2VVKA

Grb2 sh3c (1)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
GSVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Binding Modes of Two Epitopes in Gab2 that Interact with the Sh3C Domain of Grb2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2vvkA00
2LJ3A 2EBPA 2CUDA 2KT8A 2O9VA 2NUZA 1N5ZA 1SRLA 1M8MA 2EGEA 2NWMA 2F2WA 1K9AA 4HCKA 1H3HA 1VA7A 1TUCA 3H0FA 1RLPC 1KJWA 2KYBA 4J9EA 4RUGA 2DX1A 1W1FA 2O9SA 2DJQA 5HCKA 4D8DA 1KIKA 5L23A 1JEGA 1E7OA 1AWOA 2PNIA 4JZ3A 4ORZA 2LMJA 1SHGA 2D8JA 2AKKA 1PHTA 2X3XD 3PVLA 1T0JA 4F17A 4RTTA 2EQIA 1PRLC 2LZ6B 1AZEA 2YUOA 1G83A 3LH5A 2KRSA 2BZYA 1U5SA 3UATA 1GBRA 1GFDA 3VS4A 4RTVA 5IH2A 2V1QA 2I0NA 2FPDA 1YCSB 2L0AA 2KXCA 1QKXA 4DEYA 4KRTA 1UJ0A 1Z9ZA 4OMQA 1ZLMA 2OJ2A 1Y57A 3VRYA 3VS5A 2K9GA 3VS7A 2KRMA 2DL7A 1I07A 3FJ5A 4M4ZA 3R6NA 4AG1C 1X69A 2GQIA 2W10A 1WI7A 1RLQC 1V1CA 4J9IA 4HXJA 4J9GA 2OAWA 5IHKA 2E5KA 4K11A 3VS2A 3TSZA 1RUWA 2RQVA 5IHIA 2DRMA 1IO6A 2C0TA 2D8HA 1QWEA 4AFZC 2RQTA 3VRZA 4HVWA 4AFQC 4R0KA 2CSQA 2RF0A 3NHNA 3SHWA 2ED0A 1E6GA 3A98A 2AK5A 2DA9A 1WLPB 4OMLA 1FMKA 2O88A 1UFFA 1MUZA 1NYFA 2JTEA 1HJDA 1ABOA 1H92A 2X3WD 1KFZA 2GTJA 1BU1A 1SHFA 2HBWA 2JW4A 2DE0X 1SPKA 2ABLA 3SEMA 2EGCA 3JV3A 2CH4A 1GFCA 2EPDA 2IIMA 1PNJA 1AD5A 5IHNA 2QDLA 1WIEA 1SSHA 1BK2A 4LUDA 2JM9A 2MCNA 2J7IA 3M0RA 4CC7A 2DMOA 2CT4A 1X2QA 1M27C 2JM8A 2EYWA 2HDAA 2ENMA 1SEMA 2DF6A 2ROLA 1ZUUA 3EHRA 4AG2C 1NEGA 3M0UA 1GCQC 4HVUA 1AVZC 2HEQA 1GBQA 2L3SA 1OV3A 1QKWA 2KNBB 1GRIA 2ESWA 4A63B 1MV0B 2D0NA 1YN8A 1Z9QA 1X27A 1NEBA 2LP5A 2KT1A 1NM7A 2L3QA 1WA7A 2KBTA 1YWPA 3ULRB 2DL5A 2K7AA 2VWFA 1TG0A 2GNCA 2JMAA 2JMCA 1WX6A 1BBZA 1KSWA 1PWTA 1YWOA 2DL3A 2J6KA 2EW3A 1K0SA 1UE9A 2AZVA 2EYYA 1UECA 1XOVA 4EIKA 1BB9A 2EYXA 2GGRA 2DILA 1K1ZA 1WXTA 1ZSGA 4RTZA 2O31A 1NYGA 1YP5A 2VVKA 2YUQA 1QCFA 2DYBA 4OMPA 1HD3A 3QWXX 1QWFA 3NGPA 1X43A 3O5ZA 2CDTA 2ED1A 2J6OA 4LN2A 2CSIA 5I11A 4IIMA 1I1JA 1ZX6A 3GBQA 1S1NA 2HCKA 4JJDA 4Y92A 4CC2A 3QWYA 2CH4W 1WXUA 2B86A 1AZGB 1FYNA 2O2OA 4CC3A 1LCKA 2EVRA 2YUPA 1K0XA 3VS6A 3TVTA 3I9QA 4JPBW 1GCQA 1HSQA 1JXMA 3EHQA 2A37A 1WXBA 2JT4A 4D8KA 1T3SA 2XMFA 2RQWA 3PE0A 1Y0MA 2DL4A 3UA7A 1NLPC 1VYVA 1X6BA 1M3CA 4JJCA 2F2VA 1TUDA 2JS2A 2FEIA 4LUEA 2JS0A 1B3QA 1MV3A 1ARKA 2LJ1A 2YDLA 4Z88A 3PVQA 2RN8A 1K76A 1T3LA 2YUNA 4LNPA 2YSQA 4GLMA 2AZSA 2K3BA 2KYMA 3VS1A 1G2BA 4J9CA 4CC4B 3RBBB 1OPKA 4DEXA 1NG2A 1YNZA 4AFUC 1ZUKA 2A28A 2BZXA 4HVVA 4E6RA 2F2XA 4OMMA 1AWWA 3U23A 2L2PA 2BZ8A 2DM1A 3I5RA 2KE9A 2GTOA 2A08A 4JZ4A 3THKA 2W0ZA 1K4US 2OI3A 2ROTA 1OPLA 3H0IA 3KFVA 1AWXA 4WCIA 2C0IA 1JQQA 2FG0A 2LX7A 2G6FX 3CQTA 2VKNA 1OOTA 2DNUA 2FRYA 2RPNA 4OMOA 3EG1A 4RTXA 4F14A 4FSSA 1GL5A 2KR3A 1WDXA 2FO0A 1NLOC 1W70A 2KROA 5FW9A 4Z89A 5FWBA 5IXFA 1PKSA 4ZNXA 2LQWA 3M0PA 5GJVB 1PRMC 1SRMA 2CREA 3EG0A 2MIOA 3EGUA 2M51A 1RI9A 1CSKA 2CT3A 1GCPA 1JXOA 1I0CA 4LE9A 3UA6A 2AKLA 4J9HA 2RQUA 2H8HA 2DLPA 3RNJA 2K2MA 3NMZC 1W6XA 1CKBA 1M3BA 1UHFA 2YT6A 4JJBA 1AWJA 1EFNA 2JXBA 1M3AA 2PTKA 2LJ0A 2EGAA 5GJWB 4RTYA 2C0OA 1U3OA 4RTWA 1JO8A 3NPFA 2BTTA 2FPFA 4F16A 1M30A 4J9FA 1UDLA 2KXDA 5EC7A 2LQNA 2DBKA 2HSPA 2CUBA 1J3TA 3M0SA 1ABQA 5IXBA 2K79A 2P4RA 3VS0A 1UTIA 2RNAA 1WYXA 1A0NB 2DBMA 2RMOA 2KEAA 2SRCA 4J9BA 3ZL7C 2KRNA 3IQLA 4ESRA 4Z8AA 3REAB 1UUEA 1WFWA 3I35A 3VS3A 4OMNA 4X1VA 2K6DA 2L3PA 4AFSC 1X6GA 3H41A 2ECZA 3M0QA 2DRKA 2M0YA 1JU5C 3H0HA 5ECAA 3TSWA 2DVJA 1OEBA 3EG2A 2SEMA 1U06A 2FRWA 5FWCA 3M0TA 1AOJA 1T0HA 1E6HA 2J05A 1PKTA 1UGVA 2D1XA 4GBQA 3UF4A 1B07A 3EG3A 3REBB 2FPEA 1UHCA 1VYUA 1ZUYA 2V1RA 1ZBJA 1VYTA 2RQRA 3I5SA 4J9DA 4QT7A 4IIOA 1UG1A 1UJYA 2LCSA 1QLYA 2LNHB 1H8KA 2EKHA 2J6FA 1AEYA 4RTUA 2PZ1A 2GBQA 2KGTA 5I22A 2MOXA 2EYZA 3C0CA 1X2KA 2A36A 2J06A 2DL8A 1CKAA
chains in the Genus database with same CATH superfamily
3HL8A 3G4ST 2KT8A 3G1JA 1ACMB 2NUZA 3T9NA 4MZMA 1M8MA 2EGEA 3PNWC 4FL6A 2F2WA 1VQ6Q 1JRIA 3KXTA 1VA7A 5KCHA 2DFUA 1KJWA 2DX1A 5J3BA 1KIKA 4JDSA 1ZHIA 1PM3A 1AWOA 3DB3A 4ORZA 2CP6A 3EG9A 1QVPA 3SD4A 3PVLA 2K57A 1IZ6A 3EFOB 2EQIA 1AZEA 4PFZA 2K2VA 3J80E 2O4XA 4OB3B 3DLLA 2JJ9A 2COYA 1YCSB 2RJFA 2NUPB 1QKXA 4XAXB 4KRTA 4AMCA 5GANd 3CCET 1ZLMA 1OX8A 3VS7A 1VQ8A 2X51A 2GCXA 4A4KA 4AG1C 3E19A 4II1A 1RLQC 1V1CA 1WQWA 5GANg 4PK4A 4FU6A 2CKKA 4A54A 3VS2A 9ATCB 3TSZA 3V7CA 3CD6T 2DJZA 3CXCP 2C0TA 2XU8A 3PGGA 1EIFA 1QVFS 2CSQA 1PCXA 2LX9A 4O6JA 2HZYA 1K9MC 3VV0A 5A0DA 2YLCA 3AT1B 2GFUA 2RJCA 5HY6A 1K8AR 3J7AF 5GAMd 5AYFA 4M77E 5GANj 4M7DF 1YI2T 2DPPB 1QCNA 2HBWA 2DE0X 4ELZC 1SPKA 3JV3A 3OYIA 4LD9K 3MJXA 1PNJA 1N9SA 1VQNT 3G4SA 2ZPIB 3ER0A 4M77G 2XK0A 3H9NA 1BK2A 4LUDA 4BUGA 4ZTJA 2RHUA 2DZ9A 2WSEE 3M0RA 3RDVA 2QDYB 1M1GA 4C92A 2EYWA 2ENMA 3HPWA 1SEMA 2ROLA 3D7SB 3CPWS 1D1BA 1NEGA 2E6NA 5GAOm 3J81E 4RG2A 2KNBB 3A8OB 2YHTA 2K3XA 2XDBA 1GRIA 5KYYB 4A63B 3CMAQ 1Z9QA 1RI0A 1X27A 1NEBA 4R55A 2L3QA 1WA7A 4ZTFA 1Q86U 1Q82C 1QQJA 4ANJA 3DLMA 4GLKA 5GAN7 4XU2A 2DVEA 4PLIA 2KVQG 2GNCA 2M0OA 3E9GA 1WX6A 2X4WA 4MMKA 2HKNA 1KQ2A 1PWTA 4MDWA 2DL3A 4BD3A 4M78A 4NL2A 1UE9A 3CCMQ 1OI1A 1UECA 4EIKA 4M78C 5LJ3h 1BB9A 1IHWA 2DILA 2O4XB 3JCMe 3OYEA 3CCUT 1VQOQ 3SDZA 1ZSGA 5L8RE 4ZN3A 1M2OA 2YUQA 4OMPA 1HD3A 3NTKA 2L8DA 5CKHA 4MZTA 5DY9A 3O5ZA 4M75B 1OU9A 1BYMA 5I2SA 4PJJA 4OMFB 2F5TX 1C6VX 1N6AA 3EGXA 5CCAA 4JJDA 3QWYA 3BY7A 2JTMA 1PD0A 4N4GA 2RK2A 1P92A 1FYNA 2O2OA 4FT2A 4CC3A 1YIJT 2EVRA 4M7AD 5FRNA 4XQ3A 5LL6S 2LQKA 1GCQA 1HSQA 2XI9A 3OB9A 4KT0E 3QZ5B 1QVGS 3CCJQ 4HCCA 4EMGA 1D09B 2X35A 4IUVA 1FMWA 3ME9A 1VYVA 2NUPA 1M3CA 2EIFA 1TUDA 4LUEA 4PJMA 2CZ6B 4KH0B 2HKQB 1Q86C 2LJ1A 2YDLA 1YJWT 2DAQA 3PVQA 4C92D 1G8XA 1PG5B 3LYIA 3CCSA 4J9CA 4C92B 4CC4B 2RHXA 1OPKA 2QA4Q 3M54A 2A28A 4HVVA 2F2XA 4OMMA 4XK8E 1Q86R 1M1KC 4QQGA 5GAN6 4ZN1A 2DM1A 4X34A 5KE2A 3CCST 4JUVA 2EWNA 2KE9A 5KYYA 3THKA 3JB9F 2FZGB 3EG9B 3JCMd 2OI3A 2E3IA 1IXDA 1VQ4A 3KFVA 2G3RA 1BKBA 2G6FX 3CCQQ 1G3TA 3OYFA 1D0YA 1OOTA 2DK3A 5FU6B 4WTOB 3CD6Q 3EG1A 3A8MB 2A7YA 1YJNT 1VQ4Q 2QI2A 1VQOA 4E7ZA 2KR3A 2QEXA 1PSEA 2FO0A 4NS5A 2RK1A 2P84A 4LD6A 3CCLA 3GNFB 5FWBA 2EFIA 6AT1B 1K9MU 3HFOA 3VUZA 3EG0A 3OYKA 2DXTA 2CT3A 2MMPA 2XG8D 1KHCA 4J6WA 2XDDA 3QUIA 1ZSZB 4J9HA 1G3YA 1G5VA 4RKUE 3MP8A 1MNDA 3RNJA 3R6OA 2YT6A 1JJ2A 4JJBA 4EPCA 4FM4B 3RKWA 1WJSA 4M77A 4RTYA 4QVDA 1FWZA 4RTWA 3OYJA 1KC8R 1JO8A 2ATCB 1YJNQ 2BTTA 4C92G 2FPFA 3F70A 4OB2B 4DOWA 3OYYA 2LDMA 3OSVA 2LQNA 4KUIA 5CAIA 2DBKA 1WNLA 2LQ8A 2RI5A 3M0SA 4IUUA 5GMKl 2ZPGB 1UTIA 2RNAA 2RMOA 2SRCA 4YTLA 3ZL7C 3OW2A 3OYHA 3JB9H 3IQLA 4J83A 4ATOA 3REAB 2YXYA 3SB2A 3CC2T 1SKUB 3OBYA 2QAZA 4OMNA 2V26A 2K6DA 2L3PA 1U1TA 2QA4T 2P4TA 2QYZA 2YLBA 2CS7A 2YRVA 2AT1B 4BY6C 4E7SA 1UGQB 5ECAA 2DVJA 3GF5A 4BY6B 1Q7YR 4ME7A 2QG9B 3FEOA 2HD0A 5M9OA 5FWCA 1RL2A 3M0TA 1IREB 2J05A 2LNVA 3CPWA 1M9SA 1B07A 3EG3A 3C12A 1W2BS 1KD1R 2HQEA 2V1RA 2NLUA 2RQRA 2I2LA 1TSFA 4QT7A 3RKXA 2X4XA 1RAHB 1U8RA 2YWWA 4XTYA 1QLYA 4FCYA 1IHVA 1LNXA 4XTXA 2BKDN 4RTUA 4BB7A 3HKSA 2E3HA 2KGTA 4DQ2A 2KY9A 1S72Q 2AHJB 2EJFA 4PJOG 2O9VA 1N5ZA 3HTRA 2NWMA 1VQOT 5CKFA 1OQKA 1K8AC 2EKOA 1OYXA 1TUCA 3H0FA 5GAN3 2GFAA 4JRIA 4J9EA 3JCMX 2DJQA 3RMQA 4M78D 1JBMA 3G7ZA 2LMJA 4OB0B 3UDCA 5KYWB 1KQSP 4F17A 3RMSA 2L89A 1PRLC 2LZ6B 1OZ2A 2YUOA 1G83A 4C0DB 1S72T 2KRSA 1YJNA 2KI7A 3VS4A 1Q7YC 1KQSS 4BACA 5IH2A 2CP5A 4EMHA 2EQKA 1M90R 2LC4A 5DM7R 2KXCA 4M7DG 1UJ0A 2D9TA 2MYSA 1TS9A 3VS5A 3JCMV 4M7AB 3BDUA 2DL7A 4PJOF 3R6NA 1WZOA 5KYUA 2QQSA 5LJ5g 1VQ5Q 2OAWA 5GAOn 5IHKA 1PC0A 4XU0A 1B34A 5D6WA 2DRMA 2BUDA 3N5BB 3LLRA 5FRMA 4AFQC 2JUFA 3M55A 1RAIB 4R0KA 2RF0A 5CO7A 4MDXA 2VASA 2LT4A 1IGQA 1E6GA 2DA9A 1WLPB 2FZKB 1YI2A 4OMLA 5CIUA 2RD1A 3X25B 1MUZA 1NBEB 1NYFA 3HSBA 1ABOA 3VYGA 3QYHB 3CPWP 4FYVB 1SHFA 4DBHA 3I55T 2O01E 3SEMA 4A4HA 1U1SA 2CH4A 2IIMA 4N0AC 1AD5A 4PJOA 1M1FA 1BI0A 5IHNA 4C0GA 4KBMB 1KD1U 4NL3A 1RACB 4M78G 2QTVA 4C5HA 1SSHA 2HL3A 2MCNA 2J7IA 4BI3A 2X4YA 4M75F 1R77A 2HDAA 2DF6A 5FU7B 1ZUUA 3I56Q 1Q82U 5KCOA 3QSUA 1N9RA 4LXCA 3CC4Q 3X24B 3M0UA 1OU8A 4HVUA 1AVZC 5DLQE 2HEQA 4E7JA 1OV3A 4MZPA 1YJ9Q 2VC8A 5D7UA 1QP2A 1BI3A 2DL5A 2JNGA 3A1PA 3L2VA 4LDVA 4J7FA 2K7AA 1YBYA 3INZA 2JMAA 3LH0A 2JMCA 3V8KA 3CMET 4JRQA 3FDRA 2JTFA 4AT1B 1YWOA 2J6KA 2CYZB 3EH1A 2X9HA 2QEXT 1K0SA 3QKJA 4DA4A 2EQUA 1TTHB 1VQLT 4Q5WA 5KYUB 2EYXA 2GF7A 1WXTA 1SF9A 5GAN4 4RTZA 1KC8C 2VVKA 5AT1B 2V8IA 1QCFA 2KMTA 2LRQA 3QWXX 3NGPA 3WVDB 1Y96B 4O5VA 5KE3A 2ED1A 1VQKA 4LN2A 2CSIA 5I11A 1I1JA 1ZX6A 2E5QA 3M9QA 3FLGA 2XKOC 3GBQA 3SWNA 4XTUA 3MEUA 4Y92A 3JCMh 3WXMB 2HL5C 1AZGB 3P8BB 4Z02A 2YUPA 4M7AC 4MMLA 4JPBW 1Q81C 1PSFA 2E64A 2XIDA 1M4ZA 1HYOA 1T3SA 4PJOD 3OS5A 2C06A 1VQ5T 4FT4A 1Y0MA 3UA7A 2EJ9A 4JJCA 3CCJT 1Q82R 1OULA 4UC4A 3CCLQ 2L3RA 2RN8A 2PUOB 2YUNA 2YSQA 1XJWB 4WF2A 1VQKT 2KYMA 3V8JA 3EH2A 2RA2A 4C92E 4BI4A 1MGQA 1UEBA 2BZXA 1AWWA 4RCBA 3AHUA 2L2PA 3MEVA 4M7DA 4C8QE 2A08A 5LJ5e 2R57A 3CCMA 2ROTA 3UPUA 2E70A 1OPLA 2Y90A 2Z0WA 4WCIA 5GAN8 2C0IA 3L2UA 4QQ6A 1JQQA 2DIGA 2A3LA 1UGPB 1SSFA 4FYWB 1I8FA 1QCOA 1YFNA 1QVFA 3CCMT 2XHCA 4QQDA 2RPNA 1KD1C 1I5LA 4RTXA 1IRXA 2ZCFB 2LTOA 3G71Q 1G3WA 1NLOC 1W70A 4Z89A 5IXFA 4ZNXA 3V8LA 1RAGB 2HMAA 2LQWA 1SRMA 1XQHA 1M1KR 3EGUA 2M51A 1RI9A 4PJLA 3LWIA 3CCLT 2DO3A 3JCMb 4BDZA 1GCPA 5FU6C 4LE9A 2AKLA 3P8HA 3QBYA 2VB6A 1Y7XA 3H8ZA 2KK4A 4J5YA 2OX7A 1F1BB 2DLPA 1VQMA 2JZ2A 1BIBA 3BW1A 4PJOC 1W6XA 1CKBA 1M3BA 2V8KA 3WVEB 1EFNA 1M3AA 5CQXA 1NZ9A 3EGDB 5LJ3d 4F16A 1VIFA 1M30A 2EAYA 2D6FA 3JRZA 1UDLA 2KXDA 2VGMA 3HP9A 1H3ZA 2XDPA 5IXBA 2DTIA 1JJ2P 3VS0A 1VQLA 2WACA 3JB9I 1WYXA 1A0NB 2DBMA 2KEAA 4J9BA 2KRNA 4ESRA 4Y28E 2HNIA 4M77F 3CCEA 2M1HA 1VQMT 1K9MR 3I35A 3VS3A 5GANh 2DTOA 2CP3A 1VQNA 1OX9A 3SFMA 4C0FA 3MEAA 3G6EA 1ZQ1A 2VXFA 3H41A 2ECZA 2DRKA 4E7LA 2M0YA 3QPHA 1OEBA 4PFOA 3EG2A 2SEMA 1R0CB 4M75G 3DKMA 1T0HA 3TU4K 4C5GA 1PKTA 5I21A 5GAOr 3RKYA 4B6MA 2D1XA 3HHTB 4GBQA 1B7TA 2FPEA 2JOYA 1VYUA 1WHKA 1D3BB 4IUQA 2FHDA 1MNEA 3HRUA 5A2QE 1UG1A 1UJYA 3CC4T 4E7HA 1QVFP 2LNHB 4M78B 3GLXA 4J8OA 1QMCA 2PZ1A 4C8QC 1VQ4T 2MOXA 2QQRA 2VUBA 1V76A 3C0CA 1X2KA 3CC4A 2LJ3A 4FW1A 1C1AA 4JS4A 1QVGP 3JSCA 4FSXA 1N8RC 1K9AA 1RABB 4M75A 4OB1B 1RLPC 4BDYA 2KYBA 4D8DA 1W1FA 3OY9A 5L23A 5LJ3j 3TREA 2PNIA 4M77C 3QJ6A 2AKKA 1NJIR 1T0JA 3CEYA 3G4SQ 1BCOA 3MP1A 2OTLA 1FX7A 2R58A 2BZYA 1U5SA 5GMKm 3OS0A 1GBRA 1GFDA 4M78F 3GIBA 4RTVA 3QYGB 3JB9J 2I0NA 5A0GA 2FPDA 3CCVT 2L0AA 1SG5A 5GAOl 2QK0A 1BCMA 4PL6A 4PJOE 3NTHA 1Y57A 3FJPA 1Y07A 2KRMA 5LJ3g 1N8RU 4M4ZA 4ELYC 5GANf 2GQIA 2FB7A 3OS2A 2W10A 1XNIA 1QP3A 4J9IA 4HXJA 3CBPA 4IKFA 1YIJQ 2DEQA 2E5KA 4K11A 3G6EQ 1BI1A 1RUWA 2RQVA 5IHIA 2D8HA 3C4SA 5J26A 4F7UB 1QWEA 4AFZC 3E9FA 4HVWA 3OYAA 3RUXA 4XTWA 2E1HA 3SHWA 3JB9D 2ED0A 8ATCB 3OA6A 2AK5A 4ZGDB 2CP0A 4KGXB 3SWNC 3EGDA 2O88A 4HCZA 3CCUQ 2QGGA 2QQAA 3KBGA 3M57A 1MMGA 1HJDA 2X3WD 2GTJA 2RI3A 1M5Q1 1BU1A 1ZBXA 2IG0A 5FLXE 5GAMf 5CR2A 2ABLA 2EGCA 2EPDA 3A8HB 3MO8A 2OTJA 5IN1A 1D1AA 4M7DB 1WIEA 3L42A 3PTAA 2QXFA 1N27A 2B8AA 3VYHB 3JCMJ 1X6OA 3CCQA 1K73C 2DMOA 3PMIA 1X2QA 2JM8A 3M58A 4XU1A 2MWPA 4OGEA 2H3JA 3EHRA 5GMKi 4CI0C 1VQKQ 1GBQA 1KQ1A 1O9SA 2A0FB 4M7AA 4X9DA 4R56A 1QKWA 5GAN5 1VQ7Q 1WHHA 3LWHA 3OMGA 1QVGA 1M1KU 3LX7A 4QW2A 2D0NA 3UWNA 3CMAT 2MAMA 2KBTA 5GAN2 2P0QA 1VUBA 3X20B 1VQPA 3ZFJA 1TU0B 2EQJA 2QTXA 2VWFA 4KGVB 2E41A 4PJNA 2QGFB 1IGUA 1ZA1B 1BBZA 1G3SA 1KSWA 2VGNA 2EW3A 3EFSA 1I81A 2F1LA 1JB0E 3CMEA 1D1CA 2HQHA 2EYYA 1XOVA 2CP7A 3MHXA 2GGRA 3VUBA 1K1ZA 2DXBA 1TUGB 1M2VB 2ZPHB 3CC2A 3CCVA 3PIPA 4PJOB 2PVOB 3NFCA 1QWFA 2HQXA 1YIJA 4IIMA 2HCKA 4A4EA 2WSFE 1YHQQ 1WXUA 2B86A 3CC7A 4L6V5 3CMEQ 3Q1JA 2LT1A 1LCKA 2PUKB 4EMKA 3VS6A 1K0XA 3OMCA 2CZ0B 5J39A 4OP0A 1JXMA 4A4GA 1VQ7T 2PQWA 1I4K1 3EHQA 2A37A 3CCRT 3MPUB 2JT4A 3TEEA 3QO3A 2CGHA 2XMFA 3ASKA 2OTJT 3PE0A 2DL4A 5GMKe 2M02A 2JS2A 3FC3A 2JS0A 4IUPA 1B3QA 1Q95G 1MV3A 1ARKA 2MPXC 2Y4XA 1K76A 1T3LA 4LNPA 1MMNA 4GLMA 3VS1A 1G2BA 4M7AG 3KUFA 3JCMW 1QW1A 3RBBB 4DEXA 3C94A 4IUTA 1NG2A 1YNZA 2RHZA 5CK9A 4M78E 4C8QG 2BIVA 3E2UA 3PT9A 2GTOA 4JZ4A 3CXCS 1LOJA 1K73U 1K4US 3CCQT 3LW5E 3H0IA 2ZPEB 2E10A 3BDLA 5GAMg 1VQ6T 4OMOA 4TVRA 1W4SA 4F14A 5LJ5h 5FU7C 4M7AE 4PKCC 1YHQA 1ZA2B 2DIQA 4JS5A 3QDFA 2HSEB 2MF2A 2CREA 2RB6A 1YJWQ 4C5EA 2MIOA 3PIOA 1CSKA 5LJ5d 3MKDA 3OQ5A 2YRDA 2CZ1B 2DYIA 2MK5A 2VXEA 4C8QA 1NJIU 1KC8U 2NUTB 4J6YA 7AT1B 3CCVQ 1C0MA 5DLOA 1MMDA 1Y96A 2H8HA 3CBOA 4IURA 1KQSA 1FMVA 1PD1A 5LJ3e 1N8RR 1UHFA 1AWJA 4QVZA 2JVVA 3EFRA 2LJ0A 4JJNK 3UT1A 5FROA 1WPYA 1U3OA 2YRCA 3OW2P 2P0KA 4P5NA 3NPFA 2F69A 5GMKj 2NYSA 4C0ZA 3QDRB 5EC7A 4GY5A 4M77D 1RADB 5C6SA 2HSPA 1NPRA 1WHLA 1J3TA 3MP6A 2P4RA 4B9XA 3GPLA 3CD6A 4HT8A 3EGXB 5GAOp 2BE7D 3DB4A 3S3OA 4F7UA 2ZPBB 4C8QF 4HA8A 4Z8AA 1VQ8T 2RJEA 4HKEA 4ZGEB 3I56A 1UUEA 1WHMA 3CCRA 4X1VA 2X4JA 4D6WA 1K73R 5KYWA 2PU9B 3M0QA 1JU5C 4DBFA 3H0HA 3QHSA 2IVWA 1U06A 4OF1A 2IPOB 4C0DC 4QVCA 4C8QB 1AOJA 2F5KA 2OTLQ 1M90C 1Q81U 3SWNB 1UGVA 3TQ7P 8AT1B 4XTZA 4C8QD 2OTJQ 3UF4A 1YCYA 1YITQ 1M8VA 2KSSA 1NJIC 1ZUYA 4N4HA 1VYTA 3I5SA 4HT9A 2R5AA 3HRSA 1OZ3A 2ZGWA 5CKBA 1YHQT 2EKHA 4LDYA 2FZCB 1VIEA 3M4YA 2GBQA 3VU3C 5GMKh 5I22A 1KHIA 2EYZA 1V29B 2A36A 1VQMQ 1X01A 2J06A 2EBPA 2CUDA 3FB9A 2RI2A 1IB8A 2DEUA 3V7SA 1SRLA 2E4HA 4J6XA 2E6ZA 2KAFA 4HCKA 2RM4A 1H3HA 1YI2Q 3L2ZA 5HCKA 4PLLA 4RUGA 2O9SA 2K4YA 2K5IA 4LDUA 1JEGA 1E7OA 4Y91A 3QZ9B 3JCMg 4JZ3A 2H3EB 1SHGA 2D8JA 1PHTA 2X3XD 1FXXA 2WSCE 3OYLA 2OAUA 3OYBA 4RTTA 4EMKB 1VQ6A 1VQPT 5KH6A 4KUDK 3LH5A 1VQLQ 3CCUA 2FL7A 1R0BG 4A4FA 3UATA 2QEXQ 2HAXA 1MHNA 3LGLA 2V1QA 4L5GA 2RJDA 2LCCA 4DEYA 3CXCA 4L59A 1KK7A 1Z9ZA 4OMQA 2EYQA 4RCCA 2OJ2A 3VRYA 2K9GA 3OS1A 1WHJA 1I07A 3FJ5A 1EX4A 4FW2A 1O75A 1X69A 3O8VA 1YITT 1BI2A 5LJ5f 1TWBA 1WI7A 3JAME 4RMOA 2XICA 3CCEQ 4J9GA 1W2BP 1NE8A 2PVGB 3GNGA 4QKUA 2NUTA 3E1SA 3QJYA 2MWOA 4LDXA 1IO6A 3M59A 3V7RA 2RQTA 3VRZA 4BE0A 3OYCA 4M7DD 4JLGA 1WJQA 3I56T 2RO0A 3NHNA 5HK3A 3A98A 1I5OB 2EJGA 2D0QB 4M7DC 3RERA 1BIAA 1D3BA 3C95A 1FMKA 1XTDA 1UFFA 3TCJA 2CZ7B 2K5FA 5I2MA 2JTEA 1NPPA 3L2QA 1H92A 1KFZA 1VQ7A 2RHYA 3EAEA 3OBWA 3M56A 4KGZB 5KYXB 2JW4A 4J7IA 2RHIA 1X75C 1GFCA 2EQMA 3I55Q 1AHJB 1LVKA 4FYYB 2M16A 2FYKA 2QDLA 3PFSA 1WQ7A 3CCSQ 4BE2A 3OYGA 2JM9A 2QA4A 3VKIA 4CC7A 3RIRA 2CT4A 3M5AA 1M27C 4CRIA 5EG2A 4ZGJB 2HBPA 4AG2C 2AIRB 1R8OB 4JRPA 1GCQC 2L3SA 3QIIA 4EMKC 2CP2A 2K5LA 4N4IA 3S6WA 4V2SA 2ESWA 4F7UG 1LPLA 4EDUA 1MV0B 3LGFA 3URGA 1YN8A 1Q7YU 3HFNA 1VQ9Q 5IAYA 3I55A 2LP5A 2KT1A 3MCAB 1NM7A 4FYXB 4F04B 1S72A 4M75E 1YWPA 5GAMj 3ULRB 1MMAA 1WJRA 5LJ5j 3PMTA 2ZAEA 1TG0A 2L5QA 2E12A 3OW2S 3L2WA 3JCMf 5IT9E 4M7AF 1D0ZA 3JCMP 1RAEB 1VOMA 5GAOq 3RR6A 4C92C 2AZVA 2PVDB 5GAMe 5A0LA 3JB9G 4M77B 5D6XA 2O31A 1NYGA 1YP5A 2DYBA 4E7KA 4KULA 1X43A 2CDTA 3FIFA 2DERA 4XTVA 1W2BA 2J6OA 4DBQA 4C92F 4DBRA 1S1NA 4CC2A 1M90U 2VYTA 1LJOA 2CH4W 4F7UE 4HCBA 2QQBA 3FRNA 3TVTA 5CVIA 3I9QA 1B34B 4C5IA 1YJ9T 3CC7T 3X26B 5C0MA 1WXBA 3OYDA 2MI6A 4D8KA 5GANe 2RQWA 1NLPC 2RH2A 1X6BA 2F2VA 2FEIA 3CCRQ 2BE9B 4Z88A 2DETA 2FVUA 3S3NA 2AZSA 2K3BA 4F7UF 3M4GA 3QXEB 5KYXA 3ZBDA 1VQ9A 5GAMh 4AFUC 1ZUKA 3HRTA 4E6RA 3U23A 5HK0A 2BZ8A 4PFPA 3A8GB 1VQNQ 1VQPQ 3I5RA 1WHGA 4FIBA 2XD0A 2W0ZA 3A8LB 3JCMQ 3CMAA 1AWXA 2DKGA 3S3MA 2FG0A 2LX7A 3CQTA 4VUBA 2VKNA 5CKDA 3MEWA 3OSSC 2DNUA 4PNOA 2FRYA 4FSSA 1GL5A 4E47A 1DJ7B 4XU3A 4BI8B 1WDXA 3BFMA 2KROA 5FW9A 3OYMA 1PKSA 4B9WA 3M0PA 5GJVB 1AT1B 1PRMC 3NTIA 2DZCA 3L1AA 1ZSZC 4BE1A 1JJ2S 1M2VA 1JXOA 1I0CA 3UA6A 2QASA 2Y4YA 2RQUA 2OTLT 1GXIE 3CC7Q 2QQ9A 2K2MA 3NMZC 3VJPA 4N0AA 4JLIA 3H6ZA 2JXBA 5LJ3f 2PTKA 5CKEA 2EGAA 3BE3A 5GJWB 3G71T 2COZA 2C0OA 1HXDA 3X28B 2JN0A 2VV5A 1WGSA 1YJ9A 3EFOA 3ZEHA 2KQWA 1YITA 4J9FA 3GOXA 3M53A 2M9UA 2CUBA 2DXUA 1RAAB 1KG1A 3JCMc 1ABQA 4E2FB 2K79A 2DXCA 4M75D 1VQ8Q 1H641 4JRKA 4OVAA 4M7DE 2LCLA 1TH7A 2DD5A 1TOVA 4E7IA 1WFWA 2GQVA 2V8JA 3GP8A 1Q81R 1UB4A 2E65A 3A5ZB 4AFSC 3G71A 1X6GA 4DOVA 3L2RA 1UGRB 1Y71A 1K8AU 3CCJA 3CPFA 3META 3TSWA 2DTHA 2LVMA 2DD4A 3G6ET 2FRWA 4X9CA 2R5MA 1YJWA 1TXQA 1E6HA 5CQYA 3P8DA 1ZSZA 5D6YA 3RESA 1VQ9T 3REBB 1UHCA 3CBMA 5HKCA 2K3YA 2COWA 2ZZDA 3OYNA 1ZBJA 1HK9A 1VQ5A 5KYNA 4OGCA 4J9DA 4IIOA 1RAFB 2ZPFB 2LCSA 4NOYA 4LDWA 4RG8A 3QG1A 4KH1B 1H8KA 4A53A 2J6FA 1UGSB 1AEYA 1D0XA 2KDSA 4M75C 2P0PA 3CC2Q 1EZZB 2DL8A 1CKAA
chains in the Genus database with same CATH topology
2LJ3A 2EBPA 2CUDA 2KT8A 2O9VA 2NUZA 1N5ZA 1SRLA 1M8MA 2EGEA 2NWMA 2F2WA 1K9AA 4HCKA 1H3HA 1VA7A 1TUCA 3H0FA 1RLPC 1KJWA 2KYBA 4J9EA 4RUGA 2DX1A 1W1FA 2O9SA 2DJQA 5HCKA 4D8DA 1KIKA 5L23A 1JEGA 1E7OA 1AWOA 2PNIA 4JZ3A 4ORZA 2LMJA 1SHGA 2D8JA 2AKKA 1PHTA 2X3XD 3PVLA 1T0JA 4F17A 4RTTA 2EQIA 1PRLC 2LZ6B 1AZEA 2YUOA 1G83A 3LH5A 2KRSA 2BZYA 1U5SA 3UATA 1GBRA 1GFDA 3VS4A 4RTVA 5IH2A 2V1QA 2I0NA 2FPDA 1YCSB 2L0AA 2KXCA 1QKXA 4DEYA 4KRTA 1UJ0A 1Z9ZA 4OMQA 1ZLMA 2OJ2A 1Y57A 3VRYA 3VS5A 2K9GA 3VS7A 2KRMA 2DL7A 1I07A 3FJ5A 4M4ZA 3R6NA 4AG1C 1X69A 2GQIA 2W10A 1WI7A 1RLQC 1V1CA 4J9IA 4HXJA 4J9GA 2OAWA 5IHKA 2E5KA 4K11A 3VS2A 3TSZA 1RUWA 2RQVA 5IHIA 2DRMA 1IO6A 2C0TA 2D8HA 1QWEA 4AFZC 2RQTA 3VRZA 4HVWA 4AFQC 4R0KA 2CSQA 2RF0A 3NHNA 3SHWA 2ED0A 1E6GA 3A98A 2AK5A 2DA9A 1WLPB 4OMLA 1FMKA 2O88A 1UFFA 1MUZA 1NYFA 2JTEA 1HJDA 1ABOA 1H92A 2X3WD 1KFZA 2GTJA 1BU1A 1SHFA 2HBWA 2JW4A 2DE0X 1SPKA 2ABLA 3SEMA 2EGCA 3JV3A 2CH4A 1GFCA 2EPDA 2IIMA 1PNJA 1AD5A 5IHNA 2QDLA 1WIEA 1SSHA 1BK2A 4LUDA 2JM9A 2MCNA 2J7IA 3M0RA 4CC7A 2DMOA 2CT4A 1X2QA 1M27C 2JM8A 2EYWA 2HDAA 2ENMA 1SEMA 2DF6A 2ROLA 1ZUUA 3EHRA 4AG2C 1NEGA 3M0UA 1GCQC 4HVUA 1AVZC 2HEQA 1GBQA 2L3SA 1OV3A 1QKWA 2KNBB 1GRIA 2ESWA 4A63B 1MV0B 2D0NA 1YN8A 1Z9QA 1X27A 1NEBA 2LP5A 2KT1A 1NM7A 2L3QA 1WA7A 2KBTA 1YWPA 3ULRB 2DL5A 2K7AA 2VWFA 1TG0A 2GNCA 2JMAA 2JMCA 1WX6A 1BBZA 1KSWA 1PWTA 1YWOA 2DL3A 2J6KA 2EW3A 1K0SA 1UE9A 2AZVA 2EYYA 1UECA 1XOVA 4EIKA 1BB9A 2EYXA 2GGRA 2DILA 1K1ZA 1WXTA 1ZSGA 4RTZA 2O31A 1NYGA 1YP5A 2VVKA 2YUQA 1QCFA 2DYBA 4OMPA 1HD3A 3QWXX 1QWFA 3NGPA 1X43A 3O5ZA 2CDTA 2ED1A 2J6OA 4LN2A 2CSIA 5I11A 4IIMA 1I1JA 1ZX6A 3GBQA 1S1NA 2HCKA 4JJDA 4Y92A 4CC2A 3QWYA 2CH4W 1WXUA 2B86A 1AZGB 1FYNA 2O2OA 4CC3A 1LCKA 2EVRA 2YUPA 1K0XA 3VS6A 3TVTA 3I9QA 4JPBW 1GCQA 1HSQA 1JXMA 3EHQA 2A37A 1WXBA 2JT4A 4D8KA 1T3SA 2XMFA 2RQWA 3PE0A 1Y0MA 2DL4A 3UA7A 1NLPC 1VYVA 1X6BA 1M3CA 4JJCA 2F2VA 1TUDA 2JS2A 2FEIA 4LUEA 2JS0A 1B3QA 1MV3A 1ARKA 2LJ1A 2YDLA 4Z88A 3PVQA 2RN8A 1K76A 1T3LA 2YUNA 4LNPA 2YSQA 4GLMA 2AZSA 2K3BA 2KYMA 3VS1A 1G2BA 4J9CA 4CC4B 3RBBB 1OPKA 4DEXA 1NG2A 1YNZA 4AFUC 1ZUKA 2A28A 2BZXA 4HVVA 4E6RA 2F2XA 4OMMA 1AWWA 3U23A 2L2PA 2BZ8A 2DM1A 3I5RA 2KE9A 2GTOA 2A08A 4JZ4A 3THKA 2W0ZA 1K4US 2OI3A 2ROTA 1OPLA 3H0IA 3KFVA 1AWXA 4WCIA 2C0IA 1JQQA 2FG0A 2LX7A 2G6FX 3CQTA 2VKNA 1OOTA 2DNUA 2FRYA 2RPNA 4OMOA 3EG1A 4RTXA 4F14A 4FSSA 1GL5A 2KR3A 1WDXA 2FO0A 1NLOC 1W70A 2KROA 5FW9A 4Z89A 5FWBA 5IXFA 1PKSA 4ZNXA 2LQWA 3M0PA 5GJVB 1PRMC 1SRMA 2CREA 3EG0A 2MIOA 3EGUA 2M51A 1RI9A 1CSKA 2CT3A 1GCPA 1JXOA 1I0CA 4LE9A 3UA6A 2AKLA 4J9HA 2RQUA 2H8HA 2DLPA 3RNJA 2K2MA 3NMZC 1W6XA 1CKBA 1M3BA 1UHFA 2YT6A 4JJBA 1AWJA 1EFNA 2JXBA 1M3AA 2PTKA 2LJ0A 2EGAA 5GJWB 4RTYA 2C0OA 1U3OA 4RTWA 1JO8A 3NPFA 2BTTA 2FPFA 4F16A 1M30A 4J9FA 1UDLA 2KXDA 5EC7A 2LQNA 2DBKA 2HSPA 2CUBA 1J3TA 3M0SA 1ABQA 5IXBA 2K79A 2P4RA 3VS0A 1UTIA 2RNAA 1WYXA 1A0NB 2DBMA 2RMOA 2KEAA 2SRCA 4J9BA 3ZL7C 2KRNA 3IQLA 4ESRA 4Z8AA 3REAB 1UUEA 1WFWA 3I35A 3VS3A 4OMNA 4X1VA 2K6DA 2L3PA 4AFSC 1X6GA 3H41A 2ECZA 3M0QA 2DRKA 2M0YA 1JU5C 3H0HA 5ECAA 3TSWA 2DVJA 1OEBA 3EG2A 2SEMA 1U06A 2FRWA 5FWCA 3M0TA 1AOJA 1T0HA 1E6HA 2J05A 1PKTA 1UGVA 2D1XA 4GBQA 3UF4A 1B07A 3EG3A 3REBB 2FPEA 1UHCA 1VYUA 1ZUYA 2V1RA 1ZBJA 1VYTA 2RQRA 3I5SA 4J9DA 4QT7A 4IIOA 1UG1A 1UJYA 2LCSA 1QLYA 2LNHB 1H8KA 2EKHA 2J6FA 1AEYA 4RTUA 2PZ1A 2GBQA 2KGTA 5I22A 2MOXA 2EYZA 3C0CA 1X2KA 2A36A 2J06A 2DL8A 1CKAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LJ3 A;  2EBP A;  2CUD A;  2KT8 A;  2O9V A;  2NUZ A;  1N5Z A;  1SRL A;  1M8M A;  2EGE A;  2NWM A;  2F2W A;  1K9A A;  4HCK A;  1H3H A;  1VA7 A;  1TUC A;  3H0F A;  1RLP C;  1KJW A;  2KYB A;  4J9E A;  4RUG A;  2DX1 A;  1W1F A;  2O9S A;  2DJQ A;  5HCK A;  4D8D A;  1KIK A;  5L23 A;  1JEG A;  1E7O A;  1AWO A;  2PNI A;  4JZ3 A;  4ORZ A;  2LMJ A;  1SHG A;  2D8J A;  2AKK A;  1PHT A;  2X3X D;  3PVL A;  1T0J A;  4F17 A;  4RTT A;  2EQI A;  1PRL C;  2LZ6 B;  1AZE A;  2YUO A;  1G83 A;  3LH5 A;  2KRS A;  2BZY A;  1U5S A;  3UAT A;  1GBR A;  1GFD A;  3VS4 A;  4RTV A;  5IH2 A;  2V1Q A;  2I0N A;  2FPD A;  1YCS B;  2L0A A;  2KXC A;  1QKX A;  4DEY A;  4KRT A;  1UJ0 A;  1Z9Z A;  4OMQ A;  1ZLM A;  2OJ2 A;  1Y57 A;  3VRY A;  3VS5 A;  2K9G A;  3VS7 A;  2KRM A;  2DL7 A;  1I07 A;  3FJ5 A;  4M4Z A;  3R6N A;  4AG1 C;  1X69 A;  2GQI A;  2W10 A;  1WI7 A;  1RLQ C;  1V1C A;  4J9I A;  4HXJ A;  4J9G A;  2OAW A;  5IHK A;  2E5K A;  4K11 A;  3VS2 A;  3TSZ A;  1RUW A;  2RQV A;  5IHI A;  2DRM A;  1IO6 A;  2C0T A;  2D8H A;  1QWE A;  4AFZ C;  2RQT A;  3VRZ A;  4HVW A;  4AFQ C;  4R0K A;  2CSQ A;  2RF0 A;  3NHN A;  3SHW A;  2ED0 A;  1E6G A;  3A98 A;  2AK5 A;  2DA9 A;  1WLP B;  4OML A;  1FMK A;  2O88 A;  1UFF A;  1MUZ A;  1NYF A;  2JTE A;  1HJD A;  1ABO A;  1H92 A;  2X3W D;  1KFZ A;  2GTJ A;  1BU1 A;  1SHF A;  2HBW A;  2JW4 A;  2DE0 X;  1SPK A;  2ABL A;  3SEM A;  2EGC A;  3JV3 A;  2CH4 A;  1GFC A;  2EPD A;  2IIM A;  1PNJ A;  1AD5 A;  5IHN A;  2QDL A;  1WIE A;  1SSH A;  1BK2 A;  4LUD A;  2JM9 A;  2MCN A;  2J7I A;  3M0R A;  4CC7 A;  2DMO A;  2CT4 A;  1X2Q A;  1M27 C;  2JM8 A;  2EYW A;  2HDA A;  2ENM A;  1SEM A;  2DF6 A;  2ROL A;  1ZUU A;  3EHR A;  4AG2 C;  1NEG A;  3M0U A;  1GCQ C;  4HVU A;  1AVZ C;  2HEQ A;  1GBQ A;  2L3S A;  1OV3 A;  1QKW A;  2KNB B;  1GRI A;  2ESW A;  4A63 B;  1MV0 B;  2D0N A;  1YN8 A;  1Z9Q A;  1X27 A;  1NEB A;  2LP5 A;  2KT1 A;  1NM7 A;  2L3Q A;  1WA7 A;  2KBT A;  1YWP A;  3ULR B;  2DL5 A;  2K7A A;  2VWF A;  1TG0 A;  2GNC A;  2JMA A;  2JMC A;  1WX6 A;  1BBZ A;  1KSW A;  1PWT A;  1YWO A;  2DL3 A;  2J6K A;  2EW3 A;  1K0S A;  1UE9 A;  2AZV A;  2EYY A;  1UEC A;  1XOV A;  4EIK A;  1BB9 A;  2EYX A;  2GGR A;  2DIL A;  1K1Z A;  1WXT A;  1ZSG A;  4RTZ A;  2O31 A;  1NYG A;  1YP5 A;  2VVK A;  2YUQ A;  1QCF A;  2DYB A;  4OMP A;  1HD3 A;  3QWX X;  1QWF A;  3NGP A;  1X43 A;  3O5Z A;  2CDT A;  2ED1 A;  2J6O A;  4LN2 A;  2CSI A;  5I11 A;  4IIM A;  1I1J A;  1ZX6 A;  3GBQ A;  1S1N A;  2HCK A;  4JJD A;  4Y92 A;  4CC2 A;  3QWY A;  2CH4 W;  1WXU A;  2B86 A;  1AZG B;  1FYN A;  2O2O A;  4CC3 A;  1LCK A;  2EVR A;  2YUP A;  1K0X A;  3VS6 A;  3TVT A;  3I9Q A;  4JPB W;  1GCQ A;  1HSQ A;  1JXM A;  3EHQ A;  2A37 A;  1WXB A;  2JT4 A;  4D8K A;  1T3S A;  2XMF A;  2RQW A;  3PE0 A;  1Y0M A;  2DL4 A;  3UA7 A;  1NLP C;  1VYV A;  1X6B A;  1M3C A;  4JJC A;  2F2V A;  1TUD A;  2JS2 A;  2FEI A;  4LUE A;  2JS0 A;  1B3Q A;  1MV3 A;  1ARK A;  2LJ1 A;  2YDL A;  4Z88 A;  3PVQ A;  2RN8 A;  1K76 A;  1T3L A;  2YUN A;  4LNP A;  2YSQ A;  4GLM A;  2AZS A;  2K3B A;  2KYM A;  3VS1 A;  1G2B A;  4J9C A;  4CC4 B;  3RBB B;  1OPK A;  4DEX A;  1NG2 A;  1YNZ A;  4AFU C;  1ZUK A;  2A28 A;  2BZX A;  4HVV A;  4E6R A;  2F2X A;  4OMM A;  1AWW A;  3U23 A;  2L2P A;  2BZ8 A;  2DM1 A;  3I5R A;  2KE9 A;  2GTO A;  2A08 A;  4JZ4 A;  3THK A;  2W0Z A;  1K4U S;  2OI3 A;  2ROT A;  1OPL A;  3H0I A;  3KFV A;  1AWX A;  4WCI A;  2C0I A;  1JQQ A;  2FG0 A;  2LX7 A;  2G6F X;  3CQT A;  2VKN A;  1OOT A;  2DNU A;  2FRY A;  2RPN A;  4OMO A;  3EG1 A;  4RTX A;  4F14 A;  4FSS A;  1GL5 A;  2KR3 A;  1WDX A;  2FO0 A;  1NLO C;  1W70 A;  2KRO A;  5FW9 A;  4Z89 A;  5FWB A;  5IXF A;  1PKS A;  4ZNX A;  2LQW A;  3M0P A;  5GJV B;  1PRM C;  1SRM A;  2CRE A;  3EG0 A;  2MIO A;  3EGU A;  2M51 A;  1RI9 A;  1CSK A;  2CT3 A;  1GCP A;  1JXO A;  1I0C A;  4LE9 A;  3UA6 A;  2AKL A;  4J9H A;  2RQU A;  2H8H A;  2DLP A;  3RNJ A;  2K2M A;  3NMZ C;  1W6X A;  1CKB A;  1M3B A;  1UHF A;  2YT6 A;  4JJB A;  1AWJ A;  1EFN A;  2JXB A;  1M3A A;  2PTK A;  2LJ0 A;  2EGA A;  5GJW B;  4RTY A;  2C0O A;  1U3O A;  4RTW A;  1JO8 A;  3NPF A;  2BTT A;  2FPF A;  4F16 A;  1M30 A;  4J9F A;  1UDL A;  2KXD A;  5EC7 A;  2LQN A;  2DBK A;  2HSP A;  2CUB A;  1J3T A;  3M0S A;  1ABQ A;  5IXB A;  2K79 A;  2P4R A;  3VS0 A;  1UTI A;  2RNA A;  1WYX A;  1A0N B;  2DBM A;  2RMO A;  2KEA A;  2SRC A;  4J9B A;  3ZL7 C;  2KRN A;  3IQL A;  4ESR A;  4Z8A A;  3REA B;  1UUE A;  1WFW A;  3I35 A;  3VS3 A;  4OMN A;  4X1V A;  2K6D A;  2L3P A;  4AFS C;  1X6G A;  3H41 A;  2ECZ A;  3M0Q A;  2DRK A;  2M0Y A;  1JU5 C;  3H0H A;  5ECA A;  3TSW A;  2DVJ A;  1OEB A;  3EG2 A;  2SEM A;  1U06 A;  2FRW A;  5FWC A;  3M0T A;  1AOJ A;  1T0H A;  1E6H A;  2J05 A;  1PKT A;  1UGV A;  2D1X A;  4GBQ A;  3UF4 A;  1B07 A;  3EG3 A;  3REB B;  2FPE A;  1UHC A;  1VYU A;  1ZUY A;  2V1R A;  1ZBJ A;  1VYT A;  2RQR A;  3I5S A;  4J9D A;  4QT7 A;  4IIO A;  1UG1 A;  1UJY A;  2LCS A;  1QLY A;  2LNH B;  1H8K A;  2EKH A;  2J6F A;  1AEY A;  4RTU A;  2PZ1 A;  2GBQ A;  2KGT A;  5I22 A;  2MOX A;  2EYZ A;  3C0C A;  1X2K A;  2A36 A;  2J06 A;  2DL8 A;  1CKA A; 
#chains in the Genus database with same CATH topology
 3HL8 A;  3G4S T;  2KT8 A;  3G1J A;  1ACM B;  2NUZ A;  3T9N A;  4MZM A;  1M8M A;  2EGE A;  3PNW C;  4FL6 A;  2F2W A;  1VQ6 Q;  1JRI A;  3KXT A;  1VA7 A;  5KCH A;  2DFU A;  1KJW A;  2DX1 A;  5J3B A;  1KIK A;  4JDS A;  1ZHI A;  1PM3 A;  1AWO A;  3DB3 A;  4ORZ A;  2CP6 A;  3EG9 A;  1QVP A;  3SD4 A;  3PVL A;  2K57 A;  1IZ6 A;  3EFO B;  2EQI A;  1AZE A;  4PFZ A;  2K2V A;  3J80 E;  2O4X A;  4OB3 B;  3DLL A;  2JJ9 A;  2COY A;  1YCS B;  2RJF A;  2NUP B;  1QKX A;  4XAX B;  4KRT A;  4AMC A;  5GAN d;  3CCE T;  1ZLM A;  1OX8 A;  3VS7 A;  1VQ8 A;  2X51 A;  2GCX A;  4A4K A;  4AG1 C;  3E19 A;  4II1 A;  1RLQ C;  1V1C A;  1WQW A;  5GAN g;  4PK4 A;  4FU6 A;  2CKK A;  4A54 A;  3VS2 A;  9ATC B;  3TSZ A;  3V7C A;  3CD6 T;  2DJZ A;  3CXC P;  2C0T A;  2XU8 A;  3PGG A;  1EIF A;  1QVF S;  2CSQ A;  1PCX A;  2LX9 A;  4O6J A;  2HZY A;  1K9M C;  3VV0 A;  5A0D A;  2YLC A;  3AT1 B;  2GFU A;  2RJC A;  5HY6 A;  1K8A R;  3J7A F;  5GAM d;  5AYF A;  4M77 E;  5GAN j;  4M7D F;  1YI2 T;  2DPP B;  1QCN A;  2HBW A;  2DE0 X;  4ELZ C;  1SPK A;  3JV3 A;  3OYI A;  4LD9 K;  3MJX A;  1PNJ A;  1N9S A;  1VQN T;  3G4S A;  2ZPI B;  3ER0 A;  4M77 G;  2XK0 A;  3H9N A;  1BK2 A;  4LUD A;  4BUG A;  4ZTJ A;  2RHU A;  2DZ9 A;  2WSE E;  3M0R A;  3RDV A;  2QDY B;  1M1G A;  4C92 A;  2EYW A;  2ENM A;  3HPW A;  1SEM A;  2ROL A;  3D7S B;  3CPW S;  1D1B A;  1NEG A;  2E6N A;  5GAO m;  3J81 E;  4RG2 A;  2KNB B;  3A8O B;  2YHT A;  2K3X A;  2XDB A;  1GRI A;  5KYY B;  4A63 B;  3CMA Q;  1Z9Q A;  1RI0 A;  1X27 A;  1NEB A;  4R55 A;  2L3Q A;  1WA7 A;  4ZTF A;  1Q86 U;  1Q82 C;  1QQJ A;  4ANJ A;  3DLM A;  4GLK A;  5GAN 7;  4XU2 A;  2DVE A;  4PLI A;  2KVQ G;  2GNC A;  2M0O A;  3E9G A;  1WX6 A;  2X4W A;  4MMK A;  2HKN A;  1KQ2 A;  1PWT A;  4MDW A;  2DL3 A;  4BD3 A;  4M78 A;  4NL2 A;  1UE9 A;  3CCM Q;  1OI1 A;  1UEC A;  4EIK A;  4M78 C;  5LJ3 h;  1BB9 A;  1IHW A;  2DIL A;  2O4X B;  3JCM e;  3OYE A;  3CCU T;  1VQO Q;  3SDZ A;  1ZSG A;  5L8R E;  4ZN3 A;  1M2O A;  2YUQ A;  4OMP A;  1HD3 A;  3NTK A;  2L8D A;  5CKH A;  4MZT A;  5DY9 A;  3O5Z A;  4M75 B;  1OU9 A;  1BYM A;  5I2S A;  4PJJ A;  4OMF B;  2F5T X;  1C6V X;  1N6A A;  3EGX A;  5CCA A;  4JJD A;  3QWY A;  3BY7 A;  2JTM A;  1PD0 A;  4N4G A;  2RK2 A;  1P92 A;  1FYN A;  2O2O A;  4FT2 A;  4CC3 A;  1YIJ T;  2EVR A;  4M7A D;  5FRN A;  4XQ3 A;  5LL6 S;  2LQK A;  1GCQ A;  1HSQ A;  2XI9 A;  3OB9 A;  4KT0 E;  3QZ5 B;  1QVG S;  3CCJ Q;  4HCC A;  4EMG A;  1D09 B;  2X35 A;  4IUV A;  1FMW A;  3ME9 A;  1VYV A;  2NUP A;  1M3C A;  2EIF A;  1TUD A;  4LUE A;  4PJM A;  2CZ6 B;  4KH0 B;  2HKQ B;  1Q86 C;  2LJ1 A;  2YDL A;  1YJW T;  2DAQ A;  3PVQ A;  4C92 D;  1G8X A;  1PG5 B;  3LYI A;  3CCS A;  4J9C A;  4C92 B;  4CC4 B;  2RHX A;  1OPK A;  2QA4 Q;  3M54 A;  2A28 A;  4HVV A;  2F2X A;  4OMM A;  4XK8 E;  1Q86 R;  1M1K C;  4QQG A;  5GAN 6;  4ZN1 A;  2DM1 A;  4X34 A;  5KE2 A;  3CCS T;  4JUV A;  2EWN A;  2KE9 A;  5KYY A;  3THK A;  3JB9 F;  2FZG B;  3EG9 B;  3JCM d;  2OI3 A;  2E3I A;  1IXD A;  1VQ4 A;  3KFV A;  2G3R A;  1BKB A;  2G6F X;  3CCQ Q;  1G3T A;  3OYF A;  1D0Y A;  1OOT A;  2DK3 A;  5FU6 B;  4WTO B;  3CD6 Q;  3EG1 A;  3A8M B;  2A7Y A;  1YJN T;  1VQ4 Q;  2QI2 A;  1VQO A;  4E7Z A;  2KR3 A;  2QEX A;  1PSE A;  2FO0 A;  4NS5 A;  2RK1 A;  2P84 A;  4LD6 A;  3CCL A;  3GNF B;  5FWB A;  2EFI A;  6AT1 B;  1K9M U;  3HFO A;  3VUZ A;  3EG0 A;  3OYK A;  2DXT A;  2CT3 A;  2MMP A;  2XG8 D;  1KHC A;  4J6W A;  2XDD A;  3QUI A;  1ZSZ B;  4J9H A;  1G3Y A;  1G5V A;  4RKU E;  3MP8 A;  1MND A;  3RNJ A;  3R6O A;  2YT6 A;  1JJ2 A;  4JJB A;  4EPC A;  4FM4 B;  3RKW A;  1WJS A;  4M77 A;  4RTY A;  4QVD A;  1FWZ A;  4RTW A;  3OYJ A;  1KC8 R;  1JO8 A;  2ATC B;  1YJN Q;  2BTT A;  4C92 G;  2FPF A;  3F70 A;  4OB2 B;  4DOW A;  3OYY A;  2LDM A;  3OSV A;  2LQN A;  4KUI A;  5CAI A;  2DBK A;  1WNL A;  2LQ8 A;  2RI5 A;  3M0S A;  4IUU A;  5GMK l;  2ZPG B;  1UTI A;  2RNA A;  2RMO A;  2SRC A;  4YTL A;  3ZL7 C;  3OW2 A;  3OYH A;  3JB9 H;  3IQL A;  4J83 A;  4ATO A;  3REA B;  2YXY A;  3SB2 A;  3CC2 T;  1SKU B;  3OBY A;  2QAZ A;  4OMN A;  2V26 A;  2K6D A;  2L3P A;  1U1T A;  2QA4 T;  2P4T A;  2QYZ A;  2YLB A;  2CS7 A;  2YRV A;  2AT1 B;  4BY6 C;  4E7S A;  1UGQ B;  5ECA A;  2DVJ A;  3GF5 A;  4BY6 B;  1Q7Y R;  4ME7 A;  2QG9 B;  3FEO A;  2HD0 A;  5M9O A;  5FWC A;  1RL2 A;  3M0T A;  1IRE B;  2J05 A;  2LNV A;  3CPW A;  1M9S A;  1B07 A;  3EG3 A;  3C12 A;  1W2B S;  1KD1 R;  2HQE A;  2V1R A;  2NLU A;  2RQR A;  2I2L A;  1TSF A;  4QT7 A;  3RKX A;  2X4X A;  1RAH B;  1U8R A;  2YWW A;  4XTY A;  1QLY A;  4FCY A;  1IHV A;  1LNX A;  4XTX A;  2BKD N;  4RTU A;  4BB7 A;  3HKS A;  2E3H A;  2KGT A;  4DQ2 A;  2KY9 A;  1S72 Q;  2AHJ B;  2EJF A;  4PJO G;  2O9V A;  1N5Z A;  3HTR A;  2NWM A;  1VQO T;  5CKF A;  1OQK A;  1K8A C;  2EKO A;  1OYX A;  1TUC A;  3H0F A;  5GAN 3;  2GFA A;  4JRI A;  4J9E A;  3JCM X;  2DJQ A;  3RMQ A;  4M78 D;  1JBM A;  3G7Z A;  2LMJ A;  4OB0 B;  3UDC A;  5KYW B;  1KQS P;  4F17 A;  3RMS A;  2L89 A;  1PRL C;  2LZ6 B;  1OZ2 A;  2YUO A;  1G83 A;  4C0D B;  1S72 T;  2KRS A;  1YJN A;  2KI7 A;  3VS4 A;  1Q7Y C;  1KQS S;  4BAC A;  5IH2 A;  2CP5 A;  4EMH A;  2EQK A;  1M90 R;  2LC4 A;  5DM7 R;  2KXC A;  4M7D G;  1UJ0 A;  2D9T A;  2MYS A;  1TS9 A;  3VS5 A;  3JCM V;  4M7A B;  3BDU A;  2DL7 A;  4PJO F;  3R6N A;  1WZO A;  5KYU A;  2QQS A;  5LJ5 g;  1VQ5 Q;  2OAW A;  5GAO n;  5IHK A;  1PC0 A;  4XU0 A;  1B34 A;  5D6W A;  2DRM A;  2BUD A;  3N5B B;  3LLR A;  5FRM A;  4AFQ C;  2JUF A;  3M55 A;  1RAI B;  4R0K A;  2RF0 A;  5CO7 A;  4MDX A;  2VAS A;  2LT4 A;  1IGQ A;  1E6G A;  2DA9 A;  1WLP B;  2FZK B;  1YI2 A;  4OML A;  5CIU A;  2RD1 A;  3X25 B;  1MUZ A;  1NBE B;  1NYF A;  3HSB A;  1ABO A;  3VYG A;  3QYH B;  3CPW P;  4FYV B;  1SHF A;  4DBH A;  3I55 T;  2O01 E;  3SEM A;  4A4H A;  1U1S A;  2CH4 A;  2IIM A;  4N0A C;  1AD5 A;  4PJO A;  1M1F A;  1BI0 A;  5IHN A;  4C0G A;  4KBM B;  1KD1 U;  4NL3 A;  1RAC B;  4M78 G;  2QTV A;  4C5H A;  1SSH A;  2HL3 A;  2MCN A;  2J7I A;  4BI3 A;  2X4Y A;  4M75 F;  1R77 A;  2HDA A;  2DF6 A;  5FU7 B;  1ZUU A;  3I56 Q;  1Q82 U;  5KCO A;  3QSU A;  1N9R A;  4LXC A;  3CC4 Q;  3X24 B;  3M0U A;  1OU8 A;  4HVU A;  1AVZ C;  5DLQ E;  2HEQ A;  4E7J A;  1OV3 A;  4MZP A;  1YJ9 Q;  2VC8 A;  5D7U A;  1QP2 A;  1BI3 A;  2DL5 A;  2JNG A;  3A1P A;  3L2V A;  4LDV A;  4J7F A;  2K7A A;  1YBY A;  3INZ A;  2JMA A;  3LH0 A;  2JMC A;  3V8K A;  3CME T;  4JRQ A;  3FDR A;  2JTF A;  4AT1 B;  1YWO A;  2J6K A;  2CYZ B;  3EH1 A;  2X9H A;  2QEX T;  1K0S A;  3QKJ A;  4DA4 A;  2EQU A;  1TTH B;  1VQL T;  4Q5W A;  5KYU B;  2EYX A;  2GF7 A;  1WXT A;  1SF9 A;  5GAN 4;  4RTZ A;  1KC8 C;  2VVK A;  5AT1 B;  2V8I A;  1QCF A;  2KMT A;  2LRQ A;  3QWX X;  3NGP A;  3WVD B;  1Y96 B;  4O5V A;  5KE3 A;  2ED1 A;  1VQK A;  4LN2 A;  2CSI A;  5I11 A;  1I1J A;  1ZX6 A;  2E5Q A;  3M9Q A;  3FLG A;  2XKO C;  3GBQ A;  3SWN A;  4XTU A;  3MEU A;  4Y92 A;  3JCM h;  3WXM B;  2HL5 C;  1AZG B;  3P8B B;  4Z02 A;  2YUP A;  4M7A C;  4MML A;  4JPB W;  1Q81 C;  1PSF A;  2E64 A;  2XID A;  1M4Z A;  1HYO A;  1T3S A;  4PJO D;  3OS5 A;  2C06 A;  1VQ5 T;  4FT4 A;  1Y0M A;  3UA7 A;  2EJ9 A;  4JJC A;  3CCJ T;  1Q82 R;  1OUL A;  4UC4 A;  3CCL Q;  2L3R A;  2RN8 A;  2PUO B;  2YUN A;  2YSQ A;  1XJW B;  4WF2 A;  1VQK T;  2KYM A;  3V8J A;  3EH2 A;  2RA2 A;  4C92 E;  4BI4 A;  1MGQ A;  1UEB A;  2BZX A;  1AWW A;  4RCB A;  3AHU A;  2L2P A;  3MEV A;  4M7D A;  4C8Q E;  2A08 A;  5LJ5 e;  2R57 A;  3CCM A;  2ROT A;  3UPU A;  2E70 A;  1OPL A;  2Y90 A;  2Z0W A;  4WCI A;  5GAN 8;  2C0I A;  3L2U A;  4QQ6 A;  1JQQ A;  2DIG A;  2A3L A;  1UGP B;  1SSF A;  4FYW B;  1I8F A;  1QCO A;  1YFN A;  1QVF A;  3CCM T;  2XHC A;  4QQD A;  2RPN A;  1KD1 C;  1I5L A;  4RTX A;  1IRX A;  2ZCF B;  2LTO A;  3G71 Q;  1G3W A;  1NLO C;  1W70 A;  4Z89 A;  5IXF A;  4ZNX A;  3V8L A;  1RAG B;  2HMA A;  2LQW A;  1SRM A;  1XQH A;  1M1K R;  3EGU A;  2M51 A;  1RI9 A;  4PJL A;  3LWI A;  3CCL T;  2DO3 A;  3JCM b;  4BDZ A;  1GCP A;  5FU6 C;  4LE9 A;  2AKL A;  3P8H A;  3QBY A;  2VB6 A;  1Y7X A;  3H8Z A;  2KK4 A;  4J5Y A;  2OX7 A;  1F1B B;  2DLP A;  1VQM A;  2JZ2 A;  1BIB A;  3BW1 A;  4PJO C;  1W6X A;  1CKB A;  1M3B A;  2V8K A;  3WVE B;  1EFN A;  1M3A A;  5CQX A;  1NZ9 A;  3EGD B;  5LJ3 d;  4F16 A;  1VIF A;  1M30 A;  2EAY A;  2D6F A;  3JRZ A;  1UDL A;  2KXD A;  2VGM A;  3HP9 A;  1H3Z A;  2XDP A;  5IXB A;  2DTI A;  1JJ2 P;  3VS0 A;  1VQL A;  2WAC A;  3JB9 I;  1WYX A;  1A0N B;  2DBM A;  2KEA A;  4J9B A;  2KRN A;  4ESR A;  4Y28 E;  2HNI A;  4M77 F;  3CCE A;  2M1H A;  1VQM T;  1K9M R;  3I35 A;  3VS3 A;  5GAN h;  2DTO A;  2CP3 A;  1VQN A;  1OX9 A;  3SFM A;  4C0F A;  3MEA A;  3G6E A;  1ZQ1 A;  2VXF A;  3H41 A;  2ECZ A;  2DRK A;  4E7L A;  2M0Y A;  3QPH A;  1OEB A;  4PFO A;  3EG2 A;  2SEM A;  1R0C B;  4M75 G;  3DKM A;  1T0H A;  3TU4 K;  4C5G A;  1PKT A;  5I21 A;  5GAO r;  3RKY A;  4B6M A;  2D1X A;  3HHT B;  4GBQ A;  1B7T A;  2FPE A;  2JOY A;  1VYU A;  1WHK A;  1D3B B;  4IUQ A;  2FHD A;  1MNE A;  3HRU A;  5A2Q E;  1UG1 A;  1UJY A;  3CC4 T;  4E7H A;  1QVF P;  2LNH B;  4M78 B;  3GLX A;  4J8O A;  1QMC A;  2PZ1 A;  4C8Q C;  1VQ4 T;  2MOX A;  2QQR A;  2VUB A;  1V76 A;  3C0C A;  1X2K A;  3CC4 A;  2LJ3 A;  4FW1 A;  1C1A A;  4JS4 A;  1QVG P;  3JSC A;  4FSX A;  1N8R C;  1K9A A;  1RAB B;  4M75 A;  4OB1 B;  1RLP C;  4BDY A;  2KYB A;  4D8D A;  1W1F A;  3OY9 A;  5L23 A;  5LJ3 j;  3TRE A;  2PNI A;  4M77 C;  3QJ6 A;  2AKK A;  1NJI R;  1T0J A;  3CEY A;  3G4S Q;  1BCO A;  3MP1 A;  2OTL A;  1FX7 A;  2R58 A;  2BZY A;  1U5S A;  5GMK m;  3OS0 A;  1GBR A;  1GFD A;  4M78 F;  3GIB A;  4RTV A;  3QYG B;  3JB9 J;  2I0N A;  5A0G A;  2FPD A;  3CCV T;  2L0A A;  1SG5 A;  5GAO l;  2QK0 A;  1BCM A;  4PL6 A;  4PJO E;  3NTH A;  1Y57 A;  3FJP A;  1Y07 A;  2KRM A;  5LJ3 g;  1N8R U;  4M4Z A;  4ELY C;  5GAN f;  2GQI A;  2FB7 A;  3OS2 A;  2W10 A;  1XNI A;  1QP3 A;  4J9I A;  4HXJ A;  3CBP A;  4IKF A;  1YIJ Q;  2DEQ A;  2E5K A;  4K11 A;  3G6E Q;  1BI1 A;  1RUW A;  2RQV A;  5IHI A;  2D8H A;  3C4S A;  5J26 A;  4F7U B;  1QWE A;  4AFZ C;  3E9F A;  4HVW A;  3OYA A;  3RUX A;  4XTW A;  2E1H A;  3SHW A;  3JB9 D;  2ED0 A;  8ATC B;  3OA6 A;  2AK5 A;  4ZGD B;  2CP0 A;  4KGX B;  3SWN C;  3EGD A;  2O88 A;  4HCZ A;  3CCU Q;  2QGG A;  2QQA A;  3KBG A;  3M57 A;  1MMG A;  1HJD A;  2X3W D;  2GTJ A;  2RI3 A;  1M5Q 1;  1BU1 A;  1ZBX A;  2IG0 A;  5FLX E;  5GAM f;  5CR2 A;  2ABL A;  2EGC A;  2EPD A;  3A8H B;  3MO8 A;  2OTJ A;  5IN1 A;  1D1A A;  4M7D B;  1WIE A;  3L42 A;  3PTA A;  2QXF A;  1N27 A;  2B8A A;  3VYH B;  3JCM J;  1X6O A;  3CCQ A;  1K73 C;  2DMO A;  3PMI A;  1X2Q A;  2JM8 A;  3M58 A;  4XU1 A;  2MWP A;  4OGE A;  2H3J A;  3EHR A;  5GMK i;  4CI0 C;  1VQK Q;  1GBQ A;  1KQ1 A;  1O9S A;  2A0F B;  4M7A A;  4X9D A;  4R56 A;  1QKW A;  5GAN 5;  1VQ7 Q;  1WHH A;  3LWH A;  3OMG A;  1QVG A;  1M1K U;  3LX7 A;  4QW2 A;  2D0N A;  3UWN A;  3CMA T;  2MAM A;  2KBT A;  5GAN 2;  2P0Q A;  1VUB A;  3X20 B;  1VQP A;  3ZFJ A;  1TU0 B;  2EQJ A;  2QTX A;  2VWF A;  4KGV B;  2E41 A;  4PJN A;  2QGF B;  1IGU A;  1ZA1 B;  1BBZ A;  1G3S A;  1KSW A;  2VGN A;  2EW3 A;  3EFS A;  1I81 A;  2F1L A;  1JB0 E;  3CME A;  1D1C A;  2HQH A;  2EYY A;  1XOV A;  2CP7 A;  3MHX A;  2GGR A;  3VUB A;  1K1Z A;  2DXB A;  1TUG B;  1M2V B;  2ZPH B;  3CC2 A;  3CCV A;  3PIP A;  4PJO B;  2PVO B;  3NFC A;  1QWF A;  2HQX A;  1YIJ A;  4IIM A;  2HCK A;  4A4E A;  2WSF E;  1YHQ Q;  1WXU A;  2B86 A;  3CC7 A;  4L6V 5;  3CME Q;  3Q1J A;  2LT1 A;  1LCK A;  2PUK B;  4EMK A;  3VS6 A;  1K0X A;  3OMC A;  2CZ0 B;  5J39 A;  4OP0 A;  1JXM A;  4A4G A;  1VQ7 T;  2PQW A;  1I4K 1;  3EHQ A;  2A37 A;  3CCR T;  3MPU B;  2JT4 A;  3TEE A;  3QO3 A;  2CGH A;  2XMF A;  3ASK A;  2OTJ T;  3PE0 A;  2DL4 A;  5GMK e;  2M02 A;  2JS2 A;  3FC3 A;  2JS0 A;  4IUP A;  1B3Q A;  1Q95 G;  1MV3 A;  1ARK A;  2MPX C;  2Y4X A;  1K76 A;  1T3L A;  4LNP A;  1MMN A;  4GLM A;  3VS1 A;  1G2B A;  4M7A G;  3KUF A;  3JCM W;  1QW1 A;  3RBB B;  4DEX A;  3C94 A;  4IUT A;  1NG2 A;  1YNZ A;  2RHZ A;  5CK9 A;  4M78 E;  4C8Q G;  2BIV A;  3E2U A;  3PT9 A;  2GTO A;  4JZ4 A;  3CXC S;  1LOJ A;  1K73 U;  1K4U S;  3CCQ T;  3LW5 E;  3H0I A;  2ZPE B;  2E10 A;  3BDL A;  5GAM g;  1VQ6 T;  4OMO A;  4TVR A;  1W4S A;  4F14 A;  5LJ5 h;  5FU7 C;  4M7A E;  4PKC C;  1YHQ A;  1ZA2 B;  2DIQ A;  4JS5 A;  3QDF A;  2HSE B;  2MF2 A;  2CRE A;  2RB6 A;  1YJW Q;  4C5E A;  2MIO A;  3PIO A;  1CSK A;  5LJ5 d;  3MKD A;  3OQ5 A;  2YRD A;  2CZ1 B;  2DYI A;  2MK5 A;  2VXE A;  4C8Q A;  1NJI U;  1KC8 U;  2NUT B;  4J6Y A;  7AT1 B;  3CCV Q;  1C0M A;  5DLO A;  1MMD A;  1Y96 A;  2H8H A;  3CBO A;  4IUR A;  1KQS A;  1FMV A;  1PD1 A;  5LJ3 e;  1N8R R;  1UHF A;  1AWJ A;  4QVZ A;  2JVV A;  3EFR A;  2LJ0 A;  4JJN K;  3UT1 A;  5FRO A;  1WPY A;  1U3O A;  2YRC A;  3OW2 P;  2P0K A;  4P5N A;  3NPF A;  2F69 A;  5GMK j;  2NYS A;  4C0Z A;  3QDR B;  5EC7 A;  4GY5 A;  4M77 D;  1RAD B;  5C6S A;  2HSP A;  1NPR A;  1WHL A;  1J3T A;  3MP6 A;  2P4R A;  4B9X A;  3GPL A;  3CD6 A;  4HT8 A;  3EGX B;  5GAO p;  2BE7 D;  3DB4 A;  3S3O A;  4F7U A;  2ZPB B;  4C8Q F;  4HA8 A;  4Z8A A;  1VQ8 T;  2RJE A;  4HKE A;  4ZGE B;  3I56 A;  1UUE A;  1WHM A;  3CCR A;  4X1V A;  2X4J A;  4D6W A;  1K73 R;  5KYW A;  2PU9 B;  3M0Q A;  1JU5 C;  4DBF A;  3H0H A;  3QHS A;  2IVW A;  1U06 A;  4OF1 A;  2IPO B;  4C0D C;  4QVC A;  4C8Q B;  1AOJ A;  2F5K A;  2OTL Q;  1M90 C;  1Q81 U;  3SWN B;  1UGV A;  3TQ7 P;  8AT1 B;  4XTZ A;  4C8Q D;  2OTJ Q;  3UF4 A;  1YCY A;  1YIT Q;  1M8V A;  2KSS A;  1NJI C;  1ZUY A;  4N4H A;  1VYT A;  3I5S A;  4HT9 A;  2R5A A;  3HRS A;  1OZ3 A;  2ZGW A;  5CKB A;  1YHQ T;  2EKH A;  4LDY A;  2FZC B;  1VIE A;  3M4Y A;  2GBQ A;  3VU3 C;  5GMK h;  5I22 A;  1KHI A;  2EYZ A;  1V29 B;  2A36 A;  1VQM Q;  1X01 A;  2J06 A;  2EBP A;  2CUD A;  3FB9 A;  2RI2 A;  1IB8 A;  2DEU A;  3V7S A;  1SRL A;  2E4H A;  4J6X A;  2E6Z A;  2KAF A;  4HCK A;  2RM4 A;  1H3H A;  1YI2 Q;  3L2Z A;  5HCK A;  4PLL A;  4RUG A;  2O9S A;  2K4Y A;  2K5I A;  4LDU A;  1JEG A;  1E7O A;  4Y91 A;  3QZ9 B;  3JCM g;  4JZ3 A;  2H3E B;  1SHG A;  2D8J A;  1PHT A;  2X3X D;  1FXX A;  2WSC E;  3OYL A;  2OAU A;  3OYB A;  4RTT A;  4EMK B;  1VQ6 A;  1VQP T;  5KH6 A;  4KUD K;  3LH5 A;  1VQL Q;  3CCU A;  2FL7 A;  1R0B G;  4A4F A;  3UAT A;  2QEX Q;  2HAX A;  1MHN A;  3LGL A;  2V1Q A;  4L5G A;  2RJD A;  2LCC A;  4DEY A;  3CXC A;  4L59 A;  1KK7 A;  1Z9Z A;  4OMQ A;  2EYQ A;  4RCC A;  2OJ2 A;  3VRY A;  2K9G A;  3OS1 A;  1WHJ A;  1I07 A;  3FJ5 A;  1EX4 A;  4FW2 A;  1O75 A;  1X69 A;  3O8V A;  1YIT T;  1BI2 A;  5LJ5 f;  1TWB A;  1WI7 A;  3JAM E;  4RMO A;  2XIC A;  3CCE Q;  4J9G A;  1W2B P;  1NE8 A;  2PVG B;  3GNG A;  4QKU A;  2NUT A;  3E1S A;  3QJY A;  2MWO A;  4LDX A;  1IO6 A;  3M59 A;  3V7R A;  2RQT A;  3VRZ A;  4BE0 A;  3OYC A;  4M7D D;  4JLG A;  1WJQ A;  3I56 T;  2RO0 A;  3NHN A;  5HK3 A;  3A98 A;  1I5O B;  2EJG A;  2D0Q B;  4M7D C;  3RER A;  1BIA A;  1D3B A;  3C95 A;  1FMK A;  1XTD A;  1UFF A;  3TCJ A;  2CZ7 B;  2K5F A;  5I2M A;  2JTE A;  1NPP A;  3L2Q A;  1H92 A;  1KFZ A;  1VQ7 A;  2RHY A;  3EAE A;  3OBW A;  3M56 A;  4KGZ B;  5KYX B;  2JW4 A;  4J7I A;  2RHI A;  1X75 C;  1GFC A;  2EQM A;  3I55 Q;  1AHJ B;  1LVK A;  4FYY B;  2M16 A;  2FYK A;  2QDL A;  3PFS A;  1WQ7 A;  3CCS Q;  4BE2 A;  3OYG A;  2JM9 A;  2QA4 A;  3VKI A;  4CC7 A;  3RIR A;  2CT4 A;  3M5A A;  1M27 C;  4CRI A;  5EG2 A;  4ZGJ B;  2HBP A;  4AG2 C;  2AIR B;  1R8O B;  4JRP A;  1GCQ C;  2L3S A;  3QII A;  4EMK C;  2CP2 A;  2K5L A;  4N4I A;  3S6W A;  4V2S A;  2ESW A;  4F7U G;  1LPL A;  4EDU A;  1MV0 B;  3LGF A;  3URG A;  1YN8 A;  1Q7Y U;  3HFN A;  1VQ9 Q;  5IAY A;  3I55 A;  2LP5 A;  2KT1 A;  3MCA B;  1NM7 A;  4FYX B;  4F04 B;  1S72 A;  4M75 E;  1YWP A;  5GAM j;  3ULR B;  1MMA A;  1WJR A;  5LJ5 j;  3PMT A;  2ZAE A;  1TG0 A;  2L5Q A;  2E12 A;  3OW2 S;  3L2W A;  3JCM f;  5IT9 E;  4M7A F;  1D0Z A;  3JCM P;  1RAE B;  1VOM A;  5GAO q;  3RR6 A;  4C92 C;  2AZV A;  2PVD B;  5GAM e;  5A0L A;  3JB9 G;  4M77 B;  5D6X A;  2O31 A;  1NYG A;  1YP5 A;  2DYB A;  4E7K A;  4KUL A;  1X43 A;  2CDT A;  3FIF A;  2DER A;  4XTV A;  1W2B A;  2J6O A;  4DBQ A;  4C92 F;  4DBR A;  1S1N A;  4CC2 A;  1M90 U;  2VYT A;  1LJO A;  2CH4 W;  4F7U E;  4HCB A;  2QQB A;  3FRN A;  3TVT A;  5CVI A;  3I9Q A;  1B34 B;  4C5I A;  1YJ9 T;  3CC7 T;  3X26 B;  5C0M A;  1WXB A;  3OYD A;  2MI6 A;  4D8K A;  5GAN e;  2RQW A;  1NLP C;  2RH2 A;  1X6B A;  2F2V A;  2FEI A;  3CCR Q;  2BE9 B;  4Z88 A;  2DET A;  2FVU A;  3S3N A;  2AZS A;  2K3B A;  4F7U F;  3M4G A;  3QXE B;  5KYX A;  3ZBD A;  1VQ9 A;  5GAM h;  4AFU C;  1ZUK A;  3HRT A;  4E6R A;  3U23 A;  5HK0 A;  2BZ8 A;  4PFP A;  3A8G B;  1VQN Q;  1VQP Q;  3I5R A;  1WHG A;  4FIB A;  2XD0 A;  2W0Z A;  3A8L B;  3JCM Q;  3CMA A;  1AWX A;  2DKG A;  3S3M A;  2FG0 A;  2LX7 A;  3CQT A;  4VUB A;  2VKN A;  5CKD A;  3MEW A;  3OSS C;  2DNU A;  4PNO A;  2FRY A;  4FSS A;  1GL5 A;  4E47 A;  1DJ7 B;  4XU3 A;  4BI8 B;  1WDX A;  3BFM A;  2KRO A;  5FW9 A;  3OYM A;  1PKS A;  4B9W A;  3M0P A;  5GJV B;  1AT1 B;  1PRM C;  3NTI A;  2DZC A;  3L1A A;  1ZSZ C;  4BE1 A;  1JJ2 S;  1M2V A;  1JXO A;  1I0C A;  3UA6 A;  2QAS A;  2Y4Y A;  2RQU A;  2OTL T;  1GXI E;  3CC7 Q;  2QQ9 A;  2K2M A;  3NMZ C;  3VJP A;  4N0A A;  4JLI A;  3H6Z A;  2JXB A;  5LJ3 f;  2PTK A;  5CKE A;  2EGA A;  3BE3 A;  5GJW B;  3G71 T;  2COZ A;  2C0O A;  1HXD A;  3X28 B;  2JN0 A;  2VV5 A;  1WGS A;  1YJ9 A;  3EFO A;  3ZEH A;  2KQW A;  1YIT A;  4J9F A;  3GOX A;  3M53 A;  2M9U A;  2CUB A;  2DXU A;  1RAA B;  1KG1 A;  3JCM c;  1ABQ A;  4E2F B;  2K79 A;  2DXC A;  4M75 D;  1VQ8 Q;  1H64 1;  4JRK A;  4OVA A;  4M7D E;  2LCL A;  1TH7 A;  2DD5 A;  1TOV A;  4E7I A;  1WFW A;  2GQV A;  2V8J A;  3GP8 A;  1Q81 R;  1UB4 A;  2E65 A;  3A5Z B;  4AFS C;  3G71 A;  1X6G A;  4DOV A;  3L2R A;  1UGR B;  1Y71 A;  1K8A U;  3CCJ A;  3CPF A;  3MET A;  3TSW A;  2DTH A;  2LVM A;  2DD4 A;  3G6E T;  2FRW A;  4X9C A;  2R5M A;  1YJW A;  1TXQ A;  1E6H A;  5CQY A;  3P8D A;  1ZSZ A;  5D6Y A;  3RES A;  1VQ9 T;  3REB B;  1UHC A;  3CBM A;  5HKC A;  2K3Y A;  2COW A;  2ZZD A;  3OYN A;  1ZBJ A;  1HK9 A;  1VQ5 A;  5KYN A;  4OGC A;  4J9D A;  4IIO A;  1RAF B;  2ZPF B;  2LCS A;  4NOY A;  4LDW A;  4RG8 A;  3QG1 A;  4KH1 B;  1H8K A;  4A53 A;  2J6F A;  1UGS B;  1AEY A;  1D0X A;  2KDS A;  4M75 C;  2P0P A;  3CC2 Q;  1EZZ B;  2DL8 A;  1CKA A; 
#chains in the Genus database with same CATH homology
 2LJ3 A;  2EBP A;  2CUD A;  2KT8 A;  2O9V A;  2NUZ A;  1N5Z A;  1SRL A;  1M8M A;  2EGE A;  2NWM A;  2F2W A;  1K9A A;  4HCK A;  1H3H A;  1VA7 A;  1TUC A;  3H0F A;  1RLP C;  1KJW A;  2KYB A;  4J9E A;  4RUG A;  2DX1 A;  1W1F A;  2O9S A;  2DJQ A;  5HCK A;  4D8D A;  1KIK A;  5L23 A;  1JEG A;  1E7O A;  1AWO A;  2PNI A;  4JZ3 A;  4ORZ A;  2LMJ A;  1SHG A;  2D8J A;  2AKK A;  1PHT A;  2X3X D;  3PVL A;  1T0J A;  4F17 A;  4RTT A;  2EQI A;  1PRL C;  2LZ6 B;  1AZE A;  2YUO A;  1G83 A;  3LH5 A;  2KRS A;  2BZY A;  1U5S A;  3UAT A;  1GBR A;  1GFD A;  3VS4 A;  4RTV A;  5IH2 A;  2V1Q A;  2I0N A;  2FPD A;  1YCS B;  2L0A A;  2KXC A;  1QKX A;  4DEY A;  4KRT A;  1UJ0 A;  1Z9Z A;  4OMQ A;  1ZLM A;  2OJ2 A;  1Y57 A;  3VRY A;  3VS5 A;  2K9G A;  3VS7 A;  2KRM A;  2DL7 A;  1I07 A;  3FJ5 A;  4M4Z A;  3R6N A;  4AG1 C;  1X69 A;  2GQI A;  2W10 A;  1WI7 A;  1RLQ C;  1V1C A;  4J9I A;  4HXJ A;  4J9G A;  2OAW A;  5IHK A;  2E5K A;  4K11 A;  3VS2 A;  3TSZ A;  1RUW A;  2RQV A;  5IHI A;  2DRM A;  1IO6 A;  2C0T A;  2D8H A;  1QWE A;  4AFZ C;  2RQT A;  3VRZ A;  4HVW A;  4AFQ C;  4R0K A;  2CSQ A;  2RF0 A;  3NHN A;  3SHW A;  2ED0 A;  1E6G A;  3A98 A;  2AK5 A;  2DA9 A;  1WLP B;  4OML A;  1FMK A;  2O88 A;  1UFF A;  1MUZ A;  1NYF A;  2JTE A;  1HJD A;  1ABO A;  1H92 A;  2X3W D;  1KFZ A;  2GTJ A;  1BU1 A;  1SHF A;  2HBW A;  2JW4 A;  2DE0 X;  1SPK A;  2ABL A;  3SEM A;  2EGC A;  3JV3 A;  2CH4 A;  1GFC A;  2EPD A;  2IIM A;  1PNJ A;  1AD5 A;  5IHN A;  2QDL A;  1WIE A;  1SSH A;  1BK2 A;  4LUD A;  2JM9 A;  2MCN A;  2J7I A;  3M0R A;  4CC7 A;  2DMO A;  2CT4 A;  1X2Q A;  1M27 C;  2JM8 A;  2EYW A;  2HDA A;  2ENM A;  1SEM A;  2DF6 A;  2ROL A;  1ZUU A;  3EHR A;  4AG2 C;  1NEG A;  3M0U A;  1GCQ C;  4HVU A;  1AVZ C;  2HEQ A;  1GBQ A;  2L3S A;  1OV3 A;  1QKW A;  2KNB B;  1GRI A;  2ESW A;  4A63 B;  1MV0 B;  2D0N A;  1YN8 A;  1Z9Q A;  1X27 A;  1NEB A;  2LP5 A;  2KT1 A;  1NM7 A;  2L3Q A;  1WA7 A;  2KBT A;  1YWP A;  3ULR B;  2DL5 A;  2K7A A;  2VWF A;  1TG0 A;  2GNC A;  2JMA A;  2JMC A;  1WX6 A;  1BBZ A;  1KSW A;  1PWT A;  1YWO A;  2DL3 A;  2J6K A;  2EW3 A;  1K0S A;  1UE9 A;  2AZV A;  2EYY A;  1UEC A;  1XOV A;  4EIK A;  1BB9 A;  2EYX A;  2GGR A;  2DIL A;  1K1Z A;  1WXT A;  1ZSG A;  4RTZ A;  2O31 A;  1NYG A;  1YP5 A;  2VVK A;  2YUQ A;  1QCF A;  2DYB A;  4OMP A;  1HD3 A;  3QWX X;  1QWF A;  3NGP A;  1X43 A;  3O5Z A;  2CDT A;  2ED1 A;  2J6O A;  4LN2 A;  2CSI A;  5I11 A;  4IIM A;  1I1J A;  1ZX6 A;  3GBQ A;  1S1N A;  2HCK A;  4JJD A;  4Y92 A;  4CC2 A;  3QWY A;  2CH4 W;  1WXU A;  2B86 A;  1AZG B;  1FYN A;  2O2O A;  4CC3 A;  1LCK A;  2EVR A;  2YUP A;  1K0X A;  3VS6 A;  3TVT A;  3I9Q A;  4JPB W;  1GCQ A;  1HSQ A;  1JXM A;  3EHQ A;  2A37 A;  1WXB A;  2JT4 A;  4D8K A;  1T3S A;  2XMF A;  2RQW A;  3PE0 A;  1Y0M A;  2DL4 A;  3UA7 A;  1NLP C;  1VYV A;  1X6B A;  1M3C A;  4JJC A;  2F2V A;  1TUD A;  2JS2 A;  2FEI A;  4LUE A;  2JS0 A;  1B3Q A;  1MV3 A;  1ARK A;  2LJ1 A;  2YDL A;  4Z88 A;  3PVQ A;  2RN8 A;  1K76 A;  1T3L A;  2YUN A;  4LNP A;  2YSQ A;  4GLM A;  2AZS A;  2K3B A;  2KYM A;  3VS1 A;  1G2B A;  4J9C A;  4CC4 B;  3RBB B;  1OPK A;  4DEX A;  1NG2 A;  1YNZ A;  4AFU C;  1ZUK A;  2A28 A;  2BZX A;  4HVV A;  4E6R A;  2F2X A;  4OMM A;  1AWW A;  3U23 A;  2L2P A;  2BZ8 A;  2DM1 A;  3I5R A;  2KE9 A;  2GTO A;  2A08 A;  4JZ4 A;  3THK A;  2W0Z A;  1K4U S;  2OI3 A;  2ROT A;  1OPL A;  3H0I A;  3KFV A;  1AWX A;  4WCI A;  2C0I A;  1JQQ A;  2FG0 A;  2LX7 A;  2G6F X;  3CQT A;  2VKN A;  1OOT A;  2DNU A;  2FRY A;  2RPN A;  4OMO A;  3EG1 A;  4RTX A;  4F14 A;  4FSS A;  1GL5 A;  2KR3 A;  1WDX A;  2FO0 A;  1NLO C;  1W70 A;  2KRO A;  5FW9 A;  4Z89 A;  5FWB A;  5IXF A;  1PKS A;  4ZNX A;  2LQW A;  3M0P A;  5GJV B;  1PRM C;  1SRM A;  2CRE A;  3EG0 A;  2MIO A;  3EGU A;  2M51 A;  1RI9 A;  1CSK A;  2CT3 A;  1GCP A;  1JXO A;  1I0C A;  4LE9 A;  3UA6 A;  2AKL A;  4J9H A;  2RQU A;  2H8H A;  2DLP A;  3RNJ A;  2K2M A;  3NMZ C;  1W6X A;  1CKB A;  1M3B A;  1UHF A;  2YT6 A;  4JJB A;  1AWJ A;  1EFN A;  2JXB A;  1M3A A;  2PTK A;  2LJ0 A;  2EGA A;  5GJW B;  4RTY A;  2C0O A;  1U3O A;  4RTW A;  1JO8 A;  3NPF A;  2BTT A;  2FPF A;  4F16 A;  1M30 A;  4J9F A;  1UDL A;  2KXD A;  5EC7 A;  2LQN A;  2DBK A;  2HSP A;  2CUB A;  1J3T A;  3M0S A;  1ABQ A;  5IXB A;  2K79 A;  2P4R A;  3VS0 A;  1UTI A;  2RNA A;  1WYX A;  1A0N B;  2DBM A;  2RMO A;  2KEA A;  2SRC A;  4J9B A;  3ZL7 C;  2KRN A;  3IQL A;  4ESR A;  4Z8A A;  3REA B;  1UUE A;  1WFW A;  3I35 A;  3VS3 A;  4OMN A;  4X1V A;  2K6D A;  2L3P A;  4AFS C;  1X6G A;  3H41 A;  2ECZ A;  3M0Q A;  2DRK A;  2M0Y A;  1JU5 C;  3H0H A;  5ECA A;  3TSW A;  2DVJ A;  1OEB A;  3EG2 A;  2SEM A;  1U06 A;  2FRW A;  5FWC A;  3M0T A;  1AOJ A;  1T0H A;  1E6H A;  2J05 A;  1PKT A;  1UGV A;  2D1X A;  4GBQ A;  3UF4 A;  1B07 A;  3EG3 A;  3REB B;  2FPE A;  1UHC A;  1VYU A;  1ZUY A;  2V1R A;  1ZBJ A;  1VYT A;  2RQR A;  3I5S A;  4J9D A;  4QT7 A;  4IIO A;  1UG1 A;  1UJY A;  2LCS A;  1QLY A;  2LNH B;  1H8K A;  2EKH A;  2J6F A;  1AEY A;  4RTU A;  2PZ1 A;  2GBQ A;  2KGT A;  5I22 A;  2MOX A;  2EYZ A;  3C0C A;  1X2K A;  2A36 A;  2J06 A;  2DL8 A;  1CKA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...