2VVKA

Grb2 sh3c (1)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
b'GSVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
molecule tags Protein binding
source organism Homo sapiens
publication title Distinct Binding Modes of Two Epitopes in Gab2 that Interact with the Sh3C Domain of Grb2.
pubmed doi rcsb
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2vvkA00
1X2KA 3QWXX 2O9VA 1FMKA 2AKLA 4OMQA 2RQRA 1Y0MA 1S1NA 2RF0A 2V1QA 1OOTA 4A63B 1AWXA 4HVUA 4RTTA 1QLYA 1QWEA 2ENMA 2JMAA 4RUGA 2EYZA 1PKSA 1TG0A 3NHNA 1Z9QA 2D8JA 1W6XA 1M3BA 5GJVB 1BK2A 2P4RA 1NYGA 3RNJA 2O9SA 2HBWA 4IIOA 2LX7A 4RTYA 1QCFA 1GBRA 2AKKA 1AD5A 3VS1A 1GFCA 2CUDA 2DILA 2VWFA 4CC3A 4J9FA 2FRWA 2NWMA 3C0CA 2MOXA 1WXBA 2FPEA 4J9HA 4LN2A 3EHRA 2MCNA 2AZSA 2KRNA 4KRTA 4F17A 1MUZA 1ZSGA 3O5ZA 2RQUA 3GBQA 3VS2A 5ECAA 1YWPA 2LCSA 4JZ4A 2EBPA 5FWBA 1WIEA 2DRMA 1GFDA 2O31A 2YSQA 1XOVA 1AZGB 1UUEA 5EC7A 2ABLA 2EGAA 2W10A 5IHKA 5FWCA 2RQWA 2BZYA 1PRMC 2NUZA 4OMPA 1JEGA 1NLPC 3UF4A 5FW9A 2DNUA 3CQTA 4FSSA 1SEMA 1SRMA 2EYXA 2X3XD 3M0SA 1ZUKA 3FJ5A 1H8KA 1X6BA 5IH2A 3REBB 5IXBA 2M0YA 4JJCA 1N5ZA 3NGPA 4F16A 4RTWA 4CC4B 2H8HA 3EG2A 2AK5A 1J3TA 2D0NA 3I9QA 1AEYA 4J9EA 4JJBA 1YP5A 3EHQA 4Z89A 3VS5A 3VRYA 4CC7A 2QDLA 1I1JA 4HXJA 2HEQA 2F2VA 2VVKA 1HD3A 1JU5C 2KE9A 4RTZA 1VYVA 4QT7A 1WDXA 2J6KA 2W0ZA 2EYYA 1PKTA 2CT3A 2K7AA 1H3HA 1EFNA 1MV0B 2RNAA 2DJQA 2ED1A 2HCKA 3U23A 3UATA 1K76A 4CC2A 2CT4A 2DL4A 5IHIA 3RBBB 1RUWA 1AZEA 1QWFA 3PVLA 2O88A 2J6FA 3THKA 1WXTA 4M4ZA 4GLMA 1SRLA 1YN8A 2KEAA 2FRYA 2EQIA 1NM7A 1GL5A 2D1XA 4IIMA 2DF6A 4JPBW 2F2WA 4R0KA 2BZ8A 1BB9A 1ABQA 1U5SA 1PWTA 2X3WD 1VYTA 5IXFA 2JMCA 1MV3A 2DMOA 1I0CA 1JO8A 2SEMA 2K79A 1M30A 1UDLA 2RQTA 2KGTA 1JQQA 1RLPC 1SHFA 1WX6A 1KIKA 1NLOC 1ZBJA 2DVJA 2DL8A 3JV3A 1KSWA 2BTTA 5I11A 4HCKA 2OI3A 2A28A 2A08A 2PTKA 3ULRB 1QKWA 1X6GA 2JTEA 2L2PA 1AVZC 2L3SA 3NPFA 2EKHA 1X69A 3IQLA 1UFFA 4RTXA 2LP5A 3H41A 2JS2A 1QKXA 2O2OA 1OV3A 2GBQA 2EPDA 4JZ3A 1GCQC 2L3QA 5GJWB 4ZNXA 1V1CA 3I35A 4OMNA 4LUDA 3UA7A 3VS6A 2HDAA 1YNZA 2YUNA 2LJ0A 3VS0A 4JJDA 2EW3A 1T0JA 2KROA 1SPKA 2FG0A 2M51A 3KFVA 1IO6A 2PZ1A 2YUQA 4OMLA 2CSIA 1B3QA 1YCSB 2GNCA 1YWOA 2A37A 4AG2C 2J7IA 2FPDA 3ZL7C 1AWJA 2JXBA 2CH4W 2K6DA 1M3CA 2DYBA 2EGEA 3EG3A 3R6NA 2KR3A 1VYUA 3UA6A 3EG1A 2KNBB 1UGVA 1M8MA 2GQIA 2LQNA 4AFSC 5IHNA 2HSPA 3M0QA 1VA7A 2K3BA 1AWWA 1PNJA 1HSQA 4GBQA 1JXOA 1SSHA 1UECA 1NEBA 1M27C 1UG1A 2KRMA 1HJDA 2LJ1A 4J9BA 3EGUA 2I0NA 1TUDA 2KT8A 1UHFA 4WCIA 2RQVA 4D8DA 2MIOA 5L23A 2KRSA 2YDLA 2KXDA 2JW4A 2JM9A 2KYMA 2B86A 4J9GA 2LJ3A 1LCKA 1K1ZA 2L0AA 1ZX6A 2C0OA 4EIKA 3QWYA 2CSQA 1K4US 3M0UA 1RLQC 3TSWA 3TSZA 3PVQA 1U3OA 1CKBA 1SHGA 4J9IA 4K11A 2JT4A 3VS7A 4DEXA 3VRZA 2J6OA 4AG1C 1UHCA 2J06A 1X27A 1Y57A 1AOJA 3EG0A 4RTVA 1Z9ZA 3PE0A 1ZUYA 3I5SA 2LZ6B 2JS0A 3M0RA 1K0SA 1H92A 4HVVA 1E7OA 3VS3A 1KJWA 2ROTA 1WXUA 2RN8A 1KFZA 2BZXA 2DLPA 2DL3A 1UTIA 4AFUC 1M3AA 2DA9A 2CUBA 2KBTA 1ZUUA 2EYWA 2VKNA 1FYNA 1OEBA 1T0HA 2DL5A 2K2MA 2KXCA 1WA7A 1NEGA 2EGCA 2GGRA 2V1RA 1WYXA 1UE9A 1OPLA 1U06A 4DEYA 2GTJA 4ESRA 2RMOA 1W70A 2LQWA 2D8HA 2IIMA 2GTOA 2DBMA 2OAWA 1WI7A 1X43A 1ZLMA 2DBKA 1TUCA 1T3LA 1NG2A 2XMFA 2DRKA 1G83A 1NYFA 3H0HA 1JXMA 2RPNA 3LH5A 3NMZC 1PRLC 4D8KA 3M0TA 2FO0A 3H0IA 4AFZC 1B07A 2G6FX 2LMJA 3REAB 2YT6A 2C0TA 4Y92A 1E6HA 4AFQC 3M0PA 2YUOA 2KT1A 2F2XA 2YUPA 1ABOA 2JM8A 2OJ2A 3TVTA 1E6GA 2DX1A 1WFWA 1G2BA 2CREA 1WLPB 1GRIA 1RI9A 3I5RA 1GBQA 4LUEA 2J05A 2ED0A 3SEMA 2A36A 4E6RA 4J9CA 2C0IA 1T3SA 1K0XA 4OMMA 4F14A 1A0NB 4J9DA 1BBZA 2EVRA 4LE9A 4LNPA 2K9GA 2FEIA 2L3PA 3A98A 4Z8AA 4ORZA 2LNHB 1I07A 2E5KA 1UJ0A 5I22A 1GCQA 2SRCA 2CDTA 1W1FA 2FPFA 3SHWA 2DL7A 1BU1A 2ESWA 4Z88A 1ARKA 1AWOA 1OPKA 1X2QA 2DE0X 1GCPA 2PNIA 1K9AA 5HCKA 2KYBA 2DM1A 1CKAA 4OMOA 3VS4A 2ROLA 4RTUA 3H0FA 1UJYA 2CH4A 4X1VA 2ECZA 1PHTA 2AZVA 4HVWA 1CSKA
chains in the Genus database with same CATH superfamily
1X2KA 1WZOA 3EG9A 4C8QA 3CCLA 2P84A 4OMQA 2VV5A 2RQRA 1Y0MA 2QQBA 4LD9K 1D0YA 2RF0A 2OTLA 3QIIA 2F5KA 1NE8A 1AWXA 3MEVA 3OYBA 1G3WA 3VYGA 2EFIA 2R58A 1KC8R 3SWNC 4M7DE 1VQ5Q 2HQXA 1VQ5T 2P4RA 2BIVA 3RNJA 2YRVA 2HBWA 2QA4A 2LX7A 3C12A 1KHCA 4KGXB 3M53A 1BIAA 5GAN3 4PFOA 2X51A 3C0CA 1VQOQ 2MOXA 2M1HA 3PIPA 4QQGA 2XU8A 5GAOq 4KRTA 5GMKh 1MUZA 3E9FA 4RCBA 2RQUA 3VS2A 5ECAA 3LYIA 2HL5C 2DRMA 1VQ7T 4FM4B 2P0PA 1WQ7A 4IUPA 4DOWA 3H6ZA 5AYFA 4J6YA 2KY9A 1UUEA 5EC7A 1MHNA 2W10A 3OMCA 3V7RA 1JEGA 5CVIA 4O6JA 3LGLA 2EYQA 3UF4A 5GAMj 5GAOl 2DNUA 5GMKj 3RMSA 3L42A 5HK0A 2EYXA 3JCMW 3CCRA 2ZPHB 1ZUKA 4VUBA 3FJ5A 2DD4A 1BI2A 3MCAB 1N5ZA 3EG2A 2Y4XA 1Y96B 2D0NA 4PJOF 3I9QA 1TOVA 3L2RA 3G71T 1YP5A 3EHQA 4Z89A 2MF2A 5KYXA 3QYGB 1MNDA 2HKQB 3CCEQ 1BI1A 2QAZA 2HEQA 4BI3A 1I8FA 1QP3A 4RTZA 3C95A 2J6KA 2EYYA 2RA2A 2CT3A 5GAN5 1H3HA 1EFNA 4CC2A 3U23A 1AHJB 4LDYA 5GAMf 1AZEA 5I2MA 3OS2A 4CI0C 4M4ZA 4PJJA 2OTLT 5KYWB 1SF9A 4XTZA 1Y07A 2MPXC 2EQIA 1NM7A 3QKJA 4C0DC 2F2WA 3J80E 3LWHA 5LJ5h 1ABQA 1YJ9T 4E2FB 2E6NA 1Q86R 2QGGA 4C92C 4M7AG 2JMCA 1LNXA 2RH2A 1VQLQ 3KXTA 2QYZA 1QVFP 1YJNA 1JO8A 3JSCA 1VQ7Q 3L1AA 3I56Q 3RERA 1UDLA 3GNGA 2K5FA 4FCYA 4NS5A 2VB6A 1TTHB 1KIKA 2DL8A 4X9CA 1KSWA 2OI3A 1UGPB 4C92G 4XTWA 1M1KC 4C92F 4EMHA 2X9HA 4HT9A 2JTEA 2M0OA 2GFUA 1VQNQ 1I5LA 3MO8A 2YLBA 1TSFA 3X24B 1UFFA 1W2BS 4F04B 4MZMA 1QKXA 2GBQA 4BD3A 4M77F 4JZ3A 3P8HA 1VQMA 1V1CA 3I55Q 3I35A 1U1SA 3OB9A 4M7AB 4LUDA 3JCMg 4L6V5 2YRCA 1I81A 3CC4T 1D3BB 1C1AA 1T0JA 3OS0A 2EIFA 2FG0A 4ZTJA 5LJ5j 1IO6A 4XTVA 4E7ZA 3CPWS 1YWOA 5KCHA 3CCVT 1YJWQ 2FPDA 5C6SA 3ZL7C 4JRQA 2ZAEA 1M5Q1 3P8DA 4FYVB 1UGVA 3VUZA 1KQSS 5FRNA 2RJDA 3PT9A 1Q86C 2HKNA 3E2UA 3X25B 2COZA 2LQNA 3LLRA 4AFSC 4PJOB 3OQ5A 2Z0WA 2MI6A 1WHKA 2LQKA 1VQ4Q 1HSQA 2O4XA 4N0AC 1UECA 1NEBA 1M27C 2NLUA 3M57A 3OYNA 3MP8A 2DJZA 3EGUA 3CCSQ 1TUDA 2KT8A 2RQVA 1ZQ1A 1D1BA 3Q1JA 1SKUB 1QCNA 2KRSA 3V7SA 2E41A 2LT4A 4J9GA 2DEQA 4F7UB 4J7IA 3QWYA 2FHDA 4BI8B 1QVGP 1K4US 1VIFA 2XI9A 2GF7A 2GCXA 3PVQA 1B7TA 1JJ2A 2F5TX 1VQ8T 4J83A 1UHCA 3A8LB 1D1CA 1UGSB 4F7UE 1ZUYA 3CCVA 3M0RA 1K0SA 2MMPA 1MNEA 3RMQA 3JB9G 3S3NA 2RN8A 2XG8D 2WSEE 2R5MA 1WJSA 4AFUC 2CUBA 1YJNT 2RHYA 3CXCA 3NTKA 3L2UA 4DEYA 1NJIC 2WACA 4FYWB 4A53A 5L8RE 1VQ4A 4OB2B 3BY7A 4ZGJB 2IIMA 2OTJQ 1MGQA 1XJWB 4M7AA 1LPLA 1VQ7A 4YTLA 5HKCA 1ZLMA 2EQKA 4C8QB 1NG2A 4E47A 2XMFA 5KYYA 2HL3A 3WXMB 2RPNA 1VQOA 2A0FB 3LH5A 1PRLC 4IUQA 4D8KA 4EMGA 3I56A 1JB0E 8AT1B 4QKUA 3FDRA 3E1SA 1KC8C 5LJ5g 2YT6A 4IKFA 3GPLA 2YUOA 4D6WA 2KT1A 4KT0E 2RD1A 4M7AE 3TVTA 2OJ2A 1E6GA 1VQPQ 1M90U 4NOYA 2XD0A 2CREA 1RI9A 1GBQA 4LUEA 3OYKA 4PJMA 2I2LA 2A36A 1LOJA 1ZBXA 4ANJA 3VV0A 4OMMA 2EJFA 3X20B 1DJ7B 4C92E 2KSSA 4N4IA 2LCCA 3HPWA 4ORZA 2LNHB 1MMAA 5I22A 3QZ5B 1AT1B 4M77C 3C4SA 1VUBA 2DL7A 2KAFA 1K9MU 1BU1A 2ESWA 1ARKA 1OPKA 1PD0A 3NFCA 4DBFA 1RAAB 2DE0X 1VQ4T 1GCPA 3CMEQ 1WQWA 5GAMe 2KYBA 1TWBA 1H3ZA 4J5YA 1CKAA 4X9DA 5GAN6 4OMOA 4RTUA 8ATCB 5LJ3d 1SG5A 2ECZA 5CR2A 5J3BA 1VQ6Q 3CCVQ 1EIFA 4HVWA 5A0DA 4E7LA 3QWXX 1FMKA 5KYUB 1Q7YC 5KYYB 1YJWT 2EQUA 1S1NA 4DOVA 1U1TA 4Q5WA 2KVQG 4PJOG 2COWA 4RTTA 1QLYA 1QWEA 3G6EA 4M7AD 1LVKA 1QVGA 2EYZA 1N9SA 1PKSA 1BCMA 4IUVA 1W6XA 2DXBA 1SSFA 1BK2A 5M9OA 2O9SA 2DFUA 1YFNA 3RKWA 4XTYA 3CCET 2BKDN 3OBYA 4FT2A 2AKKA 1AD5A 4PJOA 1VQ6A 1K8AR 4IUUA 1JRIA 2VWFA 4J9FA 4CC3A 3OYCA 3QHSA 3OS1A 1OQKA 1WXBA 2FPEA 2V26A 4J9HA 4LN2A 1YHQQ 3OW2A 4GY5A 3CMEA 4C92D 1BI0A 1IGUA 4OGCA 4F17A 2NUPA 2AIRB 3MP6A 1X6OA 3OMGA 2D9TA 3GOXA 1YWPA 3S3OA 3JCMb 3SB2A 3M4YA 1WIEA 4MMKA 2YSQA 3CPWP 2FB7A 4JDSA 2HMAA 1AZGB 2EGAA 3EH1A 2ZPBB 3CMAQ 2BZYA 4BY6B 2NUZA 4XU3A 1NLPC 1WHJA 2JOYA 3H9NA 3DLMA 1S72T 1YI2A 2E3IA 1MMDA 1SRMA 4FT4A 2KDSA 2X3XD 3G4SQ 1OZ2A 2PVGB 1D0XA 3G71Q 5IH2A 5CKHA 1QQJA 1W2BP 1IHVA 4KGZB 4F16A 4M7DG 1AEYA 5GMKi 4J9EA 1M1KR 1OU9A 2M02A 3VS5A 4M77A 4FU6A 4QVCA 2F2VA 2K5LA 2KE9A 4E7KA 3SWNA 3KBGA 1WDXA 2W0ZA 2DEUA 2K7AA 1MV0B 4C8QF 1KQ2A 2DL4A 1RUWA 3PVLA 4LDWA 3UPUA 3TEEA 3G4SA 5FU7C 3THKA 3PIOA 3CC7Q 3CCEA 1KQ1A 4GLMA 1SRLA 1YN8A 1YI2Q 2F69A 4BB7A 4E7HA 2E10A 4PJOE 3OYHA 3G4ST 2D1XA 4IIMA 2YXYA 2FZKB 4XU2A 4B6MA 4R0KA 4XTUA 4KH1B 3CC4A 1PWTA 3HSBA 5LJ5d 3CMAT 1KD1R 4FW1A 4A54A 1UGRB 1ZHIA 4JLGA 4AMCA 2DMOA 1I0CA 1XQHA 3OYIA 5HY6A 2KK4A 3CEYA 1MMNA 3OYLA 2L5QA 2Y90A 2K79A 1M30A 2RQTA 1JQQA 1RLPC 2DXUA 4EMKB 1WX6A 2DIQA 1WHLA 2DVJA 1F1BB 3JV3A 3P8BB 3J7AF 2RJEA 5I11A 1G5VA 2A08A 3ULRB 4ZGDB 1M1KU 1QKWA 4X34A 1D09B 2L2PA 2NUPB 7AT1B 2L3SA 4DQ2A 4CRIA 2A7YA 1QVFA 1YI2T 3IQLA 4QQ6A 1EZZB 3VUBA 2LP5A 1OV3A 4M78D 3HFNA 4C5HA 3BFMA 4OGEA 2VUBA 2L3QA 3JRZA 5GMKm 2QA4Q 4M78A 1QP2A 2K4YA 4JS4A 4A4KA 4M75D 4ME7A 3VS6A 2HDAA 3CCUT 2LJ0A 3VS0A 4JJDA 3QZ9B 2EW3A 3JCMX 3KUFA 3CC7A 3KFVA 4BDZA 2PZ1A 1JJ2P 1K73C 3V8KA 1YCSB 2XDDA 2A37A 2DTHA 5DM7R 2RK1A 1VQMQ 2DVEA 1M3CA 2EGEA 4MDXA 3OSSC 2PVDB 1VYUA 3EG1A 1PSEA 2QEXQ 4JRIA 3OW2S 1M8MA 2DETA 4M7AF 2P0KA 1AWWA 3VKIA 4GBQA 4FIBA 4C92A 1G8XA 1OI1A 2QI2A 1UG1A 5EG2A 4M75F 4ZN3A 4J9BA 2CP6A 4JRPA 4ATOA 4RKUE 5L23A 1V29B 2H3EB 2KXDA 2JW4A 2B86A 2LJ3A 2C0OA 3DB3A 1R0BG 2ZPGB 5FU7B 3TSWA 3RUXA 1KHIA 3D7SB 1U3OA 3M55A 2MK5A 4C0FA 1KD1U 3HFOA 5IAYA 4QQDA 3AHUA 3CCRT 2J06A 2XHCA 4TVRA 1X27A 1Q95G 3I56T 4RTVA 3M9QA 1Z9ZA 1RL2A 3A8GB 3I5SA 2LZ6B 5GANd 1VQKA 1Y71A 5CQXA 2ZZDA 3HP9A 2RHZA 1KFZA 2BZXA 4M75C 2D0QB 2DLPA 2YHTA 4PKCC 2K5IA 3DKMA 3CCUQ 1FYNA 1OEBA 2ZPFB 2K2MA 4ELZC 3LGFA 3HHTB 3JB9I 2GGRA 1PD1A 1WYXA 2QQAA 5LJ5f 2HD0A 3ZFJA 2F1LA 2RMOA 1VQNT 3SD4A 1RAHB 3EH2A 2DBMA 3EFRA 3BDLA 2P0QA 3JAME 3OYFA 1T3LA 3N5BB 3NTIA 4Y91A 3QG1A 1NYFA 1PSFA 3G7ZA 5GAOr 4N0AA 3A8HB 3JB9D 2H3JA 5GANe 3CCMT 4J6WA 1B07A 1VQKQ 3JCMV 2K3XA 1KC8U 3G1JA 3EAEA 2QQSA 2E3HA 1VQ8A 3CBPA 4Y92A 2DD5A 3MEAA 4L59A 3CD6T 4AFQC 1O9SA 4HT8A 5D6YA 2F2XA 2BE7D 2E6ZA 3A1PA 1G3TA 4M78B 3JCMJ 2IPOB 4QVZA 1WFWA 5KYUA 1PG5B 1GRIA 5KYNA 1QVPA 5GAN8 2J05A 3SEMA 4L5GA 3MHXA 4E6RA 2L89A 2RB6A 1V76A 1A0NB 1VOMA 2YLCA 3RDVA 4E7JA 2FEIA 4R55A 4E7SA 4Z8AA 3FJPA 1MMGA 1KQSA 5IT9E 4OP0A 2CDTA 2HNIA 3CXCS 3JB9F 1S72A 4Z88A 2VXFA 5HCKA 2M16A 1D1AA 3VS4A 1BIBA 3PGGA 4A4EA 1C6VX 2XICA 5D7UA 2DO3A 2AKLA 4C8QC 2FL7A 4N4HA 2K3YA 5CK9A 5KE3A 1YJNQ 2NUTA 2OX7A 4HVUA 2JVVA 2NUTB 2ENMA 3LX7A 3NHNA 1Z9QA 1IB8A 2CZ7B 3CC2A 2EQJA 1NYGA 5CAIA 2JTMA 1N8RC 5GAMg 1QCFA 1GBRA 3HRUA 1KQSP 2CP5A 1GFCA 4PNOA 1W2BA 2V8JA 3INZA 3GNFB 1JBMA 2CUDA 2DILA 4F7UF 1K9MC 2FRWA 2RHUA 5I21A 3JCMQ 2DXCA 2DZ9A 2NWMA 3OYEA 1S72Q 5J26A 4M7DB 4A4HA 3EHRA 4OVAA 2X4JA 4R56A 3CCJT 1WPYA 2AZSA 2KRNA 1K73R 1NJIR 3CCJQ 3R6OA 4WTOB 4BDYA 3QXEB 4LDUA 5GAN2 2LCSA 2QTXA 2EBPA 5LJ3f 1VQ9Q 5FWBA 4M77G 1GFDA 3CPWA 3SDZA 3QDRB 4KH0B 1XOVA 4IUTA 2MYSA 3LW5E 4RMOA 5GANf 2AT1B 5IHKA 5FWCA 2LTOA 3CD6A 1PRMC 1VQLT 2EJGA 3CMAA 2K57A 3ZEHA 3L2ZA 3UDCA 4B9XA 2HSEB 5FW9A 2MWOA 3CQTA 4FSSA 3WVEB 1G3YA 3EGDB 3M0SA 3EGDA 5GANh 1VQPT 4JJCA 2VC8A 4M77D 5KE2A 4CC4B 2H8HA 2AK5A 1YCYA 4PFZA 1I1JA 1QMCA 4HCCA 3RIRA 1ZA1B 2VVKA 1HD3A 4HA8A 1JU5C 2X35A 4QT7A 1K8AC 2LVMA 1KG1A 4JS5A 3UATA 2DJQA 2G3RA 1K76A 2CT4A 3RBBB 2Y4YA 4MZTA 1QWFA 2LDMA 4FL6A 1D3BA 2J6FA 2OTJT 2A3LA 3HKSA 1GXIE 5CKEA 3HRTA 4M78C 1EX4A 2KEAA 1YJ9A 2FRYA 1BKBA 2DTIA 2DF6A 2LCLA 4Y28E 1VQ9A 2BZ8A 1BB9A 3LWIA 1U5SA 2JUFA 1VYTA 3CCMA 5IXFA 2QGFB 1IHWA 2WSFE 1PM3A 1FWZA 2HAXA 4PL6A 2FZCB 2SEMA 3QUIA 3QPHA 1RABB 1U8RA 4M78G 1HYOA 4MZPA 1NLOC 2L3RA 4LXCA 3J81E 4FSXA 5DLQE 1YITQ 1QW1A 4O5VA 1VQNA 4QVDA 2RM4A 4PJLA 1AVZC 3NPFA 2EKHA 2E65A 3F70A 3MJXA 1VQMT 5D6XA 3O8VA 3H41A 2DKGA 1IRXA 3SWNB 2O2OA 5FU6B 4JRKA 3JCMf 3RKYA 5GAN4 2O01E 4UC4A 1LJOA 2PVOB 4PJNA 1B34B 3OS5A 2CKKA 4IURA 4OMNA 3UA7A 1WGSA 4XK8E 3C94A 4ZTFA 4C0ZA 5CCAA 3JCMe 1HXDA 1OYXA 3HTRA 3E19A 2M51A 5GMKe 4MMLA 3M54A 2VGNA 2V8KA 2CSIA 5DY9A 1B3QA 2GNCA 3CC7T 4LD6A 1YHQA 2QEXT 4AG2C 2J7IA 4PLIA 2NYSA 2M9UA 2JXBA 2RI2A 1OU8A 2QK0A 2K6DA 4WF2A 5GMKl 3G71A 3EG3A 3UA6A 1FXXA 1PC0A 5C0MA 2CP0A 3CC2Q 3X26B 3S3MA 3OW2P 5GAMh 3ER0A 4M78E 5IHNA 2HSPA 3M0QA 2GFAA 2HZYA 2K3BA 4JLIA 1JXOA 1SSHA 1XNIA 1WJRA 4N4GA 3CPFA 4BE2A 1Q81C 2PUKB 1HJDA 1Q82U 5A0LA 3BE3A 5KYWA 4DBQA 2QQRA 3MP1A 5AT1B 3CCQQ 3RESA 5I2SA 1M9SA 4FW2A 2KYMA 1VQ9T 1K1ZA 1R0CB 4EIKA 3V8JA 2JJ9A 1RLQC 2KMTA 2DZCA 4XU0A 3M59A 1CKBA 5GAOn 4RG2A 4J9IA 2E70A 4K11A 1Y7XA 3VS7A 4DEXA 1KK7A 2J6OA 1BI3A 1AOJA 3VU3C 4EMKA 3EG0A 3X28B 4M78F 4EDUA 1M90R 3PE0A 4HVVA 2LT1A 3URGA 4C8QD 5CQYA 1KJWA 3ASKA 1Q86U 2RI5A 2X4XA 1PCXA 3T9NA 3CCQA 2EQMA 5LJ5e 1N27A 1UTIA 4A4GA 2KBTA 2EYWA 3RR6A 2VKNA 2C06A 2DL5A 1T0HA 1WA7A 1NEGA 2EGCA 3MEUA 4OMFB 2B8AA 3GP8A 2CZ0B 1UE9A 2P4TA 2DYIA 4ESRA 1UB4A 4QW2A 3CCRQ 2GTOA 2OTJA 4P5NA 1WI7A 1X43A 3CCLT 3PMTA 1YIJQ 4M7AC 3QSUA 1G83A 4JUVA 1N8RR 3H0HA 1JXMA 5CKBA 4ELYC 3OA6A 3NMZC 2RI3A 1YITA 4OB0B 3PTAA 2LMJA 2COYA 3REAB 1IREB 1M1GA 3FC3A 2C0TA 1VQ8Q 1E6HA 3H8ZA 2YUPA 3CCJA 1ABOA 2JM8A 3BDUA 3CCUA 5J39A 2D6FA 5LJ3h 4J7FA 2DX1A 1G2BA 3GLXA 1WLPB 3JCMh 3I5RA 4C92B 2VGMA 4J9CA 1K8AU 2C0IA 1T3SA 1ZA2B 3E9GA 1K0XA 2E64A 4J9DA 4NL3A 3OYAA 2EVRA 3HRSA 1TXQA 4LNPA 2L3PA 3A98A 2IG0A 3EFOA 1RAEB 3GIBA 1ZSZA 2EAYA 2E1HA 2R57A 1C0MA 1R8OB 1N6AA 2DM1A 1YIJA 3UT1A 3JCMd 2K2VA 5D6WA 1RAGB 4J8OA 3QJYA 3H0FA 2CH4A 1VIEA 3CD6Q 4BACA 3CCLQ 1CSKA 2O9VA 3TCJA 2CGHA 1OULA 3ZBDA 3G6ET 3VJPA 3OYYA 1IZ6A 2QQ9A 4F7UG 4II1A 1Q81R 2V1QA 1OOTA 4A63B 5KH6A 2BUDA 2LRQA 3MKDA 5GANg 2RJFA 2MWPA 2JMAA 4RUGA 3FB9A 3FRNA 1TG0A 3PNWC 5DLOA 1YBYA 2D8JA 2PU9B 1M3BA 3L2WA 5GJVB 3EGXB 4IIOA 3S6WA 4RTYA 1D0ZA 3VS1A 2QXFA 4A4FA 4MDWA 1FX7A 2O4XB 3OY9A 2XDPA 3MPUB 4KBMB 1WHGA 1VQ6T 2MCNA 4M7DA 1XTDA 2CP7A 1NZ9A 1ZSGA 3O5ZA 3OSVA 2E12A 4E7IA 3GBQA 1FMVA 1P92A 5LJ3j 3OYDA 4JZ4A 3TU4K 4XU1A 3L2QA 1BCOA 3CCST 5A2QE 1NJIU 4KUDK 2O31A 1M2VA 2ABLA 2EKOA 2KI7A 1B34A 5CO7A 2RQWA 2ZCFB 3VYHB 4OMPA 3EG9B 2LQ8A 3OBWA 1SEMA 4OB3B 2QASA 4HKEA 4KGVB 3M56A 1YJWA 5CKDA 1YIJT 4M75B 1N8RU 1H8KA 1X6BA 3REBB 5IXBA 2M0YA 4FYXB 4M7DD 3CC2T 5FLXE 3NGPA 4M7DF 4RTWA 2DERA 2HBPA 2QEXA 1VQKT 1J3TA 3CXCP 1UGQB 3RKXA 2E4HA 2XDBA 4JJBA 4JJNK 5KYXB 3VRYA 4M77B 4CC7A 2QDLA 4HXJA 2QTVA 3BW1A 3OYJA 5LJ3e 2ZPEB 3SFMA 1VYVA 4ZGEB 2PQWA 1PKTA 1M2VB 4XTXA 2RNAA 2HCKA 2ED1A 4FYYB 4M75G 3OYMA 3JCMc 3G6EQ 4C8QG 4V2SA 5IHIA 4EPCA 2CP2A 3JCMP 2RJCA 5FRMA 2O88A 5HK3A 1WXTA 4C0GA 2CZ6B 2JN0A 1I4K1 2JTFA 4OF1A 1GL5A 1X01A 3QYHB 2CYZB 4JPBW 4C5EA 3CC4Q 2EJ9A 1N9RA 1ACMB 1WHMA 2OAUA 1M8VA 2X3WD 1YHQT 2QA4T 4BUGA 4KULA 3CMET 1MV3A 4C5IA 4KUIA 1NPRA 1TU0B 1M4ZA 3EFSA 1Q7YU 1M2OA 2ZGWA 2KGTA 1SHFA 4DBHA 1ZBJA 3META 3LH0A 2BTTA 4HCKA 2A28A 2DXTA 3TQ7P 2LC4A 1BYMA 4BE1A 2PTKA 1G3SA 4DA4A 3EFOB 1WHHA 1X6GA 4NL2A 3V7CA 2IVWA 3EGXA 1TS9A 5CIUA 1X69A 1Q7YR 3FEOA 1OX9A 2LNVA 2MAMA 4RTXA 1RAIB 4RCCA 2JS2A 4PJOC 5LJ3g 2EPDA 1GCQC 5GJWB 4ZNXA 1QVGS 3UWNA 2FZGB 4LDVA 2V8IA 1YNZA 4DBRA 2YUNA 3OYGA 2KROA 1SPKA 3A8MB 2YUQA 4OMLA 3MEWA 3V8LA 2DTOA 1H641 1Q82R 2OTLQ 1VQ5A 1AWJA 2CH4W 1R77A 1VQPA 2DYBA 2QG9B 5GAN7 3R6NA 2KR3A 4EMKC 2KNBB 1QCOA 4HCZA 4XQ3A 2CP3A 2GQIA 2GQVA 2CZ1B 3CBOA 2RHIA 4GLKA 1RACB 1VA7A 2XKOC 5GAMd 2YWWA 1PNJA 1VQLA 4PLLA 4M75E 1W4SA 1NPPA 2KRMA 5A0GA 9ATCB 2QDYB 2LJ1A 1Q81U 2HQHA 2R5AA 2DPPB 2I0NA 3I55T 1WJQA 5LL6S 1UHFA 4WCIA 4RG8A 4D8DA 2MIOA 2CS7A 2YDLA 4HCBA 1RADB 5CKFA 2JM9A 2JZ2A 3M4GA 1LCKA 2L0AA 1ZX6A 6AT1B 5FROA 2YRDA 3A8OB 2CSQA 3M0UA 4B9WA 4AT1B 3WVDB 3CBMA 3TSZA 3M58A 1JJ2S 3JB9J 3JB9H 1SHGA 1VQOT 3L2VA 2JT4A 2RHXA 3VRZA 4AG1C 1RI0A 1Y57A 2BE9B 1IXDA 1O75A 2JS0A 1OX8A 1H92A 3ME9A 3CCMQ 1E7OA 3QJ6A 3VS3A 2XK0A 2ROTA 1X75C 4M75A 1WXUA 1M90C 1TUGB 2VXEA 2RO0A 5GAOp 1HK9A 2DL3A 1Y96A 1M3AA 2DA9A 3AT1B 1ZUUA 3A5ZB 1YJ9Q 2X4YA 2KXCA 3TREA 2DK3A 3QDFA 4Z02A 1K73U 5KCOA 2LX9A 4PJOD 3HL8A 4BY6C 3FIFA 4F7UA 2DIGA 2V1RA 1IGQA 2X4WA 3NTHA 2EWNA 1OPLA 1U06A 2GTJA 5IN1A 2AHJB 2ZPIB 1W70A 3CCSA 4ZN1A 2LQWA 2D8HA 1ZSZC 2OAWA 2DBKA 1TUCA 1YITT 2DRKA 1QVFS 2ATCB 3QO3A 1TH7A 2KQWA 3M0TA 2FO0A 2JNGA 3H0IA 4AFZC 1KD1C 3DLLA 2DAQA 3DB4A 2G6FX 2E5QA 1K9MR 1Q82C 1NBEB 4XAXB 3PMIA 3M0PA 2XIDA 3GF5A 4J6XA 4C0DB 4BE0A 2WSCE 1I5OB 5FU6C 2L8DA 3PFSA 1M1FA 2PUOB 2VASA 4OB1B 4LDXA 3FLGA 2ED0A 3QBYA 4F14A 1BBZA 3CCQT 2VYTA 4C8QE 4PFPA 4LE9A 4C5GA 3M5AA 2K9GA 2FYKA 1I07A 2E5KA 1ZSZB 5GANj 1UJ0A 1GCQA 2SRCA 4PK4A 1W1FA 2FPFA 3SHWA 1OZ3A 1RAFB 1AWOA 4M7DC 1X2QA 2FVUA 2PNIA 2RK2A 1K9AA 4M77E 4BI4A 1FMWA 1WNLA 5GAOm 3I55A 2ROLA 1UJYA 4X1VA 1PHTA 2AZVA 1UEBA 2HQEA
chains in the Genus database with same CATH topology
1X2KA 3QWXX 2O9VA 1FMKA 2AKLA 4OMQA 2RQRA 1Y0MA 1S1NA 2RF0A 2V1QA 1OOTA 4A63B 1AWXA 4HVUA 4RTTA 1QLYA 1QWEA 2ENMA 2JMAA 4RUGA 2EYZA 1PKSA 1TG0A 3NHNA 1Z9QA 2D8JA 1W6XA 1M3BA 5GJVB 1BK2A 2P4RA 1NYGA 3RNJA 2O9SA 2HBWA 4IIOA 2LX7A 4RTYA 1QCFA 1GBRA 2AKKA 1AD5A 3VS1A 1GFCA 2CUDA 2DILA 2VWFA 4CC3A 4J9FA 2FRWA 2NWMA 3C0CA 2MOXA 1WXBA 2FPEA 4J9HA 4LN2A 3EHRA 2MCNA 2AZSA 2KRNA 4KRTA 4F17A 1MUZA 1ZSGA 3O5ZA 2RQUA 3GBQA 3VS2A 5ECAA 1YWPA 2LCSA 4JZ4A 2EBPA 5FWBA 1WIEA 2DRMA 1GFDA 2O31A 2YSQA 1XOVA 1AZGB 1UUEA 5EC7A 2ABLA 2EGAA 2W10A 5IHKA 5FWCA 2RQWA 2BZYA 1PRMC 2NUZA 4OMPA 1JEGA 1NLPC 3UF4A 5FW9A 2DNUA 3CQTA 4FSSA 1SEMA 1SRMA 2EYXA 2X3XD 3M0SA 1ZUKA 3FJ5A 1H8KA 1X6BA 5IH2A 3REBB 5IXBA 2M0YA 4JJCA 1N5ZA 3NGPA 4F16A 4RTWA 4CC4B 2H8HA 3EG2A 2AK5A 1J3TA 2D0NA 3I9QA 1AEYA 4J9EA 4JJBA 1YP5A 3EHQA 4Z89A 3VS5A 3VRYA 4CC7A 2QDLA 1I1JA 4HXJA 2HEQA 2F2VA 2VVKA 1HD3A 1JU5C 2KE9A 4RTZA 1VYVA 4QT7A 1WDXA 2J6KA 2W0ZA 2EYYA 1PKTA 2CT3A 2K7AA 1H3HA 1EFNA 1MV0B 2RNAA 2DJQA 2ED1A 2HCKA 3U23A 3UATA 1K76A 4CC2A 2CT4A 2DL4A 5IHIA 3RBBB 1RUWA 1AZEA 1QWFA 3PVLA 2O88A 2J6FA 3THKA 1WXTA 4M4ZA 4GLMA 1SRLA 1YN8A 2KEAA 2FRYA 2EQIA 1NM7A 1GL5A 2D1XA 4IIMA 2DF6A 4JPBW 2F2WA 4R0KA 2BZ8A 1BB9A 1ABQA 1U5SA 1PWTA 2X3WD 1VYTA 5IXFA 2JMCA 1MV3A 2DMOA 1I0CA 1JO8A 2SEMA 2K79A 1M30A 1UDLA 2RQTA 2KGTA 1JQQA 1RLPC 1SHFA 1WX6A 1KIKA 1NLOC 1ZBJA 2DVJA 2DL8A 3JV3A 1KSWA 2BTTA 5I11A 4HCKA 2OI3A 2A28A 2A08A 2PTKA 3ULRB 1QKWA 1X6GA 2JTEA 2L2PA 1AVZC 2L3SA 3NPFA 2EKHA 1X69A 3IQLA 1UFFA 4RTXA 2LP5A 3H41A 2JS2A 1QKXA 2O2OA 1OV3A 2GBQA 2EPDA 4JZ3A 1GCQC 2L3QA 5GJWB 4ZNXA 1V1CA 3I35A 4OMNA 4LUDA 3UA7A 3VS6A 2HDAA 1YNZA 2YUNA 2LJ0A 3VS0A 4JJDA 2EW3A 1T0JA 2KROA 1SPKA 2FG0A 2M51A 3KFVA 1IO6A 2PZ1A 2YUQA 4OMLA 2CSIA 1B3QA 1YCSB 2GNCA 1YWOA 2A37A 4AG2C 2J7IA 2FPDA 3ZL7C 1AWJA 2JXBA 2CH4W 2K6DA 1M3CA 2DYBA 2EGEA 3EG3A 3R6NA 2KR3A 1VYUA 3UA6A 3EG1A 2KNBB 1UGVA 1M8MA 2GQIA 2LQNA 4AFSC 5IHNA 2HSPA 3M0QA 1VA7A 2K3BA 1AWWA 1PNJA 1HSQA 4GBQA 1JXOA 1SSHA 1UECA 1NEBA 1M27C 1UG1A 2KRMA 1HJDA 2LJ1A 4J9BA 3EGUA 2I0NA 1TUDA 2KT8A 1UHFA 4WCIA 2RQVA 4D8DA 2MIOA 5L23A 2KRSA 2YDLA 2KXDA 2JW4A 2JM9A 2KYMA 2B86A 4J9GA 2LJ3A 1LCKA 1K1ZA 2L0AA 1ZX6A 2C0OA 4EIKA 3QWYA 2CSQA 1K4US 3M0UA 1RLQC 3TSWA 3TSZA 3PVQA 1U3OA 1CKBA 1SHGA 4J9IA 4K11A 2JT4A 3VS7A 4DEXA 3VRZA 2J6OA 4AG1C 1UHCA 2J06A 1X27A 1Y57A 1AOJA 3EG0A 4RTVA 1Z9ZA 3PE0A 1ZUYA 3I5SA 2LZ6B 2JS0A 3M0RA 1K0SA 1H92A 4HVVA 1E7OA 3VS3A 1KJWA 2ROTA 1WXUA 2RN8A 1KFZA 2BZXA 2DLPA 2DL3A 1UTIA 4AFUC 1M3AA 2DA9A 2CUBA 2KBTA 1ZUUA 2EYWA 2VKNA 1FYNA 1OEBA 1T0HA 2DL5A 2K2MA 2KXCA 1WA7A 1NEGA 2EGCA 2GGRA 2V1RA 1WYXA 1UE9A 1OPLA 1U06A 4DEYA 2GTJA 4ESRA 2RMOA 1W70A 2LQWA 2D8HA 2IIMA 2GTOA 2DBMA 2OAWA 1WI7A 1X43A 1ZLMA 2DBKA 1TUCA 1T3LA 1NG2A 2XMFA 2DRKA 1G83A 1NYFA 3H0HA 1JXMA 2RPNA 3LH5A 3NMZC 1PRLC 4D8KA 3M0TA 2FO0A 3H0IA 4AFZC 1B07A 2G6FX 2LMJA 3REAB 2YT6A 2C0TA 4Y92A 1E6HA 4AFQC 3M0PA 2YUOA 2KT1A 2F2XA 2YUPA 1ABOA 2JM8A 2OJ2A 3TVTA 1E6GA 2DX1A 1WFWA 1G2BA 2CREA 1WLPB 1GRIA 1RI9A 3I5RA 1GBQA 4LUEA 2J05A 2ED0A 3SEMA 2A36A 4E6RA 4J9CA 2C0IA 1T3SA 1K0XA 4OMMA 4F14A 1A0NB 4J9DA 1BBZA 2EVRA 4LE9A 4LNPA 2K9GA 2FEIA 2L3PA 3A98A 4Z8AA 4ORZA 2LNHB 1I07A 2E5KA 1UJ0A 5I22A 1GCQA 2SRCA 2CDTA 1W1FA 2FPFA 3SHWA 2DL7A 1BU1A 2ESWA 4Z88A 1ARKA 1AWOA 1OPKA 1X2QA 2DE0X 1GCPA 2PNIA 1K9AA 5HCKA 2KYBA 2DM1A 1CKAA 4OMOA 3VS4A 2ROLA 4RTUA 3H0FA 1UJYA 2CH4A 4X1VA 2ECZA 1PHTA 2AZVA 4HVWA 1CSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2K A;  3QWX X;  2O9V A;  1FMK A;  2AKL A;  4OMQ A;  2RQR A;  1Y0M A;  1S1N A;  2RF0 A;  2V1Q A;  1OOT A;  4A63 B;  1AWX A;  4HVU A;  4RTT A;  1QLY A;  1QWE A;  2ENM A;  2JMA A;  4RUG A;  2EYZ A;  1PKS A;  1TG0 A;  3NHN A;  1Z9Q A;  2D8J A;  1W6X A;  1M3B A;  5GJV B;  1BK2 A;  2P4R A;  1NYG A;  3RNJ A;  2O9S A;  2HBW A;  4IIO A;  2LX7 A;  4RTY A;  1QCF A;  1GBR A;  2AKK A;  1AD5 A;  3VS1 A;  1GFC A;  2CUD A;  2DIL A;  2VWF A;  4CC3 A;  4J9F A;  2FRW A;  2NWM A;  3C0C A;  2MOX A;  1WXB A;  2FPE A;  4J9H A;  4LN2 A;  3EHR A;  2MCN A;  2AZS A;  2KRN A;  4KRT A;  4F17 A;  1MUZ A;  1ZSG A;  3O5Z A;  2RQU A;  3GBQ A;  3VS2 A;  5ECA A;  1YWP A;  2LCS A;  4JZ4 A;  2EBP A;  5FWB A;  1WIE A;  2DRM A;  1GFD A;  2O31 A;  2YSQ A;  1XOV A;  1AZG B;  1UUE A;  5EC7 A;  2ABL A;  2EGA A;  2W10 A;  5IHK A;  5FWC A;  2RQW A;  2BZY A;  1PRM C;  2NUZ A;  4OMP A;  1JEG A;  1NLP C;  3UF4 A;  5FW9 A;  2DNU A;  3CQT A;  4FSS A;  1SEM A;  1SRM A;  2EYX A;  2X3X D;  3M0S A;  1ZUK A;  3FJ5 A;  1H8K A;  1X6B A;  5IH2 A;  3REB B;  5IXB A;  2M0Y A;  4JJC A;  1N5Z A;  3NGP A;  4F16 A;  4RTW A;  4CC4 B;  2H8H A;  3EG2 A;  2AK5 A;  1J3T A;  2D0N A;  3I9Q A;  1AEY A;  4J9E A;  4JJB A;  1YP5 A;  3EHQ A;  4Z89 A;  3VS5 A;  3VRY A;  4CC7 A;  2QDL A;  1I1J A;  4HXJ A;  2HEQ A;  2F2V A;  2VVK A;  1HD3 A;  1JU5 C;  2KE9 A;  4RTZ A;  1VYV A;  4QT7 A;  1WDX A;  2J6K A;  2W0Z A;  2EYY A;  1PKT A;  2CT3 A;  2K7A A;  1H3H A;  1EFN A;  1MV0 B;  2RNA A;  2DJQ A;  2ED1 A;  2HCK A;  3U23 A;  3UAT A;  1K76 A;  4CC2 A;  2CT4 A;  2DL4 A;  5IHI A;  3RBB B;  1RUW A;  1AZE A;  1QWF A;  3PVL A;  2O88 A;  2J6F A;  3THK A;  1WXT A;  4M4Z A;  4GLM A;  1SRL A;  1YN8 A;  2KEA A;  2FRY A;  2EQI A;  1NM7 A;  1GL5 A;  2D1X A;  4IIM A;  2DF6 A;  4JPB W;  2F2W A;  4R0K A;  2BZ8 A;  1BB9 A;  1ABQ A;  1U5S A;  1PWT A;  2X3W D;  1VYT A;  5IXF A;  2JMC A;  1MV3 A;  2DMO A;  1I0C A;  1JO8 A;  2SEM A;  2K79 A;  1M30 A;  1UDL A;  2RQT A;  2KGT A;  1JQQ A;  1RLP C;  1SHF A;  1WX6 A;  1KIK A;  1NLO C;  1ZBJ A;  2DVJ A;  2DL8 A;  3JV3 A;  1KSW A;  2BTT A;  5I11 A;  4HCK A;  2OI3 A;  2A28 A;  2A08 A;  2PTK A;  3ULR B;  1QKW A;  1X6G A;  2JTE A;  2L2P A;  1AVZ C;  2L3S A;  3NPF A;  2EKH A;  1X69 A;  3IQL A;  1UFF A;  4RTX A;  2LP5 A;  3H41 A;  2JS2 A;  1QKX A;  2O2O A;  1OV3 A;  2GBQ A;  2EPD A;  4JZ3 A;  1GCQ C;  2L3Q A;  5GJW B;  4ZNX A;  1V1C A;  3I35 A;  4OMN A;  4LUD A;  3UA7 A;  3VS6 A;  2HDA A;  1YNZ A;  2YUN A;  2LJ0 A;  3VS0 A;  4JJD A;  2EW3 A;  1T0J A;  2KRO A;  1SPK A;  2FG0 A;  2M51 A;  3KFV A;  1IO6 A;  2PZ1 A;  2YUQ A;  4OML A;  2CSI A;  1B3Q A;  1YCS B;  2GNC A;  1YWO A;  2A37 A;  4AG2 C;  2J7I A;  2FPD A;  3ZL7 C;  1AWJ A;  2JXB A;  2CH4 W;  2K6D A;  1M3C A;  2DYB A;  2EGE A;  3EG3 A;  3R6N A;  2KR3 A;  1VYU A;  3UA6 A;  3EG1 A;  2KNB B;  1UGV A;  1M8M A;  2GQI A;  2LQN A;  4AFS C;  5IHN A;  2HSP A;  3M0Q A;  1VA7 A;  2K3B A;  1AWW A;  1PNJ A;  1HSQ A;  4GBQ A;  1JXO A;  1SSH A;  1UEC A;  1NEB A;  1M27 C;  1UG1 A;  2KRM A;  1HJD A;  2LJ1 A;  4J9B A;  3EGU A;  2I0N A;  1TUD A;  2KT8 A;  1UHF A;  4WCI A;  2RQV A;  4D8D A;  2MIO A;  5L23 A;  2KRS A;  2YDL A;  2KXD A;  2JW4 A;  2JM9 A;  2KYM A;  2B86 A;  4J9G A;  2LJ3 A;  1LCK A;  1K1Z A;  2L0A A;  1ZX6 A;  2C0O A;  4EIK A;  3QWY A;  2CSQ A;  1K4U S;  3M0U A;  1RLQ C;  3TSW A;  3TSZ A;  3PVQ A;  1U3O A;  1CKB A;  1SHG A;  4J9I A;  4K11 A;  2JT4 A;  3VS7 A;  4DEX A;  3VRZ A;  2J6O A;  4AG1 C;  1UHC A;  2J06 A;  1X27 A;  1Y57 A;  1AOJ A;  3EG0 A;  4RTV A;  1Z9Z A;  3PE0 A;  1ZUY A;  3I5S A;  2LZ6 B;  2JS0 A;  3M0R A;  1K0S A;  1H92 A;  4HVV A;  1E7O A;  3VS3 A;  1KJW A;  2ROT A;  1WXU A;  2RN8 A;  1KFZ A;  2BZX A;  2DLP A;  2DL3 A;  1UTI A;  4AFU C;  1M3A A;  2DA9 A;  2CUB A;  2KBT A;  1ZUU A;  2EYW A;  2VKN A;  1FYN A;  1OEB A;  1T0H A;  2DL5 A;  2K2M A;  2KXC A;  1WA7 A;  1NEG A;  2EGC A;  2GGR A;  2V1R A;  1WYX A;  1UE9 A;  1OPL A;  1U06 A;  4DEY A;  2GTJ A;  4ESR A;  2RMO A;  1W70 A;  2LQW A;  2D8H A;  2IIM A;  2GTO A;  2DBM A;  2OAW A;  1WI7 A;  1X43 A;  1ZLM A;  2DBK A;  1TUC A;  1T3L A;  1NG2 A;  2XMF A;  2DRK A;  1G83 A;  1NYF A;  3H0H A;  1JXM A;  2RPN A;  3LH5 A;  3NMZ C;  1PRL C;  4D8K A;  3M0T A;  2FO0 A;  3H0I A;  4AFZ C;  1B07 A;  2G6F X;  2LMJ A;  3REA B;  2YT6 A;  2C0T A;  4Y92 A;  1E6H A;  4AFQ C;  3M0P A;  2YUO A;  2KT1 A;  2F2X A;  2YUP A;  1ABO A;  2JM8 A;  2OJ2 A;  3TVT A;  1E6G A;  2DX1 A;  1WFW A;  1G2B A;  2CRE A;  1WLP B;  1GRI A;  1RI9 A;  3I5R A;  1GBQ A;  4LUE A;  2J05 A;  2ED0 A;  3SEM A;  2A36 A;  4E6R A;  4J9C A;  2C0I A;  1T3S A;  1K0X A;  4OMM A;  4F14 A;  1A0N B;  4J9D A;  1BBZ A;  2EVR A;  4LE9 A;  4LNP A;  2K9G A;  2FEI A;  2L3P A;  3A98 A;  4Z8A A;  4ORZ A;  2LNH B;  1I07 A;  2E5K A;  1UJ0 A;  5I22 A;  1GCQ A;  2SRC A;  2CDT A;  1W1F A;  2FPF A;  3SHW A;  2DL7 A;  1BU1 A;  2ESW A;  4Z88 A;  1ARK A;  1AWO A;  1OPK A;  1X2Q A;  2DE0 X;  1GCP A;  2PNI A;  1K9A A;  5HCK A;  2KYB A;  2DM1 A;  1CKA A;  4OMO A;  3VS4 A;  2ROL A;  4RTU A;  3H0F A;  1UJY A;  2CH4 A;  4X1V A;  2ECZ A;  1PHT A;  2AZV A;  4HVW A;  1CSK A; 
#chains in the Genus database with same CATH topology
 1X2K A;  1WZO A;  3EG9 A;  4C8Q A;  3CCL A;  2P84 A;  4OMQ A;  2VV5 A;  2RQR A;  1Y0M A;  2QQB A;  4LD9 K;  1D0Y A;  2RF0 A;  2OTL A;  3QII A;  2F5K A;  1NE8 A;  1AWX A;  3MEV A;  3OYB A;  1G3W A;  3VYG A;  2EFI A;  2R58 A;  1KC8 R;  3SWN C;  4M7D E;  1VQ5 Q;  2HQX A;  1VQ5 T;  2P4R A;  2BIV A;  3RNJ A;  2YRV A;  2HBW A;  2QA4 A;  2LX7 A;  3C12 A;  1KHC A;  4KGX B;  3M53 A;  1BIA A;  5GAN 3;  4PFO A;  2X51 A;  3C0C A;  1VQO Q;  2MOX A;  2M1H A;  3PIP A;  4QQG A;  2XU8 A;  5GAO q;  4KRT A;  5GMK h;  1MUZ A;  3E9F A;  4RCB A;  2RQU A;  3VS2 A;  5ECA A;  3LYI A;  2HL5 C;  2DRM A;  1VQ7 T;  4FM4 B;  2P0P A;  1WQ7 A;  4IUP A;  4DOW A;  3H6Z A;  5AYF A;  4J6Y A;  2KY9 A;  1UUE A;  5EC7 A;  1MHN A;  2W10 A;  3OMC A;  3V7R A;  1JEG A;  5CVI A;  4O6J A;  3LGL A;  2EYQ A;  3UF4 A;  5GAM j;  5GAO l;  2DNU A;  5GMK j;  3RMS A;  3L42 A;  5HK0 A;  2EYX A;  3JCM W;  3CCR A;  2ZPH B;  1ZUK A;  4VUB A;  3FJ5 A;  2DD4 A;  1BI2 A;  3MCA B;  1N5Z A;  3EG2 A;  2Y4X A;  1Y96 B;  2D0N A;  4PJO F;  3I9Q A;  1TOV A;  3L2R A;  3G71 T;  1YP5 A;  3EHQ A;  4Z89 A;  2MF2 A;  5KYX A;  3QYG B;  1MND A;  2HKQ B;  3CCE Q;  1BI1 A;  2QAZ A;  2HEQ A;  4BI3 A;  1I8F A;  1QP3 A;  4RTZ A;  3C95 A;  2J6K A;  2EYY A;  2RA2 A;  2CT3 A;  5GAN 5;  1H3H A;  1EFN A;  4CC2 A;  3U23 A;  1AHJ B;  4LDY A;  5GAM f;  1AZE A;  5I2M A;  3OS2 A;  4CI0 C;  4M4Z A;  4PJJ A;  2OTL T;  5KYW B;  1SF9 A;  4XTZ A;  1Y07 A;  2MPX C;  2EQI A;  1NM7 A;  3QKJ A;  4C0D C;  2F2W A;  3J80 E;  3LWH A;  5LJ5 h;  1ABQ A;  1YJ9 T;  4E2F B;  2E6N A;  1Q86 R;  2QGG A;  4C92 C;  4M7A G;  2JMC A;  1LNX A;  2RH2 A;  1VQL Q;  3KXT A;  2QYZ A;  1QVF P;  1YJN A;  1JO8 A;  3JSC A;  1VQ7 Q;  3L1A A;  3I56 Q;  3RER A;  1UDL A;  3GNG A;  2K5F A;  4FCY A;  4NS5 A;  2VB6 A;  1TTH B;  1KIK A;  2DL8 A;  4X9C A;  1KSW A;  2OI3 A;  1UGP B;  4C92 G;  4XTW A;  1M1K C;  4C92 F;  4EMH A;  2X9H A;  4HT9 A;  2JTE A;  2M0O A;  2GFU A;  1VQN Q;  1I5L A;  3MO8 A;  2YLB A;  1TSF A;  3X24 B;  1UFF A;  1W2B S;  4F04 B;  4MZM A;  1QKX A;  2GBQ A;  4BD3 A;  4M77 F;  4JZ3 A;  3P8H A;  1VQM A;  1V1C A;  3I55 Q;  3I35 A;  1U1S A;  3OB9 A;  4M7A B;  4LUD A;  3JCM g;  4L6V 5;  2YRC A;  1I81 A;  3CC4 T;  1D3B B;  1C1A A;  1T0J A;  3OS0 A;  2EIF A;  2FG0 A;  4ZTJ A;  5LJ5 j;  1IO6 A;  4XTV A;  4E7Z A;  3CPW S;  1YWO A;  5KCH A;  3CCV T;  1YJW Q;  2FPD A;  5C6S A;  3ZL7 C;  4JRQ A;  2ZAE A;  1M5Q 1;  3P8D A;  4FYV B;  1UGV A;  3VUZ A;  1KQS S;  5FRN A;  2RJD A;  3PT9 A;  1Q86 C;  2HKN A;  3E2U A;  3X25 B;  2COZ A;  2LQN A;  3LLR A;  4AFS C;  4PJO B;  3OQ5 A;  2Z0W A;  2MI6 A;  1WHK A;  2LQK A;  1VQ4 Q;  1HSQ A;  2O4X A;  4N0A C;  1UEC A;  1NEB A;  1M27 C;  2NLU A;  3M57 A;  3OYN A;  3MP8 A;  2DJZ A;  3EGU A;  3CCS Q;  1TUD A;  2KT8 A;  2RQV A;  1ZQ1 A;  1D1B A;  3Q1J A;  1SKU B;  1QCN A;  2KRS A;  3V7S A;  2E41 A;  2LT4 A;  4J9G A;  2DEQ A;  4F7U B;  4J7I A;  3QWY A;  2FHD A;  4BI8 B;  1QVG P;  1K4U S;  1VIF A;  2XI9 A;  2GF7 A;  2GCX A;  3PVQ A;  1B7T A;  1JJ2 A;  2F5T X;  1VQ8 T;  4J83 A;  1UHC A;  3A8L B;  1D1C A;  1UGS B;  4F7U E;  1ZUY A;  3CCV A;  3M0R A;  1K0S A;  2MMP A;  1MNE A;  3RMQ A;  3JB9 G;  3S3N A;  2RN8 A;  2XG8 D;  2WSE E;  2R5M A;  1WJS A;  4AFU C;  2CUB A;  1YJN T;  2RHY A;  3CXC A;  3NTK A;  3L2U A;  4DEY A;  1NJI C;  2WAC A;  4FYW B;  4A53 A;  5L8R E;  1VQ4 A;  4OB2 B;  3BY7 A;  4ZGJ B;  2IIM A;  2OTJ Q;  1MGQ A;  1XJW B;  4M7A A;  1LPL A;  1VQ7 A;  4YTL A;  5HKC A;  1ZLM A;  2EQK A;  4C8Q B;  1NG2 A;  4E47 A;  2XMF A;  5KYY A;  2HL3 A;  3WXM B;  2RPN A;  1VQO A;  2A0F B;  3LH5 A;  1PRL C;  4IUQ A;  4D8K A;  4EMG A;  3I56 A;  1JB0 E;  8AT1 B;  4QKU A;  3FDR A;  3E1S A;  1KC8 C;  5LJ5 g;  2YT6 A;  4IKF A;  3GPL A;  2YUO A;  4D6W A;  2KT1 A;  4KT0 E;  2RD1 A;  4M7A E;  3TVT A;  2OJ2 A;  1E6G A;  1VQP Q;  1M90 U;  4NOY A;  2XD0 A;  2CRE A;  1RI9 A;  1GBQ A;  4LUE A;  3OYK A;  4PJM A;  2I2L A;  2A36 A;  1LOJ A;  1ZBX A;  4ANJ A;  3VV0 A;  4OMM A;  2EJF A;  3X20 B;  1DJ7 B;  4C92 E;  2KSS A;  4N4I A;  2LCC A;  3HPW A;  4ORZ A;  2LNH B;  1MMA A;  5I22 A;  3QZ5 B;  1AT1 B;  4M77 C;  3C4S A;  1VUB A;  2DL7 A;  2KAF A;  1K9M U;  1BU1 A;  2ESW A;  1ARK A;  1OPK A;  1PD0 A;  3NFC A;  4DBF A;  1RAA B;  2DE0 X;  1VQ4 T;  1GCP A;  3CME Q;  1WQW A;  5GAM e;  2KYB A;  1TWB A;  1H3Z A;  4J5Y A;  1CKA A;  4X9D A;  5GAN 6;  4OMO A;  4RTU A;  8ATC B;  5LJ3 d;  1SG5 A;  2ECZ A;  5CR2 A;  5J3B A;  1VQ6 Q;  3CCV Q;  1EIF A;  4HVW A;  5A0D A;  4E7L A;  3QWX X;  1FMK A;  5KYU B;  1Q7Y C;  5KYY B;  1YJW T;  2EQU A;  1S1N A;  4DOV A;  1U1T A;  4Q5W A;  2KVQ G;  4PJO G;  2COW A;  4RTT A;  1QLY A;  1QWE A;  3G6E A;  4M7A D;  1LVK A;  1QVG A;  2EYZ A;  1N9S A;  1PKS A;  1BCM A;  4IUV A;  1W6X A;  2DXB A;  1SSF A;  1BK2 A;  5M9O A;  2O9S A;  2DFU A;  1YFN A;  3RKW A;  4XTY A;  3CCE T;  2BKD N;  3OBY A;  4FT2 A;  2AKK A;  1AD5 A;  4PJO A;  1VQ6 A;  1K8A R;  4IUU A;  1JRI A;  2VWF A;  4J9F A;  4CC3 A;  3OYC A;  3QHS A;  3OS1 A;  1OQK A;  1WXB A;  2FPE A;  2V26 A;  4J9H A;  4LN2 A;  1YHQ Q;  3OW2 A;  4GY5 A;  3CME A;  4C92 D;  1BI0 A;  1IGU A;  4OGC A;  4F17 A;  2NUP A;  2AIR B;  3MP6 A;  1X6O A;  3OMG A;  2D9T A;  3GOX A;  1YWP A;  3S3O A;  3JCM b;  3SB2 A;  3M4Y A;  1WIE A;  4MMK A;  2YSQ A;  3CPW P;  2FB7 A;  4JDS A;  2HMA A;  1AZG B;  2EGA A;  3EH1 A;  2ZPB B;  3CMA Q;  2BZY A;  4BY6 B;  2NUZ A;  4XU3 A;  1NLP C;  1WHJ A;  2JOY A;  3H9N A;  3DLM A;  1S72 T;  1YI2 A;  2E3I A;  1MMD A;  1SRM A;  4FT4 A;  2KDS A;  2X3X D;  3G4S Q;  1OZ2 A;  2PVG B;  1D0X A;  3G71 Q;  5IH2 A;  5CKH A;  1QQJ A;  1W2B P;  1IHV A;  4KGZ B;  4F16 A;  4M7D G;  1AEY A;  5GMK i;  4J9E A;  1M1K R;  1OU9 A;  2M02 A;  3VS5 A;  4M77 A;  4FU6 A;  4QVC A;  2F2V A;  2K5L A;  2KE9 A;  4E7K A;  3SWN A;  3KBG A;  1WDX A;  2W0Z A;  2DEU A;  2K7A A;  1MV0 B;  4C8Q F;  1KQ2 A;  2DL4 A;  1RUW A;  3PVL A;  4LDW A;  3UPU A;  3TEE A;  3G4S A;  5FU7 C;  3THK A;  3PIO A;  3CC7 Q;  3CCE A;  1KQ1 A;  4GLM A;  1SRL A;  1YN8 A;  1YI2 Q;  2F69 A;  4BB7 A;  4E7H A;  2E10 A;  4PJO E;  3OYH A;  3G4S T;  2D1X A;  4IIM A;  2YXY A;  2FZK B;  4XU2 A;  4B6M A;  4R0K A;  4XTU A;  4KH1 B;  3CC4 A;  1PWT A;  3HSB A;  5LJ5 d;  3CMA T;  1KD1 R;  4FW1 A;  4A54 A;  1UGR B;  1ZHI A;  4JLG A;  4AMC A;  2DMO A;  1I0C A;  1XQH A;  3OYI A;  5HY6 A;  2KK4 A;  3CEY A;  1MMN A;  3OYL A;  2L5Q A;  2Y90 A;  2K79 A;  1M30 A;  2RQT A;  1JQQ A;  1RLP C;  2DXU A;  4EMK B;  1WX6 A;  2DIQ A;  1WHL A;  2DVJ A;  1F1B B;  3JV3 A;  3P8B B;  3J7A F;  2RJE A;  5I11 A;  1G5V A;  2A08 A;  3ULR B;  4ZGD B;  1M1K U;  1QKW A;  4X34 A;  1D09 B;  2L2P A;  2NUP B;  7AT1 B;  2L3S A;  4DQ2 A;  4CRI A;  2A7Y A;  1QVF A;  1YI2 T;  3IQL A;  4QQ6 A;  1EZZ B;  3VUB A;  2LP5 A;  1OV3 A;  4M78 D;  3HFN A;  4C5H A;  3BFM A;  4OGE A;  2VUB A;  2L3Q A;  3JRZ A;  5GMK m;  2QA4 Q;  4M78 A;  1QP2 A;  2K4Y A;  4JS4 A;  4A4K A;  4M75 D;  4ME7 A;  3VS6 A;  2HDA A;  3CCU T;  2LJ0 A;  3VS0 A;  4JJD A;  3QZ9 B;  2EW3 A;  3JCM X;  3KUF A;  3CC7 A;  3KFV A;  4BDZ A;  2PZ1 A;  1JJ2 P;  1K73 C;  3V8K A;  1YCS B;  2XDD A;  2A37 A;  2DTH A;  5DM7 R;  2RK1 A;  1VQM Q;  2DVE A;  1M3C A;  2EGE A;  4MDX A;  3OSS C;  2PVD B;  1VYU A;  3EG1 A;  1PSE A;  2QEX Q;  4JRI A;  3OW2 S;  1M8M A;  2DET A;  4M7A F;  2P0K A;  1AWW A;  3VKI A;  4GBQ A;  4FIB A;  4C92 A;  1G8X A;  1OI1 A;  2QI2 A;  1UG1 A;  5EG2 A;  4M75 F;  4ZN3 A;  4J9B A;  2CP6 A;  4JRP A;  4ATO A;  4RKU E;  5L23 A;  1V29 B;  2H3E B;  2KXD A;  2JW4 A;  2B86 A;  2LJ3 A;  2C0O A;  3DB3 A;  1R0B G;  2ZPG B;  5FU7 B;  3TSW A;  3RUX A;  1KHI A;  3D7S B;  1U3O A;  3M55 A;  2MK5 A;  4C0F A;  1KD1 U;  3HFO A;  5IAY A;  4QQD A;  3AHU A;  3CCR T;  2J06 A;  2XHC A;  4TVR A;  1X27 A;  1Q95 G;  3I56 T;  4RTV A;  3M9Q A;  1Z9Z A;  1RL2 A;  3A8G B;  3I5S A;  2LZ6 B;  5GAN d;  1VQK A;  1Y71 A;  5CQX A;  2ZZD A;  3HP9 A;  2RHZ A;  1KFZ A;  2BZX A;  4M75 C;  2D0Q B;  2DLP A;  2YHT A;  4PKC C;  2K5I A;  3DKM A;  3CCU Q;  1FYN A;  1OEB A;  2ZPF B;  2K2M A;  4ELZ C;  3LGF A;  3HHT B;  3JB9 I;  2GGR A;  1PD1 A;  1WYX A;  2QQA A;  5LJ5 f;  2HD0 A;  3ZFJ A;  2F1L A;  2RMO A;  1VQN T;  3SD4 A;  1RAH B;  3EH2 A;  2DBM A;  3EFR A;  3BDL A;  2P0Q A;  3JAM E;  3OYF A;  1T3L A;  3N5B B;  3NTI A;  4Y91 A;  3QG1 A;  1NYF A;  1PSF A;  3G7Z A;  5GAO r;  4N0A A;  3A8H B;  3JB9 D;  2H3J A;  5GAN e;  3CCM T;  4J6W A;  1B07 A;  1VQK Q;  3JCM V;  2K3X A;  1KC8 U;  3G1J A;  3EAE A;  2QQS A;  2E3H A;  1VQ8 A;  3CBP A;  4Y92 A;  2DD5 A;  3MEA A;  4L59 A;  3CD6 T;  4AFQ C;  1O9S A;  4HT8 A;  5D6Y A;  2F2X A;  2BE7 D;  2E6Z A;  3A1P A;  1G3T A;  4M78 B;  3JCM J;  2IPO B;  4QVZ A;  1WFW A;  5KYU A;  1PG5 B;  1GRI A;  5KYN A;  1QVP A;  5GAN 8;  2J05 A;  3SEM A;  4L5G A;  3MHX A;  4E6R A;  2L89 A;  2RB6 A;  1V76 A;  1A0N B;  1VOM A;  2YLC A;  3RDV A;  4E7J A;  2FEI A;  4R55 A;  4E7S A;  4Z8A A;  3FJP A;  1MMG A;  1KQS A;  5IT9 E;  4OP0 A;  2CDT A;  2HNI A;  3CXC S;  3JB9 F;  1S72 A;  4Z88 A;  2VXF A;  5HCK A;  2M16 A;  1D1A A;  3VS4 A;  1BIB A;  3PGG A;  4A4E A;  1C6V X;  2XIC A;  5D7U A;  2DO3 A;  2AKL A;  4C8Q C;  2FL7 A;  4N4H A;  2K3Y A;  5CK9 A;  5KE3 A;  1YJN Q;  2NUT A;  2OX7 A;  4HVU A;  2JVV A;  2NUT B;  2ENM A;  3LX7 A;  3NHN A;  1Z9Q A;  1IB8 A;  2CZ7 B;  3CC2 A;  2EQJ A;  1NYG A;  5CAI A;  2JTM A;  1N8R C;  5GAM g;  1QCF A;  1GBR A;  3HRU A;  1KQS P;  2CP5 A;  1GFC A;  4PNO A;  1W2B A;  2V8J A;  3INZ A;  3GNF B;  1JBM A;  2CUD A;  2DIL A;  4F7U F;  1K9M C;  2FRW A;  2RHU A;  5I21 A;  3JCM Q;  2DXC A;  2DZ9 A;  2NWM A;  3OYE A;  1S72 Q;  5J26 A;  4M7D B;  4A4H A;  3EHR A;  4OVA A;  2X4J A;  4R56 A;  3CCJ T;  1WPY A;  2AZS A;  2KRN A;  1K73 R;  1NJI R;  3CCJ Q;  3R6O A;  4WTO B;  4BDY A;  3QXE B;  4LDU A;  5GAN 2;  2LCS A;  2QTX A;  2EBP A;  5LJ3 f;  1VQ9 Q;  5FWB A;  4M77 G;  1GFD A;  3CPW A;  3SDZ A;  3QDR B;  4KH0 B;  1XOV A;  4IUT A;  2MYS A;  3LW5 E;  4RMO A;  5GAN f;  2AT1 B;  5IHK A;  5FWC A;  2LTO A;  3CD6 A;  1PRM C;  1VQL T;  2EJG A;  3CMA A;  2K57 A;  3ZEH A;  3L2Z A;  3UDC A;  4B9X A;  2HSE B;  5FW9 A;  2MWO A;  3CQT A;  4FSS A;  3WVE B;  1G3Y A;  3EGD B;  3M0S A;  3EGD A;  5GAN h;  1VQP T;  4JJC A;  2VC8 A;  4M77 D;  5KE2 A;  4CC4 B;  2H8H A;  2AK5 A;  1YCY A;  4PFZ A;  1I1J A;  1QMC A;  4HCC A;  3RIR A;  1ZA1 B;  2VVK A;  1HD3 A;  4HA8 A;  1JU5 C;  2X35 A;  4QT7 A;  1K8A C;  2LVM A;  1KG1 A;  4JS5 A;  3UAT A;  2DJQ A;  2G3R A;  1K76 A;  2CT4 A;  3RBB B;  2Y4Y A;  4MZT A;  1QWF A;  2LDM A;  4FL6 A;  1D3B A;  2J6F A;  2OTJ T;  2A3L A;  3HKS A;  1GXI E;  5CKE A;  3HRT A;  4M78 C;  1EX4 A;  2KEA A;  1YJ9 A;  2FRY A;  1BKB A;  2DTI A;  2DF6 A;  2LCL A;  4Y28 E;  1VQ9 A;  2BZ8 A;  1BB9 A;  3LWI A;  1U5S A;  2JUF A;  1VYT A;  3CCM A;  5IXF A;  2QGF B;  1IHW A;  2WSF E;  1PM3 A;  1FWZ A;  2HAX A;  4PL6 A;  2FZC B;  2SEM A;  3QUI A;  3QPH A;  1RAB B;  1U8R A;  4M78 G;  1HYO A;  4MZP A;  1NLO C;  2L3R A;  4LXC A;  3J81 E;  4FSX A;  5DLQ E;  1YIT Q;  1QW1 A;  4O5V A;  1VQN A;  4QVD A;  2RM4 A;  4PJL A;  1AVZ C;  3NPF A;  2EKH A;  2E65 A;  3F70 A;  3MJX A;  1VQM T;  5D6X A;  3O8V A;  3H41 A;  2DKG A;  1IRX A;  3SWN B;  2O2O A;  5FU6 B;  4JRK A;  3JCM f;  3RKY A;  5GAN 4;  2O01 E;  4UC4 A;  1LJO A;  2PVO B;  4PJN A;  1B34 B;  3OS5 A;  2CKK A;  4IUR A;  4OMN A;  3UA7 A;  1WGS A;  4XK8 E;  3C94 A;  4ZTF A;  4C0Z A;  5CCA A;  3JCM e;  1HXD A;  1OYX A;  3HTR A;  3E19 A;  2M51 A;  5GMK e;  4MML A;  3M54 A;  2VGN A;  2V8K A;  2CSI A;  5DY9 A;  1B3Q A;  2GNC A;  3CC7 T;  4LD6 A;  1YHQ A;  2QEX T;  4AG2 C;  2J7I A;  4PLI A;  2NYS A;  2M9U A;  2JXB A;  2RI2 A;  1OU8 A;  2QK0 A;  2K6D A;  4WF2 A;  5GMK l;  3G71 A;  3EG3 A;  3UA6 A;  1FXX A;  1PC0 A;  5C0M A;  2CP0 A;  3CC2 Q;  3X26 B;  3S3M A;  3OW2 P;  5GAM h;  3ER0 A;  4M78 E;  5IHN A;  2HSP A;  3M0Q A;  2GFA A;  2HZY A;  2K3B A;  4JLI A;  1JXO A;  1SSH A;  1XNI A;  1WJR A;  4N4G A;  3CPF A;  4BE2 A;  1Q81 C;  2PUK B;  1HJD A;  1Q82 U;  5A0L A;  3BE3 A;  5KYW A;  4DBQ A;  2QQR A;  3MP1 A;  5AT1 B;  3CCQ Q;  3RES A;  5I2S A;  1M9S A;  4FW2 A;  2KYM A;  1VQ9 T;  1K1Z A;  1R0C B;  4EIK A;  3V8J A;  2JJ9 A;  1RLQ C;  2KMT A;  2DZC A;  4XU0 A;  3M59 A;  1CKB A;  5GAO n;  4RG2 A;  4J9I A;  2E70 A;  4K11 A;  1Y7X A;  3VS7 A;  4DEX A;  1KK7 A;  2J6O A;  1BI3 A;  1AOJ A;  3VU3 C;  4EMK A;  3EG0 A;  3X28 B;  4M78 F;  4EDU A;  1M90 R;  3PE0 A;  4HVV A;  2LT1 A;  3URG A;  4C8Q D;  5CQY A;  1KJW A;  3ASK A;  1Q86 U;  2RI5 A;  2X4X A;  1PCX A;  3T9N A;  3CCQ A;  2EQM A;  5LJ5 e;  1N27 A;  1UTI A;  4A4G A;  2KBT A;  2EYW A;  3RR6 A;  2VKN A;  2C06 A;  2DL5 A;  1T0H A;  1WA7 A;  1NEG A;  2EGC A;  3MEU A;  4OMF B;  2B8A A;  3GP8 A;  2CZ0 B;  1UE9 A;  2P4T A;  2DYI A;  4ESR A;  1UB4 A;  4QW2 A;  3CCR Q;  2GTO A;  2OTJ A;  4P5N A;  1WI7 A;  1X43 A;  3CCL T;  3PMT A;  1YIJ Q;  4M7A C;  3QSU A;  1G83 A;  4JUV A;  1N8R R;  3H0H A;  1JXM A;  5CKB A;  4ELY C;  3OA6 A;  3NMZ C;  2RI3 A;  1YIT A;  4OB0 B;  3PTA A;  2LMJ A;  2COY A;  3REA B;  1IRE B;  1M1G A;  3FC3 A;  2C0T A;  1VQ8 Q;  1E6H A;  3H8Z A;  2YUP A;  3CCJ A;  1ABO A;  2JM8 A;  3BDU A;  3CCU A;  5J39 A;  2D6F A;  5LJ3 h;  4J7F A;  2DX1 A;  1G2B A;  3GLX A;  1WLP B;  3JCM h;  3I5R A;  4C92 B;  2VGM A;  4J9C A;  1K8A U;  2C0I A;  1T3S A;  1ZA2 B;  3E9G A;  1K0X A;  2E64 A;  4J9D A;  4NL3 A;  3OYA A;  2EVR A;  3HRS A;  1TXQ A;  4LNP A;  2L3P A;  3A98 A;  2IG0 A;  3EFO A;  1RAE B;  3GIB A;  1ZSZ A;  2EAY A;  2E1H A;  2R57 A;  1C0M A;  1R8O B;  1N6A A;  2DM1 A;  1YIJ A;  3UT1 A;  3JCM d;  2K2V A;  5D6W A;  1RAG B;  4J8O A;  3QJY A;  3H0F A;  2CH4 A;  1VIE A;  3CD6 Q;  4BAC A;  3CCL Q;  1CSK A;  2O9V A;  3TCJ A;  2CGH A;  1OUL A;  3ZBD A;  3G6E T;  3VJP A;  3OYY A;  1IZ6 A;  2QQ9 A;  4F7U G;  4II1 A;  1Q81 R;  2V1Q A;  1OOT A;  4A63 B;  5KH6 A;  2BUD A;  2LRQ A;  3MKD A;  5GAN g;  2RJF A;  2MWP A;  2JMA A;  4RUG A;  3FB9 A;  3FRN A;  1TG0 A;  3PNW C;  5DLO A;  1YBY A;  2D8J A;  2PU9 B;  1M3B A;  3L2W A;  5GJV B;  3EGX B;  4IIO A;  3S6W A;  4RTY A;  1D0Z A;  3VS1 A;  2QXF A;  4A4F A;  4MDW A;  1FX7 A;  2O4X B;  3OY9 A;  2XDP A;  3MPU B;  4KBM B;  1WHG A;  1VQ6 T;  2MCN A;  4M7D A;  1XTD A;  2CP7 A;  1NZ9 A;  1ZSG A;  3O5Z A;  3OSV A;  2E12 A;  4E7I A;  3GBQ A;  1FMV A;  1P92 A;  5LJ3 j;  3OYD A;  4JZ4 A;  3TU4 K;  4XU1 A;  3L2Q A;  1BCO A;  3CCS T;  5A2Q E;  1NJI U;  4KUD K;  2O31 A;  1M2V A;  2ABL A;  2EKO A;  2KI7 A;  1B34 A;  5CO7 A;  2RQW A;  2ZCF B;  3VYH B;  4OMP A;  3EG9 B;  2LQ8 A;  3OBW A;  1SEM A;  4OB3 B;  2QAS A;  4HKE A;  4KGV B;  3M56 A;  1YJW A;  5CKD A;  1YIJ T;  4M75 B;  1N8R U;  1H8K A;  1X6B A;  3REB B;  5IXB A;  2M0Y A;  4FYX B;  4M7D D;  3CC2 T;  5FLX E;  3NGP A;  4M7D F;  4RTW A;  2DER A;  2HBP A;  2QEX A;  1VQK T;  1J3T A;  3CXC P;  1UGQ B;  3RKX A;  2E4H A;  2XDB A;  4JJB A;  4JJN K;  5KYX B;  3VRY A;  4M77 B;  4CC7 A;  2QDL A;  4HXJ A;  2QTV A;  3BW1 A;  3OYJ A;  5LJ3 e;  2ZPE B;  3SFM A;  1VYV A;  4ZGE B;  2PQW A;  1PKT A;  1M2V B;  4XTX A;  2RNA A;  2HCK A;  2ED1 A;  4FYY B;  4M75 G;  3OYM A;  3JCM c;  3G6E Q;  4C8Q G;  4V2S A;  5IHI A;  4EPC A;  2CP2 A;  3JCM P;  2RJC A;  5FRM A;  2O88 A;  5HK3 A;  1WXT A;  4C0G A;  2CZ6 B;  2JN0 A;  1I4K 1;  2JTF A;  4OF1 A;  1GL5 A;  1X01 A;  3QYH B;  2CYZ B;  4JPB W;  4C5E A;  3CC4 Q;  2EJ9 A;  1N9R A;  1ACM B;  1WHM A;  2OAU A;  1M8V A;  2X3W D;  1YHQ T;  2QA4 T;  4BUG A;  4KUL A;  3CME T;  1MV3 A;  4C5I A;  4KUI A;  1NPR A;  1TU0 B;  1M4Z A;  3EFS A;  1Q7Y U;  1M2O A;  2ZGW A;  2KGT A;  1SHF A;  4DBH A;  1ZBJ A;  3MET A;  3LH0 A;  2BTT A;  4HCK A;  2A28 A;  2DXT A;  3TQ7 P;  2LC4 A;  1BYM A;  4BE1 A;  2PTK A;  1G3S A;  4DA4 A;  3EFO B;  1WHH A;  1X6G A;  4NL2 A;  3V7C A;  2IVW A;  3EGX A;  1TS9 A;  5CIU A;  1X69 A;  1Q7Y R;  3FEO A;  1OX9 A;  2LNV A;  2MAM A;  4RTX A;  1RAI B;  4RCC A;  2JS2 A;  4PJO C;  5LJ3 g;  2EPD A;  1GCQ C;  5GJW B;  4ZNX A;  1QVG S;  3UWN A;  2FZG B;  4LDV A;  2V8I A;  1YNZ A;  4DBR A;  2YUN A;  3OYG A;  2KRO A;  1SPK A;  3A8M B;  2YUQ A;  4OML A;  3MEW A;  3V8L A;  2DTO A;  1H64 1;  1Q82 R;  2OTL Q;  1VQ5 A;  1AWJ A;  2CH4 W;  1R77 A;  1VQP A;  2DYB A;  2QG9 B;  5GAN 7;  3R6N A;  2KR3 A;  4EMK C;  2KNB B;  1QCO A;  4HCZ A;  4XQ3 A;  2CP3 A;  2GQI A;  2GQV A;  2CZ1 B;  3CBO A;  2RHI A;  4GLK A;  1RAC B;  1VA7 A;  2XKO C;  5GAM d;  2YWW A;  1PNJ A;  1VQL A;  4PLL A;  4M75 E;  1W4S A;  1NPP A;  2KRM A;  5A0G A;  9ATC B;  2QDY B;  2LJ1 A;  1Q81 U;  2HQH A;  2R5A A;  2DPP B;  2I0N A;  3I55 T;  1WJQ A;  5LL6 S;  1UHF A;  4WCI A;  4RG8 A;  4D8D A;  2MIO A;  2CS7 A;  2YDL A;  4HCB A;  1RAD B;  5CKF A;  2JM9 A;  2JZ2 A;  3M4G A;  1LCK A;  2L0A A;  1ZX6 A;  6AT1 B;  5FRO A;  2YRD A;  3A8O B;  2CSQ A;  3M0U A;  4B9W A;  4AT1 B;  3WVD B;  3CBM A;  3TSZ A;  3M58 A;  1JJ2 S;  3JB9 J;  3JB9 H;  1SHG A;  1VQO T;  3L2V A;  2JT4 A;  2RHX A;  3VRZ A;  4AG1 C;  1RI0 A;  1Y57 A;  2BE9 B;  1IXD A;  1O75 A;  2JS0 A;  1OX8 A;  1H92 A;  3ME9 A;  3CCM Q;  1E7O A;  3QJ6 A;  3VS3 A;  2XK0 A;  2ROT A;  1X75 C;  4M75 A;  1WXU A;  1M90 C;  1TUG B;  2VXE A;  2RO0 A;  5GAO p;  1HK9 A;  2DL3 A;  1Y96 A;  1M3A A;  2DA9 A;  3AT1 B;  1ZUU A;  3A5Z B;  1YJ9 Q;  2X4Y A;  2KXC A;  3TRE A;  2DK3 A;  3QDF A;  4Z02 A;  1K73 U;  5KCO A;  2LX9 A;  4PJO D;  3HL8 A;  4BY6 C;  3FIF A;  4F7U A;  2DIG A;  2V1R A;  1IGQ A;  2X4W A;  3NTH A;  2EWN A;  1OPL A;  1U06 A;  2GTJ A;  5IN1 A;  2AHJ B;  2ZPI B;  1W70 A;  3CCS A;  4ZN1 A;  2LQW A;  2D8H A;  1ZSZ C;  2OAW A;  2DBK A;  1TUC A;  1YIT T;  2DRK A;  1QVF S;  2ATC B;  3QO3 A;  1TH7 A;  2KQW A;  3M0T A;  2FO0 A;  2JNG A;  3H0I A;  4AFZ C;  1KD1 C;  3DLL A;  2DAQ A;  3DB4 A;  2G6F X;  2E5Q A;  1K9M R;  1Q82 C;  1NBE B;  4XAX B;  3PMI A;  3M0P A;  2XID A;  3GF5 A;  4J6X A;  4C0D B;  4BE0 A;  2WSC E;  1I5O B;  5FU6 C;  2L8D A;  3PFS A;  1M1F A;  2PUO B;  2VAS A;  4OB1 B;  4LDX A;  3FLG A;  2ED0 A;  3QBY A;  4F14 A;  1BBZ A;  3CCQ T;  2VYT A;  4C8Q E;  4PFP A;  4LE9 A;  4C5G A;  3M5A A;  2K9G A;  2FYK A;  1I07 A;  2E5K A;  1ZSZ B;  5GAN j;  1UJ0 A;  1GCQ A;  2SRC A;  4PK4 A;  1W1F A;  2FPF A;  3SHW A;  1OZ3 A;  1RAF B;  1AWO A;  4M7D C;  1X2Q A;  2FVU A;  2PNI A;  2RK2 A;  1K9A A;  4M77 E;  4BI4 A;  1FMW A;  1WNL A;  5GAO m;  3I55 A;  2ROL A;  1UJY A;  4X1V A;  1PHT A;  2AZV A;  1UEB A;  2HQE A; 
#chains in the Genus database with same CATH homology
 1X2K A;  3QWX X;  2O9V A;  1FMK A;  2AKL A;  4OMQ A;  2RQR A;  1Y0M A;  1S1N A;  2RF0 A;  2V1Q A;  1OOT A;  4A63 B;  1AWX A;  4HVU A;  4RTT A;  1QLY A;  1QWE A;  2ENM A;  2JMA A;  4RUG A;  2EYZ A;  1PKS A;  1TG0 A;  3NHN A;  1Z9Q A;  2D8J A;  1W6X A;  1M3B A;  5GJV B;  1BK2 A;  2P4R A;  1NYG A;  3RNJ A;  2O9S A;  2HBW A;  4IIO A;  2LX7 A;  4RTY A;  1QCF A;  1GBR A;  2AKK A;  1AD5 A;  3VS1 A;  1GFC A;  2CUD A;  2DIL A;  2VWF A;  4CC3 A;  4J9F A;  2FRW A;  2NWM A;  3C0C A;  2MOX A;  1WXB A;  2FPE A;  4J9H A;  4LN2 A;  3EHR A;  2MCN A;  2AZS A;  2KRN A;  4KRT A;  4F17 A;  1MUZ A;  1ZSG A;  3O5Z A;  2RQU A;  3GBQ A;  3VS2 A;  5ECA A;  1YWP A;  2LCS A;  4JZ4 A;  2EBP A;  5FWB A;  1WIE A;  2DRM A;  1GFD A;  2O31 A;  2YSQ A;  1XOV A;  1AZG B;  1UUE A;  5EC7 A;  2ABL A;  2EGA A;  2W10 A;  5IHK A;  5FWC A;  2RQW A;  2BZY A;  1PRM C;  2NUZ A;  4OMP A;  1JEG A;  1NLP C;  3UF4 A;  5FW9 A;  2DNU A;  3CQT A;  4FSS A;  1SEM A;  1SRM A;  2EYX A;  2X3X D;  3M0S A;  1ZUK A;  3FJ5 A;  1H8K A;  1X6B A;  5IH2 A;  3REB B;  5IXB A;  2M0Y A;  4JJC A;  1N5Z A;  3NGP A;  4F16 A;  4RTW A;  4CC4 B;  2H8H A;  3EG2 A;  2AK5 A;  1J3T A;  2D0N A;  3I9Q A;  1AEY A;  4J9E A;  4JJB A;  1YP5 A;  3EHQ A;  4Z89 A;  3VS5 A;  3VRY A;  4CC7 A;  2QDL A;  1I1J A;  4HXJ A;  2HEQ A;  2F2V A;  2VVK A;  1HD3 A;  1JU5 C;  2KE9 A;  4RTZ A;  1VYV A;  4QT7 A;  1WDX A;  2J6K A;  2W0Z A;  2EYY A;  1PKT A;  2CT3 A;  2K7A A;  1H3H A;  1EFN A;  1MV0 B;  2RNA A;  2DJQ A;  2ED1 A;  2HCK A;  3U23 A;  3UAT A;  1K76 A;  4CC2 A;  2CT4 A;  2DL4 A;  5IHI A;  3RBB B;  1RUW A;  1AZE A;  1QWF A;  3PVL A;  2O88 A;  2J6F A;  3THK A;  1WXT A;  4M4Z A;  4GLM A;  1SRL A;  1YN8 A;  2KEA A;  2FRY A;  2EQI A;  1NM7 A;  1GL5 A;  2D1X A;  4IIM A;  2DF6 A;  4JPB W;  2F2W A;  4R0K A;  2BZ8 A;  1BB9 A;  1ABQ A;  1U5S A;  1PWT A;  2X3W D;  1VYT A;  5IXF A;  2JMC A;  1MV3 A;  2DMO A;  1I0C A;  1JO8 A;  2SEM A;  2K79 A;  1M30 A;  1UDL A;  2RQT A;  2KGT A;  1JQQ A;  1RLP C;  1SHF A;  1WX6 A;  1KIK A;  1NLO C;  1ZBJ A;  2DVJ A;  2DL8 A;  3JV3 A;  1KSW A;  2BTT A;  5I11 A;  4HCK A;  2OI3 A;  2A28 A;  2A08 A;  2PTK A;  3ULR B;  1QKW A;  1X6G A;  2JTE A;  2L2P A;  1AVZ C;  2L3S A;  3NPF A;  2EKH A;  1X69 A;  3IQL A;  1UFF A;  4RTX A;  2LP5 A;  3H41 A;  2JS2 A;  1QKX A;  2O2O A;  1OV3 A;  2GBQ A;  2EPD A;  4JZ3 A;  1GCQ C;  2L3Q A;  5GJW B;  4ZNX A;  1V1C A;  3I35 A;  4OMN A;  4LUD A;  3UA7 A;  3VS6 A;  2HDA A;  1YNZ A;  2YUN A;  2LJ0 A;  3VS0 A;  4JJD A;  2EW3 A;  1T0J A;  2KRO A;  1SPK A;  2FG0 A;  2M51 A;  3KFV A;  1IO6 A;  2PZ1 A;  2YUQ A;  4OML A;  2CSI A;  1B3Q A;  1YCS B;  2GNC A;  1YWO A;  2A37 A;  4AG2 C;  2J7I A;  2FPD A;  3ZL7 C;  1AWJ A;  2JXB A;  2CH4 W;  2K6D A;  1M3C A;  2DYB A;  2EGE A;  3EG3 A;  3R6N A;  2KR3 A;  1VYU A;  3UA6 A;  3EG1 A;  2KNB B;  1UGV A;  1M8M A;  2GQI A;  2LQN A;  4AFS C;  5IHN A;  2HSP A;  3M0Q A;  1VA7 A;  2K3B A;  1AWW A;  1PNJ A;  1HSQ A;  4GBQ A;  1JXO A;  1SSH A;  1UEC A;  1NEB A;  1M27 C;  1UG1 A;  2KRM A;  1HJD A;  2LJ1 A;  4J9B A;  3EGU A;  2I0N A;  1TUD A;  2KT8 A;  1UHF A;  4WCI A;  2RQV A;  4D8D A;  2MIO A;  5L23 A;  2KRS A;  2YDL A;  2KXD A;  2JW4 A;  2JM9 A;  2KYM A;  2B86 A;  4J9G A;  2LJ3 A;  1LCK A;  1K1Z A;  2L0A A;  1ZX6 A;  2C0O A;  4EIK A;  3QWY A;  2CSQ A;  1K4U S;  3M0U A;  1RLQ C;  3TSW A;  3TSZ A;  3PVQ A;  1U3O A;  1CKB A;  1SHG A;  4J9I A;  4K11 A;  2JT4 A;  3VS7 A;  4DEX A;  3VRZ A;  2J6O A;  4AG1 C;  1UHC A;  2J06 A;  1X27 A;  1Y57 A;  1AOJ A;  3EG0 A;  4RTV A;  1Z9Z A;  3PE0 A;  1ZUY A;  3I5S A;  2LZ6 B;  2JS0 A;  3M0R A;  1K0S A;  1H92 A;  4HVV A;  1E7O A;  3VS3 A;  1KJW A;  2ROT A;  1WXU A;  2RN8 A;  1KFZ A;  2BZX A;  2DLP A;  2DL3 A;  1UTI A;  4AFU C;  1M3A A;  2DA9 A;  2CUB A;  2KBT A;  1ZUU A;  2EYW A;  2VKN A;  1FYN A;  1OEB A;  1T0H A;  2DL5 A;  2K2M A;  2KXC A;  1WA7 A;  1NEG A;  2EGC A;  2GGR A;  2V1R A;  1WYX A;  1UE9 A;  1OPL A;  1U06 A;  4DEY A;  2GTJ A;  4ESR A;  2RMO A;  1W70 A;  2LQW A;  2D8H A;  2IIM A;  2GTO A;  2DBM A;  2OAW A;  1WI7 A;  1X43 A;  1ZLM A;  2DBK A;  1TUC A;  1T3L A;  1NG2 A;  2XMF A;  2DRK A;  1G83 A;  1NYF A;  3H0H A;  1JXM A;  2RPN A;  3LH5 A;  3NMZ C;  1PRL C;  4D8K A;  3M0T A;  2FO0 A;  3H0I A;  4AFZ C;  1B07 A;  2G6F X;  2LMJ A;  3REA B;  2YT6 A;  2C0T A;  4Y92 A;  1E6H A;  4AFQ C;  3M0P A;  2YUO A;  2KT1 A;  2F2X A;  2YUP A;  1ABO A;  2JM8 A;  2OJ2 A;  3TVT A;  1E6G A;  2DX1 A;  1WFW A;  1G2B A;  2CRE A;  1WLP B;  1GRI A;  1RI9 A;  3I5R A;  1GBQ A;  4LUE A;  2J05 A;  2ED0 A;  3SEM A;  2A36 A;  4E6R A;  4J9C A;  2C0I A;  1T3S A;  1K0X A;  4OMM A;  4F14 A;  1A0N B;  4J9D A;  1BBZ A;  2EVR A;  4LE9 A;  4LNP A;  2K9G A;  2FEI A;  2L3P A;  3A98 A;  4Z8A A;  4ORZ A;  2LNH B;  1I07 A;  2E5K A;  1UJ0 A;  5I22 A;  1GCQ A;  2SRC A;  2CDT A;  1W1F A;  2FPF A;  3SHW A;  2DL7 A;  1BU1 A;  2ESW A;  4Z88 A;  1ARK A;  1AWO A;  1OPK A;  1X2Q A;  2DE0 X;  1GCP A;  2PNI A;  1K9A A;  5HCK A;  2KYB A;  2DM1 A;  1CKA A;  4OMO A;  3VS4 A;  2ROL A;  4RTU A;  3H0F A;  1UJY A;  2CH4 A;  4X1V A;  2ECZ A;  1PHT A;  2AZV A;  4HVW A;  1CSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...