2VWEE

Crystal structure of vascular endothelial growth factor-b in complex with a neutralizing antibody fab fragment
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
219
structure length
219
Chain Sequence
QVQLQQPGTELVKPGASVKLSCKASGYTFTGFWIHWVKQRPGQGLEWIGHINPGNGGTNYNEKFKRMATLTVDKSSSTAYMQLSSLTSEDSAVYYCARSYSNYVRAMDYWGQGTSVTVSSAKTTAPSVYPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSVTVTSNTWPSQTITCNVAHPASSTKVDKKIEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Vascular Endothelial Growth Factor-B in Complex with a Neutralising Antibody Fab Fragment.
pubmed doi rcsb
molecule keywords VASCULAR ENDOTHELIAL GROWTH FACTOR B
molecule tags Immune system
source organism Homo sapiens
total genus 30
structure length 219
sequence length 219
chains with identical sequence L
ec nomenclature
pdb deposition date 2008-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vweE01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vweE02
4U6XA 1I1AD 1YEJL 3ZT6A 3RL2B 2FX9L 3GSWA 2GEEA 1FNFA 3KR3L 2MSPA 4X6CF 5KVMC 1F11A 3KLHD 4P59H 5B8CB 1NMAH 4WUKL 1RULH 5IGXH 1T89A 3OKDB 4H26B 5TQ0H 3CVIH 4CNIA 4HC1H 2Z8WC 1I1YA 3QDGE 4PGDA 1RPQA 3WIIH 5DEFA 4PG9B 3MLRH 4I3GA 4Q6IC 3L1OH 2R1YA 3VXME 5IWLA 3CLFL 1N5YL 3D39E 4P3WA 5B39G 3QFJB 5H37G 3F7QA 3UYRH 4BK4A 3MV11 1HH9B 1E28B 1IAIL 1Q9WB 1FN4B 3PQYA 3GSQA 1NCWH 3D85D 1ORSB 4NM8H 5D5MA 5I1IH 4KXZH 3LD8B 3U4BH 3B9AA 2OYPA 2EE2A 1C08B 1ZOXA 1U8JB 1ZA3B 4KJPC 1MCQA 3T8XA 5HYJE 5KVDL 5AYUL 5E6ZA 2XRAH 3QRGH 3QWRA 2FGWL 3C6LD 5C0EA 3V6BR 2XKNB 2DQEH 4QHKJ 1K4CA 1J88A 1QKZL 1WWBX 2FHCA 2RIKA 4U1NA 4UIMA 1WK0A 1F90L 2DBLH 5E6IC 5DD0L 5FB8A 1XF3A 4ZUWB 4M3JA 4JFXA 2IFGA 3QG6B 2NW3B 4NBYB 1JUFA 3O8XD 1U8LB 1KEGH 3QCVH 4PGJA 3T2NL 3DUSB 4CMHB 4TOYH 5EU3A 3GDBA 1J0KA 5SWQB 3EGSA 2O93L 3GI8H 4MAUH 1UENA 2YD1A 4M03A 3LEXA 5F96H 1NFDA 3BH8A 1CXKA 4LCUB 5I1AA 3H3PL 3BW9B 1MQ8A 4WHYG 1I7ZB 5DK3A 4UQ2B 1P5UA 3QEGL 1RQ5A 4Y19B 5EOCH 1DQJB 4PG2C 4FN0A 1KJ3H 1CI5A 1X4YA 3FFCA 4KK8C 1TVHB 4HWEH 3DURA 2OSLB 2ATKA 4OBSA 5GZNC 1JNJA 3HNVH 3DVIA 4W4NA 1A1OB 3AREC 1IGIL 3U30C 1UYWH 4Z95L 3F5WA 3MRRA 3STZA 2XWJB 4ZXBB 2VLRD 2BNRA 4XP9L 4D0DB 4BQBA 3CCHB 3RWJA 4Z0BL 2NY6C 5FUZH 3GSNA 5IFAH 3O6FD 3AROA 1FJ1B 2ZUVA 5E8NB 3TN0C 2OTWA 4OKVA 1LNUB 1EPFA 4FFWD 1OB1A 1R5WA 3W39B 5AUMA 4MLSA 1WFNA 3LZFL 4GRWH 5IESH 2X89A 4OLYL 1M6OB 2HTLC 3SDXE 1FNAA 3HE7B 3DETC 4QHNA 2VL4A 2X4NA 4W81A 4KVCL 1Y18B 3HPLA 4PJAE 5I74B 2NY0B 3SGKA 2FH6A 2EDXA 5SX5K 4HIIB 3VWKB 5HYEA 5LXGH 1FL3B 1HXMA 4I0PC 4LCWE 4TSCL 3RWFA 4JFOB 1AP2A 2BFVL 4FQCH 1MCCA 3OKNA 3VFSB 4GRLC 1U58B 2IANB 3IDNB 5ETUB 1N3NA 1MAJA 4AG4L 3ORJA 5T1KB 3QHFH 4L9DA 1NAMH 1QFWM 4ZDHA 2XA8H 1JZ2A 4AEEA 4Z7QE 5K9OB 5GGVL 4YGVA 4PJ8C 3N0PB 4I13B 4FZEH 2IQAB 3BQUB 3O41B 1YEKH 3IFLH 4P5TC 3MNWB 4AZ8A 5C0CE 4JO1L 3CNKA 1OLZA 2PYED 1L7IL 5CWSB 4TSBL 4DK3A 5KJRH 4G9FE 4BSJA 1JGUH 5FDYA 3PGFH 3PJSA 3OZ9H 2J8UB 1T2XA 1YMMA 4L29B 4L5FH 3BSZH 3RVWD 3GIVB 1CLYL 2HLFD 3CUPA 3KNBB 1EK3A 3TO2A 3GSNL 4IRJA 1T4KB 4JPVH 3DX6A 4PP2A 4UV7L 3BGMB 2VR9A 3OKLB 1TIUA 4MA3B 3WIHA 3WL9A 4FFYH 4NKIH 4DZ8A 1YNKH 1YQVH 5CGMA 1NLBL 2VKWA 4MD0A 2QHLA 2ZSWA 4CVZA 2NZ9D 2VDLH 2R4RH 4AJ0A 1A4JA 1WFUA 1BPVA 4IRSA 2P47B 1K2DB 4G42B 4Z8FH 2X4SB 4PUBH 1A7QH 5L0QC 3WXVL 1HHIA 4PJCA 1L7TL 2WP3O 1KPVB 1QSEB 1MJUH 2QSCH 4JFFD 2DM3A 1AGEB 2EDTA 3QISA 5JDSB 5DYOA 4B5EA 5ITBL 4LKCB 1NGQL 3UO1H 2R2BA 3BP5B 4WO4A 1J8HE 3KPRA 1OTSC 4LHQB 4PJGB 2VDPH 2HMIC 3CMOH 3SO3B 3SKOA 1IILE 4JKMA 2VDOH 3EYVB 3N1QC 4OUUA 3FN9A 5J9PB 3FQTA 5C0FA 4UOJA 3FN3A 4JAMA 2E6JA 2H6PA 4HX1A 3REVA 3T4AB 1LP9F 1OAYL 4PJBF 2YPLE 3RUGE 3EJJX 4XWGL 4PRBB 5HVHB 3HCVA 1YN7A 1JV5A 4JO4L 3G6JF 3SDCB 1X44A 5KW9L 5DQ9B 4M43H 4ZTPH 1U3ZA 1I75A 2X70B 3PG2A 4YXLH 1GL4B 4JQVC 3WKML 1KTDA 15C8L 5T3XE 3GJEA 3CDCA 4L4TD 1K9TA 1LK2A 1KB9K 1ZVHA 4LRNH 3L3OA 4TPRL 4G8GD 1MCDA 5IHLB 2FJGB 4M7LH 3QIBB 4RNRA 4F7MB 3EHBD 3H9HB 2VE6B 3BZEB 4AL8H 2ED8A 1T2JA 1TVBA 1JZ8A 3RZCD 3RY6C 1A3LL 5F1IA 3C60B 1F3RB 3BZDA 2Q20A 5DUPH 3WIHL 2VZ1A 2VXSL 5MENA 3E1F1 3H7LA 5ICYB 5BXFA 4XI5D 3ESVF 4JRYD 1I7TB 2VC2L 3A6CL 3H8NA 3ROLA 4M1DH 4NQCA 4GLRI 4PJIB 1FC1A 4UUJB 2V5YA 2EXWD 4OF5A 4R2GB 4Z9KB 2EDDA 1T3FB 3OKYA 5LWYH 1LE5B 2BZDA 2DKMA 5FO9A 4L3CB 5L6YH 1AE6L 1JF6A 4WFHD 1F4XL 1G9NH 1YY9C 2EKJA 1EVUA 5LGJB 1N0LA 4OB5H 4AQ1B 4LLQA 4OZ4A 3OJVC 1IRAY 3B9KD 4DJMA 3HB3C 3QFDA 3CXDH 4HKXB 1BJ1H 5HHPA 3LKRA 4K94L 4X9HA 1JPTL 5ACZB 3IETB 5I1GH 4HJGA 3O9WB 5L2JB 1R5IA 1AJ7L 4AT6B 3DROA 1I1FA 3FN0L 4Y1AA 3VMPA 7FABL 2FJHB 4KH2A 4RBPK 7CGTA 5I75C 3PIQA 4ZTOH 3TBTA 1A6VL 3KPPA 4GKSA 1CFBA 2AJUL 4JDTL 5IW1B 5IMKB 1KYOK 2CGRH 3DV6A 3EO9L 3QWOA 3BEWA 4RZCB 5FGSA 3L9RA 4NKQB 2ZCHH 4RA0C 4CU7A 3BKYL 2ZUTA 2F9BT 4AH2A 1KTLB 2XFXA 4PLOB 1KULA 1R3HA 4M5ZH 3GSUA 2BNUA 1I3RB 3MYZA 5DZOA 3QXDA 1H5BB 2PO6C 3IFNH 1DP0A 3MNZA 4HSQA 4K8RC 3LKPB 1DQQA 5FYLH 2VXTH 1IZKA 1MVUB 3G5ZB 1KJVB 3KYAA 2E7LC 3QO1B 1OSPH 2FIKB 3KPOB 1G7PB 1DE4B 1QFUH 4JPWL 3PL6B 4F3FB 4U6YB 4JFHD 2JB6A 1GC1L 1ZANH 5IT2L 2IPUG 4DVRH 1WIPA 4H5SA 5EUKB 5GS1B 1DVFC 2VQTA 3HI5H 4CMMA 1C5CL 1YYLH 4OCYH 1F97A 4V1DB 1W0WA 1CFQB 5LGHH 4PYHA 1CGSL 3IJHB 5DJCB 2YWZA 3O2DA 3CD4A 5DS8B 5J1AB 3VRJB 1KNOB 3LKOB 5E8OA 1WT5A 2VTFA 3WLBA 4OV5A 4U2ZA 1E0OB 2HTKC 5T5FH 3BIKB 4CADA 1T22B 1XH3A 1K85A 2ATPA 4P3DB 3MNVA 1SJHB 3CH1B 1JWMA 4YHNB 2A9MH 4HKJA 3MRNB 5SWZE 3LQZB 2OJEA 3FL7A 1MVFA 1U8QA 3WDIA 3CVHA 4GO6B 1ZAGA 4PJBB 4R0LB 1CVRA 5HGBB 3T1FA 1EVTC 3FRUB 3V5KA 2NY5C 4PRHB 4EZMA 5KTEL 3KDMA 1MH5A 5JXAL 4ODWA 2HJLA 2W9DH 3QPXL 3NN8B 2FBJH 2F54A 1ZHNA 4ETQA 2VLKB 4U6VL 3S5LA 2EIEA 5EZJA 2EECA 1ERNA 1JZ4A 1U9KA 4CAGA 2R0LL 2CJUH 1RUAH 4F15B 1S5HB 5EU4B 4TVPH 3DYMA 4DEPB 5EC2A 5E5MA 2Z4QB 1PZ5A 2BMKB 2QR0B 3O6LL 3OXSB 2YA1A 3QBTB 2BP3A 1W72B 1PLGL 2E27H 5E2JA 3UTSD 1ODAA 3B3IB 1EHXA 1FCGA 2MJWA 4KMTH 3T1WA 4CGTA 3EYOB 4H25A 1WSST 1NSNL 2P8MA 4GUPA 3UZVB 5B3JF 3GNML 3ISWA 4F57L 2NX5D 3TWCL 2ADGB 3BRGC 2EH7H 1P7HL 3L7FB 3FTGB 1INEL 5E2VH 4XRCB 3LB6C 3O2DL 1PEWA 2Z31C 2WP3T 3O2VH 5KSUA 2R9HC 1E4JA 1Z3GL 1NJ9A 4DN3L 3MJ9H 5FHBL 3QNYB 2CIKB 2C7UB 2VERN 5DMIL 1JWSA 4J1UB 1FBIL 1GAFH 4JHBA 5IHUL 3ARFB 1GJIA 1HCVA 1W0VB 5HYSB 1NGZA 3LN5A 5EU5A 2R1XB 1A1NB 5FO7B 3CVHL 4Q2ZB 5HI5D 1OP5K 1HHKA 4PYGA 3JV6A 4X99A 1ZEAL 4Q9CA 2C1PA 3MV7E 4PLJC 2AS5M 2DIAA 1BQLL 4OT1H 5D9SB 1OF2A 3K81A 1GGIH 1J0IA 1I8IB 4IDJL 1PKQA 1MI5B 3ARWA 4Q9QL 1IKNC 3GMNB 4HXAL 2HT4D 4GOSA 3QDGA 5GHWH 4LNRB 3QDJA 3GBNH 5DJ0A 3TVMD 5EA0H 3SE4C 2QADB 1LEKA 3C5ZD 2QV2A 5GGTA 4XMPH 1HYSD 1OM3L 5D1ZC 1BLNA 2XTJC 1A9BA 3RKDD 1MFDH 2BVYA 4GT7A 4HEPG 4DKAA 3SE8L 1KF9B 3JUYA 1CICD 2ZUSA 4K3EH 4TULL 4UIKL 4ZNEA 3HNSL 5CSZA 3O3BB 3STLA 5HYJA 3QNZA 1UJ3B 3RVUC 3DGGA 4NZTH 4BH7B 2BVTA 3VCLA 1VFMA 4S0SD 5INDB 5HYSG 3QEHA 1FP5A 2ICWB 2F58L 3GSVA 4DTGH 2FATL 2WBJD 4RWYH 4LHUB 4D9LL 25C8L 3HC4L 3OQ3B 2B2XL 4QXTB 4XPGL 3OPZH 4I3RH 4IJ3B 1VERA 4P2QE 1U2CA 4RFOL 3QJHA 1KIRB 4GQ9H 1BGXL 2PCPB 4KK9C 5ESQB 5JORA 5DEGA 2E7CA 1J1OL 4EOWL 2I60L 3TJEH 2BCKA 5E2UL 3KPSE 2E5EA 1QACA 1WCBB 5CILH 4PY8I 5F71A 3ES6B 3U9UA 1M7IA 3TNNA 5EO9A 1HCFX 1EAPB 4NJ9H 2OL3H 4CJ0A 2FX7L 1S9VA 3EDFA 2Q6WA 1CGUA 3L3HB 3GO1L 2JJTA 1H8NA 3P11H 2JELL 4Z0XA 4WEMB 5BV7C 2ARJQ 3AB0C 5I17B 1OAUH 3V5HB 2A6IA 3RDTA 3NTCL 2DQIH 4JRWA 2FCBA 1HEZA 1YQ2A 2J7LA 5EWIL 5KS9F 1AIFA 4QRRA 3K4ZA 2MCPH 3O81A 1P7QB 3H7BA 2A0LD 4WTZA 2AXFA 3ETBF 3QEQD 4QWWD 1IM3B 1IC1A 2WUCH 5C0AD 4D0CA 2ESVD 2Q7YA 1L0QA 1YYMH 5FYLD 1FSKB 3IJSA 3VGEA 1NGWA 2YA2A 4IS6A 2FD6L 2HWZL 3L5XL 4LHUG 4LLMB 4QRUB 5KZCD 2C3VB 4NZDA 1BOGA 5EUOB 1MEXH 4K7PL 1LO0H 3V7MA 4WFEE 1U95B 2FZ3A 1RIUH 5DTFB 1FZJA 3SDXA 5JW3H 5A2JH 4IOIB 5EIIA 1T5XA 3VXMB 2AXGB 2B4CL 1A47A 2YMXL 3G6DL 2PR4L 2GTZA 1NC2A 3E8UH 1RJLB 3ESUF 3DSFL 3DRTB 4PJXA 3QUMH 5BZDA 2D9CA 1YUHA 4YHZL 1KCUL 1CD1B 4KK5D 4X9FA 3IAPA 3MLPA 5DDHA 2RFXA 4MZ3A 2HH0L 3D3VD 1A6UL 3ZDYE 4X4XB 1OLLA 2I5YH 1KJ2H 1QEWA 2BVQB 4YFLI 4Q6IA 5AD0B 4OD3L 4OFVA 5HGDA 3QXVA 3UXFA 3M07A 2GSGB 4UU9B 5HHXH 2A73A 1AGFB 2XTJE 1ETZB 1Y6KR 3TIDB 3WFEL 4M7KL 4AIZB 2X42A 3QCTH 1IC7L 3EYUH 1HSAB 2VISA 2V2WA 5BW7C 2XI9A 2JKXA 3MGTB 4P49A 5CEZH 1HZHL 1ONQA 2P7TA 4KHXH 3HI1A 3TJHC 1EEYA 3SKNA 2B1HH 1VGEL 2P8PA 2P45B 2DQDH 1J12A 1O0VA 3H0TA 3ZKSD 4TVPD 2F8OA 4XAWH 4XP6L 4Z7OE 4S1QH 5JUEL 1JNHB 3SJVD 3BKJL 1F3DH 4I77H 5DHYA 4WW2F 4UZGA 4JQIL 4K3GA 1PG7X 3CH8A 4Z7VF 1N4XL 3RFZC 1FVDB 4QHLB 1AQDA 3TYFB 3N06B 3T4YA 3FKUS 3WHXA 5DZLA 2I07A 4K71B 1FGNH 5GS2H 4LKXB 3TESA 3ZDXF 2MQ0A 5DMKB 3DO7A 4QOKD 4RMSA 1EO8L 2CH8A 4PG2A 4LHJB 1VENA 4HKZA 3TZVC 3CLEL 4OBRA 2J12B 4RBPH 1XGTA 2BDNH 3MA7B 1JWUA 3VE0A 3PWPE 4PJAB 4EN3D 2FX8H 2E7BA 4HGWB 3DXAB 3U7AA 4BSVA 5EBWA 1ZLSH 3FRPA 1PGRB 3QPQD 1UXWA 3SGDH 2VAJA 4BKLA 5DQJB 1HQRB 2OQJB 4KROC 3HR5B 4Y16A 1CS6A 2YZ8A 1TJIH 3CPLB 4MNQB 3HN3A 3TN0A 3GSOA 1EJOH 3GJFB 3MO1B 2X4TA 2DWDA 5FM8A 1BX2B 5C0BA 4O58H 5IF0A 1U8PA 1GH7A 3BP4B 1S7WB 4Y4HB 2NY1B 5INCB 3CFEB 3D9AL 4ODXB 4AYFA 3VD5A 2M26A 1A6TB 1FNSH 4FQ1H 3ZE1F 5KAQF 4N8CL 2JB5L 3LH2L 2K9UA 1OSZB 3T0VA 3QYCA 3D2UD 5C0CB 4ONGL 3HZMB 3BZFA 4I0PA 1KBGL 1I8MB 3EJZD 3QIUD 4JG0L 4OV6F 1UWEL 3I50L 4H1LB 3OKEA 5I8KL 4WUUE 5H94B 1N64L 1A6AA 1D6VH 4FG6C 4X6BA 4KY1H 3RWEA 4U1JA 1I7UB 1K4DA 1UACH 4HJJL 4RMWA 4XTRC 5DD6A 4N5UA 5HI3C 2KKQA 4YE4L 1BZ9B 5IMMB 4YUEH 1MWAB 4MA1C 3V6ZB 3JWDL 4Y2DD 4RMQA 3ZYOA 1H3WM 2YD9A 4XCYB 2O5ZL 4CVXB 5FYJH 2E7MA 2F5AH 1DBBL 4MXQD 1BIIB 2R2CA 4M8QA 3GMMA 2VDML 5C07A 1FORH 3VFPB 2VLLB 1NFIB 4PV8A 2JIXD 2W60B 4KJQD 3I02A 2F5BH 2FGZA 4L4VA 5CP7A 3U48A 1AGCB 5EO0A 1HINH 3VFRB 1JZ5A 1TJHL 2LU4A 3TNMA 5F7YC 3C87A 5JPMA 1KB5A 4FP8H 3DX9B 2F53D 5SWSD 4NZUH 2ENYA 4JN2B 4NQDA 3DUUB 2FWOA 2NY2D 1J8HB 3L7EB 5EDXA 4FABL 3H9YA 4HIEA 1P2CA 5T3XL 1JIBA 5DRZA 4PJDA 4X4ME 4GQPH 4NWTL 1IC4H 5KOMC 2YN5A 3WDHA 4EI5D 5HVWA 1YMHA 4KTEL 5J11B 3VXRB 4DVBA 3AREB 3MRBB 3TBSB 1FQ9C 1G7QA 4P3CH 3IDGA 3PWNA 4NQVA 4A2MA 4R4FH 2R69H 4Z7NF 1SBBA 1HYRC 2VSDA 2LVEA 2EXYD 2X2YA 3BAEH 2R1WA 5ACMA 1F3JA 1XGPB 5CD3B 4XX1E 3MPCA 5FYKL 1QHPA 1MNUL 2NMSA 1BD2D 1CXLA 5GGRY 3E6HB 3K8LA 5HYQB 2AGJH 4AEFA 4WENB 5JXEC 4R97C 3K4DA 3QI9A 1I1AA 2HVJB 4OZIE 4XBGA 3B43A 3FAXA 5DK0B 3EYFB 3RWIB 3LRSB 3CFDA 2D7NA 4NT6A 4GXUM 5KOVC 3S3PA 1EJ6A 3K8KA 5EBMB 4ONOA 1IM9D 4FQQA 3K0WA 1VFAA 5JDJA 4P0DA 3KLSA 3UPRA 2V9RA 2ADIA 1NQBA 4JZJB 4G7VH 5ENWA 1ZA6A 4GRLB 1OP5H 3DIFA 1KB5L 4ZD3L 3LPFA 3V4VL 1Q9LB 4BZ1H 3WFDH 3I75B 3SDDC 3VI3F 5DURB 4PB9L 4LPXA 4WNQA 4WJ5A 5GQBA 4PJ8B 1RZJC 1DDHA 4RX4D 1C16B 3TM6A 3U2SB 1TETH 5GGUB 2RQ8A 4JFEB 1QVOA 4HK3N 4JN1L 2BY3A 4P23B 4QRQB 4PRPD 4MS8C 3BT2H 3G5VA 4XNUL 2YUZA 1KCVL 1YPZE 2QQKL 5D5MF 1U0QA 2UWEF 2D0FA 5IB4A 1YEDA 2YPKB 4ZO8A 1TTFA 2WLZA 4G80A 5I18L 4LVEA 3PDOB 1SEQL 2BVOA 2DI8A 4D2NA 1MHPH 4J4PD 4EI6B 1ED3B 4ZSOE 1AGDA 1KENL 4HS3A 3V52H 3OBAA 3LSOB 2XQBL 1P6FA 3WYRA 2G75A 4HFWB 2ORBH 3MRKB 3MCLL 3W9EB 1OQXA 5GGSA 1HKFA 3S4SA 3ARDB 5K9KB 2NY4B 2VL5B 2R8SL 1RZ8A 4J6RH 4K9EH 1ZVYA 2H2PD 1AFVL 3BO8B 5D6CA 4H88L 4X5WB 2NW2B 4LFHD 4EJ1C 1BFVL 4JPIB 4D8PB 2VN4A 3JWOH 4Y4FC 1HOCA 4LGPB 1Z9LA 2EDKA 3M17A 3P30H 5CUSL 3WFCH 4CW1A 1D9KD 5BS0A 1TZGH 1E6OL 5GS2D 1NFDF 4BJLA 3KPLA 4LLUA 3NBNA 1DUYB 4U1SA 5MEPA 3HE6D 3O6FA 2GJ6B 4NO5B 3FONA 4ZMAT 1FFOA 1Q1JL 2NCMA 4A2LA 3GI9H 1A21A 4QHMA 3P0YH 3NZ8B 4D9QE 1LEIB 4NKOB 5IR1B 1LGVA 4HIHB 5IB2A 1NCBH 2ZPKL 3VJ6A 4G8FB 2N7AA 3T2PA 4UILL 3C8DA 5D1XD 2EE9A 5ANMA 5C09E 1BVKA 3L5JA 4U1GB 3P4MA 3HC3H 1KIQA 1JJUA 1SM3L 3LS4L 3BP7B 4N8VB 1XR9B 5E2TL 4N0YL 1V3MA 2WZPD 1G0YR 1S7RA 4L8CB 4EUPA 3X11B 2RB8A 3V4UH 4B0MM 2H26B 2NY3D 4IOFD 3KYNB 1JVKA 2D0GA 4P46B 5TH2B 3CX5J 4OZHA 3WNOA 2DN7A 4P2OD 4UAOB 4MAYD 2FEDD 5C0NC 5IFHH 3AU1B 3QT2A 1ZT4A 4EBQH 4JY6A 4QT5A 4U7MA 5L8KB 4NQSB 1BVLA 3IFOA 4WFFD 2PYEA 4QRPB 1YNTA 1AKJD 3FQXB 4NN7C 4U0RC 4ZS6D 1T5WB 2J3SA 1T04A 4ZUVB 2RBLA 2F8XC 3QSKB 2ICEA 3VXUD 4TTDD 2HT2D 3GMQA 1LVEA 4U05A 5IQ9A 3P77A 3VXNB 2AEQH 1XFPA 5DJXB 5J06A 1OGAB 2GJZA 1BAFH 4MQTB 1UH2A 4MWFB 2YUVA 3N1FC 1BFOB 5TFSH 1FLRH 1U3HC 2VUOA 5DRNB 3MODH 3QULB 4JFYA 5FYJD 3I9GL 4YAQB 5IB5B 1GPOL 1RIVH 4JVPA 3M45A 4J3VA 4RAHA 3KPSA 2PXYD 5HDOA 3ZKQD 2BHUA 3SKJL 4FTVE 1R3IH 1HDMA 1RHFA 4MJIE 3OAYK 4N8VG 3DX8A 4JHWH 4LSVL 3HUJB 4CNIB 3D18A 4N1EA 4PGDB 4MD5A 4KQ4H 4K7PY 4LSQL 1MCSA 4KTYA 1KN4H 2R1YB 3VMNA 4LSSL 5TDOB 3I2CL 3L6FA 5DJZA 1KEML 5FHAH 3QI9D 3OR7A 3W2DH 5CBAB 1AD9A 3AMLA 3VGFA 3GSQB 4L8SA 5D5MB 4PRAA 2PO6B 4ZOEA 5F6IB 4RISH 5J8OA 4I4WA 3U7WH 5IVOA 2DYPB 4UOW0 1JI1A 1B0GA 4YQXL 2Z31A 1WGOA 5E1AA 1KG0A 5C0JA 2P43B 3T8XB 5C08D 3KJ6H 4HBCL 4MNHA 3IVKB 3FQRA 5I8CA 2BRRL 1TQCC 4WWKC 3CFCL 4XXDA 1U8IB 2NYYC 5E9DD 4BSWA 5C0EB 3SE9H 1K4CB 3KYKH 2VDKH 4LGRB 4QTHB 4OJFL 1N59B 3RGVC 4LQFL 5EU6D 5FCUL 3MLWH 4MD4A 2APWA 4MXVE 1IEAA 1R24B 4L4TA 1T7WA 5CINH 1S9YA 5JO5A 3H2WA 4G8GA 1XT5A 2V9QA 4LVNC 3KWWB 3SOBL 3S8WA 3EGSB 5DHVH 3VXOA 4YHKH 3IAGC 1NBZA 3GMRA 1NFDB 4TUOA 2KZWA 5CGYC 2V7NA 5C2UB 3SCMB 4YDLC 2HRPH 4PJHE 5HHQB 5HDLA 1IKNA 2DMBA 4OGYL 4Z7WA 4S10A 3G9AB 4X7SH 3HRPA 2P5ED 5C9KA 4JRYA 5ESVA 4PY7B 2GUOA 2IEPA 4OFPA 1DQLL 5E00B 1RURL 4D0BA 4S1DC 4U1HA 3SE4A 2ATKB 3IJYA 1XGQB 2X4PB 1G6RB 4OCRL 4GBXD 5BOPA 1ZT1A 3QUXD 1RIHH 3MRRB 2R0ZL 4LQ1A 5CP3A 4I2XE 4P2QB 4YC2B 3SO5A 1J0JA 3UBXI 1AGBB 3C6SA 1ITBB 3OAUH 2GIYA 4HFUL 2CD0A 1T80A 4HS6B 2P1YA 3DMMD 3B9KA 2GSIA 3CSPA 4NUGL 3SPVB 3QIWD 4Z77B 1ZMYA 2YSSB 3HC0A 1A7RH 4KRPD 3DBXB 4XMKL 2Z8RA 4I18C 1RU9L 1OB1B 1FZOA 3A6BL 2HFEA 3V7AE 4E41D 4XB8A 4Y5VA 5I76A 1MJJB 4KKLC 5DHXB 3ALPA 3M8OL 1MY7A 3HPLB 1SEBA 1XCQA 3TO4D 2WANA 3F7VA 3HI6L 4R4ND 4JFDD 4NO0D 5DD3H 2CKBH 3UJTH 5I1DA 2ADFL 4P2RE 5F9OH 3RWFB 4GS7B 1WBYA 3B6SB 5D96C 2UZIL 3GBML 4OM0L 4HT1L 4YEEA 5F21B 4LPCA 2EDWA 4LCCB 5ADOH 1OPGH 4AEHH 2DQFA 4HPOH 1SYSB 5IGXL 1YEJH 5TQ0L 4WDIA 3HPJB 4YGVB 3C09B 5EB9A 2HN7A 3MLRL 3L1OL 4WUKH 1MREL 2OR9H 3PWPA 5FOJA 4OLVH 1FL5A 3UYRL 3MRGA 1MCPL 4WVRA 4KKCD 4X6FA 4OTXL 3CLFH 1NCWL 4GKOA 1N5YH 1N8ZB 5CSGA 5JHDE 2OR7A 4G9DA 2VZVA 4JLRA 4MVBD 2GK0A 4FXKB 4P9ML 1IAIH 3PJSB 4ZAKD 1YMMB 3BPNB 2BJML 4RFEA 8FABA 4R7DA 2FB4H 3KLDA 5E0QA 5M7QA 5ELIA 5EULV 1QUNA 1H8OA 4IRJB 5AYUH 5KVDH 5CEXA 4PP2B 3DX6B 3QDAA 5E08H 5E2WH 2FGWH 3KLAA 4GAGH 2D0HA 3WL9B 4A6YB 1FFRA 1QKZH 1MUJA 1SYVA 2ZSWB 3SGJC 4CVZB 4PJ5D 1F90H 3PNWA 3MV9B 5DD0H 3FOLB 5D1ZB 4F9LA 4IRSB 3HLAB 3NAAH 4U7SA 5ID1A 3T0EB 4PLNC 1QSFE 1HHIB 4PJCB 3P0GB 3T2NH 5DYOB 2R2BB 4PR5A 4GW4A 4H8WC 5C1MB 3S97C 3SBWC 2P48B 5D2LE 1XGYL 1XIWB 3VGAB 3KPRB 4YO0A 1R0AL 3H3PH 1IAKA 2AQ3A 2MFNA 1KJ3L 5EOTA 2YC1A 1EFXA 3QUYD 3QUZD 4KDTA 1TJGL 1CFNB 4OUUB 5K9QI 2A38A 3O3EB 2H6PB 4HX1B 3T3ME 2IBZX 2UVEA 2B1AL 5BRZD 3HCVB 2AKRA 5DA0B 1B3JA 1YN7B 1JV5B 4Z95H 2Z92A 5BV7L 1V7ML 1WITA 5ALBL 4JHAH 3MRPA 2R0WL 2APTA 4LPVA 2NX5A 4MNGB 4Y8AA 5BW7A 3DV4A 4XP9H 5IFAL 4YHIB 1Y0LA 1F4YL 1NLDL 3ARBD 4YDKL 2P8LA 1DL7L 1MQKL 1LK2B 3MJ6A 4F9PC 3BXNA 1TZIA 3MX0A 2E9JA 4UT9L 2IAMB 3BVNA 4JO2L 1MCRA 4RNRB 3B5GA 4PD4K 2WIIB 5ERWA 1D5ZB 2BY2A 5B38B 3LZFH 1TVBB 4NNXA 3ZKND 5HHOA 3VH8A 2MKLC 3NMEA 3E3QC 1M7DA 1T6WA 4O4YL 4KVCH 4ZS7H 4Z7UA 1YDPB 3FT3A 3RKPA 3WLWC 3ROLB 4OUOA 1IGCL 4NQCB 5CJXC 2KZ1B 4U7KA 2NTFA 2YXMA 3HRZB 1FNEB 3O3AA 1N0XH 3F7RA 5E8PA 2BFVH 3SEPA 4Y4KB 4LIQE 1BBJA 4FQXD 3D48R 2CUHA 2KDGA 5ITFB 2EDEA 3Q1SH 5KANI 4LLVA 2SEBA 5GRJL 4OCSH 3QNXA 3VGDA 4NO2B 4GG6E 5T1MB 2FJFA 5FV2A 1ZGLA 5T33H 4LLQB 1YEKL 5GGVH 3QFDB 3KYMA 5JZ7D 1KIPB 4EXPX 1I4FA 1GOHA 3EZJB 3ARGC 4NJAL 3TVMA 3WIFA 5GGRB 3ARVA 5KG9A 3VFWB 5TGBB 1JGUL 1R5IB 3MMEB 5DD5L 3OGOE 4JO1H 4FMKA 4Y1AB 1L7IH 2WBKA 3T0DA 3JTTA 4TSBH 2DBJA 3LPWA 4WUUB 1Z9MA 3TBTB 3KPPB 3K4AA 4XH2B 3VFOB 3DV6B 1FV1A 1MCNA 3L9RB 4P5MB 4F80A 1A9EB 3KYOA 1I8LC 5D7LD 1ES0A 1AXSA 1IGYA 4FFZL 1D5IL 1KFAL 4POYA 5B38G 5IB3A 3CC5A 1G7LA 4FFYL 2KL6A 3QXDB 3DRQA 3GSNH 3BYYA 5IVXA 3MNZB 4UV7H 4WI8A 1OP3K 4DOHE 2WBJA 2R4RL 1DQQB 2GCYA 5EFIA 1B2WL 3EIFA 1NLBH 1DCLA 4HUKB 1A7QL 4OI7A 4DGVL 4OGAD 4F37K 2VITA 1UCTA 3C5SB 4P4RA 3ZTJG 2HLAB 2JB6B 4KJWC 2VLRE 5DVMA 1L7TH 1EO7A 35C8L 2VIRA 5L2KB 2CK0L 1RI8A 1FYTA 1NGQH 2BSSA 2R2EB 2VDPL 1OAQH 2ZG3A 4F37F 4R3SA 3TA3D 1PSKL 4TSAL 3JV0A 4HMEA 2Y23A 1RY7B 4JKKA 3WLBB 4OV5B 4CADB 4PGBB 2CRIA 1XH3B 3TT3L 3I85A 3MNVB 1OAYH 1F4WH 1FPTL 1EERB 4PTTA 4HKJB 4M43L 4QCIB 4XWGH 5E5RB 5AWNL 4H0IA 1FO0H 1E27A 4J3WA 4JO4H 3SDAD 1EZVY 5AZ2H 1U8QB 3GMOB 3MLSL 4FA8A 5A40E 4DQOL 1I1RA 3QEQA 2XKSA 3T1FB 4YZFF 1QRND 3B2UC 5C0AA 15C8H 2GW5A 5T1LD 2VDQL 2OTUB 5CIPA 4OZIB 2W07A 3KDMB 3UDWC 5C0GA 4C56D 1CWVA 4JCLA 4TPRH 3W9DB 4F2MA 1CE6A 3HZKA 2VZOA 4MZ2A 2NR6C 3UTQA 1ZV5A 4ETQB 3OAYH 3SQBA 4YFEA 1S7QA 2P5WD 3QEUA 2A74A 1I9IL 3MRDA 3MYJA 2ZCKL 3E3QE 3EOAA 1JL8A 3FHAA 3GK8L 3UTPE 1A3LH 4YK4B 4JM2C 5EC2B 4LL9A 5E5MB 1AR1D 1M71A 3WIHH 2YD3A 2BNQD 4Z18A 4V2BA 3ALXA 5MEQA 1J7VR 1DN0B 3ZE2F 4OZFB 4NRYB 4ZQKB 1YEHL 3RVTC 5J13B 3P4OA 1KTKE 3C8KA 5LWYL 4JANB 3KGRA 4H25B 4L3AA 6FABL 5JXEA 1UC6A 2G2RA 1F4AA 3D0VB 4OB5L 3VGGA 1AE6H 3KXFE 1LWRA 3DHJA 4YHOL 1JN6A 1F4XH 3D3VA 3GSXA 2AK1H 1VADB 3SDXF 2R2HA 2BOBA 3VW3L 5MHSD 4OLUL 1FVCB 2DF3A 4CU8A 5I1GL 1CZ8H 5JNYA 3D25A 4MJ6A 1DANU 3DJ9A 1NJ9B 4DGYL 5D1QD 3VFVA 1QO3A 4X6CA 4ZUSA 5E94A 4NC2B 1JWSB 1AJ7H 3FQNB 4PJXF 3FN0H 1PDKA 1RJCA 2BY1A 3MGOB 1HHHA 3P9MA 4LPWA 7FABH 4JFFE 2IMNA 3S37X 1VA9A 5DSCA 3HA0A 4JDTH 4QHUB 5TE4H 3EO9H 4M5ZL 3SDDA 3MRMA 5D6DC 5MI0B 3SQOH 3BKYH 4Z7QF 4NN5B 5D93B 5I1JL 4P4KC 3IFNL 4JRXE 1HHKB 1K6QL 2QHRH 4Z78A 2VB5A 4X99B 5FYLL 5HD8C 4YPGA 5DO2C 2XN9E 4GW5A 1CLOL 1OF2B 4L9LB 2VXQL 4ODVL 4ODTL 4N0FA 4FTVA 1PKQB 4OLWL 4N90D 1ZANL 2JCCE 2ICWJ 1PG7H 3X13B 2ITDA 4JPWH 2H2SC 3MR9B 3D69A 1GC1H 3F12A 5IT2H 3ARUA 1LEKB 2UZYB 4FZ8L 2BY0A 1ZHLA 5D2NC 1RSFA 1T2QL 4E42A 3PQYD 4QOKA 1A9BB 5J3HC 4LLAA 1FZMA 3MREA 4M62L 3GEWB 1CGSH 3ZT5A 1VDGA 3MJ9A 1GGCL 1I85A 1VEPA 3OKKB 5CSZB 5IB1B 2OLDA 4Z5RB 2WLYA 3HG1A 2EZ0D 2IBBA 4EN3A 3DGGB 1UM5L 4TQEL 4MDJA 1MJ7H 4CVWA 3R1GL 2Y6SC 2ED7A 4Z6AT 1NC4D 2QLVB 5IM7A 1XF1A 1A6PA 3ZLQC 1RD6A 3R06B 4PJEA 2DKSA 4HK3J 1LE9B 1KCSL 4HZLA 1CGXA 1KTRL 4PJFE 5F44A 1T20A 2UYLA 2YXFA 1NUDA 4MX7B 2XWTB 3DO3A 4XNZC 2ZNWA 3CZFB 5JORB 32C2A 2CJUL 5DEGB 5EN2A 1GGTA 1RZJL 2CXGA 4KWUA 3U46A 1KCRH 4M7ZC 4U6VH 2O5YL 2BCKB 5FIEA 3RUGF 2X9WA 1LO2L 3RTQB 1FFQA 3CFBA 2R0LH 2AEPL 3D2UA 5HHME 1T1YA 2EO1A 3U9UB 1M7IB 2FL5A 4RIRA 3TNNB 3GHEL 1QPPA 3O6LH 3HZVB 1S9VB 4J2XA 4N0UE 3OJDB 4POUB 3NA4A 1MHCA 4Z0XB 1BF8A 3AFLA 3K46A 3RDTB 2BNRD 3ILPA 4OIIL 4Y2DA 1HEZB 1GOGA 3GNMH 3PV7A 5E2VL 1AIFB 5GS0C 1SQ2N 3MUJA 3H7BB 4L4JA 3TWCH 4LCIL 3V4PL 1QLRB 3O2VL 4D0CB 5ADPH 5F88A 5I6XB 4LLWA 3P2TA 3IJSB 3MJ9L 3I3BA 1NGWB 1FG2A 5CLWA 4BQCA 5J89A 1DEEA 1FAIL 3O4LE 5CKGA 1ACYH 1XR8A 1Z3GH 3RAJL 1F2QA 2FZ3B 2G60L 5FHBH 1CD9B 5B8CC 1FZJB 4RWHA 2H9GA 3MRJA 2YS4A 5DMIH 4MCZB 5F89B 1FBIH 1TZHB 1J5OL 5IW6A 1T5XB 3MUGB 4JY4B 2PF6A 1ZHBA 3BHBA 1PYWA 4MA8L 4X6DE 1HSBA 5FCSH 3STBA 1G7JA 2GITB 1PX3A 1U3HA 3CVHH 1U8HA 3RU8H 2H32H 5BZDB 2XG5A 4HKBB 3REWA 4OT1L 3LD8C 1JBJA 3BD4A 2EEDA 2OP4L 1FGVH 3VXSD 5IEKB 1BQLH 4QXUH 1ORQB 2N1KA 4I5BA 1UM6L 1J1XL 5JMRA 4RGNB 3S98A 5JA8B 1QYGL 3RI5K 4CBPA 4DFHA 4S1RL 4Q9QH 3RWHA 1C12A 4HXAH 3C60D 4XMPL 2AQ1A 5D2NE 4YHLL 4NQXA 1BD2A 2W92A 2A73B 4S2SB 1PZUB 3NFPB 2MMXA 1VFBA 3NABL 3FOMB 4WTZG 3RI5F 1OM3H 1BECA 5I0DA 1OAZH 1PG7W 3BDXA 4CMHC 3N1GC 2D31A 3SE8H 3Q5OA 5ACLA 3H9SE 4UIKH 3ULUC 3ZYJA 1IZJA 2DWEA 3CXHJ 5JIIA 3H42L 3NCMA 3HNSH 2K7QA 5HI4D 4WWKA 1KIUA 1JGLH 1IM9A 2DQTH 3H0TB 5HDBE 4DTGL 4L3EB 5I1LB 3MUHL 3RGVA 5JMOC 1I8KA 2AW2A 2F58H 5T5NG 2ZG2A 2FATH 3VFUA 2Y7QB 3T77A 4I3RL 4YFLF 2DQJL 4NKMB 4PIRF 4D9LH 2NPLX 3FO2A 3HC4H 5JW5A 3MUZ1 1HI6A 1K5NA 4XPGH 1F42A 4ZXBC 1LO4L 5HSFA 3KHOA 5I30L 2FRGP 4QY8B 3T4YB 3FB5B 4B7LA 2I07B 4RX4A 1AHWA 3MV8D 4WO4D 5HVFB 3HAEH 4EOWH 2I60H 1J0YA 2VLJB 4IHOA 4PFEA 5E2UH 2W9EL 1QSVA 4NN7B 4GKZA 3VG9B 1H15A 4KKNA 3QDME 1RZKC 1YECL 1XZ0B 3BGFB 4GLRH 4PRPA 4XMLH 5DGRA 3ZE0E 4HG4J 3RWDB 1DZBA 4I48B 1RZFH 1ND0A 4PTUA 2ZUUA 1G9ML 2FX7H 1JWUB 2X4RA 5FECA 1JYNA 4ZG1A 3HE7C 2V2XA 3RWCB 3GO1H 4ELMB 5EBWB 2JELH 2DQIL 3PL6D 4RA3A 5I74C 5D7JD 2NY0C 1UXWB 5C0IB 3KPNB 2OMBA 2R29L 2MCPL 3RGHA 2D3VA 3VWKC 4BKLB 5JPNA 2D03L 1MFCL 5EWIH 4Y16B 1CDHA 5C8JB 4IMKA 1AO7B 1OP3H 2Q3AA 2VAAA 1P4LB 1MEXL 4XVJL 5I1CL 5IFJA 3PF2A 4XVSL 3D0LA 4LOUC 3HZYA 3N50A 2FD6H 5F3BA 3L5XH 3DUHA 3U0TA 1WBXA 4M5YH 4O51A 3LQAC 2DOCA 3BQUC 1F45A 4WV1B 1MLBA 5MEND 4R90L 2W91A 3BZFB 4NWUL 2M8XA 3LPGA 2B4CH 5LAXA 4RSVA 3HE6A 1XCTA 2YMXH 3G6DH 4G8EA 3TPUA 1NEZA 2PR4H 1CT8A 4ORGA 3UEZA 3RWEB 4X6BB 4G6FB 4U1JB 3WS3A 2FSEB 1IKFL 3W11D 2OM5A 4YHZH 1J10A 1KCUH 2EIDA 3E2HB 1WTGT 3EYQD 4PRHD 1W8NA 5L8LB 1LEGA 5KSAB 4LSDA 2HH0H 3LRHA 2CR3A 5DF0A 1JFQL 3MV01 1A6UH 1IL1B 4OGXL 4M8QB 5KSVA 3GMMB 5C07B 5HYIA 4QRTA 4L4VB 4OD3H 3BJLA 2P49B 2XIDA 5EO0B 1QSFB 1ZS8B 5JPMB 3EDDA 5KSBE 1SVCP 3RNKA 3RVVC 1H3UA 3WFEH 4M7KH 5DVKA 1T1XA 4U1LA 1X6NA 3ULUE 4KHXL 1IC7H 4NQDB 1EEZA 2EIBA 2B1HL 4P2OA 2FWOB 4MAYA 4C83A 1XF2A 4X9GA 1P2CB 2Z35B 1HZHH 4PJDB 3LEYL 2PW2B 4PRIB 4I77L 4Y19E 1VGEH 3PWJA 3FZUC 5JOFA 2I26N 5D7KD 4MMXC 4N9GA 3GBLA 4NQED 4XP6H 5JUEH 3BKJH 4QF1B 2COQA 5IOPB 2AK4A 3PP4L 1T7VA 3B2VH 3VXUA 4P5KA 4JQIH 5E24E 2GAZB 3JV4A 1VACA 5F9DC 3PWNB 5GJSL 2IQ9H 5ILTL 3PGCA 5HVHC 1N4XH 1QBMH 1RK1A 4KRLB 1UQSB 2R1WB 3S36L 3SDCC 3ARFD 2IALB 3S35X 3UTTB 1WEJL 2GTWB 5ISZD 4S1SL 4WI9A 2Y07H 1QBBA 1KJMB 2PXYA 1OWRM 2WUBL 3QI9B 4ODUA 4U6TA 4UBDD 5C0DB 1UCBH 3OGCA 4G43A 1EO8H 3NIGE 4KI5D 3QIBC 5MERA 2UY7A 4X7CC 2X44D 1EHNA 5J56B 5EH1A 2FX8L 3CLEH 1RK0B 2DQHH 1NUGA 4FQQB 1VFAB 4G6AD 1MI5D 5IHBA 3U4EB 1F6FB 4AENB 2H41A 5LJYH 2ARJA 2Q86B 4BK5A 3FJTA 1FNLA 3D85B 3O3UN 4WU7B 2ARWA 4ZOBA 2EYRB 2IANE 4R2GC 3DX7A 3VFGL 4F9PA 4O58L 1DBML 2A83A 3CFKB 5C08A 3BUYA 4GG6B 2VLMD 5C6TL 2F54D 5EZLA 1ZE3C 4PBVC 4FQ1L 3C6LB 3OJ2C 3D9AH 3ZZ1A 4R26H 4BFIA 1IGJA 3OKMB 4N8CH 1S7UA 2A6JA 5EU6A 2JB5H 3LH2H 1Y6MR 4EDXB 3LDBC 2CR6A 4WEUD 3O9WC 3O8XB 5CJXA 1WZMA 5EBLA 1OTUC 4J3OC 1KBGH 4XP5H 4JG0H 1JTPA 3I50H 1N6QL 5IB4B 1DQMH 4KUCF 2EDRA 5I8KH 2J8UE 1BQUA 2PYFA 1M1SA 4HQQL 2BVOB 4YUEL 4LBEA 1WWCA 3O3DA 3RVXC 4H8WL 1AGDB 4YE4H 5FF6B 4HS3B 2FHFA 1VESA 4O2CA 3FB6A 1W0YT 2G75B 2MHAA 5F72S 2HJFB 1JPGA 2P5EA 4N0CC 5A3ID 1A0QL 1S78C 1DBBH 4TN9A 2DTML 4NBZB 1KPRA 4JCMA 1JRHI 4LCYA 5EC1A 1RZ8B 2VDMH 5ABDE 5A16A 2IWGA 4FP8L 2BXZA 1YN6A 5D6CB 5FM5M 5KVEL 4BUGA 1TJHH 2VLRB 5LVEA 5CJ8A 4ZYKA 4M7JL 5GS1C 5A2IH 3QIWA 3O6FB 1YEGL 1G7MA 4Y5YA 4OIAA 1FNGB 4PJGE 5EO1B 3FONB 4X7TB 3B9DA 5F1NA 1A3RL 4FABH 1FFOB 4Z7WF 1YEIL 3ZDYF 5T3XH 1UH3A 3F6LA 1QLFB 1UZ8B 3QUKB 1AXTH 3N85H 4NWTH 3G08B 2ZSVB 2XN9A 1WZ1L 3OG4B 4KTEH 4EIZC 3VJ6B 5IJKC 4UTAL 3TO4A 4JFDA 4NO0A 3QDGD 4O2EA 1JYXA 4CRPA 3P4MB 4F7PB 4PJ7A 2XQYK 3V0VA 3VXMD 3D39D 5IUSA 3HNTH 1PW3A 3NH7L 4K7FB 5FYKH 3MBEC 5E70A 1S7RB 2VSCA 3X3GL 4OGZA 4WW1A 4Z7OF 4UI2A 3QHTC 3S4SG 3RZWA 3SKUD 4OCWH 3DTXB 4OZHB 5CD5D 1MCOH 2CMRL 1PX4A 3L3IA 5HYJD 2X4OB 1OT1A 3P4NB 1ZT4B 4JY6B 4AIOA 1WFOA 3I6KA 4QT5B 4F15C 5I1EL 3C9NA 1BVLB 1R3JA 3V5DA 3R4DA 5DMJB 2PYEB 3MROA 1YNTB 2QKIB 3R8BB 1VKXA 1SJVA 3BP6B 4R8WL 4NDMA 3HMWH 4FOMA 4BZ1L 3G9VA 3GMQB 5IQ9B 1GSMA 2VRAA 1U93B 3P77B 1KB5H 4ZD3H 3QXUA 5FDWA 3UDWA 3V4VH 2LV4A 4WI4A 2H45A 4J3TA 4OF0A 1FZKA 4PB9H 1MLCA 1CGTA 4JFYB 3KHQA 2V7HA 4PS4L 1SMOA 2CDFB 4P57A 5ICXA 2CPCA 4WHTA 3C5JB 1NANI 3EO0A 5TE7L 1KT2A 4KC3B 4GMSL 4JN1H 3PWLA 4I1NB 3RY4A 1Q94A 4XNUH 3D18B 1KCVH 4MD5B 2QQKH 4JFFB 4XXCC 3EJYD 4GMTL 3NFSL 4HJ0C 1MHPL 1VGKA 1R5VA 5FXCH 5DRWA 3L6FB 5I18H 4LAQL 3A6OA 1QFWI 1SEQH 2XG4A 1WAAE 2AXJA 3TCLB 5E4EB 4L8SB 4QRRD 4PRAB 2CLVA 1KENH 2HP4A 3IKCA 3QUYA 4Z76A 2JLLA 2XQBH 2BOCB 5CBEA 1NCNA 1U3YA 1B0GB 2P24A 4K3DL 5E1AB 1KG0B 1X3DA 3QXWA 4NNPL 1JHTB 2NTSP 4MNHB 4L8DB 4Q7DA 3FQRB 5I8CB 2R8SH 3FO0H 4ZUUA 4OZGB 3VDCA 3O4LA 4XXDB 1ZHKB 4WI3A 5GRZA 2JCCB 5BRZA 4HLJA 1AFVH 3JWOL 3P30L 4KVNH 4JKPL 3THML 4H88H 2Z93A 4QYOA 4POZD 1G6VK 1BFVH 1B90A 3MCKA 1NDMA 1JK8B 4MD4B 2QADC 1G7HB 3ARBA 4JE4B 1E6OH 5D6DA 4L4TB 4V1DE 4BUHA 4LCWD 1S9YB 4P4KA 5JO5B 4G8GB 4M1GL 1R3LA 2KH2B 3QR2A 4GH7B 1Z0NA 2QEJA 1Q1JH 5IK3B 3MRCA 1XGUA 2PTTB 3RZCB 1NBYA 2V7NB 5DJYA 4YHPB 3OWEA 1UJ3C 4DCQA 2W38A 3MLVH 5JQ6L 3BIAX 3CSYB 4JRYB 5ESVB 4UILH 3VFTA 1RJYB 4D0BB 3K2UH 1SM3H 3LS4H 3X12A 4I3SL 4NOFA 4PJBE 5E2TH 4G9FD 3GB7A 4FQXA 2X4UA 4NRZB 1D5XA 4DZBB 3T3PE 1HE7A 5ICZB 1LO5B 2EKSA 3QHZL 3P9LA 4KJPD 3IRZA 2VLKE 2GSIB 1F2XK 3NFNA 1PFCA 2DLTA 2HAZA 5JOPD 1F00I 3DVFA 2AJ3B 5GSRA 4ZFGL 4XHJC 1H8SA 4OD1L 4W4OA 2V9TA 2W65A 4GAJL 1RJZA 2I9LA 5FUOL 1MCJA 1FZOB 2JK5A 5E6ID 4Y5VB 4WFGE 1D5BA 2HKFH 1L6ZA 5K9JH 3WJLC 2AEQL 4G3YH 1OW0C 2X1WL 3MLYH 5DHVA 3E6FB 3IXTA 4M93B 5D7LA 4YDJA 1K8IB 1JNLH 5I1DB 5CEZE 1AI1H 2XZCH 5B39A 3U1SL 1WBYB 4M8VA 5IEHB 2DLEA 1WUNT 5F8QC 5EIQA 5SV4A 1J8HD 1PQZB 1A7NL 3I9GH 3JVGA 3IDXH 3QQ3A 1S7XA 2P42B 4J8RA 2DQFB 1R3IL 1T1ZA 4K8RH 1FSKC 5HBBA 3SKJH 1U8OB 3MLTA 5JW4M 4GKNA 4KK8D 3Q2CA 3I84A 5F9JB 5GZND 2W0FB 2VZ3A 3ARED 4LSVH 5DFWH 1A14L 2YPLD 3WE6B 1BWMA 5CJOL 3BOVA 5EIVA 1JZ6A 1NL0H 4LSQH 4XCNA 1WZLA 4W68A 4X6DB 3FO9B 1UM4H 4QXWA 4X6FB 4LSSH 4MHHI 3I2CH 2H8PB 5HGHA 1NCDL 1KEMH 4G9DB 4ERSH 2P46B 3SE3C 2FO1A 5E6YA 2NY6D 4OFKA 1H3VA 5FOBA 1JRHL 5T3XD 4MSWA 5IVXF 1U8NA 4HK0A 4RFEB 3TN0D 4GRWB 4EUPH 3V6OC 3PGDB 3LY6A 4JG1L 4YQXH 2BRQA 5DMGC 3SE9L 1JGEA 5CEXB 4HBCH 2HTLD 5FKPB 2BRRH 1YPZF 3CFCH 5B8CA 3ZTNL 3OKDA 4H26A 3DETD 4EEEA 2CKBA 3IXAA 4JDVA 4NGHL 3SDAA 2YK1H 2KQNA 5J12B 4LSUL 3EDKA 3TC9A 3ULSA 5CINL 4LQFH 4HIJB 1EXUB 3QFJA 4I0PD 4YHMH 5FCUH 2G9HB 2X1OA 1HH9A 5D7IB 1FN4A 2YKLL 3ARQA 4OQ1A 5I8EB 2AQ2A 4C56A 3L5WB 5IMOA 1ROWA 4GRLD 1MF2L 2HFFB 1NAMB 3IDMB 2BVPA 3RPKA 4PGEB 4LEOB 4PR5B 1C08A 4GW4B 1U8JA 1QFOA 5DURD 2WSKA 4L1DA 1BVZA 4X7SL 1IAKB 4QNPE 4PJ8D 4XAKD 3EZ8A 5EOTB 2YC1B 3CU1A 2XKNA 4FQHA 4OGYH 2BNQA 3ZSSA 3UTSB 4P5TD 1MY5A 3VWJC 1DQLH 5CFHA 5IKCA 3P9WB 4ZUWA 3FT4A 4N1HB 2NW3A 5E7FA 2CIIB 3GM8A 4LP4A 4OCRH 1U8LA 4GFTB 2R0ZH 4J3UA 2FYYA 4KFZC 3BEVB 3LHPH 5KVGH 4IOSD 2NX5B 3DV4B 3BJ91 1JGDA 3JZ7A 3MXWL 4K71C 1E6JH 1Y0LB 4M7ZB 5EPMA 5FYJE 2P8LB 4LCUA 3BW9A 4M02A 1N5AB 3BGAA 3DYPA 1I7ZA 4H0GA 3QDMB 2D9QB 3BVNB 4DUVA 1BZQK 4PREB 5ALCL 1DQJA 5D1QA 1RU9H 4HH9B 4ISVA 4MLIA 3A6BH 4YXKL 2JF1A 2OSLA 4NNXB 3QXAB 3RBGA 2AJYL 3VH8B 1A1OA 3Q5YA 5JIKA 2HKHL 4Z7UB 2XWJA 4ZXBA 3HI6H 3FT3B 2O61B 3RY5A 4CU6A 3BFOA 1UEYA 2A6DB 4D0DA 5HYFA 4ONFL 2ADFH 1T0MB 2IF7A 3TIEB 3CCHA 1SY6A 3O3AB 3GBMH 1H0DB 1OTSD 2DM4A 4OM0H 2HMID 4HT1H 2AVGA 5IQ7L 1FJ1A 4NZRL 1LNUA 4LLVB 2SEBB 4FRWA 3W39A 1ZGLB 2K1MA 3U36A 5EUOE 2OR9L 4X7DC 4ZOAA 1M6OA 1H3XA 4WY7H 2NY1C 3KYMB 4OLVL 4Y4HC 2LTQB 3HE7A 5M94B 3TVMB 1MREH 2ADJA 3C5ZB 5SWZD 1QFPA 3PP3K 4KU1A 5LBSL 4KUZL 1MCPH 1FL3A 4OTXH 3U82B 2BVEA 4JFOA 2UWEA 2FB4L 4JDZB 2NXYC 1CICB 4P9MH 1KLGA 3VFSA 1U58A 1EIBA 2IANA 3EOBB 4Q58C 1FV1B 3BMWA 5ETUA 3V6OE 3C2SA 2NQCA 5CP3H 3KYOB 4PPTA 2BJMH 1EX0A 3ULUL 4IIQC 1IGYB 5F7UA 5E08L 5E2WL 3OB0K 5IB3B 4GAGL 5DR5L 3I6LE 5K9OA 1G7IA 3E0GA 3VH8G 1NC4A 2IQAA 1J0HA 3IU3A 4HF5L 1MCWW 1MIMH 1HKLL 3NAAL 1RMFL 3MNWA 2VABB 4PLKC 4BELD 4CJ1A 3LKQA 4FQJL 1OAXL 2C4FU 4P99A 5KSBB 4LF3A 4LMQE 2Z9TA 3NACH 4ZFOB 4P4RB 1A6ZB 2BK8A 5CMAB 3MRHB 1E4WL 3MRLB 1UB6B 4L29A 2ZOKA 2BSSB 1BIHA 1YY9D 3GIVA 4R3SB 4XP1H 1SY6L 3KNBA 2EDNA 5E4IA 1XGYH 5TE6H 3HB3D 1G1YA 1T4KA 5GIRB 1R0AH 2CK2A 2F8VA 3OKLA 4GW1B 1RZKL 5DJDB 4GSDL 1TJGH 4UDUB 2JE8A 1T1WB 4MCYB 4PJEF 2XYCA 5J11C 5IHZB 4MXVF 3BD3A 3KS0J 1K2DA 3CZJA 4G42A 5HPOA 4JHAL 3MTRA 3ZL4L 3AY4C 5D72L 5EZOL 3G04B 2B1AH 1CDIA 5FGBC 3TPKA 3HMXL 1T21B 3VGHA 3ARPA 4M6OL 1KPVA 1QSEA 5BS0D 4C54A 1AGEA 3AS3A 1V7MH 5BV7H 1CFVH 1NGYB 5ALBH 2R0WH 4WW2C 3FB7B 3ZO0A 1TCRB 1IGFL 3QEQB 3BP5A 5DD1H 4LVOB 1F4YH 1NLDH 1S3KL 3TBWA 4YDKH 2ESVB 3MRFA 1DL7H 1MQKH 4PJHF 1JHLL 4PJGA 1ZGLM 2PO6D 1CK0L 4K8RD 3WCYA 1FAKT 5KZCB 1CE6B 3HZKB 5J9PA 3MV7D 4UT9H 4JO2H 2DYPD 4MJ2A 3UTQB 1MFAH 1IJ9A 3BMVA 2C3GA 3MRDB 4YDVB 3T4AA 4ZS7L 3DXAE 5C71A 1Z0MA 1M71B 5CJBA 3MFFB 4O4YH 3SDCA 5H35A 2PETA 2IG2H 1DVFD 2DL2A 4OLEA 5DQ9A 3S34H 4JZJC 3P4OB 2X70A 1RUKL 1N0XL 3QQ9C 1IGCH 5BO1L 1U91B 1VB9A 3FQWA 3Q1SL 4MNQE 4LPTA 5HHVL 4JREB 3VXSA 4OCSL 4HV8B 4HUXB 4EQ2A 5T33L 2FJGA 9CGTA 4WHCA 2BXYA 4F7MA 1JN6B 2HTKD 1OARL 3GMLA 3GSXB 3D3VB 5GRJH 5KS9E 4U3HA 2J5LB 1PVHA 1YEFL 1FO0A 1URLA 1RVFL 3C60A 2D7OA 3D25B 1I7RB 1NGXA 4MJ6B 5FK9A 4AQOA 4NJAH 4E0RA 1J0ZA 4P23C 1QO3B 4X6CB 1I7TA 5E94B 4QRSB 5ID0B 1D5MA 5DD5H 4YBLB 4PJIA 4PGZA 3P9MB 3R8QA 4QGYA 2VYRE 5JQHC 1T3FA 4KGLA 5FO8B 4L3CA 1QP1A 3MRMB 4XP4L 2Q87A 1TTGA 5DFVC 4HS8H 3LCYA 4FFZH 1D5IH 1KFAH 2OR8A 4Z78B 1EGJH 1IGMH 3SJVB 3ILQC 1CG9A 4HKXA 3GM0A 3KPSD 3LS5L 4PJ9C 3OX8A 4GW5B 5FAAA 3ARDC 2N7BA 4J3XA 2NY4C 1B2WH 2O5XL 4RFNC 1BQSA 3IETA 1QQDA 1F6AB 4LSRH 4D3CL 1A2YB 5L7XH 4AT6A 3K8MA 4DGVH 3BRFA 2HT3C 5K9QG 1MJ8L 5HGAB 3MOQA 4U1KA 5IMKA 5E7BA 1OAQL 1W2KT 2IPKB 4RZCA 35C8H 3MV8A 3ZT7A 2CK0H 2VQUA 1S9KC 1KTLA 4E42B 4APQC 4QOKB 4F7CA 2V2TA 1PSKH 4TSAH 1FZMB 3LB6D 1H5BA 4KUCD 3BKCL 1G9EA 2Z31D 5I8OH 5BVJB 3O11B 3LKPA 1JP5A 2C26A 4PP1C 4WI2A 2X4QB 2R9HD 3VXRE 1F4WL 4RRPA 1MCFA 1MVUA 3G5ZA 3TT3H 4EN3B 5TF0A 3KPOA 4MDJB 1FO0L 1DE4A 4WFED 4GG8A 5T1DL 3F7YA 3PL6A 4U6YA 1FPTH 5D7JA 5AZ2L 4E5XB 4BQ9A 5AWNH 3FFDA 2HFTA 1NDGB 4U1GC 4X4YB 2IADA 5EUKA 2QTEA 1OTTC 3WS6C 5GS1A 2LABA 2HFGL 2XY1A 1MRDH 2GY5A 3MLSH 2Y25A 4LLYB 1Z9SA 4DQOH 4V1DA 1V3KA 2UYLB 1CFQA 4CDHA 1TMCB 1KLUB 2W1NA 3AUVA 2VDQH 4PLJD 4JZNB 1JPST 3VRJA 1KNOA 3QQNA 4P46C 3BIKA 1PD6A 5EN2B 1T22A 1T83C 3U46B 4P3DA 4UAOC 1SJHA 3CH1A 1I9IH 2ZCKH 1T1YB 2VQ1A 3GK8H 5TPWL 2FL5B 4RIRB 4CN4A 5C0RH 3OR6B 2E8YA 1ZT7B 3QIUB 1GZQB 5JLZB 1A4KB 5F93C 5F9AC 1YEHH 1A64A 4JHZA 2EH8H 5D1ZD 2XTJD 4R0LA 2C1OA 5HGBA 1AC0A 1OY3B 4NM4L 3FRUA 1HWHB 6FABH 4M1CC 5FYJU 4EKXA 4PRHA 3ILPB 2AK1L 4HHAB 4DUWA 4WCYL 3NN8A 1YY8B 3KG5A 4YHOH 5F3HB 1VEOA 2AJZA 2VLKA 1EHAA 2B7DT 1CZ8L 5BCAA 3RVUD 3KPTA 4JFEE 4LLWB 1S5HA 3VW3H 4OLUH 2JIXB 3LDBB 2VMFA 4DN4L 2Z4QA 1HHGA 2BMKA 1JTOA 1DEEB 5JOEA 3OXSA 2FO4B 5J6HA 4NNYB 4DGYH 2DQCL 3B3IA 2DI7A 1U8MA 2F53B 3BZ4B 3MRJB 5AAWA 5SWSB 5TE4L 5IW6B 3EYOA 4EDWL 4XCCL 2JJSC 4NOBA 3SQOL 3NPSB 4MQXC 1ZHBB 3BHBB 1PYWB 5IWLC 1RUPH 2NY2B 1U3JA 2QHRL 3DVGB 3UX9B 1G7JB 3QO0B 4KK9D 3MRQB 3QQ4B 2NXZC 1S5IH 3MCG1 5I1JH 3U0PB 5F6IC 4LASH 3REWB 1K6QH 3L7FA 3N1PC 4XRCA 4NQEA 4ZFFB 4EI5B 1IARB 2OL3B 1TQBB 2EEBA 5CIPH 1VHPA 2XV6B 4KAQH 1DJSA 1CLOH 1DQDL 1PG7L 2VXQH 4ODVH 4ODTH 3QNYA 2B0SH 2XWBB 5C70A 4OLWH 3RWHB 2X1PA 3PWPD 1C12B 3ARFA 5HYSA 1W0VA 4XWOC 1BD2B 5ISZA 5FO7A 4FZ8H 2GJ6E 1VFBB 1W8OA 1QRNE 4Q2ZA 1V7NH 3VRIB 1G0DA 1T2QH 3LQMA 3SHSA 2IH3B 2D4DA 3I3EA 3OF6D 3JV5A 2D31B 3TT1L 4RAVA 4M62H 3W0WE 2Q76A 4PRDA 5F7FA 1GGCH 5D9SA 1MJ7L 3MLZH 2DMKA 4N1CA 3SCMC 1MI5A 3WUWA 3RNQB 1UM5H 1MRCL 1IVLA 3R0MA 4TQEH 3WJJA 5MP6L 3R1GH 4N0RA 2GT9B 4KK6C 4N5EC 4KZDL 4NP4L 2BSTB 1CCZA 1LP9B 3MBEB 1W72L 3T77B 2XZZA 3QUMB 2H32A 2Y36L 1UKQA 5DRXB 5JW5B 1KCSH 3G6JB 1K5NB 4YXHL 4WUUD 5BQ7B 2EIZA 3BDYL 4YC2C 1WTLA 4TUJB 1KCRL 3TH4T 3LIZH 1AHWB 1AD0B 3O3BA 1KJ2B 3IDJA 4O9HH 1RZJH 4G6KL 2AABL 4PGCA 3VFMB 1WZKA 4BH7A 3EAKA 4IHOB 1EFXD 2O5YH 5F97E 2AV1B 1H15B 1LO2H 1XF5A 3AS0A 3H9ZA 5INDA 2AEPH 4PRPB 2DRUA 4QRPE 3T65B 5GZOC 1UA6L 4M6ML 5IW3A 1Z6JT 3PP3H 4Y5XA 1KLFA 3GHEH 4LHUA 4ENEC 1A1MA 5I73C 1Q38A 5CZXC 4M3KB 5GRYA 5FECB 1IMHC 4UT7L 2V2XB 4FQLL 1MFNA 1LDSA 4QXTA 5BJTB 1BP3B 1OGAE 2WWMC 3G6AB 4Y8DC 4OQTH 1D6EB 3UZEA 1DUZB 5DT1L 5JIPA 4QXGH 1A5FH 1KIRA 2HG5B 1Z9OA 3S3JA 4GS7C 3OB0H 4OIIH 5ADPL 4C57C 4OCXH 3TJHD 4MYWB 3M1BA 2Y1VA 4LCIH 3V4PH 3F65A 4LCCC 1WCBA 4YBQC 1ACYL 5IFJB 3ES6A 3D0LB 3KPMA 1BREA 1EAPA 4UINL 3MA9L 5FGRA 3S9DB 1FAIH 3C09C 3HUJE 1WBXB 1O7VA 1FFNA 3WJLA 4OLZH 4O51B 4YLQT 4ZO7A 5HHOD 3RAJH 1N6VA 2X10A 2G60H 1D9KB 4UT6L 1PAMA 1J5OH 2EICA 5E99L 5D7SL 4X5LA 3HE6B 4XC1L 3RU8L 1XCTB 4MA8H 4F7TB 4G8EB 3HAEA 3WBDA 1NEZB 2V5TA 1R3KB 2WINA 2WNGA 4ORGB 5D5ME 4NUJA 4YEFA 1P7QA 1FGVL 3WS3B 1X5XA 1T66C 4QXUL 1IM3A 1TDQA 2ENSA 3BPNC 1C5DB 3G5YA 2OP4H 4O2FB 1T03L 3TZVD 4QRUA 4LSPL 2C3VA 2DI9A 5EUOA 1UM6H 3ECBB 4IRJC 1J1XH 4P48A 5D1XB 1U95A 3B9VA 3QXTA 4K23H 3V0WH 5JW4R 1QYGH 5KSVB 2QSTA 4S1RH 1LD9B 4HBQA 4IOIA 2ZNXA 2OX5A 2CLZB 3VXMA 3D39A 4IEFB 3S6CA 4X8XA 4YHLH 5F7DB 1OAZL 4IRSC 3T0EC 4KROD 1DANT 3RNKB 3NABH 4KGJA 1A02N 2NY3B 1QR1A 3V8OA 3WFBL 1CD1A 1L0XA 1NFDE 5DUML 4P2OB 1JGLL 4MAYB 2M1KA 2DQTL 1PKOA 3H42H 4LFHG 1XIWC 2X7LB 3VGAC 4BZYA 4XBEL 4RQQB 2P44B 3VXTB 3PWJB 1Q9OB 3UZQA 5JOFB 2A6KA 1AKJB 3IB4A 4N9GB 1EA9C 1X5IA 2BVQA 4K94C 3FFCE 1KELL 2AEIT 4PJ7F 4U0QB 5DJ8B 4LU5H 3X14B 4HCRL 3VXUB 4M00A 2HVKA 2XOTA 4XVTH 1NEZG 4M4PA 1IC5L 4UU9A 1XF4B 3PGCB 3ARYA 2DQJH 1RK1B 3TIDA 2YEZB 4FG6D 2YWYA 4XTRD 3WN5A 1AR2A 5HI3D 2GHWB 1HSAA 1LO4H 4B7IA 1H3PH 2LE9A 4DFIA 5I30H 4YNYB 3TBYA 1FYTD 1GZPB 5I2IA 3MGTA 3P3YA 1NBVL 2PXYB 4ODUB 4XMLL 3L3JA 3OGCB 4JFQB 1P7KB 4HD9A 1RZFL 2IAMC 2W9EH 1JNHA 5MERB 3BN9C 1P84K 1YECH 5DI8A 4KTDL 1VPOL 1L9MA 2FHBA 2JTDA 1B0WA 5H2BB 1G9MH 2GY7B 4PJFF 2R56L 1FVDA 3WDJA 2WW8A 1NFKA 1FYHB 3TYFA 1P1ZB 2R29H 1RHHB 4LKXA 2VO5A 2CSPA 4FFVC 3EO1A 4BA8A 2D03H 1MFCH 5DMKA 1MAML 4JM2F 4Y4KC 2AEWA 2DQGL 1ZGLP 4U31A 1X4ZA 1BMGA 4XVJH 5I1CH 4NRXA 4M5YL 5E9DB 4XVSH 1BZ7A 4I9WE 4D9QD 5GGVY 1DLFL 4NN6B 4M48H 3MA7A 4MQ7B 4X9BA 4BFIB 4PJAA 3C2AL 4HGWA 2A6JB 3N1MC 1FH5L 5C09D 4LVHB 1BQHA 1X5KA 4R90H 1NCAL 4NWUH 4LCWA 3H6JA 5EBLB 3UROR 4LPYA 4JVWA 2A9NL 3BPCA 5C86A 1Q9KB 2OQJA 1T0NB 2J4WL 3HR5A 4YWGL 5JXED 1YMME 2BHZA 1F5WA 4MNQA 3AAZB 3O3DB 1IKFH 3DLQR 3PWVB 3TGXA 4EVNB 1BX2A 3VD9A 1TPXB 3BP4A 5GS3A 1S7WA 4X9IA 1A6TA 3JWNC 1JFQH 1OL0A 4XVUC 1KOAA 1KPRB 3VI4E 1OSZA 4OGXH 4JJ5B 1DBJH 4LCYB 5EC1B 5C0CA 3VXPB 3HZMA 5A16B 3MV9E 1U6AH 4GBXB 3IFPB 3EOTL 3QUXB 3RQ3A 2CDGB 3T0EE 4IRZL 4G9FA 2XA3A 4H1LA 4PJCE 1L0YA 4LDLB 2GFBB 1IAOB 3MOBL 1UVQB 4UOW1 2WAHA 4ETYA 3DMMB 3SDDD 3ARZA 4HUVA 2M2DA 5EORL 1RUQL 2CUIA 3QIWB 4WWID 1CL7I 5I66B 4KRPB 5IMMA 3V6ZA 4Y5YB 3KPRE 1G84A 5F1NB 3LEVL 1ZTXL 3LEYH 4HUNB 5E6IA 3VWJB 4E41B 3B2VL 1WT5C 3WXWL 4YR6B 2VLLA 1NFIA 2W60A 2IQ9L 4MS8D 4FTVD 1QBML 3PP4H 4MJID 1AGCA 5JW4Q 3VFRA 5B3NA 4TNVK 3BIBX 5HPMB 5GJSH 5ILTH 3DX9A 1P6AB 4HUUB 1QR4A 4U6HB 3CGTA 4DKFL 4KKBC 4MNGE 3V0VB 1N26A 3S36H 3UAJC 2Y07L 5IIEB 4TNVF 3DUUA 1KN2H 1WEJH 3BN3B 1J8HA 3L7EA 1UCBL 3L5HA 4S1SH 5GSVB 1B6UA 3WO4B 1U92B 5HDBF 4UB0L 4WW1B 1UXSB 2WUBH 5B4MC 1AC6A 3ULVC 3OHXA 4UQ3A 2IBGA 3D5OF 5DZNA 2XTLA 5F7EL 2DQHL 2G5BB 3HG1D 4IBLT 4Q9RL 3AREA 1JF1B 2YPLA 4X83A 3RUGA 2MCG1 2J88H 1KXVC 5D4QA 3I6KB 1XGRB 3C9NB 5IBTL 3V5DB 5MENE 4YK4C 4R4BA 2NNAB 4Y4FD 1X5JA 1VKXB 1MHHA 2AJXL 3GKWL 4NQCE 1XGPA 5CD3A 3QB7C 4NDMB 5J13C 1SJEB 3P73B 4ZAKB 3E6HA 4K07A 4UDTB 3U79A 2DICA 5FDWB 3Q48A 5TDPB 3VFGH 1RZIB 1DBMH 3RRQA 3ZE0F 1T7XA 2VWEC 5GJTL 5DK0A 4JB9L 5KS9B 5C6TH 3EYFA 1MWAL 12E8L 3BH9B 3RWIA 4R26L 3LRSA 1ZLWK 4NCC2 1KPUB 3BPLB 5EBMA 4P57B 3WNKA 5IP4A 1DLHA 4WHTB 3CX5K 4PJ5B 3LKNB 4K3JL 5E8EA 4ZNCD 1CFSB 3MLXL 4UV4H 4XP5L 2APVA 4JZJA 4Y1AE 1DQML 1Q94B 1Q0YL 2NXYB 4GRLA 1I9RL 2ZUQB 3I6GB 1VGKB 1N6QH 1NUFA 1R5VB 2ZZUT 1FVEA 4IIQB 4HIXL 3GGWA 4HQQH 1CIUA 3QJFA 3I75A 2XZAL 5MI0C 1C1EL 1YJDC 1QSZA 4RMUA 3S88L 4HXBL 4H8WH 4NN5C 4PJ8A 2CLVB 5D93C 1C7SA 5C0ND 3QUYB 3QUZB 3U2SA 4PB0L 1LMKA 3TH2T 4DUXA 4JM4L 1M4KA 1U42A 5GGUA 2P24B 4HLZH 3WO3B 4JFEA 4P5TA 5CEYA 3TEUA 1A0QH 1X7QB 2DTMH 2UVFA 4JZOB 4L9LC 4UMGA 4GAYA 1RZ7H 4ZUUB 2OMNA 5BRZB 3NCFB 1AQKL 4JKWA 3WHE1 5KVEH 3S7GA 3JTSB 3UJIL 5C2BL 5DXWA 4CN6A 2Z93B 4MJ5A 2YPKA 2X5PA 4NFCA 4FXGB 4U3CA 3PDOA 3V6FB 2VDNL 3MCKB 1NDMB 5L2KE 4D94A 4M7JH 2DD8H 3ARBB 1LQSR 3S96A 4P2RD 4EI6A 1ED3A 3NCEB 1QA9B 2DIJA 1U3HD 1AXTL 1YEGH 2Q8BL 3N85L 1R3LB 3LSOA 1WISA 1A3RH 2OXHA 1YEIH 3MRKA 4BQ6A 3PHOB 3ARDA 1IBGL 3NPZB 4LLDB 5CZVL 4ODSH 5IMLA 1WZ1H 4HUWB 1NGPL 5DVLA 4DCQB 5F7KC 1B4JH 5C7XL 3GMPB 2DJSA 2NW2A 4UTAH 3VFTB 4JPIA 4D8PA 1Z2KA 4WW2B 3HNTL 2B4CC 2DLGA 2APFA 3ULUF 1OT2A 2AJVH 5C9JA 1AY1L 2Q3ZA 4Z7VB 3X12B 2QQLL 3CDGB 1DUYA 1EUUA 5JHDD 3NH7H 2GJ6A 1QG3A 4KJYB 4NO5A 4NC1C 4OCWL 4J3SA 2X4UB 3MUY1 1D5XB 1M05B 3X3GH 3U9PH 3ULVE 1MCOL 3IDUA 2EKSB 1UT9A 5EOCJ 5TDNB 1JNNH 3NZ8A 1LEIA 5HTSA 5FEBA 4NKOA 5IR1A 3LKSA 4WWKD 5GSRB 2CMRH 4HIHA 2NYYD 1K3ZA 1ZSDA 5IBLC 4JPKL 2W65B 5E8DL 5K93A 4G8FA 3RTQC 2C3XA 4HEME 3RWGA 5I71B 2ZCLL 5SWZA 3GSRA 3RGVD 5I1EH 3A0OA 4JY5L 3HMWL 3O2WL 2R39A 2IH1B 4JQVA 1D5BB 2HYMA 3WS6A 3U7YL 1F8TL 2YOCA 1CE1L 1XR9A 4R8WH 3UTOA 2CRYA 1QLEH 2JJTC 5DHVB 3L3GB 3IXTB 3OB8A 5DK2B 4L8CA 5D7LB 1A7PL 4YDJB 1CDBA 4X0KB 3U6RA 3RDTC 2VWEE 1CU4H 3NIGF 1CXFA 1VSCA 3KYNA 4P46A 2YBRA 5TH2A 1IQDA 5CGYD 5L8JB 5J1SC 3DVNB 3RY6A 3ZKMC 4D9RE 4KQ3L 2I25N 3MJ7B 3AU1A 4OAWA 4PS4H 2QQQA 1S7XB 3L95B 5I6XC 4KMQA 1T1ZB 1GHFL 3MLTB 4MQSB 5TE7H 3FQXA 5FA3B 2WM0A 4S1DD 3EW3B 1C8PA 1T5WA 4ZUVA 1ZLVK 1BEYH 1HXYB 4U1MB 4GMSH 1QOKA 4WTXA 4HULB 4GMTH 3NFSH 5FGCE 3VXNA 43CAB 3CAFA 1WBZA 4LAQH 3TA3B 4MWFA 4TYUA 3DWTA 3MGAA 3OV6A 1BFOA 1CTNA 4KHTH 5DRNA 4F58L 5FOBB 4PJ9B 2Y5TA 2GKIA 4YAQA 5IB5A 4JFPB 4OI8A 2CKNA 1UB5B 2EYTB 5KN5A 4RFNB 1OD7A 3FO0L 4K3DH 2Z91B 5J6GB 1JGEB 1UJTA 4KPHL 4NNPH 1PKQE 4KVNL 2DAVA 2DB8A 4RGNC 4KKLD 3HUJA 2CKBB 3IXAB 3MACL 3MJ8B 3ALWA 4JDVB 4JKPH 3SDAB 2J8UF 3QDJE 1CL7L 2JJSA 3THMH 3FO1B 5DMYA 3WFHB 1UADC 3FAWA 3ULSB 5TDOA 3ARRA 4NC0B 3TP4A 4APQB 4U1IB 1FE8L 5CJQL 1I3VA 1QRNB 5CBAA 5T1LB 2B5IB 4BZ2L 2PO6A 3AXLB 4C56B 5IMOB 2VNCA 1HK6A 5C3TA 4YFDB 5BVPL 2BVPB 4M1GH 3W0WB 3MV7A 1GVIA 2DYPA 4ZNEE 1HHJA 2E7LA 2P5WB 4HDIB 1J9CT 1KSRA 3IVKA 5DUBA 3MLVL 4ONHB 5CJ5A 1U8IA 5KAQG 4FQHB 2BNQB 1JCKA 4RGMB 3K2UL 4QTHA 2RR3A 4FQ2L 1N59A 1DVFA 5JQ6H 4IMLB 1P9MC 5IV2B 5IKCB 3FT4B 2Z8SA 4RDQF 1R24A 4GRMB 4P2CG 3TFKC 4NC1E 4I3SH 4PJGF 2FYYB 3V2AR 3KWWA 3IS0X 5K59F 2DDQL 2V17L 5T3ZE 1JGDB 5D8JL 2EE6A 4YPJA 3RP1A 4HWZB 3FMGL 4XPAH 5EPMB 3QHZH 3QWQB 3JWDC 2FLRT 2X1XR 3GIZL 4YZFE 1CF8H 1VEMA 3SCMA 4ZFGH 5HHQA 2I9TA 4OD1H 4GAJH 2XNAB 5D1QB 2O26U 3VG9C 4HGMA 4HUMB 2HKFL 3LVEA 2BSED 3BGFC 4ISVB 4PY7A 5FUOH 3NZHH 5K9JL 2VH5L 4G3YL 5E00A 3MLYL 2AK4D 2XZQL 1JE6A 1XGQA 1J1PH 2X4PA 3VFNA 1G6RA 1Z5LA 3IU4H 4FQPA 5TQ2L 2ICCA 4Y2OA 1JNLL 1F6LL 1OGTA 1ZVSA 1AI1L 2XZCL 4P2QA 3ZE2E 1AGBA 4JFZH 5AG8A 3WD5L 3RA7H 4QRRE 4XNYL 4HS6A 4KDWA 3LMJL 3U1SH 1PEZA 3IDXL 3SPVA 4Z77A 2YSSA 4Y16C 3DBXA 3Q3GB 4K8RL 1GGBH 1S7TA 2ZKHL 4U6XB 1A7NH 2J1KA 2EEAA 1C5BL 3GSWB 2IPUK 3MXVH 3O6KL 4F8TA 1F11B 3U36B 3RX5A 4KZEL 5IBUB 4PJIF 4YDIH 1I1YB 1ZWIA 5DEFB 1D7FA 1MJJA 1NL0L 2BVUA 1B0RA 1UM4L 4YHYB 2C3WA 1A14H 1X9QA 4WV1C 1CQKA 5HY9A 2ADJB 5CJOH 1TFHA 4ERSL 2NXZB 3PQYB 1UKSA 1NCDH 4YX2L 2UWEB 3B6SA 4PJXE 1KLGB 3MZGB 5IVZA 1JRHH 4LCCA 3RX8A 3E2HC 4FMFA 1BJ1J 5DC4B 1CR9L 4GXUN 1SYSA 4JG1H 4RGNE 3HPJA 1G7IB 4HAGA 5KSAC 4FNLH 2YK1L 1NC4B 3Q0HA 5AZEL 4U1NB 4UIMB 1IAIM 3ZTNH 3IU3B 4M6AA 5FB8B 4KMLB 3UTPD 1XF3B 1M7XA 4NGHH 4YHML 4JFXB 3WLWD 1JUFB 4LSUH 3LKQB 1WAAF 1N8ZA 4QHKI 4LF3B 3FCTA 1G6RL 4FXKA 5EU3B 2NY5L 2YKLH 3Q5TA 4W6XB 1MF2H 3LEXB 3BH8B 5I1AB 2ZOKB 3IS1X 1BJMA 3KXFD 5JOPE 2JJWA 3NCYP 5H37H 5IBUG 3WNPA 3MZTA 3CSGA 1K8DA 3IKKA 4L3EE 3FFCB 4A6YA 3QG7L 3ARGD 1BM3L 3DURB 4OCNC 5DC9B 3P40A 4LSTL 4OCMC 3MV9A 3FOLA 5D1ZA 4PRNA 1GGUA 3F5WB 3HLAA 4XPHH 3T0EA 3STZB 2AP2A 1E4KC 2K3TA 3LHPL 5KVGL 2BNRB 3X3FH 3PE9A 1E6JL 1UWGL 2YD7A 4KKAC 3QH3A 3RWJB 1YZZA 1BFSA 1INQA 2YHGA 3GSNB 4G6JL 3MXWH 3MLUL 1DFBL 2FEEI 3TBWB 3PXHA 1CDGA 4KRNA 1XIWA 1ZLWH 5GS0H 3MRFB 2OTWB 3BRDA 4OKVB 4ALAH 4JRXD 5DLML 2VLJE 1R5WB 3QI9C 5AUMB 3VRLF 1I1AC 4O02L 4DAGL 4M7LT 1CFNA 2IPTL 4Y0GA 5AEAA 5I73B 5ALCH 2XN9D 3O3EA 3NIDE 3KLHC 4QHNB 1EMTL 2J8OA 2X4NB 4YXKH 2AJYH 4WRLA 3CSBA 4ELME 4WHYH 4KJWD 4JO3L 3S37L 5H35B 1HXMB 3Q6GH 2HKHH 3T3PF 1AP2B 4MNGA 3IF1A 4NKDA 3OKNB 4LRIC 4ONFH 3FQWB 4YHIA 4KRMB 1N3NB 4LEXL 1AO7E 1NANH 4MHHG 2R23A 3VXSB 4ZDHB 3KJ4B 1I9JH 5C0BE 5IQ7H 4NZRH 2IAMA 1KUMA 3GMLB 4WY7L 1JMZA 4XBPA 5IJVA 2WIIA 2VXUL 3C6LC 1D5ZA 3V79C 5B38A 5HHNA 1FO0B 1XMWA 4G8IA 4Y88A 5E56A 4P2YA 1QFWH 4A6YL 1NGXB 5FK9B 3B5HA 3UYPA 2MTPA 4FXLA 1TITA 5F70A 1YDPA 2DLHA 4E0RB 5FYKE 3UTZA 4WGVB 5GXBB 1D5MB 1KGCE 3O8XC 4Q74A 5LBSH 3IDYB 4KUZH 4RDQG 5I1KH 4BH8A 3OF6A 3T04D 3B2UD 3HRZA 1FNEA 3ET9F 4Y4KA 1JTTA 3EOYG 5ITFA 3CUPB 1DSFH 3TO2B 3SDYH 2NR6D 1OAKL 3ULUH 1NPUA 4NO2A 5T1MA 4XAKE 3CK0L 4P9HC 5DR5H 5AYQA 3UMTA 3GFUA 1CG9B 1MIML 2HA1A 4DZ8B 3OX8B 4MD0B 1KIPA 4JM2D 5C07E 2VDRL 3MC0A 5HHMD 3UC0L 3MFGB 4HF5H 5GGRA 4L4VE 4OFDA 1A4JB 1QQDB 1HKLH 1IEBA 3NACL 1RMFH 3RVTD 3VFWA 1F13A 5TGBA 5DJ2A 1P69B 3MMEA 4JQXC 4X80L 1JF5A 4FQJH 1OAXH 4WUUA 1QRKA 4RCAA 5FA4A 3EBAA 4U1KB 4XH2A 3VFOA 1XAUA 4KI5F 1E4WH 4P5MA 4NQDE 4XP1L 1A8JH 1A9EA 3MV8B 5LCVL 4AY0A 4WO4B 4HGKC 1C7TA 5TE6L 1JI2A 3O6FC 4F7CB 2V2TB 3SKOB 2X05A 4PJDE 1SY6H 4PRIE 4FFWC 4M4RA 4OLXL 3FQTB 5C0FB 2RCSH 4JAMB 4ODHL 2YUXA 5FKAA 1RZKH 1X5FA 3REVB 4GSDH 3RL1A 2EC9U 5D70L 1DBKL 3O4LD 2ZP0T 4URTB 4GG8B 3OG6B 3F7YB 4AMKH 3LRGA 1QD0A 5TF1L 5D7JB 1CFVL 3C5SA 3ZL4H 2HLAA 5D72H 3B8SA 5EZOH 3FFDB 1WICA 3HMXH 4M6OH 2IADB 1F58L 3UTTE 5DD1L 5L2KA 3TBVA 1KTDB 3GJEB 1EGJA 3H3KA 2R2EA 2X09A 3JXAA 4P4KD 1IGFH 3L3OB 4ZUTA 2A2QT 4QNPF 4X4MA 1S3KH 2UV3A 4YIQA 1SVZA 2EDYA 4QGTA 1UWXK 1MFAL 5HD8D 1JHLH 1IGTA 5DO2D 1CK0H 2PW1A 2