2VVKA

Grb2 sh3c (1)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
b'GSVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
publication title Distinct Binding Modes of Two Epitopes in Gab2 that Interact with the Sh3C Domain of Grb2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2vvkA00
2HDAA 2BZ8A 3M0TA 1UECA 4OMLA 2EW3A 2J06A 1U3OA 1X2KA 5I11A 1AWXA 1UG1A 4J9HA 1RI9A 2K7AA 3NPFA 2AKKA 2KYMA 1OPKA 1PNJA 2EPDA 4KRTA 1V1CA 1ZX6A 1WXTA 1IO6A 2B86A 4LUDA 2KEAA 2CT4A 3RBBB 1BK2A 4JJDA 2ABLA 1GCPA 2LQWA 2DL5A 4RTXA 4HCKA 2K6DA 4GLMA 4CC7A 1X69A 1Y57A 2FO0A 2KRMA 4HVUA 2RQTA 3M0QA 1QLYA 3NMZC 2NWMA 4JZ4A 4AFUC 2FPEA 2L3QA 4RTUA 3TSZA 2ECZA 1X6GA 2KXCA 2A36A 1H92A 4J9GA 3VS6A 3TSWA 3VRZA 1QWFA 2KRNA 1I0CA 2DBMA 4AFZC 4CC2A 1SRLA 1WXBA 1UE9A 3EG1A 4AFSC 2L0AA 3M0SA 5IXFA 1K0XA 2CSQA 2VVKA 1BU1A 1BBZA 2DBKA 1UJYA 1JU5C 1NM7A 3NGPA 1WI7A 2YUOA 4JJBA 4JZ3A 4Z89A 4D8DA 2LJ0A 1Y0MA 2A37A 2DMOA 3VS7A 1X6BA 1WDXA 2RF0A 2CUBA 4J9DA 2HSPA 1JQQA 5ECAA 1ABOA 1TUDA 3I9QA 1YP5A 1BB9A 2DL4A 2BZXA 1NLPC 3VS5A 2RQUA 2O31A 2LJ1A 2G6FX 1YWOA 1PKSA 3UA7A 2OI3A 1ZBJA 2LX7A 1T3LA 1SHGA 3M0RA 2JXBA 1RLPC 1S1NA 1HJDA 2YT6A 1TUCA 1WFWA 4FSSA 1X43A 1M8MA 4HVWA 2BZYA 3H0FA 3I5RA 2DA9A 2KR3A 1B3QA 1UHFA 4A63B 2C0OA 2EGAA 1AZEA 2KT1A 4HVVA 3SHWA 2RN8A 2FPDA 1HD3A 1PHTA 2KRSA 1VYVA 2DX1A 4ZNXA 1ZLMA 1M3BA 2YSQA 3VS0A 5I22A 1E6GA 2GTJA 1FYNA 2LZ6B 3U23A 2HBWA 3VRYA 1VYUA 5GJWB 2KNBB 3JV3A 2KGTA 3UA6A 1PWTA 1M30A 2PTKA 2AZSA 3H0HA 1PRLC 4RTYA 2MCNA 2DNUA 1HSQA 2EQIA 1K9AA 2V1QA 4LNPA 1NG2A 1SSHA 3A98A 4DEYA 1AEYA 2K9GA 4J9IA 2L2PA 4IIMA 2NUZA 1SEMA 2RPNA 1OEBA 2ED1A 1PKTA 3PVLA 1A0NB 3M0PA 2EVRA 1J3TA 1NYFA 2DLPA 2W10A 2ESWA 2DILA 1I07A 4AFQC 1UGVA 3PE0A 4J9CA 1N5ZA 1VYTA 4EIKA 1UUEA 1ABQA 3I5SA 2L3SA 1U06A 1NEBA 2J7IA 1KIKA 3RNJA 5IH2A 1UJ0A 4LUEA 2EBPA 2DRMA 1XOVA 2EKHA 2CH4W 2LNHB 2YDLA 2PNIA 1UDLA 1WIEA 4F14A 2ROLA 4RTVA 4J9FA 2DL3A 2JS0A 2EYWA 2A08A 1FMKA 4RTWA 1QKWA 2DM1A 2J6FA 3NHNA 3REBB 2D8HA 1OPLA 1K0SA 2MOXA 2KBTA 1EFNA 2X3WD 1GRIA 2DF6A 1ZSGA 3REAB 2GBQA 1AWJA 4K11A 2JM9A 4CC4B 1YWPA 2W0ZA 2O9SA 3FJ5A 4OMPA 5IHNA 3EHQA 1G2BA 4D8KA 2EYZA 2RMOA 2VKNA 2KT8A 3UATA 3EGUA 1VA7A 2GTOA 5GJVB 3LH5A 2SEMA 2D1XA 2JS2A 2EGEA 1E7OA 2JT4A 1JEGA 1W6XA 2GGRA 2CH4A 1NLOC 2JMAA 2E5KA 1ZUYA 5IXBA 1MV0B 2DL7A 1UTIA 1KJWA 1H3HA 1JXOA 2CREA 1UFFA 2DE0X 1SRMA 3SEMA 3UF4A 1KSWA 2AK5A 4OMMA 1SHFA 3VS3A 2ED0A 2PZ1A 1GFCA 5IHIA 1MV3A 2GQIA 3THKA 1I1JA 1W1FA 1CSKA 3C0CA 3VS4A 1WXUA 4J9BA 4OMNA 1T0JA 5FW9A 1GCQA 2L3PA 1QKXA 2FEIA 1YNZA 5IHKA 2F2WA 1RLQC 2GNCA 2V1RA 2MIOA 2EYYA 4J9EA 3H0IA 1QWEA 3O5ZA 1OV3A 1CKAA 2FRYA 1JXMA 3EG3A 3KFVA 4HXJA 2DL8A 4ESRA 2CT3A 1QCFA 2I0NA 3ULRB 2QDLA 1U5SA 2A28A 3PVQA 1X27A 2LCSA 1G83A 1WA7A 2J6KA 1UHCA 2HEQA 3EG0A 1GBQA 1H8KA 3TVTA 2RNAA 1AZGB 1ZUUA 4RTTA 3GBQA 3I35A 4QT7A 2IIMA 1T3SA 1W70A 2LP5A 1WLPB 2O2OA 2H8HA 1B07A 2DVJA 2LQNA 1NYGA 4IIOA 1M3CA 1ZUKA 4JJCA 2J6OA 2LMJA 1GCQC 1RUWA 2JMCA 2YUQA 2JM8A 3VS1A 2M0YA 4M4ZA 5EC7A 2K79A 2JW4A 1K4US 1Z9QA 1AWWA 4RUGA 2SRCA 4GBQA 2EGCA 4DEXA 2CSIA 1GFDA 2DRKA 2AKLA 4CC3A 2FG0A 3M0UA 5L23A 1GL5A 1KFZA 2J05A 1LCKA 2JTEA 4X1VA 2CDTA 4JPBW 2LJ3A 2RQRA 2VWFA 3EG2A 2ROTA 2YUNA 3IQLA 4Z88A 1YCSB 4LN2A 1YN8A 2X3XD 2P4RA 4AG2C 2FPFA 1M27C 2RQWA 2KE9A 3R6NA 2M51A 2DJQA 5HCKA 4F17A 1CKBA 5FWCA 1OOTA 1WYXA 4LE9A 1Z9ZA 2D0NA 1MUZA 2KXDA 2D8JA 2K2MA 2K3BA 4E6RA 1ARKA 2FRWA 3VS2A 2KROA 1WX6A 2HCKA 2F2VA 2RQVA 4F16A 1T0HA 3CQTA 1GBRA 5FWBA 1X2QA 3ZL7C 1NEGA 3QWXX 1M3AA 1E6HA 2BTTA 4R0KA 2ENMA 2C0TA 2OAWA 2DYBA 1TG0A 4RTZA 2OJ2A 1AD5A 2KYBA 2XMFA 4OMQA 2AZVA 4ORZA 1K76A 3QWYA 1AVZC 4AG1C 4Y92A 2CUDA 2YUPA 2C0IA 1K1ZA 3H41A 2O9VA 2EYXA 1JO8A 4OMOA 1SPKA 4Z8AA 1PRMC 2F2XA 2O88A 1AWOA 3EHRA 1AOJA 4WCIA
chains in the Genus database with same CATH superfamily
3OW2A 1YFNA 1M4ZA 3OYBA 4KGVB 3FJPA 2J06A 1X2KA 5I11A 3JCMW 4J9HA 1RI9A 3V8JA 5FU7B 1YITT 4JS5A 1IO6A 2DEUA 2CT4A 2QQ9A 3QKJA 3RBBB 5LJ3h 3ER0A 1VQ7A 1IXDA 1YI2A 4RTXA 5CAIA 4GLMA 3KBGA 1Y57A 1FMWA 2KRMA 2JTMA 1RI0A 3NMZC 1MMDA 3EGDB 1IGQA 1PG5B 5KCHA 4OGCA 3MPUB 5KYXA 1Q86R 1X6GA 2KXCA 1YBYA 1H92A 4E7LA 1I4K1 4M78G 3VRZA 4PLIA 1VQ9Q 2DBMA 1WXBA 1UE9A 2BKDN 4AFSC 1K0XA 3QO3A 4Y28E 2QGFB 1BU1A 1BBZA 1NM7A 3VU3C 3HP9A 1VQNQ 2P4TA 1K8AC 2P0KA 4MZMA 1D0YA 1Y0MA 2A37A 3VS7A 4PJOD 2BE7D 4FT4A 4B9XA 2Y4XA 1WDXA 1N8RU 5FRMA 1VQ5A 1WHJA 4M77F 5AT1B 1NJIC 2OTLA 1YP5A 4XTYA 5DY9A 3VS5A 4KH1B 4C5GA 4PFZA 2RQUA 4QKUA 4E7JA 4CI0C 3OYHA 3M5AA 1PKSA 2OI3A 4X9DA 3S3OA 1YHQT 1ZBJA 1T3LA 3V8LA 1SHGA 4EDUA 2CP0A 2LT4A 3CCEQ 4UC4A 1TUCA 1WFWA 2YXYA 5KYUA 3I5RA 4C92E 2DA9A 1B3QA 3M54A 3JAME 1HK9A 1UHFA 4NOYA 2C0OA 3AHUA 5FROA 1D1AA 3OS5A 1R0BG 3GF5A 1Q81R 4J7FA 2KRSA 2DXCA 1KC8U 1ZLMA 4BDYA 3KXTA 2M02A 3QUIA 3UPUA 1E6GA 5AYFA 3OSVA 8AT1B 2E5QA 2MF2A 2HBWA 1YIJT 3EAEA 3NFCA 3BY7A 9ATCB 2CYZB 1TU0B 5GAMg 3GNGA 2RHZA 4M78F 3V7CA 4M75B 4FL6A 1PWTA 1M30A 3BW1A 2AZSA 2LTOA 3CBPA 2LT1A 4HCZA 4RCBA 3VYGA 2LCLA 2YLBA 3QHSA 4LXCA 2QEXA 1Q82C 1BIAA 2PVGB 4LNPA 3JCMJ 2KDSA 2VUBA 2K9GA 2L2PA 2OTJQ 3V7SA 2M0OA 4BE2A 3EFSA 1XQHA 3PT9A 2A0FB 4A4EA 5KYXB 2R5MA 3FIFA 3LGLA 4IUUA 5GAOq 2DILA 3EG9B 1I07A 4FYWB 5GMKi 3SB2A 2CP5A 2DETA 3H6ZA 3L2RA 1N5ZA 4C8QA 1UUEA 1ABQA 2HQHA 1D1CA 2J7IA 2X51A 1UJ0A 3S3MA 1OYXA 3CEYA 1XOVA 2CH4W 2YDLA 3FLGA 1RL2A 4BI4A 3JB9G 1QCOA 4OF1A 2DPPB 5GAMh 3CCMT 1VQOT 5GAMf 2MYSA 2AHJB 1FMKA 2H3JA 5GAN6 3REBB 2WSCE 5D7UA 1K0SA 1Y96B 4ZN3A 4C5EA 1GRIA 4WF2A 2F69A 2GBQA 2D6FA 4K11A 1MMAA 3RESA 4IUTA 1N9RA 3QDFA 3CC2Q 1S72T 4D8KA 2EYZA 2RMOA 3QYHB 4OB1B 1VA7A 4C8QC 3X20B 2BIVA 2O4XA 3CCQA 2JS2A 3CBOA 2JT4A 4EPCA 2ATCB 4DOWA 2Y90A 1NLOC 3HFNA 2JMAA 3OYKA 1YIJA 2I2LA 1UGQB 1WPYA 1ZUYA 2RHUA 1MV0B 3S3NA 3MEAA 3ZBDA 1TH7A 4C5IA 4QW2A 2LX9A 4QVDA 1UFFA 3QZ5B 2YWWA 4BACA 2C06A 1LOJA 4M75E 2AK5A 2KY9A 4IKFA 3VS3A 5KYWB 3HL8A 2QXFA 1TTHB 5FU6C 4VUBA 1MV3A 1SSFA 1YJWA 3A8GB 1VQ6Q 4BE1A 1CSKA 2R58A 2RI5A 2EJFA 3JB9J 4J9BA 3HSBA 4JRPA 2QA4T 5FW9A 5I2MA 1GCQA 2JNGA 2V26A 4IURA 2DTHA 2YHTA 2PU9B 1OX8A 2E3HA 2GNCA 1G3YA 3H0IA 4M7DG 5GANj 4KGXB 2A7YA 3KFVA 2CT3A 2I0NA 1QW1A 1AT1B 3A8OB 2E65A 5LJ5d 2E6ZA 2MAMA 1G83A 1WA7A 1YCYA 4OB0B 3RUXA 2NUPA 3EG0A 2RK2A 5FRNA 2COYA 2ZPHB 3CCRQ 4RTTA 2DJZA 3NTKA 3CCMA 2LP5A 2O2OA 2F1LA 4ME7A 1ZA1B 3EGXA 5GMKl 2J6OA 4ZGEB 1GCQC 3G4ST 1RUWA 2RI2A 2YUQA 3PMTA 2R57A 4QQGA 4KULA 1Q7YC 2M0YA 2R5AA 3CCJQ 3AT1B 3OW2P 4XU2A 4RCCA 3TEEA 2QQAA 4DEXA 3CC7Q 3URGA 3L1AA 1M2VA 4N0AA 1RAEB 1QVFS 1IRXA 4C8QD 4CC3A 3M0UA 5L23A 2LVMA 2JTEA 1KQSP 5IN1A 4A4KA 3OMCA 2LJ3A 4JPBW 4AMCA 4LDWA 1KG1A 2YUNA 1KD1U 2DTIA 4LN2A 1UGRB 2X3XD 3OS0A 1WNLA 4XK8E 1M27C 2DJQA 4Z02A 2QQRA 2O4XB 4M77A 3M55A 3TCJA 5GAN7 4LE9A 5C6SA 4L6V5 2K2MA 2KQWA 1JJ2S 4E6RA 2JUFA 2QDYB 2P0PA 4A54A 4M7DF 1G8XA 3PIOA 2HCKA 5HK0A 4F16A 3L42A 3CC4T 4M7AB 1T0HA 1G3WA 4N0AC 1MMNA 4OP0A 1X2QA 3QPHA 2HQEA 1E6HA 2DKGA 2ENMA 2OAWA 2HBPA 3X28B 2L8DA 3I55A 2OJ2A 5EG2A 2XMFA 2DIQA 5I2SA 5KCOA 3QWYA 4DBQA 4PK4A 1VQ8T 5CQYA 1K1ZA 3H41A 1M90C 2O01E 4KH0B 5KYYB 1M1FA 1PRMC 2VXFA 5C0MA 4M77C 2BZ8A 2LC4A 4ZGJB 1UECA 2X4XA 3CCSQ 4OGEA 1AWXA 1UG1A 2EQKA 5KYNA 3NPFA 3CMET 3CCVT 2FYKA 3QBYA 3QYGB 1QQJA 3CCUA 4XTUA 4M78A 2CS7A 1BK2A 4JJDA 3RKXA 4LDXA 3OYMA 8ATCB 3OYYA 5KE3A 2DL5A 5DLQE 1WHGA 2K3XA 4RMOA 2EYQA 2BUDA 1I5OB 2JOYA 2PUKB 4HVUA 4JZ4A 1KHIA 2F5KA 3QXEB 1VQLA 2L3QA 4XTXA 3TSZA 3CD6A 3RR6A 5CKBA 3T9NA 3SWNA 3TREA 4C0DC 1I0CA 3E2UA 4CC2A 3SFMA 3N5BB 1D3BB 2YRVA 3M0SA 5IXFA 1M2VB 4N4HA 4YTLA 4DOVA 3JCMe 4JJBA 4M78C 5D6WA 1KQ2A 4XQ3A 4Z89A 3GPLA 2LJ0A 4HT9A 2DMOA 2ZPEB 3A8LB 1VQPA 2RF0A 4J9DA 4ZTFA 1M1KR 1TUDA 3MHXA 4M7AE 1NLPC 3OQ5A 4ELYC 4L59A 4XU3A 3INZA 3DLMA 5LL6S 2LX7A 4FM4B 1EIFA 1G3TA 3SWNC 1VQKA 3PFSA 3LGFA 1Y07A 4EMKA 3GOXA 4FYYB 4QQDA 3CCLA 1VQ9T 2CKKA 2DK3A 2QASA 4FSSA 1VQ4T 1M8MA 2CZ6B 3H0FA 3MCAB 3G71Q 2DD4A 2KR3A 1IHWA 1WZOA 4FW1A 1VQNT 2NYSA 2X9HA 1AZEA 2ZPFB 2XG8D 4M77G 1D0ZA 3I56T 3RKYA 4IUQA 3G6EA 1K9MR 4HVVA 1KC8C 3CCVA 1PHTA 3CMAQ 1K73R 1WHMA 4FCYA 4XTVA 3VS0A 5I22A 2GTJA 3UT1A 1FYNA 1NPPA 2HKNA 2P84A 3D7SB 1BKBA 3CCET 4EMKC 4D6WA 2KGTA 5GAOn 3UA6A 1KQSA 4DQ2A 4RTYA 2MCNA 1W2BS 2RB6A 1VQ7Q 4E7ZA 1YI2Q 1NG2A 4J6XA 1SSHA 5A0GA 3A98A 1X75C 1WJQA 4RG2A 3CPWS 4J9IA 1XNIA 4MMLA 2NUTA 4C0GA 2RHXA 1YJ9A 4A53A 1OEBA 1VQMA 4R56A 4M78D 4C92G 1NYFA 4ELZC 3DB4A 4QQ6A 3LH0A 4PJOB 3WVEB 2RJDA 1UGVA 3PE0A 1JB0E 1VYTA 2RK1A 4EIKA 1R0CB 3I5SA 2LQKA 1B34A 2L3SA 1U06A 1NEBA 4GY5A 5GAN5 3RNJA 4LUEA 2EKHA 2PNIA 1UDLA 4RTVA 1YJNA 1VQ5Q 5LJ3e 2OTLQ 1VQ9A 2EYWA 1OQKA 4RTWA 1VQ4A 1QKWA 3NHNA 5L8RE 2OTJT 1OPLA 2ZPBB 4LDYA 2EWNA 3P8HA 1IGUA 2X3WD 2DF6A 1ZSGA 3REAB 4XU0A 1K8AR 1FMVA 3I56A 2JN0A 1UEBA 1QVFA 3TU4K 3LH5A 1WGSA 2SEMA 3EFOB 1NJIR 1E7OA 1JEGA 2M16A 5GMKe 1W2BP 3WXMB 2XU8A 2CH4A 3PIPA 4Q5WA 4F7UB 1RADB 1C6VX 2DL7A 1G3SA 3M56A 2JJ9A 3EFRA 1YITA 4J8OA 1K73U 4M7DA 2QAZA 3MO8A 4C5HA 3CBMA 4MZTA 1JJ2A 2E41A 2VASA 2GQIA 3ZFJA 3THKA 1I1JA 1W1FA 5LJ5j 4C92F 3CC2T 1T0JA 2L3PA 1OI1A 2G3RA 1RLQC 1RAIB 2V1RA 2BE9B 4E7IA 2QEXQ 1QWEA 1OV3A 4XTWA 5IAYA 4PJOE 1QCFA 3ULRB 5LJ3j 2WACA 2LCSA 2PQWA 1LNXA 1V76A 4M7DC 1UHCA 1Q86U 1GBQA 1H8KA 1H3ZA 4V2SA 1IZ6A 3RERA 1BI1A 2IIMA 1W70A 4XAXB 5GAOl 1Q82R 1QMCA 1B07A 2L89A 2DVJA 1VQ6T 2E10A 2LQNA 1WQ7A 2KSSA 3RMQA 4E2FB 2NLUA 1ZUKA 4JJCA 5GANe 2CZ7B 3JB9D 4M75G 3VKIA 2JM8A 3VS1A 1YHQA 3QDRB 1U8RA 2RJFA 1GXIE 2ZPIB 5GMKj 4RUGA 2SRCA 1LJOA 4GBQA 5HKCA 2EQUA 4PL6A 2JTFA 1ZSZA 2FL7A 4FW2A 4C0ZA 4ATOA 2FG0A 1KFZA 1TWBA 1KD1C 1M8VA 4R55A 3VJPA 1YCSB 3CCRT 4F7UE 4EMHA 1G5VA 2RJCA 2P4RA 1BCMA 3OBYA 2K5FA 2FPFA 3GP8A 1LPLA 1TS9A 1O75A 3CCQQ 3PGGA 1NJIU 3A5ZB 2EQMA 5KYUB 2MPXC 1MUZA 2K5IA 3M53A 2KXDA 1YIJQ 2K3BA 1ARKA 1Q81U 3VS2A 3CCJT 2KROA 1W4SA 4FYXB 1TUGB 3CC7T 2ZGWA 1ZSZC 5GAMe 3JCMP 3ZL7C 1NEGA 2BTTA 1OX9A 2MMPA 1PCXA 2DYBA 4X9CA 2XD0A 1YJWQ 4ORZA 1WHKA 1O9SA 2X35A 1AVZC 4AG1C 4Y92A 3WVDB 4P5NA 2EYXA 4OMOA 1X6OA 4M7DD 1AWOA 4B9WA 3EHRA 1AOJA 2HDAA 3M0TA 3M4GA 2PVOB 4M75F 4PFPA 5J39A 2E64A 2K7AA 3NTHA 2AKKA 2KYMA 1PNJA 4KRTA 1WHLA 1V1CA 1WXTA 2EQJA 2B86A 2KEAA 4CRIA 3NTIA 2ABLA 1ACMB 2LNVA 1GCPA 2LQWA 4KBMB 2IG0A 1KQ1A 4HCKA 1Q82U 2K6DA 1VQOA 3M58A 3TQ7P 3OYEA 4BD3A 4C8QB 1QLYA 3FDRA 1VOMA 2H3EB 4L5GA 1W2BA 5D6YA 2FPEA 3MEUA 1BCOA 5GAOm 1X01A 4J9GA 2GF7A 3VS6A 3TSWA 1I5LA 3CPFA 2KRNA 1S72A 4AFZC 3CPWA 3QSUA 3EG1A 5J3BA 3A8HB 3X25B 3DLLA 4BY6C 4QVCA 3CCST 4JJNK 2CSQA 2VVKA 3CXCS 2QTXA 2DBKA 2XHCA 3OBWA 3QZ9B 4II1A 4XU1A 3UWNA 4JZ3A 5GAMj 5FU6B 5CO7A 1Q7YR 1X6BA 1ZBXA 3OSSC 2HSPA 1JQQA 5ECAA 3I9QA 2FZKB 5FLXE 2DL4A 2EKOA 1QCNA 1BI2A 4KGZB 2G6FX 2K2VA 3OYIA 4LD6A 1RAHB 3LYIA 3M0RA 2JXBA 1RLPC 1HJDA 1NE8A 3OS1A 3V8KA 5DLOA 2QA4A 1X43A 3FRNA 4HVWA 4PJJA 3L2ZA 3OS2A 4N4GA 2A3LA 4A63B 3I55Q 1IB8A 1PC0A 4J83A 2Z0WA 5GAOp 4PLLA 4KUIA 2KT1A 2D0QB 1I81A 3HRUA 2RD1A 3SHWA 2CP2A 2RN8A 1HD3A 1MGQA 1WJRA 2MWPA 2X4YA 4ZNXA 1QVGS 3MEVA 1M3BA 4OB3B 2DXTA 5D6XA 4JRKA 4FSXA 1ZQ1A 2KNBB 3ASKA 4C92A 4C8QE 3G4SA 3CCUQ 1QVFP 2PTKA 3H0HA 1M90R 4M7AG 1PRLC 1OULA 3G71T 2DNUA 3P8DA 4IUVA 2NUPB 1HSQA 2EQIA 1K9AA 3ME9A 2V1QA 4FU6A 4DEYA 4LDUA 4X34A 3EGXB 4OB2B 1SEMA 3CMAT 3OY9A 1VQLQ 1LVKA 1Q95G 3CD6Q 2XI9A 2ED1A 3FEOA 1PKTA 3PVLA 5GMKm 1J3TA 5CQXA 2ESWA 1JJ2P 1WHHA 4J9CA 3JCMQ 3JCMX 1PSEA 5CIUA 3C94A 3L2WA 4NL3A 1KIKA 4C92C 2EBPA 2LNHB 5CVIA 1RACB 1WIEA 2AT1B 3HHTB 4ZGDB 1N8RC 3A8MB 2ROLA 1VQPQ 3EH2A 1EZZB 1VQ7T 2QK0A 1YI2T 3OB9A 2KI7A 1MMGA 3CC4A 3E19A 2QG9B 3JB9I 5FU7C 1QP3A 2EAYA 2DM1A 1OZ2A 2D8HA 2KBTA 2X4JA 4M77B 1AWJA 2F5TX 4WTOB 1VQKQ 3FJ5A 4OMPA 2CGHA 3EHQA 3CCLQ 1VQ8A 4J5YA 2VKNA 2HAXA 3VUBA 3EGUA 1M1GA 2D1XA 2XDPA 2EGEA 1C1AA 2VB6A 4M77D 1W6XA 3OA6A 3QJYA 2GGRA 4OVAA 4M7AF 2FB7A 3C12A 1D1BA 3G6EQ 3L2VA 3CCVQ 2DO3A 3CMEA 3HRTA 1H3HA 1JXOA 3MP8A 2CREA 2DE0X 1SRMA 3UF4A 3P8BB 4OMMA 2ED0A 4A4FA 3RDVA 2D9TA 3QIIA 2KVQG 1GFCA 2PZ1A 5IHIA 4C0DB 4MMKA 3J7AF 2DD5A 3C0CA 3PNWC 2CZ1B 3VS4A 1QVPA 2RJEA 1MHNA 6AT1B 1HXDA 1QKXA 1KC8R 1M90U 4BB7A 2MIOA 2EYYA 4M78B 4J9EA 3E9FA 1CKAA 1PD1A 2FRYA 3EG3A 2DIGA 2COWA 4HXJA 4JDSA 2IPOB 2A28A 4M75A 1YJ9Q 3PVQA 1VQMQ 1Q86C 1Y7XA 4C92D 1TOVA 3O8VA 2J6KA 4A4HA 2HEQA 2HKQB 5LJ5e 3TVTA 2RNAA 1AZGB 1ZUUA 5LJ3f 1OU9A 3I35A 4QT7A 3SWNB 1T3SA 2EIFA 3C95A 1WLPB 2H8HA 2WSEE 1RAFB 3QJ6A 1NYGA 4IIOA 1M3CA 2E12A 4HA8A 2LMJA 3PTAA 4GLKA 4KT0E 2P0QA 2V8KA 1ZHIA 4M77E 2KMTA 2V8IA 5HY6A 1C0MA 4BUGA 4M4ZA 5EC7A 1YJNQ 2JW4A 3EG9A 2QEXT 4FIBA 2QQBA 2EGCA 1M1KU 4HKEA 2CSIA 1VQ4Q 2DFUA 2RA2A 1GFDA 3VV0A 5GMKh 1PM3A 4M75C 2DRKA 4XTZA 1QP2A 3M4YA 2J05A 4EMGA 1VQNA 2CDTA 1WQWA 2RQRA 3EG2A 3IQLA 3I56Q 2E3IA 2DEQA 5IT9E 1U1SA 5KH6A 4LD9K 4EMKB 4PJOG 2RQWA 5GANg 3CXCA 2M51A 2DAQA 4F17A 1Y96A 1CKBA 5FWCA 3A1PA 1OOTA 1WYXA 3M59A 5GAN8 2JZ2A 3L2UA 2D8JA 1Q81C 2DVEA 1K9MU 2FRWA 1WJSA 4F04B 1WX6A 4JS4A 3CCEA 2F2VA 1YITQ 3CPWP 1I8FA 4PJLA 2X4WA 2PVDB 1M3AA 1BYMA 3RIRA 3OYNA 1EX4A 4M78E 1TG0A 1DJ7B 4RTZA 1B7TA 2KYBA 4OMQA 2AZVA 5GAN2 1FX7A 3R6OA 2YLCA 1RABB 1Y71A 4AT1B 2CUDA 2YUPA 2C0IA 4JRQA 2O9VA 2HL3A 3H8ZA 3OYFA 1TXQA 3JCMb 1F1BB 3CCQT 4Z8AA 5KYWA 1KHCA 2F2XA 1GL5A 3RMSA 1AHJB 2Y4YA 4OMLA 4ZTJA 4MDWA 2EW3A 1U3OA 4F7UG 5GANh 4J7IA 4JRIA 3HKSA 5GANf 1QVGA 2FZGB 1OPKA 2EPDA 2NUTB 2L5QA 1VIFA 1ZX6A 5J26A 4LUDA 2HNIA 5A0LA 1NZ9A 1JRIA 3EH1A 3GNFB 2L3RA 1M5Q1 1ZA2B 1YJWT 4CC7A 1X69A 2FO0A 2K3YA 4NL2A 3JB9H 5CKDA 2RQTA 3M0QA 2OTJA 1B34B 4M75D 2NWMA 4PJOF 4AFUC 4B6MA 5CK9A 4OMFB 4RTUA 1YHQQ 2ECZA 3G7ZA 2QTVA 2A36A 2PUOB 2VYTA 1QWFA 2M9UA 3BFMA 1SRLA 2RH2A 2L0AA 4DA4A 2E70A 1UGSB 4PFOA 2K4YA 3JCMd 1BIBA 1UJYA 1JU5C 4JLIA 3NGPA 1WI7A 2YUOA 1K8AU 3MJXA 4D8DA 2XDDA 2FVUA 4RKUE 2VC8A 2CUBA 4ANJA 1ABOA 1BB9A 3FB9A 1XJWB 2BZXA 4MZPA 2O31A 2LJ1A 3VYHB 3X24B 1YWOA 3UA7A 3PMIA 3OMGA 1KD1R 1S1NA 2YT6A 3CC2A 1R8OB 5CKEA 2LDMA 3JCMc 2ZZDA 4F7UF 2BZYA 5GAN4 4M7DB 2CP3A 3RKWA 2DTOA 2EGAA 3OW2S 1RAAB 4E47A 2ZAEA 5GAN3 1KK7A 7AT1B 2LRQA 2XKOC 2KAFA 3JCMV 3S6WA 2FPDA 1XTDA 4M7AA 2GFUA 1VYVA 2DX1A 1IHVA 1BI3A 2E1HA 2YSQA 5CKHA 1D0XA 1KQSS 4HCBA 1FWZA 2LZ6B 1BI0A 1NPRA 3U23A 3VRYA 2VXEA 2YRDA 4E7HA 1VYUA 2HD0A 5GJWB 1VQ6A 3J81E 3JV3A 1U1TA 3MEWA 5KYYA 4DBHA 4BI8B 5DM7R 4NS5A 2DZCA 2QYZA 2JVVA 3I55T 3CCMQ 1VQOQ 1VIEA 2GQVA 3M9QA 3JB9F 1VUBA 1AEYA 3H9NA 4IIMA 4M7AC 2HL5C 4TVRA 3V7RA 5M9OA 1TSFA 2NUZA 2RPNA 2HSEB 3E9GA 5A0DA 3JSCA 3MP1A 2FHDA 4FT2A 1A0NB 3M0PA 2EVRA 2HQXA 2DLPA 3LWHA 2W10A 3CCRA 1S72Q 4HT8A 4AFQC 1MNDA 1FXXA 3OYLA 5CR2A 1RAGB 2K57A 2OAUA 1ZSZB 2VGMA 5IH2A 1D09B 3CCUT 5I21A 2DRMA 2RHIA 5KE2A 4C0FA 2M1HA 5LJ3d 4F14A 4J9FA 3CCJA 3DB3A 2DL3A 3MP6A 1D3BA 2RI3A 3META 2JS0A 2QQSA 2HMAA 1OZ3A 5HK3A 2A08A 3CC7A 1V29B 4IUPA 2XICA 2J6FA 2DERA 3HPWA 4O6JA 2MOXA 4M7DE 3OYDA 4C8QG 1EFNA 2DXBA 1VQLT 3F70A 3CD6T 2JM9A 3HFOA 4CC4B 1YWPA 2W0ZA 2O9SA 1MNEA 5IHNA 1G2BA 2OX7A 1R77A 2KT8A 3UATA 2QA4Q 2K5LA 1N9SA 2GTOA 5GJVB 3JCMg 3L2QA 4A4GA 2E4HA 2B8AA 3VUZA 1JBMA 3GLXA 1PSFA 2RHYA 2E5KA 3BE3A 5IXBA 1VQPT 1UTIA 1KJWA 3BDLA 1NBEB 3LWIA 3SEMA 4KUDK 2RM4A 2WSFE 2QI2A 1KSWA 2QGGA 1SHFA 4PKCC 4LDVA 5A2QE 2LQ8A 4BE0A 1VQKT 3MKDA 3FC3A 3Q1JA 1SF9A 2CP7A 1WXUA 4OMNA 4BY6B 2HZYA 2VV5A 2ZPGB 4DBRA 3CCLT 2MI6A 4PJMA 3G4SQ 4M7AD 4E7SA 2FEIA 3CXCP 2YRCA 1YNZA 5IHKA 2F2WA 1HYOA 4MDXA 3O5ZA 2LCCA 2RO0A 1JXMA 4BDZA 1H641 2DL8A 3J80E 4N4IA 4ESRA 3G6ET 2EJ9A 2EFIA 3JRZA 2AIRB 2CP6A 3CCSA 1N27A 2QDLA 1U5SA 5GAOr 3JCMh 1X27A 3JCMf 3OYJA 4BI3A 3UDCA 3SDZA 4JUVA 3GBQA 4C8QF 2GFAA 4ZN1A 3OYAA 2ZCFB 4PNOA 2DXUA 3QG1A 3OYCA 5GANd 2EJGA 3EGDA 2VGNA 2JMCA 3E1SA 3C4SA 1SG5A 3DKMA 3KUFA 3G1JA 4PJOA 1SKUB 2K79A 1Q7YU 1K4US 1Z9QA 1M1KC 1AWWA 4DBFA 2KK4A 3CC4Q 2XDBA 2MWOA 4QVZA 5LJ5g 2AKLA 1QVGP 4E7KA 1YJ9T 1VQMT 1LCKA 3HTRA 4PJNA 4X1VA 4RG8A 2VWFA 3M57A 4O5VA 1P92A 2ROTA 1UGPB 2E6NA 4Z88A 1YN8A 1VQ8Q 1OU8A 3LX7A 1PD0A 2IVWA 1N8RR 2V8JA 4AG2C 2KE9A 3R6NA 2DYIA 5HCKA 3OYGA 4Y91A 2GCXA 1Z9ZA 2D0NA 1N6AA 3SD4A 3HRSA 3X26B 1K9MC 5LJ3g 2DZ9A 2COZA 3LLRA 2CZ0B 4PJOC 1YJNT 3ZEHA 3CMEQ 3GIBA 5GAMd 1VQ5T 3LW5E 4FYVB 2RQVA 4HCCA 1K73C 2OTLT 1IREB 5CKFA 3CQTA 1GBRA 3EFOA 5FWBA 2FZCB 3QWXX 3G71A 4R0KA 2XIDA 2C0TA 2MK5A 1M9SA 1UB4A 4F7UA 1AD5A 1K76A 1M2OA 2XK0A 4J6WA 5LJ5h 1JO8A 3CMAA 5LJ5f 4C92B 1SPKA 4JLGA 4J6YA 2O88A 3BDUA 5CCAA 4WCIA
chains in the Genus database with same CATH topology
2HDAA 2BZ8A 3M0TA 1UECA 4OMLA 2EW3A 2J06A 1U3OA 1X2KA 5I11A 1AWXA 1UG1A 4J9HA 1RI9A 2K7AA 3NPFA 2AKKA 2KYMA 1OPKA 1PNJA 2EPDA 4KRTA 1V1CA 1ZX6A 1WXTA 1IO6A 2B86A 4LUDA 2KEAA 2CT4A 3RBBB 1BK2A 4JJDA 2ABLA 1GCPA 2LQWA 2DL5A 4RTXA 4HCKA 2K6DA 4GLMA 4CC7A 1X69A 1Y57A 2FO0A 2KRMA 4HVUA 2RQTA 3M0QA 1QLYA 3NMZC 2NWMA 4JZ4A 4AFUC 2FPEA 2L3QA 4RTUA 3TSZA 2ECZA 1X6GA 2KXCA 2A36A 1H92A 4J9GA 3VS6A 3TSWA 3VRZA 1QWFA 2KRNA 1I0CA 2DBMA 4AFZC 4CC2A 1SRLA 1WXBA 1UE9A 3EG1A 4AFSC 2L0AA 3M0SA 5IXFA 1K0XA 2CSQA 2VVKA 1BU1A 1BBZA 2DBKA 1UJYA 1JU5C 1NM7A 3NGPA 1WI7A 2YUOA 4JJBA 4JZ3A 4Z89A 4D8DA 2LJ0A 1Y0MA 2A37A 2DMOA 3VS7A 1X6BA 1WDXA 2RF0A 2CUBA 4J9DA 2HSPA 1JQQA 5ECAA 1ABOA 1TUDA 3I9QA 1YP5A 1BB9A 2DL4A 2BZXA 1NLPC 3VS5A 2RQUA 2O31A 2LJ1A 2G6FX 1YWOA 1PKSA 3UA7A 2OI3A 1ZBJA 2LX7A 1T3LA 1SHGA 3M0RA 2JXBA 1RLPC 1S1NA 1HJDA 2YT6A 1TUCA 1WFWA 4FSSA 1X43A 1M8MA 4HVWA 2BZYA 3H0FA 3I5RA 2DA9A 2KR3A 1B3QA 1UHFA 4A63B 2C0OA 2EGAA 1AZEA 2KT1A 4HVVA 3SHWA 2RN8A 2FPDA 1HD3A 1PHTA 2KRSA 1VYVA 2DX1A 4ZNXA 1ZLMA 1M3BA 2YSQA 3VS0A 5I22A 1E6GA 2GTJA 1FYNA 2LZ6B 3U23A 2HBWA 3VRYA 1VYUA 5GJWB 2KNBB 3JV3A 2KGTA 3UA6A 1PWTA 1M30A 2PTKA 2AZSA 3H0HA 1PRLC 4RTYA 2MCNA 2DNUA 1HSQA 2EQIA 1K9AA 2V1QA 4LNPA 1NG2A 1SSHA 3A98A 4DEYA 1AEYA 2K9GA 4J9IA 2L2PA 4IIMA 2NUZA 1SEMA 2RPNA 1OEBA 2ED1A 1PKTA 3PVLA 1A0NB 3M0PA 2EVRA 1J3TA 1NYFA 2DLPA 2W10A 2ESWA 2DILA 1I07A 4AFQC 1UGVA 3PE0A 4J9CA 1N5ZA 1VYTA 4EIKA 1UUEA 1ABQA 3I5SA 2L3SA 1U06A 1NEBA 2J7IA 1KIKA 3RNJA 5IH2A 1UJ0A 4LUEA 2EBPA 2DRMA 1XOVA 2EKHA 2CH4W 2LNHB 2YDLA 2PNIA 1UDLA 1WIEA 4F14A 2ROLA 4RTVA 4J9FA 2DL3A 2JS0A 2EYWA 2A08A 1FMKA 4RTWA 1QKWA 2DM1A 2J6FA 3NHNA 3REBB 2D8HA 1OPLA 1K0SA 2MOXA 2KBTA 1EFNA 2X3WD 1GRIA 2DF6A 1ZSGA 3REAB 2GBQA 1AWJA 4K11A 2JM9A 4CC4B 1YWPA 2W0ZA 2O9SA 3FJ5A 4OMPA 5IHNA 3EHQA 1G2BA 4D8KA 2EYZA 2RMOA 2VKNA 2KT8A 3UATA 3EGUA 1VA7A 2GTOA 5GJVB 3LH5A 2SEMA 2D1XA 2JS2A 2EGEA 1E7OA 2JT4A 1JEGA 1W6XA 2GGRA 2CH4A 1NLOC 2JMAA 2E5KA 1ZUYA 5IXBA 1MV0B 2DL7A 1UTIA 1KJWA 1H3HA 1JXOA 2CREA 1UFFA 2DE0X 1SRMA 3SEMA 3UF4A 1KSWA 2AK5A 4OMMA 1SHFA 3VS3A 2ED0A 2PZ1A 1GFCA 5IHIA 1MV3A 2GQIA 3THKA 1I1JA 1W1FA 1CSKA 3C0CA 3VS4A 1WXUA 4J9BA 4OMNA 1T0JA 5FW9A 1GCQA 2L3PA 1QKXA 2FEIA 1YNZA 5IHKA 2F2WA 1RLQC 2GNCA 2V1RA 2MIOA 2EYYA 4J9EA 3H0IA 1QWEA 3O5ZA 1OV3A 1CKAA 2FRYA 1JXMA 3EG3A 3KFVA 4HXJA 2DL8A 4ESRA 2CT3A 1QCFA 2I0NA 3ULRB 2QDLA 1U5SA 2A28A 3PVQA 1X27A 2LCSA 1G83A 1WA7A 2J6KA 1UHCA 2HEQA 3EG0A 1GBQA 1H8KA 3TVTA 2RNAA 1AZGB 1ZUUA 4RTTA 3GBQA 3I35A 4QT7A 2IIMA 1T3SA 1W70A 2LP5A 1WLPB 2O2OA 2H8HA 1B07A 2DVJA 2LQNA 1NYGA 4IIOA 1M3CA 1ZUKA 4JJCA 2J6OA 2LMJA 1GCQC 1RUWA 2JMCA 2YUQA 2JM8A 3VS1A 2M0YA 4M4ZA 5EC7A 2K79A 2JW4A 1K4US 1Z9QA 1AWWA 4RUGA 2SRCA 4GBQA 2EGCA 4DEXA 2CSIA 1GFDA 2DRKA 2AKLA 4CC3A 2FG0A 3M0UA 5L23A 1GL5A 1KFZA 2J05A 1LCKA 2JTEA 4X1VA 2CDTA 4JPBW 2LJ3A 2RQRA 2VWFA 3EG2A 2ROTA 2YUNA 3IQLA 4Z88A 1YCSB 4LN2A 1YN8A 2X3XD 2P4RA 4AG2C 2FPFA 1M27C 2RQWA 2KE9A 3R6NA 2M51A 2DJQA 5HCKA 4F17A 1CKBA 5FWCA 1OOTA 1WYXA 4LE9A 1Z9ZA 2D0NA 1MUZA 2KXDA 2D8JA 2K2MA 2K3BA 4E6RA 1ARKA 2FRWA 3VS2A 2KROA 1WX6A 2HCKA 2F2VA 2RQVA 4F16A 1T0HA 3CQTA 1GBRA 5FWBA 1X2QA 3ZL7C 1NEGA 3QWXX 1M3AA 1E6HA 2BTTA 4R0KA 2ENMA 2C0TA 2OAWA 2DYBA 1TG0A 4RTZA 2OJ2A 1AD5A 2KYBA 2XMFA 4OMQA 2AZVA 4ORZA 1K76A 3QWYA 1AVZC 4AG1C 4Y92A 2CUDA 2YUPA 2C0IA 1K1ZA 3H41A 2O9VA 2EYXA 1JO8A 4OMOA 1SPKA 4Z8AA 1PRMC 2F2XA 2O88A 1AWOA 3EHRA 1AOJA 4WCIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDA A;  2BZ8 A;  3M0T A;  1UEC A;  4OML A;  2EW3 A;  2J06 A;  1U3O A;  1X2K A;  5I11 A;  1AWX A;  1UG1 A;  4J9H A;  1RI9 A;  2K7A A;  3NPF A;  2AKK A;  2KYM A;  1OPK A;  1PNJ A;  2EPD A;  4KRT A;  1V1C A;  1ZX6 A;  1WXT A;  1IO6 A;  2B86 A;  4LUD A;  2KEA A;  2CT4 A;  3RBB B;  1BK2 A;  4JJD A;  2ABL A;  1GCP A;  2LQW A;  2DL5 A;  4RTX A;  4HCK A;  2K6D A;  4GLM A;  4CC7 A;  1X69 A;  1Y57 A;  2FO0 A;  2KRM A;  4HVU A;  2RQT A;  3M0Q A;  1QLY A;  3NMZ C;  2NWM A;  4JZ4 A;  4AFU C;  2FPE A;  2L3Q A;  4RTU A;  3TSZ A;  2ECZ A;  1X6G A;  2KXC A;  2A36 A;  1H92 A;  4J9G A;  3VS6 A;  3TSW A;  3VRZ A;  1QWF A;  2KRN A;  1I0C A;  2DBM A;  4AFZ C;  4CC2 A;  1SRL A;  1WXB A;  1UE9 A;  3EG1 A;  4AFS C;  2L0A A;  3M0S A;  5IXF A;  1K0X A;  2CSQ A;  2VVK A;  1BU1 A;  1BBZ A;  2DBK A;  1UJY A;  1JU5 C;  1NM7 A;  3NGP A;  1WI7 A;  2YUO A;  4JJB A;  4JZ3 A;  4Z89 A;  4D8D A;  2LJ0 A;  1Y0M A;  2A37 A;  2DMO A;  3VS7 A;  1X6B A;  1WDX A;  2RF0 A;  2CUB A;  4J9D A;  2HSP A;  1JQQ A;  5ECA A;  1ABO A;  1TUD A;  3I9Q A;  1YP5 A;  1BB9 A;  2DL4 A;  2BZX A;  1NLP C;  3VS5 A;  2RQU A;  2O31 A;  2LJ1 A;  2G6F X;  1YWO A;  1PKS A;  3UA7 A;  2OI3 A;  1ZBJ A;  2LX7 A;  1T3L A;  1SHG A;  3M0R A;  2JXB A;  1RLP C;  1S1N A;  1HJD A;  2YT6 A;  1TUC A;  1WFW A;  4FSS A;  1X43 A;  1M8M A;  4HVW A;  2BZY A;  3H0F A;  3I5R A;  2DA9 A;  2KR3 A;  1B3Q A;  1UHF A;  4A63 B;  2C0O A;  2EGA A;  1AZE A;  2KT1 A;  4HVV A;  3SHW A;  2RN8 A;  2FPD A;  1HD3 A;  1PHT A;  2KRS A;  1VYV A;  2DX1 A;  4ZNX A;  1ZLM A;  1M3B A;  2YSQ A;  3VS0 A;  5I22 A;  1E6G A;  2GTJ A;  1FYN A;  2LZ6 B;  3U23 A;  2HBW A;  3VRY A;  1VYU A;  5GJW B;  2KNB B;  3JV3 A;  2KGT A;  3UA6 A;  1PWT A;  1M30 A;  2PTK A;  2AZS A;  3H0H A;  1PRL C;  4RTY A;  2MCN A;  2DNU A;  1HSQ A;  2EQI A;  1K9A A;  2V1Q A;  4LNP A;  1NG2 A;  1SSH A;  3A98 A;  4DEY A;  1AEY A;  2K9G A;  4J9I A;  2L2P A;  4IIM A;  2NUZ A;  1SEM A;  2RPN A;  1OEB A;  2ED1 A;  1PKT A;  3PVL A;  1A0N B;  3M0P A;  2EVR A;  1J3T A;  1NYF A;  2DLP A;  2W10 A;  2ESW A;  2DIL A;  1I07 A;  4AFQ C;  1UGV A;  3PE0 A;  4J9C A;  1N5Z A;  1VYT A;  4EIK A;  1UUE A;  1ABQ A;  3I5S A;  2L3S A;  1U06 A;  1NEB A;  2J7I A;  1KIK A;  3RNJ A;  5IH2 A;  1UJ0 A;  4LUE A;  2EBP A;  2DRM A;  1XOV A;  2EKH A;  2CH4 W;  2LNH B;  2YDL A;  2PNI A;  1UDL A;  1WIE A;  4F14 A;  2ROL A;  4RTV A;  4J9F A;  2DL3 A;  2JS0 A;  2EYW A;  2A08 A;  1FMK A;  4RTW A;  1QKW A;  2DM1 A;  2J6F A;  3NHN A;  3REB B;  2D8H A;  1OPL A;  1K0S A;  2MOX A;  2KBT A;  1EFN A;  2X3W D;  1GRI A;  2DF6 A;  1ZSG A;  3REA B;  2GBQ A;  1AWJ A;  4K11 A;  2JM9 A;  4CC4 B;  1YWP A;  2W0Z A;  2O9S A;  3FJ5 A;  4OMP A;  5IHN A;  3EHQ A;  1G2B A;  4D8K A;  2EYZ A;  2RMO A;  2VKN A;  2KT8 A;  3UAT A;  3EGU A;  1VA7 A;  2GTO A;  5GJV B;  3LH5 A;  2SEM A;  2D1X A;  2JS2 A;  2EGE A;  1E7O A;  2JT4 A;  1JEG A;  1W6X A;  2GGR A;  2CH4 A;  1NLO C;  2JMA A;  2E5K A;  1ZUY A;  5IXB A;  1MV0 B;  2DL7 A;  1UTI A;  1KJW A;  1H3H A;  1JXO A;  2CRE A;  1UFF A;  2DE0 X;  1SRM A;  3SEM A;  3UF4 A;  1KSW A;  2AK5 A;  4OMM A;  1SHF A;  3VS3 A;  2ED0 A;  2PZ1 A;  1GFC A;  5IHI A;  1MV3 A;  2GQI A;  3THK A;  1I1J A;  1W1F A;  1CSK A;  3C0C A;  3VS4 A;  1WXU A;  4J9B A;  4OMN A;  1T0J A;  5FW9 A;  1GCQ A;  2L3P A;  1QKX A;  2FEI A;  1YNZ A;  5IHK A;  2F2W A;  1RLQ C;  2GNC A;  2V1R A;  2MIO A;  2EYY A;  4J9E A;  3H0I A;  1QWE A;  3O5Z A;  1OV3 A;  1CKA A;  2FRY A;  1JXM A;  3EG3 A;  3KFV A;  4HXJ A;  2DL8 A;  4ESR A;  2CT3 A;  1QCF A;  2I0N A;  3ULR B;  2QDL A;  1U5S A;  2A28 A;  3PVQ A;  1X27 A;  2LCS A;  1G83 A;  1WA7 A;  2J6K A;  1UHC A;  2HEQ A;  3EG0 A;  1GBQ A;  1H8K A;  3TVT A;  2RNA A;  1AZG B;  1ZUU A;  4RTT A;  3GBQ A;  3I35 A;  4QT7 A;  2IIM A;  1T3S A;  1W70 A;  2LP5 A;  1WLP B;  2O2O A;  2H8H A;  1B07 A;  2DVJ A;  2LQN A;  1NYG A;  4IIO A;  1M3C A;  1ZUK A;  4JJC A;  2J6O A;  2LMJ A;  1GCQ C;  1RUW A;  2JMC A;  2YUQ A;  2JM8 A;  3VS1 A;  2M0Y A;  4M4Z A;  5EC7 A;  2K79 A;  2JW4 A;  1K4U S;  1Z9Q A;  1AWW A;  4RUG A;  2SRC A;  4GBQ A;  2EGC A;  4DEX A;  2CSI A;  1GFD A;  2DRK A;  2AKL A;  4CC3 A;  2FG0 A;  3M0U A;  5L23 A;  1GL5 A;  1KFZ A;  2J05 A;  1LCK A;  2JTE A;  4X1V A;  2CDT A;  4JPB W;  2LJ3 A;  2RQR A;  2VWF A;  3EG2 A;  2ROT A;  2YUN A;  3IQL A;  4Z88 A;  1YCS B;  4LN2 A;  1YN8 A;  2X3X D;  2P4R A;  4AG2 C;  2FPF A;  1M27 C;  2RQW A;  2KE9 A;  3R6N A;  2M51 A;  2DJQ A;  5HCK A;  4F17 A;  1CKB A;  5FWC A;  1OOT A;  1WYX A;  4LE9 A;  1Z9Z A;  2D0N A;  1MUZ A;  2KXD A;  2D8J A;  2K2M A;  2K3B A;  4E6R A;  1ARK A;  2FRW A;  3VS2 A;  2KRO A;  1WX6 A;  2HCK A;  2F2V A;  2RQV A;  4F16 A;  1T0H A;  3CQT A;  1GBR A;  5FWB A;  1X2Q A;  3ZL7 C;  1NEG A;  3QWX X;  1M3A A;  1E6H A;  2BTT A;  4R0K A;  2ENM A;  2C0T A;  2OAW A;  2DYB A;  1TG0 A;  4RTZ A;  2OJ2 A;  1AD5 A;  2KYB A;  2XMF A;  4OMQ A;  2AZV A;  4ORZ A;  1K76 A;  3QWY A;  1AVZ C;  4AG1 C;  4Y92 A;  2CUD A;  2YUP A;  2C0I A;  1K1Z A;  3H41 A;  2O9V A;  2EYX A;  1JO8 A;  4OMO A;  1SPK A;  4Z8A A;  1PRM C;  2F2X A;  2O88 A;  1AWO A;  3EHR A;  1AOJ A;  4WCI A; 
#chains in the Genus database with same CATH topology
 3OW2 A;  1YFN A;  1M4Z A;  3OYB A;  4KGV B;  3FJP A;  2J06 A;  1X2K A;  5I11 A;  3JCM W;  4J9H A;  1RI9 A;  3V8J A;  5FU7 B;  1YIT T;  4JS5 A;  1IO6 A;  2DEU A;  2CT4 A;  2QQ9 A;  3QKJ A;  3RBB B;  5LJ3 h;  3ER0 A;  1VQ7 A;  1IXD A;  1YI2 A;  4RTX A;  5CAI A;  4GLM A;  3KBG A;  1Y57 A;  1FMW A;  2KRM A;  2JTM A;  1RI0 A;  3NMZ C;  1MMD A;  3EGD B;  1IGQ A;  1PG5 B;  5KCH A;  4OGC A;  3MPU B;  5KYX A;  1Q86 R;  1X6G A;  2KXC A;  1YBY A;  1H92 A;  4E7L A;  1I4K 1;  4M78 G;  3VRZ A;  4PLI A;  1VQ9 Q;  2DBM A;  1WXB A;  1UE9 A;  2BKD N;  4AFS C;  1K0X A;  3QO3 A;  4Y28 E;  2QGF B;  1BU1 A;  1BBZ A;  1NM7 A;  3VU3 C;  3HP9 A;  1VQN Q;  2P4T A;  1K8A C;  2P0K A;  4MZM A;  1D0Y A;  1Y0M A;  2A37 A;  3VS7 A;  4PJO D;  2BE7 D;  4FT4 A;  4B9X A;  2Y4X A;  1WDX A;  1N8R U;  5FRM A;  1VQ5 A;  1WHJ A;  4M77 F;  5AT1 B;  1NJI C;  2OTL A;  1YP5 A;  4XTY A;  5DY9 A;  3VS5 A;  4KH1 B;  4C5G A;  4PFZ A;  2RQU A;  4QKU A;  4E7J A;  4CI0 C;  3OYH A;  3M5A A;  1PKS A;  2OI3 A;  4X9D A;  3S3O A;  1YHQ T;  1ZBJ A;  1T3L A;  3V8L A;  1SHG A;  4EDU A;  2CP0 A;  2LT4 A;  3CCE Q;  4UC4 A;  1TUC A;  1WFW A;  2YXY A;  5KYU A;  3I5R A;  4C92 E;  2DA9 A;  1B3Q A;  3M54 A;  3JAM E;  1HK9 A;  1UHF A;  4NOY A;  2C0O A;  3AHU A;  5FRO A;  1D1A A;  3OS5 A;  1R0B G;  3GF5 A;  1Q81 R;  4J7F A;  2KRS A;  2DXC A;  1KC8 U;  1ZLM A;  4BDY A;  3KXT A;  2M02 A;  3QUI A;  3UPU A;  1E6G A;  5AYF A;  3OSV A;  8AT1 B;  2E5Q A;  2MF2 A;  2HBW A;  1YIJ T;  3EAE A;  3NFC A;  3BY7 A;  9ATC B;  2CYZ B;  1TU0 B;  5GAM g;  3GNG A;  2RHZ A;  4M78 F;  3V7C A;  4M75 B;  4FL6 A;  1PWT A;  1M30 A;  3BW1 A;  2AZS A;  2LTO A;  3CBP A;  2LT1 A;  4HCZ A;  4RCB A;  3VYG A;  2LCL A;  2YLB A;  3QHS A;  4LXC A;  2QEX A;  1Q82 C;  1BIA A;  2PVG B;  4LNP A;  3JCM J;  2KDS A;  2VUB A;  2K9G A;  2L2P A;  2OTJ Q;  3V7S A;  2M0O A;  4BE2 A;  3EFS A;  1XQH A;  3PT9 A;  2A0F B;  4A4E A;  5KYX B;  2R5M A;  3FIF A;  3LGL A;  4IUU A;  5GAO q;  2DIL A;  3EG9 B;  1I07 A;  4FYW B;  5GMK i;  3SB2 A;  2CP5 A;  2DET A;  3H6Z A;  3L2R A;  1N5Z A;  4C8Q A;  1UUE A;  1ABQ A;  2HQH A;  1D1C A;  2J7I A;  2X51 A;  1UJ0 A;  3S3M A;  1OYX A;  3CEY A;  1XOV A;  2CH4 W;  2YDL A;  3FLG A;  1RL2 A;  4BI4 A;  3JB9 G;  1QCO A;  4OF1 A;  2DPP B;  5GAM h;  3CCM T;  1VQO T;  5GAM f;  2MYS A;  2AHJ B;  1FMK A;  2H3J A;  5GAN 6;  3REB B;  2WSC E;  5D7U A;  1K0S A;  1Y96 B;  4ZN3 A;  4C5E A;  1GRI A;  4WF2 A;  2F69 A;  2GBQ A;  2D6F A;  4K11 A;  1MMA A;  3RES A;  4IUT A;  1N9R A;  3QDF A;  3CC2 Q;  1S72 T;  4D8K A;  2EYZ A;  2RMO A;  3QYH B;  4OB1 B;  1VA7 A;  4C8Q C;  3X20 B;  2BIV A;  2O4X A;  3CCQ A;  2JS2 A;  3CBO A;  2JT4 A;  4EPC A;  2ATC B;  4DOW A;  2Y90 A;  1NLO C;  3HFN A;  2JMA A;  3OYK A;  1YIJ A;  2I2L A;  1UGQ B;  1WPY A;  1ZUY A;  2RHU A;  1MV0 B;  3S3N A;  3MEA A;  3ZBD A;  1TH7 A;  4C5I A;  4QW2 A;  2LX9 A;  4QVD A;  1UFF A;  3QZ5 B;  2YWW A;  4BAC A;  2C06 A;  1LOJ A;  4M75 E;  2AK5 A;  2KY9 A;  4IKF A;  3VS3 A;  5KYW B;  3HL8 A;  2QXF A;  1TTH B;  5FU6 C;  4VUB A;  1MV3 A;  1SSF A;  1YJW A;  3A8G B;  1VQ6 Q;  4BE1 A;  1CSK A;  2R58 A;  2RI5 A;  2EJF A;  3JB9 J;  4J9B A;  3HSB A;  4JRP A;  2QA4 T;  5FW9 A;  5I2M A;  1GCQ A;  2JNG A;  2V26 A;  4IUR A;  2DTH A;  2YHT A;  2PU9 B;  1OX8 A;  2E3H A;  2GNC A;  1G3Y A;  3H0I A;  4M7D G;  5GAN j;  4KGX B;  2A7Y A;  3KFV A;  2CT3 A;  2I0N A;  1QW1 A;  1AT1 B;  3A8O B;  2E65 A;  5LJ5 d;  2E6Z A;  2MAM A;  1G83 A;  1WA7 A;  1YCY A;  4OB0 B;  3RUX A;  2NUP A;  3EG0 A;  2RK2 A;  5FRN A;  2COY A;  2ZPH B;  3CCR Q;  4RTT A;  2DJZ A;  3NTK A;  3CCM A;  2LP5 A;  2O2O A;  2F1L A;  4ME7 A;  1ZA1 B;  3EGX A;  5GMK l;  2J6O A;  4ZGE B;  1GCQ C;  3G4S T;  1RUW A;  2RI2 A;  2YUQ A;  3PMT A;  2R57 A;  4QQG A;  4KUL A;  1Q7Y C;  2M0Y A;  2R5A A;  3CCJ Q;  3AT1 B;  3OW2 P;  4XU2 A;  4RCC A;  3TEE A;  2QQA A;  4DEX A;  3CC7 Q;  3URG A;  3L1A A;  1M2V A;  4N0A A;  1RAE B;  1QVF S;  1IRX A;  4C8Q D;  4CC3 A;  3M0U A;  5L23 A;  2LVM A;  2JTE A;  1KQS P;  5IN1 A;  4A4K A;  3OMC A;  2LJ3 A;  4JPB W;  4AMC A;  4LDW A;  1KG1 A;  2YUN A;  1KD1 U;  2DTI A;  4LN2 A;  1UGR B;  2X3X D;  3OS0 A;  1WNL A;  4XK8 E;  1M27 C;  2DJQ A;  4Z02 A;  2QQR A;  2O4X B;  4M77 A;  3M55 A;  3TCJ A;  5GAN 7;  4LE9 A;  5C6S A;  4L6V 5;  2K2M A;  2KQW A;  1JJ2 S;  4E6R A;  2JUF A;  2QDY B;  2P0P A;  4A54 A;  4M7D F;  1G8X A;  3PIO A;  2HCK A;  5HK0 A;  4F16 A;  3L42 A;  3CC4 T;  4M7A B;  1T0H A;  1G3W A;  4N0A C;  1MMN A;  4OP0 A;  1X2Q A;  3QPH A;  2HQE A;  1E6H A;  2DKG A;  2ENM A;  2OAW A;  2HBP A;  3X28 B;  2L8D A;  3I55 A;  2OJ2 A;  5EG2 A;  2XMF A;  2DIQ A;  5I2S A;  5KCO A;  3QWY A;  4DBQ A;  4PK4 A;  1VQ8 T;  5CQY A;  1K1Z A;  3H41 A;  1M90 C;  2O01 E;  4KH0 B;  5KYY B;  1M1F A;  1PRM C;  2VXF A;  5C0M A;  4M77 C;  2BZ8 A;  2LC4 A;  4ZGJ B;  1UEC A;  2X4X A;  3CCS Q;  4OGE A;  1AWX A;  1UG1 A;  2EQK A;  5KYN A;  3NPF A;  3CME T;  3CCV T;  2FYK A;  3QBY A;  3QYG B;  1QQJ A;  3CCU A;  4XTU A;  4M78 A;  2CS7 A;  1BK2 A;  4JJD A;  3RKX A;  4LDX A;  3OYM A;  8ATC B;  3OYY A;  5KE3 A;  2DL5 A;  5DLQ E;  1WHG A;  2K3X A;  4RMO A;  2EYQ A;  2BUD A;  1I5O B;  2JOY A;  2PUK B;  4HVU A;  4JZ4 A;  1KHI A;  2F5K A;  3QXE B;  1VQL A;  2L3Q A;  4XTX A;  3TSZ A;  3CD6 A;  3RR6 A;  5CKB A;  3T9N A;  3SWN A;  3TRE A;  4C0D C;  1I0C A;  3E2U A;  4CC2 A;  3SFM A;  3N5B B;  1D3B B;  2YRV A;  3M0S A;  5IXF A;  1M2V B;  4N4H A;  4YTL A;  4DOV A;  3JCM e;  4JJB A;  4M78 C;  5D6W A;  1KQ2 A;  4XQ3 A;  4Z89 A;  3GPL A;  2LJ0 A;  4HT9 A;  2DMO A;  2ZPE B;  3A8L B;  1VQP A;  2RF0 A;  4J9D A;  4ZTF A;  1M1K R;  1TUD A;  3MHX A;  4M7A E;  1NLP C;  3OQ5 A;  4ELY C;  4L59 A;  4XU3 A;  3INZ A;  3DLM A;  5LL6 S;  2LX7 A;  4FM4 B;  1EIF A;  1G3T A;  3SWN C;  1VQK A;  3PFS A;  3LGF A;  1Y07 A;  4EMK A;  3GOX A;  4FYY B;  4QQD A;  3CCL A;  1VQ9 T;  2CKK A;  2DK3 A;  2QAS A;  4FSS A;  1VQ4 T;  1M8M A;  2CZ6 B;  3H0F A;  3MCA B;  3G71 Q;  2DD4 A;  2KR3 A;  1IHW A;  1WZO A;  4FW1 A;  1VQN T;  2NYS A;  2X9H A;  1AZE A;  2ZPF B;  2XG8 D;  4M77 G;  1D0Z A;  3I56 T;  3RKY A;  4IUQ A;  3G6E A;  1K9M R;  4HVV A;  1KC8 C;  3CCV A;  1PHT A;  3CMA Q;  1K73 R;  1WHM A;  4FCY A;  4XTV A;  3VS0 A;  5I22 A;  2GTJ A;  3UT1 A;  1FYN A;  1NPP A;  2HKN A;  2P84 A;  3D7S B;  1BKB A;  3CCE T;  4EMK C;  4D6W A;  2KGT A;  5GAO n;  3UA6 A;  1KQS A;  4DQ2 A;  4RTY A;  2MCN A;  1W2B S;  2RB6 A;  1VQ7 Q;  4E7Z A;  1YI2 Q;  1NG2 A;  4J6X A;  1SSH A;  5A0G A;  3A98 A;  1X75 C;  1WJQ A;  4RG2 A;  3CPW S;  4J9I A;  1XNI A;  4MML A;  2NUT A;  4C0G A;  2RHX A;  1YJ9 A;  4A53 A;  1OEB A;  1VQM A;  4R56 A;  4M78 D;  4C92 G;  1NYF A;  4ELZ C;  3DB4 A;  4QQ6 A;  3LH0 A;  4PJO B;  3WVE B;  2RJD A;  1UGV A;  3PE0 A;  1JB0 E;  1VYT A;  2RK1 A;  4EIK A;  1R0C B;  3I5S A;  2LQK A;  1B34 A;  2L3S A;  1U06 A;  1NEB A;  4GY5 A;  5GAN 5;  3RNJ A;  4LUE A;  2EKH A;  2PNI A;  1UDL A;  4RTV A;  1YJN A;  1VQ5 Q;  5LJ3 e;  2OTL Q;  1VQ9 A;  2EYW A;  1OQK A;  4RTW A;  1VQ4 A;  1QKW A;  3NHN A;  5L8R E;  2OTJ T;  1OPL A;  2ZPB B;  4LDY A;  2EWN A;  3P8H A;  1IGU A;  2X3W D;  2DF6 A;  1ZSG A;  3REA B;  4XU0 A;  1K8A R;  1FMV A;  3I56 A;  2JN0 A;  1UEB A;  1QVF A;  3TU4 K;  3LH5 A;  1WGS A;  2SEM A;  3EFO B;  1NJI R;  1E7O A;  1JEG A;  2M16 A;  5GMK e;  1W2B P;  3WXM B;  2XU8 A;  2CH4 A;  3PIP A;  4Q5W A;  4F7U B;  1RAD B;  1C6V X;  2DL7 A;  1G3S A;  3M56 A;  2JJ9 A;  3EFR A;  1YIT A;  4J8O A;  1K73 U;  4M7D A;  2QAZ A;  3MO8 A;  4C5H A;  3CBM A;  4MZT A;  1JJ2 A;  2E41 A;  2VAS A;  2GQI A;  3ZFJ A;  3THK A;  1I1J A;  1W1F A;  5LJ5 j;  4C92 F;  3CC2 T;  1T0J A;  2L3P A;  1OI1 A;  2G3R A;  1RLQ C;  1RAI B;  2V1R A;  2BE9 B;  4E7I A;  2QEX Q;  1QWE A;  1OV3 A;  4XTW A;  5IAY A;  4PJO E;  1QCF A;  3ULR B;  5LJ3 j;  2WAC A;  2LCS A;  2PQW A;  1LNX A;  1V76 A;  4M7D C;  1UHC A;  1Q86 U;  1GBQ A;  1H8K A;  1H3Z A;  4V2S A;  1IZ6 A;  3RER A;  1BI1 A;  2IIM A;  1W70 A;  4XAX B;  5GAO l;  1Q82 R;  1QMC A;  1B07 A;  2L89 A;  2DVJ A;  1VQ6 T;  2E10 A;  2LQN A;  1WQ7 A;  2KSS A;  3RMQ A;  4E2F B;  2NLU A;  1ZUK A;  4JJC A;  5GAN e;  2CZ7 B;  3JB9 D;  4M75 G;  3VKI A;  2JM8 A;  3VS1 A;  1YHQ A;  3QDR B;  1U8R A;  2RJF A;  1GXI E;  2ZPI B;  5GMK j;  4RUG A;  2SRC A;  1LJO A;  4GBQ A;  5HKC A;  2EQU A;  4PL6 A;  2JTF A;  1ZSZ A;  2FL7 A;  4FW2 A;  4C0Z A;  4ATO A;  2FG0 A;  1KFZ A;  1TWB A;  1KD1 C;  1M8V A;  4R55 A;  3VJP A;  1YCS B;  3CCR T;  4F7U E;  4EMH A;  1G5V A;  2RJC A;  2P4R A;  1BCM A;  3OBY A;  2K5F A;  2FPF A;  3GP8 A;  1LPL A;  1TS9 A;  1O75 A;  3CCQ Q;  3PGG A;  1NJI U;  3A5Z B;  2EQM A;  5KYU B;  2MPX C;  1MUZ A;  2K5I A;  3M53 A;  2KXD A;  1YIJ Q;  2K3B A;  1ARK A;  1Q81 U;  3VS2 A;  3CCJ T;  2KRO A;  1W4S A;  4FYX B;  1TUG B;  3CC7 T;  2ZGW A;  1ZSZ C;  5GAM e;  3JCM P;  3ZL7 C;  1NEG A;  2BTT A;  1OX9 A;  2MMP A;  1PCX A;  2DYB A;  4X9C A;  2XD0 A;  1YJW Q;  4ORZ A;  1WHK A;  1O9S A;  2X35 A;  1AVZ C;  4AG1 C;  4Y92 A;  3WVD B;  4P5N A;  2EYX A;  4OMO A;  1X6O A;  4M7D D;  1AWO A;  4B9W A;  3EHR A;  1AOJ A;  2HDA A;  3M0T A;  3M4G A;  2PVO B;  4M75 F;  4PFP A;  5J39 A;  2E64 A;  2K7A A;  3NTH A;  2AKK A;  2KYM A;  1PNJ A;  4KRT A;  1WHL A;  1V1C A;  1WXT A;  2EQJ A;  2B86 A;  2KEA A;  4CRI A;  3NTI A;  2ABL A;  1ACM B;  2LNV A;  1GCP A;  2LQW A;  4KBM B;  2IG0 A;  1KQ1 A;  4HCK A;  1Q82 U;  2K6D A;  1VQO A;  3M58 A;  3TQ7 P;  3OYE A;  4BD3 A;  4C8Q B;  1QLY A;  3FDR A;  1VOM A;  2H3E B;  4L5G A;  1W2B A;  5D6Y A;  2FPE A;  3MEU A;  1BCO A;  5GAO m;  1X01 A;  4J9G A;  2GF7 A;  3VS6 A;  3TSW A;  1I5L A;  3CPF A;  2KRN A;  1S72 A;  4AFZ C;  3CPW A;  3QSU A;  3EG1 A;  5J3B A;  3A8H B;  3X25 B;  3DLL A;  4BY6 C;  4QVC A;  3CCS T;  4JJN K;  2CSQ A;  2VVK A;  3CXC S;  2QTX A;  2DBK A;  2XHC A;  3OBW A;  3QZ9 B;  4II1 A;  4XU1 A;  3UWN A;  4JZ3 A;  5GAM j;  5FU6 B;  5CO7 A;  1Q7Y R;  1X6B A;  1ZBX A;  3OSS C;  2HSP A;  1JQQ A;  5ECA A;  3I9Q A;  2FZK B;  5FLX E;  2DL4 A;  2EKO A;  1QCN A;  1BI2 A;  4KGZ B;  2G6F X;  2K2V A;  3OYI A;  4LD6 A;  1RAH B;  3LYI A;  3M0R A;  2JXB A;  1RLP C;  1HJD A;  1NE8 A;  3OS1 A;  3V8K A;  5DLO A;  2QA4 A;  1X43 A;  3FRN A;  4HVW A;  4PJJ A;  3L2Z A;  3OS2 A;  4N4G A;  2A3L A;  4A63 B;  3I55 Q;  1IB8 A;  1PC0 A;  4J83 A;  2Z0W A;  5GAO p;  4PLL A;  4KUI A;  2KT1 A;  2D0Q B;  1I81 A;  3HRU A;  2RD1 A;  3SHW A;  2CP2 A;  2RN8 A;  1HD3 A;  1MGQ A;  1WJR A;  2MWP A;  2X4Y A;  4ZNX A;  1QVG S;  3MEV A;  1M3B A;  4OB3 B;  2DXT A;  5D6X A;  4JRK A;  4FSX A;  1ZQ1 A;  2KNB B;  3ASK A;  4C92 A;  4C8Q E;  3G4S A;  3CCU Q;  1QVF P;  2PTK A;  3H0H A;  1M90 R;  4M7A G;  1PRL C;  1OUL A;  3G71 T;  2DNU A;  3P8D A;  4IUV A;  2NUP B;  1HSQ A;  2EQI A;  1K9A A;  3ME9 A;  2V1Q A;  4FU6 A;  4DEY A;  4LDU A;  4X34 A;  3EGX B;  4OB2 B;  1SEM A;  3CMA T;  3OY9 A;  1VQL Q;  1LVK A;  1Q95 G;  3CD6 Q;  2XI9 A;  2ED1 A;  3FEO A;  1PKT A;  3PVL A;  5GMK m;  1J3T A;  5CQX A;  2ESW A;  1JJ2 P;  1WHH A;  4J9C A;  3JCM Q;  3JCM X;  1PSE A;  5CIU A;  3C94 A;  3L2W A;  4NL3 A;  1KIK A;  4C92 C;  2EBP A;  2LNH B;  5CVI A;  1RAC B;  1WIE A;  2AT1 B;  3HHT B;  4ZGD B;  1N8R C;  3A8M B;  2ROL A;  1VQP Q;  3EH2 A;  1EZZ B;  1VQ7 T;  2QK0 A;  1YI2 T;  3OB9 A;  2KI7 A;  1MMG A;  3CC4 A;  3E19 A;  2QG9 B;  3JB9 I;  5FU7 C;  1QP3 A;  2EAY A;  2DM1 A;  1OZ2 A;  2D8H A;  2KBT A;  2X4J A;  4M77 B;  1AWJ A;  2F5T X;  4WTO B;  1VQK Q;  3FJ5 A;  4OMP A;  2CGH A;  3EHQ A;  3CCL Q;  1VQ8 A;  4J5Y A;  2VKN A;  2HAX A;  3VUB A;  3EGU A;  1M1G A;  2D1X A;  2XDP A;  2EGE A;  1C1A A;  2VB6 A;  4M77 D;  1W6X A;  3OA6 A;  3QJY A;  2GGR A;  4OVA A;  4M7A F;  2FB7 A;  3C12 A;  1D1B A;  3G6E Q;  3L2V A;  3CCV Q;  2DO3 A;  3CME A;  3HRT A;  1H3H A;  1JXO A;  3MP8 A;  2CRE A;  2DE0 X;  1SRM A;  3UF4 A;  3P8B B;  4OMM A;  2ED0 A;  4A4F A;  3RDV A;  2D9T A;  3QII A;  2KVQ G;  1GFC A;  2PZ1 A;  5IHI A;  4C0D B;  4MMK A;  3J7A F;  2DD5 A;  3C0C A;  3PNW C;  2CZ1 B;  3VS4 A;  1QVP A;  2RJE A;  1MHN A;  6AT1 B;  1HXD A;  1QKX A;  1KC8 R;  1M90 U;  4BB7 A;  2MIO A;  2EYY A;  4M78 B;  4J9E A;  3E9F A;  1CKA A;  1PD1 A;  2FRY A;  3EG3 A;  2DIG A;  2COW A;  4HXJ A;  4JDS A;  2IPO B;  2A28 A;  4M75 A;  1YJ9 Q;  3PVQ A;  1VQM Q;  1Q86 C;  1Y7X A;  4C92 D;  1TOV A;  3O8V A;  2J6K A;  4A4H A;  2HEQ A;  2HKQ B;  5LJ5 e;  3TVT A;  2RNA A;  1AZG B;  1ZUU A;  5LJ3 f;  1OU9 A;  3I35 A;  4QT7 A;  3SWN B;  1T3S A;  2EIF A;  3C95 A;  1WLP B;  2H8H A;  2WSE E;  1RAF B;  3QJ6 A;  1NYG A;  4IIO A;  1M3C A;  2E12 A;  4HA8 A;  2LMJ A;  3PTA A;  4GLK A;  4KT0 E;  2P0Q A;  2V8K A;  1ZHI A;  4M77 E;  2KMT A;  2V8I A;  5HY6 A;  1C0M A;  4BUG A;  4M4Z A;  5EC7 A;  1YJN Q;  2JW4 A;  3EG9 A;  2QEX T;  4FIB A;  2QQB A;  2EGC A;  1M1K U;  4HKE A;  2CSI A;  1VQ4 Q;  2DFU A;  2RA2 A;  1GFD A;  3VV0 A;  5GMK h;  1PM3 A;  4M75 C;  2DRK A;  4XTZ A;  1QP2 A;  3M4Y A;  2J05 A;  4EMG A;  1VQN A;  2CDT A;  1WQW A;  2RQR A;  3EG2 A;  3IQL A;  3I56 Q;  2E3I A;  2DEQ A;  5IT9 E;  1U1S A;  5KH6 A;  4LD9 K;  4EMK B;  4PJO G;  2RQW A;  5GAN g;  3CXC A;  2M51 A;  2DAQ A;  4F17 A;  1Y96 A;  1CKB A;  5FWC A;  3A1P A;  1OOT A;  1WYX A;  3M59 A;  5GAN 8;  2JZ2 A;  3L2U A;  2D8J A;  1Q81 C;  2DVE A;  1K9M U;  2FRW A;  1WJS A;  4F04 B;  1WX6 A;  4JS4 A;  3CCE A;  2F2V A;  1YIT Q;  3CPW P;  1I8F A;  4PJL A;  2X4W A;  2PVD B;  1M3A A;  1BYM A;  3RIR A;  3OYN A;  1EX4 A;  4M78 E;  1TG0 A;  1DJ7 B;  4RTZ A;  1B7T A;  2KYB A;  4OMQ A;  2AZV A;  5GAN 2;  1FX7 A;  3R6O A;  2YLC A;  1RAB B;  1Y71 A;  4AT1 B;  2CUD A;  2YUP A;  2C0I A;  4JRQ A;  2O9V A;  2HL3 A;  3H8Z A;  3OYF A;  1TXQ A;  3JCM b;  1F1B B;  3CCQ T;  4Z8A A;  5KYW A;  1KHC A;  2F2X A;  1GL5 A;  3RMS A;  1AHJ B;  2Y4Y A;  4OML A;  4ZTJ A;  4MDW A;  2EW3 A;  1U3O A;  4F7U G;  5GAN h;  4J7I A;  4JRI A;  3HKS A;  5GAN f;  1QVG A;  2FZG B;  1OPK A;  2EPD A;  2NUT B;  2L5Q A;  1VIF A;  1ZX6 A;  5J26 A;  4LUD A;  2HNI A;  5A0L A;  1NZ9 A;  1JRI A;  3EH1 A;  3GNF B;  2L3R A;  1M5Q 1;  1ZA2 B;  1YJW T;  4CC7 A;  1X69 A;  2FO0 A;  2K3Y A;  4NL2 A;  3JB9 H;  5CKD A;  2RQT A;  3M0Q A;  2OTJ A;  1B34 B;  4M75 D;  2NWM A;  4PJO F;  4AFU C;  4B6M A;  5CK9 A;  4OMF B;  4RTU A;  1YHQ Q;  2ECZ A;  3G7Z A;  2QTV A;  2A36 A;  2PUO B;  2VYT A;  1QWF A;  2M9U A;  3BFM A;  1SRL A;  2RH2 A;  2L0A A;  4DA4 A;  2E70 A;  1UGS B;  4PFO A;  2K4Y A;  3JCM d;  1BIB A;  1UJY A;  1JU5 C;  4JLI A;  3NGP A;  1WI7 A;  2YUO A;  1K8A U;  3MJX A;  4D8D A;  2XDD A;  2FVU A;  4RKU E;  2VC8 A;  2CUB A;  4ANJ A;  1ABO A;  1BB9 A;  3FB9 A;  1XJW B;  2BZX A;  4MZP A;  2O31 A;  2LJ1 A;  3VYH B;  3X24 B;  1YWO A;  3UA7 A;  3PMI A;  3OMG A;  1KD1 R;  1S1N A;  2YT6 A;  3CC2 A;  1R8O B;  5CKE A;  2LDM A;  3JCM c;  2ZZD A;  4F7U F;  2BZY A;  5GAN 4;  4M7D B;  2CP3 A;  3RKW A;  2DTO A;  2EGA A;  3OW2 S;  1RAA B;  4E47 A;  2ZAE A;  5GAN 3;  1KK7 A;  7AT1 B;  2LRQ A;  2XKO C;  2KAF A;  3JCM V;  3S6W A;  2FPD A;  1XTD A;  4M7A A;  2GFU A;  1VYV A;  2DX1 A;  1IHV A;  1BI3 A;  2E1H A;  2YSQ A;  5CKH A;  1D0X A;  1KQS S;  4HCB A;  1FWZ A;  2LZ6 B;  1BI0 A;  1NPR A;  3U23 A;  3VRY A;  2VXE A;  2YRD A;  4E7H A;  1VYU A;  2HD0 A;  5GJW B;  1VQ6 A;  3J81 E;  3JV3 A;  1U1T A;  3MEW A;  5KYY A;  4DBH A;  4BI8 B;  5DM7 R;  4NS5 A;  2DZC A;  2QYZ A;  2JVV A;  3I55 T;  3CCM Q;  1VQO Q;  1VIE A;  2GQV A;  3M9Q A;  3JB9 F;  1VUB A;  1AEY A;  3H9N A;  4IIM A;  4M7A C;  2HL5 C;  4TVR A;  3V7R A;  5M9O A;  1TSF A;  2NUZ A;  2RPN A;  2HSE B;  3E9G A;  5A0D A;  3JSC A;  3MP1 A;  2FHD A;  4FT2 A;  1A0N B;  3M0P A;  2EVR A;  2HQX A;  2DLP A;  3LWH A;  2W10 A;  3CCR A;  1S72 Q;  4HT8 A;  4AFQ C;  1MND A;  1FXX A;  3OYL A;  5CR2 A;  1RAG B;  2K57 A;  2OAU A;  1ZSZ B;  2VGM A;  5IH2 A;  1D09 B;  3CCU T;  5I21 A;  2DRM A;  2RHI A;  5KE2 A;  4C0F A;  2M1H A;  5LJ3 d;  4F14 A;  4J9F A;  3CCJ A;  3DB3 A;  2DL3 A;  3MP6 A;  1D3B A;  2RI3 A;  3MET A;  2JS0 A;  2QQS A;  2HMA A;  1OZ3 A;  5HK3 A;  2A08 A;  3CC7 A;  1V29 B;  4IUP A;  2XIC A;  2J6F A;  2DER A;  3HPW A;  4O6J A;  2MOX A;  4M7D E;  3OYD A;  4C8Q G;  1EFN A;  2DXB A;  1VQL T;  3F70 A;  3CD6 T;  2JM9 A;  3HFO A;  4CC4 B;  1YWP A;  2W0Z A;  2O9S A;  1MNE A;  5IHN A;  1G2B A;  2OX7 A;  1R77 A;  2KT8 A;  3UAT A;  2QA4 Q;  2K5L A;  1N9S A;  2GTO A;  5GJV B;  3JCM g;  3L2Q A;  4A4G A;  2E4H A;  2B8A A;  3VUZ A;  1JBM A;  3GLX A;  1PSF A;  2RHY A;  2E5K A;  3BE3 A;  5IXB A;  1VQP T;  1UTI A;  1KJW A;  3BDL A;  1NBE B;  3LWI A;  3SEM A;  4KUD K;  2RM4 A;  2WSF E;  2QI2 A;  1KSW A;  2QGG A;  1SHF A;  4PKC C;  4LDV A;  5A2Q E;  2LQ8 A;  4BE0 A;  1VQK T;  3MKD A;  3FC3 A;  3Q1J A;  1SF9 A;  2CP7 A;  1WXU A;  4OMN A;  4BY6 B;  2HZY A;  2VV5 A;  2ZPG B;  4DBR A;  3CCL T;  2MI6 A;  4PJM A;  3G4S Q;  4M7A D;  4E7S A;  2FEI A;  3CXC P;  2YRC A;  1YNZ A;  5IHK A;  2F2W A;  1HYO A;  4MDX A;  3O5Z A;  2LCC A;  2RO0 A;  1JXM A;  4BDZ A;  1H64 1;  2DL8 A;  3J80 E;  4N4I A;  4ESR A;  3G6E T;  2EJ9 A;  2EFI A;  3JRZ A;  2AIR B;  2CP6 A;  3CCS A;  1N27 A;  2QDL A;  1U5S A;  5GAO r;  3JCM h;  1X27 A;  3JCM f;  3OYJ A;  4BI3 A;  3UDC A;  3SDZ A;  4JUV A;  3GBQ A;  4C8Q F;  2GFA A;  4ZN1 A;  3OYA A;  2ZCF B;  4PNO A;  2DXU A;  3QG1 A;  3OYC A;  5GAN d;  2EJG A;  3EGD A;  2VGN A;  2JMC A;  3E1S A;  3C4S A;  1SG5 A;  3DKM A;  3KUF A;  3G1J A;  4PJO A;  1SKU B;  2K79 A;  1Q7Y U;  1K4U S;  1Z9Q A;  1M1K C;  1AWW A;  4DBF A;  2KK4 A;  3CC4 Q;  2XDB A;  2MWO A;  4QVZ A;  5LJ5 g;  2AKL A;  1QVG P;  4E7K A;  1YJ9 T;  1VQM T;  1LCK A;  3HTR A;  4PJN A;  4X1V A;  4RG8 A;  2VWF A;  3M57 A;  4O5V A;  1P92 A;  2ROT A;  1UGP B;  2E6N A;  4Z88 A;  1YN8 A;  1VQ8 Q;  1OU8 A;  3LX7 A;  1PD0 A;  2IVW A;  1N8R R;  2V8J A;  4AG2 C;  2KE9 A;  3R6N A;  2DYI A;  5HCK A;  3OYG A;  4Y91 A;  2GCX A;  1Z9Z A;  2D0N A;  1N6A A;  3SD4 A;  3HRS A;  3X26 B;  1K9M C;  5LJ3 g;  2DZ9 A;  2COZ A;  3LLR A;  2CZ0 B;  4PJO C;  1YJN T;  3ZEH A;  3CME Q;  3GIB A;  5GAM d;  1VQ5 T;  3LW5 E;  4FYV B;  2RQV A;  4HCC A;  1K73 C;  2OTL T;  1IRE B;  5CKF A;  3CQT A;  1GBR A;  3EFO A;  5FWB A;  2FZC B;  3QWX X;  3G71 A;  4R0K A;  2XID A;  2C0T A;  2MK5 A;  1M9S A;  1UB4 A;  4F7U A;  1AD5 A;  1K76 A;  1M2O A;  2XK0 A;  4J6W A;  5LJ5 h;  1JO8 A;  3CMA A;  5LJ5 f;  4C92 B;  1SPK A;  4JLG A;  4J6Y A;  2O88 A;  3BDU A;  5CCA A;  4WCI A; 
#chains in the Genus database with same CATH homology
 2HDA A;  2BZ8 A;  3M0T A;  1UEC A;  4OML A;  2EW3 A;  2J06 A;  1U3O A;  1X2K A;  5I11 A;  1AWX A;  1UG1 A;  4J9H A;  1RI9 A;  2K7A A;  3NPF A;  2AKK A;  2KYM A;  1OPK A;  1PNJ A;  2EPD A;  4KRT A;  1V1C A;  1ZX6 A;  1WXT A;  1IO6 A;  2B86 A;  4LUD A;  2KEA A;  2CT4 A;  3RBB B;  1BK2 A;  4JJD A;  2ABL A;  1GCP A;  2LQW A;  2DL5 A;  4RTX A;  4HCK A;  2K6D A;  4GLM A;  4CC7 A;  1X69 A;  1Y57 A;  2FO0 A;  2KRM A;  4HVU A;  2RQT A;  3M0Q A;  1QLY A;  3NMZ C;  2NWM A;  4JZ4 A;  4AFU C;  2FPE A;  2L3Q A;  4RTU A;  3TSZ A;  2ECZ A;  1X6G A;  2KXC A;  2A36 A;  1H92 A;  4J9G A;  3VS6 A;  3TSW A;  3VRZ A;  1QWF A;  2KRN A;  1I0C A;  2DBM A;  4AFZ C;  4CC2 A;  1SRL A;  1WXB A;  1UE9 A;  3EG1 A;  4AFS C;  2L0A A;  3M0S A;  5IXF A;  1K0X A;  2CSQ A;  2VVK A;  1BU1 A;  1BBZ A;  2DBK A;  1UJY A;  1JU5 C;  1NM7 A;  3NGP A;  1WI7 A;  2YUO A;  4JJB A;  4JZ3 A;  4Z89 A;  4D8D A;  2LJ0 A;  1Y0M A;  2A37 A;  2DMO A;  3VS7 A;  1X6B A;  1WDX A;  2RF0 A;  2CUB A;  4J9D A;  2HSP A;  1JQQ A;  5ECA A;  1ABO A;  1TUD A;  3I9Q A;  1YP5 A;  1BB9 A;  2DL4 A;  2BZX A;  1NLP C;  3VS5 A;  2RQU A;  2O31 A;  2LJ1 A;  2G6F X;  1YWO A;  1PKS A;  3UA7 A;  2OI3 A;  1ZBJ A;  2LX7 A;  1T3L A;  1SHG A;  3M0R A;  2JXB A;  1RLP C;  1S1N A;  1HJD A;  2YT6 A;  1TUC A;  1WFW A;  4FSS A;  1X43 A;  1M8M A;  4HVW A;  2BZY A;  3H0F A;  3I5R A;  2DA9 A;  2KR3 A;  1B3Q A;  1UHF A;  4A63 B;  2C0O A;  2EGA A;  1AZE A;  2KT1 A;  4HVV A;  3SHW A;  2RN8 A;  2FPD A;  1HD3 A;  1PHT A;  2KRS A;  1VYV A;  2DX1 A;  4ZNX A;  1ZLM A;  1M3B A;  2YSQ A;  3VS0 A;  5I22 A;  1E6G A;  2GTJ A;  1FYN A;  2LZ6 B;  3U23 A;  2HBW A;  3VRY A;  1VYU A;  5GJW B;  2KNB B;  3JV3 A;  2KGT A;  3UA6 A;  1PWT A;  1M30 A;  2PTK A;  2AZS A;  3H0H A;  1PRL C;  4RTY A;  2MCN A;  2DNU A;  1HSQ A;  2EQI A;  1K9A A;  2V1Q A;  4LNP A;  1NG2 A;  1SSH A;  3A98 A;  4DEY A;  1AEY A;  2K9G A;  4J9I A;  2L2P A;  4IIM A;  2NUZ A;  1SEM A;  2RPN A;  1OEB A;  2ED1 A;  1PKT A;  3PVL A;  1A0N B;  3M0P A;  2EVR A;  1J3T A;  1NYF A;  2DLP A;  2W10 A;  2ESW A;  2DIL A;  1I07 A;  4AFQ C;  1UGV A;  3PE0 A;  4J9C A;  1N5Z A;  1VYT A;  4EIK A;  1UUE A;  1ABQ A;  3I5S A;  2L3S A;  1U06 A;  1NEB A;  2J7I A;  1KIK A;  3RNJ A;  5IH2 A;  1UJ0 A;  4LUE A;  2EBP A;  2DRM A;  1XOV A;  2EKH A;  2CH4 W;  2LNH B;  2YDL A;  2PNI A;  1UDL A;  1WIE A;  4F14 A;  2ROL A;  4RTV A;  4J9F A;  2DL3 A;  2JS0 A;  2EYW A;  2A08 A;  1FMK A;  4RTW A;  1QKW A;  2DM1 A;  2J6F A;  3NHN A;  3REB B;  2D8H A;  1OPL A;  1K0S A;  2MOX A;  2KBT A;  1EFN A;  2X3W D;  1GRI A;  2DF6 A;  1ZSG A;  3REA B;  2GBQ A;  1AWJ A;  4K11 A;  2JM9 A;  4CC4 B;  1YWP A;  2W0Z A;  2O9S A;  3FJ5 A;  4OMP A;  5IHN A;  3EHQ A;  1G2B A;  4D8K A;  2EYZ A;  2RMO A;  2VKN A;  2KT8 A;  3UAT A;  3EGU A;  1VA7 A;  2GTO A;  5GJV B;  3LH5 A;  2SEM A;  2D1X A;  2JS2 A;  2EGE A;  1E7O A;  2JT4 A;  1JEG A;  1W6X A;  2GGR A;  2CH4 A;  1NLO C;  2JMA A;  2E5K A;  1ZUY A;  5IXB A;  1MV0 B;  2DL7 A;  1UTI A;  1KJW A;  1H3H A;  1JXO A;  2CRE A;  1UFF A;  2DE0 X;  1SRM A;  3SEM A;  3UF4 A;  1KSW A;  2AK5 A;  4OMM A;  1SHF A;  3VS3 A;  2ED0 A;  2PZ1 A;  1GFC A;  5IHI A;  1MV3 A;  2GQI A;  3THK A;  1I1J A;  1W1F A;  1CSK A;  3C0C A;  3VS4 A;  1WXU A;  4J9B A;  4OMN A;  1T0J A;  5FW9 A;  1GCQ A;  2L3P A;  1QKX A;  2FEI A;  1YNZ A;  5IHK A;  2F2W A;  1RLQ C;  2GNC A;  2V1R A;  2MIO A;  2EYY A;  4J9E A;  3H0I A;  1QWE A;  3O5Z A;  1OV3 A;  1CKA A;  2FRY A;  1JXM A;  3EG3 A;  3KFV A;  4HXJ A;  2DL8 A;  4ESR A;  2CT3 A;  1QCF A;  2I0N A;  3ULR B;  2QDL A;  1U5S A;  2A28 A;  3PVQ A;  1X27 A;  2LCS A;  1G83 A;  1WA7 A;  2J6K A;  1UHC A;  2HEQ A;  3EG0 A;  1GBQ A;  1H8K A;  3TVT A;  2RNA A;  1AZG B;  1ZUU A;  4RTT A;  3GBQ A;  3I35 A;  4QT7 A;  2IIM A;  1T3S A;  1W70 A;  2LP5 A;  1WLP B;  2O2O A;  2H8H A;  1B07 A;  2DVJ A;  2LQN A;  1NYG A;  4IIO A;  1M3C A;  1ZUK A;  4JJC A;  2J6O A;  2LMJ A;  1GCQ C;  1RUW A;  2JMC A;  2YUQ A;  2JM8 A;  3VS1 A;  2M0Y A;  4M4Z A;  5EC7 A;  2K79 A;  2JW4 A;  1K4U S;  1Z9Q A;  1AWW A;  4RUG A;  2SRC A;  4GBQ A;  2EGC A;  4DEX A;  2CSI A;  1GFD A;  2DRK A;  2AKL A;  4CC3 A;  2FG0 A;  3M0U A;  5L23 A;  1GL5 A;  1KFZ A;  2J05 A;  1LCK A;  2JTE A;  4X1V A;  2CDT A;  4JPB W;  2LJ3 A;  2RQR A;  2VWF A;  3EG2 A;  2ROT A;  2YUN A;  3IQL A;  4Z88 A;  1YCS B;  4LN2 A;  1YN8 A;  2X3X D;  2P4R A;  4AG2 C;  2FPF A;  1M27 C;  2RQW A;  2KE9 A;  3R6N A;  2M51 A;  2DJQ A;  5HCK A;  4F17 A;  1CKB A;  5FWC A;  1OOT A;  1WYX A;  4LE9 A;  1Z9Z A;  2D0N A;  1MUZ A;  2KXD A;  2D8J A;  2K2M A;  2K3B A;  4E6R A;  1ARK A;  2FRW A;  3VS2 A;  2KRO A;  1WX6 A;  2HCK A;  2F2V A;  2RQV A;  4F16 A;  1T0H A;  3CQT A;  1GBR A;  5FWB A;  1X2Q A;  3ZL7 C;  1NEG A;  3QWX X;  1M3A A;  1E6H A;  2BTT A;  4R0K A;  2ENM A;  2C0T A;  2OAW A;  2DYB A;  1TG0 A;  4RTZ A;  2OJ2 A;  1AD5 A;  2KYB A;  2XMF A;  4OMQ A;  2AZV A;  4ORZ A;  1K76 A;  3QWY A;  1AVZ C;  4AG1 C;  4Y92 A;  2CUD A;  2YUP A;  2C0I A;  1K1Z A;  3H41 A;  2O9V A;  2EYX A;  1JO8 A;  4OMO A;  1SPK A;  4Z8A A;  1PRM C;  2F2X A;  2O88 A;  1AWO A;  3EHR A;  1AOJ A;  4WCI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...