2VWHA

Haloferax mediterranei glucose dehydrogenase in complex with nadp, zn and glucose.
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
357
structure length
357
Chain Sequence
b'MKAIAVKRGEDRPVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDHLVLGHEAVGVVVDPNDTELEEGDIVVPTVRRPPASGTNEYFERDQPDMAPDGMYFERGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYCLGRRDRPDPTIDIIEELDATYVDSRQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLHNKALVGSVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFDDDDTTIKTAIEFSTV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUCOSE DEHYDROGENASE
publication title Active site dynamics in the zinc-dependent medium chain alcohol dehydrogenase superfamily.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Oxidoreductase
total genus 115
structure length 357
sequence length 357
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2008-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vwhA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2vwhA01
1ARZA 2HMTA 5L3ZA 4CUJA 2ZB8A 1WVGA 2W90A 1X7GA 4II3A 3ITKA 2PH5A 2P9EA 4EGFA 1E0DA 2JFGA 1PJ2A 4E32A 2OXIA 5CDUA 5U4QA 4TKLA 1DC6A 1XDWA 3RQSA 3VZSA 1FK8A 1P74A 4ZICA 1ENYA 1U1IA 3KLMX 1OFGA 2HSDA 4EJ6A 5IDQA 4D45A 4ALNA 3OHSX 3JD1A 1WAMA 4MKRA 5EL0A 5ITVA 3BA1A 1TT5A 2X7HA 1T2AA 4Z3DA 5IZCA 2FHSA 1UP4A 3TOXA 5JAIA 2GF2A 3G1UA 2X1HA 1WDLA 1LRJA 2JFFA 3BHMA 2DUWA 4R3NA 1I33A 3FI9A 5JE8A 3TL3A 3H6KA 2HDHA 5L95A 2Y0EA 2Y93A 5KVSA 5G0VA 1YBVA 1P31A 2CY0A 5T57A 4NJMA 3IP1A 2J3KA 4DIFA 1YGYA 4NBVA 5U9CA 3VPSA 1UUFA 1T2FA 3SLKA 3W1VA 3HG7A 4IDEA 4IDDA 1X0XA 1LQUA 4KDEA 5KJ6A 1F8GA 4GX2A 4QO7A 2GN4A 3EAGA 1QYWA 3BYZA 1KEPA 2O3TA 4ND3A 4YJDA 3VH1A 5L45A 4N5LA 1Q2XA 4E5KA 4CM9A 3FWZA 2Q2QA 3D4NA 1E92A 2XAAA 4WCFB 4FW8A 5HS6A 5CEJA 1P3DA 2AE1A 4GSLA 3VKVA 5JFOA 2E49A 3Q9UA 5B12A 1M6HA 1PGQA 4O6VA 4L74A 4G65A 1Y81A 2YHUA 4Y6PA 4JIGA 4QX6A 2I65A 2IEBA 2V7PA 3GVXA 2X23A 5CFZA 2ZB3A 3BXXA 4R5HA 1DRVA 1LRLA 4FJ1A 3IIEA 4Q39A 1FJHA 4JGBA 2I6TA 3DB2A 4MP3A 2LDXA 2VHYA 1YJQA 2UYYA 3EMKA 2V6BA 1I0ZA 2J3JA 2F1KA 2G17A 5EPOA 4YR9A 3I9NA 1ZUD1 2YV2A 2PFGA 3DZJA 5THQA 5F5NA 4FCCA 2J6IA 1DRUA 3PJFA 2VUTA 2Y0DA 4JBHA 2VYNA 1NFFA 2BHLA 1K6IA 5KCZA 3I3OA 4HFJA 4YJHA 2GGSA 4MVJI 1BHSA 3LT0A 2TMGA 1ZK0A 5G4KA 3DHEA 4MJLA 4E2WA 1EUCA 2EJWA 5B37A 2JCYA 3LU1A 1D1SA 1MFPA 4HX5A 4Q3BA 2HO5A 4NHEA 5ENDA 1NQTA 5A9TA 3BAZA 1JWBB 3L6EA 2PLAA 3UOGA 3WB9A 4DQUA 3CKYA 4YT2A 2E48A 1KS9A 5BSGA 1IULA 1PGOA 1U5CA 1Y8QA 4BB5A 1YWGO 3QA9A 3KTDA 4BS9A 4E5NA 4J2HA 2WYUA 3OSUA 4BGEA 5C7IO 5ENVA 4YQYA 3GT0A 4XGKA 3U4DA 2C0CA 3T7EA 3NYWA 2DFDA 2PWZA 3WS7A 4DYVA 3JYNA 3I9JA 4IJKA 3C3XA 3K2EA 4DC0A 5I7EA 4OGWA 1Z45A 3GDOA 4FS3A 2WD8A 3X2FA 2VNAA 1V8BA 3B1KA 3PFFA 2IDZA 4XR4A 5B4UA 4HUJA 4MVJH 1EVZA 3N7UA 1LDMA 1UXIA 1KOLA 1ZSVA 3GEDA 1CEQA 3PPIA 3VDQA 3GMDA 4J7CA 3CMCO 5IDXA 3RJ5A 1GDHA 1FDUA 2HJSA 4DPKA 4JROA 3PIIA 2GO1A 2WD7A 3DOCA 3NT5A 4NH4A 1VJTA 2VWGA 4K6CA 2WM3A 3U3XA 1Y9EA 2HUNA 2IYPA 3E1KA 4RPKA 5TJ9A 3WIDA 1XQ1A 2E4AA 2NU7A 4DQVA 3ONDA 2X6TA 2EEZA 4R16A 2C5EA 3LZ6A 5A3VA 3JQCA 1U2DA 4IDBA 4HNHA 1QR6A 2RHRA 3QLJA 1WWKA 3C24A 3QP9A 2AMFA 4EDFA 1HYEA 4IJVA 5LDHA 1DAOA 2D4AA 1ZVMA 1PWZA 2GZ2A 4GGPA 3GEMA 1QLJA 1JDJA 3H9EO 3GC6A 1J49A 2X5OA 1HDRA 2ZYDA 4CM3A 4ZHSA 2PKQP 1NX6A 1IZ9A 1EQUA 3UF0A 1DHRA 3SC6A 4PRKA 1UR5A 4F6LA 2D5CA 1M67A 5IAAA 1MC5A 3H65A 1Z75A 3RAJA 3UXYA 4RVGA 3D3WA 1P1RA 4BNJA 4EW6A 2GUGA 3TDKA 4R1SA 4OQZA 2NACA 3N58A 4QFDA 1A72A 1T1SA 4PZEA 5U1PA 3WGTA 2X22A 1QKIA 4R5MA 1YQDA 3AW9A 3JQ9C 1H0KA 5EQDA 4WNIA 3ZWYA 4CL3A 5A05A 1I3LA 3KSZO 2AE2A 4A2CA 4XGIA 5HS4A 4GSKA 4HADA 4CM4B 3K9QO 2Y67A 4UAGA 5CG2A 1U3VA 1J4AA 1E1LA 2QZZA 2HCTA 2VN8A 2NADA 1OC2A 5DCWA 3WJAA 4RF4A 5HWSA 1BW9B 3INRA 3OETA 5A3JA 3AFMA 2IRWA 3ANLA 4U6QA 2CDCA 3KM0A 1DBVO 1VKOA 5L53A 1QYXA 4P38A 4PLHA 3H2SA 3O9ZA 2GSDA 3WX0A 2ZYGA 4A73A 4EEZA 4CMEC 1N5DA 4UREA 2PTGA 3GQVA 4DXHA 3LYLA 4UUPA 2PY6A 3SJUA 1ONNA 1JN0A 5T8KC 2FSSA 2ZKLA 3DC2A 4BL5A 3N74A 3BIOA 3CTMA 1NASA 2PK3A 3TL2A 4TRRA 1HLPA 3KV3O 3VZRA 3ZWOA 4CM8B 3TZKA 3WIEA 4BNIA 4PG8A 3GNSA 3QHAA 4FD3A 3BZUA 1D3AA 1M66A 4PLVA 3Q3CA 4PG4A 1RWBA 4EBFA 2P5UA 1CQJA 1E7MA 1KC3A 2O3UA 1U3TA 4M8SA 3ZWXA 5TC4A 3ZZNA 2OUIA 2WJPA 3DBHA 1PGNA 1Q1NA 3DMTC 4BKUA 5I8ZA 4KQWA 1VJ1A 1WXDA 3AM5A 1I3KA 2O4UX 2D59A 4CMJA 1DIRA 4AJOA 3WSWA 4CR8A 3VZQA 5JAMA 1R37A 3C7CB 2G76A 1B16A 2HU2A 2VZ8A 4Y9DA 3NDIA 3AFNA 3IJRA 4WCFA 2Y05A 4XYBA 4BNVA 3HDQA 3UKOA 4YT4A 3PEFA 5CEEA 4PLPA 2Y1DA 2J5KA 4GPD1 5K6AA 1Q7CA 1BWSA 1LSUA 5DBFA 1V35A 2X0NA 2AQKA 4H16A 3DZGA 1EE2A 1J5PA 3TSCA 4BKRA 2DBQA 4BHTA 2ZIZA 1I3NA 3FWNA 3G1TA 4XB2A 1Y1PA 2CD9A 3PRJA 4OHUA 4MVJG 1Y9AA 5JDIA 4DREA 1BXKA 3HB4X 4OKNA 4QT0A 4O63O 4DBZA 1QRRA 4MKZA 4M54A 5COQA 5G0SA 2PD4A 2P5YA 4RCVA 3WTCA 3SVTA 2LDBA 3WBBA 2Q4BA 2E37A 2W4QA 2G1UA 3K31A 4NU6A 1DHTA 2Z5LA 4M55A 4YTEA 4RLSA 4NFSA 3JSAA 1IPEA 2YV1A 5AXBA 1G0OA 4U5QA 1JW9B 1MGOA 2JCXA 3O8QB 3GG2A 4W4TA 3ZV4A 4U6SA 2BRUA 3WMWA 4E30A 3G79A 5F21A 2YQ4A 2GR9A 2YYYA 4RV9A 4RO0A 1YONA 4J6FA 3LC1O 3JTMA 4W9NC 3WLFA 2GCGA 2NVUA 3C7DB 5KJFA 5JMWA 1E3IA 1Z73A 2DTDA 4B7CA 2DUUA 1CQIA 3GRKA 3K2BA 5EINA 1PJCA 5BSFA 4L8VA 2OO5A 3ZWAA 3FPCA 1ZXBA 3LF1A 1X14A 4CV0A 4D41A 1HSOA 4OQYA 4FN4A 4FBGA 3C1OA 3LC2O 2VT2A 4BO6A 1HZZA 1I3MA 5DF1A 3BTUA 1ML3A 1KEUA 5DNAA 5A04A 2E6UX 4MVJE 4KTTE 1KYQA 3FBGA 3O03A 3MWDB 4N5NA 3DZIA 1HE4A 1M76A 3LQFA 5F5LA 3JQBC 4HFMA 1YDEA 1UJMA 3GVIA 5IDYA 1PZGA 3AM4A 3E8XA 3L07A 5AXAA 1T2DA 4WNCA 1DFIA 3G17A 1DIHA 1VJ0A 1UXKA 2VNSA 1U9JA 3BTOA 4FFLA 1A4IA 3I83A 2PD3A 4E12A 4R4JA 3DBLA 3OEWA 4QEDA 2AEFA 4XKJA 1OAAA 1IY8A 4ZN6A 1XHLA 2Q46A 3M1LA 4NI5A 3ULKA 1ISGA 3WNQA 3T4XA 3A28A 3RUCA 5JLAA 4BNNA 2QRKA 1QV7A 3GZ4A 4XZ3A 1X7DA 2OBNA 1PL6A 2Y1FA 3G3EA 5GZ3A 2OL4A 2C2XA 2OGUA 4YEDA 3JQ9A 2IYOA 1YXMA 3RBVA 3PDJA 1EFLA 3B20A 4BQRA 4GL4A 3EW7A 4LVCA 2OP1A 2O23A 1I10A 2YW9A 2VRCD 5JDCC 3WXBA 1EQ2A 1AXEA 4GMFA 3GGGA 3U4HA 5DULA 3ANNA 3PHIA 4OXYA 1PL7A 3KHUA 3PXXA 4E5MA 2I3AA 4TRJA 3JQ7A 4NNJA 3P5SA 5HTOA 4J2OA 1C1DB 1Q0LA 1JU9A 5COAA 1NHWA 3AM3A 5IZ4A 4A5OA 3DXFA 2IZZA 5C37A 3HFGA 1Q7BA 2P68A 1DC4A 4RVHA 4DMMA 1LDGA 4GAEA 2VRBA 4UUNA 3FBTA 4B7UA 1E7WA 2PGDA 5DP1A 1T2EA 2OORA 1BRMA 2YFHA 4AJKA 4Z9XA 3MJSA 3H2ZA 3NV9A 1MA0A 2H63A 4R54A 2P9GA 2HMSA 4CLOB 2EKPA 2YUTA 3ABIA 3DTTA 5KVQA 4IINA 4FFOA 3FNHA 3O4RA 5G4KB 1N1GA 1PQUA 3GMSA 5G0WA 5F1PA 1PJ3A 4J1QA 4CM4A 3ZV3A 1IHYA 4XIJA 4WLUA 4XYLA 3MJ4A 4WE3A 3W8EA 1UDBA 3NEPX 4LRTB 3DMTA 4R1NA 4XD2A 8ADHA 1ZCJA 3ITDA 3GEGA 2G82A 1BW9A 3PK0A 1DEHA 1U5AA 3VHRA 1RKXA 1YVEI 2DBZA 4MP6A 2B4TO 3V2GA 5ILGA 2CUKA 3KYCA 1N2SA 3M2TA 3ZWWA 4MINA 3ZWNA 3E9MA 4AJIA 1ISFA 3U5TA 3DAPA 1ADFA 4XEHA 3AOEC 1XQ6A 2NU9A 3A1NA 2D1YA 5I7VA 5GMOA 4BMNA 3PGJA 4GKVA 5C5IA 1QYVA 3P19A 3IUSA 1VI2A 4PFJA 5JO9A 2VOJA 1GV0A 3PTZA 2BGMA 1KC1A 2WYWA 3TZCA 3FF4A 2EKLA 2WTBA 3RC2A 1DFGA 3ROPA 5JAQA 1SNYA 4XJSA 1CERA 4U7WA 4UVHA 3EDMA 1ENPA 3GH3A 3P7MA 3I4FA 3PZRA 1PSDA 4R1UA 5K0ZA 1PL8A 4BMVA 3HHPA 2O3JA 4E2XA 4GVLA 1HEUA 4BV9A 5DCYA 5ES3A 4C7KA 2WD7B 3GLQA 3ORFA 2J5RA 1UZMA 1LNQA 4L4XA 3RWBA 3I4CA 4EUFA 2C07A 4Q3NA 4Z6KA 2CMDA 4K9DA 4BVAA 1BVUA 1GYQA 2I3GA 2GD1O 4UVEA 4G2NA 2RCYA 2ET6A 4PGFA 1CRWG 4IBOA 3I9OA 4URFA 3D5QA 1RM3A 3BMOB 2HMVA 1MXHA 1HT0A 3L6DA 1ORRA 1CDOA 3DTYA 2CVOA 1RM5A 1HF3A 3TOZA 4JNKA 2CNBA 1MG0A 4FPXA 4MIYA 3QWIA 4JXKA 5A02A 1YH3A 1BDMA 1T26A 5KKAA 3JQ8B 2NU8A 3EVTA 5ADHA 5JY6A 1NFQA 2DM6A 4HBGA 2NTNA 5CDGA 7MDHA 1CJCA 1YBMA 3ZU3A 1H9BA 4BGVA 4EITA 1H9AA 1I2CA 3CE6A 5BT9A 3RIHA 4AJEA 5AXDA 4TRNA 1IZ0A 1LXCA 4OOFA 3SC4A 1Z7EA 3D3WB 5A9RA 2P9CA 4BGIA 4XIYA 1O94A 5L7WA 3F1LA 3L4SO 3JQBA 4TWRA 2HMUA 4WASA 3ONFA 3ETDA 4XRRA 1HYGA 5ICSA 2Q45A 3TFQA 1X1TA 3DAGA 4J4BA 5IXSA 4IIVA 4GX1A 4WKGA 4IXTA 3A4VA 4DQXA 4CMIB 1ENOA 3FD8A 5F1KA 4PLYA 1V6AA 1RPNA 1QV6A 1NVTA 5A5FA 1YOVA 4ONEA 4GX5A 1B14A 3TZ6A 4IY1A 2WWRA 3VDRA 4OSOA 3OBBA 4B4WA 2EERA 3D64A 4P8RA 2O3RA 1PWXA 4FJ2A 2VT3A 1N7GA 5F1OA 4YAKA 4EYEA 4E33A 4GH5A 1SMKA 1YDWA 1DC3A 1XGKA 5I9MA 1MP0A 3OA0A 1VSUA 4MO2A 3W8FA 4PZDA 3GA0A 2B5WA 3LT4A 1X13A 1V0JA 1F0YA 2PZJA 1FXSA 3C7AA 3K96A 4YDRA 3HDYA 1OBFO 3KOUA 4R51A 1WDMA 2YV3A 1ZK2A 4L76A 5BNFA 4Y6SA 4BIIA 4GKBA 4ROSA 1E6EA 1OI7A 2AA3A 2HK7A 1UP7A 2H1SA 2XF8A 4R41A 3PHHA 2BI8A 4GVXA 5DOZA 1U7HA 4L75A 1GUYA 3TRIA 2RIRA 1YL6A 4MVJM 1EK5A 4J0EA 4QUKA 4YT8A 3KB6A 2BFMA 3DBHB 1Y7TA 2HKIA 1P77A 4H15A 2O2YA 4YXFA 1IB6A 5FEUA 3TPCA 4DPLA 1I5RA 4CV3A 2BFOA 2EP7A 1B8UA 4FFNA 4IDAA 2I76A 1VL0A 4TZTA 4F3YA 5BNTA 4YCAA 1EZ4A 4FFPA 3FTNA 3RU7A 3UAGA 5A4DA 1AXGA 3LDHA 3H3FA 3A06A 3MJVA 1UAYA 1DJNA 4LMRA 4UEOA 2VHWA 4BNKA 1Y5RA 5JSFA 2QX7A 3FNFA 4F46A 2GZ1A 3Q6IA 5IJZA 4O0LA 2EG9A 4YPOA 4O59O 4JQCA 1VRWA 2Q3EA 2ZB7A 3KEQA 4YJFA 3E6AA 4TROA 1D7OA 3OMLA 3OJ0A 4H3VA 1JTVA 4OM8A 5G0UA 4ZQHA 3WNVA 3GVPA 4KDFA 1YKFA 2Q4EA 5KIAA 5IN4A 1C1DA 5IDWA 3AUSA 2NM0A 4PVDA 1DJQA 3WGQA 4B8ZA 4XR9A 3OQ6A 5JBIA 3DEYX 3JQGB 4G81A 1YL5A 2W2LD 3QW2A 2Q1SA 3X2EA 4ND5A 3FN4A 1P45A 2QYSA 3HN2A 1ZK4A 4IGFA 3PLNA 4TMFA 1NXQA 5MGBA 5AVOA 3INGA 1AHIA 2PZKA 4BNUA 4ITUA 2A35A 1X15A 3JD0A 3DDNA 4U8GA 4CMCA 1X1EA 4CLOA 1BMDA 2HLPA 1JVBA 3GHHA 3UGKA 3HADA 1H93A 4E13A 3ZW9A 1NPTO 1F17A 3H9QA 3RD5A 1XCBA 5A5EA 3DHYA 4II2A 1PJLA 1U3WA 3UVEA 2PGLA 1P0CA 2O4CA 4GBJA 3KUXA 3SBOA 3COSA 3O38A 2CSUA 3DOJA 3Q1LA 4E2YA 2NVUB 4DIOA 1A4UA 2V6MA 4OOEA 2X86A 1IPFA 5DDIP 4YRBA 4J90A 1GAEO 1YL7A 3JYLA 4E5YA 2EXXA 5T6BA 3VH3A 3I6IA 1QYDA 4RZHA 4Q3AA 4BUCA 4CLHA 1LDYA 1JKIA 5CG1A 3FNEA 3I52A 4RLHA 4BO3A 2IODA 2PKQO 4P4NA 3GRPA 3W4KA 2EHDA 4B4OA 2C59A 3GFBA 3JQFC 1EBUA 4FGWA 4J49A 1PS0A 2XXBA 2DLDA 3NJ8A 2H6EA 3RUEA 2AQHA 1SBYA 1NYTA 1YBAA 1B15A 4RVDA 4OL9A 1GTMA 1GZ3A 3PJGA 4R9RA 3RUIA 4YB8A 3GAFA 3SX2A 5DN9A 2FN7A 4CLDA 3NGLA 1YB1A 1YB5A 3UCXA 3E9NA 1GZ6A 1E7YA 3DBLB 4O5OA 5AYVA 4CODB 5HA5A 2ZQZA 1Q0QA 4HNGA 4K6FA 3VKUA 2JKVA 1LLUA 1F8FA 1UH5A 3EC7A 5TT0A 2F00A 3H8VA 3IKVA 1SEPA 4CM1A 3PI7A 5ER6A 1TT7A 5JCJD 4BNFA 1BSVA 3AK4A 1ZMOA 1GL3A 3FPLA 3HZZA 4CLRA 3RU9A 4KQXA 5K1SA 3EVNA 4BNWA 3KEOA 1H2BA 4A03A 3BMOA 3HB5X 4YYZA 2HRZA 4YJGA 4ZQEA 4BO5A 3GN1A 4ZRNA 3CMMA 4JP3A 5HRUA 3C1TA 2D3TA 2NUAA 3MZ0A 5TX7A 3JQ7B 3IJPA 4PG6A 2X0IA 1JQBA 5FWNA 3JQ8A 4CQLB 4CR6A 4R9SA 4WEQA 4KUHA 1RM4A 3CIFA 5BSHA 1HE3A 3GZNB 2FPPA 4MKXA 5DT9A 2D0IA 1I2BA 1K3TA 2P4QA 3Q2IA 4OIMA 3DL2A 4ZGWA 1H6AA 5A06A 2Y68A 4ZA2A 3MEQA 1LRKA 3EZLA 4YAGA 4NBTA 2DU8A 1CIVA 4FB5A 2VWHA 1U7TA 2DC1A 3I9LA 3WG9A 4E31A 5G2OA 5KNLA 1VM6A 2XXJA 4O1MA 4DUPA 4XRGA 3JQEA 4OSPA 3NDJA 3RI3A 3JYOA 3W6ZA 4CMIA 1ZSNA 4J9UE 1PGPA 1LU9A 4XGNA 4WPGA 4WLVA 1YQGA 4J3FA 3ZV5A 3ZCXA 3K6JA 3WFIA 3WWYA 1B7GO 2B37A 3OIGA 4QECA 2W98A 4UVGA 2FR1A 1MUUA 4YQZA 2AG8A 1R0LA 4JBIA 1EK6A 4ILKA 4FJ0A 3KYCB 2OZPA 1GYRA 5HBRA 1B0AA 4JJGA 3RVDA 1K6JA 5A9SA 4FDAA 4PLCA 3AY3A 4JCOA 2C5AA 1MC4A 2VRCA 4UVDA 1IE3A 1KY5A 1JAYA 3UUWA 2VHXA 3ON5A 1L7DA 4QSMA 4FFRA 3GUCA 4CPDA 5ICMA 3VTZA 3VH2A 2FOIA 2B83A 4TVBA 1YQXA 1L7EA 2JAHA 2AQIA 1GU7A 3KYDB 4HV4A 4QO8A 3U9LA 2D5AA 3JD3A 3KBOA 4TKMA 3GPDG 3QE3A 4Q3DA 2VHVA 1YRLA 4OAQA 1ZZEA 4AG3A 1UDAA 3JQDA 2YY7A 1R6DA 4B79A 4J1TA 3AI1A 1MB4A 3DFZA 2EWMA 3PGXA 3ZI0A 5HM8A 2B4RO 3V5NA 1R4NB 3GDGA 4XDZA 4BNTA 3MTJA 1YO6A 3ZU4A 2D8AA 4L0QA 4H7PA 5EJ2A 3UH1A 4YAIA 5A1TA 4PLWA 1EDOA 5EERA 2UDPA 4IQ0A 1FDSA 4J16A 2NVBA 4F45A 1E5LA 1AGNA 1BVRA 1MFZA 2Z1MA 4W7HA 3EYWA 3UCEA 1SOVA 5AOVA 3ZHBA 2QYTA 3S8MA 3DMYA 4LGVA 1ONPA 4XDYA 4XQGA 1KVQA 4U0JA 1RJWA 3ZNQA 1I32A 3IAHA 2FPGA 2BFPA 1A71A 1DC5A 2Q50A 2BD0A 3RUAA 1T2CA 1U8XX 2DTEA 4IM7A 3WGHA 5BR7A 4R68A 3PLRA 3VC7A 1EEHA 1EFKA 3AUTA 3OJOA 1WP4A 1E7QA 2B35A 4Y98A 3KSDO 2YDXA 2OP0A 4K26A 4BNHA 1H94A 3JQGA 4FR5A 5JW6A 1N9GB 3IOYA 4CQMD 3RASA 1K2WA 3S2FA 1E3EA 2VOEA 3ONEA 1PIWA 1V3UA 2BGLA 3NTOA 1AUPA 3CZRA 2B5VA 2A94A 4OXNA 1UXHA 3STHA 1A27A 2FRDA 2POQX 3VVCA 3VPHA 2ZTMA 4B7XA 3OQ1A 3EK2A 5C3MA 3TF5A 1VSVA 1W8DA 4D44A 4J0FA 1LA2A 2GLXA 5T64A 1YOVB 1QP8A 3VZPA 1Q7GA 4HY3A 2CVZA 2R00C 2BH9A 1DAPA 2EGHA 2ZK7A 3IS3A 1KEWA 1LX6A 5JO0A 3FSRA 2HAEA 1LEHA 4RDIA 1GQYA 1LC3A 3D1LA 1X0VA 4NK4A 2EP5A 3NKLA 3FTPA 3U49A 3WSVA 4M87A 3GN2A 3D7LA 2W2KA 2EJVA 2NQTA 1HWYA 4OKIA 2UAGA 2GERA 2V6FA 3WJ7A 2JD0A 4NBWA 2GN8A 2J3HA 1KERA 2GASA 4MVJD 3OIFA 1DOHA 1DLIA 2O2SA 3V2HA 4D46A 4PN3A 4JLWA 5JAZA 5MDHA 1C3VA 5LCXA 4QTZA 3IL2A 3VH4A 3F47A 2O3QA 4YACA 1O5IA 1UDCA 1KIFA 4D3DA 2EGGA 1ZKMA 4LSMA 3H9UA 3PFWO 1NNUA 3ZWMA 3GNTA 3JQAD 4W6ZA 3MCVA 4UEKA 3GG9A 3INTA 1C0IA 9LDBA 1LDNA 1QXSA 4UUMA 4YAJA 4E3ZA 2H5LA 1ZMTA 2DQ4A 4ALJA 2IE0A 1UP6A 1NQ5A 2DBRA 2ZTLA 3VAZA 4AJHA 4GQAA 1A5ZA 5KOIA 4J7UA 4B3JA 4CM5A 3BTSA 4YWJA 4NR0A 4MDHA 2GRAA 3ENNA 1E5QA 3P2YA 5LDGA 3L9WA 4ZQBA 3ZNNA 5G0TA 2WMDA 4J43A 3ENKA 2GNAA 4MPDA 1R15A 5TJHA 1O6ZA 4CL8A 4YJFB 5TGDA 4KMSA 3IP3A 1KY4A 2GZ3A 3NTRA 4MP8A 1P1FA 4W99A 1VLLA 4CM6A 4CQLA 5JYEA 1LSSA 3QRWA 1VE9A 2Y1EA 4RVUA 4CMEA 1LDBA 4GWKA 1H5QA 4BOYA 3GZNA 1XR3A 2VYVD 3PJEA 3QJ5A 1LLQA 4WUVA 4YVFA 1DIAA 4XYMA 5T8KA 3WGIA 2I67A 1VC2A 4NQZA 4LCEA 3GVCA 1XU9A 1DB3A 1QORA 3H9GA 2CVQA 1HYHA 4D0SA 1C0KA 1R4MB 4IDFA 4IS3A 4N54A 3V1TC 4FSHA 4KZPA 1HDYA 3V1UA 1FMCA 1B8VA 2PZLA 3GOHA 4OJNA 4BNMA 2B69A 3GK3A 3ZHXA 4ZJUA 4IJUA 3ICCA 3UFXA 4B3HA 1KVRA 1ZFNA 2DT5A 4Q9NA 3I1JA 1NWHA 2CF6A 4XQCA 2VTDA 1ID1A 3ADOA 3S1LA 5JMPA 5JC1A 1RYDA 3DHNA 1LSOA 3C1AA 4BNYA 4OXKA 1K0UA 2W8ZA 3RC7A 3DAFA 1DIGA 4TRMA 2FZEA 1WPQA 3WGZA 3OFSA 2YHIB 3O26A 4E6PA 3MWEB 3PWKA 3IC5A 5DOVA 3WFJA 1ISJA 2C82A 1G6KA 4ESOA 3LT2A 1O8CA 4B8WA 2Q1TA 2HJRA 3EY4A 2O7QA 2X9VA 1LQTA 4RVFA 2VWPA 2RH8A 4PLZA 5L40A 1B8PA 3F46A 3QWBA 1FDTA 2AG5A 3K8ZA 1NPDA 4BO7A 1KVTA 1D4FA 4PG7A 1V3VA 3MJTA 1UZLA 1ZH8A 1W4ZA 3KYDA 4W7IA 3W6UA 3V8BA 4RL6A 5J23A 4XCVA 2YZ7A 5ILOA 3Q9NA 4LISA 4PLFA 4IUYA 2DBVO 2W2LA 3PQFA 1NAHA 1E6WA 5IXYA 1TVEA 3JQ6A 1QSGA 3TNLA 1Y8RA 1CF2O 3DOOA 1E3JA 3WYEA 2QIOA 1E7SA 2J8ZA 2JD2A 4CR7A 3IKTA 2IEDA 3IUPA 1M6WA 1R4NA 5TT1A 1ZW1A 4ND1A 4CLRB 4CUKA 3ICPA 3BTVA 4L73A 1Z82A 4Q3CA 1XYGA 1ONOA 3HNPA 3K73O 1TA4A 2QRLA 3PYXA 3CUKA 1GYPA 1TB4A 3CH6A 4HFNA 5CDSA 1T1RA 3OIDA 1I2ZA 4WLEA 4QFCA 5THKA 2B0JA 2R00A 4CUZA 4W9NA 1MG5A 2VHZA 5EQFA 4YJGB 2JHFA 4CMBA 4IIUA 3QVWA 3EGOA 2BMAA 1PX0A 1HDCA 1XG5A 4CLEA 3IDSA 4IDCA 3RCBA 3PZBA 4DRYA 3JYPA 3QVTA 5I9NA 1SO8A 5T67A 1PQWA 5FYDA 1UZNA 2A9FA 5I9LA 1PS9A 1I24A 1T4DA 3HUDA 4YT5A 2PKRA 1NVGA 3DZFA 4A10A 4GMGA 3WDSA 2C7GA 3WOHA 1P1KA 5ER9A 1Z74A 1N9GA 2UUOA 2XPCA 1GUFA 3QWAA 4I1IA 4QQRA 1PJ4A 1JAXA 5L7YA 5I8WA 1GFSA 4BQPA 1GD1O 1Z6ZA 3A9WA 3PIDA 4BNZA 4KUGA 1OC4A 2BELA 3OQBA 2Q2VA 4R3WA 5DCUA 3MOGA 5H82A 3DONA 4BO1A 3AUAA 4DLAA 4ND4A 5JXWA 2ZYAA 4RF2A 1PZHA 1ZEJA 2CFCA 2NLOA 2Q1UA 3G49A 4ZVVA 3S2GA 1IL0A 3JQAB 4R69A 4ALLA 4DL9A 4DWVA 1B3RA 1TXGA 3I5MA 3LVFO 2Y66A 4I08A 3RFTA 4EJMA 5JCJA 3C8MA 3PQDA 4M89A 6LDHA 4NZ9A 3WGYA 3E5MA 4I9UA 1G1AA 2EIHA 2QW8A 1AN9A 3B1JA 2C2YA 3GDFA 1NVMB 4UEJA 4NMHA 2GN6A 3NGXA 5DP2A 4EUHA 1Y6JA 3L4BC 3K5PA 2WE8A 5A9SB 3T4EA 4WCDA 3DR3A 4NK5A 1XA0A 1UAGA 3AJRA 4IPTA 3VTFA 5JC8A 4J91A 4ZD6A 5GZ6A 3H4VA 2UUPA 4NDNE 1CWUA 1WMBA 4Q3EA 5JDCA 1BXGB 3GF4A 2BLLA 1R0KA 1ZSYA 4C7JA 5L4SA 1E3WA 4TZKA 4IS2A 3R3JA 3LSYA 3GY0A 4XYEA 1HETA 3ROKA 2ZJ1A 1PJBA 1XIVA 1XELA 1GV1A 3L77A 2ZQYA 1U4OA 4KOAA 3RC9A 1LSJA 4EZBA 1IUKA 3ZH2A 3WQQA 2FZWA 3ZU5A 5JY1A 3DBRB 2WE7A 3HQ4O 2NNLD 2CF5A 2PH3A 3DZKA 1Y5MA 4TSKA 3D5TA 1R12A 1SB8A 1SB9A 2A4KA 3HFSA 4RPJA 1TI7A 3SEFA 3DZHA 1H6CA 4HP8A 2RHCA 2CDBA 1VKNA 3RKUA 4PIVA 4NBUA 2RBEA 4BO2A 1QLHA 4DA9A 2RH4A 4AJLA 4B4VA 4M86A 1T4BA 1P1HA 3LLVA 3AY7A 4N7RA 1NBOA 3WR5A 3UICA 4YRAA 4A27A 1W0CA 4N18A 1SZJG 3H5RA 3KZVA 5CDYA 1H6DA 3ETGA 2Q49A 2X0JA 4J4HA 2WSBA 5TRTA 4NU5A 3WBFA 3PP8A 1ZK1A 4RGBA 4NFHA 1OMOA 1QMGA 4P4GA 1YB4A 3AI2A 3BMNA 1IYZA 1LUAA 1N8KA 4BKOA 3ANMA 1O89A 1TLTA 3IQDB 4IJWA 4KP7A 4BMSA 3D0OA 1Q0HA 4AL4A 3AOEA 3RUHA 1GQ2A 2X5JO 4A26A 5KVVA 1DDOA 3F9IA 2JHGA 1C0PA 4Z0PA 2X0RA 2IZ0A 3F4LA 1DRWA 1E1KA 1ADGA 1NFRA 3E18A 2AQ8A 1N7HA 2ZB4A 1KBZA 4L4SA 1H2HA 4PRLA 3VPFA 1L1FA 3H5NA 3ASVA 5EIOA 3ZNOA 1RYEA 1PU2A 1R4MA 2GYYA 3PDUA 3U0BA 2CZCA 4I5FA 2YFQA 3WYCA 3DFUA 1NTOA 3W4IA 1ZEMA 2PD6A 1RM0A 2X58A 5I7FA 3M6IA 1NWCA 4ZU3A 3BMQA 1O95A 3FR8A 3V2UA 4ZRMA 3GFGA 4NPCA 3JYQA 1B26A 4B4UA 2YDYA 3FCOA 5C7OO 4XQEA 1S6YA 1SC6A 4RF3A 1DIBA 2I9PA 2PV7A 3WGOA 1A7AA 4F6CA 1WMAA 2OMEA 4DC1A 2YHIA 4RJTA 1PQPA 3KRTA 1C1XB 4DPMA 5KJEA 1GEEA 5T5QA 1VPDA 3GPIA 1AE1A 2VTEA 4PG5A 4WCFC 4XA8A 4GX0A 5FF9A 4DLLA 3WTBA 1HDGO 2FWMX 2B4QA 2W2KB 4FOOA 4I5GA 1DPGA 4PZCA 3OJLA 3SXPA 3HDJA 2WDZA 1IOLA 1E3SA 1AHHA 1EDZA 1JWAB 4R01A 2GPTA 5AXCA 5K6AC 1ZJZA 4XQ9A 2SCUA 1GZ4A 2J5QA 2EW8A 5ITWA 4N5MA 3S55A 5BSEA 1M75A 1P1IA 1U2GA 3PHJA 4FOSA 3WGGA 3L9XA 3ZHYA 3GNQA 2Y99A 3H9JA 2GN9A 2JJYA 3ZWCA 4D7AA 4CQMA 4AJJA 5IF3A 1E7RA 4J7XA 5JDIC 3FHLA 5CPFA 4WGGA 4P4LA 4LRSB 2DFVA 3I23A 4BNGA 3GR6A 3R1IA 4AJ2A 2IXBA 2Y1CA 3CXRA 3NJ4A 3QVXA 4XX0A 3LK7A 2OFPA 5JS6A 3KSUA 4S3MA 4CMGA 2HK8A 1LJ8A 3NUGA 4NIMA 5EESA 2FP4A 4NJOA 3RBXA 2EF1A 3F5SA 4RQTA 2ZCUA 1WW8A 3OA2A 4JX8A 3RFVA 3AU9A 1PJTA 5FI3A 2Z95A 4WOJA 4UUOA 2JD1A 2DKNA 1VL6A 3MOIA 1DO8A 1U8FO 3OJFA 4AJ1A 2O3SA 5COBA 3VOSA 3KETA 1G0NA 1SOWA 1U3UA 2TMDA 3L6OO 2G0TA 4KUEA 4DLBA 3D3EA 2JAPA 3DQPA 3H3JA 1W6UA 1S7CA 3OICA 3E48A 4PVCA 1BXZA 2X8LA 2ZTVA 3L4BA 4ZQGA 1NQOA 1MXFA 1SPXA 1T25A 1XSEA 4HFRA 4PLTA 3UN1A 2VCYA 4NFYA 1EUDA 1X7HA 3NTQA 4S1VA 2AEMA 1ZJYA 5TQVA 4MVJA 1E77A 5F3RA 4OMUA 5KKCA 1JKFA 3NX4A 1HLDA 2OBYA 5C7LO 3D4PA 1D1TA 2HQ1A 4ALMA 3ROMA 2AHRA 3ST7A 4IXWA 1A7KA 1NHGA 4DTIA 3ZWVA 2C54A 2BGKA 2Q1WA 2DAPA 3JQAA 4JK3A 3MJCA 3OF2A 1PJQA 3RSHA 5CDTA 1GCOA 4M49A 2B36A 3QIVA 3V1YA 4I5DA 1PR9A 2VUUA 1M2WA 1SEVA 3MTGA 3QY9A 1NR7A 3ZV6A 4D79A 3VVBA 5CAEA 4MVJF 1W73A 1E1NA 3ADPA 2YQ5A 3QVSA 2WEKA 1HTBA 4BB6A 4OH1A 3BMCB 4BKPA 4P22A 4WLFA 3LT1A 5JPIA 3PWSA 4CM9D 4GI2A 4BO9A 4LSWA 4IZHA 4E4YA 1ENZA 1BXGA 1GUZA 2P4HX 3KYBA 3NAQA 4WK6A 4GGOA 3L0DA 2H9IA 1EVJA 3RROA 5DBIA 4IZIA 1GPJA 2G5CA 1KETA 2QZ9A 4XB1A 4E5PA 3D4OA 5TS3A 1LBEA 3ZWPA 3FR7A 2VYVA 3DBRA 5IG2A 5CEFA 5L9AA 3ZGYA 1I01A 2PNFA 4FGSA 3GHYA 3I9MA 3GGPA 2PA3A 3RBZA 1ZO8A 4Y6RA 1K89A 2OHXA 1Y8RB 8LDHA 4Z9YA 4LCJA 4BGUA 3QWFA 4L9RA 2Y0CA 4M1QA 4BO0A 2VWQA 4J4TA 2R6JA 1FDWA 1K5HA 4BO4A 2OOSA 1U28A 1WZEA 4C4OA 5DZSA 1DLJA 3MJEA 2UV8A 5CHEA 4YRDA 4CMHA 1K6XA 3WQSB 2BKAA 2VYND 2ZCVA 9LDTA 4DGSA 2PZMA 3ZNPA 4B3IA 3WWZA 1E1MA 1FF9A 2DTXA 2CDAA 3WLEA 2EKQA 2V6GA 1EMDA 4CMKA 5TF4A 3ZHZA 1E6UA 1R66A 3DZBA 3GGOA 5JCXA 4Z0HO 4EJ0A 1BTOA 1PR3A 2Y1GA 3RUDA 1LLCA 2EV9A 4DYDA 1ISIA 4LW8A 1GCUA 4JJFA 7ADHA 5DBGA 3TZQA 1VL8A 2BFAA 2XOXA 1R0SA 4J1NA 2ZJ0A 4ALIA 3GVHA 2C7VA 1EUZA 4BV8A 2Q2WA 3Q11A 2NV6A 3PYMA 1N1EA 4CV1A 1HL3A 3JQFA 4U0KA 5EN4A 3OH8A 1T24A 2X4GA 1BDBA 3NT4A 1PGJA 2Z1NA 3T7CA 3IMFA 1GPDG 1A9ZA 1BG6A 1F12A 3PVZA 3F1KA 3EHEA 5JYDA 3GAZA 3OP4A 3CSDA 3F5QA 2EW2A 3ZN2A 4BNXA 4D0RA 4WEOA 2R2GA 3WICA 2AW5A 2VUSA 2JL1A 5L51A 3U09A 5B1YA 1F06A 2HRBA 3Q0EA 1HE5A 1NP3A 3SJ7A 3PHGA 2VZ0A 4AJNA 5TLSA 1HSZA 1WLYA 2ILTA 3JV7A 1MX3A 3DBVO 3F3SA 4L4RA 4BKQA 3QVOA 4TQGA 1TEHA 1ISHA 4Y8VA 3H5AA 1PZFA 1DXYA 1UXGA 3I6QA 3PJDA 4LMPA 5TSDA 4CMAA 3KVOA 3LC7O 3B1FA 4IQ8A 4W82A 5KTKA 1C1XA 4UVIA 1P44A 4Z3KA 1J6UA 2FPIA 1Z7BA 4HKTA 1DSSG 4EEXA 3AI3A 4HXYA 3E82A 2DPGA 1ZK3A 1E3WB 3M1AA 4K1LA 4E2ZA 4Y67A 4ID9A 1KVSA 4INAA 2ZTUA 4MVJP 5L4LA 4R1TA 1CETA 3ASUA 4CV2A 2PR2A 1ZBQA 4BNLA 2HMWA 1NAIA 5KJCA 1WDKA 1CYDA 1H6BA 3EUWA 1EE9A 4YBZA 1MV8A 1LLDA 4I9NA 6ADHA 1V9LA 1D8AA 3OECA 3WYBA 5BQFA 1SAYA 3AY6A 1GQQA 1EVYA 5GZ1A 1TT5B 1NM5A 1XKQA 3PHLA 2I99A 3TJRA 2FMUA 1GEGA 2Q99A 2V65A 4CJXA 5TIIA 1J0XO 1P0FA 3TN7A 3U4IA 3FRJA 3G0OA 3R0IA 4FQ8A 3PQEA 3ZWBA 4RPLA 3P2OA 4AFNA 4WECA 3H7AA 2O7SA 1HZJA 1JA9A 2BI7A 3B70A 1JKJA 3B6ZA 1XLTA 4NJMB 5AQ1A 3QQPA 3PYLA 4KWHA 4JJIA 3GUYA 1QG6A 3F4BA 4ND2A 4RF5A 4XYGA 4AICA 3I9KA 2FY8A 3E5RA 3DO5A 1C14A 3UCFA 3F6YA 1YJ8A 3AWDA 5BNIA 2O50A 3W8DA 3BMNB 5EMHA 1XEAA 5H83A 4E0BA 4EI2A 2X9GA 4FIZA 1DFHA 1MLDA 2E82A 2ZATA 2X5KO 3FNGA 3S2EA 3LLSA 2O48X 1V3TA 2QQ5A 5TNXA 1HE2A 2FR8A 2BF7A 2NSDA 1NPYA 5IN5A 1OOEA 2NQ8A 3WQRA 5K9ZA 4IMPA 4Z9FA 2QG4A 1B2LA 3QSGA 4WLOA 4AVYA 1ZXLA 2QRJA 5IZCC 3NT2A 4J1SA 3RC1A 4MOWA 3R6DA 4TVOA 5L4NA 3KO8A 4JN6B 2PGJA 5FFFA 1I36A 5LC1A 2J3IA 4UULA 4K28A 3HN7A 3AUUA 3U62A 5H81A 4D42A 3BMQB 3JD2A 4FFMA 4LK3A 4Z0TA 1IHXA 2AXQA 5JNLA 1P33A 4J9VA 2DPHA 4BO8A 1FDVA 3CPSA 5A03A 2VZ9A 3S2IA 3ETEA 1JLLA 2I5PO 2NVWA 3JD4A 3CEAA 1I8TA 2NWQA 1YE3A 3ZU2A 2YJZA 1HDZA 1LI4A 4YA6A 4I9HA 5IFLA 3K92A 4YJHB 3CINA 3RFXA 1WNTA 5L7TA 4FC6A 3BMCA 3UHAA 4ZQFA 1GR0A 1HXHA 5G4LA 1A9YA 1C0LA 1GY8A 5CPBA 5CP8A 2HK9A 3PWZA 1P9LA 3TQHA 4NBRA 3BHJA 4WLNA 1GADO 4NG5A 1HDXA 4EUEA 4GWGA 2AEJA 4KTVE 4LVUA 2X9NA 4DIBA 4GLOA 2NTJA 4IMRA 4KWIA 2VQ3A 3TFOA 1O0SA 1JVSA 1PZEA 2DVMA 3Q2KA 1ZIDA 1Y8QB 2UVDA 4WOKA 3QV1A 4RQUA 4AJ4A 4CQMB 2IXAA 3RUFA 4E21A 4A0SA 1B3BA 1ULUA 1U4SA 4D3SA 5KWEA 3CZMA 3RKRA 2IZ1A 1WZIA 1LC0A 1BGVA 2FR0A 1P1JA 2P2SA 4CM8A 4HWKA 3EZYA 3E9QA 1HKUA 3HJAA 1XWFA 4PLGA 1PTJA 4XWYA 5KVCA 2P91A 3DWFA 5B4TA 2FSVA 2A92A 1UXJA 4DBVO 1ADCA 2Y1OA 3NDRA 3UW3A 4D3FA 4I5EA 3TWOA 4PCVA 5I7SA 1XU7A 3HWRA 3KXDA 1E3LA 4WJZA 2NU6A 2RAFA 3HSKA 3R3SA 3HE3A 1LTHR 2C20A 3NRCA 4A7PA 2C29D 1PEDA 5FI5A 4RDHA 4OYRA 2JCVA 4IGEA 3HDHA 4DMLA 4D43A 1EBFA 4AJPA 4YAEA 1HRDA 1OZAA 4LN1A 4X54A 1KEVA 3QWHA 1QYCA 3C85A 3WMXA 1EVIA 3RJ9A 4ALKA 4G5HA 1ULSA 2NTVA 4XJTA 1F14A 3OEYA 1O9BA 5GY7A 4CM7A 3U4CA 4JBGA 4QXMA 1ZNQO 3LF2A 3ZDFA 4MIEA 3VPGA 3BHIA 4DVJA 5B4VA 3JCZA 1PJSA 1I30A 3W4JA 3E03A 3OM9A 4I8XA 1N92A 2QHXA 1NR1A 2JFHA 4GLLA 1LDEA 4IQGA 3M2PA 2WYVA 3SLGA 3K30A 4OO3A 3TZHA 1PS8A 1NQAO 4RPHA 4JP2A 1YS4A 3ROQA 3OJEA 3VPXA 2GDZA 3AOGA 1KVUA 1ADBA 2D2IA 1ISMA 1SCUA 4CLXA 1HDOA 4IDGA 3KLPX 4RORA 4RPGA 3ZW8A 1R16A 4FC7A 5KJ1A 4RZIA 4MIOA 3A14A 3O8QA 4RVSA 2I66A 3AU8A
chains in the Genus database with same CATH superfamily
1ARZA 3MBKA 2PT6A 2HMTA 4QGBA 3EB9A 1QTQA 4QOSA 1A3CA 1YS7A 1WCYA 2ZB8A 3L7IA 4GEKA 2IYFA 2H08A 2JCGA 2J67A 4ZAGA 1Z2AA 4MGIR 3CUWA 2PH5A 4Y6LA 2EGUA 3SSNA 2WYOA 3WRWA 3KB1A 2OXIA 2XVZA 3VZSA 1XDWA 3RQSA 2IF0A 3CHYA 1FK8A 4QARA 4Y18A 1CY4A 4KYUA 5HCIA 4BLOA 2HSDA 5IDQA 5LNK1 1M72A 2IEGA 4F7DA 5B57C 4XGQA 4ALNA 5FUMA 4L0CA 3SCZA 3P1JA 2V4MA 3OHSX 4IRUB 2QLBA 4GKAA 4MKRA 1XCLA 1NP7A 3MINA 4PGHA 5B7GA 4DA0A 4MQLA 3DZCA 5AK0A 5AVWA 2PSHA 4JA2A 3VSCA 2NT3A 1SUBA 2NW6A 4A3SA 1UP4A 5JVDA 1WY5A 2F3TA 8OHMA 1IC6A 2X1HA 4GC5A 1WDLA 2F6RA 5KSWB 4PWZA 1RIIA 2JFFA 1KEZA 3BHMA 2QD5A 2DUWA 3CLKA 1QTIA 3JQRA 4M9SA 5K2OA 3FI9A 2ANBA 3TL3A 1QGUA 3F49S 3FCYA 4MB6A 4DKJA 4BLPA 3H86A 1P31A 4I50A 5T57A 3L8MA 1XJ5A 3VI4B 5D86A 2J3KA 3ZBTA 1GZUA 3C6QA 3MD0A 4OBEA 3A3KA 1OX5A 4DIFA 2QSZA 1JJBA 2D0PB 3V8PA 2I3BA 3HYRA 4DBLE 4A15A 5EHXA 3VPSA 3T0IA 2ZE6A 2PRYA 1NBAA 2HRDA 5JBNA 2C95A 5DI9A 5FI0B 4C5AA 2HTEA 3E15A 5HOQA 4Y9UA 4IP0A 4BU1A 4BAUA 4IDDA 3LLMA 1Z3IX 2F4NA 5KJ6A 2AN5A 4E88A 4PAQA 3V4PB 3EAGA 4YJDA 4BFWA 1YJAA 4ND3A 3GPLA 4N5LA 2ZUDA 3LUJA 1NP6A 5T4EA 3N2LA 2BFBB 4AKGA 3FWZA 1E8NA 1XRSB 1XJQA 3GJ8A 4NYIQ 2XAAA 4C43A 5JVDF 1FUUA 4FW8A 3W5HA 1P3DA 3RK0A 3N2IA 2GAAA 1KI9A 3Q7SA 4BQQA 1JDTA 3R8CA 4MQBA 2D2VA 2PQ0A 1M6HA 3TTVA 3E27A 2VKTA 1OBHA 1L4KA 1R8QA 2GBLA 3QQ5A 4NCJA 2G07A 3KDSE 4G65A 4RAOA 1Y81A 3IEXA 4G23A 5IWAB 3OURA 2I65A 2ILVA 4G5SA 1IHUA 5CFZA 3TZBA 1X7WA 4R5HA 1IN6A 2RGWA 3ENZA 4FJ1A 3IIEA 4Q39A 1FJHA 2PLNA 1V3QE 2I6TA 1P2GA 4KQ6A 4MP3A 3HB9A 4WN9B 3IR5A 3PX3A 2J3JA 3KR1A 5B7QA 4AZ3B 1VXOA 1ZL0A 1Q0SA 4YR9A 1B73A 1ZUD1 1ZOSA 2TRSB 1N6RA 2VSNA 1H05A 1XMIA 1BFUA 3HCWA 4IH9A 5THQA 1F2DA 3BJMA 2RGNC 4ITRC 1DRUA 3PJFA 3ZGOA 2XCIA 4JBHA 4KQ2A 4MB0A 4G1UC 1PR5A 4TQ9A 2BHLA 5CT9A 3UPTA 4FMDB 2FZ5A 2QYHA 5C18A 1WCV1 2WILA 2J0VA 2GGSA 4MVJI 3DLAA 4W7SA 2FK7A 3TM5A 2XMBA 3THYA 5JH7B 1E2NA 2TMGA 2FPIB 4LF7B 4BJ6A 3UTCA 5KU1A 3DLPX 3A4NA 3VKFA 3ZZTA 1MIHA 5HF6A 2F62A 4MQMA 5JWOA 5HQTA 4PGAA 1D1SA 3N87A 2BKUA 4KVZA 1MFPA 5LBUA 5ARCA 5I01A 4PXYA 4Q4AB 3GDHA 1HFWA 1CZLA 3C5VA 4N65A 5A9TA 1G291 3DUFB 1JIUA 2PLAA 3UOGA 3WB9A 4K6KA 5CDFE 5CVDA 2QLNA 3CKYA 1Q95A 2BGNA 4FDLA 5C4IA 4QGAA 2P65A 1BWPA 1T5DX 4XLLA 1U5CA 3AERB 4TV8B 1H2FA 1O4VA 1YWGO 3PI6A 4HXGA 4TLCA 1Q3HA 5LA6A 3NYIA 4JL5A 4QJ5A 1O87A 3T5MA 5I6DA 1PNQA 1PVVA 4J2HA 3GJ3A 3OSUA 5C7IO 3ZUPA 1Z28A 3PNBA 4YQYA 4TTPA 3VM6A 3IOMA 4O2AB 1OFUA 3UB4A 2QX6A 2ZI5A 4XGKA 1RAIA 3HO1A 5BR8B 2MOKA 1N5MA 4M0UA 4QFBA 5GM2A 3OZAA 2DFDA 4DYVA 2DMRA 4II7A 1VE1A 3NJRA 3NS7A 4IJKA 3C3XA 3SZRA 5I7EA 5K4AA 1UEIA 4FS3A 4W5RA 3BRWA 3LTNC 3UK7A 2A1TR 4A82A 3VKGA 1IXYA 4MVJH 2W4MA 4QELA 5JIBA 3NHWA 3G2OA 4WBXC 4OFBA 1VL1A 1KOLA 1JDBC 1BDIA 1WD5A 1JKJB 1A95A 1CUBA 2ZBGA 4HDAA 3LA6A 5FBQB 2Q8PA 2GD0A 3CMCO 1L4UA 3IDFA 4WUTA 2GWHA 4YX9A 1NDQA 4BVBA 1X8KA 4PYKA 4X6XA 4JB8A 2QB5A 5KZMB 1AKVA 1TZBA 3D31A 3PUJA 3NT5A 4NH4A 1FP2A 3FOAA 1KH1A 2VWGA 2VZLA 1DAMA 3STXA 1L5FA 4ECEA 1D2EA 4KR7A 1R0ZA 3ZGXA 4CRWB 3U3XA 2IYPA 2JGDA 3E1KA 3OE1A 1XQ1A 4F85A 3GLUA 1IHDA 4G25A 2NXJA 4JEMA 1YCFA 3BD6A 1HZZC 2X6TA 4KDRA 4R16A 4AY4A 821PA 3ZE0B 3NBXX 3AL0C 5EIBC 2PZAA 1Z63A 4IDBA 5KO2A 3QSYA 1C3JA 1YTUA 1ULZA 1WWKA 3C24A 1ZWLA 1ONBA 4A16A 2Y3IA 4IJVA 1GL6A 3N75A 4RENA 1NRWA 5LDHA 2NTEA 1DAOA 2D4AA 4LZJA 2XE6A 3Q8LA 3K8QA 1FTNA 3H04A 4GGPA 1OWNA 2LBPA 3OPYA 2P0YA 1FQKA 1JDJA 3GC6A 2VDLB 2SBTA 1P1CA 3R0JA 4RGVA 5EE3A 1J49A 4TL7A 5K3DA 4F5YA 5IKEA 4CM3A 2FGJA 1K75A 4AW9A 5DXJA 1PKEA 1JHAA 1EQUA 4OHFA 4O29A 3VR6A 4EY6A 2BGRA 3NOQA 4F6LA 1W36C 4GYKA 3AIOA 5IAAA 3H65A 3UV6A 1Z75A 4KQ9A 2J87A 3RB8A 2JAXA 1FTGA 1QHHA 2VATA 1LBTA 1W1IA 2CUNA 2GUGA 5DM0A 1NONA 4R2HA 5C81A 4PSAA 1T1SA 1U0RA 4IJ5A 3EMDA 4TYQA 1QH9A 5BQPA 2C0PA 1QKIA 4AYTA 3TG2A 1YQDA 4PNPA 3AW9A 5EQDA 1H0KA 2Y6UA 4WNIA 1SCDA 2R47A 4QOJA 4HEA1 3OMXA 4C0LA 5C52B 4ND7A 3IV7A 2Q8NA 4R9VA 4RD6A 1JEEA 2Y67A 3ZX5A 1YASA 3C8DA 5CG2A 3C74A 2WU8A 2P2ZA 1BKDR 4ISCA 3SMQA 3KTOA 3W78A 5HZGA 1DV1A 3OF5A 2BOVA 4E7PA 1P73A 3TRJA 3ORSA 4RF4A 3H4IA 1J25A 3PCTA 1YB2A 3AFMA 3JZAA 2BW0A 2IRWA 2V8OA 3A6HA 1CB0A 1DOZA 1G5IA 1VIAA 2AC4A 3BJIC 3C8UA 4G56A 2GF0A 4HWGA 4CHTA 5L53A 5LQJA 5C80A 2PUAA 1E0JA 2VDWA 3B5EA 1N2JA 1OILA 4OQ4A 4PLHA 1D9ZA 4U9UA 3TLXA 4Q00A 3VFDA 3WKBA 1P9WA 2H57A 4UNQA 1N5DA 2PTGA 3FYTA 4G07A 4NG4A 5IDVA 3LYLA 2VF5X 1WBJB 1ZNYA 1LGYA 1NE7A 4JVNA 4DXHA 1AB6A 1BCRA 1HTWA 3IQWA 3SJCA 1RC8A 2A4MA 3NEYA 1SY7A 3DC2A 3U80A 4B3FX 3N74A 4BL5A 4EG1A 4ZMBA 1TTTA 2PK3A 4V1CB 3L0YA 5ALTA 4G0ZA 3KV3O 1EFDN 4Y9SA 3ZWOA 2MCFA 1L7MA 3WK5A 4PG8A 3IQXA 1B0UA 2F3UA 1QH1B 2FMHA 4N49A 1B2RA 5C1BA 3ZLJA 3O92A 3Q3CA 1KYVA 4K81B 5JLJA 3ITNA 1KZ7B 2DWOA 3LBNA 3CEMA 3RS9A 3G9UA 3SSAA 3C15C 4MV9A 5TC4A 4XJVA 3DNFA 5BQ5A 2WJPA 4JU8A 1RZ3A 3DBHA 1PGNA 1QS0A 1JG3A 1MC8A 2GF9A 3EF1A 4HMOA 4RKYA 2RAPA 3CA8A 1MIOA 1W0JA 2X1LA 1OFHA 4I6JA 1JR4A 2BLNA 4LZNA 3VNRA 3J81A 4UAVA 1Z6TA 1TAQA 4KVFA 2DKFA 1OPRA 1R0CA 2NIPA 3EN0A 1DTEA 3AKCA 4F38A 2B8JA 1XJCA 3OG9A 3OZIA 2DY0A 3VZQA 4WZAE 1D5CA 1R37A 3WV5A 4CDRA 5CYGA 4UD2A 2JLZA 2G76A 4Y9DA 4RZ3A 4US2R 4WCFA 1TK9A 2Y05A 2HTFA 3AR3A 3HDQA 4FXOA 4JVSB 3PEFA 1RKBA 2PEYA 3JWGA 4XYBA 3Q87B 2NYRA 4YP1A 4WHMA 1Y89A 3WKDA 1OU0A 1Q7CA 1YR6A 2JFUA 4KBGA 5AH0A 3WC4A 1RP7A 5AM5A 3BHNA 2YWFA 4AMBA 4BQOA 2X0NA 4EUNA 4ZO7A 2CXOA 5EWLA 5K5EA 2WWYA 4BLUA 1WX1A 4UOZA 2A5FA 3MB5A 4Q37A 1CFZA 5K0BA 2ZRIA 2RK3A 3WGLA 5IM4F 3HH8A 3KYJB 4O25A 2JIOA 3PRJA 4OHUA 2GESA 1SA0B 3RUIA 1PR1A 5ALWA 5JDIA 4RYLA 3HB4X 1OA1A 1ECJA 4R2JA 4WZ6A 4QT0A 4O63O 4W63A 1G1MA 5AM1A 1QRRA 4Y1RA 4MKZA 3QM1A 2ZUWA 4NZZA 4RACA 4C05A 1RTTA 1I9CA 2PD4A 3WTCA 1ZR4A 1Z5ZA 2CMFA 2LDBA 4OHWA 4I1SA 3OFJA 3ZXXA 2W4QA 2VXOA 5BSMA 4CTNA 3IA7A 4M55A 4YTEA 3REFA 4V0RA 4IV0A 5B7PA 4YY3B 1KO1A 1E9AA 4HQFA 3L7NA 3NHYA 4NFSA 1IPEA 1WSWA 3EDQA 3H05A 4OQQA 2ZIXB 2JCXA 1KY3A 3KZOA 3O8QB 4W4TA 2BRUA 1GQRA 2QDXA 3G79A 5F21A 3WMWA 4M0CA 2P7IA 3OZGA 2RGEA 2GR9A 4B6QA 2QP4A 3T3DA 3HXOA 2IQ5A 5JMTA 3DEFA 4EL0A 2HGSA 2OXRA 4J6FA 5K05A 4W9NC 1Q1QA 1H65A 3PGVA 2CNLA 4NMMA 1G98A 2O14A 3RU3A 5LZ7A 5TPZA 4AY6A 2YCLA 2VHCA 2IHNA 1EK2A 2DTDA 2YX1A 1WPRA 1CQIA 3GRKA 3K2BA 4WQMA 5EINA 3TUIC 5A5GA 1XXHA 1LJLA 1T4MA 3FPCA 3SE0A 3SXJA 4EG7A 3LF1A 1BU5A 3PDHA 4PTZA 3GQBB 4CV0A 4M1ZA 1WTCA 4FN4A 5EJ4A 3EJWA 5IT5A 4I66A 3LC2O 2ZITA 3GJ0A 3CX7A 3CVXA 1ML3A 1KEUA 5DNAA 3ER8A 2P2NA 2ZSIA 4MVJE 1KYQA 3MINB 3LYUA 1M5TA 3OY2A 4JB2A 3AIMA 4FOLA 3UT0A 1J0BA 2X2EA 1O5TA 3O03A 1MO6A 2CFRA 2DWUA 2RGAA 1TX4B 2FUEA 3SKVA 3K71B 1FFDA 1UBKS 5JVDB 2MR5A 5AUQA 5ALDA 3OZWA 2G9VA 1K5DA 4H35A 4UM9D 3E8XA 2O5EA 1UBNA 1YACA 3HLKA 4QU0A 4ZTZB 2AS0A 2PS0A 4WNCA 1SIWA 1K7FB 1LV8A 3G17A 3JASA 2XUDA 4BECA 3SKYA 1RYMA 2F9FA 1T3GA 1KI8A 3I83A 3OEWA 4KE9A 3PQ7A 1UWKA 4JS0A 1ZGAA 4E5UA 1XHLA 2HXYA 3D7RA 1AUOA 1CUDA 4KB5A 4XUCA 3G8DA 2VRWA 3L7CA 2FRVA 5KYXA 1SUWA 1GQOA 1ODLA 2TSYB 3Q40A 1AKQA 3QBEA 4MWBA 4REQA 3T4XA 3A28A 1EZZA 3FLMA 4HGNA 5J5VA 4F91B 2QRKA 1QV7A 1G8HA 3BFKA 3MQFA 3E7PA 1QBGA 1K9VF 4XZ3A 2OBNA 3AUYA 5AJXA 1FVHA 4FUTA 2P9FA 4K05A 1TQ4A 3WO0A 5K3FA 5GZ3A 2OGUA 3QXGA 4NNOA 1E4VA 2VK2A 4YEDA 2R4QA 1OIVA 5G3ZA 3CR8A 4B4DA 3QXJA 4HGPA 3GGDA 3GA5A 4V03A 2E4ZA 4LBWA 1WSDA 1I10A 2VRCD 1CNFA 3WXBA 1EQ2A 5D51S 4GMFA 4UNRA 2QTZA 1QPZA 4RHXA 3ANNA 3GD7A 3PHIA 3A2NA 4M1SA 3EBPA 4OXYA 3I05A 4DNFA 3KHUA 3EQ7A 3PXXA 4NCXA 1SCAA 4Q18A 2IPLA 3BICA 2GPSA 4NNJA 5IAOA 2QMUA 4J2OA 1C1DB 3FCSB 3HZHA 2DR3A 4ZAYA 4AULA 3X0DA 4G84A 4X84A 3UAXA 1BN7A 3R3XA 2R1VB 2ZSFA 5C37A 1Q7BA 1DC4A 2QTBA 2XDQA 2YZGA 1DKPA 1MDFA 4H9GA 4UUNA 2LIVA 4F8EA 2QXTA 3T3OA 2QQFA 3W9BA 1ZVVA 2PGDA 3OLZA 2OORA 1B6GA 1BRMA 3GPCA 4E22A 1XZMA 2GUWA 4Z9XA 3H2ZA 4MCAA 1CEEA 4CFYA 5HFJA 3H5OA 2PUGA 5K99A 2P9GA 1C9NA 3CX8A 2CXXA 4CLOB 5SZHB 3ABIA 2B9VA 1QIEA 3CKKA 3DTTA 3X44A 3THYB 3UJAA 3GFPA 3OPXA 2FFJA 4RGYA 4M8LA 4QYMA 5AUPB 1JNYA 1PJ3A 4J1QA 1TQDA 2CLMB 4CM4A 4JMLA 4XIJA 2QX8A 3MAJA 4XYLA 4NRDA 4K9RA 4LRTB 1QGAA 5E6UA 3YASA 2XIJA 5FJJA 1OZFA 3AHIA 3UA4A 1IWOA 1P0PA 3OKPA 2AWOA 4XFKA 1AQJA 5K8UA 1V4NA 1F2VA 3KQYA 4D8YA 2B4TO 3V2GA 5ILGA 4GIBA 1A1SA 3M2TA 1E2IA 4QHSA 4XWOA 3T3GA 2W11A 1HTTA 2VHQA 2XUGA 1DVRA 3DAPA 1ADFA 1E2LA 4HPWA 2HSWA 4HBZA 1ULHA 4J29A 3CVOA 5CTJA 2V0NA 4L08A 1Z6AA 1KWKA 2D1YA 3EVEA 4DMHA 1RW4A 3P19A 5ERXA 3TKLA 4QUAA 3L7MA 1AGXA 4MNTA 4JLVA 2HPHA 2WYWA 1Y3AA 4WSOA 3FF4A 3LUKA 4XUGB 1CHDA 3U3ZA 3HMQA 1LQ2A 3RC2A 2GYWA 3RVOA 4B2LA 2OHGA 1ABFA 4XJSA 1VECA 4JKYA 4UVHA 5F2KA 3EDMA 5JZ9A 1NT4A 2AFIE 3PZRA 1GU0A 1TUIA 4MR8B 5J2TA 3GDWA 4JJ8A 2O3JA 5D7BA 1O95C 4GVLA 3TX6A 1HEUA 1U0TA 3X1MA 1LF5A 1VCIA 4Y1FA 2N42A 3WHLA 3N0WA 4EL5A 2X76A 1SCKA 1YC5A 4GM1A 2I6UA 3FJOA 3CE9A 1LNQA 1M34A 3I4CA 1BA3A 2C07A 2M6RA 4JFRA 1K8YB 4C2TA 4QHYA 3A6JA 4YUYA 4TS1A 4BVAA 2I3GA 1Y33E 2JGDB 2R62A 2DE0X 3H1PA 1XI2A 4UVEA 3HCBA 1VLMA 1ADJA 1Z8DA 2R7AA 4G2NA 4V2UA 4WKPA 3R3VA 4TL9A 1CR4A 3SF0A 5K45A 2FPKA 1GGNA 3ZQ6A 2B1QA 3D5QA 5J2UA 3MGKA 5K6TA 3BMOB 3SQMA 4TSRA 4QDUA 1QHXA 2A30A 4H7IA 3DLCA 1CDOA 3ELWA 3TKYA 4X3CA 5H3LA 5J2TF 2B25A 2NOAA 3G5AA 3K6SB 1HF3A 5HMMA 4R1OA 3KWJA 1FLVA 1N2ZA 4ZI2A 2H1OA 3UENA 4RSMA 4MIYA 4W5QA 5A02A 4UDYX 3DP9A 1YH3A 4KN8A 3CO5A 3OPYB 4P82A 4OGLA 2NU8A 5JY6A 1G5PA 2E55A 1CD5A 4I4NA 4L51A 3KQHA 4AS2A 1IB0A 1W5BA 3ML1A 1APBA 5CNMA 3K70C 1X3SA 2AI2A 1V45E 3N2YA 1YBMA 3QKRA 3QLUC 2VJBA 3FXAA 1EA7A 1AQIA 3E3AA 2PJDA 4BGVA 1ZD5A 2ZI4A 5LU8A 5BT9A 4DMUB 5DO9A 4BRZA 3ETLA 4TRNA 2HC9A 4KPFC 1LXCA 3BCUA 3SC4A 2AI3A 3L0CA 4JLSA 1PNRA 4G5YA 1VMDA 1W581 4YLYA 4XIYA 3EAQA 5J2UF 2GDJA 3W1WA 4F5ZA 4DNXA 2Y1XA 3OY7A 4KIFA 2HMUA 3B1XA 3B60A 3ONFA 4M38A 5DM70 1GKUB 4N5HX 4R9UC 5ICSA 2YINC 3FVQA 5LP6A 4OQFA 3KZMA 1S3GA 4GX1A 5BOSB 3TXAA 5DN6D 2VTBB 5F1KA 3ME5A 4RY8A 3II6X 1DNPA 1V6AA 3KSRA 1RPNA 2WWIA 5BMOA 5LP1A 2O8CA 5A5FA 1NVKA 1YOVA 1E2GA 2LVBA 4N3AA 4ONEA 4S35A 3FUWA 3TZ6A 4X8MA 3TPFA 1EJ6A 1VB5A 4KFSA 2EERA 1FBTA 4I4TF 2XZTA 4XUEA 4EHBA 1TM5E 2HA2A 1C30B 4FJ2A 3UG7A 3THXA 2PEZA 3O1IC 2CHUA 2VT3A 2O8BA 2OQ2A 1XP5A 4EI9A 2HWYA 3IUEA 3NASA 1DC3A 1II8A 5SY6A 5I7AA 5B58T 4PQFA 1QAOA 1VSUA 4YHBA 3W8FA 2RG1A 4HB3A 1FFGA 4Q7QA 5LP6F 2DH5A 2QP9X 1TZCA 1QGED 1L4HA 2RHMA 5LJIA 1WDMA 1NW3A 4YP0A 2BVNA 1ZK2A 2JFYA 4L76A 4N6OA 4NYMR 5JD6A 5K8IA 2G7ZA 4Y6SA 4GKBA 4MYSA 1CBUA 4IVQA 2RJ3A 3BDAA 4A6EA 2XF8A 1ELOA 3ZOZA 5HRCA 1P4HA 1IOVA 1KS2A 2AUNA 3K1TA 4GVXA 3RRYA 2PZGA 4H1HA 1FIUA 1H3NA 2QTFA 4L75A 1GUYA 3RFUA 3H2YA 1M1NB 2AOVA 1L4FA 3GL9A 3C3DA 5AW5A 2PMDA 3A7EA 3EFEA 4J0EA 4BQSA 3KB6A 1O96A 3DBHB 1BH6A 1LBIA 4BV2A 4G9BA 4H15A 1P77A 2BP7A 2XTAA 3LGSA 3ZHQA 5A4MS 2NZ2A 3BGOS 4UUBA 1DARA 3TPCA 5FTNA 3K20A 4I3HA 1I5RA 3KOYA 1KOFA 3P94A 1XN4A 3KG2A 3I0ZA 3CS3A 5A5VA 5KKNB 2EP7A 4FFNA 4IDAA 3AVUA 2I76A 3GI1A 2PA0A 4TZTA 4PFKA 4YLEA 4I6EA 4MV0A 4RMGA 1UMBB 1U7WA 5D87A 2UXCB 4FFPA 2GB4A 2XB6A 3FTNA 1KSJA 1R8SA 4MZDA 1AXGA 3R3WA 4DGQA 2NAFA 3H3FA 3K4PA 1ZJWA 3A06A 2WHEA 5DHPA 1UPBA 3C87A 4LMRA 2W70A 2V4UA 1YZHA 2QX7A 3UUGA 4OPMA 1O7JA 3MBOA 4O0LA 4YPOA 5IJZA 1SC3A 2ZKIA 3G0GA 3ORYA 3NDPA 5HSGA 2WKQA 2Q3EA 1NXOA 2R6ZA 5KSPA 1IM8A 1PNVA 3UWMA 4ECAA 2V3CC 1XXLA 1D7OA 3JALA 2ZT8A 4OM8A 4NPHA 5ICCA 4NYJR 1DKNA 5EWLB 1TDJA 5JI2E 2PS1A 1E1YA 1TGVA 4IRMA 3VNAA 4UFPA 5IDWA 1ACJA 3RABA 1JYFA 2IXGA 1J7KA 1ODJA 1DJQA 2NM0A 2XR1A 4QASA 3V4ZA 3P0EA 2GKOA 2E2WA 2RG7A 2IDKA 1W75A 4G1CA 3TBHA 2HDOA 5CAEA 2WD9A 5JBIA 2C5GA 4EUSA 4NP6A 1YL5A 1RI2A 2F43A 2NO0A 2Q1SA 3L8ZA 4S1OA 3QHQA 4ND5A 4U7GA 4IGFA 1TRKA 1CR0A 3E0QA 1NXQA 3PLNA 2WKWA 1AHIA 2GO7A 3K16A 4HYQA 4ITUA 2A35A 1FJ2A 2XCSB 1N2BA 1U8TA 2ENUA 3DDNA 5JZVA 3OTHA 3N9IA 4ZRDA 4ZVOA 3T9AA 1DCMA 2VHUA 2KHZA 2W2NA 4NBSA 3STUA 3PL5A 4EGJA 2AEEA 5KWSA 3ZW9A 1NPTO 1I0LA 2BFEB 1Q57A 1XCBA 4LXIA 1QTRA 5A5EA 2ZWIA 4XTRA 1PT8A 2DULA 2JGJA 3O0TA 3UVEA 4E11A 4QDOA 3WZLA 4GBJA 1RXYA 4HEJA 1NVWQ 3LA8A 5EHGA 4CIVA 3NCHA 1IK6A 3SBOA 3COSA 1C4KA 2ZDQA 1O4WA 2HRRA 3M6VA 3O38A 3SU8A 1DUSA 3LZDA 3EGEA 2OG2A 4G6ZA 1ZG3A 1DBIA 5DDIP 1YSCA 1T3LA 1YL7A 3BJZA 1RI4A 3LVBA 3V34A 1V7CA 3DEAA 1SC9A 4X1YA 1XXHB 5IWCA 3CLUD 3L4JA 1PL0A 1QYDA 3MWEA 1SHJA 5EVCA 3T5AA 2WW8A 3PBKA 5AP9A 3CZCA 3I52A 2DERA 1IRXA 2NPFA 2JIZD 1ZCZA 4RLHA 2CXTA 2PKQO 1E4EA 2VT7A 3GRPA 5F73A 3KEMA 5BV0A 1J97A 2EHDA 3HL4A 1O5OA 2QRGA 1FNDA 1WUTA 3HCCA 4FGWA 3FHCB 4JI5B 4B2YA 4DM3A 1BNCA 2DQSA 2XXBA 2H6EA 4J76A 2IP4A 3RUEA 1Z7WA 1YBAA 1B15A 3KVYA 1ZRNA 1BMTA 1IXSB 3ESZA 1GZ3A 3PJGA 3IKMB 4LSGA 1B00A 3FPAA 3GRUA 1CUJA 4UNSA 3B9RA 2FXIA 4FDMA 3U40A 3PF8A 1DAGA 2CZGA 2J08A 3JASB 2J31A 4FGUA 3TD9A 3UCXA 4C2BA 3E7XA 1CLEA 2M6SA 3E9NA 5DPMA 3TQFA 2BTOA 2JK0A 1M8JA 3GZTB 4R7TA 4FGLA 4I6GA 1OXSC 4LUCA 3RSGA 4LDJA 2JKVA 4JLJA 3HXPA 4CKZA 2D1RA 5KYXB 1G16A 3DHVA 5TT0A 3IKVA 3LBFA 4XE5A 4CM1A 1KTVA 1V39A 2Z8YA 3PUZA 1CLUA 4LYDA 1H2RS 4REQB 5ER6A 5JCJD 4ESVA 4M37A 1Q21A 1T9GR 3GUUA 2KBEA 3FPLA 3KB2A 5FR1A 5GJWC 3EZ2A 2AK3A 3HZZA 4CLRA 1P3JA 3ZJUA 3DE3X 4RK7A 1H2AS 3QU4A 4KQXA 2HSZA 4M7RA 4JLOA 1NVUQ 2ZRAA 2RBKA 3H87A 1SOAA 2Q7OE 3B6JA 1XZBA 1VL2A 1VJGA 2ZJAA 3DWIA 3L04A 4ARAA 1US8B 4NZMA 4G0UA 3QMPA 1H2BA 2CLKB 4LOLA 3EOZA 4WACA 4TTSA 4OGKA 4YRPA 1EGMB 1PT5A 4J0GA 5FA6A 3BE6A 4KO1S 4ZQEA 4DWWA 3NTUA 3LKBA 4JP3A 3DULA 4ZRNA 2D3TA 2NUAA 4N0PA 4PNZA 4D81A 2AXEA 4BLQA 2NV0A 1JQBA 4FINA 2YZNA 1TAHA 1RS0A 1FP4A 5C0OE 4CQLB 5JWHA 4R9SA 2D5IA 4X8HA 1ZH2A 3BXOA 4WEQA 4KUHA 2PKCA 1RM4A 3D2AA 1KAHA 4LXQA 3CIFA 5K51A 1JU4A 2OWDA 3UUEA 4TXMA 4MKXA 2V1XA 4PXSA 3LBAA 4LQLA 4M46A 1FYVA 5JH7A 4MMZB 2G9UA 4X95A 3DL2A 4JWKA 2AV6A 3N2ZB 2EZ4A 4RVOA 2P6UA 4OLAA 1FFSA 1T8WA 4ZA2A 2B9EA 3U4MA 3ESCA 4QM6A 3DO6A 4BBJA 4C4YA 4F2HA 4YAGA 5FAXA 2YJNA 4MVYA 5AKIA 3ZHVA 1A9QA 2WZCA 3EC1A 3GGSA 5EIXA 1FZQA 4WXPA 4EMBA 4FB5A 4MRPA 2DC1A 3LP8A 3W79A 3EISA 1KYZA 1CEXA 3PC7A 5KNLA 1VM6A 2XXJA 3OLWA 3JVVA 4HVAA 1X6VA 4UXIA 4LQDA 3RI3A 3U7IA 1P2FA 1XVVA 3F2IA 4X20A 4CMIA 4NAVA 2A58A 2V6JA 3NU1A 1IPHA 2JGNA 1PGPA 1JEJA 4WLVA 5E6UB 1RYFA 3CZPA 4F1WA 2PLFA 3OIVA 4J3FA 3DQZA 3C6KA 3WFIA 1B7GO 3EGWA 2FX3A 1DBRA 1UFOA 5BN4B 3GMIA 1P0IA 1VJRA 1WOMA 4B6FA 5L3RA 1NBEA 4ZZ0A 5K7SA 1B0AA 4Q7LA 2O07A 1XNGA 4Z4QA 3C8HA 1QQBA 1XZAA 1WG8A 3DD1A 3OQIB 5HIIA 1N2XA 4DIDA 3KP1A 2VRCA 3CRNA 3EGIA 1W88B 5F3WB 2ORED 3EOAI 1JKMA 2XUKA 2ES4A 1ZICA 4UNIA 2VHXA 3Q3JB 3ON5A 4CIYA 3TX2A 2B1RA 1L7DA 3BWMA 3G2NA 4N7BA 4FFRA 3FPGA 4FNAA 5ICMA 2ZI9A 2JKYA 2EFGA 3HJGA 1TCVA 5BNZA 3ZY5A 4TVBA 1YQXA 1PJRA 1SXHA 3IXMA 3MGBA 3OTQA 4L07A 4ZOLA 2AQIA 4DILA 2OAGA 1R0WA 2RGXA 2OZLA 4Y2JA 4M1YA 3JW8A 2WUVA 4R2MA 4F21A 1JTFA 2VP3A 3JD3A 4JXXA 3QE3A 4Q9HA 4CI9A 4Q3DA 5CB0A 5J2TB 1UDAA 5J9FA 5DMXA 4QUDA 2AX3A 4V3BA 4B81A 4YP7A 2RAUA 5BMVF 5HCNA 5TMBA 3TSYA 5LQMA 5CFLA 4EB0A 3HR4A 2BH2A 2VXCA 3P8ZA 2I91A 2AG0A 3IUMA 4KPUA 1Q1EA 1AZLA 3HLTA 2VUIB 3PGXA 1M34B 4HRVA 5LQAA 3O8CA 1E60A 2E1RA 3OC6A 4BNTA 2VDMB 3A04A 1X7ZA 5A1TA 5ARDA 1IZ7A 4YAIA 4DIMA 3DBOB 2CHGA 4KNWA 4DV5B 2UDPA 1GN9A 4B32A 1FDSA 1FRFS 3ERCA 4J16A 1ESZA 2XTNA 1A4XA 4GKKB 3Q3GE 2REOA 1RXVA 4YMUA 2QYTA 3DMYA 3T5TA 4J0DA 2YTZA 3I1YA 2JANA 3L41A 4LTDA 1KVQA 2W43A 4XQGA 3SLRA 1I32A 2FPGA 2N9UA 2FHPA 1DC5A 2Q50A 1X1AA 2WUDA 1NY5A 5C1IA 4OQPA 4UMDA 4REOA 1T2CA 4PFQA 4EA7A 4MV1A 2RB5A 1UMKA 2Z9BA 4U02A 2YIDA 2NU8B 2PRZA 2NQ2C 1XCMA 1Q7TA 1XRQA 2DHCA 3ISJA 4IM7A 1LW6E 4B75A 4GNRA 4Q66C 4KSCA 3IVGA 3NHZA 3OJOA 1ZCAA 1E7QA 3DAOA 1SRRA 3KSDO 4X3PA 3FZGA 4M99A 4OJMX 4Y98A 3RTBA 1H94A 2E1PA 3PU6A 4I4TB 4G1VA 4CQMD 3TR5A 3MYYA 2Q2OA 4EW2A 4LOKA 3S2FA 4BCDA 3DPSA 3ONEA 1JMVA 5EXPA 1UKYA 3A6ZA 2QMOA 3W2FA 4ZEVA 5ITSA 4QXQA 5BYBA 1EAYA 5I4CA 2GCEA 1AUPA 3CZRA 1XCPA 3STVA 2BBSA 3OI7A 3SMVA 2IPMA 2QRMA 3SC2A 2POQX 4Q05A 3D2LA 3SK0A 1NBME 1UMCA 3JX9A 5LP6B 2OD7A 4P32A 1J8QA 2FSVC 2XEXA 3M5WA 2BFNA 3ANTA 4DCJA 4U2CA 4EY7A 1XAGA 3BKWA 2XT6A 1N77A 2GLXA 2X0EA 1ZRMA 3FMIA 1AG9A 4LECA 1UBMS 5T64A 2O8CB 1YOVB 1W4RA 1J70A 3HVIA 4HY3A 4IIJF 4RW0A 4ENRA 1P5JA 2CVZA 2BH9A 1DAPA 4GR9A 5G1OA 4ZCLA 2R5FA 2DKOA 2Q7DA 1N3LA 3UKDA 3ICQB 5EZ6B 5A4KA 3FSRA 2OO3A 4RA6A 1L3IA 1LEHA 4GP7A 3STTA 3T3IA 3IVMA 2WFAA 3HYTA 3IEIA 1FXWA 1X0VA 3OLCX 2FW6A 3Q7TA 3HZOA 3PX7A 2EP5A 3NKLA 1RDFA 3U49A 3RSQA 4BP9A 1II8B 2W2KA 1V1MA 1XWIA 3JQPA 4JQZA 4FFDA 3IYLW 2W6QA 3ZWKA 4GZ3A 3QK7A 4NBWA 2GN8A 4FYHA 1LNSA 3V7YA 4O33A 1KERA 2WV7A 4YV2A 1Q14A 1QB8A 5FPYA 4MVJD 1XAJA 4QOIA 1DOHA 2O2SA 2O1SA 3MD9A 4LXUA 2V7UA 5CH8A 1RXCA 1G21A 2QT0A 3V2HA 1SU6A 4PN3A 3RAEC 5LCXA 4QTZA 1I7PA 1MQ9A 3F47A 4YACA 4PZPA 1O5IA 1Z5VA 5LZ8A 4D3DA 3KLOA 4BP8A 7REQA 2DSTA 4RSGA 1MH9A 3TSZA 1PBTA 2MSWA 3H9UA 5KUTA 1EYZA 3SJZA 2AI1A 3M5DA 3TCXB 2IITA 2ISQA 4X8OA 4XH9B 3GG9A 2XRYA 3INTA 1Y9DA 3RJMA 2BM1A 9LDBA 2BP7B 2CWDA 3OWXA 2XHEA 2DQ4A 5P21A 4QATA 2PVCA 4BBPA 2IE0A 1QQ5A 3ND7A 2BGUA 3QX7A 1NQ5A 3VAZA 4AJHA 1W35A 2PGNA 2VBGA 3EDCA 3W5UA 2VPPA 5DN6A 1XZDA 1ILWA 2APJA 2JJMA 4J7UA 4GLFA 4B3JA 1IOWA 3ESYA 3LP5A 4NR0A 4DM7A 5BW5A 1KOGA 3QNWA 3B2EA 3C5CA 3UKJA 2BGJA 3ENNA 3L9WA 4B3GA 3ZNNA 1GA6A 4TUYA 4C89A 1E20A 1YB6A 2WMDA 3M9XA 4KNVA 4YJ2A 1SKMA 1QDLB 4JBXA 4ENTA 2GNAA 3GWGA 1R15A 1XEWX 1PR0A 2ZUVA 3WRXA 1PD0A 4D5EA 1GXSB 1ESEA 2P6PA 5TGDA 2QQEA 2XRMA 2Z58A 3JALB 5JS2A 3IP3A 3DC7A 1EGHA 3KT3A 4ZK2A 3I8XA 1JDUA 3DJFA 3ZWQA 3CB2A 2ZVDA 4ZOEA 1E94E 2SKCA 3D6JA 4QU5A 4RK5A 3WL4A 1E8MA 2Y1EA 4CMEA 3HSSA 4NNPA 3NBZC 5DYIA 4DCTA 2VYVD 2Q3CA 2Q4RA 2WAXA 4EB6A 1CJSA 1W44A 4WUVA 5IC6A 5T8KA 2F43B 3WVNA 1HNZB 1WSAA 2INGX 4MUJA 1PZNA 3S3TA 2O8DB 2VSYA 1PW7A 1EI9A 1VC2A 4EO4A 2G80A 2QMHA 2QTAA 4TQAA 4GE3A 4YJ2F 3JARA 4B17A 3H9GA 1DB3A 4WY5A 4BZZA 1HYHA 1QIGA 1C0KA 3VPBA 1R4MB 1K27A 2PX8A 3CONA 3LQ1A 4IS3A 4N54A 4WXRA 5MFPA 4RTMA 4ZCPA 5CLHA 2OHIA 1JSCA 5J4VA 1E9VA 4XASA 4MROA 2XGGA 3TUJC 3ZHXA 3GK3A 2IH4A 3LNCA 3N2NA 4O4HA 1MJGA 1MX9A 5EXTA 5FB3A 2CFSA 4AF6A 5B64A 4B3SB 1SBQA 4CG1A 4KXFB 4CKXA 4GZ6A 3AZQA 5JZMA 1ZFNA 4Q9NA 1SZCA 9GPBA 1NWHA 2VTDA 3ADOA 2DP4E 3K9LA 4HXEB 3DHNA 3FFAA 5JMPA 3V4OA 1CX9B 1ZBDA 2ZBFA 2G9NA 4F6RB 3K6KA 3OLXA 3SNKA 3LT5A 2VRNA 2W8ZA 2JVKA 4B6GA 2ZJ8A 4H0CA 1RCFA 1DIGA 3DAFA 4Z86A 5AKYA 4CG0A 3URKA 2FZEA 3ZHCA 1BKSB 3G7UA 4CCYA 3VO9A 2DOKA 2LR0A 3JRWA 2H07A 1L3BA 5K0TA 3RVRA 1VMEA 3MWEB 4CE6A 2NO4A 1V26A 2ZVJA 4LJKA 1QP4A 2A0FA 4FEGA 3U3KA 4NCKA 4PCAA 4DCVA 1ZN9A 5PGMA 2XUFA 2AL7A 3U16A 3X1XA 3P2MA 2G70A 1XTZA 2WU1A 4I81A 5JCZA 5H8WA 4KH1A 2GBLC 5L40A 2WG1A 1PV4A 3Q15C 2AG5A 2PVPA 3K8ZA 3M6XA 5D1NA 3SHWA 3WLEA 4MDFA 4EPVA 4KIWA 1KVTA 1QWSA 1GT91 2AMLA 1YS1X 5J1SB 3AJAA 4BBZA 1GPAA 1JR2A 4EHHA 2IU4A 2PWPA 1RAHA 1SWWA 5ETJA 1W19A 3S40A 1RIFA 1T15A 3OZTA 4GM0A 3VOTA 4E2FA 4D4GA 2IIVA 2YY6A 1PG5A 4PLFA 4URWR 5HKOA 4FU0A 3IT2A 2QR2A 2I7XA 3GAAA 3PNOA 2KW5A 3HO8A 2AF4C 4C3UA 4ZHQB 1SQ5A 2BTQA 1ZX1A 2ECPA 3JQ6A 4HL6A 5F12A 1MGPA 3TNLA 1CF2O 5CVUA 1EG2A 3AETA 3DOOA 4B87A 5J4YA 2W58A 1RQXA 3WYEA 3MT7A 1U0HC 1L5NA 1K8ZB 4HX9A 3UK0A 3IP6A 4ZYZA 5KC9A 4IOJA 4TWZA 4CLRB 4D9CA 3WL6A 1CQXA 2GEBA 1I0IA 1W87A 3PUKA 4Q3CA 5BQOA 4EOGA 4MRNA 3Q9LA 3HNPA 1M2EA 3C5HA 1YU9A 4RH3A 4Z2YA 1G66A 1NGSA 3DL0A 4AMVA 3CUKA 5E9QA 4J0QA 3CRW1 3OIDA 4INPA 1JE1A 1TZJA 2IYUA 1UDRA 2DHQA 1KFKB 3BCRA 3KOWA 3MT0A 3X1DA 4AG6A 2VHZA 4DR6B 1XA3A 2JHFA 3J7TA 2A5LA 4D9MA 1KAOA 1L7AA 2NUAB 4B44A 3QVWA 4EELA 2ZGVA 5IBQA 2Q3MA 1PX0A 1XG5A 5CDFA 2FSFA