2DD9 A;  4LJB A;  4IK4 A;  2G6X A;  4IK5 A;  5DPJ A;  5DQB A;  2AWL A;  3TMR A;  3DQM A;  3LA1 A;  5BQL A;  5DRG A;  2YE1 A;  1KYP A;  1YZW A;  5BTT B;  1KP5 A;  4ZFS A;  4ZIO A;  2GX2 A;  4W6D A;  2A56 B;  3KCT A;  3DQD A;  3U8P A;  2ZMU A;  1YHH A;  2OKY A;  1KYR A;  3DQH A;  4DXM A;  4DXQ A;  1EMA A;  3LVC A;  3EVV A;  3GEX A;  2G16 B;  3DQ3 A;  4KF5 A;  5EB7 A;  4TZA A;  1GL4 A;  3GL4 A;  5LTP A;  3SVR A;  5LTQ A;  2HPW A;  4Q7U A;  2VVJ A;  3EVU A;  5DQM A;  4EUL A;  2DDC A;  1EMB A;  3SG7 A;  3ZUL A;  3DQ2 A;  5DU0 A;  4W6H A;  2HQK A;  3EVP A;  2WUR A;  3OSR A;  4TZG A;  2G5Z B;  3MGF A;  3SST A;  4LW5 A;  4HVF A;  4Z4K A;  2Z6Z A;  1Z1P A;  3DQN A;  3EK4 A;  3WCK A;  5DTX A;  2VVI A;  2HRS A;  1YHG A;  4W6F A;  2JAD A;  1OXD A;  2Q57 A;  1QYF A;  1ZGQ A;  5FHV A;  4OHS A;  2H6V A;  1Q4E A;  5DY6 A;  2A48 A;  4KPI A;  3ZUF A;  3DQ1 A;  5DTY A;  1EME A;  3DQE A;  3OSQ A;  3DQ4 A;  3TMT A;  5FVI A;  4ZF3 A;  2ZO7 A;  5AQB B;  2DD7 A;  2OGR A;  4AR7 A;  4Q9W A;  1W7U A;  5DPI A;  1HUY A;  4W7X A;  3SSL A;  3DQ5 A;  2WIS A;  1G7K A;  2QRF A;  4GOB A;  4H3N A;  4R6D A;  3P8U A;  4KGF A;  4XL5 A;  3E5W A;  4KEX A;  4EDS A;  2C9J A;  1RM9 A;  5DTL A;  2ZMW A;  3O77 A;  2O24 A;  4NWS A;  3VHT A;  4W72 A;  3CFA A;  4JRB A;  2IB5 A;  2DUH A;  4KF5 C;  3SVN A;  3I19 A;  2BTJ A;  3O78 A;  1JC1 A;  3G9A A;  1Q4C A;  3ST3 A;  4GF6 B;  3U0L A;  3E5V A;  2OTB A;  4KA9 A;  1MYW A;  3IR8 A;  2FL1 A;  4OQW A;  2GW3 A;  1Q4A A;  4EMQ A;  4XOV A;  3U8A A;  2WHU A;  1OXF A;  5H87 A;  2G3O A;  4W6S A;  3SSH A;  5DPH A;  2H5R A;  1ZGP A;  4JF9 A;  2G2S B;  2H8Q A;  1KYS A;  2PXS A;  2QU1 A;  3NED A;  2PXW A;  2IE2 A;  3LVD A;  5FVF A;  3EKH A;  1B9C A;  2DUF A;  2B3P A;  3SSV A;  5H88 A;  3ST4 A;  1XQM A;  3ST0 A;  4DXP A;  1MOV A;  3DQF A;  3ZUJ A;  3VHT B;  4LJD A;  4J8A A;  1QXT A;  4W6U A;  1EML A;  4W6R A;  4PPL A;  4H3M A;  4AS8 A;  2AHA A;  5HW9 A;  2G3D B;  4H48 A;  2YDZ A;  2WSN A;  4BDU A;  2C9I A;  4HE4 A;  4ZIN A;  2FWQ A;  3SG2 A;  3SSK A;  4B5Y A;  3PIB A;  4W7E A;  5HZT A;  4W6T A;  1GFL A;  1XMZ A;  3SVE A;  5LTR A;  4P1Q A;  1EMC A;  3W1D A;  2WHT A;  4KAG A;  2HJO A;  5H89 A;  1BFP A;  1OXE A;  1JBZ A;  3GJ2 A;  3BXC A;  4ZF5 A;  4ZB1 A;  2AWK A;  4RYW A;  1YHI A;  4GES B;  2IOV A;  2HCG A;  1F0B A;  2H9W A;  2RH7 A;  3BXB A;  4L12 A;  4ZBL A;  4W6L A;  3SV5 A;  3PJB A;  4L13 A;  3WLC A;  3DQC A;  1Q4D A;  4IK8 A;  2O2B A;  4IK1 A;  2OJK A;  4I2Y A;  2DUG A;  3ST2 A;  1JBY A;  3AI5 A;  2QLG A;  4OY4 A;  2AWM A;  3LVA A;  4IZN A;  3SG4 A;  3EK7 A;  4DXI A;  4KW8 A;  3VK1 A;  4DXO A;  4JFG A;  3P28 A;  4J88 A;  3CD9 A;  3GB3 A;  4KGE A;  4PPJ A;  4Q7T A;  3AI4 A;  4W7A A;  5J2O A;  4ANJ A;  3EVR A;  5BTT A;  3PJ5 A;  4W6P A;  2HGY A;  3LS3 A;  3SSP A;  1ZUX A;  2ICR A;  3H1R A;  1XA9 A;  5HZU A;  4LJD C;  2VAE A;  4HQ8 A;  1UIS A;  1RRX A;  3DPZ A;  2Y0G A;  2G6E A;  2OTE A;  2GX0 A;  4W73 A;  3CBE A;  3DQ6 A;  1RMM A;  4RYS A;  4XOW A;  4W6B A;  3SVO A;  4KW9 A;  2A52 B;  1YJ2 A;  3OGO A;  2VZX A;  2H5Q A;  2WIQ A;  1EMK A;  4W77 A;  3DQO A;  4Q9X A;  4ORN A;  3SVC A;  3DQ7 A;  5F9G A;  5HZS A;  3SSY A;  1F09 A;  1QY3 A;  2HFC A;  4JEO A;  4JC2 A;  3ED8 A;  4H47 A;  4DKN A;  1QYQ A;  3NEZ A;  4W7F A;  3H1O A;  3DQA A;  2O29 A;  2ARL A;  2ZO6 A;  3BXA A;  2QLG B;  1GGX A;  2HGD A;  2A47 A;  2P4M A;  1W7T A;  2YE0 A;  4B30 A;  3SVB A;  4P76 A;  3PJ7 A;  3RWA A;  4UTS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...