2VVKA

Grb2 sh3c (1)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
56
structure length
56
Chain Sequence
GSVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Distinct Binding Modes of Two Epitopes in Gab2 that Interact with the Sh3C Domain of Grb2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords GROWTH FACTOR RECEPTOR-BOUND PROTEIN 2
total genus 14
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2008-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2vvkA00
1GFCA 4AFQC 2DJQA 4M4ZA 1B07A 2JTEA 4HVWA 2EYXA 3M0UA 3VRYA 1Z9QA 1E7OA 5FWBA 4HVUA 4K11A 2JM9A 2GQIA 3CQTA 2K7AA 1ZX6A 2A36A 2KYBA 1AVZC 1LCKA 3VS5A 4AFZC 2DILA 2IIMA 4QT7A 1UFFA 4J9BA 2O9VA 1WYXA 4F14A 1WXUA 4DEXA 1SRLA 3QWYA 1NM7A 2J06A 1ZUKA 3H0FA 2A28A 1CKBA 4R0KA 1WFWA 1GBQA 3LH5A 1UHCA 1W1FA 1M8MA 2L3QA 2EW3A 5I11A 2JXBA 2NWMA 2DF6A 3NMZC 1PRMC 2A08A 1PHTA 2LNHB 2EVRA 1E6GA 4A63B 1GCQC 2EBPA 2F2VA 2DL8A 4Z89A 3EHQA 2L2PA 1JQQA 2NUZA 2DL4A 2QDLA 2V1QA 1SPKA 1X6BA 1JXMA 4RTTA 3VS0A 1GL5A 3R6NA 4RTYA 2O9SA 2RN8A 3VS4A 1AWJA 2K3BA 1BU1A 2DRMA 4RTXA 1KFZA 2HEQA 1UECA 1S1NA 4OMNA 1AWOA 1UGVA 2V1RA 3EG0A 2EYWA 4AFUC 2JMAA 4IIMA 1FYNA 2HSPA 2CUDA 2D8JA 2PZ1A 3I5SA 3EG3A 1HJDA 1OPKA 2W10A 2DBKA 2LMJA 4OMLA 2F2XA 1GCQA 4RTWA 3ULRB 2DYBA 1JXOA 4IIOA 4DEYA 2D0NA 1MUZA 1G83A 2CT3A 2VWFA 2EPDA 2CDTA 4JPBW 4EIKA 1K9AA 1UUEA 2JM8A 2ROLA 2LP5A 1NEGA 1WXBA 1FMKA 2KRNA 1VA7A 2SEMA 2RNAA 4HXJA 2CREA 2W0ZA 1H8KA 1YNZA 3VS6A 3FJ5A 2HCKA 1I07A 2ED0A 2KGTA 1W6XA 2GNCA 5I22A 4ESRA 1I1JA 2LJ3A 2ED1A 5HCKA 4AG1C 1U06A 1BB9A 4CC2A 2AZSA 2LZ6B 3TSWA 4J9EA 2B86A 2VVKA 1K0XA 1QWFA 5IHNA 2ENMA 1QCFA 1SRMA 3VS7A 2DA9A 2DX1A 2JMCA 3RNJA 2DLPA 1HSQA 2O88A 4RTVA 5FWCA 4J9CA 2KRSA 1T3SA 4CC3A 4J9HA 1NYFA 2FPFA 2K79A 1K0SA 4OMQA 1HD3A 1NEBA 3VS2A 2RQRA 2SRCA 2O2OA 4D8KA 1G2BA 1MV0B 1ZUYA 3RBBB 4AFSC 2DL5A 1QLYA 1U5SA 2CUBA 1OV3A 1WDXA 1ZBJA 1ZSGA 3M0TA 3H0HA 3REAB 1UJ0A 3M0SA 4X1VA 4Z8AA 2KE9A 1RI9A 1GBRA 1XOVA 5IXFA 1PRLC 1WLPB 4JZ4A 4KRTA 4Y92A 1WA7A 2X3WD 5IHIA 2KT8A 1WIEA 2M51A 3VRZA 2DNUA 2JS2A 3EGUA 2KR3A 1MV3A 4J9IA 5IH2A 1UE9A 2EKHA 4LNPA 4Z88A 2ROTA 2RQVA 4F16A 2RQWA 4J9FA 1KJWA 1UJYA 2CH4A 1ZLMA 4WCIA 2EGAA 3REBB 2C0IA 3I9QA 2K2MA 2OAWA 2D1XA 3NPFA 2P4RA 1K4US 4HCKA 1J3TA 2J6OA 2FG0A 1H3HA 1AD5A 1T3LA 1GRIA 4FSSA 2YDLA 1AOJA 1UTIA 2LQNA 2AZVA 2CH4W 3PVLA 1VYUA 3H0IA 2BZ8A 2ECZA 1RUWA 2RQUA 1KSWA 1V1CA 1WX6A 1NLOC 4JJCA 3PVQA 3I5RA 2FEIA 1OOTA 2KT1A 1Y0MA 3JV3A 4J9GA 2HBWA 1JEGA 1JU5C 5FW9A 1EFNA 2FO0A 4LE9A 2J6KA 2I0NA 5GJVB 2VKNA 1YWOA 1I0CA 1IO6A 1YP5A 2HDAA 2F2WA 2FRWA 2CT4A 2A37A 2OJ2A 1M30A 3THKA 1UHFA 1QKWA 5GJWB 2L0AA 1GCPA 1K76A 2H8HA 5L23A 2O31A 3M0QA 2C0TA 1PNJA 2ESWA 2YSQA 2PTKA 1CSKA 2FPDA 1M3BA 1WXTA 2AKKA 3QWXX 3M0RA 3ZL7C 2L3SA 3SHWA 3I35A 1H92A 1X69A 2EGEA 2PNIA 2KBTA 2JW4A 1M27C 2YUPA 2K9GA 2BZXA 2DRKA 1RLPC 1TUCA 2FPEA 2KEAA 1PWTA 1NLPC 1RLQC 2YUNA 3EG2A 3UA7A 1Y57A 1X2KA 4JZ3A 1YWPA 3UATA 4OMOA 2DMOA 1QKXA 2ABLA 2KYMA 4D8DA 2KROA 1W70A 1AZGB 3U23A 5IXBA 1A0NB 5ECAA 1AWWA 4F17A 4GLMA 2K6DA 1ZUUA 4CC4B 1M3AA 2LQWA 2D8HA 3IQLA 3TSZA 2CSIA 2LCSA 1BBZA 3VS1A 1BK2A 2C0OA 1QWEA 1PKTA 1T0JA 1JO8A 1M3CA 1ABOA 2YUOA 2GTOA 3H41A 1X6GA 1T0HA 1VYVA 2EQIA 2GBQA 2EYZA 2JS0A 2RF0A 3EHRA 4ZNXA 2OI3A 2KXCA 2XMFA 1NYGA 1CKAA 4LUDA 4JJBA 2LX7A 4LN2A 3A98A 1AEYA 2BZYA 2LJ1A 3O5ZA 2RMOA 3NHNA 4E6RA 4CC7A 1KIKA 2DVJA 3KFVA 1K1ZA 4HVVA 2KXDA 1SHGA 2FRYA 2GTJA 2KNBB 1SSHA 2DM1A 1U3OA 1YN8A 1OEBA 1PKSA 1ABQA 2G6FX 2EYYA 3M0PA 2J6FA 1VYTA 3VS3A 2RQTA 2E5KA 1SEMA 2YT6A 3UA6A 2MIOA 1ARKA 1YCSB 2RPNA 2X3XD 3NGPA 1X43A 2MCNA 2DL3A 3SEMA 4RTUA 4J9DA 1TG0A 5EC7A 4JJDA 1SHFA 2DL7A 2MOXA 2YUQA 2BTTA 2J05A 2J7IA 1Z9ZA 3TVTA 1N5ZA 4RTZA 2EGCA 2AK5A 3GBQA 2AKLA 2CSQA 1B3QA 5IHKA 1GFDA 2LJ0A 3C0CA 4OMPA 2M0YA 4RUGA 1OPLA 1UG1A 4ORZA 3PE0A 1NG2A 1AWXA 4GBQA 2GGRA 2KRMA 1AZEA 4AG2C 2JT4A 1E6HA 2L3PA 2DBMA 2DE0X 1X2QA 3EG1A 1TUDA 4LUEA 3UF4A 1X27A 1WI7A 4OMMA 1UDLA
chains in the Genus database with same CATH superfamily
3GNGA 4O6JA 2MWPA 3CMAQ 4XTYA 4C5EA 1Q82C 2Y90A 4KUDK 3CCQQ 4C0GA 4XQ3A 3VU3C 3M0UA 3BFMA 5IN1A 3CCJT 3QO3A 1E7OA 4HVUA 4B9XA 4N4IA 4E7JA 3LYIA 3CQTA 1NJIR 4IURA 2K7AA 2A36A 1Y96B 4BI3A 3MP6A 2LNVA 3VS5A 4AFZC 3L2UA 2DILA 2CZ6B 1UFFA 2Y4YA 4F14A 3RIRA 2OTJT 2RI2A 5D6WA 1SRLA 3I56A 1YJWQ 4PFPA 1VQ8Q 4M78E 4R0KA 2QK0A 3OYMA 4QQGA 3JCMX 1VQ8A 4C0DB 5I11A 2NWMA 1PRMC 1ZA2B 1IGUA 1PHTA 4LXCA 1RAEB 2LQ8A 3V7SA 2DL8A 4OB2B 2QDLA 2MK5A 1SPKA 1JXMA 4F04B 4R56A 1GL5A 3OW2S 1D09B 1G3SA 2O9SA 2O4XA 1LVKA 3VS4A 1AWJA 2K3BA 4RKUE 2VC8A 5L8RE 2DRMA 2K3YA 2LRQA 4RTXA 1AWOA 5GANg 1UGVA 3FDRA 1LNXA 3EG0A 4KT0E 4M78B 2JMAA 5LJ5g 5KYYB 5FU7B 2VASA 1PSEA 1VQLQ 2CUDA 2JJ9A 2D8JA 3H8ZA 1WHMA 1HJDA 2DBKA 1QVFA 2LMJA 5KYUA 4PJMA 3VUBA 3H6ZA 4RTWA 4MZPA 1BIBA 4FL6A 2GCXA 2MMPA 2D6FA 5GAOm 1MUZA 4II1A 1Q82R 2KDSA 2EPDA 2HBPA 4JPBW 1ZA1B 1UUEA 3QDFA 3A8HB 2LP5A 1MMGA 2L3RA 1WXBA 3VYHB 4BD3A 5KE2A 1FMKA 4JRQA 2SEMA 1VQKT 3PTAA 2ATCB 2E70A 2QAZA 1LOJA 2DEUA 1Q7YU 4PJOD 4ELYC 1G3TA 2P0QA 2A7YA 4GY5A 3X26B 1YI2A 1W6XA 1RI0A 5GAMj 5I22A 3CC4A 1K8AC 5FU6C 1G8XA 3I56T 2ED1A 3OBWA 1MMDA 4XK8E 1K8AU 4ZGEB 1Q95G 5CAIA 3JB9J 3TSWA 5LJ3j 2VVKA 4GLKA 5IHNA 3VS7A 1XJWB 3QDRB 2DA9A 4V2SA 3RNJA 5CKHA 1OZ3A 4NL2A 1NE8A 3QJ6A 2DIQA 1O9SA 4J9CA 1T3SA 3CCSQ 2O4XB 3MJXA 4J9HA 3J7AF 1NYFA 2DJZA 2COWA 4OB0B 4MMLA 5KE3A 5D6XA 3CCLT 3JB9D 4PK4A 4D8KA 4AFSC 1M90C 1F1BB 4PJOB 2RJCA 2DD4A 1VQMQ 3CC4T 1ZSGA 4C8QG 5A0DA 1V29B 4M75C 3M0SA 4X1VA 4OF1A 1GBRA 4D6WA 3OYHA 1XOVA 2QQSA 5IXFA 1WLPB 4JZ4A 2CKKA 1TUGB 6AT1B 3ASKA 2NUPB 1VUBA 1WA7A 1OULA 1KQSA 3VJPA 2JS2A 4EDUA 1MV3A 4J9IA 4LNPA 4Z88A 5A0LA 1PSFA 3OYAA 5CCAA 4IUQA 2RK1A 1UJYA 3OYKA 5I2SA 4P5NA 4BUGA 2BUDA 3HTRA 4DBHA 4LDUA 3OYIA 3NPFA 2P4RA 1BCOA 2J6OA 1J3TA 4NL3A 2ZPGB 1G3WA 2EFIA 3V8JA 4FSSA 3NTHA 2MPXC 5DLQE 2JNGA 2PUKB 3H0IA 3ZEHA 3S3OA 1V1CA 1NLOC 3PVQA 3CCVT 2YLBA 3JSCA 3RDVA 4J9GA 1U1SA 2KAFA 4E7KA 4L6V5 2I0NA 2VKNA 2QQRA 1TXQA 1IO6A 2LT4A 1YP5A 3C94A 3LGLA 2DTOA 1R8OB 2A37A 3THKA 2OJ2A 1W2BP 3QZ9B 1QKWA 1KHCA 5GJWB 2AT1B 2L0AA 1VQNA 2V8KA 3DB3A 4B9WA 2OTJA 4AT1B 2O31A 2C0TA 2ESWA 2YSQA 1KQ1A 2DXTA 3UDCA 2FPDA 2QQ9A 3TQ7P 3CMAT 1M3BA 2E64A 2KQWA 5KYXB 4MZTA 2LT1A 2QGGA 3LH0A 2FVUA 2YUPA 3OQ5A 2K9GA 2BZXA 1TUCA 5DLOA 3MO8A 1B7TA 2PU9B 1UB4A 5EG2A 4E2FB 2HQEA 5CVIA 5D7UA 2ZPBB 3BE3A 4X9DA 2ABLA 2KROA 3TEEA 4M7AF 2RHIA 1KC8U 1AWWA 4VUBA 4F17A 4E7IA 3RMSA 2K6DA 1M3AA 4FCYA 2ZZDA 2CSIA 2LCSA 3CMAA 5DY9A 2DIGA 1ACMB 1JO8A 2FYKA 1ABOA 4M77D 4CI0C 5GAOl 4A4HA 2DETA 4C92F 1YJNT 3O8VA 2EQIA 2EYZA 1MMAA 2CZ1B 1YJWA 4M7AD 2JVVA 1FMWA 2LX7A 1RACB 4LN2A 3EGDB 1X6OA 2ZAEA 2O01E 1FX7A 3MEVA 3NHNA 2DYIA 3SB2A 1LJOA 4PL6A 1KQSS 3A8MB 2KXDA 4M7AG 1VQ9T 2DM1A 2CP5A 2E6ZA 2EYYA 1NJIC 4KBMB 4OGCA 2ZPIB 1YJ9A 1IRXA 1N6AA 4A54A 3G6EA 3G71Q 2ZPFB 3UA6A 1WHJA 4RCCA 2QI2A 1LPLA 1KQSP 3I55Q 3G71A 2F5KA 2K5LA 2DXBA 1K8AR 1VQ5A 4M77G 1YIJQ 3V8LA 4PJOG 2J05A 3Q1JA 2CP7A 2J7IA 3RR6A 3HKSA 4MZMA 4BI8B 4FW1A 2CSQA 2P0PA 3CCEQ 4F7UG 3C0CA 2RO0A 3M9QA 4ORZA 5KCOA 3CXCP 5LJ3d 2KRMA 2JT4A 4IUTA 2A3LA 4LUEA 1Q82U 3C4SA 1X27A 4OMMA 3LW5E 1G3YA 1GFCA 1EZZB 3G1JA 4M4ZA 1B07A 2JTEA 1ZSZB 3VRYA 5CQXA 3CCVQ 4M7AA 2G3RA 3CC7Q 3JCMP 1ZX6A 4BE1A 3NTKA 3G7ZA 2YXYA 1LCKA 5GAN3 2E4HA 4J6YA 3CCMQ 3OY9A 3HFNA 2IIMA 4C0DC 4FSXA 2O9VA 1WYXA 5A2QE 5J26A 1YITT 3QWYA 3LLRA 3NTIA 1YHQT 1NM7A 1FXXA 1JJ2P 3H0FA 1CKBA 3OYCA 2WSFE 1R77A 4JRIA 5CKEA 4LDXA 1UHCA 2E65A 3CCJA 5LJ5h 2DXCA 4ZGDB 1OU8A 1M8MA 3OW2P 2JXBA 4OB3B 1KC8R 2DF6A 2V26A 2A08A 2LNHB 2EVRA 3QG1A 4A63B 1GCQC 3QBYA 1JB0E 3EHQA 2L2PA 5KYNA 1JQQA 2NUZA 2DL4A 2EJ9A 2H3EB 3RMQA 4E7LA 3VS0A 1IB8A 2RN8A 3HRTA 7AT1B 1BU1A 1YJNA 4EMKA 4KGVB 1S1NA 1OQKA 3OW2A 3CC4Q 1QVPA 1QVGA 3NFCA 2HSPA 4C92D 1JRIA 1IREB 2HQXA 3I5SA 5DM7R 3EG3A 1OPKA 3M54A 4C92E 3JCMW 1Q86C 2B8AA 1GCQA 3G6EQ 3X24B 1JXOA 4DEYA 2RHXA 2L8DA 1G83A 2VWFA 1ZSZA 1QCOA 3ME9A 5KYWB 4XTZA 5GAN6 1NPPA 3HSBA 2EQKA 2ROLA 1NEGA 2QQBA 1VA7A 4HXJA 2AIRB 2E3IA 3OYYA 2W0ZA 4C92B 1ZSZC 1S72T 3HHTB 2DVEA 2ED0A 2KGTA 1C1AA 3CXCS 4MDXA 1FWZA 4ESRA 1I1JA 3GNFB 4M77C 2LJ3A 1KD1R 3VV0A 2PVOB 3EG9B 3CCUQ 1U06A 1BB9A 2AZSA 4J9EA 1VQ8T 2B86A 3CCUT 1K0XA 1QCFA 2XDPA 1M8VA 2EJGA 2IVWA 2JMCA 3DKMA 5GANd 1QCNA 1N8RR 4RTVA 2LC4A 3EFOA 4F7UB 5CIUA 1YJ9T 3PNWC 2GF7A 2FPFA 1M4ZA 2DO3A 3UPUA 3CCJQ 4XTVA 1VQ7A 2RQRA 4ATOA 2YRCA 2KVQG 3DLLA 1SKUB 3M0TA 1VQPT 3QIIA 2QTXA 1M90U 3REAB 4Z8AA 2KE9A 1RI9A 4KH1B 2XIDA 3G6ET 2GQVA 3SD4A 3CMET 4Y92A 1RADB 2KI7A 3QSUA 1MNDA 1VIFA 1WIEA 2M51A 2DTHA 3VRZA 3D7SB 1BI2A 4XTUA 4BE2A 4ZTJA 1UE9A 2DD5A 2ROTA 4QW2A 3HRSA 2QQAA 2A0FB 2JZ2A 4J9FA 1HXDA 1C6VX 2QEXA 2FHDA 4WCIA 3C12A 3FEOA 3CPWS 1B34A 1TOVA 1WNLA 2PVDB 4HCKA 1D1CA 2XI9A 4M75G 3M58A 4ZTFA 3UT1A 5GAOn 4HT8A 3MEAA 4ANJA 1AOJA 5C0MA 2AZVA 2CH4W 5KCHA 1BYMA 1PCXA 3GF5A 2XG8D 2VYTA 4OVAA 4HT9A 2FEIA 2KT1A 1FMVA 5KYUB 3JB9H 1Y07A 2OX7A 3QJYA 1YHQA 1JEGA 4RG8A 4F7UA 1IHVA 5FW9A 4IUUA 5GAN7 1MNEA 1Q86R 3OYGA 2J6KA 5GJVB 1WHGA 2CP0A 1YWOA 1JJ2A 4LD6A 3ER0A 2F2WA 3CD6T 2FRWA 2CT4A 5LJ5e 5IT9E 3A8OB 1UHFA 1YITQ 3CCEA 4WF2A 1PM3A 2QDYB 2RA2A 2H8HA 4O5VA 3JB9I 3M0QA 1UGPB 2XHCA 3A5ZB 2KMTA 2PTKA 4PFOA 2MAMA 4Q5WA 3P8HA 3ZL7C 3PMIA 3CC7T 2E1HA 3P8DA 1VQMA 2X35A 3MP1A 2EGEA 4IKFA 4M7DF 3I55A 2KBTA 5CKDA 3RKWA 1M27C 3SWNC 2DRKA 1VQ7Q 1NLPC 1VQ4Q 2IG0A 1QP3A 1WHLA 3SFMA 3JRZA 1K73U 4FT2A 3VKIA 3OYDA 4JZ3A 4OMOA 1D3BA 3EFRA 3E9GA 3QZ5B 1QKXA 2KYMA 4EMKC 1D0ZA 4C8QE 1W70A 5LJ3f 1AZGB 3U23A 3CD6A 4A4FA 2LTOA 5ECAA 1B34B 3CCET 1BKBA 3P8BB 3JB9G 3CCVA 1ZUUA 2LQWA 4XU1A 5J3BA 3JCMh 3TSZA 4M77A 1TU0B 1BBZA 2NUTA 1T0JA 2YUOA 2QTVA 5KYXA 2GTOA 3H41A 4N0AC 3I55T 2K57A 4A53A 1KD1C 9ATCB 3EHRA 2KXCA 3EH2A 2BE7D 2CZ7B 4M7AC 4KH0B 1XNIA 3JCMf 3A98A 3PIOA 2LJ1A 2OAUA 4E6RA 3OS1A 2X4YA 1KIKA 8AT1B 2QA4T 3KFVA 4C5IA 2HZYA 4HVVA 2HSEB 2HNIA 2OTLA 3A1PA 5GAN5 2F69A 2CP2A 3JB9F 3M0PA 1M1FA 3JCMe 1BI0A 3LGFA 4X34A 3JCMb 2DFUA 3FLGA 2F1LA 3CCRA 2MIOA 3QPHA 4JDSA 3OSVA 1YCSB 4XAXB 3X25B 2DL3A 1TG0A 2RJDA 5EC7A 1K9MU 2MOXA 5A0GA 3M4GA 1Q86U 4BDZA 2XKOC 4QQ6A 5I2MA 5I21A 3TVTA 2EGCA 4MMKA 3TCJA 2F5TX 1TTHB 2AKLA 3JAME 4J6WA 1GFDA 3EGDA 2BIVA 1OPLA 4KULA 3PE0A 3LWHA 1MGQA 1AZEA 3OSSC 3VYGA 1VQLA 2DXUA 3L1AA 3EG1A 1X2QA 4QVCA 4M7DA 1UGSB 4JLIA 3JCMg 2LX9A 1UEBA 4AFQC 3DB4A 4HVWA 1OYXA 2EYXA 2JUFA 1Z9QA 3QHSA 5FWBA 4C0FA 1TS9A 1N8RU 4M75D 2KYBA 2DPPB 1VQ9A 4M78F 2MI6A 4OGEA 1KK7A 5KH6A 5LJ5f 2EKOA 2MF2A 4J9BA 5GAOq 1WXUA 2X9HA 1EX4A 4M7DD 1VQKA 2J06A 3N5BB 1GBQA 1OX8A 3L2WA 3J80E 1H641 3JCMQ 1DJ7B 2AHJB 1RAIB 2L3QA 2EW3A 2OTLT 3CEYA 4Y28E 1RAFB 2NLUA 3PGGA 1E6GA 2LDMA 3SDZA 2EBPA 1BCMA 3OMGA 2V1QA 4FYVB 4KGZB 4C8QD 3CD6Q 2Z0WA 4RTTA 5FU7C 1WJRA 3R6NA 2YHTA 4RTYA 1N9RA 3MEUA 4QKUA 4ZN3A 1KFZA 1WGSA 5GMKh 2JN0A 3X20B 2DEQA 1AHJB 3A8GB 4IIMA 1IXDA 3CBPA 1QMCA 4C0ZA 2PZ1A 2WSCE 5HKCA 5GAOr 1VQNT 4M7DB 2F2XA 4DQ2A 4J7FA 2YRVA 2DYBA 4BDYA 4M78C 5GANe 1SG5A 1D0YA 1QVFS 2CT3A 1RAAB 4EMGA 4EIKA 2PVGB 1K9AA 1X01A 4F7UE 3X28B 2HKQB 2L89A 2RB6A 2VB6A 4JRKA 5FU6B 1U1TA 2P0KA 2QEXQ 3BW1A 1YNZA 3VS6A 3FJ5A 1Q81C 2HCKA 1OZ2A 1IHWA 2MYSA 4CRIA 2X4JA 3INZA 5FROA 2GNCA 1I5OB 4XU2A 2DZ9A 3LX7A 5HK0A 4RG2A 2LQKA 4AG1C 2VXEA 2H3JA 2KSSA 2WSEE 4CC2A 2XD0A 4FYWB 2LZ6B 1JBMA 4OP0A 1QWFA 3EH1A 2GFAA 1HSQA 5GMKj 2O88A 5FWCA 2YRDA 2C06A 1VQOQ 4FYYB 3QXEB 1BIAA 3URGA 1W4SA 2HMAA 4PJOE 4M77F 4OMQA 3CC2A 1HD3A 1NEBA 4M75A 1VQKQ 2QA4A 1D1BA 1G2BA 1MV0B 1ZUYA 2EQUA 3RBBB 2DL5A 3GP8A 1U5SA 2CUBA 1OV3A 1WDXA 3FB9A 3PT9A 1OX9A 4X9CA 2LCLA 4PFZA 2HKNA 1Q81U 1VQNQ 2VV5A 2X3WD 2X4WA 3JCMV 2DNUA 1VQLT 2MWOA 4M7DC 3EGUA 3M53A 2KR3A 1WQ7A 5HY6A 5LL6S 3CC2Q 5IH2A 1RAHB 2EKHA 1U8RA 4F16A 1VQPA 2RHYA 3MKDA 4C92G 2CH4A 3KUFA 1ZLMA 4KGXB 3OS5A 3EGXA 2K2MA 1K4US 4C8QF 2M0OA 1WPYA 4EMKB 1KG1A 2FG0A 1AD5A 5GMKe 2YDLA 3JCMJ 1UTIA 1WJQA 2LQNA 4LDWA 3EFSA 3PVLA 5GMKl 1RUWA 2RQUA 1KSWA 1WX6A 4UC4A 3G4SA 4JJCA 4HA8A 3I5RA 2LCCA 3A8LB 4M78D 3L2QA 1EFNA 2FO0A 2K4YA 4LE9A 4J83A 3FRNA 4E7ZA 2DK3A 4AMCA 2HDAA 1TWBA 2QYZA 2BKDN 2EJFA 1YJNQ 1YJWT 5IAYA 4M75B 1M2VA 3OYEA 2OTJQ 1GCPA 2R57A 4BY6C 4QQDA 2L5QA 1VOMA 3SWNB 3JCMc 1W2BA 2WACA 1QQJA 1WXTA 2AKKA 3M0RA 2L3SA 1Y96A 4B6MA 3SHWA 4F7UF 3I35A 4JS4A 1HK9A 1X69A 1W2BS 1Y71A 3PFSA 3V7CA 2JW4A 3QUIA 3CCQT 1UGRB 2HAXA 1RLPC 5LJ3h 1RLQC 2YUNA 1YIJT 3UA7A 2QASA 1M90R 1N8RC 2E3HA 3META 1YWPA 3L2ZA 3G71T 3TREA 2RH2A 3V8KA 5GAN8 5GAMh 2COZA 2NUPA 2PUOB 2EQJA 1A0NB 3RKYA 1SSFA 2E41A 4ELZC 2VUBA 2K5FA 4CC4B 2D8HA 3MHXA 3IQLA 4FYXB 1WJSA 2CYZB 5D6YA 3HL8A 2M1HA 2CZ0B 2BE9B 1PD0A 1QWEA 4LDYA 1NBEB 3RUXA 4E7SA 1X6GA 1T0HA 1VYVA 3E1SA 2GBQA 4PJOF 2V8IA 4M77E 3AT1B 2OI3A 2XMFA 4M78A 4JJBA 1M1GA 3CCSA 1KD1U 4WTOB 4J5YA 1VIEA 4CC7A 2DVJA 1YCYA 4JLGA 2XDBA 1D1AA 3M57A 1Q7YC 3CPWP 2QA4Q 4LDVA 2KNBB 2IPOB 1U3OA 4EPCA 1OEBA 3GLXA 4FT4A 2ZPHB 3V7RA 2RI3A 2X3XD 2FZGB 2HD0A 2NUTB 3NGPA 1X43A 4PJNA 4TVRA 3SEMA 4J9DA 2DL7A 2YUQA 2BTTA 1XQHA 5GAMf 1N5ZA 1N27A 1VQ6T 2K3XA 5CKFA 3GBQA 1M5Q1 1M1KC 5IHKA 2LJ0A 3C95A 5GAMe 2JTMA 2M0YA 4PNOA 1UG1A 5KYWA 1I4K1 1NG2A 4LD9K 1S72A 3EAEA 4PLIA 2KY9A 4AG2C 1E6HA 1VQ7T 2K2VA 3OYLA 2DE0X 1VQMT 3UF4A 3BY7A 3S3MA 1WI7A 1VQ4T 4NS5A 2CP6A 2DJQA 4A4EA 2PQWA 2NYSA 4K11A 1QW1A 1K73C 2JM9A 2GQIA 4HCCA 3KBGA 3EG9A 1AVZC 2X51A 1X75C 2R58A 4DBQA 2EIFA 4PJOA 4R55A 4QT7A 1PD1A 1MHNA 1I8FA 4DEXA 3J81E 1ZUKA 2DAQA 2A28A 1WFWA 3ZBDA 3GIBA 3LH5A 3EFOB 1W1FA 3BDUA 4C92C 3GOXA 1M2OA 3L2RA 3I56Q 2XICA 3NMZC 1VQOA 3H9NA 2D9TA 1Q7YR 2CP3A 2JTFA 3OS0A 3OYFA 2F2VA 4M7DG 4Z89A 1G5VA 4DBFA 1JJ2S 1X6BA 3CCRT 4Y91A 4EMHA 3ZFJA 4XTWA 2EWNA 2DTIA 4PJJA 3KXTA 5FRNA 1KHIA 4OMFB 4FIBA 2HEQA 1EIFA 1UECA 1RABB 4OMNA 3CCQA 2V1RA 2HL3A 1I5LA 2EYWA 4AFUC 1H3ZA 1Y7XA 1FYNA 4C5GA 1YI2Q 1YIJA 4OB1B 2W10A 2RHZA 4JUVA 4OMLA 3ULRB 5C6SA 1S72Q 4IIOA 2D0NA 1VQ5T 5AYFA 1VQOT 1RL2A 3T9NA 3CC7A 3M55A 3CMEQ 2CDTA 1IZ6A 5GAN4 2JM8A 2RD1A 4L59A 4ME7A 2VGMA 3DLMA 1YITA 3QYGB 2V8JA 2KRNA 4M75F 2RNAA 4E47A 4FW2A 2CREA 4XTXA 3HFOA 1H8KA 1VQ5Q 1I07A 2VGNA 3OYBA 3OA6A 1M1KU 4RMOA 1ZBXA 5M9OA 1M1KR 1AT1B 1BI1A 1K9MR 4M7AB 1ZQ1A 5GMKm 4E7HA 2OTLQ 5HCKA 1YJ9Q 3E19A 4A4KA 2QEXT 1M9SA 4C8QC 4KUIA 4HCBA 2ENMA 1SRMA 3WXMB 3MP8A 2DX1A 3CCLQ 4JS5A 2E10A 5GAMg 1C0MA 2DLPA 4J7IA 1BI3A 1OI1A 2KRSA 4CC3A 1YBYA 2R5AA 2YWWA 3OS2A 4FU6A 1WHKA 3CCRQ 3MEWA 1V76A 4C8QA 2EAYA 1QP2A 2K79A 3CCST 1K0SA 5LJ3g 4MDWA 3VS2A 3VUZA 2SRCA 2P84A 4L5GA 2O2OA 1OU9A 4ZGJB 1ZHIA 5CR2A 1I81A 1QLYA 2VXFA 5GANj 3CPFA 3QYHB 1ZBJA 3CCMA 5LJ5j 2RHUA 1P92A 3H0HA 4A4GA 1UJ0A 3OBYA 1IGQA 1VQ6A 1WZOA 1PRLC 4KRTA 3CC2T 2XDDA 5IHIA 2KT8A 3M5AA 1WHHA 1KQ2A 3FC3A 4QVZA 2HL5C 3FJPA 4DOVA 1NJIU 2RQVA 4M77B 3RKXA 4N4GA 2RQWA 3AHUA 5CKBA 1KJWA 2E12A 2EGAA 3REBB 2C0IA 3I9QA 1K73R 2DKGA 5FLXE 2OAWA 1Q81R 2D1XA 5J39A 4XU0A 2YLCA 3WVEB 5LJ3e 3CBOA 4BI4A 4J8OA 1RAGB 4JJNK 1H3HA 1T3LA 1GRIA 4PKCC 2CGHA 4C92A 1QVGS 1QVFP 1VYUA 2M16A 4QVDA 2BZ8A 5GAN2 2ECZA 2QGFB 2R5MA 1VQ4A 1OOTA 3L42A 1Y0MA 3JV3A 3TU4K 2HBWA 4J6XA 1YHQQ 1JU5C 2Y4XA 2FL7A 4C5HA 4C8QB 4BY6B 1HYOA 5GANh 3G4SQ 1QVGP 4PJOC 1I0CA 3MPUB 5GMKi 3HPWA 1M30A 8ATCB 3OB9A 5CK9A 4HCZA 1K76A 4M7DE 5L23A 3CMEA 1PNJA 3EGXB 2XU8A 1CSKA 5GANf 1WQWA 4N4HA 3QWXX 4N0AA 1YI2T 2FZKB 3S3NA 1H92A 2EQMA 2PNIA 4M75E 4BB7A 1UGQB 2FB7A 2FPEA 3BDLA 1TH7A 2GFUA 1PWTA 1SF9A 2KEAA 2KK4A 3EG2A 2ZGWA 2FZCB 4YTLA 4DOWA 2K5IA 1Y57A 1X2KA 2XK0A 3UATA 4DBRA 2DMOA 3OYJA 4DA4A 4D8DA 1VQ6Q 4JRPA 3M56A 4BACA 5IXBA 4ZN1A 3L2VA 1M2VB 2DERA 2E6NA 3M4YA 4GLMA 2RJFA 2LVMA 3CCUA 3SWNA 5GAMd 3E9FA 3VS1A 1BK2A 3OYNA 2C0OA 2M9UA 2CS7A 1PKTA 4PJLA 1M3CA 3PMTA 4NOYA 3WVDB 3R6OA 2COYA 2RI5A 1N9SA 3CCMT 2JS0A 2RF0A 3RESA 4ZNXA 3OMCA 1NYGA 3G4ST 1CKAA 4LUDA 1TSFA 3F70A 5CQYA 5FRMA 1NZ9A 4Z02A 3CXCA 1YFNA 1AEYA 2BZYA 3O5ZA 2RMOA 2DZCA 2EYQA 2RJEA 1VQ9Q 2X4XA 1PC0A 3HRUA 1K1ZA 1SHGA 2HQHA 2FRYA 5HK3A 2GTJA 3RERA 2E5QA 4PLLA 1R0BG 1D0XA 1SSHA 5LJ5d 1YN8A 2M02A 2QG9B 1PKSA 1ABQA 2G6FX 3LWIA 2J6FA 3S6WA 1VYTA 3PIPA 3VS3A 2D0QB 1NPRA 2P4TA 2RQTA 5GAOp 4FM4B 2E5KA 1SEMA 2JOYA 3HP9A 2YT6A 4RCBA 1KC8C 5AT1B 5CO7A 1ARKA 2RPNA 1R0CB 1XTDA 3M59A 2MCNA 4RTUA 2RM4A 4JJDA 3CCLA 1PG5B 1SHFA 3MCAB 3UWNA 1MMNA 1Z9ZA 2ZPEB 3CBMA 4RTZA 2AK5A 3JCMd 3FIFA 1K9MC 1O75A 1B3QA 3E2UA 4IUPA 3CPWA 4OMPA 3GPLA 4RUGA 4HKEA 5KYYA 1GXIE 3QKJA 1AWXA 4GBQA 2GGRA 2L3PA 4BE0A 2ZCFB 2DBMA 4M78G 1VQPQ 2I2LA 4IUVA 1TUDA 1D3BB 4M7AE 2QXFA 2RK2A 4XU3A 1UDLA
chains in the Genus database with same CATH topology
1GFCA 4AFQC 2DJQA 4M4ZA 1B07A 2JTEA 4HVWA 2EYXA 3M0UA 3VRYA 1Z9QA 1E7OA 5FWBA 4HVUA 4K11A 2JM9A 2GQIA 3CQTA 2K7AA 1ZX6A 2A36A 2KYBA 1AVZC 1LCKA 3VS5A 4AFZC 2DILA 2IIMA 4QT7A 1UFFA 4J9BA 2O9VA 1WYXA 4F14A 1WXUA 4DEXA 1SRLA 3QWYA 1NM7A 2J06A 1ZUKA 3H0FA 2A28A 1CKBA 4R0KA 1WFWA 1GBQA 3LH5A 1UHCA 1W1FA 1M8MA 2L3QA 2EW3A 5I11A 2JXBA 2NWMA 2DF6A 3NMZC 1PRMC 2A08A 1PHTA 2LNHB 2EVRA 1E6GA 4A63B 1GCQC 2EBPA 2F2VA 2DL8A 4Z89A 3EHQA 2L2PA 1JQQA 2NUZA 2DL4A 2QDLA 2V1QA 1SPKA 1X6BA 1JXMA 4RTTA 3VS0A 1GL5A 3R6NA 4RTYA 2O9SA 2RN8A 3VS4A 1AWJA 2K3BA 1BU1A 2DRMA 4RTXA 1KFZA 2HEQA 1UECA 1S1NA 4OMNA 1AWOA 1UGVA 2V1RA 3EG0A 2EYWA 4AFUC 2JMAA 4IIMA 1FYNA 2HSPA 2CUDA 2D8JA 2PZ1A 3I5SA 3EG3A 1HJDA 1OPKA 2W10A 2DBKA 2LMJA 4OMLA 2F2XA 1GCQA 4RTWA 3ULRB 2DYBA 1JXOA 4IIOA 4DEYA 2D0NA 1MUZA 1G83A 2CT3A 2VWFA 2EPDA 2CDTA 4JPBW 4EIKA 1K9AA 1UUEA 2JM8A 2ROLA 2LP5A 1NEGA 1WXBA 1FMKA 2KRNA 1VA7A 2SEMA 2RNAA 4HXJA 2CREA 2W0ZA 1H8KA 1YNZA 3VS6A 3FJ5A 2HCKA 1I07A 2ED0A 2KGTA 1W6XA 2GNCA 5I22A 4ESRA 1I1JA 2LJ3A 2ED1A 5HCKA 4AG1C 1U06A 1BB9A 4CC2A 2AZSA 2LZ6B 3TSWA 4J9EA 2B86A 2VVKA 1K0XA 1QWFA 5IHNA 2ENMA 1QCFA 1SRMA 3VS7A 2DA9A 2DX1A 2JMCA 3RNJA 2DLPA 1HSQA 2O88A 4RTVA 5FWCA 4J9CA 2KRSA 1T3SA 4CC3A 4J9HA 1NYFA 2FPFA 2K79A 1K0SA 4OMQA 1HD3A 1NEBA 3VS2A 2RQRA 2SRCA 2O2OA 4D8KA 1G2BA 1MV0B 1ZUYA 3RBBB 4AFSC 2DL5A 1QLYA 1U5SA 2CUBA 1OV3A 1WDXA 1ZBJA 1ZSGA 3M0TA 3H0HA 3REAB 1UJ0A 3M0SA 4X1VA 4Z8AA 2KE9A 1RI9A 1GBRA 1XOVA 5IXFA 1PRLC 1WLPB 4JZ4A 4KRTA 4Y92A 1WA7A 2X3WD 5IHIA 2KT8A 1WIEA 2M51A 3VRZA 2DNUA 2JS2A 3EGUA 2KR3A 1MV3A 4J9IA 5IH2A 1UE9A 2EKHA 4LNPA 4Z88A 2ROTA 2RQVA 4F16A 2RQWA 4J9FA 1KJWA 1UJYA 2CH4A 1ZLMA 4WCIA 2EGAA 3REBB 2C0IA 3I9QA 2K2MA 2OAWA 2D1XA 3NPFA 2P4RA 1K4US 4HCKA 1J3TA 2J6OA 2FG0A 1H3HA 1AD5A 1T3LA 1GRIA 4FSSA 2YDLA 1AOJA 1UTIA 2LQNA 2AZVA 2CH4W 3PVLA 1VYUA 3H0IA 2BZ8A 2ECZA 1RUWA 2RQUA 1KSWA 1V1CA 1WX6A 1NLOC 4JJCA 3PVQA 3I5RA 2FEIA 1OOTA 2KT1A 1Y0MA 3JV3A 4J9GA 2HBWA 1JEGA 1JU5C 5FW9A 1EFNA 2FO0A 4LE9A 2J6KA 2I0NA 5GJVB 2VKNA 1YWOA 1I0CA 1IO6A 1YP5A 2HDAA 2F2WA 2FRWA 2CT4A 2A37A 2OJ2A 1M30A 3THKA 1UHFA 1QKWA 5GJWB 2L0AA 1GCPA 1K76A 2H8HA 5L23A 2O31A 3M0QA 2C0TA 1PNJA 2ESWA 2YSQA 2PTKA 1CSKA 2FPDA 1M3BA 1WXTA 2AKKA 3QWXX 3M0RA 3ZL7C 2L3SA 3SHWA 3I35A 1H92A 1X69A 2EGEA 2PNIA 2KBTA 2JW4A 1M27C 2YUPA 2K9GA 2BZXA 2DRKA 1RLPC 1TUCA 2FPEA 2KEAA 1PWTA 1NLPC 1RLQC 2YUNA 3EG2A 3UA7A 1Y57A 1X2KA 4JZ3A 1YWPA 3UATA 4OMOA 2DMOA 1QKXA 2ABLA 2KYMA 4D8DA 2KROA 1W70A 1AZGB 3U23A 5IXBA 1A0NB 5ECAA 1AWWA 4F17A 4GLMA 2K6DA 1ZUUA 4CC4B 1M3AA 2LQWA 2D8HA 3IQLA 3TSZA 2CSIA 2LCSA 1BBZA 3VS1A 1BK2A 2C0OA 1QWEA 1PKTA 1T0JA 1JO8A 1M3CA 1ABOA 2YUOA 2GTOA 3H41A 1X6GA 1T0HA 1VYVA 2EQIA 2GBQA 2EYZA 2JS0A 2RF0A 3EHRA 4ZNXA 2OI3A 2KXCA 2XMFA 1NYGA 1CKAA 4LUDA 4JJBA 2LX7A 4LN2A 3A98A 1AEYA 2BZYA 2LJ1A 3O5ZA 2RMOA 3NHNA 4E6RA 4CC7A 1KIKA 2DVJA 3KFVA 1K1ZA 4HVVA 2KXDA 1SHGA 2FRYA 2GTJA 2KNBB 1SSHA 2DM1A 1U3OA 1YN8A 1OEBA 1PKSA 1ABQA 2G6FX 2EYYA 3M0PA 2J6FA 1VYTA 3VS3A 2RQTA 2E5KA 1SEMA 2YT6A 3UA6A 2MIOA 1ARKA 1YCSB 2RPNA 2X3XD 3NGPA 1X43A 2MCNA 2DL3A 3SEMA 4RTUA 4J9DA 1TG0A 5EC7A 4JJDA 1SHFA 2DL7A 2MOXA 2YUQA 2BTTA 2J05A 2J7IA 1Z9ZA 3TVTA 1N5ZA 4RTZA 2EGCA 2AK5A 3GBQA 2AKLA 2CSQA 1B3QA 5IHKA 1GFDA 2LJ0A 3C0CA 4OMPA 2M0YA 4RUGA 1OPLA 1UG1A 4ORZA 3PE0A 1NG2A 1AWXA 4GBQA 2GGRA 2KRMA 1AZEA 4AG2C 2JT4A 1E6HA 2L3PA 2DBMA 2DE0X 1X2QA 3EG1A 1TUDA 4LUEA 3UF4A 1X27A 1WI7A 4OMMA 1UDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GFC A;  4AFQ C;  2DJQ A;  4M4Z A;  1B07 A;  2JTE A;  4HVW A;  2EYX A;  3M0U A;  3VRY A;  1Z9Q A;  1E7O A;  5FWB A;  4HVU A;  4K11 A;  2JM9 A;  2GQI A;  3CQT A;  2K7A A;  1ZX6 A;  2A36 A;  2KYB A;  1AVZ C;  1LCK A;  3VS5 A;  4AFZ C;  2DIL A;  2IIM A;  4QT7 A;  1UFF A;  4J9B A;  2O9V A;  1WYX A;  4F14 A;  1WXU A;  4DEX A;  1SRL A;  3QWY A;  1NM7 A;  2J06 A;  1ZUK A;  3H0F A;  2A28 A;  1CKB A;  4R0K A;  1WFW A;  1GBQ A;  3LH5 A;  1UHC A;  1W1F A;  1M8M A;  2L3Q A;  2EW3 A;  5I11 A;  2JXB A;  2NWM A;  2DF6 A;  3NMZ C;  1PRM C;  2A08 A;  1PHT A;  2LNH B;  2EVR A;  1E6G A;  4A63 B;  1GCQ C;  2EBP A;  2F2V A;  2DL8 A;  4Z89 A;  3EHQ A;  2L2P A;  1JQQ A;  2NUZ A;  2DL4 A;  2QDL A;  2V1Q A;  1SPK A;  1X6B A;  1JXM A;  4RTT A;  3VS0 A;  1GL5 A;  3R6N A;  4RTY A;  2O9S A;  2RN8 A;  3VS4 A;  1AWJ A;  2K3B A;  1BU1 A;  2DRM A;  4RTX A;  1KFZ A;  2HEQ A;  1UEC A;  1S1N A;  4OMN A;  1AWO A;  1UGV A;  2V1R A;  3EG0 A;  2EYW A;  4AFU C;  2JMA A;  4IIM A;  1FYN A;  2HSP A;  2CUD A;  2D8J A;  2PZ1 A;  3I5S A;  3EG3 A;  1HJD A;  1OPK A;  2W10 A;  2DBK A;  2LMJ A;  4OML A;  2F2X A;  1GCQ A;  4RTW A;  3ULR B;  2DYB A;  1JXO A;  4IIO A;  4DEY A;  2D0N A;  1MUZ A;  1G83 A;  2CT3 A;  2VWF A;  2EPD A;  2CDT A;  4JPB W;  4EIK A;  1K9A A;  1UUE A;  2JM8 A;  2ROL A;  2LP5 A;  1NEG A;  1WXB A;  1FMK A;  2KRN A;  1VA7 A;  2SEM A;  2RNA A;  4HXJ A;  2CRE A;  2W0Z A;  1H8K A;  1YNZ A;  3VS6 A;  3FJ5 A;  2HCK A;  1I07 A;  2ED0 A;  2KGT A;  1W6X A;  2GNC A;  5I22 A;  4ESR A;  1I1J A;  2LJ3 A;  2ED1 A;  5HCK A;  4AG1 C;  1U06 A;  1BB9 A;  4CC2 A;  2AZS A;  2LZ6 B;  3TSW A;  4J9E A;  2B86 A;  2VVK A;  1K0X A;  1QWF A;  5IHN A;  2ENM A;  1QCF A;  1SRM A;  3VS7 A;  2DA9 A;  2DX1 A;  2JMC A;  3RNJ A;  2DLP A;  1HSQ A;  2O88 A;  4RTV A;  5FWC A;  4J9C A;  2KRS A;  1T3S A;  4CC3 A;  4J9H A;  1NYF A;  2FPF A;  2K79 A;  1K0S A;  4OMQ A;  1HD3 A;  1NEB A;  3VS2 A;  2RQR A;  2SRC A;  2O2O A;  4D8K A;  1G2B A;  1MV0 B;  1ZUY A;  3RBB B;  4AFS C;  2DL5 A;  1QLY A;  1U5S A;  2CUB A;  1OV3 A;  1WDX A;  1ZBJ A;  1ZSG A;  3M0T A;  3H0H A;  3REA B;  1UJ0 A;  3M0S A;  4X1V A;  4Z8A A;  2KE9 A;  1RI9 A;  1GBR A;  1XOV A;  5IXF A;  1PRL C;  1WLP B;  4JZ4 A;  4KRT A;  4Y92 A;  1WA7 A;  2X3W D;  5IHI A;  2KT8 A;  1WIE A;  2M51 A;  3VRZ A;  2DNU A;  2JS2 A;  3EGU A;  2KR3 A;  1MV3 A;  4J9I A;  5IH2 A;  1UE9 A;  2EKH A;  4LNP A;  4Z88 A;  2ROT A;  2RQV A;  4F16 A;  2RQW A;  4J9F A;  1KJW A;  1UJY A;  2CH4 A;  1ZLM A;  4WCI A;  2EGA A;  3REB B;  2C0I A;  3I9Q A;  2K2M A;  2OAW A;  2D1X A;  3NPF A;  2P4R A;  1K4U S;  4HCK A;  1J3T A;  2J6O A;  2FG0 A;  1H3H A;  1AD5 A;  1T3L A;  1GRI A;  4FSS A;  2YDL A;  1AOJ A;  1UTI A;  2LQN A;  2AZV A;  2CH4 W;  3PVL A;  1VYU A;  3H0I A;  2BZ8 A;  2ECZ A;  1RUW A;  2RQU A;  1KSW A;  1V1C A;  1WX6 A;  1NLO C;  4JJC A;  3PVQ A;  3I5R A;  2FEI A;  1OOT A;  2KT1 A;  1Y0M A;  3JV3 A;  4J9G A;  2HBW A;  1JEG A;  1JU5 C;  5FW9 A;  1EFN A;  2FO0 A;  4LE9 A;  2J6K A;  2I0N A;  5GJV B;  2VKN A;  1YWO A;  1I0C A;  1IO6 A;  1YP5 A;  2HDA A;  2F2W A;  2FRW A;  2CT4 A;  2A37 A;  2OJ2 A;  1M30 A;  3THK A;  1UHF A;  1QKW A;  5GJW B;  2L0A A;  1GCP A;  1K76 A;  2H8H A;  5L23 A;  2O31 A;  3M0Q A;  2C0T A;  1PNJ A;  2ESW A;  2YSQ A;  2PTK A;  1CSK A;  2FPD A;  1M3B A;  1WXT A;  2AKK A;  3QWX X;  3M0R A;  3ZL7 C;  2L3S A;  3SHW A;  3I35 A;  1H92 A;  1X69 A;  2EGE A;  2PNI A;  2KBT A;  2JW4 A;  1M27 C;  2YUP A;  2K9G A;  2BZX A;  2DRK A;  1RLP C;  1TUC A;  2FPE A;  2KEA A;  1PWT A;  1NLP C;  1RLQ C;  2YUN A;  3EG2 A;  3UA7 A;  1Y57 A;  1X2K A;  4JZ3 A;  1YWP A;  3UAT A;  4OMO A;  2DMO A;  1QKX A;  2ABL A;  2KYM A;  4D8D A;  2KRO A;  1W70 A;  1AZG B;  3U23 A;  5IXB A;  1A0N B;  5ECA A;  1AWW A;  4F17 A;  4GLM A;  2K6D A;  1ZUU A;  4CC4 B;  1M3A A;  2LQW A;  2D8H A;  3IQL A;  3TSZ A;  2CSI A;  2LCS A;  1BBZ A;  3VS1 A;  1BK2 A;  2C0O A;  1QWE A;  1PKT A;  1T0J A;  1JO8 A;  1M3C A;  1ABO A;  2YUO A;  2GTO A;  3H41 A;  1X6G A;  1T0H A;  1VYV A;  2EQI A;  2GBQ A;  2EYZ A;  2JS0 A;  2RF0 A;  3EHR A;  4ZNX A;  2OI3 A;  2KXC A;  2XMF A;  1NYG A;  1CKA A;  4LUD A;  4JJB A;  2LX7 A;  4LN2 A;  3A98 A;  1AEY A;  2BZY A;  2LJ1 A;  3O5Z A;  2RMO A;  3NHN A;  4E6R A;  4CC7 A;  1KIK A;  2DVJ A;  3KFV A;  1K1Z A;  4HVV A;  2KXD A;  1SHG A;  2FRY A;  2GTJ A;  2KNB B;  1SSH A;  2DM1 A;  1U3O A;  1YN8 A;  1OEB A;  1PKS A;  1ABQ A;  2G6F X;  2EYY A;  3M0P A;  2J6F A;  1VYT A;  3VS3 A;  2RQT A;  2E5K A;  1SEM A;  2YT6 A;  3UA6 A;  2MIO A;  1ARK A;  1YCS B;  2RPN A;  2X3X D;  3NGP A;  1X43 A;  2MCN A;  2DL3 A;  3SEM A;  4RTU A;  4J9D A;  1TG0 A;  5EC7 A;  4JJD A;  1SHF A;  2DL7 A;  2MOX A;  2YUQ A;  2BTT A;  2J05 A;  2J7I A;  1Z9Z A;  3TVT A;  1N5Z A;  4RTZ A;  2EGC A;  2AK5 A;  3GBQ A;  2AKL A;  2CSQ A;  1B3Q A;  5IHK A;  1GFD A;  2LJ0 A;  3C0C A;  4OMP A;  2M0Y A;  4RUG A;  1OPL A;  1UG1 A;  4ORZ A;  3PE0 A;  1NG2 A;  1AWX A;  4GBQ A;  2GGR A;  2KRM A;  1AZE A;  4AG2 C;  2JT4 A;  1E6H A;  2L3P A;  2DBM A;  2DE0 X;  1X2Q A;  3EG1 A;  1TUD A;  4LUE A;  3UF4 A;  1X27 A;  1WI7 A;  4OMM A;  1UDL A; 
#chains in the Genus database with same CATH topology
 3GNG A;  4O6J A;  2MWP A;  3CMA Q;  4XTY A;  4C5E A;  1Q82 C;  2Y90 A;  4KUD K;  3CCQ Q;  4C0G A;  4XQ3 A;  3VU3 C;  3M0U A;  3BFM A;  5IN1 A;  3CCJ T;  3QO3 A;  1E7O A;  4HVU A;  4B9X A;  4N4I A;  4E7J A;  3LYI A;  3CQT A;  1NJI R;  4IUR A;  2K7A A;  2A36 A;  1Y96 B;  4BI3 A;  3MP6 A;  2LNV A;  3VS5 A;  4AFZ C;  3L2U A;  2DIL A;  2CZ6 B;  1UFF A;  2Y4Y A;  4F14 A;  3RIR A;  2OTJ T;  2RI2 A;  5D6W A;  1SRL A;  3I56 A;  1YJW Q;  4PFP A;  1VQ8 Q;  4M78 E;  4R0K A;  2QK0 A;  3OYM A;  4QQG A;  3JCM X;  1VQ8 A;  4C0D B;  5I11 A;  2NWM A;  1PRM C;  1ZA2 B;  1IGU A;  1PHT A;  4LXC A;  1RAE B;  2LQ8 A;  3V7S A;  2DL8 A;  4OB2 B;  2QDL A;  2MK5 A;  1SPK A;  1JXM A;  4F04 B;  4R56 A;  1GL5 A;  3OW2 S;  1D09 B;  1G3S A;  2O9S A;  2O4X A;  1LVK A;  3VS4 A;  1AWJ A;  2K3B A;  4RKU E;  2VC8 A;  5L8R E;  2DRM A;  2K3Y A;  2LRQ A;  4RTX A;  1AWO A;  5GAN g;  1UGV A;  3FDR A;  1LNX A;  3EG0 A;  4KT0 E;  4M78 B;  2JMA A;  5LJ5 g;  5KYY B;  5FU7 B;  2VAS A;  1PSE A;  1VQL Q;  2CUD A;  2JJ9 A;  2D8J A;  3H8Z A;  1WHM A;  1HJD A;  2DBK A;  1QVF A;  2LMJ A;  5KYU A;  4PJM A;  3VUB A;  3H6Z A;  4RTW A;  4MZP A;  1BIB A;  4FL6 A;  2GCX A;  2MMP A;  2D6F A;  5GAO m;  1MUZ A;  4II1 A;  1Q82 R;  2KDS A;  2EPD A;  2HBP A;  4JPB W;  1ZA1 B;  1UUE A;  3QDF A;  3A8H B;  2LP5 A;  1MMG A;  2L3R A;  1WXB A;  3VYH B;  4BD3 A;  5KE2 A;  1FMK A;  4JRQ A;  2SEM A;  1VQK T;  3PTA A;  2ATC B;  2E70 A;  2QAZ A;  1LOJ A;  2DEU A;  1Q7Y U;  4PJO D;  4ELY C;  1G3T A;  2P0Q A;  2A7Y A;  4GY5 A;  3X26 B;  1YI2 A;  1W6X A;  1RI0 A;  5GAM j;  5I22 A;  3CC4 A;  1K8A C;  5FU6 C;  1G8X A;  3I56 T;  2ED1 A;  3OBW A;  1MMD A;  4XK8 E;  1K8A U;  4ZGE B;  1Q95 G;  5CAI A;  3JB9 J;  3TSW A;  5LJ3 j;  2VVK A;  4GLK A;  5IHN A;  3VS7 A;  1XJW B;  3QDR B;  2DA9 A;  4V2S A;  3RNJ A;  5CKH A;  1OZ3 A;  4NL2 A;  1NE8 A;  3QJ6 A;  2DIQ A;  1O9S A;  4J9C A;  1T3S A;  3CCS Q;  2O4X B;  3MJX A;  4J9H A;  3J7A F;  1NYF A;  2DJZ A;  2COW A;  4OB0 B;  4MML A;  5KE3 A;  5D6X A;  3CCL T;  3JB9 D;  4PK4 A;  4D8K A;  4AFS C;  1M90 C;  1F1B B;  4PJO B;  2RJC A;  2DD4 A;  1VQM Q;  3CC4 T;  1ZSG A;  4C8Q G;  5A0D A;  1V29 B;  4M75 C;  3M0S A;  4X1V A;  4OF1 A;  1GBR A;  4D6W A;  3OYH A;  1XOV A;  2QQS A;  5IXF A;  1WLP B;  4JZ4 A;  2CKK A;  1TUG B;  6AT1 B;  3ASK A;  2NUP B;  1VUB A;  1WA7 A;  1OUL A;  1KQS A;  3VJP A;  2JS2 A;  4EDU A;  1MV3 A;  4J9I A;  4LNP A;  4Z88 A;  5A0L A;  1PSF A;  3OYA A;  5CCA A;  4IUQ A;  2RK1 A;  1UJY A;  3OYK A;  5I2S A;  4P5N A;  4BUG A;  2BUD A;  3HTR A;  4DBH A;  4LDU A;  3OYI A;  3NPF A;  2P4R A;  1BCO A;  2J6O A;  1J3T A;  4NL3 A;  2ZPG B;  1G3W A;  2EFI A;  3V8J A;  4FSS A;  3NTH A;  2MPX C;  5DLQ E;  2JNG A;  2PUK B;  3H0I A;  3ZEH A;  3S3O A;  1V1C A;  1NLO C;  3PVQ A;  3CCV T;  2YLB A;  3JSC A;  3RDV A;  4J9G A;  1U1S A;  2KAF A;  4E7K A;  4L6V 5;  2I0N A;  2VKN A;  2QQR A;  1TXQ A;  1IO6 A;  2LT4 A;  1YP5 A;  3C94 A;  3LGL A;  2DTO A;  1R8O B;  2A37 A;  3THK A;  2OJ2 A;  1W2B P;  3QZ9 B;  1QKW A;  1KHC A;  5GJW B;  2AT1 B;  2L0A A;  1VQN A;  2V8K A;  3DB3 A;  4B9W A;  2OTJ A;  4AT1 B;  2O31 A;  2C0T A;  2ESW A;  2YSQ A;  1KQ1 A;  2DXT A;  3UDC A;  2FPD A;  2QQ9 A;  3TQ7 P;  3CMA T;  1M3B A;  2E64 A;  2KQW A;  5KYX B;  4MZT A;  2LT1 A;  2QGG A;  3LH0 A;  2FVU A;  2YUP A;  3OQ5 A;  2K9G A;  2BZX A;  1TUC A;  5DLO A;  3MO8 A;  1B7T A;  2PU9 B;  1UB4 A;  5EG2 A;  4E2F B;  2HQE A;  5CVI A;  5D7U A;  2ZPB B;  3BE3 A;  4X9D A;  2ABL A;  2KRO A;  3TEE A;  4M7A F;  2RHI A;  1KC8 U;  1AWW A;  4VUB A;  4F17 A;  4E7I A;  3RMS A;  2K6D A;  1M3A A;  4FCY A;  2ZZD A;  2CSI A;  2LCS A;  3CMA A;  5DY9 A;  2DIG A;  1ACM B;  1JO8 A;  2FYK A;  1ABO A;  4M77 D;  4CI0 C;  5GAO l;  4A4H A;  2DET A;  4C92 F;  1YJN T;  3O8V A;  2EQI A;  2EYZ A;  1MMA A;  2CZ1 B;  1YJW A;  4M7A D;  2JVV A;  1FMW A;  2LX7 A;  1RAC B;  4LN2 A;  3EGD B;  1X6O A;  2ZAE A;  2O01 E;  1FX7 A;  3MEV A;  3NHN A;  2DYI A;  3SB2 A;  1LJO A;  4PL6 A;  1KQS S;  3A8M B;  2KXD A;  4M7A G;  1VQ9 T;  2DM1 A;  2CP5 A;  2E6Z A;  2EYY A;  1NJI C;  4KBM B;  4OGC A;  2ZPI B;  1YJ9 A;  1IRX A;  1N6A A;  4A54 A;  3G6E A;  3G71 Q;  2ZPF B;  3UA6 A;  1WHJ A;  4RCC A;  2QI2 A;  1LPL A;  1KQS P;  3I55 Q;  3G71 A;  2F5K A;  2K5L A;  2DXB A;  1K8A R;  1VQ5 A;  4M77 G;  1YIJ Q;  3V8L A;  4PJO G;  2J05 A;  3Q1J A;  2CP7 A;  2J7I A;  3RR6 A;  3HKS A;  4MZM A;  4BI8 B;  4FW1 A;  2CSQ A;  2P0P A;  3CCE Q;  4F7U G;  3C0C A;  2RO0 A;  3M9Q A;  4ORZ A;  5KCO A;  3CXC P;  5LJ3 d;  2KRM A;  2JT4 A;  4IUT A;  2A3L A;  4LUE A;  1Q82 U;  3C4S A;  1X27 A;  4OMM A;  3LW5 E;  1G3Y A;  1GFC A;  1EZZ B;  3G1J A;  4M4Z A;  1B07 A;  2JTE A;  1ZSZ B;  3VRY A;  5CQX A;  3CCV Q;  4M7A A;  2G3R A;  3CC7 Q;  3JCM P;  1ZX6 A;  4BE1 A;  3NTK A;  3G7Z A;  2YXY A;  1LCK A;  5GAN 3;  2E4H A;  4J6Y A;  3CCM Q;  3OY9 A;  3HFN A;  2IIM A;  4C0D C;  4FSX A;  2O9V A;  1WYX A;  5A2Q E;  5J26 A;  1YIT T;  3QWY A;  3LLR A;  3NTI A;  1YHQ T;  1NM7 A;  1FXX A;  1JJ2 P;  3H0F A;  1CKB A;  3OYC A;  2WSF E;  1R77 A;  4JRI A;  5CKE A;  4LDX A;  1UHC A;  2E65 A;  3CCJ A;  5LJ5 h;  2DXC A;  4ZGD B;  1OU8 A;  1M8M A;  3OW2 P;  2JXB A;  4OB3 B;  1KC8 R;  2DF6 A;  2V26 A;  2A08 A;  2LNH B;  2EVR A;  3QG1 A;  4A63 B;  1GCQ C;  3QBY A;  1JB0 E;  3EHQ A;  2L2P A;  5KYN A;  1JQQ A;  2NUZ A;  2DL4 A;  2EJ9 A;  2H3E B;  3RMQ A;  4E7L A;  3VS0 A;  1IB8 A;  2RN8 A;  3HRT A;  7AT1 B;  1BU1 A;  1YJN A;  4EMK A;  4KGV B;  1S1N A;  1OQK A;  3OW2 A;  3CC4 Q;  1QVP A;  1QVG A;  3NFC A;  2HSP A;  4C92 D;  1JRI A;  1IRE B;  2HQX A;  3I5S A;  5DM7 R;  3EG3 A;  1OPK A;  3M54 A;  4C92 E;  3JCM W;  1Q86 C;  2B8A A;  1GCQ A;  3G6E Q;  3X24 B;  1JXO A;  4DEY A;  2RHX A;  2L8D A;  1G83 A;  2VWF A;  1ZSZ A;  1QCO A;  3ME9 A;  5KYW B;  4XTZ A;  5GAN 6;  1NPP A;  3HSB A;  2EQK A;  2ROL A;  1NEG A;  2QQB A;  1VA7 A;  4HXJ A;  2AIR B;  2E3I A;  3OYY A;  2W0Z A;  4C92 B;  1ZSZ C;  1S72 T;  3HHT B;  2DVE A;  2ED0 A;  2KGT A;  1C1A A;  3CXC S;  4MDX A;  1FWZ A;  4ESR A;  1I1J A;  3GNF B;  4M77 C;  2LJ3 A;  1KD1 R;  3VV0 A;  2PVO B;  3EG9 B;  3CCU Q;  1U06 A;  1BB9 A;  2AZS A;  4J9E A;  1VQ8 T;  2B86 A;  3CCU T;  1K0X A;  1QCF A;  2XDP A;  1M8V A;  2EJG A;  2IVW A;  2JMC A;  3DKM A;  5GAN d;  1QCN A;  1N8R R;  4RTV A;  2LC4 A;  3EFO A;  4F7U B;  5CIU A;  1YJ9 T;  3PNW C;  2GF7 A;  2FPF A;  1M4Z A;  2DO3 A;  3UPU A;  3CCJ Q;  4XTV A;  1VQ7 A;  2RQR A;  4ATO A;  2YRC A;  2KVQ G;  3DLL A;  1SKU B;  3M0T A;  1VQP T;  3QII A;  2QTX A;  1M90 U;  3REA B;  4Z8A A;  2KE9 A;  1RI9 A;  4KH1 B;  2XID A;  3G6E T;  2GQV A;  3SD4 A;  3CME T;  4Y92 A;  1RAD B;  2KI7 A;  3QSU A;  1MND A;  1VIF A;  1WIE A;  2M51 A;  2DTH A;  3VRZ A;  3D7S B;  1BI2 A;  4XTU A;  4BE2 A;  4ZTJ A;  1UE9 A;  2DD5 A;  2ROT A;  4QW2 A;  3HRS A;  2QQA A;  2A0F B;  2JZ2 A;  4J9F A;  1HXD A;  1C6V X;  2QEX A;  2FHD A;  4WCI A;  3C12 A;  3FEO A;  3CPW S;  1B34 A;  1TOV A;  1WNL A;  2PVD B;  4HCK A;  1D1C A;  2XI9 A;  4M75 G;  3M58 A;  4ZTF A;  3UT1 A;  5GAO n;  4HT8 A;  3MEA A;  4ANJ A;  1AOJ A;  5C0M A;  2AZV A;  2CH4 W;  5KCH A;  1BYM A;  1PCX A;  3GF5 A;  2XG8 D;  2VYT A;  4OVA A;  4HT9 A;  2FEI A;  2KT1 A;  1FMV A;  5KYU B;  3JB9 H;  1Y07 A;  2OX7 A;  3QJY A;  1YHQ A;  1JEG A;  4RG8 A;  4F7U A;  1IHV A;  5FW9 A;  4IUU A;  5GAN 7;  1MNE A;  1Q86 R;  3OYG A;  2J6K A;  5GJV B;  1WHG A;  2CP0 A;  1YWO A;  1JJ2 A;  4LD6 A;  3ER0 A;  2F2W A;  3CD6 T;  2FRW A;  2CT4 A;  5LJ5 e;  5IT9 E;  3A8O B;  1UHF A;  1YIT Q;  3CCE A;  4WF2 A;  1PM3 A;  2QDY B;  2RA2 A;  2H8H A;  4O5V A;  3JB9 I;  3M0Q A;  1UGP B;  2XHC A;  3A5Z B;  2KMT A;  2PTK A;  4PFO A;  2MAM A;  4Q5W A;  3P8H A;  3ZL7 C;  3PMI A;  3CC7 T;  2E1H A;  3P8D A;  1VQM A;  2X35 A;  3MP1 A;  2EGE A;  4IKF A;  4M7D F;  3I55 A;  2KBT A;  5CKD A;  3RKW A;  1M27 C;  3SWN C;  2DRK A;  1VQ7 Q;  1NLP C;  1VQ4 Q;  2IG0 A;  1QP3 A;  1WHL A;  3SFM A;  3JRZ A;  1K73 U;  4FT2 A;  3VKI A;  3OYD A;  4JZ3 A;  4OMO A;  1D3B A;  3EFR A;  3E9G A;  3QZ5 B;  1QKX A;  2KYM A;  4EMK C;  1D0Z A;  4C8Q E;  1W70 A;  5LJ3 f;  1AZG B;  3U23 A;  3CD6 A;  4A4F A;  2LTO A;  5ECA A;  1B34 B;  3CCE T;  1BKB A;  3P8B B;  3JB9 G;  3CCV A;  1ZUU A;  2LQW A;  4XU1 A;  5J3B A;  3JCM h;  3TSZ A;  4M77 A;  1TU0 B;  1BBZ A;  2NUT A;  1T0J A;  2YUO A;  2QTV A;  5KYX A;  2GTO A;  3H41 A;  4N0A C;  3I55 T;  2K57 A;  4A53 A;  1KD1 C;  9ATC B;  3EHR A;  2KXC A;  3EH2 A;  2BE7 D;  2CZ7 B;  4M7A C;  4KH0 B;  1XNI A;  3JCM f;  3A98 A;  3PIO A;  2LJ1 A;  2OAU A;  4E6R A;  3OS1 A;  2X4Y A;  1KIK A;  8AT1 B;  2QA4 T;  3KFV A;  4C5I A;  2HZY A;  4HVV A;  2HSE B;  2HNI A;  2OTL A;  3A1P A;  5GAN 5;  2F69 A;  2CP2 A;  3JB9 F;  3M0P A;  1M1F A;  3JCM e;  1BI0 A;  3LGF A;  4X34 A;  3JCM b;  2DFU A;  3FLG A;  2F1L A;  3CCR A;  2MIO A;  3QPH A;  4JDS A;  3OSV A;  1YCS B;  4XAX B;  3X25 B;  2DL3 A;  1TG0 A;  2RJD A;  5EC7 A;  1K9M U;  2MOX A;  5A0G A;  3M4G A;  1Q86 U;  4BDZ A;  2XKO C;  4QQ6 A;  5I2M A;  5I21 A;  3TVT A;  2EGC A;  4MMK A;  3TCJ A;  2F5T X;  1TTH B;  2AKL A;  3JAM E;  4J6W A;  1GFD A;  3EGD A;  2BIV A;  1OPL A;  4KUL A;  3PE0 A;  3LWH A;  1MGQ A;  1AZE A;  3OSS C;  3VYG A;  1VQL A;  2DXU A;  3L1A A;  3EG1 A;  1X2Q A;  4QVC A;  4M7D A;  1UGS B;  4JLI A;  3JCM g;  2LX9 A;  1UEB A;  4AFQ C;  3DB4 A;  4HVW A;  1OYX A;  2EYX A;  2JUF A;  1Z9Q A;  3QHS A;  5FWB A;  4C0F A;  1TS9 A;  1N8R U;  4M75 D;  2KYB A;  2DPP B;  1VQ9 A;  4M78 F;  2MI6 A;  4OGE A;  1KK7 A;  5KH6 A;  5LJ5 f;  2EKO A;  2MF2 A;  4J9B A;  5GAO q;  1WXU A;  2X9H A;  1EX4 A;  4M7D D;  1VQK A;  2J06 A;  3N5B B;  1GBQ A;  1OX8 A;  3L2W A;  3J80 E;  1H64 1;  3JCM Q;  1DJ7 B;  2AHJ B;  1RAI B;  2L3Q A;  2EW3 A;  2OTL T;  3CEY A;  4Y28 E;  1RAF B;  2NLU A;  3PGG A;  1E6G A;  2LDM A;  3SDZ A;  2EBP A;  1BCM A;  3OMG A;  2V1Q A;  4FYV B;  4KGZ B;  4C8Q D;  3CD6 Q;  2Z0W A;  4RTT A;  5FU7 C;  1WJR A;  3R6N A;  2YHT A;  4RTY A;  1N9R A;  3MEU A;  4QKU A;  4ZN3 A;  1KFZ A;  1WGS A;  5GMK h;  2JN0 A;  3X20 B;  2DEQ A;  1AHJ B;  3A8G B;  4IIM A;  1IXD A;  3CBP A;  1QMC A;  4C0Z A;  2PZ1 A;  2WSC E;  5HKC A;  5GAO r;  1VQN T;  4M7D B;  2F2X A;  4DQ2 A;  4J7F A;  2YRV A;  2DYB A;  4BDY A;  4M78 C;  5GAN e;  1SG5 A;  1D0Y A;  1QVF S;  2CT3 A;  1RAA B;  4EMG A;  4EIK A;  2PVG B;  1K9A A;  1X01 A;  4F7U E;  3X28 B;  2HKQ B;  2L89 A;  2RB6 A;  2VB6 A;  4JRK A;  5FU6 B;  1U1T A;  2P0K A;  2QEX Q;  3BW1 A;  1YNZ A;  3VS6 A;  3FJ5 A;  1Q81 C;  2HCK A;  1OZ2 A;  1IHW A;  2MYS A;  4CRI A;  2X4J A;  3INZ A;  5FRO A;  2GNC A;  1I5O B;  4XU2 A;  2DZ9 A;  3LX7 A;  5HK0 A;  4RG2 A;  2LQK A;  4AG1 C;  2VXE A;  2H3J A;  2KSS A;  2WSE E;  4CC2 A;  2XD0 A;  4FYW B;  2LZ6 B;  1JBM A;  4OP0 A;  1QWF A;  3EH1 A;  2GFA A;  1HSQ A;  5GMK j;  2O88 A;  5FWC A;  2YRD A;  2C06 A;  1VQO Q;  4FYY B;  3QXE B;  1BIA A;  3URG A;  1W4S A;  2HMA A;  4PJO E;  4M77 F;  4OMQ A;  3CC2 A;  1HD3 A;  1NEB A;  4M75 A;  1VQK Q;  2QA4 A;  1D1B A;  1G2B A;  1MV0 B;  1ZUY A;  2EQU A;  3RBB B;  2DL5 A;  3GP8 A;  1U5S A;  2CUB A;  1OV3 A;  1WDX A;  3FB9 A;  3PT9 A;  1OX9 A;  4X9C A;  2LCL A;  4PFZ A;  2HKN A;  1Q81 U;  1VQN Q;  2VV5 A;  2X3W D;  2X4W A;  3JCM V;  2DNU A;  1VQL T;  2MWO A;  4M7D C;  3EGU A;  3M53 A;  2KR3 A;  1WQ7 A;  5HY6 A;  5LL6 S;  3CC2 Q;  5IH2 A;  1RAH B;  2EKH A;  1U8R A;  4F16 A;  1VQP A;  2RHY A;  3MKD A;  4C92 G;  2CH4 A;  3KUF A;  1ZLM A;  4KGX B;  3OS5 A;  3EGX A;  2K2M A;  1K4U S;  4C8Q F;  2M0O A;  1WPY A;  4EMK B;  1KG1 A;  2FG0 A;  1AD5 A;  5GMK e;  2YDL A;  3JCM J;  1UTI A;  1WJQ A;  2LQN A;  4LDW A;  3EFS A;  3PVL A;  5GMK l;  1RUW A;  2RQU A;  1KSW A;  1WX6 A;  4UC4 A;  3G4S A;  4JJC A;  4HA8 A;  3I5R A;  2LCC A;  3A8L B;  4M78 D;  3L2Q A;  1EFN A;  2FO0 A;  2K4Y A;  4LE9 A;  4J83 A;  3FRN A;  4E7Z A;  2DK3 A;  4AMC A;  2HDA A;  1TWB A;  2QYZ A;  2BKD N;  2EJF A;  1YJN Q;  1YJW T;  5IAY A;  4M75 B;  1M2V A;  3OYE A;  2OTJ Q;  1GCP A;  2R57 A;  4BY6 C;  4QQD A;  2L5Q A;  1VOM A;  3SWN B;  3JCM c;  1W2B A;  2WAC A;  1QQJ A;  1WXT A;  2AKK A;  3M0R A;  2L3S A;  1Y96 A;  4B6M A;  3SHW A;  4F7U F;  3I35 A;  4JS4 A;  1HK9 A;  1X69 A;  1W2B S;  1Y71 A;  3PFS A;  3V7C A;  2JW4 A;  3QUI A;  3CCQ T;  1UGR B;  2HAX A;  1RLP C;  5LJ3 h;  1RLQ C;  2YUN A;  1YIJ T;  3UA7 A;  2QAS A;  1M90 R;  1N8R C;  2E3H A;  3MET A;  1YWP A;  3L2Z A;  3G71 T;  3TRE A;  2RH2 A;  3V8K A;  5GAN 8;  5GAM h;  2COZ A;  2NUP A;  2PUO B;  2EQJ A;  1A0N B;  3RKY A;  1SSF A;  2E41 A;  4ELZ C;  2VUB A;  2K5F A;  4CC4 B;  2D8H A;  3MHX A;  3IQL A;  4FYX B;  1WJS A;  2CYZ B;  5D6Y A;  3HL8 A;  2M1H A;  2CZ0 B;  2BE9 B;  1PD0 A;  1QWE A;  4LDY A;  1NBE B;  3RUX A;  4E7S A;  1X6G A;  1T0H A;  1VYV A;  3E1S A;  2GBQ A;  4PJO F;  2V8I A;  4M77 E;  3AT1 B;  2OI3 A;  2XMF A;  4M78 A;  4JJB A;  1M1G A;  3CCS A;  1KD1 U;  4WTO B;  4J5Y A;  1VIE A;  4CC7 A;  2DVJ A;  1YCY A;  4JLG A;  2XDB A;  1D1A A;  3M57 A;  1Q7Y C;  3CPW P;  2QA4 Q;  4LDV A;  2KNB B;  2IPO B;  1U3O A;  4EPC A;  1OEB A;  3GLX A;  4FT4 A;  2ZPH B;  3V7R A;  2RI3 A;  2X3X D;  2FZG B;  2HD0 A;  2NUT B;  3NGP A;  1X43 A;  4PJN A;  4TVR A;  3SEM A;  4J9D A;  2DL7 A;  2YUQ A;  2BTT A;  1XQH A;  5GAM f;  1N5Z A;  1N27 A;  1VQ6 T;  2K3X A;  5CKF A;  3GBQ A;  1M5Q 1;  1M1K C;  5IHK A;  2LJ0 A;  3C95 A;  5GAM e;  2JTM A;  2M0Y A;  4PNO A;  1UG1 A;  5KYW A;  1I4K 1;  1NG2 A;  4LD9 K;  1S72 A;  3EAE A;  4PLI A;  2KY9 A;  4AG2 C;  1E6H A;  1VQ7 T;  2K2V A;  3OYL A;  2DE0 X;  1VQM T;  3UF4 A;  3BY7 A;  3S3M A;  1WI7 A;  1VQ4 T;  4NS5 A;  2CP6 A;  2DJQ A;  4A4E A;  2PQW A;  2NYS A;  4K11 A;  1QW1 A;  1K73 C;  2JM9 A;  2GQI A;  4HCC A;  3KBG A;  3EG9 A;  1AVZ C;  2X51 A;  1X75 C;  2R58 A;  4DBQ A;  2EIF A;  4PJO A;  4R55 A;  4QT7 A;  1PD1 A;  1MHN A;  1I8F A;  4DEX A;  3J81 E;  1ZUK A;  2DAQ A;  2A28 A;  1WFW A;  3ZBD A;  3GIB A;  3LH5 A;  3EFO B;  1W1F A;  3BDU A;  4C92 C;  3GOX A;  1M2O A;  3L2R A;  3I56 Q;  2XIC A;  3NMZ C;  1VQO A;  3H9N A;  2D9T A;  1Q7Y R;  2CP3 A;  2JTF A;  3OS0 A;  3OYF A;  2F2V A;  4M7D G;  4Z89 A;  1G5V A;  4DBF A;  1JJ2 S;  1X6B A;  3CCR T;  4Y91 A;  4EMH A;  3ZFJ A;  4XTW A;  2EWN A;  2DTI A;  4PJJ A;  3KXT A;  5FRN A;  1KHI A;  4OMF B;  4FIB A;  2HEQ A;  1EIF A;  1UEC A;  1RAB B;  4OMN A;  3CCQ A;  2V1R A;  2HL3 A;  1I5L A;  2EYW A;  4AFU C;  1H3Z A;  1Y7X A;  1FYN A;  4C5G A;  1YI2 Q;  1YIJ A;  4OB1 B;  2W10 A;  2RHZ A;  4JUV A;  4OML A;  3ULR B;  5C6S A;  1S72 Q;  4IIO A;  2D0N A;  1VQ5 T;  5AYF A;  1VQO T;  1RL2 A;  3T9N A;  3CC7 A;  3M55 A;  3CME Q;  2CDT A;  1IZ6 A;  5GAN 4;  2JM8 A;  2RD1 A;  4L59 A;  4ME7 A;  2VGM A;  3DLM A;  1YIT A;  3QYG B;  2V8J A;  2KRN A;  4M75 F;  2RNA A;  4E47 A;  4FW2 A;  2CRE A;  4XTX A;  3HFO A;  1H8K A;  1VQ5 Q;  1I07 A;  2VGN A;  3OYB A;  3OA6 A;  1M1K U;  4RMO A;  1ZBX A;  5M9O A;  1M1K R;  1AT1 B;  1BI1 A;  1K9M R;  4M7A B;  1ZQ1 A;  5GMK m;  4E7H A;  2OTL Q;  5HCK A;  1YJ9 Q;  3E19 A;  4A4K A;  2QEX T;  1M9S A;  4C8Q C;  4KUI A;  4HCB A;  2ENM A;  1SRM A;  3WXM B;  3MP8 A;  2DX1 A;  3CCL Q;  4JS5 A;  2E10 A;  5GAM g;  1C0M A;  2DLP A;  4J7I A;  1BI3 A;  1OI1 A;  2KRS A;  4CC3 A;  1YBY A;  2R5A A;  2YWW A;  3OS2 A;  4FU6 A;  1WHK A;  3CCR Q;  3MEW A;  1V76 A;  4C8Q A;  2EAY A;  1QP2 A;  2K79 A;  3CCS T;  1K0S A;  5LJ3 g;  4MDW A;  3VS2 A;  3VUZ A;  2SRC A;  2P84 A;  4L5G A;  2O2O A;  1OU9 A;  4ZGJ B;  1ZHI A;  5CR2 A;  1I81 A;  1QLY A;  2VXF A;  5GAN j;  3CPF A;  3QYH B;  1ZBJ A;  3CCM A;  5LJ5 j;  2RHU A;  1P92 A;  3H0H A;  4A4G A;  1UJ0 A;  3OBY A;  1IGQ A;  1VQ6 A;  1WZO A;  1PRL C;  4KRT A;  3CC2 T;  2XDD A;  5IHI A;  2KT8 A;  3M5A A;  1WHH A;  1KQ2 A;  3FC3 A;  4QVZ A;  2HL5 C;  3FJP A;  4DOV A;  1NJI U;  2RQV A;  4M77 B;  3RKX A;  4N4G A;  2RQW A;  3AHU A;  5CKB A;  1KJW A;  2E12 A;  2EGA A;  3REB B;  2C0I A;  3I9Q A;  1K73 R;  2DKG A;  5FLX E;  2OAW A;  1Q81 R;  2D1X A;  5J39 A;  4XU0 A;  2YLC A;  3WVE B;  5LJ3 e;  3CBO A;  4BI4 A;  4J8O A;  1RAG B;  4JJN K;  1H3H A;  1T3L A;  1GRI A;  4PKC C;  2CGH A;  4C92 A;  1QVG S;  1QVF P;  1VYU A;  2M16 A;  4QVD A;  2BZ8 A;  5GAN 2;  2ECZ A;  2QGF B;  2R5M A;  1VQ4 A;  1OOT A;  3L42 A;  1Y0M A;  3JV3 A;  3TU4 K;  2HBW A;  4J6X A;  1YHQ Q;  1JU5 C;  2Y4X A;  2FL7 A;  4C5H A;  4C8Q B;  4BY6 B;  1HYO A;  5GAN h;  3G4S Q;  1QVG P;  4PJO C;  1I0C A;  3MPU B;  5GMK i;  3HPW A;  1M30 A;  8ATC B;  3OB9 A;  5CK9 A;  4HCZ A;  1K76 A;  4M7D E;  5L23 A;  3CME A;  1PNJ A;  3EGX B;  2XU8 A;  1CSK A;  5GAN f;  1WQW A;  4N4H A;  3QWX X;  4N0A A;  1YI2 T;  2FZK B;  3S3N A;  1H92 A;  2EQM A;  2PNI A;  4M75 E;  4BB7 A;  1UGQ B;  2FB7 A;  2FPE A;  3BDL A;  1TH7 A;  2GFU A;  1PWT A;  1SF9 A;  2KEA A;  2KK4 A;  3EG2 A;  2ZGW A;  2FZC B;  4YTL A;  4DOW A;  2K5I A;  1Y57 A;  1X2K A;  2XK0 A;  3UAT A;  4DBR A;  2DMO A;  3OYJ A;  4DA4 A;  4D8D A;  1VQ6 Q;  4JRP A;  3M56 A;  4BAC A;  5IXB A;  4ZN1 A;  3L2V A;  1M2V B;  2DER A;  2E6N A;  3M4Y A;  4GLM A;  2RJF A;  2LVM A;  3CCU A;  3SWN A;  5GAM d;  3E9F A;  3VS1 A;  1BK2 A;  3OYN A;  2C0O A;  2M9U A;  2CS7 A;  1PKT A;  4PJL A;  1M3C A;  3PMT A;  4NOY A;  3WVD B;  3R6O A;  2COY A;  2RI5 A;  1N9S A;  3CCM T;  2JS0 A;  2RF0 A;  3RES A;  4ZNX A;  3OMC A;  1NYG A;  3G4S T;  1CKA A;  4LUD A;  1TSF A;  3F70 A;  5CQY A;  5FRM A;  1NZ9 A;  4Z02 A;  3CXC A;  1YFN A;  1AEY A;  2BZY A;  3O5Z A;  2RMO A;  2DZC A;  2EYQ A;  2RJE A;  1VQ9 Q;  2X4X A;  1PC0 A;  3HRU A;  1K1Z A;  1SHG A;  2HQH A;  2FRY A;  5HK3 A;  2GTJ A;  3RER A;  2E5Q A;  4PLL A;  1R0B G;  1D0X A;  1SSH A;  5LJ5 d;  1YN8 A;  2M02 A;  2QG9 B;  1PKS A;  1ABQ A;  2G6F X;  3LWI A;  2J6F A;  3S6W A;  1VYT A;  3PIP A;  3VS3 A;  2D0Q B;  1NPR A;  2P4T A;  2RQT A;  5GAO p;  4FM4 B;  2E5K A;  1SEM A;  2JOY A;  3HP9 A;  2YT6 A;  4RCB A;  1KC8 C;  5AT1 B;  5CO7 A;  1ARK A;  2RPN A;  1R0C B;  1XTD A;  3M59 A;  2MCN A;  4RTU A;  2RM4 A;  4JJD A;  3CCL A;  1PG5 B;  1SHF A;  3MCA B;  3UWN A;  1MMN A;  1Z9Z A;  2ZPE B;  3CBM A;  4RTZ A;  2AK5 A;  3JCM d;  3FIF A;  1K9M C;  1O75 A;  1B3Q A;  3E2U A;  4IUP A;  3CPW A;  4OMP A;  3GPL A;  4RUG A;  4HKE A;  5KYY A;  1GXI E;  3QKJ A;  1AWX A;  4GBQ A;  2GGR A;  2L3P A;  4BE0 A;  2ZCF B;  2DBM A;  4M78 G;  1VQP Q;  2I2L A;  4IUV A;  1TUD A;  1D3B B;  4M7A E;  2QXF A;  2RK2 A;  4XU3 A;  1UDL A; 
#chains in the Genus database with same CATH homology
 1GFC A;  4AFQ C;  2DJQ A;  4M4Z A;  1B07 A;  2JTE A;  4HVW A;  2EYX A;  3M0U A;  3VRY A;  1Z9Q A;  1E7O A;  5FWB A;  4HVU A;  4K11 A;  2JM9 A;  2GQI A;  3CQT A;  2K7A A;  1ZX6 A;  2A36 A;  2KYB A;  1AVZ C;  1LCK A;  3VS5 A;  4AFZ C;  2DIL A;  2IIM A;  4QT7 A;  1UFF A;  4J9B A;  2O9V A;  1WYX A;  4F14 A;  1WXU A;  4DEX A;  1SRL A;  3QWY A;  1NM7 A;  2J06 A;  1ZUK A;  3H0F A;  2A28 A;  1CKB A;  4R0K A;  1WFW A;  1GBQ A;  3LH5 A;  1UHC A;  1W1F A;  1M8M A;  2L3Q A;  2EW3 A;  5I11 A;  2JXB A;  2NWM A;  2DF6 A;  3NMZ C;  1PRM C;  2A08 A;  1PHT A;  2LNH B;  2EVR A;  1E6G A;  4A63 B;  1GCQ C;  2EBP A;  2F2V A;  2DL8 A;  4Z89 A;  3EHQ A;  2L2P A;  1JQQ A;  2NUZ A;  2DL4 A;  2QDL A;  2V1Q A;  1SPK A;  1X6B A;  1JXM A;  4RTT A;  3VS0 A;  1GL5 A;  3R6N A;  4RTY A;  2O9S A;  2RN8 A;  3VS4 A;  1AWJ A;  2K3B A;  1BU1 A;  2DRM A;  4RTX A;  1KFZ A;  2HEQ A;  1UEC A;  1S1N A;  4OMN A;  1AWO A;  1UGV A;  2V1R A;  3EG0 A;  2EYW A;  4AFU C;  2JMA A;  4IIM A;  1FYN A;  2HSP A;  2CUD A;  2D8J A;  2PZ1 A;  3I5S A;  3EG3 A;  1HJD A;  1OPK A;  2W10 A;  2DBK A;  2LMJ A;  4OML A;  2F2X A;  1GCQ A;  4RTW A;  3ULR B;  2DYB A;  1JXO A;  4IIO A;  4DEY A;  2D0N A;  1MUZ A;  1G83 A;  2CT3 A;  2VWF A;  2EPD A;  2CDT A;  4JPB W;  4EIK A;  1K9A A;  1UUE A;  2JM8 A;  2ROL A;  2LP5 A;  1NEG A;  1WXB A;  1FMK A;  2KRN A;  1VA7 A;  2SEM A;  2RNA A;  4HXJ A;  2CRE A;  2W0Z A;  1H8K A;  1YNZ A;  3VS6 A;  3FJ5 A;  2HCK A;  1I07 A;  2ED0 A;  2KGT A;  1W6X A;  2GNC A;  5I22 A;  4ESR A;  1I1J A;  2LJ3 A;  2ED1 A;  5HCK A;  4AG1 C;  1U06 A;  1BB9 A;  4CC2 A;  2AZS A;  2LZ6 B;  3TSW A;  4J9E A;  2B86 A;  2VVK A;  1K0X A;  1QWF A;  5IHN A;  2ENM A;  1QCF A;  1SRM A;  3VS7 A;  2DA9 A;  2DX1 A;  2JMC A;  3RNJ A;  2DLP A;  1HSQ A;  2O88 A;  4RTV A;  5FWC A;  4J9C A;  2KRS A;  1T3S A;  4CC3 A;  4J9H A;  1NYF A;  2FPF A;  2K79 A;  1K0S A;  4OMQ A;  1HD3 A;  1NEB A;  3VS2 A;  2RQR A;  2SRC A;  2O2O A;  4D8K A;  1G2B A;  1MV0 B;  1ZUY A;  3RBB B;  4AFS C;  2DL5 A;  1QLY A;  1U5S A;  2CUB A;  1OV3 A;  1WDX A;  1ZBJ A;  1ZSG A;  3M0T A;  3H0H A;  3REA B;  1UJ0 A;  3M0S A;  4X1V A;  4Z8A A;  2KE9 A;  1RI9 A;  1GBR A;  1XOV A;  5IXF A;  1PRL C;  1WLP B;  4JZ4 A;  4KRT A;  4Y92 A;  1WA7 A;  2X3W D;  5IHI A;  2KT8 A;  1WIE A;  2M51 A;  3VRZ A;  2DNU A;  2JS2 A;  3EGU A;  2KR3 A;  1MV3 A;  4J9I A;  5IH2 A;  1UE9 A;  2EKH A;  4LNP A;  4Z88 A;  2ROT A;  2RQV A;  4F16 A;  2RQW A;  4J9F A;  1KJW A;  1UJY A;  2CH4 A;  1ZLM A;  4WCI A;  2EGA A;  3REB B;  2C0I A;  3I9Q A;  2K2M A;  2OAW A;  2D1X A;  3NPF A;  2P4R A;  1K4U S;  4HCK A;  1J3T A;  2J6O A;  2FG0 A;  1H3H A;  1AD5 A;  1T3L A;  1GRI A;  4FSS A;  2YDL A;  1AOJ A;  1UTI A;  2LQN A;  2AZV A;  2CH4 W;  3PVL A;  1VYU A;  3H0I A;  2BZ8 A;  2ECZ A;  1RUW A;  2RQU A;  1KSW A;  1V1C A;  1WX6 A;  1NLO C;  4JJC A;  3PVQ A;  3I5R A;  2FEI A;  1OOT A;  2KT1 A;  1Y0M A;  3JV3 A;  4J9G A;  2HBW A;  1JEG A;  1JU5 C;  5FW9 A;  1EFN A;  2FO0 A;  4LE9 A;  2J6K A;  2I0N A;  5GJV B;  2VKN A;  1YWO A;  1I0C A;  1IO6 A;  1YP5 A;  2HDA A;  2F2W A;  2FRW A;  2CT4 A;  2A37 A;  2OJ2 A;  1M30 A;  3THK A;  1UHF A;  1QKW A;  5GJW B;  2L0A A;  1GCP A;  1K76 A;  2H8H A;  5L23 A;  2O31 A;  3M0Q A;  2C0T A;  1PNJ A;  2ESW A;  2YSQ A;  2PTK A;  1CSK A;  2FPD A;  1M3B A;  1WXT A;  2AKK A;  3QWX X;  3M0R A;  3ZL7 C;  2L3S A;  3SHW A;  3I35 A;  1H92 A;  1X69 A;  2EGE A;  2PNI A;  2KBT A;  2JW4 A;  1M27 C;  2YUP A;  2K9G A;  2BZX A;  2DRK A;  1RLP C;  1TUC A;  2FPE A;  2KEA A;  1PWT A;  1NLP C;  1RLQ C;  2YUN A;  3EG2 A;  3UA7 A;  1Y57 A;  1X2K A;  4JZ3 A;  1YWP A;  3UAT A;  4OMO A;  2DMO A;  1QKX A;  2ABL A;  2KYM A;  4D8D A;  2KRO A;  1W70 A;  1AZG B;  3U23 A;  5IXB A;  1A0N B;  5ECA A;  1AWW A;  4F17 A;  4GLM A;  2K6D A;  1ZUU A;  4CC4 B;  1M3A A;  2LQW A;  2D8H A;  3IQL A;  3TSZ A;  2CSI A;  2LCS A;  1BBZ A;  3VS1 A;  1BK2 A;  2C0O A;  1QWE A;  1PKT A;  1T0J A;  1JO8 A;  1M3C A;  1ABO A;  2YUO A;  2GTO A;  3H41 A;  1X6G A;  1T0H A;  1VYV A;  2EQI A;  2GBQ A;  2EYZ A;  2JS0 A;  2RF0 A;  3EHR A;  4ZNX A;  2OI3 A;  2KXC A;  2XMF A;  1NYG A;  1CKA A;  4LUD A;  4JJB A;  2LX7 A;  4LN2 A;  3A98 A;  1AEY A;  2BZY A;  2LJ1 A;  3O5Z A;  2RMO A;  3NHN A;  4E6R A;  4CC7 A;  1KIK A;  2DVJ A;  3KFV A;  1K1Z A;  4HVV A;  2KXD A;  1SHG A;  2FRY A;  2GTJ A;  2KNB B;  1SSH A;  2DM1 A;  1U3O A;  1YN8 A;  1OEB A;  1PKS A;  1ABQ A;  2G6F X;  2EYY A;  3M0P A;  2J6F A;  1VYT A;  3VS3 A;  2RQT A;  2E5K A;  1SEM A;  2YT6 A;  3UA6 A;  2MIO A;  1ARK A;  1YCS B;  2RPN A;  2X3X D;  3NGP A;  1X43 A;  2MCN A;  2DL3 A;  3SEM A;  4RTU A;  4J9D A;  1TG0 A;  5EC7 A;  4JJD A;  1SHF A;  2DL7 A;  2MOX A;  2YUQ A;  2BTT A;  2J05 A;  2J7I A;  1Z9Z A;  3TVT A;  1N5Z A;  4RTZ A;  2EGC A;  2AK5 A;  3GBQ A;  2AKL A;  2CSQ A;  1B3Q A;  5IHK A;  1GFD A;  2LJ0 A;  3C0C A;  4OMP A;  2M0Y A;  4RUG A;  1OPL A;  1UG1 A;  4ORZ A;  3PE0 A;  1NG2 A;  1AWX A;  4GBQ A;  2GGR A;  2KRM A;  1AZE A;  4AG2 C;  2JT4 A;  1E6H A;  2L3P A;  2DBM A;  2DE0 X;  1X2Q A;  3EG1 A;  1TUD A;  4LUE A;  3UF4 A;  1X27 A;  1WI7 A;  4OMM A;  1UDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...