2VWHA

Haloferax mediterranei glucose dehydrogenase in complex with nadp, zn and glucose.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
357
structure length
357
Chain Sequence
MKAIAVKRGEDRPVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDHLVLGHEAVGVVVDPNDTELEEGDIVVPTVRRPPASGTNEYFERDQPDMAPDGMYFERGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYCLGRRDRPDPTIDIIEELDATYVDSRQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLHNKALVGSVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFDDDDTTIKTAIEFSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE DEHYDROGENASE
publication title Active site dynamics in the zinc-dependent medium chain alcohol dehydrogenase superfamily.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Oxidoreductase
total genus 115
structure length 357
sequence length 357
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vwhA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2vwhA01
2PR2A 3RD5A 1YBAA 1P77A 4AJJA 3FCOA 4DLBA 3I1JA 3I52A 4DUPA 3JQBA 5IFLA 4CV2A 1IZ0A 3PHHA 1YL7A 4RVGA 4ZQEA 1R4NB 3STHA 2XXJA 2Q2WA 2JCVA 4PLYA 5L7TA 1WPQA 1UR5A 3S2GA 3BIOA 3E03A 1V3VA 4BGVA 4J1QA 5GY7A 4DMMA 3MZ0A 1LSJA 4S1VA 1YQDA 2Y99A 5FFFA 4CR8A 1NFFA 4ND4A 3VZQA 1DLIA 2EF1A 3WB9A 4BB6A 4ZD6A 1LDGA 3INGA 4B8WA 1NX6A 2IYOA 3QHAA 1XG5A 2P9EA 1U5AA 4AJPA 1YWGO 3PJEA 3I6IA 4QXMA 4IMPA 4KUEA 3JQDA 1B8UA 3M1LA 4AICA 2A35A 1E92A 1VSVA 3PDJA 4E2ZA 3ADPA 5U9CA 1CERA 1B14A 4WCFA 4ZQBA 5TRTA 4CMEA 2OBYA 4GSKA 3WGQA 2UVDA 4JJIA 4O0LA 2C0CA 4LMRA 4GMGA 5H83A 3ZWWA 4DBZA 3BZUA 2JCYA 1E6WA 1O95A 5LDGA 4KOAA 1D3AA 1FDSA 2NTJA 2B83A 2Y1OA 3RIHA 1GY8A 3GDOA 2JD0A 4YA6A 3NRCA 4J0EA 4ALIA 1T2AA 5DULA 2YY7A 1PL8A 1EK5A 1TI7A 4FBGA 4OXNA 1ZEMA 1PZEA 4IS3A 3WMXA 1ARZA 3GRPA 4IQGA 4YJHA 1YJ8A 3C3XA 1MUUA 1YBVA 3AUAA 5CG1A 1DC6A 1SO8A 2B35A 4IDDA 3FR7A 1HRDA 5IAAA 5T8KA 4TRMA 2VUSA 4RVFA 1BVRA 3TF5A 2PV7A 4BNXA 4IBOA 4IPTA 2QZZA 4WEOA 3PLRA 4PG5A 3NV9A 1HETA 2J3IA 4BO4A 3WGZA 5G4KA 4XRRA 4O59O 3ZWOA 3C85A 4L9RA 1N9GB 3FBTA 4XD2A 5DBFA 1X0XA 3GUCA 4PZDA 2CY0A 5L40A 5BQFA 3NGXA 2X5KO 3PYLA 3RU7A 4W7HA 1O8CA 4UEOA 2DBZA 1OAAA 3MWDB 4CLDA 4JGBA 2VZ9A 3GAZA 4YAEA 3GT0A 3GNSA 1P1HA 3I9KA 3A1NA 3GFGA 3WGGA 2SCUA 4CM8A 2Q4BA 1QYVA 4YJFA 5COQA 5AXAA 1MFPA 1YGYA 1PS0A 1QYDA 4Z6KA 1NQAO 2I9PA 3W6UA 1N2SA 3JD2A 3EVNA 1B8VA 2G0TA 3I9LA 3PYXA 3U0BA 1ORRA 2IE0A 4I9NA 1HYGA 4CMCA 3FPLA 3TWOA 3K8ZA 2AW5A 3OETA 4BO6A 3NDRA 1EQUA 1JTVA 1SEVA 3O9ZA 1ISJA 5CEFA 1XQ6A 1H2BA 2C59A 2EW8A 4K6FA 1HE5A 3BMCA 1ENOA 5DCUA 1U7HA 3MEQA 4OKNA 2I65A 3FN4A 4E5NA 3RC1A 4J2HA 1VM6A 2Y66A 2YHIA 4FIZA 4MIOA 4DXHA 3KEQA 3RFXA 3WGTA 4PRKA 4TMFA 5JDIC 2O2YA 4GVLA 1HWYA 2B4TO 4PLGA 3ZNNA 1EBUA 4RPKA 3UKOA 1DSSG 5CDYA 1Y5MA 5JYDA 4GAEA 4IIVA 2P5UA 3H8VA 1T2DA 4BKUA 4GX0A 1PSDA 3GA0A 6ADHA 2Z1NA 5JDCA 2EWMA 3HNPA 1A7KA 3ASVA 4YACA 3MWEB 5I9MA 3B70A 5DBIA 5T5QA 4A2CA 5JBIA 2G5CA 5ENDA 5DCWA 3Q2IA 3L0DA 4KWHA 1ML3A 4IZIA 1LI4A 5I8WA 1O0SA 4YVFA 4OOFA 3VOSA 2X0NA 2P9GA 4WJZA 4BIIA 1E3JA 2DTXA 3JTMA 1LBEA 2QQ5A 1JKFA 1QMGA 4FR5A 2VNSA 3GZNB 3S8MA 1A9YA 3P2YA 4ESOA 4D0SA 5TQVA 1GZ3A 3GPDG 4DPKA 1XELA 3H9QA 4WOKA 2PTGA 1DB3A 3U9LA 1LEHA 3KHUA 3GEMA 3AUSA 2BI7A 4WECA 1WMAA 3SC6A 3EAGA 4M89A 2CD9A 3VKVA 2PD3A 2IDZA 1T2CA 4BS9A 3PHJA 1DRUA 4R5MA 1D8AA 3UOGA 4BVAA 1ZBQA 2WSBA 2CZCA 3M6IA 3SVTA 1NASA 1DRVA 5T8KC 3OJLA 3GLQA 4FS3A 1ISGA 3SEFA 4NDNE 5CDSA 3ADOA 1PJBA 1T4DA 4RLHA 5EESA 3P2OA 1CETA 1P45A 5F21A 2NADA 1N7GA 1E7SA 5JCJA 4CM9D 3K2BA 1DXYA 4W9NA 1ZK1A 4CLRB 4BNVA 2ZB7A 2YQ4A 4CQLA 3D0OA 3S55A 4CLOA 1PJSA 2IXBA 4BO5A 4CQMB 1I01A 2X5JO 2YZ7A 3FF4A 3CIFA 2PFGA 3ETGA 4L75A 4LISA 2D3TA 3AM3A 2AE2A 1CYDA 3DAPA 3PQEA 2VUUA 4DLAA 2OGUA 2X0RA 1O94A 4CLHA 4PG7A 1YXMA 2R6JA 3H2SA 1KS9A 4BNKA 4EBFA 1J6UA 5I7FA 4CM6A 1QG6A 3ANMA 1WMBA 1W0CA 1Y81A 1R4NA 3AOGA 4FDAA 1ENPA 3H6KA 4DQUA 2IRWA 4WLOA 3PQDA 5ITVA 4BNFA 4LVUA 1FDVA 4NQZA 1RWBA 5ILOA 1GZ6A 5G0SA 3BAZA 1LDMA 4MVJI 4CPDA 4PLCA 4F6CA 2O4UX 4WKGA 2C29D 4QUKA 5HS6A 3ZHYA 5IDWA 4M54A 2X58A 1P74A 4U7WA 2ZQYA 2CDCA 3F4LA 4RV9A 1QYCA 3CTMA 1ID1A 2LDBA 4XGKA 3S2FA 3T4XA 3I23A 3P19A 2DLDA 2Q46A 2W90A 3ULKA 4A10A 3RBXA 4B4OA 2W98A 3L6OO 4QECA 1L7DA 3SLGA 5CEEA 1ZXBA 3PI7A 4PG4A 3WQSB 2W4QA 2E37A 1NXQA 4GKBA 1LDNA 2WYWA 2GERA 3RI3A 3ZHBA 1O9BA 3MOIA 4ALJA 1HEUA 4TVBA 4CL8A 2Y0EA 1DIAA 3OEYA 1PZGA 2VYND 3B1JA 3GHYA 3DZFA 2HCTA 5JDCC 3QIVA 1RJWA 2YV1A 4II2A 3IDSA 1P44A 3CINA 3PHIA 3TFQA 4DYVA 4ONEA 1E1KA 1A27A 3VPXA 4IQ8A 3KUXA 1YQXA 2J5KA 1E7QA 3RC2A 4BOYA 2VZ8A 1LDBA 4WLVA 3LLSA 3QV1A 4YYZA 1LTHR 1KVQA 1B2LA 3KZVA 2TMDA 5B4UA 1AN9A 1PIWA 1H93A 3GGOA 3H5NA 3EUWA 2AQIA 4E5PA 4E12A 1ADBA 4GWKA 4BO2A 1X15A 4XDYA 3WICA 4Z3KA 4E2WA 2P91A 4ZQFA 4IS2A 2YYYA 3QWIA 1ISIA 1ULSA 1N9GA 3HDJA 3ZV6A 2YDXA 4MJLA 3AFMA 1XDWA 1ONPA 1XEAA 3PZRA 1N5DA 2O7SA 1EVYA 1R12A 3JYOA 3D4NA 4EITA 5IN5A 3I5MA 3WQRA 1PJCA 5TGDA 3ZWNA 3N74A 4R1UA 1DFIA 5F1KA 1PJQA 3WSWA 3JD3A 4P8RA 2GDZA 2VOEA 2FMUA 4Y6SA 3S2EA 2Q1UA 3NDJA 4MVJD 4FJ1A 4QFCA 4A73A 1EQ2A 1SB8A 2YV2A 2WE8A 4DPLA 1GYQA 1JU9A 2V6BA 2RH4A 3RU9A 4BNLA 2Y0CA 8ADHA 4RVDA 5I9NA 4KP7A 5FF9A 3M1AA 2DBQA 3EZYA 1LQUA 3VC7A 1UXGA 2JKVA 4DYDA 1P0FA 1WP4A 5KJ6A 3A06A 1E3LA 1RM4A 4LK3A 4B79A 4RVHA 3ZWYA 1K2WA 4YAJA 2UYYA 1BXZA 4IM7A 3OIDA 1U8FO 3UFXA 2Z1MA 1K6JA 3D5QA 4AJLA 5MGBA 3WOHA 4GGOA 4Q9NA 3EZLA 1U2DA 4L74A 3NTQA 1HZJA 3E9QA 3JCZA 3KM0A 3ANNA 4KTVE 4R9SA 1EE9A 1RYEA 1Y6JA 1UXJA 3L4BA 4CM4B 1WZIA 3TDKA 3PIIA 2Y1CA 2EEZA 4X54A 3KEOA 4GQAA 3Q11A 2VHXA 4E4YA 2UUPA 4UAGA 2I5PO 4EUFA 1MX3A 3GN1A 4ITUA 1VL8A 2ZIZA 2ZQZA 4UUOA 3TL2A 1VRWA 3WXBA 3AK4A 3MJ4A 3DWFA 5A3JA 2B4RO 4M55A 1M6WA 2VN8A 3GVPA 4MIEA 3PQFA 4J6FA 2FPPA 3H9EO 3H3JA 3JV7A 4FFPA 3TOXA 1GDHA 1BHSA 3ZWBA 3JQAA 1HDYA 2OHXA 3W8DA 5B1YA 2B5WA 4HFRA 2I99A 1UH5A 1E3SA 4XCVA 4K28A 5IDYA 3CH6A 1N1GA 2VT2A 3LC2O 5JC8A 1JAXA 2HMSA 1DIRA 3W6ZA 2JFFA 1F8GA 2FP4A 2FY8A 3GDFA 5G0VA 4XA8A 3VVCA 4F6LA 5L3ZA 1FDUA 3HG7A 4E33A 3PTZA 3OFSA 5BNFA 2IEBA 2DPGA 1MV8A 2PD4A 2Y1FA 3GHHA 4MIYA 3U4DA 3W4JA 2GN9A 1UZNA 1T25A 1NBOA 5KVCA 4CMKA 1QV6A 4PN3A 1GFSA 4HXYA 3MJCA 2UV8A 1V35A 3DBVO 5CDGA 1NQOA 2O23A 1Y7TA 3RASA 1PJTA 3ROQA 5TJHA 1R16A 2I3GA 4NFHA 1ZCJA 3VAZA 4YJGB 3F9IA 3WWZA 1NVMB 1KVTA 1D1TA 2Q1SA 2Y67A 2BHLA 2NQ8A 4R41A 3R3SA 1HE2A 1GYPA 1P9LA 1ZIDA 4CLRA 1KC1A 1FK8A 3DZKA 2ZTVA 4FJ2A 4NPCA 4ZVVA 4BV9A 4JJFA 4CQMA 4HV4A 2EGHA 5GZ6A 5L4LA 2DM6A 3TSCA 1DAOA 2ZYAA 3WNVA 4YAGA 4I5DA 1TLTA 2IODA 5A1TA 1E7RA 3GUYA 2Q2QA 2VHYA 3CMMA 1V8BA 3CZRA 3U3XA 3ASUA 1KYQA 3I9MA 1F14A 1GPJA 2EG9A 3JYPA 4NU6A 5C7LO 5JAMA 3F5QA 3QWFA 4YWJA 3B6ZA 2PA3A 3ONEA 4XGIA 4PVCA 3QW2A 1B15A 1LRLA 4E2YA 1FMCA 1TVEA 1I3KA 3UH1A 4R54A 2EERA 2NU7A 5AXCA 4UUNA 1NNUA 2RHRA 2EV9A 4MVJH 2GASA 3ZHZA 4A0SA 2C07A 3L6EA 2AG5A 3WTCA 3ZWPA 3UUWA 5DP2A 1GD1O 2LDXA 4DIOA 3LT2A 4DL9A 3DDNA 1A71A 1KVRA 3E5MA 1J4AA 3DQPA 3SJUA 2VHZA 4BO8A 1A72A 3BTUA 4E2XA 4NMHA 4DGSA 1QLHA 4K26A 3K6JA 1X0VA 1E5QA 2EP5A 1C0KA 3IKTA 3LT1A 4FW8A 3AFNA 4UVHA 4JNKA 3RCBA 1IUKA 3RC7A 3VTFA 2FOIA 5U4QA 3WR5A 5BNIA 2P4QA 4LMPA 3A14A 5GZ3A 5KJ1A 2B5VA 2D2IA 2FRDA 2ZYGA 3UF0A 3AU8A 4FCCA 2ILTA 2RBEA 3ROKA 2H6EA 4QQRA 5HRUA 1HDXA 5TIIA 3FNHA 2NU6A 5KTKA 5BNTA 3H9GA 1LXCA 4OAQA 3KYCB 3FI9A 1I30A 3FRJA 2POQX 4ZU3A 5I9LA 1OC2A 2WD8A 4OSOA 2GNAA 3I4FA 3OBBA 3UN1A 5TC4A 1EE2A 3OECA 2NWQA 1VPDA 4Y9DA 1WZEA 3V1UA 3H9JA 4NBUA 2OOSA 3KO8A 4CODB 3I83A 3ROPA 4KUHA 1E3WB 2JFHA 1JVSA 4QT0A 3WS7A 4E13A 4OM8A 1JAYA 4N7RA 3QVXA 4XR4A 3ENNA 3EK2A 4AJIA 3LC7O 1ZH8A 4J4HA 4JX8A 3IC5A 2IZ1A 1QLJA 1ZXLA 2VZ0A 3HSKA 3U5TA 2AHRA 1U5CA 2O50A 1YONA 2HK8A 2HSDA 3BA1A 4UVIA 5HS4A 4N5LA 2VTEA 2Y1GA 4B4UA 1UDCA 3IS3A 3BXXA 3IKVA 3DOCA 3O03A 2R2GA 5KWEA 4J16A 4YT8A 4OJNA 4OXKA 4YAKA 4K1LA 2VYVA 2D8AA 3QRWA 4G81A 1GQ2A 3BMNB 3RSHA 1D1SA 2HJRA 2EXXA 4J9UE 2GN8A 1Q1NA 2OFPA 2BGKA 4P4LA 4GMFA 1I5RA 5G0WA 3TZCA 1DJQA 3PDUA 2PWZA 1Q0LA 3WGIA 5U1PA 3SX2A 3DZIA 2FZWA 4NZ9A 1GYRA 5JDIA 3WX0A 1DOHA 2I6TA 3RUFA 4IDCA 1AGNA 5AXBA 3JD0A 4PLPA 4NHEA 3GC6A 2VNAA 4R3WA 2I3AA 3ZGYA 5H82A 2AQHA 1LLQA 2QX7A 2AEMA 3E48A 3DTTA 4GGPA 1NHGA 1OC4A 3PJDA 1E3EA 3LDHA 3HJAA 3WWYA 2GPTA 5CG2A 1QORA 3AUTA 1YDWA 3D1LA 3H2ZA 5JCJD 4BO7A 1GZ4A 4C4OA 7ADHA 5CFZA 4CM4A 1KY4A 1EEHA 2ZJ0A 5HBRA 1T26A 3UAGA 4HBGA 2Q3EA 3E8XA 2VOJA 4OO3A 4PLTA 1I2BA 1K6XA 1P1IA 2NVWA 1ZVMA 2DBRA 4RVUA 1YH3A 5EIOA 2FN7A 1SOVA 4CUZA 1DO8A 3LC1O 4RF4A 3RFVA 5JPIA 4OH1A 1P1RA 3EHEA 3DAFA 3JQCA 3C7CB 4PVDA 5KJCA 1YE3A 4XDZA 2BH9A 1KBZA 2Y1EA 4RO0A 2GUGA 3DMYA 5A03A 4HX5A 5A05A 3CEAA 1HYHA 5A9TA 4CV3A 3OHSX 4OSPA 4PLWA 1E0DA 1JLLA 2A94A 1B0AA 4CMJA 4B4WA 5GZ1A 1V3UA 3UHAA 4D45A 1J5PA 2PKQP 5EERA 4BB5A 4INAA 1KETA 3GMSA 2D5CA 3GF4A 2QZ9A 3KOUA 4WGGA 1LJ8A 3VPHA 1SC6A 3ZU2A 2PZLA 4W7IA 1VKNA 5IG2A 1KEWA 2WD7B 1KEVA 4BMSA 3WIDA 1A4IA 4Y8VA 4BMVA 5IZCC 1E7MA 3FNGA 1HSOA 1KEPA 1WDLA 3L6DA 1TA4A 1ISMA 5HTOA 3LLVA 1PEDA 4RGBA 3ZN2A 1DDOA 3GK3A 4YJGA 2D5AA 1CJCA 3G3EA 2BFPA 1YBMA 1K5HA 3KXDA 3N58A 4Q3EA 2JFGA 1HL3A 4GH5A 1UDAA 1B3RA 2H63A 3AWDA 2I67A 1ENYA 5KKCA 1QR6A 1GUFA 4EJMA 2YQ5A 3C7DB 3BHJA 4FN4A 5ICSA 4FPXA 3FPCA 1I24A 4PG6A 3LYLA 2PGJA 4KUGA 4KZPA 1KC3A 2HAEA 4YRAA 3EYWA 4RJTA 4TZTA 2OMEA 4R5HA 3GFBA 4CMIB 1C1XB 3E82A 3Q1LA 3ENKA 2Q2VA 2JL1A 1AXEA 4BKRA 1Z6ZA 4DVJA 1FF9A 1HF3A 2VWPA 1X1EA 1TB4A 5F5NA 3M2PA 1BXGB 5DNAA 2H5LA 2V6MA 1DIGA 4AJKA 3QWBA 3JQ7B 3ROMA 2PY6A 2E6UX 1XU9A 2J5QA 3A9WA 3R6DA 3D4OA 5C7OO 4R3NA 3D3WB 4BQRA 5BSGA 3ZWXA 1C14A 3NKLA 1C3VA 2ZCUA 1O89A 1TT5B 4WNIA 2EW2A 1Z45A 5KKAA 4II3A 3INTA 4HFMA 1DC5A 3PWKA 2V65A 4RDHA 1YOVB 4GX2A 1QSGA 3WMWA 3C8MA 1C1DB 5C5IA 3MJSA 3GGGA 4LCEA 2WM3A 3ONFA 3DBLB 5G0UA 1YDEA 1F12A 4PCVA 5DZSA 1DFHA 4J9VA 1LUAA 1H6AA 4G65A 1M66A 3FWNA 1UZMA 1E1NA 3SJ7A 5CDTA 4I5GA 2B69A 3JQAB 1W6UA 2BI8A 4PLVA 1I0ZA 1T4BA 2P2SA 5IN4A 3LT4A 1UXHA 2GRAA 2NUAA 2HO5A 5JNLA 3KYCA 1BGVA 5DOVA 2FR1A 4NU5A 4AJNA 2OL4A 3E9NA 1Z82A 5IXSA 2BRUA 5I8ZA 1IPFA 3DFUA 1VL6A 3RFTA 1IPEA 3R0IA 4AL4A 1O5IA 4A03A 3QVWA 2B0JA 2NLOA 1H6CA 4HADA 3OIFA 2IXAA 3RQSA 3GY0A 2HMVA 2NQTA 1E3WA 4NK5A 1OI7A 2HJSA 1WW8A 1JW9B 1U9JA 5MDHA 4FD3A 3PIDA 2GN4A 1LLUA 1RM3A 2Y93A 3G17A 1LQTA 4GBJA 1LDEA 4PLHA 1QV7A 3WFIA 4XB1A 3DZBA 5ADHA 2EJWA 5FYDA 5T64A 1Z7BA 4XYBA 4R01A 4IGFA 4JCOA 4AG3A 1DAPA 4NH4A 2QYSA 1HE3A 2J3KA 3BMQB 1S7CA 3Q9NA 5L95A 2J5RA 3AJRA 1UXKA 1NAHA 4ZJUA 4L73A 1Q0HA 1NPTO 3K30A 2RAFA 1Y1PA 3BMNA 2IEDA 3AUUA 3ZU4A 2HDHA 4YR9A 1U1IA 1Z7EA 4JXKA 3V5NA 1OMOA 4PLFA 3DR3A 1B26A 2OBNA 1MG5A 1ULUA 2NVUB 4JBGA 4TSKA 4UEKA 2NM0A 2QG4A 4FC6A 1BTOA 3OH8A 3ORFA 5FI3A 5AXDA 2ZTLA 3OP4A 4WE3A 5DDIP 3MTJA 5EN4A 3ZDFA 4XYGA 1TXGA 5A06A 1U3TA 1U2GA 3KVOA 3PGXA 1XSEA 3IIEA 3PXXA 5ICMA 2VWHA 1ENZA 4E32A 3DFZA 4BNNA 1YL5A 1EFLA 3K9QO 1W4ZA 5JFOA 4TKLA 4BL5A 1IOLA 1T2FA 1I33A 2X8LA 3WGHA 4O63O 1VE9A 3ANLA 5KJFA 1GL3A 4D3DA 4YT2A 5H81A 2Y68A 2BLLA 1PJLA 2GZ3A 3LSYA 1XLTA 1MC5A 3F5SA 3PHLA 1QRRA 2DFDA 4CQMD 1NVGA 3R1IA 4FJ0A 5JS6A 3PVZA 3KYDB 1R4MB 4ZQHA 1PQUA 3TNLA 4C7KA 4YJDA 1UZLA 3K2EA 1AHHA 1H9BA 1YB5A 1VI2A 4E30A 4YT5A 5TT0A 3DZGA 3OQ1A 3V2HA 5L7WA 1KERA 2C7GA 2X9VA 3PWSA 3TFOA 1F0YA 4GL4A 4P4NA 3BYZA 1DEHA 2RIRA 3F1LA 3O4RA 2PZKA 3RC9A 1ISHA 3PZBA 1O6ZA 1K3TA 1BRMA 1DHTA 1M75A 2VCYA 5A9SB 2DPHA 2V6GA 2VRCA 3A4VA 5JSFA 1JKIA 3DTYA 4MVJF 3DOOA 3GR6A 3I4CA 4O6VA 4P22A 1NFQA 1IB6A 5F5LA 2AMFA 4B4VA 5FI5A 3OQ6A 4J90A 1DIHA 4PZEA 3ZWMA 5LDHA 1ZSYA 4I5EA 5IDQA 2ZB8A 4O1MA 1U3UA 4TQGA 2WD7A 1ONOA 4IIUA 1W73A 3GQVA 4JLWA 4ND5A 4GLLA 2X0JA 4NIMA 4E6PA 4BMNA 2CVOA 4BKQA 1C0IA 1CWUA 5TSDA 3MJTA 1LDYA 3AM4A 3OQBA 5G0TA 3GVHA 2WDZA 3EMKA 5IZ4A 2NV6A 4J0FA 3ZV3A 1P33A 5L4NA 1WVGA 4M87A 4Y98A 1DBVO 3I9NA 1J49A 1NR7A 3NYWA 3INRA 3UCXA 2RCYA 4M86A 1HT0A 4B7CA 1LRJA 1DIBA 1F17A 3ZNPA 1SZJG 2B36A 3D4PA 4XEHA 3KV3O 4HUJA 4TRJA 4Z0TA 2EJVA 3AU9A 3NT4A 5TT1A 4CMIA 1C1XA 2JAPA 2PNFA 3ICPA 1FJHA 4Q39A 3WGOA 1KVUA 3SC4A 4WLUA 4D79A 3C1AA 5EMHA 1DC3A 1S6YA 3QE3A 4U0JA 5KCZA 5EL0A 1EDOA 3H4VA 1BXGA 1FXSA 1M67A 4IXWA 1PQWA 1R37A 5IJZA 1Y5RA 3JQ7A 2VWQA 1OOEA 4E3ZA 3GAFA 4WASA 2NNLD 3D3WA 5A9RA 1MA0A 3V1YA 4ND1A 2X9GA 3GEGA 2VTDA 4YEDA 1TT7A 1ZFNA 2AA3A 4LRSB 4QO8A 1X7DA 1R0KA 1PGQA 1U4SA 1TT5A 1X7HA 2ZCVA 2F1KA 1YQGA 4BNUA 2C5EA 3WGYA 1EUDA 1QKIA 1YB1A 1YOVA 3DL2A 1LRKA 3GH3A 5JW6A 2QRKA 1C1DA 3V1TC 2X23A 1SPXA 1M76A 3VPFA 1UXIA 2DAPA 1LLDA 4M1QA 3MTGA 3FD8A 3DBLA 4JN6B 5JAQA 3T7EA 8LDHA 2VYVD 3V8BA 4E21A 1PGJA 1GQYA 1ZMTA 2RHCA 3PYMA 5JCXA 1KIFA 3ZWAA 4GKVA 3OA0A 5C37A 2J3JA 2YW9A 5DOZA 3W8FA 1DPGA 5JO9A 1IHYA 5C7IO 2GZ2A 2DUWA 2C54A 5JE8A 5CP8A 1IHXA 3DHYA 3AM5A 4CUJA 4XYEA 3U49A 1ZUD1 4ZICA 4BKOA 1UP7A 4Q3NA 1NP3A 5JO0A 2FR8A 2PLAA 5DBGA 2DFVA 3DO5A 2AQ8A 2GF2A 4S3MA 4KMSA 4GLOA 4RORA 4WOJA 4C7JA 4UVEA 1HTBA 3TN7A 3I9OA 3H3FA 4BKPA 3LF2A 3H65A 3HDYA 4P4GA 3HZZA 3VVBA 3IJRA 4EI2A 4Z0PA 3WDSA 1PGNA 3EGOA 1D4FA 1NWHA 1HDGO 1H9AA 5CHEA 4A27A 5I7SA 4WLFA 2BMAA 1NPDA 1ZJZA 1Z74A 2FPGA 4YQYA 4XQ9A 5BT9A 3UCFA 2O3QA 3F1KA 2FSVA 3ZV4A 3D7LA 1GR0A 2A9FA 2F00A 2NTNA 2VUTA 4NBWA 5I7VA 3KYBA 3BMQA 3V2GA 1PTJA 1PX0A 4BO0A 4MDHA 4HP8A 1ADGA 1DC4A 1SCUA 3DZJA 4A7PA 3HDQA 4FSHA 3ZNQA 4GWGA 4UUMA 4XQEA 3EY4A 3OF2A 2Q49A 4MVJP 4RZHA 4HNHA 3DB2A 1DLJA 1E5LA 1PQPA 1ZW1A 2RH8A 4I5FA 4QX6A 1ZKMA 3KSZO 4YT4A 4TROA 1NAIA 1ONNA 1M2WA 2NVUA 1XR3A 2VRBA 3HB5X 2BF7A 4RQTA 3FTPA 5L7YA 4CMBA 3QQPA 4EZBA 2W2KB 3W8EA 1T24A 2WE7A 3F3SA 5L51A 1FDWA 3CKYA 4DBVO 3JQFA 1ZSNA 2EKPA 4WLEA 1TEHA 5TF4A 4KTTE 3WNQA 4XQCA 4BNIA 1P31A 3JQEA 2CF6A 4AJ2A 4GI2A 2HQ1A 3QSGA 3HFGA 5TS3A 5F3RA 4IQ0A 4U6QA 4G2NA 4AJ4A 2IZZA 3IP1A 4FOOA 2QW8A 3WLEA 9LDTA 4W82A 4YB8A 5CEJA 3K31A 3UVEA 4XJSA 2AQKA 4NI5A 4E5YA 3PLNA 1MB4A 2P4HX 4QTZA 3UCEA 3ST7A 4CLXA 1ZO8A 3OJFA 2X6TA 1YKFA 4RDIA 1GAEO 4RCVA 1RYDA 2X22A 4QEDA 2B37A 4GX1A 4KDEA 4E0BA 3ZU5A 2D4AA 1LX6A 4NNJA 1WXDA 5DP1A 1MXFA 3CZMA 1OFGA 3KYDA 5TX7A 1R4MA 1XCBA 3FWZA 2GCGA 2TMGA 1DFGA 3M2TA 4R4JA 3UICA 4CM5A 4RZIA 4NJMB 3GVCA 1R15A 1CF2O 4DQXA 3SBOA 3UW3A 1IE3A 1E7WA 2NU8A 4MP6A 3JQGB 3ZHXA 3PJGA 1ZK4A 5A4DA 3QVOA 1EK6A 5C3MA 3D3EA 3Q0EA 4Y6PA 5JY6A 4R68A 3JSAA 2J8ZA 5IZCA 3IAHA 5KVSA 4ZHSA 5A9SA 1E1MA 2QRLA 2XXBA 4JJGA 1VJTA 2C20A 1GUYA 2X86A 3C1OA 1GV1A 1YB4A 4GSLA 4BNMA 2OO5A 2UAGA 3ZZNA 1YO6A 5CAEA 2OP1A 2Y0DA 5LCXA 3OMLA 2BD0A 4D44A 3OIGA 2W8ZA 4MOWA 1JDJA 1Y9EA 3LQFA 4EGFA 1VC2A 2VHVA 3PWZA 4W99A 4YCAA 2ZTMA 3QLJA 4NBTA 3BTOA 2CNBA 4H16A 5IDXA 4L4RA 2OXIA 3FNEA 1ZK0A 4CM3A 5KIAA 1YRLA 3L77A 3DBHB 3T7CA 1E6UA 1VJ0A 4R1TA 3H5RA 2PKQO 2EP7A 3ZWCA 3C7AA 4IDBA 5A04A 4W4TA 5HM8A 3K5PA 3GGPA 3NUGA 2BFOA 1U4OA 3CPSA 1H94A 2XF8A 2W2LA 3AY7A 1XYGA 2IZ0A 3ZNOA 1M6HA 4RLSA 4M49A 3VZRA 1GEEA 3HADA 1MG0A 3TZQA 1H5QA 1Z73A 3G1TA 1X7GA 1N8KA 4RPLA 4H3VA 3OM9A 2ZB4A 5AVOA 4PG8A 4LSWA 1N1EA 4BO3A 1GTMA 3TRIA 4U8GA 5EJ2A 2C2YA 4IXTA 2YUTA 2AG8A 3DHNA 3FNFA 4PZCA 1GPDG 3D64A 2XOXA 2YV3A 2DU8A 4J43A 5K1SA 2GN6A 2Q99A 2VWGA 3RKUA 3GVXA 3RKRA 1Q0QA 3NJ4A 1EVIA 3JQFC 2CF5A 2A4KA 1OZAA 1BG6A 3P7MA 3GPIA 3L07A 1CQJA 1EDZA 3QJ5A 4IDAA 4A26A 5EINA 3ZH2A 1C0LA 4YRBA 1R0LA 4XR9A 1SEPA 1RPNA 1EVZA 2ZB3A 3TZKA 1XHLA 4MVJG 5DF1A 5KJEA 5I7EA 4EUHA 2XAAA 1CIVA 3GEDA 5JMPA 1W8DA 4XRGA 4B7XA 2BFMA 3GOHA 1PGPA 1PJ4A 4ZRNA 4D3FA 1E7YA 2G82A 3RVDA 3LK7A 2NSDA 4YDRA 1XQ1A 4K9DA 1P3DA 2DQ4A 2CSUA 4YRDA 4CM7A 4RL6A 1JKJA 1V9LA 3IQDB 4NFSA 1PJ2A 3PJFA 4ALNA 3EC7A 5CDUA 2I76A 3IMFA 2YJZA 4JBIA 4RPGA 4ZRMA 2J3HA 3R3JA 9LDBA 4EJ6A 1AE1A 2E4AA 2ZTUA 4D0RA 2PKRA 4BGEA 4D43A 4OOEA 4F3YA 4NR0A 2WTBA 5G4LA 2O3JA 3CE6A 3L9XA 3QA9A 1LSOA 4XYMA 2X7HA 2BGLA 2Y05A 4UEJA 2HU2A 1HLDA 3NGLA 2QIOA 1EUZA 1V6AA 5F1OA 4PFJA 3WG9A 5A5FA 3RUAA 4L8VA 3BTVA 3IL2A 4AJEA 1J0XO 1MFZA 3HUDA 4P38A 3SXPA 1QP8A 4Q3BA 4CMAA 4MINA 1D7OA 4IZHA 5TJ9A 2QHXA 2FHSA 4F45A 2JD2A 1PWZA 1UP6A 1Y8QB 3DBRB 3JYNA 1CEQA 3NAQA 3W1VA 4CMHA 4EYEA 3O8QB 2P68A 2ZYDA 3JQ9C 3GN2A 3ONDA 5DN9A 5K9ZA 3RWBA 4DTIA 3K92A 1RKXA 3OA2A 3DMTC 4URFA 2B4QA 1PL6A 3TQHA 4LN1A 1HE4A 2DT5A 1AUPA 4MPDA 1JA9A 2DTEA 3H7AA 3ITKA 5ER6A 1YS4A 1Z75A 4KWIA 4R69A 3OICA 1CDOA 3ZW9A 4WNCA 4YAIA 3HFSA 2VRCD 4BV8A 3H9UA 4I08A 4IDGA 4OIMA 3COSA 1I3MA 1PU2A 2X4GA 3TZ6A 3S2IA 1BW9B 2W2KA 1UDBA 3PFFA 4RQUA 4BNHA 1H6DA 1GADO 4TWRA 5FEUA 4CM1A 4CR7A 3Q9UA 1Y8RB 4IGEA 5CPFA 1NHWA 3IJPA 4JQCA 1EZ4A 5ENVA 1XWFA 3VHRA 4D41A 2WEKA 3I9JA 4NBVA 2G76A 2PH5A 3QP9A 1NTOA 3PFWO 1G1AA 1MP0A 4B8ZA 3OJEA 3GRKA 1GCOA 4GX5A 1ZMOA 4U5QA 1A5ZA 2X1HA 3JQBC 3AI3A 3QY9A 3T4EA 4N54A 4TVOA 4ID9A 4J4BA 1ADCA 3N7UA 3B1KA 1V0JA 5JC1A 2C2XA 3VKUA 1PJ3A 4BNTA 4N5MA 4YTEA 2WWRA 3DONA 1F8FA 3RBZA 1T1SA 3TL3A 1G6KA 4IDEA 1LU9A 3TPCA 5L9AA 2X9NA 4FFOA 1LA2A 3D5TA 1H2HA 4WEQA 3NEPX 5LC1A 3NDIA 5DT9A 3VZPA 4NJMA 4E31A 4IMRA 5B37A 2V7PA 1LNQA 3F4BA 2O3TA 3JQGA 5JY1A 3L9WA 4QO7A 5TNXA 1HSZA 1V3TA 2D59A 3NTOA 4UVDA 3LT0A 4GVXA 1SNYA 5A02A 1JVBA 4WCFC 3ZU3A 4B3IA 4CMEC 1U28A 1UUFA 1KEUA 1ISFA 4PGFA 4ALLA 5JAZA 4BHTA 1LSUA 1JWBB 3FTNA 2DBVO 5JXWA 3PHGA 4EUEA 4Z9FA 3JD1A 2GLXA 1RM5A 3KSUA 3DHEA 3JQ8B 3NT5A 3RJ5A 3KB6A 4RVSA 2JD1A 4AJ1A 4JP3A 5COAA 5EQFA 2Q4EA 3F6YA 2YHUA 2O7QA 4JIGA 3GNTA 2O3SA 3HN7A 1B3BA 3Q6IA 1UAGA 4M8SA 3RUHA 2Q1TA 3ICCA 2Q50A 2FR0A 3DBHA 4J7UA 4R51A 1LSSA 1E1LA 3W4IA 1NPYA 3HDHA 1CQIA 1X1TA 4RF3A 2I66A 4YXFA 3TZHA 1EMDA 3JQAD 5K0ZA 3P5SA 5J23A 2CMDA 4ZQGA 5T57A 3KETA 1L1FA 3I3OA 3PEFA 4J3FA 3NTRA 4GPD1 2HRBA 3TJRA 1U3WA 3CUKA 3GVIA 4Z9YA 1WNTA 4FGWA 1NQ5A 1R6DA 2OUIA 3TOZA 1MLDA 4WCDA 2CDBA 3X2FA 4LW8A 1CRWG 4PIVA 3VPSA 2C82A 3Q3CA 4MO2A 4WLNA 4DMLA 5B4VA 3KLPX 4OXYA 1T2EA 2GZ1A 3DEYX 4UUPA 4WK6A 4DIBA 7MDHA 3QWAA 5ITWA 4BQPA 2D0IA 3BMOB 3BTSA 4FQ8A 5BSHA 1NQTA 3GNQA 4E5MA 5AYVA 4BNZA 4H7PA 2HKIA 3VH4A 1L7EA 1VL0A 3KLMX 3O38A 2HMUA 4OQYA 3ZCXA 1YVEI 3C24A 1BWSA 2Z95A 3DAGA 4MVJE 1MC4A 4H15A 2EKQA 1U3VA 3ITDA 3VZSA 5L53A 2UDPA 2JHGA 1K89A 4J7CA 3B1FA 4U6SA 2J6IA 2ZK7A 2G1UA 4HFNA 3Q2KA 4CR6A 5JAIA 3HWRA 4IINA 1IYZA 1EFKA 1R0SA 2FZEA 2XPCA 5KVQA 3G0OA 1PZHA 3H5AA 4NBRA 1PS9A 3S1LA 4IJUA 1T1RA 1HXHA 4OHUA 4LVCA 4BNGA 3DC2A 2R00A 3G49A 3OJ0A 3QWHA 1HKUA 2QYTA 4D46A 1LC0A 4UREA 3AI1A 3VH3A 3GG2A 4YQZA 3KBOA 1Y9AA 4L0QA 4N18A 5HWSA 4XGNA 1PWXA 1IY8A 4IJWA 4NG5A 1A9ZA 2ZATA 4EJ0A 1U8XX 4CV1A 1YL6A 3E18A 4DPMA 1XIVA 4MP8A 3IUSA 5F1PA 4KQWA 4D7AA 1HZZA 1MXHA 4XZ3A 4BO9A 1JWAB 1YJQA 3ZW8A 4OL9A 1XA0A 1X14A 4Q3DA 4AVYA 2DC1A 4ILKA 3RBVA 2ZKLA 3K73O 3AOEA 4YPOA 1BVUA 2JJYA 4DA9A 2DUUA 3KTDA 3GDGA 1BDMA 2Q1WA 4NFYA 4L4SA 4QSMA 1PZFA 4IUYA 5KNLA 4B3JA 2P9CA 4UVGA 4R9RA 4HFJA 4JP2A 1WDMA 3PRJA 1BXKA 1PL7A 2HK9A 5EQDA 1P1FA 3G1UA 5ILGA 2Q45A 3PPIA 3WBBA 1XGKA 2AXQA 1Y8QA 3DBRA 2OP0A 4FC7A 4XKJA 4Z3DA 5A5EA 4CMGA 4QFDA 2Z5LA 3MJVA 3O8QA 3OSUA 4CL3A 2NTVA 1ZZEA 3DZHA 2JAHA 4IY1A 1SB9A 5T67A 4MKRA 4PRLA 1NYTA 4ZA2A 3HHPA 5BSFA 2GYYA 1MGOA 2ET6A 3AY3A 4EEZA 3RUEA 4L76A 3O26A 2NU9A 1I2CA 1BMDA 3WJAA 1VSUA 2UUOA 3KSDO 2H1SA 1NVTA 1VLLA 4HKTA 1VJ1A 2O48X 4CUKA 5BSEA 4OMUA 1B16A 1A4UA 3BHIA 3ABIA 4PLZA 5DCYA 4W9NC 4Q3AA 2OZPA 4OQZA 3WBFA 2PH3A 1B7GO 4XJTA 3PP8A 4IJVA 1ADFA 3FHLA 1BW9A 2IYPA 3E9MA 1Q2XA 4F46A 3E6AA 3DXFA 2AE1A 1OBFO 5ER9A 4TKMA 4Q3CA 4CV0A 3ETDA 4Y6RA 1Y8RA 4DC0A 5GMOA 1HDCA 1I36A 2EIHA 4KQXA 4AJHA 2O4CA 4Z9XA 3ON5A 1SMKA 2WYUA 4HWKA 1K6IA 6LDHA 2VQ3A 3WLFA 2YFHA 3RUIA 3JYLA 3ZWVA 4J7XA 2AEJA 3WYBA 2O3UA 4JBHA 5IXYA 3VDQA 3VTZA 2JCXA 1LC3A 1B8PA 2PZJA 1K0UA 2H9IA 1F06A 4AFNA 1WAMA 4I9UA 2O2SA 4UULA 1DRWA 4DC1A 5ES3A 2V6FA 1I3NA 3LU1A 1VKOA 5KOIA 3FR8A 3LF1A 1PR3A 2W2LD 3WJ7A 2HLPA 4DREA 3UGKA 4I8XA 1P0CA 5EPOA 5IF3A 1KOLA 4WCFB 4CM9A 1ZEJA 2NVBA 4L4XA 4XB2A 1XU7A 5FWNA 1NWCA 5K6AA 1E6EA 2R00C 4IDFA 3E5RA 4LSMA 3CXRA 2VT3A 4Z0HO 5THKA 4U0KA 1Q7CA 2DTDA 4K6CA 2BGMA 4G5HA 1GV0A 4NJOA 4XX0A 3L4SO 1RM0A 4J2OA 3W4KA 2YFQA 3WFJA 4J4TA 4IJKA 1P1KA 2PGLA 4ALKA 2X0IA 3GZ4A 3HE3A 4ND2A 1LLCA 3AI2A 2YDYA 4OKIA 1I2ZA 3IUPA 2PZMA 3MCVA 2D1YA 1HDOA 4ZN6A 3C1TA 4BGUA 4BUCA 4YJHB 2E48A 1I32A 3GZNA 3RJ9A 4LGVA 1IL0A 3JQ8A 4I1IA 4RF2A 4ROSA 2EGGA 1A7AA 3K96A 1KVSA 3GG9A 1WWKA 4CLEA 4TZKA 4MP3A 4XYLA 4DIFA 5JYEA 2HUNA 1JN0A 3AOEC 1UP4A 5G4KB 3V2UA 2GR9A 2Y1DA 3HB4X 5CPBA 2FWMX 3WYCA 2BELA 2ZJ1A 3WSVA 1N7HA 4J91A 1NM5A 5JLAA 1NR1A 4D3SA 3VPGA 5KVVA 5L45A 5G2OA 2GO1A 4FFRA 3WIEA 2GD1O 4B3HA 4CJXA 3EDMA 3E1KA 2WJPA 3G79A 4LRTB 5BR7A 4YBZA 5COBA 3JQ6A 4CM8B 3U09A 1ZK2A 2FSSA 3IP3A 3KRTA 1I10A 1G0NA 1AHIA 2WYVA 4YJFB 2EKLA 5B12A 3RAJA 3U4CA 1UAYA 3F47A 2PGDA 2A92A 2OORA 2HK7A 1KY5A 5B4TA 4LCJA 1WLYA 4XQGA 1QYWA 3FSRA 3JD4A 2CVZA 1G0OA 1AXGA 4J1TA 1IULA 2VYNA 3CMCO 3EW7A 3BMOA 1C0PA 3NT2A 4HNGA 1PS8A 3EVTA 4XWYA 3OJOA 4J1NA 4NK4A 2FPIA 3RUCA 4AJOA 4DWVA 4E5KA 3U4HA 4B7UA 2HMWA 2PD6A 1UJMA 4DQVA 3BMCB 1HLPA 4N5NA 4WUVA 2C7VA 4Y67A 5JMWA 2CDAA 1GCUA 4MKXA 1Q7GA 4J1SA 4JK3A 2YHIB 4EDFA 4ZGWA 4MKZA 1U7TA 4R1NA 1NFRA 1GEGA 1R66A 3B20A 3X2EA 1QXSA 2PK3A 1SOWA 1QYXA 2AEFA 4R16A 1BSVA 1XKQA 3AY6A 1I3LA 1GU7A 4O5OA 5T6BA 4RPHA 1PR9A 4TRNA 4HY3A 4J49A 3I6QA 4EW6A 2NACA 4DLLA 2HMTA 2C5AA 4DRYA 4OYRA 5L4SA 4BGIA 1FDTA 3L4BC 3HN2A 1EBFA 3LVFO 1GQQA 3U62A 3WQQA 3ETEA 3A28A 4ALMA 1EVJA 1E3IA 2G17A 4A5OA 4R1SA 1X13A 4FFNA 5AQ1A 1Q7BA 1ZJYA 4JROA 4TRRA 2EHDA 3JYQA 2BFAA 3MJEA 3RUDA 5K6AC 5TLSA 4MVJA 4WPGA 3CSDA 3IOYA 4D42A 3WYEA 3LZ6A 5AOVA 3UXYA 3GMDA 2QRJA 4XIYA 3NX4A 3QVTA 1HDZA 3U4IA 3WTBA 4I9HA 2GSDA 4FFMA 4OGWA 1BDBA 1P1JA 2CFCA 4XIJA 4BNYA 4MVJM 2CVQA 5A3VA 1DJNA 1ZSVA 3BHMA 3RROA 3JQ9A 3F46A 4RPJA 1H0KA 4KDFA 1E77A 4FB5A 1IZ9A 2CUKA 3VH1A 3DMTA 4FFLA 3VH2A 4BNJA 2DVMA 3FBGA 4EEXA 1SAYA 1PGOA 5HA5A 4BNWA 1JQBA 2HRZA 3ZV5A 5THQA 1EUCA 3NJ8A 4FGSA 2O3RA 3QVSA 1ZK3A 2E49A 3PK0A 2WMDA 4CQLB 3SLKA 2P5YA 2GGSA 3PGJA 4CLOB 1HYEA 2DKNA 2E82A 4ND3A 2X5OA 4W6ZA 1N92A 1WDKA 4RF5A 1I8TA 3VDRA 3AW9A 1SBYA 4FOSA 1HDRA 3HQ4O 2JHFA 3MOGA 1GUZA 3DOJA 3OEWA 1H6BA 1ZNQO 4BO1A 2BKAA 1DHRA 2VHWA 3ZI0A
chains in the Genus database with same CATH superfamily
3DPUA 4NVRA 2O52A 1YBAA 5C52B 3HXMA 3QMMA 2JHCA 2HYIC 1NMYA 1T2NA 1GZDA 3I52A 1TUBB 5CFRA 2JGDA 3W6PA 4QPNA 1VYVA 2W22A 3EVEA 5IFLA 1IZ0A 1RQRA 4ZQEA 1EFRA 5EP4A 3UOAB 4PLYA 2JCVA 3AHDA 2Q5IA 4L4YA 2GCIA 4H6XA 4KQ6A 4U5XA 4A1OA 1UQUA 5H9VA 2IU0A 3TI7A 2YH2A 1XD8A 3GP5A 1XAHA 4J1QA 1OI4A 3H2IA 3MZ0A 4GGMX 1YQDA 2Y99A 4O2AA 1VP3A 1J09A 4CR8A 1NFFA 2ZDGA 4ND4A 2J3MA 4BFYA 1C5KA 1DLIA 5I48A 2E55A 1XALA 2COKA 4B8WA 3QKRB 2P9EA 1F2TB 3M82A 4XUCA 3OMWA 4AJPA 5HRAA 3EGDB 1R74A 4AWXA 2SICE 4IMPA 4KRGA 4M98A 5ALPA 1B8UA 5CXUA 4D57A 3TE6A 2A35A 3AFIA 1RI1A 3WSTA 3CZPA 4JUFA 3IYLW 4EL0A 3ACBA 5AM3A 5CT8A 1DCFA 2UVDA 1KIAA 1Z2DA 2JF0A 4JJIA 4O0LA 5H83A 4HQLA 4DBZA 4EY8A 3ZW7A 1OH6A 2XQFA 1E60A 1SN7A 2IPOA 2WWTA 3COYA 3OP1A 3AV0B 4QL3A 4L57A 3HLKA 4OX9Y 4XE5A 4B4DA 4NOMA 4HEA6 5FWXB 4UU1A 1P2DA 2QD2A 5DLQC 2CNDA 2YJTD 3D2CA 3NRCA 3AH8A 3STVA 1T2AA 2ZB2A 4BN4A 4KDCA 2Z4SA 1ISPA 1TI7A 1G9SA 1N8NA 2AT1A 1VG8A 3GUUA 3Q3GE 4H1TA 2PO7A 1J21A 2GFHA 2KW5A 2VDWB 1BCRB 4LE1A 5EXEA 3SHFA 4IS3A 1G7CA 5HIJA 5JMTA 5CH8A 4OATA 1BO6A 3CUYA 1Z4NA 1YJ8A 5EJFA 3C3XA 3SJCA 1BEEA 3IQEA 1MVLA 4EPVA 3ZVNA 2AN5A 5WRFA 1SO8A 3O9MA 2IZOA 4TRMA 1BVRA 4EYQA 2VPTA 2B8JA 4TMVA 2PRSA 4WEOA 3PLRA 2VPXA 4XVQA 1RCUA 3RSGA 4C0BA 3WGZA 4LDRA 4CCYA 4Z8YA 2H0RA 4JKIA 2FUG6 3I5AA 1XFAA 2BR5A 1WXHA 5LLSA 3BWEA 5ANRB 3SYRA 3O74A 1USUA 3OM8A 3MWDB 4KBGA 4OHRA 4OHCA 4JGBA 5HMMA 4GL2A 2IU4A 1NYLA 1USIA 2DFTA 2JEYA 4PZAA 2JFOA 4TV9F 3SHTA 1L5HB 4RFSB 1F6WA 3GT0A 5GIOE 2A9RA 3I9KA 1S3SA 5LP6C 5KMGB 3OM0A 4AG5A 1QO0D 2Q4BA 4I1RA 3H5VA 2N3ZA 3O75A 1QYVA 1RE1A 4I4LA 4WESB 5COQA 4AY6A 1GKUB 1MFPA 2ARKA 2PLNA 3HFRA 4KV9A 4P33A 3TH5A 2HTEA 3KTAA 2GTPA 3UXEA 2NOAA 1JIUA 2G6BA 3JD2A 1GLGA 2Q8QA 3PYXA 4WOCA 1RQ2A 4LOLA 2XT0A 5BVGB 4UE6A 4J16C 3USCS 4CMCA 3CRQA 4W5NA 3H83A 2NUTB 1N1DA 3UBMA 3O8RA 2BMFA 2NYRA 3NDRA 3TLCA 2VH1A 1SVMA 3EQ6A 4Z4FA 3O9ZA 2QGNA 3UAZA 2GNPA 4LXQA 3LT5A 1HE5A 1Q11A 4H7HA 2OCPA 4IV5A 3FCAA 2HNAA 5EE9A 5I7OA 4R0MA 5ALEA 3V4RA 4PX9A 5DVZA 2QJRA 4MZDA 1G6HA 1QVWA 2I65A 2XYGA 1QPGA 4E5NA 5HYVA 3KE8A 3KAJA 1VYUA 3UFXB 4DXHA 1FFGA 1P2BA 2GK7A 4HDNA 3WKDA 4JZKA 4V0QA 3CH7A 2JG3A 3K2QA 1JSLA 3ZOKA 1K66A 4ZOAA 5KMGA 1OU4A 1USKA 3FIUA 2B4TO 4IEFB 1P5HA 3F9CA 4UDOA 2JFZA 3MXOA 4RTMA 1K4KA 4EFKA 3OZUA 1KNQA 1L0BA 3H8VA 3UZUA 3OIYA 3RHSA 4S1PA 4X1IA 1PSDA 3GA0A 5DMHA 4YACA 5T5QA 1P7PA 3K1AA 2HNBA 4Q7JB 3R8CA 1XRNA 4MNTA 1JV2B 1P3Y1 5I9SA 5ENDA 1I3CA 2W2TA 1GSAA 3WQBA 4RD6A 1F3OA 1K7FB 3Q98A 3P9IA 5I8WA 2QU8A 1GRVA 1UMBA 1K4YA 1SCIA 5BVGA 1FMJA 3UAWA 2P9GA 3DDUA 5ALMA 4BIIA 1CFJA 2IPLA 2VA9A 4KQJA 1LBEA 4I4NA 1H05A 2QQ5A 5DNYB 4FR5A 2C84A 4HZIA 2OM2A 2H52A 1O4WA 2VNSA 3GZNB 3TGWA 4MAMA 3X1KA 4DYHA 1A9YA 3MC1A 3P2YA 4HDCA 4F9FA 2HQSA 2VXBA 4D0SA 5AVVA 2YYAA 3LDUA 3X43A 3L8YA 2V1XA 2W6MA 2NIPA 3HUTA 5HKOA 2FZCA 4B44A 3GEMA 4L4ZA 4Y0VA 4L5JA 4OP3A 1XQXA 1B4DA 1W1UA 3GCXA 3EAGA 1E89A 1U0LA 3QM1A 4M89A 1EBBA 4L28A 2IDZA 5B64A 4I81A 4N65A 3TNJA 1SZDA 2Z8ZA 3NALA 3ZCRA 1U0HC 1WD5A 5CLQA 3O31A 2J0UB 5FT9A 2P9YA 2M6LA 3ROGA 4B6SA 3SVTA 1NASA 1DRVA 3UV7A 1P9WA 1VMIA 3B6IA 2WTNA 2WJ3A 4ZOBA 1JJ7A 3QLUA 3ADOA 4P4SB 1PJBA 4RLHA 5EESA 3IIJA 2VDVE 1VIYA 1TRKA 3Q1KA 4G3XA 1P45A 4BVFA 2NADA 4X20A 3UWKA 1E4VA 5JCJA 1FLAA 4W9NA 3ZY4A 2WW8A 1G21E 5K09A 3AINA 3B2EA 4CQLA 2OILA 1F1BA 2GD0A 4BTEA 3DAOA 2ZRCA 4CLOA 1OPRA 1PJSA 1TYDE 2WZBA 4PS1A 2IYUA 4MS1A 3UMGA 3AVWA 1F2DA 4NE2A 1ZM3A 2R1TB 4O02B 5C53B 5EUQB 2X1VA 4U02A 3SBEA 3ETGA 1YB7A 3I28A 1ZOSA 2NO6A 4LISA 3SYTA 1ONSA 2NXEA 4IW3B 3PQEA 1FSGA 4D9JA 2OGUA 4NYIR 1C30B 3ZKWA 2X0RA 4OQMA 4RM2A 3CO0S 4XX1A 4ZVTA 1O94A 1T3ZA 2ZAGA 3FHCB 5F4BA 1SUIA 1HKHA 4EBFA 1OFIA 4Z99A 4CM6A 1QG6A 1TUBA 1SQ5A 3ANMA 5DNEA 3JTEA 1FTYA 4AKHA 3EA5A 3ITEA 2VJBA 4B0PA 5K8IA 3AOGA 4FDAA 4UXIA 2Q62A 3PQDA 3QBJA 1ZCBA 5AOAA 4PYMA 2Z5VA 1GZ6A 1M1YE 3I9V1 4Q18A 4QOFA 4PC7A 4PYRA 5G0SA 3MS2A 4G6ZA 5JXJA 3G9UA 4PY2A 2O4UX 1C1HA 3IEPA 2XNDD 2WA1A 1Z0JA 2CYBA 4K81B 5EE5B 4RHFA 1Z2EA 4RPIA 4AQDA 3CNNA 2CDCA 4MHSA 2C2WA 5BNWA 1QYCA 3CTMA 1ID1A 3QKRA 3T4XA 2OB2A 1F2TA 5ERGB 3B12A 2DLDA 3EGDA 2AR9A 4GE0A 3BGDA 1O97C 4YYEA 2ATIA 1VHDA 4RHYA 4RK6A 1FNSA 4QTTB 1F5SA 4U9IS 4XLLA 4L3OA 4PG4A 2W4QA 3A9UA 5BQ3A 3VVLA 2CHEA 1E18A 3MOIA 1KYXA 2ZWVA 4R2WA 3UHJA 4Z54A 4NZZA 4CL8A 2Y0EA 3QA3E 1DIAA 4L0MA 1PZGA 3GHYA 4LJ4A 5FDFA 2RGRA 4R8SA 4WOPA 3EPJA 3USZA 3DFFA 1IK6A 3BIXA 2FAXA 4H7KA 3UJCA 4II2A 1NRIA 4NCKA 2J08A 3IDSA 2BHSA 5FWXA 1P44A 3EIUA 2HOQA 3GXBA 3H87A 3OPMA 3VM6A 3U4MA 4L7VA 1NVBA 2OWDA 3TSYA 1K98A 2H9AA 3Q8MA 3R0QA 4RHCA 2ODQA 4LTNA 1YQXA 3OWHA 1P19A 2VDWA 1L8AA 5UKDA 1BCRA 2W42A 1S89A 1RXSA 3D2AA 2C1ZA 3TE7A 1K8XB 4W5RA 4LRYA 3PS9A 3IHTA 3PQ2A 2JFYA 1ZD5A 1D2CA 4XFDA 3KQUA 1W85B 1FQJA 1CUWA 2R5WA 1R0XA 1DKNA 3Q7QA 3QV1A 4K6GA 4NAVA 1LTHR 1KVQA 3I1FA 3O83A 1F8UA 4YMTA 4O8CA 3HVKA 3M6VA 2H2FA 2AQIA 1DQYA 1ADBA 1U5BB 3AG6A 1RZ3A 3MAGA 4XDYA 5LBTA 3N8NA 4G25A 4E2WA 4Z3KA 4IS2A 3QE9Y 2A86A 1SBCA 1Z68A 1U1DA 3QWIA 1XEFA 4F3KA 1L1QA 1ULSA 3BXFA 3FOZA 3HDJA 2F1IA 3NW9A 1ZNXA 3U7QB 2A9QA 1A8IA 2IHUA 4LYAA 4RADA 2RG7A 2WB4A 2QB5A 3MWDA 4P81A 1TC2A 4IV8A 1EVYA 5DWVA 5GADl 3HCNA 3LH5A 3JYOA 1L5HA 4RFSA 1YZKA 2WSMA 3ISVA 2BFFB 3F3MA 4UCXA 2GYUA 1Z25A 221PA 2I55A 3BULA 1EFDN 1WUTA 2YVQA 3LQYA 3MUEA 4R1UA 3WSWA 4AUNA 4WESA 4K7JA 4MRNA 3ILHA 5FBHA 2GDZA 2VOEA 3HCFA 4C0WA 4Y6SA 4CL0A 2Q1UA 2XNHA 4QFCA 5CH5A 1RPZA 1EQ2A 1SB8A 2X2EA 3TVDA 1J20A 1JR2A 1SM4A 2QM8A 2XKAA 2XV1A 3AVQA 1FYEA 4QNMA 1XTSA 5JD5A 3ZOZA 5EIBD 4RD3A 4BNLA 3H3XA 3D6NB 2A9KA 2FGKA 2AZTA 3VJRA 1R18A 3DO8A 2QOEA 3LUDA 2R8BA 4JBYA 4OD0A 2NUTA 2HF9A 2OCBA 5I9NA 1KL7A 5FF9A 3S3TA 1AZLA 4O4LF 5B1EA 2XE4A 2O6LA 3VC7A 5DLPA 3O94A 5CU7A 1P0FA 5KJ6A 1ZA1A 5K3DA 3Q3VA 3DEFA 4UHEA 2IOFA 1L7OA 3TOCA 4RVHA 4DSAA 1NSTA 1K2WA 4B2PA 2FZ4A 3IRUA 2ID9A 3UFXA 2H1VA 4EI9A 2JLUA 2ZU6A 3K0HA 4UHCA 1K8ZB 4P1ZA 4Q05A 2H16A 2PMDA 4UDNA 3RYHB 5SICE 4ZZ3A 3M9XA 5BW4A 3CVYA 3I61A 1DAEA 3KM0A 1NNI1 3ANNA 3K4HA 1Y9JA 1G2OA 5CX1B 1RYEA 3VKWA 1UXJA 3M4NA 4CM4B 4YRPA 3A4TA 2Z6UA 2EEZA 4ER6A 1VGQA 1QTIA 4NATA 5EHNA 5ISMA 1EUYA 4IIFA 3KEOA 1D7AA 4CTNA 4BU1A 3RGGA 5I7RA 2VHXA 3GN1A 1E2EA 4PGAA 1ZL0A 1LB1B 1PUIA 4ITUA 4K9SA 4RMHA 3COPA 4UUOA 4YIKA 4X65B 1VRWA 2G7ZA 2RI0A 3AK4A 4KV7A 3RFUA 3LWDA 4G97A 3C0KA 1GZSA 3MIZA 3H3JA 1XLTC 4RMGA 3JV7A 4WFQA 3TOXA 4JYCA 1BA2A 2IIVA 1L4EA 1SBTA 2YV5A 3H4TA 5JD3A 5K0SA 2PGOA 3AUFA 4RDXA 3JQAA 1HDYA 1P5ZB 3JWJA 5J9FA 4ASUA 5B1YA 5E1DA 3AESB 4H3HB 1OUMA 1W1WA 1U0NA 2EHJA 3GGCA 4K28A 2H85A 1ORDA 2DXIA 4RSHA 2YWHA 1KI9A 3SSAA 1JAXA 3HCPA 1THZA 1DIRA 3W6ZA 1SXJB 3PEUA 3L46A 4CBVA 2FPWA 1EP1B 1J2RA 4F6LA 3BD6A 2RHOA 1XWIA 1FDUA 13PKA 3OZDA 3RM3A 4E33A 1Z8FA 5BNFA 5EP3A 1TGYA 1RXIA 1EINA 1MV8A 2PD4A 3I8SA 4ZTBA 3U4DA 4BPRA 1UAAA 1O0BA 4PBTA 2BKXA 4D4KA 4ZCRA 3IT2A 3I2YX 4CMKA 4TTAA 5EJ5A 3O82A 4MZXA 4I4TF 1TZ2A 2J0UA 2PT7A 2B4YA 1NQOA 3T1TA 4BEVA 1Y7TA 1PJTA 2I3GA 2OV4A 2Q29A 1ZCJA 2H1RA 4NFHA 4S2EA 4YJGB 5B58T 3VDXA 2O8EB 4P4SA 4PHHA 1NVMB 3NXSA 3WWZA 4ZWNA 4BPBA 3AO0B 3DE2X 1L9XA 4FX5A 1IBRA 1PNOA 1VPWA 2NQ8A 3NHRA 2EEPA 4R41A 2VQ6A 1QPZA 3N76A 4HO1X 1HE2A 4FHCA 1GYPA 1ZIDA 4FS8A 2QTWB 5K3OA 2HMYB 2ODWA 2GKSA 3DZKA 3I1YA 5EE1A 4JLOA 1P61B 4CFSA 2ERCA 3F0TA 4FJ2A 4ZVVA 2ADOA 3IVGA 4D82A 4YUWA 3LL7A 4P53A 5L4LA 1DAOA 2R1TA 2ZYAA 4R98A 5AKGA 3WO1A 3VJLA 2A0WA 2IODA 4MRSA 1EQAA 1CDEA 4BAUA 2PQ6A 1GPJA 5AKZA 3FUXA 3ABOB 3HXLA 1BDIA 5KSOA 3QWFA 4QLAA 3UXMA 4YWJA 3X1WA 1C30A 3B6ZA 3ONEA 2PUTA 4XGIA 4PVCA 3UHPA 5JRDS 4P0TA 1LRLA 3HC7A 4AN4A 4Q48A 5D1NA 2YXEA 1E69A 1FMCA 1I3KA 4INPA 5E1OA 4NZYA 3RIMA 4BQNA 2QVYX 6YASA 1NNUA 3HB1A 3VMFA 1F48A 3W5BA 3OO0A 1G5PA 2XX3A 2C07A 4JDUA 3UWSA 1H3EA 3UUWA 5DP2A 2LDXA 4DIOA 3T7RA 1P3JA 4IHJB 4QTYA 2IYXA 2RH9B 3R3ZA 3OPNA 1B41A 1PWHA 2VHZA 4Y9RA 1QYRA 2RHLA 2Z4RA 1U8EA 4E2XA 4AF8A 3RS7A 4K40A 4DGSA 3MD9A 3FMPB 1SCKA 2AOVA 4LBWA 5K6RA 1E6CA 4U9HS 5DYNA 5D01A 4EG7A 3ZCQA 3U37A 5BYBA 2A7QA 1N4AA 1U81A 3QITA 1ZICA 3LT1A 4ATNA 1KO8A 4JNKA 3BC1A 3RCBA 5I4KA 4COKA 1IN4A 1IUKA 1DAHA 1XQVA 2B6HA 4WKOA 4LV6A 2FOIA 4JCCA 4JLMA 4DLTA 4Q82A 1CNFA 1L8XA 1LPBB 2YHBA 3EH1A 2AN9A 1Y89A 4GUDA 4RJKA 1Z47A 1G16A 4IHQA 1M0SA 2BFBB 1ISSA 1R0BA 2A88A 2QP4A 4W1RA 4LY6A 4YASA 3B1WA 3ZE6A 4CT5A 1V11B 2GWHA 2ILTA 2RKBA 4GFDA 4ZVKA 2CK3D 4C2AA 1G5QA 3N6VA 1FRQA 2H6EA 5HRUA 1HDXA 4A4DA 3C14C 2Q4OA 1BKYA 1H2EA 2HN9A 4M38A 3LOQA 1FP2A 3VKHA 1B0PA 2AYXA 5F52A 4P6VF 2R9VA 5BNTA 3HM9A 3H9GA 2NUAB 4OAQA 2CFRA 4R40A 2W4IA 1K7YA 2YVUA 4KSCA 2I7TA 4QUBA 3PJRA 1JHRA 1L7AA 2CNOA 3FRHA 2H4XA 1WO8A 3G2LA 1V7ZA 3ECAA 4F06A 3OBBA 3PXGA 5K8VA 2REOA 1ILEA 1EE2A 3FZNA 1F60A 3MQ2A 3EXG1 1SHTX 1S2IA 1WZEA 3G2IA 4MWDA 2JVJA 4LWOA 4NBUA 4DIEA 4PONA 1DXHA 1W85A 4FOPA 4CODB 4EKGA 3V7UA 4J0JA 3I83A 3V8PA 3NHPA 4JYPA 2FPLA 4FWIB 1JVSA 3NNSA 4LQCA 4E13A 4YRFA 3PSAA 4BLPA 1Y4SA 4L8WB 1JAYA 4N7RA 5LXTB 1EXVA 1U5BA 2XCOA 3EK2A 4RD2A 4D8WA 2C57A 4U3JB 1Q6ZA 2YNMA 3U5TA 2OYSA 2ZWOA 4RTRA 1U5CA 2O50A 3HBAA 1Y1QA 3U7QA 1XN1A 3IESA 4DQLA 5FORA 1L7XA 4DLNA 4BATA 2WYIA 5HS4A 2VTEA 1U7UA 4GR5A 4DCSA 3ZEAA 3FNIA 1C7JA 5I47A 2HDNB 3GRRA 4HAZA 3O03A 3DOCA 5KWEA 4P82A 2BFFA 4X45A 1ZCAA 1T3GA 1YOBA 2PZGA 1G8JA 5ALRA 2FSVC 3RFCA 4YAKA 2GTIA 1SVKA 2VYVA 4K1LA 3X1DA 4P3NA 1SCQA 1ODTC 4YRTA 3KQYA 2P77A 3RSHA 3B6JA 1TPYA 2I1LA 3DMNA 4NV1A 4F2PA 3TB4A 3T5GA 1CSEE 4MYUA 1YQQA 4P4LA 2IS6A 3K7EA 2VSYA 1PTJC 4KAFA 4LJ5A 3L05A 3TLYA 3WWDA 4A6DA 1LPAB 3PDUA 2PWZA 1Q0PA 3U7EB 1UKZA 2ZI6A 3DZIA 1Z62A 2FZWA 3R5TA 3S5UA 2X0KA 1GPKA 1Q6YA 4FDUA 5A4KA 1T3HA 2EDAA 2BBWA 1QF6A 4W5JA 4NOJA 5AXBA 2G63A 1Q95A 5SZJA 1C50A 4IH9A 4NHEA 2VDQB 3TGLA 3BJZA 1IHOA 2YBEA 1LLQA 2RGWA 4I5IA 3C3DA 5IAJA 4DM7A 5BN1A 1KAMA 2ZAIA 3QVUA 1QIIA 1GL7A 1EP2B 2BM8A 2JBAB 1ISRA 3ROZA 2N0SA 2C0QA 4DLPA 2XVYA 3LDHA 4QZVA 4JXZA 2GBLA 3VISA 1MX9A 3G2HA 4DLSA 3AUTA 4B48A 1YDWA 3RYHA 5CG2A 3H2ZA 2IL1A 2QTLA 4BO7A 3C16C 4I6JA 5CX1A 5BW6B 5IJ9B 5CFZA 4CM4A 2PKWA 1EEHA 2JIZA 1T26A 1MO2A 3UAGA 1IOVA 2ZJ3A 4DEYA 4ZJZA 4EG1A 2Q3EA 2VOJA 4OO3A 5F12A 4RANA 2ACEA 1K6XA 2OCLA 3IPLA 5CH3A 3WZLA 1OGYA 5IXJA 3B3JA 2DBRA 4Q16A 3DD1A 1TUIA 1TTHA 3BB3A 3P97A 3ZLTA 3K94A 2VNKA 4LAFA 4RF4A 3RFVA 3H6GA 4OH1A 2YYZA 2Q8NA 3JQCA 4V24A 3C7CB 5HDQA 2IIQA 3TD6A 2PWYA 5ELLA 4F04A 1G3IA 4I99A 5KJCA 2CJPA 1YUMA 4YRJA 2Y1EA 2YWEA 4O5AA 2GUGA 3FNQA 5BR4A 4KIJA 5LU9A 5A03A 2HU7A 3RO7A 3WIBA 2E18A 2AV6A 5A05A 4JU8A 5AUQA 3CEAA 1HYHA 2HPAA 1ZI6A 3OHSX 4HTFB 4R31A 4RZ3A 1G8SA 3AESA 1E0DA 1GNQA 3HACA 1NBHA 1RLTA 1SUFA 1QH1B 2XT9A 5CB4F 4Q1CA 5JSHA 1UEJA 4B4WA 5CB4B 1YZYA 5KHAA 4OHOA 1V3UA 4K9KA 4NEHB 1GUAA 3UHAA 4D45A 1Q5PA 3L8HA 1Z8HA 4MAFA 4FE7A 1SXJA 5K0EA 3ZVMA 4G2TA 1ULZA 1YJ5A 4C4SA 2CNNA 3K0BA 3OZ7A 1N2CE 1LJ8A 3A6KA 3D8UA 2NN3C 2WICA 3AC0A 3CCBA 4QAQA 5KQRA 5LQDA 4C29A 1KEWA 3TBKA 4BMSA 1A4IA 4Y8VA 3IPAA 1WEKA 1HSOA 1M2KA 1KEPA 4ERXA 1WDLA 2YCLA 3UMCA 1ISMA 2A67A 3LHDA 3GA5A 3HCRA 3SHWA 4ZI7B 3NHZA 4KPGA 4YJGA 3YASA 1CJCA 2C8JA 4A8PA 4D4HA 2O8EA 3G3EA 3ZXSA 3I9V6 4V0OA 1KSFX 3N58A 3TEFA 2FN9A 3A27A 1T0PA 1HL3A 4GH5A 1FLDA 1IHDA 2I4LA 2YNMC 2ZU0C 3ZGNA 1QP7A 2ASVA 2GBFA 2I2BA 3C3PA 1ECLA 3G02A 2WM9B 4H6WA 5KKCA 1WETA 2R8XA 4A0RA 1XLVA 3DVAB 4M9CA 2ZUVA 3BHJA 4FN4A 4FPXA 3DOHA 4C3ZA 4PG6A 3LYLA 3T5TA 2PGJA 4KUGA 1FDIA 3LY5A 1G4UR 1KC3A 3EUAA 4YRAA 4HAIA 1W76A 4G0MA 2ZIGA 4NBKA 2E5LB 1A4RA 4L72A 2P0YA 2O8CB 4LJKA 1EGVB 4YRLA 2ZT8A 3F9RA 3BEOA 1N57A 4CMIB 1SHLA 2MSEB 3ELYA 4ARVA 4TL8A 1E3TA 2HLDA 3BPSA 2HBRA 3DDCA 4UHKA 4Z1MD 3LUBA 4KE8A 5FBRB 3O3MB 1SCAA 2JL1A 5TEWA 1AXEA 1DVRA 4MV5A 5IWCA 1H3NA 3R6LA 4Z4CA 4ZVQA 1JBQA 1Z6ZA 1W0JD 1HF3A 4W6QA 5E3JA 1BQ4A 1BX0A 1JAZA 1TB4A 1LVUA 3NH9A 2ODAA 3M2PA 3OUZA 5FYQA 2Q7XA 4C04A 2H5LA 1EGAA 2V6MA 3ZJUA 3QWBA 2PY6A 4KXYA 1XU9A 3EFOB 5B30A 5A2QA 1ZD1A 3D3WB 4BQRA 2OC4A 3L04A 3LNCA 3N8GA 4DCTA 4ND8B 2B1GA 5IEJA 2FMFA 2GM3A 4UCQA 3X44A 2AEEA 1XMSA 3QLVA 1LKZA 3L18A 1TT5B 1XDZA 5A7HA 1UOOA 4YCDA 3GT3A 3INTA 1Z3IX 4HFMA 4QWWA 2QTAA 3T1OA 1QSGA 4JEHA 4UHJA 3RU3A 1BMFD 2R47A 1SUDA 1C1DB 3IV7A 2D1SA 5KNCA 2IIBA 1NJ6A 5IK2A 3IA7A 4JOCA 2JH8A 3R7NA 1RWXA 1F4PA 7ABPA 4R6XA 2B7CA 2PYIA 3DBLB 1ECJA 4EK9A 3TI9A 4CKYA 1IBCA 2H48A 3A7EA 1MENA 1P4GA 1OQAA 2BONA 1H6AA 3V9PA 2BFBA 3HNOA 1U2ZA 3FLEA 3PICA 3FWNA 3ZWQA 1V11A 4X5OA 5AM1A 1NBEA 1E1NA 1Y63A 3PXCX 4I5GA 4OQEA 1Y4ZA 2WM8A 5D5PA 1U7XA 2M98A 3N8KA 3MPOA 5G3YA 3C6ZA 3F67A 2OTCA 5NULA 3ZHRA 3TMAA 2W6JA 3LY9A 1ZLXA 1TUEA 2WTEA 1MEEA 5KTOA 1EX6A 2GRAA 2ZETA 2IUFA 2NUAA 1RI3A 4LV8B 3VOBA 2QUAA 5CBKA 5FOSA 1YIDA 3E9NA 3V8VA 1IONA 5IJXA 5I8ZA 1B2RA 2V58A 2CE7A 4FDLA 1NOKA 3R0IA 4AL4A 4DV1B 1Y8ZA 3HP1A 4A03A 4QXPA 3CKMA 4FKZA 2RH5A 3P32A 1J5XA 1V25A 2HXGA 2VKTA 2CMHA 1QO9A 2EZTA 3GY0A 4RAQA 3VR5D 2HMVA 5CFQA 1OI7A 3NO4A 2VHCA 4ER5A 2Z43A 5JWHA 4F4DA 2R65A 2QZ4A 1SXJC 2HJSA 1WW8A 5C4MA 2F3PA 3D6VA 2EFJA 2GZRA 3OU7A 1IVYA 1GT91 2BOVA 4BN5A 3CF0A 4HXFB 4LC0A 3NPMA 4J0GA 4WN3A 4U3JA 5LYYA 3SHQA 1LQTA 3L41A 1LDEA 2QY6A 1QV7A 1Y37A 3WK7A 5M34A 1XZAA 5ADHA 4FUQA 1YB2A 4S1WA 5T64A 1Z7BA 2SKCA 4XQ0A 5HZHA 4DILA 4R01A 4EHBA 4IOJA 4DR5B 5JS8A 1NURA 1G17A 1VFPA 3IUEA 1QB8A 2IX9A 3I37X 1DAPA 3H8WA 1CX9B 3WL7A 5AKJA 2J3KA 3R7BA 5EJEA 1N3BA 5AK4A 5FX2A 2HA3A 1JKMA 1OVMA 1Y34E 4FCVA 1BYIA 4BGDA 1ZW6A 1NNEA 2HA6A 3HO1A 2ZPTX 3IUYA 5L95A 1SCDA 8ATCA 1UXKA 2OXEA 2IOFK 4L73A 1Q0HA 1ZISA 3PFBA 3RF6A 2A57A 1LV8A 2PX0A 2Q3FA 3FTQA 4YK7A 4AP9A 4YCLA 4XFKA 4HX2A 3AUUA 4XTRA 3WJ2A 3ZU4A 2XGJA 3I2IA 4X7BA 1ESEA 3OHMA 4O0MA 1U1IA 1Q16A 4PZ9A 3V5NA 1W88B 1ZL2A 4M8LA 4N3GA 3DR3A 2QTVB 4MUFA 1AU9A 3KWJA 4HAVA 1ULUA 3GLIE 2PCJA 2KSQA 5CLGA 3SXJA 1NJ8A 2XUDA 2C9ZA 1U0JA 4RACA 2NM0A 5CR9A 2ZPAA 4TTSA 4WFKA 3PUJA 4RENA 2OO7A 3O0DA 1ESZA 4JC5A 1FZQA 3K4PA 4RFLA 5DDIP 1ZBDA 2ZBRA 5LA6F 3V2IA 4HOYA 3ZDFA 3LCRA 5FFMA 3JWGA 3COJA 3IQFA 3JRNA 3GZJA 3K1JA 5HIIA 3ZDBA 2WJJA 2JGRA 5A06A 1U2GA 3KVOA 3T0GA 1XSEA 3WL8A 4DSNA 1KFJB 1JH8A 1ENZA 2QUBA 2ZJ6A 4DCMA 1EFLA 5CNIA 1RRMA 1OX4B 2JFWA 1IOLA 1NUPA 1I33A 3W7VA 3WGHA 4DWJA 3NIWA 3MERA 1Z08A 1CUHA 3GIDA 4GR4A 3RRNA 2RARA 2Y68A 5IJ9A 2JLXA 3RAEC 1OB2A 2O5CA 4YECA 1S2LA 3JU3A 1TJPB 4HNQA 1M10A 1RXUA 2GZ3A 2VHQA 3F5SA 4DNFA 1QRRA 4BFTA 2FN8A 1UADA 2FJPA 3K9BA 4OMCA 1K3UB 2DECA 1XTTA 2F6RA 2WZQA 3TQCA 3HCAA 4YDQA 1PZXA 4YJ3F 4ZREA 4WA8A 2NZJA 3Q5EA 4C4AA 1IUOA 1QCCA 1VBNA 1PQUA 2FTKE 4PNHA 3TNLA 1Z0KA 2B61A 4KE6A 1O58A 3UA3A 3IFSA 4LDPA 3DS8A 3E3MA 4P92A 1A04A 4HWOA 3A1FA 3EULA 3M81A 5L7WA 1KERA 4AMVA 1P2FA 4OHWA 2X9VA 2PTHA 3PWSA 2FF5A 2I7VA 1Z39A 4YLGA 4GL4A 5T3UA 4IIEA 1QBGA 3JWEA 3O4RA 5K20A 2PZKA 3V3TA 4ZHQF 4HTFA 3MD0A 2HQOA 1T5OA 4QOJA 3T1QA 4BP1A 5F4ZA 3EDRA 1QH1A 2YIJA 1O9GA 4U8HA 1DHTA 1M75A 3A26A 3A2LA 2D0DA 4RK0A 3A4VA 4AZ3B 3TQRA 5CB4A 5HKKA 5KNCD 2VH2A 3DTYA 2BL4A 3EZ6A 2XZPA 2EBFX 2WIAA 2P9BA 3I4CA 4HQNA 4MVJF 5FFNA 1E2BA 4I1YA 4YCBA 2VNIA 1CUJA 1VA4A 2AMFA 5J2UF 4KWCA 5J2UB 1QFXA 1J06A 2OCAA 3SU8A 1ELOA 2PRZA 1TM2A 3PV0A 3UUEA 2C7OA 4Z4QA 1VMDA 4D9HA 4Z7JA 1E1RD 1GUBA 2FFRA 3T5BA 1A9XB 1ONOA 3OJXA 3WLMA 3TRDA 4JLWA 4EA8A 2J3LA 2X0JA 3KT6A 1W9MA 2HCJB 3RREA 4ZXFA 2XJ9A 5B57C 1ZHHA 5C3UA 2CDRA 3E3AA 3MJTA 4YUYA 1P6UA 1XTJA 4ZCPA 4ZI7A 1LDYA 1M33A 2W7TA 3AM4A 3HWSA 3OQBA 2OBLA 2PZAA 3M7IA 5FTLA 4GIBA 4QA9A 1Z5ZA 4NABA 3K6KA 2DX7A 5C8VA 3STTA 4TZ0A 3O8BA 2JVKA 4C21A 1AKEA 1M2EA 1MKYA 1SWWA 4JOSA 2P5SA 3L0IB 1J49A 1NR7A 2OG2A 3DVAA 3INRA 2CV1A 1CZKA 2E21A 1M0WA 3WAKA 1FQWA 4B7CA 3NR2A 4PC3A 1DT3A 1SZJG 5IARA 3TDNA 3WHKA 3ZNPA 4M9QA 1GM5A 5D7NA 2YIVX 5JEEA 2IH4A 4M6WB 5KTPA 2O8CA 4Z0TA 3EVZA 3MLAA 4O4IF 1XF1A 2VUIB 4JD5A 3NT4A 4L95C 4CMIA 3TD2A 1CUGA 3A37A 2PNFA 1MEOA 2PUGA 1FJHA 3UOWA 1HT1E 2I71A 1ATZA 4U63A 5IH3A 5LP1A 3X0DA 4MGEA 2XD9A 1S4QA 3KKMA 4U0JA 5KCZA 5AVTA 3GLGE 4N8SA 3MILA 2HSJA 3RNOA 4BLUA 2W43A 3TPZA 4J76A 4DSUA 4OB7A 4FB4A 3C3JA 2EL7A 2N75A 2Y4OA 3B7GA 3BILA 4JLAA 4WASA 3EFOA 2ZR7A 5JNSA 3D3WA 1XTVA 3GEGA 4ND8A 3V1NA 1LTQA 5LQKA 1R0KA 1RP7A 1UJ2A 1U4SA 4ETWA 4UNRA 1TT5A 5K5EA 1X7HA 2JLVA 4G1FA 1JG1A 2F1KA 5FI1B 2OZLB 5GP1A 2VDKB 3U6KA 4BNUA 2C5EA 1CQJB 1JR3E 4DNQA 4BX0A 1FP1D 1U2GC 3LFHA 2PIDA 3M33A 4KO8A 5DASA 2F59A 3TVYA 2QRKA 2GM5A 4XGRA 1C1DA 3DQZA 3V1TC 2DR0A 4BMCA 2X23A 1ZOPA 1SPXA 2XHZA 3VPFA 3DZCA 4QOEA 3A3PA 3MELA 5EY5B 1U1GA 2DKFA 3C3MA 4LZJA 1P4HA 2GMWA 3DBLA 2PU7A 3FD8A 4JN6B 3DGFC 4JY7A 4BEJA 4ISCA 2F7SA 3C5WP 3ELBA 2GZHA 4DXAA 5F33A 3GP3A 1PGJA 1QRDA 3FPSA 4C22A 1IQPA 1GQYA 5DEIA 3GJSA 4JYZA 1KI2A 4LDAA 2VJYA 4R2HA 1G41A 1JKJB 2J3JA 2YW9A 1YJAA 2DPXA 2PS1A 3W8FA 2P3SA 5C7IO 2PHZA 5JHGB 1D2HA 3U40A 1ZCZA 2CHVA 1IHXA 3L0ZA 1FU7A 1RWNA 4CNBA 4K86A 4L02A 3U49A 4MKHA 3EGCA 4QHTA 3VBEA 4O1IA 4XJVA 4G9BA 4MGZR 5A4MS 3QPWA 1UWKA 4Q3NA 5JO0A 2FR8A 3ZXYA 1TO2E 2H2DA 1XHFA 2R6GA 2WFLB 1ZCFA 3AEQB 4WOJA 3DPIA 4F5DA 5AP9A 4E1AA 4C4YA 1E98A 4YCJA 4PNEA 3MWYW 1HTBA 3U7GA 1M2VB 3V8NA 9MHTA 4NCJA 1NMXA 4LE2A 4FLEA 4P4GA 3HZZA 2VHTA 3I53A 3EG5A 3IJRA 3LECA 1LF5A 1IBMB 3RTDA 1WOMA 5CT4A 1L5SA 1V3QE 2EZ8A 1GTJ1 3IHKA 1NDQA 3ANSA 1H9AA 1VJCA 4A27A 4HYQA 3SZOA 3A3OA 3LX5A 4JLDA 1QM5A 1HZZC 1NPDA 2N1MA 3B1YA 1Z74A 4UBLA 3E9EA 4X3PA 3REFA 4C1NA 2HWWA 4P3YA 2JJ2D 3UCFA 3PD7A 5ICCA 3F1KA 3NJRA 2V5VA 3WMGA 2IYAA 1G2PA 1PV2A 4ZCSA 1KFBB 3NBAA 4O1HA 2B8WA 3AUKA 2PMKA 1J1UA 2FVXA 2A9FA 2VUTA 5I7VA 2P8JA 1DI0A 1LBTA 1PR6A 3CIOA 4OHVA 1KDYA 4MDHA 4HP8A 4V38A 3V8EA 1ADGA 3FVVA 4BVKA 2OVFA 4A7PA 3ICEA 2WG2A 3ZNQA 2OE2A 1E0KA 1XZPA 3I30X 4GWGA 5FI0B 5LZ7A 3UWMA 3QOFA 3EY4A 2HK6A 2LV8A 5JUWA 3PUWA 1DLJA 1ZQ9A 1E5LA 3PC3A 1ZW1A 4QX6A 5AKLA 1JDNA 1EJ2A 2QVBA 5DYWA 3L6CA 1W88A 4RVCA 3HGTA 1EGHA 3T15A 3R4VA 2QTVA 4YBRA 1B0ZA 2GX6A 1UBEA 2VRBA 1M2WA 2L82A 4Y2SA 4UPDA 5L7YA 4CMBA 4DMKA 3FTPA 3M5WA 2ZPUA 5EIWA 5JXHA 3QPCA 3QQPA 4EZBA 2XUFA 3SZRA 2XWJI 3KUUA 2PX3A 2R85A 1MH9A 2DJ5A 2VR1A 3FCCA 5BYKA 3AEXA 3BL5A 4DBVO 4HQRA 3JQFA 3AB8A 1NX9A 3PD0A 3K0SA 1HG0A 2GARA 3IBFA 4L51A 3OKCA 4BNIA 3HCCA 2GEBA 4XQCA 4ZRDA 1ZZGA 4AJ2A 4GI2A 3A9CA 2HQ1A 1OYWA 2GH1A 5TS3A 5F3RA 2JK1A 2PH7A 4K88A 4ZYLA 4G9GA 3L1UA 3T61A 1COZA 4E1VA 3SYLA 4EG5A 2DEUA 3S27A 5IC6A 4B6EA 1OX4A 3IP1A 3WLEA 2QW8A 4DUGA 4H7JA 4W82A 4YB8A 3K31A 3TJMA 1P2TA 4D6YA 4DB2A 3BORA 4E5YA 1PR1A 1R0ZA 1MB2A 4F3CA 4C0KA 4PGMA 5TQJA 3OJFA 1AKWA 2X6TA 3HV2A 5SZIA 3U3RA 3UQZA 2P9FA 2EAUA 2O2GA 3KKEA 4RCVA 4PO8A 4QEDA 3ZU5A 3F6RA 2R6CA 4Q7EA 1WXDA 1MXFA 4NRDA 1EIWA 3PGLA 1ORVA 3BXHA 4KR7A 1R5NA 2MYNA 1EDEA 1L8OA 1OWLA 1TU4A 1PEAA 1XCBA 3K8OE 1UXOA 2GF9A 4HNAB 4JUIA 3EGXB 3VC1A 3ZLVA 4LSGA 5B7GA 1F7UA 2DSTA 3D0QA 2A2ZA 2IZ7A 2GETA 4R4JA 4UTXA 3I0MA 3OURA 5DW0A 1G8HA 4RZIA 4DCCA 4M1EA 4NJMB 2M6RA 1XCPA 3WC4A 1C7ZA 2O9JA 1GNLA 4K6OA 2KQUA 3UW3A 1XTQA 4E46A 3E7FA 1CVLA 3OQNA 1O0CA 5E7IA 3MSCA 3STYA 3FOWA 4CXMA 3DVLA 3IPCA 2P27A 1IXZA 1N6KA 2XECA 1NYQA 1BEZA 1KHTA 4FR0A 4KVFA 5A4JA 2H4JA 2P1RA 3GRZA 5BV8A 1A96A 2XOEA 3L8GA 4AZ3A 4RDCA 3FPAA 2B3TA 3GU3A 6PFKA 1GV1A 4YCCA 3N53A 1PFUA 2WHRA 3L8MA 4YDSA 2JGJA 5I7UA 5J2UA 1YO6A 2BGGA 4EMTA 2OP1A 2BTEA 4OHYA 2EDCA 2RAUA 2BD0A 3OMLA 3RVNA 3VHQA 1A9XA 1Y9EA 3B51X 3LQFA 2BT4A 4MRMB 3ZI7A 5BWLA 2Y4NA 2OK7A 3LIIA 4E11A 4DR4B 1FPQA 1CULC 4YP9A 3IE1A 2OXIA 5DXFA 1LS1A 5YASA 4J29A 3U81A 5LD2C 1NVEA 4JHXA 3FNEA 2GPWA 1ZK0A 3IUBA 5CIWA 3OU2A