2VVKA

Grb2 sh3c (1)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
GSVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Distinct Binding Modes of Two Epitopes in Gab2 that Interact with the Sh3C Domain of Grb2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2vvkA00
4RTZA 2KXDA 1RLQC 2A08A 2W0ZA 1I07A 1UJYA 4OMMA 2DVJA 2RQUA 4Z89A 2EYYA 2CT3A 3RBBB 2DBKA 1YP5A 4GBQA 1OOTA 2EYXA 2RMOA 2VVKA 2HCKA 3H0IA 4ORZA 4DEXA 2H8HA 2L3PA 1AWXA 1AZGB 2OJ2A 2LCSA 2JTEA 2PTKA 2J05A 5IXBA 2RN8A 3PE0A 1X43A 1NM7A 1RI9A 1WXBA 2PNIA 2D8HA 2RQTA 1K0XA 2K3BA 1U3OA 2DBMA 3EG1A 1WFWA 3PVLA 2EBPA 2I0NA 4OMQA 1ZBJA 4J9CA 3H41A 4OMPA 1AVZC 2M51A 1AEYA 2RF0A 1T3SA 2CT4A 3O5ZA 4RTYA 1JEGA 3UA7A 1FYNA 1S1NA 1M30A 2K9GA 3VS0A 4AG1C 1SSHA 4J9HA 1QKXA 3M0QA 2FRYA 3U23A 1PRLC 2P4RA 2DL7A 2LMJA 1K1ZA 1H8KA 1Y0MA 3QWXX 1KJWA 2FPFA 2DL8A 1SRMA 5IHIA 2LNHB 1H3HA 2V1RA 5FWCA 1ZUYA 4HVVA 1K4US 1AD5A 2A36A 2CH4W 2CUBA 2AKKA 2BZ8A 2L2PA 2DMOA 2E5KA 2VWFA 1MV0B 1X27A 1YNZA 1K0SA 2DX1A 4J9FA 4JZ4A 2GNCA 2L0AA 2V1QA 2BZYA 2A28A 2MIOA 4J9BA 2F2VA 2C0OA 1YCSB 1NYGA 1WXUA 1WI7A 1YN8A 3A98A 2AZSA 2J06A 5HCKA 1GCPA 3EG3A 1ABQA 2O88A 1NLPC 2EGCA 2HDAA 3SEMA 2AZVA 2LQNA 2PZ1A 1T0HA 2LJ3A 3R6NA 1ABOA 1TUDA 1T3LA 2KXCA 4RTUA 1U5SA 4D8KA 4WCIA 1UG1A 1W6XA 2K6DA 1VYVA 1SHGA 4CC2A 1JU5C 2RPNA 3M0PA 3VRZA 2LJ1A 1FMKA 3M0RA 3UF4A 4HXJA 2GBQA 3TVTA 2B86A 1GBQA 1SHFA 2G6FX 4AFUC 3THKA 1PNJA 1YWPA 1NYFA 4Z8AA 2FRWA 4HVWA 1K9AA 4RTXA 1M3AA 4LUDA 1H92A 5IHKA 1G83A 3VS4A 2K2MA 2DL3A 1Z9QA 2FO0A 2YT6A 1UGVA 4AFZC 2JMAA 2M0YA 2RQVA 2A37A 2KT1A 1WA7A 3I9QA 1V1CA 2DRKA 2X3XD 3TSWA 1WX6A 4LNPA 1X69A 1RUWA 1PWTA 1NG2A 2ED0A 2KRMA 3UA6A 2DF6A 1BU1A 1HD3A 2KYBA 1E6HA 1GFCA 1KSWA 1UFFA 3JV3A 2IIMA 4HCKA 4A63B 4OMLA 1JXOA 2EGEA 4JJCA 2D0NA 2EKHA 5I22A 1NEGA 1WXTA 1NEBA 2F2XA 2D8JA 2EYWA 2VKNA 1WDXA 1AOJA 2KRNA 1AWWA 1SRLA 5I11A 3H0HA 1BB9A 2FPEA 2L3QA 3I35A 3VS1A 3EG2A 5IH2A 2DE0X 3LH5A 2HSPA 1EFNA 2JM8A 1X2QA 2O31A 2JXBA 1X6BA 4OMNA 5FW9A 3M0TA 4IIMA 4CC3A 1WIEA 5EC7A 1HJDA 3NHNA 1ZSGA 1ZUUA 2LJ0A 4LE9A 2LQWA 2JS2A 2RQWA 1X2KA 1JO8A 2ENMA 2EW3A 4ZNXA 1GRIA 2GTJA 2YDLA 2O9VA 1M3BA 2J6KA 2K79A 3SHWA 2HBWA 1PKTA 2KROA 2LX7A 1AWOA 1BK2A 1UTIA 2EYZA 3VS5A 3H0FA 1JQQA 2CDTA 2J6OA 5L23A 2DA9A 2BZXA 3IQLA 2KYMA 2J6FA 1GBRA 1OEBA 4IIOA 2W10A 1CKAA 4J9DA 1CSKA 1WLPB 3GBQA 2O9SA 2NWMA 3M0SA 3REAB 5IHNA 4GLMA 4JJDA 1SEMA 2LP5A 4Z88A 5GJWB 1GCQA 1MV3A 2DL4A 3EGUA 1A0NB 2EQIA 1OPLA 1X6GA 1QWEA 3EHRA 3RNJA 4J9IA 1KIKA 2RQRA 2DNUA 2EGAA 1UE9A 2CREA 1PRMC 2ESWA 2KR3A 2GQIA 2JS0A 5FWBA 4F16A 4OMOA 1M27C 4ESRA 1QKWA 3EHQA 1MUZA 4E6RA 4F17A 2D1XA 3EG0A 1GCQC 1UHFA 1W1FA 2DJQA 1QWFA 1UUEA 1RLPC 1M8MA 1ZUKA 2DL5A 2SRCA 1OPKA 2X3WD 3ZL7C 2ABLA 1B3QA 2YUOA 1YWOA 3FJ5A 1GL5A 1UJ0A 1T0JA 2JW4A 3VS6A 4J9GA 1SPKA 4AFSC 4J9EA 1PHTA 1I1JA 1UECA 2CH4A 4KRTA 3VS2A 2CUDA 3VS3A 2F2WA 4RUGA 1ZLMA 4JJBA 5ECAA 4RTVA 2J7IA 1Y57A 1I0CA 1QLYA 1VYTA 4EIKA 4K11A 2RNAA 2CSQA 1QCFA 3QWYA 3M0UA 2K7AA 1PKSA 2AK5A 2GGRA 4LN2A 1J3TA 2JM9A 2OAWA 4FSSA 2FPDA 1M3CA 1XOVA 2CSIA 2FG0A 3ULRB 2EPDA 4CC4B 2DYBA 2NUZA 4QT7A 4HVUA 2KE9A 1OV3A 4LUEA 4Y92A 1IO6A 3NGPA 2ROTA 2C0TA 2JT4A 2JMCA 1JXMA 2C0IA 3KFVA 1CKBA 3TSZA 4AFQC 1ZX6A 1N5ZA 2EVRA 2DM1A 5IXFA 1WYXA 4R0KA 2DRMA 2YUPA 1W70A 4JPBW 2YSQA 2KRSA 2XMFA 4X1VA 3VS7A 4DEYA 2ROLA 2DLPA 1NLOC 3CQTA 2OI3A 1TUCA 3PVQA 3VRYA 1KFZA 1GFDA 2BTTA 1VA7A 1VYUA 2YUNA 1Z9ZA 2MCNA 2ECZA 2ED1A 2AKLA 4JZ3A 2KT8A 2MOXA 4F14A 2O2OA 2SEMA 1ARKA 2KEAA 2L3SA 1AWJA 1UHCA 3NMZC 3REBB 1BBZA 1TG0A 1E7OA 1UDLA 2KGTA 1B07A 2QDLA 2KBTA 3UATA 2GTOA 1U06A 3I5RA 4AG2C 2FEIA 1AZEA 2KNBB 1K76A 3C0CA 1E6GA 2DILA 3I5SA 4RTWA 1G2BA 3NPFA 4D8DA 4M4ZA 2YUQA 1HSQA 4CC7A 1LCKA 2LZ6B 5GJVB 4RTTA 2HEQA
chains in the Genus database with same CATH superfamily
1LNXA 4PJLA 2DETA 1RLQC 2A08A 1Q86C 1UJYA 3CCEQ 2DXTA 4Z89A 3RKXA 2EYYA 4PJMA 2CT3A 3S3MA 3JRZA 1M9SA 4HKEA 4C0ZA 2RHUA 4J6WA 2L5QA 2RHZA 3EH1A 2RK1A 2VVKA 3CC4A 2L3PA 3HP9A 3G6EA 2OJ2A 1Q7YR 3EFOB 1IREB 5IXBA 3M59A 1WJSA 3X20B 3PE0A 2RD1A 1YHQT 4PKCC 1WXBA 1Y7XA 5KE3A 4JDSA 2DBMA 3EG1A 4BI4A 4M77F 4MDWA 3R6OA 2E65A 2EBPA 3VYHB 2ZPFB 2ZGWA 1ZBJA 4M7DF 4OMPA 1B34A 1KD1U 1AHJB 1SF9A 3ZEHA 4RTYA 2E6ZA 4PFPA 5FU6B 2M9UA 3TU4K 3NTIA 3QHSA 3VS0A 4AG1C 3JSCA 4J9HA 2ZZDA 2EQUA 3MEVA 2FRYA 1PRLC 2P4RA 2LMJA 3JCMP 3EGDB 5GAMe 2DL8A 1Q81C 1AD5A 2A36A 3G6ET 5AYFA 5LJ3h 1JJ2S 4OGCA 1VQ4A 4FCYA 1K73R 3CD6Q 5DY9A 2M16A 1VQOQ 2YRVA 2VWFA 3I55Q 1YNZA 4J9FA 4B9XA 4JZ4A 2V1QA 2A3LA 4II1A 4J9BA 5KCHA 2F2VA 2C0OA 1WI7A 1YN8A 3CPWP 5CR2A 2FL7A 3CCLT 2HDAA 3OYYA 2HBPA 2LCCA 2MF2A 2ZCFB 2KY9A 1T0HA 3R6NA 1YIJT 2E70A 4CRIA 1ABOA 1TUDA 1T3LA 2R5AA 2D6FA 1K8AR 5AT1B 4WCIA 1O9SA 3EFSA 1IRXA 4XTXA 5LJ3d 3KUFA 5CKHA 4QQDA 4M75G 3VRZA 3EH2A 2DKGA 2XICA 3OYMA 3M0RA 2WSCE 4HXJA 4IUUA 3JB9G 4KGVB 1Q81U 1KQSS 1ZA2B 2F5TX 2G6FX 4P5NA 5J26A 5CQYA 3L2RA 4XTWA 4AFUC 1G3WA 3THKA 2MPXC 2COWA 3BW1A 2VV5A 4F7UF 2YLCA 2XD0A 3VUBA 1TS9A 5LL6S 3A8HB 4C92F 1QVFS 2K2MA 3V8JA 1UGVA 1P92A 2D0QB 2RH2A 1R0BG 1V1CA 2DRKA 3MHXA 1VQPA 4LNPA 2ED0A 2VUBA 2YWWA 1UFFA 2GF7A 3M9QA 4HCKA 4PL6A 1VQ5T 4OMLA 2DZCA 2IVWA 3OW2A 2EGEA 3CMAQ 4C5GA 1WJRA 5GAMg 1F1BB 1NEGA 3CCSQ 1RABB 2D8JA 4NOYA 1WDXA 3JCMe 3HRUA 4PJOD 2KRNA 4MDXA 1WHGA 2EFIA 4N0AA 1BB9A 2P0QA 2QA4T 3I35A 3VS1A 1XJWB 3G71A 3CCUT 2L89A 2HSPA 2O31A 4HCCA 2COYA 4E2FB 3NHNA 1ZSGA 2K5LA 3QO3A 6AT1B 2QQAA 2ATCB 4L5GA 2RQWA 1JO8A 2P0PA 4FYYB 1GRIA 2M1HA 1M3BA 2K79A 4BE1A 1PKTA 1C6VX 4DBFA 3LYIA 2RJCA 4E7HA 3VS5A 5CAIA 5GAMf 3H0FA 2J6OA 4FL6A 2BZXA 3T9NA 3E19A 2J6FA 1D0ZA 4J8OA 1GBRA 2H3EB 4IIOA 1CKAA 3ME9A 1IHWA 3L2UA 3CBOA 2L8DA 4M78A 5IHNA 3DLLA 5GAOn 1H3ZA 1GCQA 3C4SA 1U8RA 3P8DA 2DIQA 5HKCA 3MEWA 3LWIA 3OYAA 4IUVA 3JB9H 1QWEA 1VQ8A 1WHJA 2DNUA 2EGAA 4C8QB 1UGPB 1SG5A 4KH0B 2KR3A 4F16A 1NE8A 1M27C 1MUZA 4E6RA 1NJIR 4M78C 4RCCA 3FEOA 1Q7YU 3EG0A 1GCQC 1HYOA 1UHFA 1S72Q 2DJQA 4JS5A 3LGLA 4QVZA 5FRMA 1QWFA 2K4YA 3G4SA 3CC7A 5FROA 2KI7A 5CQXA 1B3QA 3JCMg 2FVUA 4VUBA 3I55A 1I81A 4FT4A 3VS6A 5A0LA 1SPKA 3JB9I 1PHTA 1I1JA 2O4XA 3UPUA 1VQ8T 1MMDA 1Y71A 3VS2A 4KGZB 3J7AF 2F2WA 2YXYA 4RUGA 1TOVA 2XDBA 4K11A 1YHQQ 4WF2A 3H6ZA 4HA8A 1YJNT 5A2QE 2Z0WA 2JM9A 1K73U 4FSSA 1IGQA 4PLLA 3G4ST 1MMAA 1M3CA 3CC7T 2LT4A 1V76A 5FLXE 2FG0A 2NUZA 2YRCA 4DOWA 2DVEA 2CZ1B 4FW2A 4LUEA 4XU1A 2R57A 4Y92A 2RJDA 3D7SB 3JCMf 2CS7A 4C8QF 2JT4A 2JMCA 1JXMA 5KYXA 2K3YA 1N9RA 3MJXA 4NL3A 1ZX6A 4RG8A 3UT1A 2DM1A 5IXFA 2DRMA 1W70A 1K8AU 2XKOC 2CKKA 3OSVA 3G6EQ 3UWNA 4X1VA 4XAXB 3ZFJA 4OP0A 1ZSZA 1BI3A 4C5HA 2EQMA 2FHDA 1TUCA 3RKWA 1KFZA 4M75A 3OY9A 1VA7A 2ECZA 3G7ZA 3QJ6A 2ZPIB 1M1FA 4FYVB 1OZ2A 4QQGA 3CCSA 2R58A 3CCLQ 2O2OA 3OYCA 1M1GA 5D7UA 5HK0A 2E12A 1UHCA 3REBB 1YIJQ 3GLXA 1D0XA 1WGSA 1UDLA 1ZSZC 3L2QA 1B07A 4C8QE 1U06A 3I5RA 1OX9A 1M1KR 4M75C 2WSEE 3QDRB 2RA2A 2VASA 2LNVA 5KCOA 1ZBXA 3M4YA 4J7FA 3FJPA 4RTZA 3OYJA 2DVJA 2RQUA 2CYZB 2DXBA 3TCJA 2DBKA 1OOTA 1JJ2P 2EYXA 4J83A 1U1SA 2BE7D 1BCMA 3URGA 2QXFA 1VQNT 2DJZA 3H0IA 4OMFB 2M02A 1AZGB 4PFOA 1YJ9A 1M5Q1 2RM4A 3H8ZA 1X01A 5GAOp 2RN8A 1LOJA 2LCLA 3DKMA 1RI9A 2PNIA 2RQTA 4ZGEB 1W2BP 2QTVA 3E1SA 2I0NA 3CBMA 2AT1B 3MP6A 2P84A 1VQ5Q 2LT1A 2M51A 1AEYA 2CT4A 2QEXT 1PC0A 4C0DC 2BUDA 2K9GA 1QKXA 3M0QA 5A0DA 3ZBDA 3U23A 2ZPGB 1K1ZA 3SWNA 2QA4Q 3QWXX 5D6YA 4FW1A 2FPFA 3CCUQ 2LNHB 1H3HA 2V1RA 3OYNA 4RMOA 3JCMX 1KG1A 4FU6A 1KQSP 2CP0A 1YJ9T 2CUBA 2AKKA 2YRDA 5GAOm 5KH6A 2DMOA 9ATCB 2E5KA 1YJWT 2B8AA 1MV0B 1X27A 4M77G 1K0SA 2DX1A 3MEAA 3DB4A 4N4GA 4BE2A 4M7DG 4E7IA 2VYTA 4RCBA 2PVOB 1YCSB 1WXUA 3SWNC 3M56A 5GAMj 2MMPA 1GCPA 1NLPC 3RESA 3QUIA 2DTOA 2V26A 2QG9B 2Y4YA 3HHTB 3JCMQ 4A4KA 1NJIU 4RTUA 3RMSA 4D8KA 1NBEB 3UDCA 1W6XA 1WZOA 2QI2A 2RJEA 3OS2A 1YHQA 2ZPHB 1SHGA 3CXCA 4CC2A 3FRNA 4XU3A 5I21A 2DYIA 2LJ1A 1PSEA 2LDMA 3TVTA 2B86A 4X34A 1X75C 2WACA 4AMCA 3V8KA 4HCZA 3RIRA 1Y96A 2EJ9A 4RTXA 4KT0E 4LUDA 4A4GA 5IHKA 3OMGA 2DL3A 1Z9QA 4M78B 3X25B 2PUOB 2YT6A 1BIBA 2JMAA 2KSSA 4J6XA 4MMKA 2M0YA 4QVCA 4MZPA 1VQ9T 1TXQA 2CP5A 3I9QA 5I2MA 2X3XD 3CPFA 3TSWA 4A53A 3OYBA 3SD4A 2CGHA 1X69A 5J39A 2KYBA 2FYKA 4RG2A 1GFCA 1VUBA 3L2VA 3JV3A 5GAOl 3VV0A 3PFSA 4A63B 3OYFA 1JXOA 4JJCA 4KH1B 4MZTA 1D09B 1VQ8Q 2HNIA 4QVDA 3CCLA 1AOJA 2LQ8A 4F7UG 1TU0B 3M58A 5I11A 2EYQA 1YIJA 4FYWB 4C92G 2ZPEB 2DE0X 3WVEB 3LH5A 2A0FB 3NFCA 2JXBA 3A8OB 3QZ5B 3QYGB 4E7LA 1YJNQ 2ZAEA 2JTFA 3M57A 3I56A 1VQKA 3G4SQ 3H9NA 3OW2P 3CC7Q 1ZUUA 2LJ0A 2O4XB 2LQWA 2WSFE 3META 2EW3A 1EZZB 2GTJA 2E6NA 1MMNA 2O9VA 3VJPA 3SHWA 4AT1B 2HBWA 3PIPA 2KROA 3RR6A 2V8IA 2LX7A 5GAN7 2JTMA 4BB7A 3CCQT 4JRPA 1W2BS 3FIFA 2FZGB 3A1PA 1LJOA 2V8KA 4E47A 3S3NA 4M78F 3PGGA 5L23A 2DA9A 2RO0A 2DD5A 1OEBA 1M1KU 2W10A 1OQKA 4XU0A 4J9DA 2QGGA 4GLMA 2X4JA 4Z88A 5GJWB 1UGRB 2QQ9A 1D1CA 3I56T 1VQKT 1WHMA 4BI3A 5KYXB 2EQIA 1VQ5A 2V8JA 3KBGA 1ZQ1A 3HRTA 1YBYA 1KIKA 4J9IA 3FC3A 2RQRA 4NL2A 1Q82R 2CREA 2ESWA 5GAN4 2JS0A 5FWBA 3CEYA 4ESRA 3EHQA 5GAN5 4F17A 2EJGA 2QA4A 4JRQA 1ZSZB 1VQMT 3CCUA 1O75A 2NUTA 4GLKA 4M75B 3JCMV 2NLUA 4C8QD 2AHJB 1M8MA 4HCBA 3CCMA 4M78E 2X35A 2ABLA 2IG0A 5GANe 5L8RE 1VQ6A 2L3RA 1GL5A 1UJ0A 4XTUA 5GAN3 5GAOr 1XNIA 2DEUA 4DQ2A 2CH4A 4QQ6A 1I5OB 1VQNQ 2QQRA 2KMTA 4O6JA 4JJBA 5ECAA 4C0FA 4BE0A 1JB0E 2QYZA 1I0CA 1QLYA 5HY6A 4EDUA 3PMIA 2RNAA 2DK3A 2RB6A 2X4XA 3MP1A 2KVQG 1PKSA 2GGRA 4LDUA 1VQ7A 4ATOA 2DAQA 2CSIA 4BI8B 1QVGA 4M7AA 2EPDA 4CC4B 2Y90A 3CCMT 2K5FA 2KE9A 1WHHA 1VQ6T 1KC8R 4M7DA 2QEXQ 1R77A 2ROTA 3CPWA 3OA6A 2MI6A 1Q7YC 5M9OA 4C0DB 1NPRA 5KYWA 1CKBA 2BIVA 2HD0A 3CBPA 4AFQC 1QCOA 1G3SA 4PJNA 1XQHA 4D6WA 1WYXA 1IGUA 5C0MA 4JPBW 4RKUE 1EX4A 4M7AC 2RI5A 2XMFA 4E7JA 1M2OA 2QAZA 3RKYA 1YJ9Q 4LD9K 2ROLA 4M7DC 2OI3A 1YJWQ 2FB7A 3PVQA 3L2WA 1VQ7T 4JLGA 1VYUA 2MCNA 2ED1A 5HK3A 3M4GA 2LRQA 2K3XA 2VXEA 3SWNB 1UB4A 3WXMB 3OW2S 1K73C 1X6OA 5LJ5e 5GANg 3TEEA 2QDLA 2KDSA 2KBTA 3BDLA 4TVRA 2GTOA 2FEIA 3GIBA 2KNBB 1K76A 3HL8A 1QMCA 4KUIA 3OQ5A 3QDFA 3NPFA 1YJNA 2K57A 3QZ9B 2EWNA 2YUQA 3CC2T 5CK9A 4CC7A 1QQJA 4ZTFA 5DLQE 5GAMh 4PJOG 3CMEA 1SSFA 4M75E 1IHVA 2KXDA 1I07A 4OMMA 3ASKA 3DLMA 1IB8A 1K8AC 4GBQA 3V8LA 2RMOA 1B7TA 2K2VA 2F5KA 1NPPA 2HCKA 4ORZA 4DEXA 2H8HA 4F7UA 1AWXA 5CKBA 1ZA1B 1N6AA 2LCSA 2JTEA 1QP2A 1WQWA 3E9GA 1VQ9Q 1NM7A 5GANf 1U3OA 4J7IA 2HL3A 4E7ZA 2DXCA 1WFWA 2NUPA 5GAOq 2CZ6B 3CCVA 3OYIA 3X26B 5GAMd 1AVZC 2E41A 3OYKA 1N8RR 1I5LA 1Y96B 2RF0A 3CMET 1T3SA 3O5ZA 3J81E 4L6V5 5KYYA 2DERA 1SSHA 2Y4XA 1RAAB 1H8KA 1D0YA 3LH0A 1MGQA 2RHYA 5IHIA 4HVVA 1K4US 4ME7A 1U1TA 1RAIB 4Z02A 2KK4A 2BKDN 2L2PA 1MMGA 2XU8A 1VQLT 2QQBA 2VC8A 5KYUA 2GNCA 2A28A 2MIOA 2E64A 1D1BA 3CCVT 4OVAA 5LJ5g 1ACMB 1RAFB 2JOYA 3QSUA 1M90R 1Q82U 3JCMb 2EGCA 3CCQQ 1Q86R 1VQNA 2DPPB 4DBHA 2GFUA 3O8VA 3HFNA 3GF5A 2P0KA 2KXCA 1OI1A 4OB3B 3EFRA 1KC8C 1QCNA 2K6DA 1VYVA 5CIUA 2JJ9A 5FU7C 5IT9E 4Q5WA 3JCMh 3M54A 2HQXA 2XDPA 4C5IA 2E3HA 2RPNA 3VU3C 3JCMJ 1FMKA 2COZA 3V7RA 2LC4A 1VOMA 2IPOB 3I56Q 1VQKQ 3UF4A 4ELZC 4LDWA 1SHFA 2QEXA 5LJ3e 1PNJA 2FRWA 1FXXA 2CZ7B 4HVWA 2XG8D 1D1AA 2JUFA 1M3AA 5LJ5f 3CCJA 1H92A 2QTXA 1JRIA 5CKDA 1G83A 1TH7A 1VQMQ 4JLIA 3VS4A 1KQ2A 2F1LA 4IUTA 3X28B 2FO0A 1WJQA 4MMLA 2RQVA 2KT1A 1WA7A 2D9TA 1OYXA 2JN0A 1WX6A 3JCMd 1M2VA 1NG2A 2KRMA 3OYGA 2DF6A 3CCRA 1YJWA 1BU1A 1EIFA 2X51A 2IIMA 4LDVA 2HMAA 1OU8A 4EPCA 4M78D 2E4HA 4A4HA 5I22A 1KC8U 1NJIC 3SB2A 3OB9A 2HQHA 1NEBA 3MO8A 2F2XA 2K5IA 3GNFB 2EYWA 3OS5A 2DO3A 2NUTB 1AWWA 1R8OB 1IZ6A 1SRLA 3V7SA 2FPEA 2OTJT 2VGNA 3EG2A 3CCJT 1G5VA 5IH2A 4XK8E 2YLBA 1EFNA 3GNGA 1X2QA 4PK4A 5FW9A 3M0TA 3WVDB 1WIEA 5EC7A 1ZHIA 5KYNA 5I2SA 2BE9B 3CCMQ 1N9SA 4JJNK 2JS2A 1X2KA 2YHTA 3CCRT 1VQ6Q 3M53A 8ATCB 4ZNXA 1M8VA 1V29B 2YDLA 2J6KA 4O5VA 4DBQA 1FX7A 1AWOA 1BK2A 2EYZA 2DD4A 4LDXA 3GPLA 4ZN3A 2CP2A 3A8MB 3ER0A 1N8RC 3BE3A 2KYMA 4M7AB 1VQ9A 5IAYA 3C12A 2MYSA 3GBQA 4CI0C 2NWMA 1C1AA 2LP5A 5LJ3g 4M7DB 1KK7A 1MV3A 1VQ7Q 4FSXA 3PIOA 2OTLA 1OPLA 1X6GA 3EGXA 5KYWB 4PJOA 3HRSA 3VYGA 3QYHB 1WPYA 1UE9A 3OBYA 3G1JA 1PRMC 2GQIA 1JJ2A 4OMOA 2VGMA 1QKWA 4JUVA 2D1XA 2H3JA 2JNGA 2MWOA 4LD6A 4M78G 1UGSB 2XHCA 1WNLA 2M0OA 2VB6A 4GY5A 1RAEB 2CP7A 4PJOC 3CC2Q 1ZUKA 1M90C 2SRCA 1BI1A 2LQKA 2X3WD 3ZL7C 2YUOA 1YWOA 3FJ5A 3PTAA 2HKNA 2GCXA 1T0JA 2EQJA 2JW4A 4QKUA 1N8RU 4ZN1A 5LJ3f 3RDVA 1UEBA 4AFSC 2OTLT 4L59A 1MNEA 4XU2A 4M75D 1M1KC 2DTHA 1PCXA 3CCQA 2CUDA 3JB9D 1BIAA 2F69A 3QIIA 4RTVA 1G8XA 5D6XA 2J7IA 3HFOA 5GANj 2DXUA 3N5BB 4EIKA 4M7AF 2MAMA 4DBRA 2CSQA 3JB9J 1KQSA 3M0UA 2AK5A 1J3TA 2OAWA 1JBMA 2XK0A 1XOVA 2RI2A 2DYBA 4QT7A 3QBYA 4OB0B 1YI2A 3L42A 1QVFA 4BDYA 1OV3A 2LX9A 3CMEQ 1IO6A 2C0TA 3CXCS 4F7UB 2HZYA 2EAYA 1M90U 1YITA 3S6WA 4C92B 4UC4A 1QW1A 1K9MR 2I2LA 5DLOA 4B6MA 1Q86U 2EVRA 3CC4T 2QDYB 3QPHA 5GAN8 3LW5E 2YUPA 1VQMA 3AT1B 2NUPB 2YSQA 3NTHA 4PLIA 3VS7A 3LLRA 3VUZA 1QVGP 4DEYA 1RADB 4IKFA 3C95A 1N27A 4DA4A 1H641 1VQLQ 3VRYA 2RHIA 3MKDA 1GFDA 3EG9B 2HQEA 3OSSC 4M7AE 4M77E 3CCVQ 4ZGJB 5KYYB 4BY6C 4EMKA 4M7DE 1YI2T 4E7SA 4EMHA 2AKLA 2KT8A 3MPUB 2SEMA 4N4HA 3LX7A 1FWZA 1TG0A 1YITT 2KGTA 4WTOB 1RL2A 5KYUB 1AT1B 3C0CA 1E6GA 2DILA 2ZPBB 3I5SA 1VQ4T 1G2BA 1R0CB 5FU7B 4M4ZA 4EMKC 4V2SA 1TTHB 3A8LB 2LZ6B 5GJVB 1W4SA 5J3BA 2W0ZA 2E3IA 5LJ5j 3RBBB 4XQ3A 5GMKj 1YP5A 1G3YA 2LVMA 1QVPA 3INZA 4FM4B 4A4FA 1BYMA 1BI2A 4XTZA 1KHCA 3KXTA 2PTKA 2J05A 2OX7A 2CP3A 1X43A 2VXFA 2D8HA 4OGEA 1K0XA 2K3BA 2PQWA 3PVLA 3OYHA 3QKJA 4OMQA 4HT9A 3L2ZA 1WHLA 4J9CA 1M4ZA 1OULA 3H41A 3VKIA 2QGFB 1D3BA 1BI0A 4M77A 2NYSA 1YCYA 4N4IA 5EG2A 2GFAA 1JEGA 4BUGA 1MNDA 3UA7A 1RI0A 1FYNA 1S1NA 1M30A 2E1HA 4Y91A 2DL7A 1LPLA 3GP8A 1Y0MA 2OTJQ 3MEUA 1KJWA 3CCJQ 4X9CA 4F7UE 5DM7R 1SRMA 1M2VB 3P8HA 5FWCA 1ZUYA 4J5YA 4C92E 2CH4W 2KQWA 5CKFA 1VQPT 3E9FA 3CC2A 4M75F 4M77C 3DB3A 2BZ8A 3JCMW 2HAXA 1XTDA 3A5ZB 3OYLA 3JB9F 3JAME 4KUDK 3CCRQ 2L0AA 4N0AC 3CCEA 2BZYA 1NYGA 2HL5C 3A98A 2AZSA 2J06A 5GMKm 5HCKA 3EG3A 2DZ9A 1ABQA 2RK2A 2O88A 1PD0A 1RAHB 1SKUB 3SEMA 1KHIA 2AZVA 4C8QG 2LQNA 2PZ1A 5C6SA 1FMVA 2LJ3A 4A4EA 4JRKA 4C0GA 2R5MA 3G71T 1Y07A 1U5SA 3QXEB 5KE2A 2EKOA 1UG1A 4LXCA 5GAN2 4IURA 2HSEB 2QK0A 2XIDA 4J6YA 5GMKe 4BD3A 2DEQA 3EFOA 1JU5C 3M0PA 1TWBA 1K9MC 4XTVA 5D6WA 8AT1B 2GBQA 2MWPA 1LVKA 1GBQA 3CCET 3EAEA 1BKBA 1YWPA 1VIFA 1NYFA 4Z8AA 1KQ1A 3HSBA 1RACB 3TQ7P 1QVGS 1K9AA 4OB1B 3M5AA 3RERA 1YFNA 4IUPA 3CPWS 4AFZC 5GAN6 4ZTJA 2KAFA 2A37A 3CD6A 4FIBA 1VQOA 3FB9A 3EGDA 3BY7A 4C92A 4PJOB 3EGXB 1I4K1 1RUWA 1PWTA 3UA6A 1VQLA 5LJ3j 3LWHA 1HD3A 1Q82C 1E6HA 1KSWA 3MCAB 4LDYA 2CP6A 2O01E 2D0NA 2EKHA 5FU6C 3OYDA 2OTLQ 1WXTA 2VKNA 1HK9A 4EMGA 4Y28E 3EG9A 2XDDA 3MP8A 2G3RA 1K9MU 4HT8A 4C92C 4F04B 2P4TA 3P8BB 3H0HA 3HPWA 5GMKl 2L3QA 2FZCB 1DJ7B 2AIRB 4FYXB 4ELYC 2JM8A 2CZ0B 1X6BA 4OMNA 3RUXA 4IIMA 4CC3A 3L1AA 1HJDA 4XTYA 3OYEA 2A7YA 3F70A 4ANJA 4OB2B 1VQOT 3CD6T 4MZMA 3I55T 5A0GA 4LE9A 4YTLA 1KD1R 3E2UA 2ENMA 2XI9A 2DFUA 4A54A 1RAGB 1IXDA 1UTIA 5CCAA 5GANh 3HKSA 1JQQA 3CC4Q 4NS5A 2CDTA 4KGXB 2EJFA 3QG1A 3FDRA 3PT9A 3BDUA 1B34B 3IQLA 1CSKA 4PJOF 1WLPB 3M0SA 2O9SA 3REAB 5CVIA 1GXIE 3LGFA 1PSFA 1SEMA 4JJDA 5CKEA 2DL4A 3CMAA 3EGUA 3TREA 1A0NB 4FT2A 3EHRA 4JS4A 3RNJA 3OBWA 4BY6B 1YI2Q 1HXDA 4M7AD 3AHUA 4M77D 2RI3A 1TUGB 5GANd 4M7DD 1YITQ 2DTIA 2OAUA 3SDZA 2OTJA 5GMKi 1OU9A 2PU9B 1W1FA 2E5QA 1VQ4Q 1UUEA 1I8FA 4X9DA 1RLPC 2RHXA 3CXCP 2GQVA 2DL5A 1OPKA 3Q1JA 3V7CA 4R56A 4EMKB 1BCOA 4OF1A 1VIEA 1Q81R 4J9GA 4E7KA 1WQ7A 4KULA 2EIFA 4JRIA 4PJOE 3CMAT 2QQSA 4J9EA 2LTOA 1UECA 3CCST 2QASA 4IUQA 4KRTA 2EQKA 3VS3A 1G3TA 5FRNA 1ZLMA 4ZGDB 3C94A 4R55A 2PUKB 1Y57A 4PFZA 1VYTA 3OS0A 4DOVA 1FMWA 1QCFA 3QWYA 2K7AA 1OZ3A 4QW2A 1Q95G 4LN2A 2FPDA 3A8GB 1NZ9A 2PVGB 3ULRB 5LJ5h 3RMQA 5CO7A 5GMKh 4HVUA 1C0MA 7AT1B 3NGPA 2FZKB 1PD1A 4PNOA 2E10A 2C0IA 3KFVA 3TSZA 2X4YA 1N5ZA 4C8QA 4R0KA 3JCMc 4BACA 1S72A 2JVVA 2X4WA 2KRSA 4BDZA 4M7AG 5IN1A 1PG5B 1MHNA 2HKQB 1VQPQ 2JZ2A 3HTRA 2DLPA 1NLOC 4B9WA 3CQTA 1D3BB 4C92D 4M77B 2MK5A 1QVFP 4C5EA 3PMTA 3OS1A 2BTTA 4PJJA 2YUNA 5LJ5d 1Z9ZA 1TSFA 2C06A 4C8QC 3QJYA 3PNWC 1UGQB 1QP3A 3X24B 1PM3A 4JZ3A 2MOXA 4F14A 3FLGA 1ARKA 2KEAA 1AWJA 2L3SA 3NMZC 1BBZA 1E7OA 3G71Q 1KD1C 1WHKA 3UATA 3BFMA 4AG2C 1AZEA 1S72T 3OMCA 3GOXA 3M55A 2X9HA 4RTWA 3SFMA 4D8DA 2RJFA 3S3OA 2PVDB 4KBMB 1HSQA 1LCKA 3NTKA 3J80E 4RTTA 1OX8A 2HEQA 1W2BA 2DIGA
chains in the Genus database with same CATH topology
4RTZA 2KXDA 1RLQC 2A08A 2W0ZA 1I07A 1UJYA 4OMMA 2DVJA 2RQUA 4Z89A 2EYYA 2CT3A 3RBBB 2DBKA 1YP5A 4GBQA 1OOTA 2EYXA 2RMOA 2VVKA 2HCKA 3H0IA 4ORZA 4DEXA 2H8HA 2L3PA 1AWXA 1AZGB 2OJ2A 2LCSA 2JTEA 2PTKA 2J05A 5IXBA 2RN8A 3PE0A 1X43A 1NM7A 1RI9A 1WXBA 2PNIA 2D8HA 2RQTA 1K0XA 2K3BA 1U3OA 2DBMA 3EG1A 1WFWA 3PVLA 2EBPA 2I0NA 4OMQA 1ZBJA 4J9CA 3H41A 4OMPA 1AVZC 2M51A 1AEYA 2RF0A 1T3SA 2CT4A 3O5ZA 4RTYA 1JEGA 3UA7A 1FYNA 1S1NA 1M30A 2K9GA 3VS0A 4AG1C 1SSHA 4J9HA 1QKXA 3M0QA 2FRYA 3U23A 1PRLC 2P4RA 2DL7A 2LMJA 1K1ZA 1H8KA 1Y0MA 3QWXX 1KJWA 2FPFA 2DL8A 1SRMA 5IHIA 2LNHB 1H3HA 2V1RA 5FWCA 1ZUYA 4HVVA 1K4US 1AD5A 2A36A 2CH4W 2CUBA 2AKKA 2BZ8A 2L2PA 2DMOA 2E5KA 2VWFA 1MV0B 1X27A 1YNZA 1K0SA 2DX1A 4J9FA 4JZ4A 2GNCA 2L0AA 2V1QA 2BZYA 2A28A 2MIOA 4J9BA 2F2VA 2C0OA 1YCSB 1NYGA 1WXUA 1WI7A 1YN8A 3A98A 2AZSA 2J06A 5HCKA 1GCPA 3EG3A 1ABQA 2O88A 1NLPC 2EGCA 2HDAA 3SEMA 2AZVA 2LQNA 2PZ1A 1T0HA 2LJ3A 3R6NA 1ABOA 1TUDA 1T3LA 2KXCA 4RTUA 1U5SA 4D8KA 4WCIA 1UG1A 1W6XA 2K6DA 1VYVA 1SHGA 4CC2A 1JU5C 2RPNA 3M0PA 3VRZA 2LJ1A 1FMKA 3M0RA 3UF4A 4HXJA 2GBQA 3TVTA 2B86A 1GBQA 1SHFA 2G6FX 4AFUC 3THKA 1PNJA 1YWPA 1NYFA 4Z8AA 2FRWA 4HVWA 1K9AA 4RTXA 1M3AA 4LUDA 1H92A 5IHKA 1G83A 3VS4A 2K2MA 2DL3A 1Z9QA 2FO0A 2YT6A 1UGVA 4AFZC 2JMAA 2M0YA 2RQVA 2A37A 2KT1A 1WA7A 3I9QA 1V1CA 2DRKA 2X3XD 3TSWA 1WX6A 4LNPA 1X69A 1RUWA 1PWTA 1NG2A 2ED0A 2KRMA 3UA6A 2DF6A 1BU1A 1HD3A 2KYBA 1E6HA 1GFCA 1KSWA 1UFFA 3JV3A 2IIMA 4HCKA 4A63B 4OMLA 1JXOA 2EGEA 4JJCA 2D0NA 2EKHA 5I22A 1NEGA 1WXTA 1NEBA 2F2XA 2D8JA 2EYWA 2VKNA 1WDXA 1AOJA 2KRNA 1AWWA 1SRLA 5I11A 3H0HA 1BB9A 2FPEA 2L3QA 3I35A 3VS1A 3EG2A 5IH2A 2DE0X 3LH5A 2HSPA 1EFNA 2JM8A 1X2QA 2O31A 2JXBA 1X6BA 4OMNA 5FW9A 3M0TA 4IIMA 4CC3A 1WIEA 5EC7A 1HJDA 3NHNA 1ZSGA 1ZUUA 2LJ0A 4LE9A 2LQWA 2JS2A 2RQWA 1X2KA 1JO8A 2ENMA 2EW3A 4ZNXA 1GRIA 2GTJA 2YDLA 2O9VA 1M3BA 2J6KA 2K79A 3SHWA 2HBWA 1PKTA 2KROA 2LX7A 1AWOA 1BK2A 1UTIA 2EYZA 3VS5A 3H0FA 1JQQA 2CDTA 2J6OA 5L23A 2DA9A 2BZXA 3IQLA 2KYMA 2J6FA 1GBRA 1OEBA 4IIOA 2W10A 1CKAA 4J9DA 1CSKA 1WLPB 3GBQA 2O9SA 2NWMA 3M0SA 3REAB 5IHNA 4GLMA 4JJDA 1SEMA 2LP5A 4Z88A 5GJWB 1GCQA 1MV3A 2DL4A 3EGUA 1A0NB 2EQIA 1OPLA 1X6GA 1QWEA 3EHRA 3RNJA 4J9IA 1KIKA 2RQRA 2DNUA 2EGAA 1UE9A 2CREA 1PRMC 2ESWA 2KR3A 2GQIA 2JS0A 5FWBA 4F16A 4OMOA 1M27C 4ESRA 1QKWA 3EHQA 1MUZA 4E6RA 4F17A 2D1XA 3EG0A 1GCQC 1UHFA 1W1FA 2DJQA 1QWFA 1UUEA 1RLPC 1M8MA 1ZUKA 2DL5A 2SRCA 1OPKA 2X3WD 3ZL7C 2ABLA 1B3QA 2YUOA 1YWOA 3FJ5A 1GL5A 1UJ0A 1T0JA 2JW4A 3VS6A 4J9GA 1SPKA 4AFSC 4J9EA 1PHTA 1I1JA 1UECA 2CH4A 4KRTA 3VS2A 2CUDA 3VS3A 2F2WA 4RUGA 1ZLMA 4JJBA 5ECAA 4RTVA 2J7IA 1Y57A 1I0CA 1QLYA 1VYTA 4EIKA 4K11A 2RNAA 2CSQA 1QCFA 3QWYA 3M0UA 2K7AA 1PKSA 2AK5A 2GGRA 4LN2A 1J3TA 2JM9A 2OAWA 4FSSA 2FPDA 1M3CA 1XOVA 2CSIA 2FG0A 3ULRB 2EPDA 4CC4B 2DYBA 2NUZA 4QT7A 4HVUA 2KE9A 1OV3A 4LUEA 4Y92A 1IO6A 3NGPA 2ROTA 2C0TA 2JT4A 2JMCA 1JXMA 2C0IA 3KFVA 1CKBA 3TSZA 4AFQC 1ZX6A 1N5ZA 2EVRA 2DM1A 5IXFA 1WYXA 4R0KA 2DRMA 2YUPA 1W70A 4JPBW 2YSQA 2KRSA 2XMFA 4X1VA 3VS7A 4DEYA 2ROLA 2DLPA 1NLOC 3CQTA 2OI3A 1TUCA 3PVQA 3VRYA 1KFZA 1GFDA 2BTTA 1VA7A 1VYUA 2YUNA 1Z9ZA 2MCNA 2ECZA 2ED1A 2AKLA 4JZ3A 2KT8A 2MOXA 4F14A 2O2OA 2SEMA 1ARKA 2KEAA 2L3SA 1AWJA 1UHCA 3NMZC 3REBB 1BBZA 1TG0A 1E7OA 1UDLA 2KGTA 1B07A 2QDLA 2KBTA 3UATA 2GTOA 1U06A 3I5RA 4AG2C 2FEIA 1AZEA 2KNBB 1K76A 3C0CA 1E6GA 2DILA 3I5SA 4RTWA 1G2BA 3NPFA 4D8DA 4M4ZA 2YUQA 1HSQA 4CC7A 1LCKA 2LZ6B 5GJVB 4RTTA 2HEQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RTZ A;  2KXD A;  1RLQ C;  2A08 A;  2W0Z A;  1I07 A;  1UJY A;  4OMM A;  2DVJ A;  2RQU A;  4Z89 A;  2EYY A;  2CT3 A;  3RBB B;  2DBK A;  1YP5 A;  4GBQ A;  1OOT A;  2EYX A;  2RMO A;  2VVK A;  2HCK A;  3H0I A;  4ORZ A;  4DEX A;  2H8H A;  2L3P A;  1AWX A;  1AZG B;  2OJ2 A;  2LCS A;  2JTE A;  2PTK A;  2J05 A;  5IXB A;  2RN8 A;  3PE0 A;  1X43 A;  1NM7 A;  1RI9 A;  1WXB A;  2PNI A;  2D8H A;  2RQT A;  1K0X A;  2K3B A;  1U3O A;  2DBM A;  3EG1 A;  1WFW A;  3PVL A;  2EBP A;  2I0N A;  4OMQ A;  1ZBJ A;  4J9C A;  3H41 A;  4OMP A;  1AVZ C;  2M51 A;  1AEY A;  2RF0 A;  1T3S A;  2CT4 A;  3O5Z A;  4RTY A;  1JEG A;  3UA7 A;  1FYN A;  1S1N A;  1M30 A;  2K9G A;  3VS0 A;  4AG1 C;  1SSH A;  4J9H A;  1QKX A;  3M0Q A;  2FRY A;  3U23 A;  1PRL C;  2P4R A;  2DL7 A;  2LMJ A;  1K1Z A;  1H8K A;  1Y0M A;  3QWX X;  1KJW A;  2FPF A;  2DL8 A;  1SRM A;  5IHI A;  2LNH B;  1H3H A;  2V1R A;  5FWC A;  1ZUY A;  4HVV A;  1K4U S;  1AD5 A;  2A36 A;  2CH4 W;  2CUB A;  2AKK A;  2BZ8 A;  2L2P A;  2DMO A;  2E5K A;  2VWF A;  1MV0 B;  1X27 A;  1YNZ A;  1K0S A;  2DX1 A;  4J9F A;  4JZ4 A;  2GNC A;  2L0A A;  2V1Q A;  2BZY A;  2A28 A;  2MIO A;  4J9B A;  2F2V A;  2C0O A;  1YCS B;  1NYG A;  1WXU A;  1WI7 A;  1YN8 A;  3A98 A;  2AZS A;  2J06 A;  5HCK A;  1GCP A;  3EG3 A;  1ABQ A;  2O88 A;  1NLP C;  2EGC A;  2HDA A;  3SEM A;  2AZV A;  2LQN A;  2PZ1 A;  1T0H A;  2LJ3 A;  3R6N A;  1ABO A;  1TUD A;  1T3L A;  2KXC A;  4RTU A;  1U5S A;  4D8K A;  4WCI A;  1UG1 A;  1W6X A;  2K6D A;  1VYV A;  1SHG A;  4CC2 A;  1JU5 C;  2RPN A;  3M0P A;  3VRZ A;  2LJ1 A;  1FMK A;  3M0R A;  3UF4 A;  4HXJ A;  2GBQ A;  3TVT A;  2B86 A;  1GBQ A;  1SHF A;  2G6F X;  4AFU C;  3THK A;  1PNJ A;  1YWP A;  1NYF A;  4Z8A A;  2FRW A;  4HVW A;  1K9A A;  4RTX A;  1M3A A;  4LUD A;  1H92 A;  5IHK A;  1G83 A;  3VS4 A;  2K2M A;  2DL3 A;  1Z9Q A;  2FO0 A;  2YT6 A;  1UGV A;  4AFZ C;  2JMA A;  2M0Y A;  2RQV A;  2A37 A;  2KT1 A;  1WA7 A;  3I9Q A;  1V1C A;  2DRK A;  2X3X D;  3TSW A;  1WX6 A;  4LNP A;  1X69 A;  1RUW A;  1PWT A;  1NG2 A;  2ED0 A;  2KRM A;  3UA6 A;  2DF6 A;  1BU1 A;  1HD3 A;  2KYB A;  1E6H A;  1GFC A;  1KSW A;  1UFF A;  3JV3 A;  2IIM A;  4HCK A;  4A63 B;  4OML A;  1JXO A;  2EGE A;  4JJC A;  2D0N A;  2EKH A;  5I22 A;  1NEG A;  1WXT A;  1NEB A;  2F2X A;  2D8J A;  2EYW A;  2VKN A;  1WDX A;  1AOJ A;  2KRN A;  1AWW A;  1SRL A;  5I11 A;  3H0H A;  1BB9 A;  2FPE A;  2L3Q A;  3I35 A;  3VS1 A;  3EG2 A;  5IH2 A;  2DE0 X;  3LH5 A;  2HSP A;  1EFN A;  2JM8 A;  1X2Q A;  2O31 A;  2JXB A;  1X6B A;  4OMN A;  5FW9 A;  3M0T A;  4IIM A;  4CC3 A;  1WIE A;  5EC7 A;  1HJD A;  3NHN A;  1ZSG A;  1ZUU A;  2LJ0 A;  4LE9 A;  2LQW A;  2JS2 A;  2RQW A;  1X2K A;  1JO8 A;  2ENM A;  2EW3 A;  4ZNX A;  1GRI A;  2GTJ A;  2YDL A;  2O9V A;  1M3B A;  2J6K A;  2K79 A;  3SHW A;  2HBW A;  1PKT A;  2KRO A;  2LX7 A;  1AWO A;  1BK2 A;  1UTI A;  2EYZ A;  3VS5 A;  3H0F A;  1JQQ A;  2CDT A;  2J6O A;  5L23 A;  2DA9 A;  2BZX A;  3IQL A;  2KYM A;  2J6F A;  1GBR A;  1OEB A;  4IIO A;  2W10 A;  1CKA A;  4J9D A;  1CSK A;  1WLP B;  3GBQ A;  2O9S A;  2NWM A;  3M0S A;  3REA B;  5IHN A;  4GLM A;  4JJD A;  1SEM A;  2LP5 A;  4Z88 A;  5GJW B;  1GCQ A;  1MV3 A;  2DL4 A;  3EGU A;  1A0N B;  2EQI A;  1OPL A;  1X6G A;  1QWE A;  3EHR A;  3RNJ A;  4J9I A;  1KIK A;  2RQR A;  2DNU A;  2EGA A;  1UE9 A;  2CRE A;  1PRM C;  2ESW A;  2KR3 A;  2GQI A;  2JS0 A;  5FWB A;  4F16 A;  4OMO A;  1M27 C;  4ESR A;  1QKW A;  3EHQ A;  1MUZ A;  4E6R A;  4F17 A;  2D1X A;  3EG0 A;  1GCQ C;  1UHF A;  1W1F A;  2DJQ A;  1QWF A;  1UUE A;  1RLP C;  1M8M A;  1ZUK A;  2DL5 A;  2SRC A;  1OPK A;  2X3W D;  3ZL7 C;  2ABL A;  1B3Q A;  2YUO A;  1YWO A;  3FJ5 A;  1GL5 A;  1UJ0 A;  1T0J A;  2JW4 A;  3VS6 A;  4J9G A;  1SPK A;  4AFS C;  4J9E A;  1PHT A;  1I1J A;  1UEC A;  2CH4 A;  4KRT A;  3VS2 A;  2CUD A;  3VS3 A;  2F2W A;  4RUG A;  1ZLM A;  4JJB A;  5ECA A;  4RTV A;  2J7I A;  1Y57 A;  1I0C A;  1QLY A;  1VYT A;  4EIK A;  4K11 A;  2RNA A;  2CSQ A;  1QCF A;  3QWY A;  3M0U A;  2K7A A;  1PKS A;  2AK5 A;  2GGR A;  4LN2 A;  1J3T A;  2JM9 A;  2OAW A;  4FSS A;  2FPD A;  1M3C A;  1XOV A;  2CSI A;  2FG0 A;  3ULR B;  2EPD A;  4CC4 B;  2DYB A;  2NUZ A;  4QT7 A;  4HVU A;  2KE9 A;  1OV3 A;  4LUE A;  4Y92 A;  1IO6 A;  3NGP A;  2ROT A;  2C0T A;  2JT4 A;  2JMC A;  1JXM A;  2C0I A;  3KFV A;  1CKB A;  3TSZ A;  4AFQ C;  1ZX6 A;  1N5Z A;  2EVR A;  2DM1 A;  5IXF A;  1WYX A;  4R0K A;  2DRM A;  2YUP A;  1W70 A;  4JPB W;  2YSQ A;  2KRS A;  2XMF A;  4X1V A;  3VS7 A;  4DEY A;  2ROL A;  2DLP A;  1NLO C;  3CQT A;  2OI3 A;  1TUC A;  3PVQ A;  3VRY A;  1KFZ A;  1GFD A;  2BTT A;  1VA7 A;  1VYU A;  2YUN A;  1Z9Z A;  2MCN A;  2ECZ A;  2ED1 A;  2AKL A;  4JZ3 A;  2KT8 A;  2MOX A;  4F14 A;  2O2O A;  2SEM A;  1ARK A;  2KEA A;  2L3S A;  1AWJ A;  1UHC A;  3NMZ C;  3REB B;  1BBZ A;  1TG0 A;  1E7O A;  1UDL A;  2KGT A;  1B07 A;  2QDL A;  2KBT A;  3UAT A;  2GTO A;  1U06 A;  3I5R A;  4AG2 C;  2FEI A;  1AZE A;  2KNB B;  1K76 A;  3C0C A;  1E6G A;  2DIL A;  3I5S A;  4RTW A;  1G2B A;  3NPF A;  4D8D A;  4M4Z A;  2YUQ A;  1HSQ A;  4CC7 A;  1LCK A;  2LZ6 B;  5GJV B;  4RTT A;  2HEQ A; 
#chains in the Genus database with same CATH topology
 1LNX A;  4PJL A;  2DET A;  1RLQ C;  2A08 A;  1Q86 C;  1UJY A;  3CCE Q;  2DXT A;  4Z89 A;  3RKX A;  2EYY A;  4PJM A;  2CT3 A;  3S3M A;  3JRZ A;  1M9S A;  4HKE A;  4C0Z A;  2RHU A;  4J6W A;  2L5Q A;  2RHZ A;  3EH1 A;  2RK1 A;  2VVK A;  3CC4 A;  2L3P A;  3HP9 A;  3G6E A;  2OJ2 A;  1Q7Y R;  3EFO B;  1IRE B;  5IXB A;  3M59 A;  1WJS A;  3X20 B;  3PE0 A;  2RD1 A;  1YHQ T;  4PKC C;  1WXB A;  1Y7X A;  5KE3 A;  4JDS A;  2DBM A;  3EG1 A;  4BI4 A;  4M77 F;  4MDW A;  3R6O A;  2E65 A;  2EBP A;  3VYH B;  2ZPF B;  2ZGW A;  1ZBJ A;  4M7D F;  4OMP A;  1B34 A;  1KD1 U;  1AHJ B;  1SF9 A;  3ZEH A;  4RTY A;  2E6Z A;  4PFP A;  5FU6 B;  2M9U A;  3TU4 K;  3NTI A;  3QHS A;  3VS0 A;  4AG1 C;  3JSC A;  4J9H A;  2ZZD A;  2EQU A;  3MEV A;  2FRY A;  1PRL C;  2P4R A;  2LMJ A;  3JCM P;  3EGD B;  5GAM e;  2DL8 A;  1Q81 C;  1AD5 A;  2A36 A;  3G6E T;  5AYF A;  5LJ3 h;  1JJ2 S;  4OGC A;  1VQ4 A;  4FCY A;  1K73 R;  3CD6 Q;  5DY9 A;  2M16 A;  1VQO Q;  2YRV A;  2VWF A;  3I55 Q;  1YNZ A;  4J9F A;  4B9X A;  4JZ4 A;  2V1Q A;  2A3L A;  4II1 A;  4J9B A;  5KCH A;  2F2V A;  2C0O A;  1WI7 A;  1YN8 A;  3CPW P;  5CR2 A;  2FL7 A;  3CCL T;  2HDA A;  3OYY A;  2HBP A;  2LCC A;  2MF2 A;  2ZCF B;  2KY9 A;  1T0H A;  3R6N A;  1YIJ T;  2E70 A;  4CRI A;  1ABO A;  1TUD A;  1T3L A;  2R5A A;  2D6F A;  1K8A R;  5AT1 B;  4WCI A;  1O9S A;  3EFS A;  1IRX A;  4XTX A;  5LJ3 d;  3KUF A;  5CKH A;  4QQD A;  4M75 G;  3VRZ A;  3EH2 A;  2DKG A;  2XIC A;  3OYM A;  3M0R A;  2WSC E;  4HXJ A;  4IUU A;  3JB9 G;  4KGV B;  1Q81 U;  1KQS S;  1ZA2 B;  2F5T X;  2G6F X;  4P5N A;  5J26 A;  5CQY A;  3L2R A;  4XTW A;  4AFU C;  1G3W A;  3THK A;  2MPX C;  2COW A;  3BW1 A;  2VV5 A;  4F7U F;  2YLC A;  2XD0 A;  3VUB A;  1TS9 A;  5LL6 S;  3A8H B;  4C92 F;  1QVF S;  2K2M A;  3V8J A;  1UGV A;  1P92 A;  2D0Q B;  2RH2 A;  1R0B G;  1V1C A;  2DRK A;  3MHX A;  1VQP A;  4LNP A;  2ED0 A;  2VUB A;  2YWW A;  1UFF A;  2GF7 A;  3M9Q A;  4HCK A;  4PL6 A;  1VQ5 T;  4OML A;  2DZC A;  2IVW A;  3OW2 A;  2EGE A;  3CMA Q;  4C5G A;  1WJR A;  5GAM g;  1F1B B;  1NEG A;  3CCS Q;  1RAB B;  2D8J A;  4NOY A;  1WDX A;  3JCM e;  3HRU A;  4PJO D;  2KRN A;  4MDX A;  1WHG A;  2EFI A;  4N0A A;  1BB9 A;  2P0Q A;  2QA4 T;  3I35 A;  3VS1 A;  1XJW B;  3G71 A;  3CCU T;  2L89 A;  2HSP A;  2O31 A;  4HCC A;  2COY A;  4E2F B;  3NHN A;  1ZSG A;  2K5L A;  3QO3 A;  6AT1 B;  2QQA A;  2ATC B;  4L5G A;  2RQW A;  1JO8 A;  2P0P A;  4FYY B;  1GRI A;  2M1H A;  1M3B A;  2K79 A;  4BE1 A;  1PKT A;  1C6V X;  4DBF A;  3LYI A;  2RJC A;  4E7H A;  3VS5 A;  5CAI A;  5GAM f;  3H0F A;  2J6O A;  4FL6 A;  2BZX A;  3T9N A;  3E19 A;  2J6F A;  1D0Z A;  4J8O A;  1GBR A;  2H3E B;  4IIO A;  1CKA A;  3ME9 A;  1IHW A;  3L2U A;  3CBO A;  2L8D A;  4M78 A;  5IHN A;  3DLL A;  5GAO n;  1H3Z A;  1GCQ A;  3C4S A;  1U8R A;  3P8D A;  2DIQ A;  5HKC A;  3MEW A;  3LWI A;  3OYA A;  4IUV A;  3JB9 H;  1QWE A;  1VQ8 A;  1WHJ A;  2DNU A;  2EGA A;  4C8Q B;  1UGP B;  1SG5 A;  4KH0 B;  2KR3 A;  4F16 A;  1NE8 A;  1M27 C;  1MUZ A;  4E6R A;  1NJI R;  4M78 C;  4RCC A;  3FEO A;  1Q7Y U;  3EG0 A;  1GCQ C;  1HYO A;  1UHF A;  1S72 Q;  2DJQ A;  4JS5 A;  3LGL A;  4QVZ A;  5FRM A;  1QWF A;  2K4Y A;  3G4S A;  3CC7 A;  5FRO A;  2KI7 A;  5CQX A;  1B3Q A;  3JCM g;  2FVU A;  4VUB A;  3I55 A;  1I81 A;  4FT4 A;  3VS6 A;  5A0L A;  1SPK A;  3JB9 I;  1PHT A;  1I1J A;  2O4X A;  3UPU A;  1VQ8 T;  1MMD A;  1Y71 A;  3VS2 A;  4KGZ B;  3J7A F;  2F2W A;  2YXY A;  4RUG A;  1TOV A;  2XDB A;  4K11 A;  1YHQ Q;  4WF2 A;  3H6Z A;  4HA8 A;  1YJN T;  5A2Q E;  2Z0W A;  2JM9 A;  1K73 U;  4FSS A;  1IGQ A;  4PLL A;  3G4S T;  1MMA A;  1M3C A;  3CC7 T;  2LT4 A;  1V76 A;  5FLX E;  2FG0 A;  2NUZ A;  2YRC A;  4DOW A;  2DVE A;  2CZ1 B;  4FW2 A;  4LUE A;  4XU1 A;  2R57 A;  4Y92 A;  2RJD A;  3D7S B;  3JCM f;  2CS7 A;  4C8Q F;  2JT4 A;  2JMC A;  1JXM A;  5KYX A;  2K3Y A;  1N9R A;  3MJX A;  4NL3 A;  1ZX6 A;  4RG8 A;  3UT1 A;  2DM1 A;  5IXF A;  2DRM A;  1W70 A;  1K8A U;  2XKO C;  2CKK A;  3OSV A;  3G6E Q;  3UWN A;  4X1V A;  4XAX B;  3ZFJ A;  4OP0 A;  1ZSZ A;  1BI3 A;  4C5H A;  2EQM A;  2FHD A;  1TUC A;  3RKW A;  1KFZ A;  4M75 A;  3OY9 A;  1VA7 A;  2ECZ A;  3G7Z A;  3QJ6 A;  2ZPI B;  1M1F A;  4FYV B;  1OZ2 A;  4QQG A;  3CCS A;  2R58 A;  3CCL Q;  2O2O A;  3OYC A;  1M1G A;  5D7U A;  5HK0 A;  2E12 A;  1UHC A;  3REB B;  1YIJ Q;  3GLX A;  1D0X A;  1WGS A;  1UDL A;  1ZSZ C;  3L2Q A;  1B07 A;  4C8Q E;  1U06 A;  3I5R A;  1OX9 A;  1M1K R;  4M75 C;  2WSE E;  3QDR B;  2RA2 A;  2VAS A;  2LNV A;  5KCO A;  1ZBX A;  3M4Y A;  4J7F A;  3FJP A;  4RTZ A;  3OYJ A;  2DVJ A;  2RQU A;  2CYZ B;  2DXB A;  3TCJ A;  2DBK A;  1OOT A;  1JJ2 P;  2EYX A;  4J83 A;  1U1S A;  2BE7 D;  1BCM A;  3URG A;  2QXF A;  1VQN T;  2DJZ A;  3H0I A;  4OMF B;  2M02 A;  1AZG B;  4PFO A;  1YJ9 A;  1M5Q 1;  2RM4 A;  3H8Z A;  1X01 A;  5GAO p;  2RN8 A;  1LOJ A;  2LCL A;  3DKM A;  1RI9 A;  2PNI A;  2RQT A;  4ZGE B;  1W2B P;  2QTV A;  3E1S A;  2I0N A;  3CBM A;  2AT1 B;  3MP6 A;  2P84 A;  1VQ5 Q;  2LT1 A;  2M51 A;  1AEY A;  2CT4 A;  2QEX T;  1PC0 A;  4C0D C;  2BUD A;  2K9G A;  1QKX A;  3M0Q A;  5A0D A;  3ZBD A;  3U23 A;  2ZPG B;  1K1Z A;  3SWN A;  2QA4 Q;  3QWX X;  5D6Y A;  4FW1 A;  2FPF A;  3CCU Q;  2LNH B;  1H3H A;  2V1R A;  3OYN A;  4RMO A;  3JCM X;  1KG1 A;  4FU6 A;  1KQS P;  2CP0 A;  1YJ9 T;  2CUB A;  2AKK A;  2YRD A;  5GAO m;  5KH6 A;  2DMO A;  9ATC B;  2E5K A;  1YJW T;  2B8A A;  1MV0 B;  1X27 A;  4M77 G;  1K0S A;  2DX1 A;  3MEA A;  3DB4 A;  4N4G A;  4BE2 A;  4M7D G;  4E7I A;  2VYT A;  4RCB A;  2PVO B;  1YCS B;  1WXU A;  3SWN C;  3M56 A;  5GAM j;  2MMP A;  1GCP A;  1NLP C;  3RES A;  3QUI A;  2DTO A;  2V26 A;  2QG9 B;  2Y4Y A;  3HHT B;  3JCM Q;  4A4K A;  1NJI U;  4RTU A;  3RMS A;  4D8K A;  1NBE B;  3UDC A;  1W6X A;  1WZO A;  2QI2 A;  2RJE A;  3OS2 A;  1YHQ A;  2ZPH B;  1SHG A;  3CXC A;  4CC2 A;  3FRN A;  4XU3 A;  5I21 A;  2DYI A;  2LJ1 A;  1PSE A;  2LDM A;  3TVT A;  2B86 A;  4X34 A;  1X75 C;  2WAC A;  4AMC A;  3V8K A;  4HCZ A;  3RIR A;  1Y96 A;  2EJ9 A;  4RTX A;  4KT0 E;  4LUD A;  4A4G A;  5IHK A;  3OMG A;  2DL3 A;  1Z9Q A;  4M78 B;  3X25 B;  2PUO B;  2YT6 A;  1BIB A;  2JMA A;  2KSS A;  4J6X A;  4MMK A;  2M0Y A;  4QVC A;  4MZP A;  1VQ9 T;  1TXQ A;  2CP5 A;  3I9Q A;  5I2M A;  2X3X D;  3CPF A;  3TSW A;  4A53 A;  3OYB A;  3SD4 A;  2CGH A;  1X69 A;  5J39 A;  2KYB A;  2FYK A;  4RG2 A;  1GFC A;  1VUB A;  3L2V A;  3JV3 A;  5GAO l;  3VV0 A;  3PFS A;  4A63 B;  3OYF A;  1JXO A;  4JJC A;  4KH1 B;  4MZT A;  1D09 B;  1VQ8 Q;  2HNI A;  4QVD A;  3CCL A;  1AOJ A;  2LQ8 A;  4F7U G;  1TU0 B;  3M58 A;  5I11 A;  2EYQ A;  1YIJ A;  4FYW B;  4C92 G;  2ZPE B;  2DE0 X;  3WVE B;  3LH5 A;  2A0F B;  3NFC A;  2JXB A;  3A8O B;  3QZ5 B;  3QYG B;  4E7L A;  1YJN Q;  2ZAE A;  2JTF A;  3M57 A;  3I56 A;  1VQK A;  3G4S Q;  3H9N A;  3OW2 P;  3CC7 Q;  1ZUU A;  2LJ0 A;  2O4X B;  2LQW A;  2WSF E;  3MET A;  2EW3 A;  1EZZ B;  2GTJ A;  2E6N A;  1MMN A;  2O9V A;  3VJP A;  3SHW A;  4AT1 B;  2HBW A;  3PIP A;  2KRO A;  3RR6 A;  2V8I A;  2LX7 A;  5GAN 7;  2JTM A;  4BB7 A;  3CCQ T;  4JRP A;  1W2B S;  3FIF A;  2FZG B;  3A1P A;  1LJO A;  2V8K A;  4E47 A;  3S3N A;  4M78 F;  3PGG A;  5L23 A;  2DA9 A;  2RO0 A;  2DD5 A;  1OEB A;  1M1K U;  2W10 A;  1OQK A;  4XU0 A;  4J9D A;  2QGG A;  4GLM A;  2X4J A;  4Z88 A;  5GJW B;  1UGR B;  2QQ9 A;  1D1C A;  3I56 T;  1VQK T;  1WHM A;  4BI3 A;  5KYX B;  2EQI A;  1VQ5 A;  2V8J A;  3KBG A;  1ZQ1 A;  3HRT A;  1YBY A;  1KIK A;  4J9I A;  3FC3 A;  2RQR A;  4NL2 A;  1Q82 R;  2CRE A;  2ESW A;  5GAN 4;  2JS0 A;  5FWB A;  3CEY A;  4ESR A;  3EHQ A;  5GAN 5;  4F17 A;  2EJG A;  2QA4 A;  4JRQ A;  1ZSZ B;  1VQM T;  3CCU A;  1O75 A;  2NUT A;  4GLK A;  4M75 B;  3JCM V;  2NLU A;  4C8Q D;  2AHJ B;  1M8M A;  4HCB A;  3CCM A;  4M78 E;  2X35 A;  2ABL A;  2IG0 A;  5GAN e;  5L8R E;  1VQ6 A;  2L3R A;  1GL5 A;  1UJ0 A;  4XTU A;  5GAN 3;  5GAO r;  1XNI A;  2DEU A;  4DQ2 A;  2CH4 A;  4QQ6 A;  1I5O B;  1VQN Q;  2QQR A;  2KMT A;  4O6J A;  4JJB A;  5ECA A;  4C0F A;  4BE0 A;  1JB0 E;  2QYZ A;  1I0C A;  1QLY A;  5HY6 A;  4EDU A;  3PMI A;  2RNA A;  2DK3 A;  2RB6 A;  2X4X A;  3MP1 A;  2KVQ G;  1PKS A;  2GGR A;  4LDU A;  1VQ7 A;  4ATO A;  2DAQ A;  2CSI A;  4BI8 B;  1QVG A;  4M7A A;  2EPD A;  4CC4 B;  2Y90 A;  3CCM T;  2K5F A;  2KE9 A;  1WHH A;  1VQ6 T;  1KC8 R;  4M7D A;  2QEX Q;  1R77 A;  2ROT A;  3CPW A;  3OA6 A;  2MI6 A;  1Q7Y C;  5M9O A;  4C0D B;  1NPR A;  5KYW A;  1CKB A;  2BIV A;  2HD0 A;  3CBP A;  4AFQ C;  1QCO A;  1G3S A;  4PJN A;  1XQH A;  4D6W A;  1WYX A;  1IGU A;  5C0M A;  4JPB W;  4RKU E;  1EX4 A;  4M7A C;  2RI5 A;  2XMF A;  4E7J A;  1M2O A;  2QAZ A;  3RKY A;  1YJ9 Q;  4LD9 K;  2ROL A;  4M7D C;  2OI3 A;  1YJW Q;  2FB7 A;  3PVQ A;  3L2W A;  1VQ7 T;  4JLG A;  1VYU A;  2MCN A;  2ED1 A;  5HK3 A;  3M4G A;  2LRQ A;  2K3X A;  2VXE A;  3SWN B;  1UB4 A;  3WXM B;  3OW2 S;  1K73 C;  1X6O A;  5LJ5 e;  5GAN g;  3TEE A;  2QDL A;  2KDS A;  2KBT A;  3BDL A;  4TVR A;  2GTO A;  2FEI A;  3GIB A;  2KNB B;  1K76 A;  3HL8 A;  1QMC A;  4KUI A;  3OQ5 A;  3QDF A;  3NPF A;  1YJN A;  2K57 A;  3QZ9 B;  2EWN A;  2YUQ A;  3CC2 T;  5CK9 A;  4CC7 A;  1QQJ A;  4ZTF A;  5DLQ E;  5GAM h;  4PJO G;  3CME A;  1SSF A;  4M75 E;  1IHV A;  2KXD A;  1I07 A;  4OMM A;  3ASK A;  3DLM A;  1IB8 A;  1K8A C;  4GBQ A;  3V8L A;  2RMO A;  1B7T A;  2K2V A;  2F5K A;  1NPP A;  2HCK A;  4ORZ A;  4DEX A;  2H8H A;  4F7U A;  1AWX A;  5CKB A;  1ZA1 B;  1N6A A;  2LCS A;  2JTE A;  1QP2 A;  1WQW A;  3E9G A;  1VQ9 Q;  1NM7 A;  5GAN f;  1U3O A;  4J7I A;  2HL3 A;  4E7Z A;  2DXC A;  1WFW A;  2NUP A;  5GAO q;  2CZ6 B;  3CCV A;  3OYI A;  3X26 B;  5GAM d;  1AVZ C;  2E41 A;  3OYK A;  1N8R R;  1I5L A;  1Y96 B;  2RF0 A;  3CME T;  1T3S A;  3O5Z A;  3J81 E;  4L6V 5;  5KYY A;  2DER A;  1SSH A;  2Y4X A;  1RAA B;  1H8K A;  1D0Y A;  3LH0 A;  1MGQ A;  2RHY A;  5IHI A;  4HVV A;  1K4U S;  4ME7 A;  1U1T A;  1RAI B;  4Z02 A;  2KK4 A;  2BKD N;  2L2P A;  1MMG A;  2XU8 A;  1VQL T;  2QQB A;  2VC8 A;  5KYU A;  2GNC A;  2A28 A;  2MIO A;  2E64 A;  1D1B A;  3CCV T;  4OVA A;  5LJ5 g;  1ACM B;  1RAF B;  2JOY A;  3QSU A;  1M90 R;  1Q82 U;  3JCM b;  2EGC A;  3CCQ Q;  1Q86 R;  1VQN A;  2DPP B;  4DBH A;  2GFU A;  3O8V A;  3HFN A;  3GF5 A;  2P0K A;  2KXC A;  1OI1 A;  4OB3 B;  3EFR A;  1KC8 C;  1QCN A;  2K6D A;  1VYV A;  5CIU A;  2JJ9 A;  5FU7 C;  5IT9 E;  4Q5W A;  3JCM h;  3M54 A;  2HQX A;  2XDP A;  4C5I A;  2E3H A;  2RPN A;  3VU3 C;  3JCM J;  1FMK A;  2COZ A;  3V7R A;  2LC4 A;  1VOM A;  2IPO B;  3I56 Q;  1VQK Q;  3UF4 A;  4ELZ C;  4LDW A;  1SHF A;  2QEX A;  5LJ3 e;  1PNJ A;  2FRW A;  1FXX A;  2CZ7 B;  4HVW A;  2XG8 D;  1D1A A;  2JUF A;  1M3A A;  5LJ5 f;  3CCJ A;  1H92 A;  2QTX A;  1JRI A;  5CKD A;  1G83 A;  1TH7 A;  1VQM Q;  4JLI A;  3VS4 A;  1KQ2 A;  2F1L A;  4IUT A;  3X28 B;  2FO0 A;  1WJQ A;  4MML A;  2RQV A;  2KT1 A;  1WA7 A;  2D9T A;  1OYX A;  2JN0 A;  1WX6 A;  3JCM d;  1M2V A;  1NG2 A;  2KRM A;  3OYG A;  2DF6 A;  3CCR A;  1YJW A;  1BU1 A;  1EIF A;  2X51 A;  2IIM A;  4LDV A;  2HMA A;  1OU8 A;  4EPC A;  4M78 D;  2E4H A;  4A4H A;  5I22 A;  1KC8 U;  1NJI C;  3SB2 A;  3OB9 A;  2HQH A;  1NEB A;  3MO8 A;  2F2X A;  2K5I A;  3GNF B;  2EYW A;  3OS5 A;  2DO3 A;  2NUT B;  1AWW A;  1R8O B;  1IZ6 A;  1SRL A;  3V7S A;  2FPE A;  2OTJ T;  2VGN A;  3EG2 A;  3CCJ T;  1G5V A;  5IH2 A;  4XK8 E;  2YLB A;  1EFN A;  3GNG A;  1X2Q A;  4PK4 A;  5FW9 A;  3M0T A;  3WVD B;  1WIE A;  5EC7 A;  1ZHI A;  5KYN A;  5I2S A;  2BE9 B;  3CCM Q;  1N9S A;  4JJN K;  2JS2 A;  1X2K A;  2YHT A;  3CCR T;  1VQ6 Q;  3M53 A;  8ATC B;  4ZNX A;  1M8V A;  1V29 B;  2YDL A;  2J6K A;  4O5V A;  4DBQ A;  1FX7 A;  1AWO A;  1BK2 A;  2EYZ A;  2DD4 A;  4LDX A;  3GPL A;  4ZN3 A;  2CP2 A;  3A8M B;  3ER0 A;  1N8R C;  3BE3 A;  2KYM A;  4M7A B;  1VQ9 A;  5IAY A;  3C12 A;  2MYS A;  3GBQ A;  4CI0 C;  2NWM A;  1C1A A;  2LP5 A;  5LJ3 g;  4M7D B;  1KK7 A;  1MV3 A;  1VQ7 Q;  4FSX A;  3PIO A;  2OTL A;  1OPL A;  1X6G A;  3EGX A;  5KYW B;  4PJO A;  3HRS A;  3VYG A;  3QYH B;  1WPY A;  1UE9 A;  3OBY A;  3G1J A;  1PRM C;  2GQI A;  1JJ2 A;  4OMO A;  2VGM A;  1QKW A;  4JUV A;  2D1X A;  2H3J A;  2JNG A;  2MWO A;  4LD6 A;  4M78 G;  1UGS B;  2XHC A;  1WNL A;  2M0O A;  2VB6 A;  4GY5 A;  1RAE B;  2CP7 A;  4PJO C;  3CC2 Q;  1ZUK A;  1M90 C;  2SRC A;  1BI1 A;  2LQK A;  2X3W D;  3ZL7 C;  2YUO A;  1YWO A;  3FJ5 A;  3PTA A;  2HKN A;  2GCX A;  1T0J A;  2EQJ A;  2JW4 A;  4QKU A;  1N8R U;  4ZN1 A;  5LJ3 f;  3RDV A;  1UEB A;  4AFS C;  2OTL T;  4L59 A;  1MNE A;  4XU2 A;  4M75 D;  1M1K C;  2DTH A;  1PCX A;  3CCQ A;  2CUD A;  3JB9 D;  1BIA A;  2F69 A;  3QII A;  4RTV A;  1G8X A;  5D6X A;  2J7I A;  3HFO A;  5GAN j;  2DXU A;  3N5B B;  4EIK A;  4M7A F;  2MAM A;  4DBR A;  2CSQ A;  3JB9 J;  1KQS A;  3M0U A;  2AK5 A;  1J3T A;  2OAW A;  1JBM A;  2XK0 A;  1XOV A;  2RI2 A;  2DYB A;  4QT7 A;  3QBY A;  4OB0 B;  1YI2 A;  3L42 A;  1QVF A;  4BDY A;  1OV3 A;  2LX9 A;  3CME Q;  1IO6 A;  2C0T A;  3CXC S;  4F7U B;  2HZY A;  2EAY A;  1M90 U;  1YIT A;  3S6W A;  4C92 B;  4UC4 A;  1QW1 A;  1K9M R;  2I2L A;  5DLO A;  4B6M A;  1Q86 U;  2EVR A;  3CC4 T;  2QDY B;  3QPH A;  5GAN 8;  3LW5 E;  2YUP A;  1VQM A;  3AT1 B;  2NUP B;  2YSQ A;  3NTH A;  4PLI A;  3VS7 A;  3LLR A;  3VUZ A;  1QVG P;  4DEY A;  1RAD B;  4IKF A;  3C95 A;  1N27 A;  4DA4 A;  1H64 1;  1VQL Q;  3VRY A;  2RHI A;  3MKD A;  1GFD A;  3EG9 B;  2HQE A;  3OSS C;  4M7A E;  4M77 E;  3CCV Q;  4ZGJ B;  5KYY B;  4BY6 C;  4EMK A;  4M7D E;  1YI2 T;  4E7S A;  4EMH A;  2AKL A;  2KT8 A;  3MPU B;  2SEM A;  4N4H A;  3LX7 A;  1FWZ A;  1TG0 A;  1YIT T;  2KGT A;  4WTO B;  1RL2 A;  5KYU B;  1AT1 B;  3C0C A;  1E6G A;  2DIL A;  2ZPB B;  3I5S A;  1VQ4 T;  1G2B A;  1R0C B;  5FU7 B;  4M4Z A;  4EMK C;  4V2S A;  1TTH B;  3A8L B;  2LZ6 B;  5GJV B;  1W4S A;  5J3B A;  2W0Z A;  2E3I A;  5LJ5 j;  3RBB B;  4XQ3 A;  5GMK j;  1YP5 A;  1G3Y A;  2LVM A;  1QVP A;  3INZ A;  4FM4 B;  4A4F A;  1BYM A;  1BI2 A;  4XTZ A;  1KHC A;  3KXT A;  2PTK A;  2J05 A;  2OX7 A;  2CP3 A;  1X43 A;  2VXF A;  2D8H A;  4OGE A;  1K0X A;  2K3B A;  2PQW A;  3PVL A;  3OYH A;  3QKJ A;  4OMQ A;  4HT9 A;  3L2Z A;  1WHL A;  4J9C A;  1M4Z A;  1OUL A;  3H41 A;  3VKI A;  2QGF B;  1D3B A;  1BI0 A;  4M77 A;  2NYS A;  1YCY A;  4N4I A;  5EG2 A;  2GFA A;  1JEG A;  4BUG A;  1MND A;  3UA7 A;  1RI0 A;  1FYN A;  1S1N A;  1M30 A;  2E1H A;  4Y91 A;  2DL7 A;  1LPL A;  3GP8 A;  1Y0M A;  2OTJ Q;  3MEU A;  1KJW A;  3CCJ Q;  4X9C A;  4F7U E;  5DM7 R;  1SRM A;  1M2V B;  3P8H A;  5FWC A;  1ZUY A;  4J5Y A;  4C92 E;  2CH4 W;  2KQW A;  5CKF A;  1VQP T;  3E9F A;  3CC2 A;  4M75 F;  4M77 C;  3DB3 A;  2BZ8 A;  3JCM W;  2HAX A;  1XTD A;  3A5Z B;  3OYL A;  3JB9 F;  3JAM E;  4KUD K;  3CCR Q;  2L0A A;  4N0A C;  3CCE A;  2BZY A;  1NYG A;  2HL5 C;  3A98 A;  2AZS A;  2J06 A;  5GMK m;  5HCK A;  3EG3 A;  2DZ9 A;  1ABQ A;  2RK2 A;  2O88 A;  1PD0 A;  1RAH B;  1SKU B;  3SEM A;  1KHI A;  2AZV A;  4C8Q G;  2LQN A;  2PZ1 A;  5C6S A;  1FMV A;  2LJ3 A;  4A4E A;  4JRK A;  4C0G A;  2R5M A;  3G71 T;  1Y07 A;  1U5S A;  3QXE B;  5KE2 A;  2EKO A;  1UG1 A;  4LXC A;  5GAN 2;  4IUR A;  2HSE B;  2QK0 A;  2XID A;  4J6Y A;  5GMK e;  4BD3 A;  2DEQ A;  3EFO A;  1JU5 C;  3M0P A;  1TWB A;  1K9M C;  4XTV A;  5D6W A;  8AT1 B;  2GBQ A;  2MWP A;  1LVK A;  1GBQ A;  3CCE T;  3EAE A;  1BKB A;  1YWP A;  1VIF A;  1NYF A;  4Z8A A;  1KQ1 A;  3HSB A;  1RAC B;  3TQ7 P;  1QVG S;  1K9A A;  4OB1 B;  3M5A A;  3RER A;  1YFN A;  4IUP A;  3CPW S;  4AFZ C;  5GAN 6;  4ZTJ A;  2KAF A;  2A37 A;  3CD6 A;  4FIB A;  1VQO A;  3FB9 A;  3EGD A;  3BY7 A;  4C92 A;  4PJO B;  3EGX B;  1I4K 1;  1RUW A;  1PWT A;  3UA6 A;  1VQL A;  5LJ3 j;  3LWH A;  1HD3 A;  1Q82 C;  1E6H A;  1KSW A;  3MCA B;  4LDY A;  2CP6 A;  2O01 E;  2D0N A;  2EKH A;  5FU6 C;  3OYD A;  2OTL Q;  1WXT A;  2VKN A;  1HK9 A;  4EMG A;  4Y28 E;  3EG9 A;  2XDD A;  3MP8 A;  2G3R A;  1K9M U;  4HT8 A;  4C92 C;  4F04 B;  2P4T A;  3P8B B;  3H0H A;  3HPW A;  5GMK l;  2L3Q A;  2FZC B;  1DJ7 B;  2AIR B;  4FYX B;  4ELY C;  2JM8 A;  2CZ0 B;  1X6B A;  4OMN A;  3RUX A;  4IIM A;  4CC3 A;  3L1A A;  1HJD A;  4XTY A;  3OYE A;  2A7Y A;  3F70 A;  4ANJ A;  4OB2 B;  1VQO T;  3CD6 T;  4MZM A;  3I55 T;  5A0G A;  4LE9 A;  4YTL A;  1KD1 R;  3E2U A;  2ENM A;  2XI9 A;  2DFU A;  4A54 A;  1RAG B;  1IXD A;  1UTI A;  5CCA A;  5GAN h;  3HKS A;  1JQQ A;  3CC4 Q;  4NS5 A;  2CDT A;  4KGX B;  2EJF A;  3QG1 A;  3FDR A;  3PT9 A;  3BDU A;  1B34 B;  3IQL A;  1CSK A;  4PJO F;  1WLP B;  3M0S A;  2O9S A;  3REA B;  5CVI A;  1GXI E;  3LGF A;  1PSF A;  1SEM A;  4JJD A;  5CKE A;  2DL4 A;  3CMA A;  3EGU A;  3TRE A;  1A0N B;  4FT2 A;  3EHR A;  4JS4 A;  3RNJ A;  3OBW A;  4BY6 B;  1YI2 Q;  1HXD A;  4M7A D;  3AHU A;  4M77 D;  2RI3 A;  1TUG B;  5GAN d;  4M7D D;  1YIT Q;  2DTI A;  2OAU A;  3SDZ A;  2OTJ A;  5GMK i;  1OU9 A;  2PU9 B;  1W1F A;  2E5Q A;  1VQ4 Q;  1UUE A;  1I8F A;  4X9D A;  1RLP C;  2RHX A;  3CXC P;  2GQV A;  2DL5 A;  1OPK A;  3Q1J A;  3V7C A;  4R56 A;  4EMK B;  1BCO A;  4OF1 A;  1VIE A;  1Q81 R;  4J9G A;  4E7K A;  1WQ7 A;  4KUL A;  2EIF A;  4JRI A;  4PJO E;  3CMA T;  2QQS A;  4J9E A;  2LTO A;  1UEC A;  3CCS T;  2QAS A;  4IUQ A;  4KRT A;  2EQK A;  3VS3 A;  1G3T A;  5FRN A;  1ZLM A;  4ZGD B;  3C94 A;  4R55 A;  2PUK B;  1Y57 A;  4PFZ A;  1VYT A;  3OS0 A;  4DOV A;  1FMW A;  1QCF A;  3QWY A;  2K7A A;  1OZ3 A;  4QW2 A;  1Q95 G;  4LN2 A;  2FPD A;  3A8G B;  1NZ9 A;  2PVG B;  3ULR B;  5LJ5 h;  3RMQ A;  5CO7 A;  5GMK h;  4HVU A;  1C0M A;  7AT1 B;  3NGP A;  2FZK B;  1PD1 A;  4PNO A;  2E10 A;  2C0I A;  3KFV A;  3TSZ A;  2X4Y A;  1N5Z A;  4C8Q A;  4R0K A;  3JCM c;  4BAC A;  1S72 A;  2JVV A;  2X4W A;  2KRS A;  4BDZ A;  4M7A G;  5IN1 A;  1PG5 B;  1MHN A;  2HKQ B;  1VQP Q;  2JZ2 A;  3HTR A;  2DLP A;  1NLO C;  4B9W A;  3CQT A;  1D3B B;  4C92 D;  4M77 B;  2MK5 A;  1QVF P;  4C5E A;  3PMT A;  3OS1 A;  2BTT A;  4PJJ A;  2YUN A;  5LJ5 d;  1Z9Z A;  1TSF A;  2C06 A;  4C8Q C;  3QJY A;  3PNW C;  1UGQ B;  1QP3 A;  3X24 B;  1PM3 A;  4JZ3 A;  2MOX A;  4F14 A;  3FLG A;  1ARK A;  2KEA A;  1AWJ A;  2L3S A;  3NMZ C;  1BBZ A;  1E7O A;  3G71 Q;  1KD1 C;  1WHK A;  3UAT A;  3BFM A;  4AG2 C;  1AZE A;  1S72 T;  3OMC A;  3GOX A;  3M55 A;  2X9H A;  4RTW A;  3SFM A;  4D8D A;  2RJF A;  3S3O A;  2PVD B;  4KBM B;  1HSQ A;  1LCK A;  3NTK A;  3J80 E;  4RTT A;  1OX8 A;  2HEQ A;  1W2B A;  2DIG A; 
#chains in the Genus database with same CATH homology
 4RTZ A;  2KXD A;  1RLQ C;  2A08 A;  2W0Z A;  1I07 A;  1UJY A;  4OMM A;  2DVJ A;  2RQU A;  4Z89 A;  2EYY A;  2CT3 A;  3RBB B;  2DBK A;  1YP5 A;  4GBQ A;  1OOT A;  2EYX A;  2RMO A;  2VVK A;  2HCK A;  3H0I A;  4ORZ A;  4DEX A;  2H8H A;  2L3P A;  1AWX A;  1AZG B;  2OJ2 A;  2LCS A;  2JTE A;  2PTK A;  2J05 A;  5IXB A;  2RN8 A;  3PE0 A;  1X43 A;  1NM7 A;  1RI9 A;  1WXB A;  2PNI A;  2D8H A;  2RQT A;  1K0X A;  2K3B A;  1U3O A;  2DBM A;  3EG1 A;  1WFW A;  3PVL A;  2EBP A;  2I0N A;  4OMQ A;  1ZBJ A;  4J9C A;  3H41 A;  4OMP A;  1AVZ C;  2M51 A;  1AEY A;  2RF0 A;  1T3S A;  2CT4 A;  3O5Z A;  4RTY A;  1JEG A;  3UA7 A;  1FYN A;  1S1N A;  1M30 A;  2K9G A;  3VS0 A;  4AG1 C;  1SSH A;  4J9H A;  1QKX A;  3M0Q A;  2FRY A;  3U23 A;  1PRL C;  2P4R A;  2DL7 A;  2LMJ A;  1K1Z A;  1H8K A;  1Y0M A;  3QWX X;  1KJW A;  2FPF A;  2DL8 A;  1SRM A;  5IHI A;  2LNH B;  1H3H A;  2V1R A;  5FWC A;  1ZUY A;  4HVV A;  1K4U S;  1AD5 A;  2A36 A;  2CH4 W;  2CUB A;  2AKK A;  2BZ8 A;  2L2P A;  2DMO A;  2E5K A;  2VWF A;  1MV0 B;  1X27 A;  1YNZ A;  1K0S A;  2DX1 A;  4J9F A;  4JZ4 A;  2GNC A;  2L0A A;  2V1Q A;  2BZY A;  2A28 A;  2MIO A;  4J9B A;  2F2V A;  2C0O A;  1YCS B;  1NYG A;  1WXU A;  1WI7 A;  1YN8 A;  3A98 A;  2AZS A;  2J06 A;  5HCK A;  1GCP A;  3EG3 A;  1ABQ A;  2O88 A;  1NLP C;  2EGC A;  2HDA A;  3SEM A;  2AZV A;  2LQN A;  2PZ1 A;  1T0H A;  2LJ3 A;  3R6N A;  1ABO A;  1TUD A;  1T3L A;  2KXC A;  4RTU A;  1U5S A;  4D8K A;  4WCI A;  1UG1 A;  1W6X A;  2K6D A;  1VYV A;  1SHG A;  4CC2 A;  1JU5 C;  2RPN A;  3M0P A;  3VRZ A;  2LJ1 A;  1FMK A;  3M0R A;  3UF4 A;  4HXJ A;  2GBQ A;  3TVT A;  2B86 A;  1GBQ A;  1SHF A;  2G6F X;  4AFU C;  3THK A;  1PNJ A;  1YWP A;  1NYF A;  4Z8A A;  2FRW A;  4HVW A;  1K9A A;  4RTX A;  1M3A A;  4LUD A;  1H92 A;  5IHK A;  1G83 A;  3VS4 A;  2K2M A;  2DL3 A;  1Z9Q A;  2FO0 A;  2YT6 A;  1UGV A;  4AFZ C;  2JMA A;  2M0Y A;  2RQV A;  2A37 A;  2KT1 A;  1WA7 A;  3I9Q A;  1V1C A;  2DRK A;  2X3X D;  3TSW A;  1WX6 A;  4LNP A;  1X69 A;  1RUW A;  1PWT A;  1NG2 A;  2ED0 A;  2KRM A;  3UA6 A;  2DF6 A;  1BU1 A;  1HD3 A;  2KYB A;  1E6H A;  1GFC A;  1KSW A;  1UFF A;  3JV3 A;  2IIM A;  4HCK A;  4A63 B;  4OML A;  1JXO A;  2EGE A;  4JJC A;  2D0N A;  2EKH A;  5I22 A;  1NEG A;  1WXT A;  1NEB A;  2F2X A;  2D8J A;  2EYW A;  2VKN A;  1WDX A;  1AOJ A;  2KRN A;  1AWW A;  1SRL A;  5I11 A;  3H0H A;  1BB9 A;  2FPE A;  2L3Q A;  3I35 A;  3VS1 A;  3EG2 A;  5IH2 A;  2DE0 X;  3LH5 A;  2HSP A;  1EFN A;  2JM8 A;  1X2Q A;  2O31 A;  2JXB A;  1X6B A;  4OMN A;  5FW9 A;  3M0T A;  4IIM A;  4CC3 A;  1WIE A;  5EC7 A;  1HJD A;  3NHN A;  1ZSG A;  1ZUU A;  2LJ0 A;  4LE9 A;  2LQW A;  2JS2 A;  2RQW A;  1X2K A;  1JO8 A;  2ENM A;  2EW3 A;  4ZNX A;  1GRI A;  2GTJ A;  2YDL A;  2O9V A;  1M3B A;  2J6K A;  2K79 A;  3SHW A;  2HBW A;  1PKT A;  2KRO A;  2LX7 A;  1AWO A;  1BK2 A;  1UTI A;  2EYZ A;  3VS5 A;  3H0F A;  1JQQ A;  2CDT A;  2J6O A;  5L23 A;  2DA9 A;  2BZX A;  3IQL A;  2KYM A;  2J6F A;  1GBR A;  1OEB A;  4IIO A;  2W10 A;  1CKA A;  4J9D A;  1CSK A;  1WLP B;  3GBQ A;  2O9S A;  2NWM A;  3M0S A;  3REA B;  5IHN A;  4GLM A;  4JJD A;  1SEM A;  2LP5 A;  4Z88 A;  5GJW B;  1GCQ A;  1MV3 A;  2DL4 A;  3EGU A;  1A0N B;  2EQI A;  1OPL A;  1X6G A;  1QWE A;  3EHR A;  3RNJ A;  4J9I A;  1KIK A;  2RQR A;  2DNU A;  2EGA A;  1UE9 A;  2CRE A;  1PRM C;  2ESW A;  2KR3 A;  2GQI A;  2JS0 A;  5FWB A;  4F16 A;  4OMO A;  1M27 C;  4ESR A;  1QKW A;  3EHQ A;  1MUZ A;  4E6R A;  4F17 A;  2D1X A;  3EG0 A;  1GCQ C;  1UHF A;  1W1F A;  2DJQ A;  1QWF A;  1UUE A;  1RLP C;  1M8M A;  1ZUK A;  2DL5 A;  2SRC A;  1OPK A;  2X3W D;  3ZL7 C;  2ABL A;  1B3Q A;  2YUO A;  1YWO A;  3FJ5 A;  1GL5 A;  1UJ0 A;  1T0J A;  2JW4 A;  3VS6 A;  4J9G A;  1SPK A;  4AFS C;  4J9E A;  1PHT A;  1I1J A;  1UEC A;  2CH4 A;  4KRT A;  3VS2 A;  2CUD A;  3VS3 A;  2F2W A;  4RUG A;  1ZLM A;  4JJB A;  5ECA A;  4RTV A;  2J7I A;  1Y57 A;  1I0C A;  1QLY A;  1VYT A;  4EIK A;  4K11 A;  2RNA A;  2CSQ A;  1QCF A;  3QWY A;  3M0U A;  2K7A A;  1PKS A;  2AK5 A;  2GGR A;  4LN2 A;  1J3T A;  2JM9 A;  2OAW A;  4FSS A;  2FPD A;  1M3C A;  1XOV A;  2CSI A;  2FG0 A;  3ULR B;  2EPD A;  4CC4 B;  2DYB A;  2NUZ A;  4QT7 A;  4HVU A;  2KE9 A;  1OV3 A;  4LUE A;  4Y92 A;  1IO6 A;  3NGP A;  2ROT A;  2C0T A;  2JT4 A;  2JMC A;  1JXM A;  2C0I A;  3KFV A;  1CKB A;  3TSZ A;  4AFQ C;  1ZX6 A;  1N5Z A;  2EVR A;  2DM1 A;  5IXF A;  1WYX A;  4R0K A;  2DRM A;  2YUP A;  1W70 A;  4JPB W;  2YSQ A;  2KRS A;  2XMF A;  4X1V A;  3VS7 A;  4DEY A;  2ROL A;  2DLP A;  1NLO C;  3CQT A;  2OI3 A;  1TUC A;  3PVQ A;  3VRY A;  1KFZ A;  1GFD A;  2BTT A;  1VA7 A;  1VYU A;  2YUN A;  1Z9Z A;  2MCN A;  2ECZ A;  2ED1 A;  2AKL A;  4JZ3 A;  2KT8 A;  2MOX A;  4F14 A;  2O2O A;  2SEM A;  1ARK A;  2KEA A;  2L3S A;  1AWJ A;  1UHC A;  3NMZ C;  3REB B;  1BBZ A;  1TG0 A;  1E7O A;  1UDL A;  2KGT A;  1B07 A;  2QDL A;  2KBT A;  3UAT A;  2GTO A;  1U06 A;  3I5R A;  4AG2 C;  2FEI A;  1AZE A;  2KNB B;  1K76 A;  3C0C A;  1E6G A;  2DIL A;  3I5S A;  4RTW A;  1G2B A;  3NPF A;  4D8D A;  4M4Z A;  2YUQ A;  1HSQ A;  4CC7 A;  1LCK A;  2LZ6 B;  5GJV B;  4RTT A;  2HEQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...