2VWOL

Aminopyrrolidine factor xa inhibitor
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
51
structure length
42
Chain Sequence
LCSLDNGDCDQFCVVCSCARGYTLAKACIPTGPYPCGKQTLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of Novel Aminopyrrolidine Factor Xa Inhibitors from a Screening Hit.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Blood clotting
molecule keywords ACTIVATED FACTOR XA HEAVY CHAIN
total genus 9
structure length 42
sequence length 51
ec nomenclature ec 3.4.21.6: Coagulation factor Xa.
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
L PF14670 FXa_inhibition Coagulation Factor Xa inhibitory site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.25.10 Mainly Beta Ribbon Laminin Laminin 2vwoL00
2WG4B 1XDTR 3N8VA 1HCGB 2RHPA 1PGEA 5IKVA 3N8WA 2P94L 1ATEA 2VWLL 1DDXA 2WPME 1IQML 1HJ7A 3QMOA 2I9AA 4CUEA 3KRKA 1B9WA 5IKQA 3KCGL 4D0FA 1W7XL 2P95L 3HO5A 3NTBA 4RRYA 1IGXA 1DIYA 4BXSA 3HS7A 2Y7ZB 3ENSA 2Y81B 1O5DL 3KQEL 2MGRA 3V65B 3Q7DA 5CKMA 2K2SB 4ZH8B 3SW2A 4D90A 3OLUA 5EGMB 4BDWA 2W86A 2VH0B 5KN5C 3KQCL 1U8CB 2TGFA 3NTGA 2P16L 2WPIE 1HAFA 3MQEA 3CENL 1DQBA 2B7DL 1CVUA 1FFMA 4BTIA 1PRHA 2W3IB 1EMNA 3KK6A 4LMFA 3QH0A 3OLTA 1P0SL 4Y79B 2FLBL 3TH3L 2YGOA 3EGFA 3FBYA 2P93L 1K36A 2DDUA 2W26B 4Y76B 5IKTA 4Z6AL 2WPHE 2KL7A 4MMYB 1SZBA 3IJEB 2EI7B 1Z6CA 3H5CB 3MDLA 1ATAA 2AYLA 5L30L 1MQ5L 1X7AL 2H9EL 3HPTA 1G1SA 1P9JA 3SOVA 1YO8A 2ADXA 1JL9A 5I46L 1KIGL 3ZYJB 2PUQL 1KLOA 1NFWB 1HT5A 2J2UB 2P3FN 4PH9A 3N8ZA 4COXA 2XC0L 1G2MB 3F6UL 2WG3C 3LAQA 4XL1A 1KLJL 1EAIC 1IQFL 4E1GA 2J95B 2BO2A 4JZFL 1QFKL 1IQGL 4Y71B 3TBDA 2J4IB 4Z0KB 1AUTL 2XBVL 2BOXA 2EI8B 2XC4L 1U67A 2VVUL 5JBCE 1IP0A 1NZIA 3Q3KB 1TPGA 3LN0A 4X8VL 3P5BL 5JW1A 3HS6A 1NFXB 1IQLL 3HO3A 1N7DA 1EPGA 1Z6EL 4ZXXL 2W2QE 1CCFA 1OB1C 3C9AC 2VJ3A 1FSBA 2Y5FL 2WPLE 1IOEL 1IOXA 1KSNB 1HZ8A 1NFYB 4JZEL 1ZAQA 2W2OE 3ELAL 3TK5B 3LIWB 1J9CL 5L2ZL 3SOBB 4CSYA 4BTUA 2P28B 1F7EA 1HRFA 1YGCL 1JBUL 2Y7XB 1IQIL 1EGFA 2P3FL 1CVWL 4TGFA 3M37L 1IQEL 3U7UG 2W2ME 1WHEA 1EQGA 1URKA 4Z0LA 4AQTA 4C16A 2VH6B 1IVOC 4BDXA 1CCVA 4X8UL 1F0RB 3TK6B 2WYJB 1ADXA 2M74A 2FLGA 4M10A 3GCWE 1IJQA 1NT0A 2XC5L 2Y80B 4BXWA 3POYA 2J38B 4RUTA 5JVYA 3CA7A 1IQJL 1EPJA 1PTHA 1G2LB 4ZAEB 2VWMK 1TOZA 4XBMA 3CFWA 2YGPA 4RS0A 1TLEA 4D0EA 2W3KB 3SOQA 4G1MB 3GCXE 2WPKE 1COUA 1WHFA 2K2TA 1EBVA 2BOKL 1K37A 1LPGA 2UWLB 1HREA 3LN1A 2XBYL 3IITB 1DVAL 1PXXA 4Y7BB 5JVZA 2BOHA 4O02B 1DX5I 5CKNA 4ZHAB 3PGHA 1F0SB 3LTGD 3CS7L 5F1AA 3V64C 2WFTA 5COXA 1CEJA 1FAKL 3K9XA 3BT1A 5CKQA 2W2NE 4JYUL 4FM5A 1L3YA 1EPHA 2WFXB 3BPSE 2I9BA 3N8YB 2FZZL 4RRZA 2FLRL 3KL6B 2P3TA 2Y38A 1G1QA 4NA9L 2BZ6L 2MGPA 1UZPA 4O1ZA 5JBAE 2Y5HL 2P3UA 5IKRA 3BT2A 2Y5GL 3DEMA 2J94B 1A3PA 4RRWA 5FDQA 1FE2A 5CISA 4CUFA 3LTFB 3N8XA 2BQ6A 4A7IA 1Q4GA 1LPZA 5E8DA 3FFGL 3TZIA 3TGFA 3HO4A 1IQHL 1NPEB 3LC5B 3ZYGA 3U73A 1WU1B 2BOUA 3QCWA 1G1TA 3N8WB 1NFUB 4MMXB 4Y6DB 5K0HB 1NQLB 4ISHL 2UWOB 1IQNL 1XKBA 2BQ7A 2D1JB 2JKHL 3ASIA 1FAXL 1EQHA 3M36L 1GK5A 1F7MA 2PR3B 5JB9E 1M1XB 4ISIL 1CX2A 1MOXC 2FD6A 4X8TL 2XBWL 1EPIA 4M11A 4YT6L 2F9BL 2VWOL 1V3XB 2MHPA 1W8BL 1ATBA 1EZQB 1XKAL 3HS5A 2CJIB 2WYGB 2VWNL 3ZYIB 3KQDL 3NJPC 2G00L 1APQA 3N8YA 1ATDA 1LQDA 1IQKL 4X8SL 2GD4A 5F19A 2OYUP 2PHBB 4JYVL 2BQWA 4OTJA 1BF9A 2RA0L 2W2PE 3LC3B 1RFNB 1UZQA 2Y82B 1XFEA 4MMZB 4OTYA 2NPRA 1UZKA 4CUDA 1IGZA 3R05A 1FF7A 4YZUB 4YT7L 2XBXL 1C5MF 2KV4A 2BMGA 1G1RA 4ZXYL 2VVVL 3RR3A 1JV2B 1YUFA 2J34B 2OYEP 1HX2A 4NGAL 4XLWA 5KIRA 1LPKA 4NG9L 3FCSB 2Q1JB 1N1IA 1YUGA 3NT1A 3F1SB 2EI6B 3KQBL 1KLIL 1LMJA 2P26A 1FJSL 1UZJA 3GISX 1YUKB 2KB9A 1EMOA 1MQ6L 1APOA 1I0UA 2UWPB 1PFXL 2RNLA 4RRXA 1HT8A 2VVCK 6COXA 1L5GB 5L2YL 5JB8E 1CQEA 1HAEA 2WPJE 4JZDL 4LORA 5JBBE 4BTTA 4Y7AB
chains in the Genus database with same CATH superfamily
2WG4B 1XDTR 3N8VA 1HCGB 2RHPA 1PGEA 5IKVA 3N8WA 2P94L 1ATEA 2VWLL 1DDXA 2WPME 1IQML 1HJ7A 3QMOA 2I9AA 4CUEA 3KRKA 1B9WA 5IKQA 3KCGL 4D0FA 1W7XL 2P95L 1V1IA 3HO5A 3NTBA 4RRYA 1IGXA 1DIYA 4BXSA 3HS7A 2Y7ZB 3ENSA 2Y81B 1O5DL 3KQEL 2MGRA 3V65B 3Q7DA 5CKMA 2K2SB 4ZH8B 3SW2A 4D90A 3OLUA 5EGMB 4BDWA 2W86A 2VH0B 5KN5C 3KQCL 1U8CB 2TGFA 3NTGA 2P16L 2WPIE 1HAFA 3MQEA 3CENL 1DQBA 2B7DL 1CVUA 1FFMA 4A94C 4BTIA 1PRHA 2W3IB 1EMNA 3KK6A 4LMFA 3QH0A 3OLTA 1P0SL 4Y79B 2FLBL 3TH3L 2YGOA 3EGFA 3FBYA 2P93L 1K36A 2DDUA 2W26B 4Y76B 5IKTA 4Z6AL 2WPHE 2KL7A 4MMYB 1SZBA 3IJEB 3S6XA 2EI7B 1Z6CA 3H5CB 2YGQA 3MDLA 1ATAA 2AYLA 5L30L 1MQ5L 1X7AL 2H9EL 3HPTA 1G1SA 1P9JA 3SOVA 1YO8A 2ADXA 1JL9A 5I46L 1KIGL 3ZYJB 2PUQL 1KLOA 1NFWB 1HT5A 2J2UB 2P3FN 4PH9A 3N8ZA 4COXA 2XC0L 1G2MB 3F6UL 2WG3C 3LAQA 4XL1A 1LK9A 1KLJL 1EAIC 1IQFL 4E1GA 2J95B 2BO2A 2HOXA 1QFKL 1IQGL 4JZFL 4Y71B 3TBDA 2J4IB 4Z0KB 1AUTL 2XBVL 1V1HA 2BOXA 2EI8B 2XC4L 1U67A 2VVUL 5JBCE 1IP0A 1NZIA 3Q3KB 1TPGA 3LN0A 4X8VL 3P5BL 5JW1A 3HS6A 1NFXB 1IQLL 3HO3A 1N7DA 1EPGA 1Z6EL 4ZXXL 2HORA 2W2QE 1CCFA 1OB1C 3C9AC 2VJ3A 1FSBA 2Y5FL 2WPLE 1IOEL 1QIUA 1IOXA 1KSNB 1HZ8A 1NFYB 4JZEL 1ZAQA 2W2OE 3ELAL 3TK5B 3LIWB 1J9CL 5L2ZL 3SOBB 4CSYA 4BTUA 2P28B 1F7EA 1HRFA 1YGCL 1JBUL 2Y7XB 1IQIL 1LMMA 1EGFA 2P3FL 1CVWL 4TGFA 3M37L 1IQEL 3U7UG 2W2ME 1WHEA 1EQGA 1URKA 4Z0LA 4AQTA 4C16A 2VH6B 1IVOC 4BDXA 1CCVA 4X8UL 1F0RB 3TK6B 2WYJB 2JJLA 1ADXA 2M74A 2FLGA 4M10A 3GCWE 1IJQA 1NT0A 2XC5L 2Y80B 4BXWA 3POYA 2J38B 4RUTA 5JVYA 3CA7A 1IQJL 1EPJA 1PTHA 1G2LB 4ZAEB 2VWMK 1TOZA 4XBMA 3CFWA 2YGPA 4RS0A 1TLEA 4D0EA 2W3KB 3SOQA 4G1MB 3GCXE 2WPKE 1COUA 1WHFA 2K2TA 1EBVA 2BOKL 2VRSA 1K37A 1LPGA 2UWLB 1HREA 3LN1A 2XBYL 3IITB 1DVAL 1PXXA 4Y7BB 5JVZA 2BOHA 4O02B 1DX5I 5CKNA 4ZHAB 3PGHA 1F0SB 3LTGD 3CS7L 5F1AA 3V64C 2WFTA 5COXA 1CEJA 2BT8A 1FAKL 3K9XA 3BT1A 5CKQA 2W2NE 4JYUL 4FM5A 1L3YA 1EPHA 2WFXB 3BPSE 2I9BA 2WZPP 3N8YB 2FZZL 4RRZA 2FLRL 1KKEA 3KL6B 2P3TA 2Y38A 1G1QA 4NA9L 2BZ6L 2MGPA 1UZPA 4O1ZA 5JBAE 2Y5HL 2P3UA 5IKRA 3BT2A 2Y5GL 3DEMA 2J94B 4GU4A 1A3PA 4RRWA 5FDQA 1FE2A 5CISA 4CUFA 3LTFB 3N8XA 2BQ6A 4A7IA 1Q4GA 1LPZA 5E8DA 3FFGL 3TZIA 3TGFA 3HO4A 1IQHL 1NPEB 3LC5B 3ZYGA 3U73A 1WU1B 2BOUA 3QCWA 1G1TA 3N8WB 1NFUB 4MMXB 4Y6DB 5K0HB 1NQLB 4ISHL 2UWOB 1IQNL 1XKBA 2BQ7A 2D1JB 2JKHL 3ASIA 1FAXL 1EQHA 3M36L 1GK5A 1F7MA 2PR3B 5JB9E 1M1XB 2H9EC 4ISIL 1CX2A 1MOXC 2FD6A 4X8TL 2XBWL 1EPIA 4M11A 4YT6L 2F9BL 2VWOL 1V3XB 2BT7A 2MHPA 1W8BL 1ATBA 1EZQB 1XKAL 3HS5A 2CJIB 2WYGB 2VWNL 3ZYIB 3KQDL 3NJPC 2G00L 1APQA 3N8YA 1ATDA 1LQDA 1IQKL 4X8SL 2GD4A 5F19A 2OYUP 2PHBB 4JYVL 4GU3A 2BQWA 4OTJA 1BF9A 2RA0L 2W2PE 3LC3B 1RFNB 1UZQA 2Y82B 1XFEA 4MMZB 4OTYA 2NPRA 1UZKA 4CUDA 1IGZA 3R05A 1FF7A 4YZUB 4YT7L 2XBXL 1C5MF 2KV4A 2BMGA 1G1RA 4ZXYL 2VVVL 3RR3A 1JV2B 1YUFA 2J34B 2OYEP 1HX2A 4NGAL 4XLWA 5KIRA 1LPKA 4NG9L 3FCSB 2Q1JB 1N1IA 1YUGA 3NT1A 3F1SB 2EI6B 3KQBL 1KLIL 1LMJA 2P26A 1FJSL 1UZJA 3GISX 1YUKB 2KNIA 2BSFA 2KB9A 1EMOA 1MQ6L 1APOA 1I0UA 2UWPB 1PFXL 2RNLA 4RRXA 1HT8A 2VVCK 6COXA 1L5GB 5L2YL 5JB8E 1CQEA 1HAEA 2WPJE 4JZDL 4LORA 5JBBE 4BTTA 4Y7AB
chains in the Genus database with same CATH topology
2WG4B 1XDTR 3N8VA 1HCGB 2RHPA 1PGEA 5IKVA 3N8WA 2P94L 1ATEA 2VWLL 1DDXA 2WPME 1IQML 1HJ7A 3QMOA 2I9AA 4CUEA 3KRKA 1B9WA 5IKQA 3KCGL 4D0FA 1W7XL 2P95L 3HO5A 3NTBA 4RRYA 1IGXA 1DIYA 4BXSA 3HS7A 2Y7ZB 3ENSA 2Y81B 1O5DL 3KQEL 2MGRA 3V65B 3Q7DA 5CKMA 2K2SB 4ZH8B 3SW2A 4D90A 3OLUA 5EGMB 4BDWA 2W86A 2VH0B 5KN5C 3KQCL 1U8CB 2TGFA 3NTGA 2P16L 2WPIE 1HAFA 3MQEA 3CENL 1DQBA 2B7DL 1CVUA 1FFMA 4A94C 4BTIA 1PRHA 2W3IB 1EMNA 3KK6A 4LMFA 3QH0A 3OLTA 1P0SL 4Y79B 2FLBL 3TH3L 2YGOA 3EGFA 3FBYA 2P93L 1K36A 2DDUA 2W26B 4Y76B 5IKTA 4Z6AL 2WPHE 2KL7A 4MMYB 1SZBA 3IJEB 3S6XA 2EI7B 1Z6CA 3H5CB 2YGQA 3MDLA 1ATAA 2AYLA 5L30L 1MQ5L 1X7AL 2H9EL 3HPTA 1G1SA 1P9JA 3SOVA 1YO8A 2ADXA 1JL9A 5I46L 1KIGL 3ZYJB 2PUQL 1KLOA 1NFWB 1HT5A 2J2UB 2P3FN 4PH9A 3N8ZA 4COXA 2XC0L 1G2MB 3F6UL 2WG3C 3LAQA 4XL1A 1KLJL 1EAIC 1IQFL 4E1GA 2J95B 2BO2A 4JZFL 1QFKL 1IQGL 4Y71B 3TBDA 2J4IB 4Z0KB 1AUTL 2XBVL 2BOXA 2EI8B 2XC4L 1U67A 2VVUL 5JBCE 1IP0A 1NZIA 3Q3KB 1TPGA 3LN0A 4X8VL 3P5BL 5JW1A 3HS6A 1NFXB 1IQLL 3HO3A 1N7DA 1EPGA 1Z6EL 4ZXXL 2W2QE 1CCFA 1OB1C 3C9AC 2VJ3A 1FSBA 2Y5FL 2WPLE 1IOEL 1IOXA 1KSNB 1HZ8A 1NFYB 4JZEL 1ZAQA 2W2OE 3ELAL 3TK5B 3LIWB 1J9CL 5L2ZL 3SOBB 4CSYA 4BTUA 2P28B 1F7EA 1HRFA 1YGCL 1JBUL 2Y7XB 1IQIL 1LMMA 1EGFA 2P3FL 1CVWL 4TGFA 3M37L 1IQEL 3U7UG 2W2ME 1WHEA 1EQGA 1URKA 4Z0LA 4AQTA 4C16A 2VH6B 1IVOC 4BDXA 1CCVA 4X8UL 1F0RB 3TK6B 2WYJB 1ADXA 2M74A 2FLGA 4M10A 3GCWE 1IJQA 1NT0A 2XC5L 2Y80B 4BXWA 3POYA 2J38B 4RUTA 5JVYA 3CA7A 1IQJL 1EPJA 1PTHA 1G2LB 4ZAEB 2VWMK 1TOZA 4XBMA 3CFWA 2YGPA 4RS0A 1TLEA 4D0EA 2W3KB 3SOQA 4G1MB 3GCXE 2WPKE 1COUA 1WHFA 2K2TA 1EBVA 2BOKL 1K37A 1LPGA 2UWLB 1HREA 3LN1A 2XBYL 3IITB 1DVAL 1PXXA 4Y7BB 5JVZA 2BOHA 4O02B 1DX5I 5CKNA 4ZHAB 3PGHA 1F0SB 3LTGD 3CS7L 5F1AA 3V64C 2WFTA 5COXA 1CEJA 1FAKL 3K9XA 3BT1A 5CKQA 2W2NE 4JYUL 4FM5A 1L3YA 1EPHA 2WFXB 3BPSE 2I9BA 2WZPP 3N8YB 2FZZL 4RRZA 2FLRL 3KL6B 2P3TA 2Y38A 1G1QA 4NA9L 2BZ6L 2MGPA 1UZPA 4O1ZA 5JBAE 2Y5HL 2P3UA 5IKRA 3BT2A 2Y5GL 3DEMA 2J94B 1A3PA 4RRWA 5FDQA 1FE2A 5CISA 4CUFA 3LTFB 3N8XA 2BQ6A 4A7IA 1Q4GA 1LPZA 5E8DA 3FFGL 3TZIA 3TGFA 3HO4A 1IQHL 1NPEB 3LC5B 3ZYGA 3U73A 1WU1B 2BOUA 3QCWA 1G1TA 3N8WB 1NFUB 4MMXB 4Y6DB 5K0HB 1NQLB 4ISHL 2UWOB 1IQNL 1XKBA 2BQ7A 2D1JB 2JKHL 3ASIA 1FAXL 1EQHA 3M36L 1GK5A 1F7MA 2PR3B 5JB9E 1M1XB 2H9EC 4ISIL 1CX2A 1MOXC 2FD6A 4X8TL 2XBWL 1EPIA 4M11A 4YT6L 2F9BL 2VWOL 1V3XB 2MHPA 1W8BL 1ATBA 1EZQB 1XKAL 3HS5A 2CJIB 2WYGB 2VWNL 3ZYIB 3KQDL 3NJPC 2G00L 1APQA 3N8YA 1ATDA 1LQDA 1IQKL 4X8SL 2GD4A 5F19A 2OYUP 2PHBB 4JYVL 2BQWA 4OTJA 1BF9A 2RA0L 2W2PE 3LC3B 1RFNB 1UZQA 2Y82B 1XFEA 4MMZB 4OTYA 2NPRA 1UZKA 4CUDA 1IGZA 3R05A 1FF7A 4YZUB 4YT7L 2XBXL 1C5MF 2KV4A 2BMGA 1G1RA 4ZXYL 2VVVL 3RR3A 1JV2B 1YUFA 2J34B 2OYEP 1HX2A 4NGAL 4XLWA 5KIRA 1LPKA 4NG9L 3FCSB 2Q1JB 1N1IA 1YUGA 3NT1A 3F1SB 2EI6B 3KQBL 1KLIL 1LMJA 2P26A 1FJSL 1UZJA 3GISX 1YUKB 2KNIA 2KB9A 1EMOA 1MQ6L 1APOA 1I0UA 2UWPB 1PFXL 2RNLA 4RRXA 1HT8A 2VVCK 6COXA 1L5GB 5L2YL 5JB8E 1CQEA 1HAEA 2WPJE 4JZDL 4LORA 5JBBE 4BTTA 4Y7AB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WG4 B;  1XDT R;  3N8V A;  1HCG B;  2RHP A;  1PGE A;  5IKV A;  3N8W A;  2P94 L;  1ATE A;  2VWL L;  1DDX A;  2WPM E;  1IQM L;  1HJ7 A;  3QMO A;  2I9A A;  4CUE A;  3KRK A;  1B9W A;  5IKQ A;  3KCG L;  4D0F A;  1W7X L;  2P95 L;  3HO5 A;  3NTB A;  4RRY A;  1IGX A;  1DIY A;  4BXS A;  3HS7 A;  2Y7Z B;  3ENS A;  2Y81 B;  1O5D L;  3KQE L;  2MGR A;  3V65 B;  3Q7D A;  5CKM A;  2K2S B;  4ZH8 B;  3SW2 A;  4D90 A;  3OLU A;  5EGM B;  4BDW A;  2W86 A;  2VH0 B;  5KN5 C;  3KQC L;  1U8C B;  2TGF A;  3NTG A;  2P16 L;  2WPI E;  1HAF A;  3MQE A;  3CEN L;  1DQB A;  2B7D L;  1CVU A;  1FFM A;  4BTI A;  1PRH A;  2W3I B;  1EMN A;  3KK6 A;  4LMF A;  3QH0 A;  3OLT A;  1P0S L;  4Y79 B;  2FLB L;  3TH3 L;  2YGO A;  3EGF A;  3FBY A;  2P93 L;  1K36 A;  2DDU A;  2W26 B;  4Y76 B;  5IKT A;  4Z6A L;  2WPH E;  2KL7 A;  4MMY B;  1SZB A;  3IJE B;  2EI7 B;  1Z6C A;  3H5C B;  3MDL A;  1ATA A;  2AYL A;  5L30 L;  1MQ5 L;  1X7A L;  2H9E L;  3HPT A;  1G1S A;  1P9J A;  3SOV A;  1YO8 A;  2ADX A;  1JL9 A;  5I46 L;  1KIG L;  3ZYJ B;  2PUQ L;  1KLO A;  1NFW B;  1HT5 A;  2J2U B;  2P3F N;  4PH9 A;  3N8Z A;  4COX A;  2XC0 L;  1G2M B;  3F6U L;  2WG3 C;  3LAQ A;  4XL1 A;  1KLJ L;  1EAI C;  1IQF L;  4E1G A;  2J95 B;  2BO2 A;  4JZF L;  1QFK L;  1IQG L;  4Y71 B;  3TBD A;  2J4I B;  4Z0K B;  1AUT L;  2XBV L;  2BOX A;  2EI8 B;  2XC4 L;  1U67 A;  2VVU L;  5JBC E;  1IP0 A;  1NZI A;  3Q3K B;  1TPG A;  3LN0 A;  4X8V L;  3P5B L;  5JW1 A;  3HS6 A;  1NFX B;  1IQL L;  3HO3 A;  1N7D A;  1EPG A;  1Z6E L;  4ZXX L;  2W2Q E;  1CCF A;  1OB1 C;  3C9A C;  2VJ3 A;  1FSB A;  2Y5F L;  2WPL E;  1IOE L;  1IOX A;  1KSN B;  1HZ8 A;  1NFY B;  4JZE L;  1ZAQ A;  2W2O E;  3ELA L;  3TK5 B;  3LIW B;  1J9C L;  5L2Z L;  3SOB B;  4CSY A;  4BTU A;  2P28 B;  1F7E A;  1HRF A;  1YGC L;  1JBU L;  2Y7X B;  1IQI L;  1EGF A;  2P3F L;  1CVW L;  4TGF A;  3M37 L;  1IQE L;  3U7U G;  2W2M E;  1WHE A;  1EQG A;  1URK A;  4Z0L A;  4AQT A;  4C16 A;  2VH6 B;  1IVO C;  4BDX A;  1CCV A;  4X8U L;  1F0R B;  3TK6 B;  2WYJ B;  1ADX A;  2M74 A;  2FLG A;  4M10 A;  3GCW E;  1IJQ A;  1NT0 A;  2XC5 L;  2Y80 B;  4BXW A;  3POY A;  2J38 B;  4RUT A;  5JVY A;  3CA7 A;  1IQJ L;  1EPJ A;  1PTH A;  1G2L B;  4ZAE B;  2VWM K;  1TOZ A;  4XBM A;  3CFW A;  2YGP A;  4RS0 A;  1TLE A;  4D0E A;  2W3K B;  3SOQ A;  4G1M B;  3GCX E;  2WPK E;  1COU A;  1WHF A;  2K2T A;  1EBV A;  2BOK L;  1K37 A;  1LPG A;  2UWL B;  1HRE A;  3LN1 A;  2XBY L;  3IIT B;  1DVA L;  1PXX A;  4Y7B B;  5JVZ A;  2BOH A;  4O02 B;  1DX5 I;  5CKN A;  4ZHA B;  3PGH A;  1F0S B;  3LTG D;  3CS7 L;  5F1A A;  3V64 C;  2WFT A;  5COX A;  1CEJ A;  1FAK L;  3K9X A;  3BT1 A;  5CKQ A;  2W2N E;  4JYU L;  4FM5 A;  1L3Y A;  1EPH A;  2WFX B;  3BPS E;  2I9B A;  3N8Y B;  2FZZ L;  4RRZ A;  2FLR L;  3KL6 B;  2P3T A;  2Y38 A;  1G1Q A;  4NA9 L;  2BZ6 L;  2MGP A;  1UZP A;  4O1Z A;  5JBA E;  2Y5H L;  2P3U A;  5IKR A;  3BT2 A;  2Y5G L;  3DEM A;  2J94 B;  1A3P A;  4RRW A;  5FDQ A;  1FE2 A;  5CIS A;  4CUF A;  3LTF B;  3N8X A;  2BQ6 A;  4A7I A;  1Q4G A;  1LPZ A;  5E8D A;  3FFG L;  3TZI A;  3TGF A;  3HO4 A;  1IQH L;  1NPE B;  3LC5 B;  3ZYG A;  3U73 A;  1WU1 B;  2BOU A;  3QCW A;  1G1T A;  3N8W B;  1NFU B;  4MMX B;  4Y6D B;  5K0H B;  1NQL B;  4ISH L;  2UWO B;  1IQN L;  1XKB A;  2BQ7 A;  2D1J B;  2JKH L;  3ASI A;  1FAX L;  1EQH A;  3M36 L;  1GK5 A;  1F7M A;  2PR3 B;  5JB9 E;  1M1X B;  4ISI L;  1CX2 A;  1MOX C;  2FD6 A;  4X8T L;  2XBW L;  1EPI A;  4M11 A;  4YT6 L;  2F9B L;  2VWO L;  1V3X B;  2MHP A;  1W8B L;  1ATB A;  1EZQ B;  1XKA L;  3HS5 A;  2CJI B;  2WYG B;  2VWN L;  3ZYI B;  3KQD L;  3NJP C;  2G00 L;  1APQ A;  3N8Y A;  1ATD A;  1LQD A;  1IQK L;  4X8S L;  2GD4 A;  5F19 A;  2OYU P;  2PHB B;  4JYV L;  2BQW A;  4OTJ A;  1BF9 A;  2RA0 L;  2W2P E;  3LC3 B;  1RFN B;  1UZQ A;  2Y82 B;  1XFE A;  4MMZ B;  4OTY A;  2NPR A;  1UZK A;  4CUD A;  1IGZ A;  3R05 A;  1FF7 A;  4YZU B;  4YT7 L;  2XBX L;  1C5M F;  2KV4 A;  2BMG A;  1G1R A;  4ZXY L;  2VVV L;  3RR3 A;  1JV2 B;  1YUF A;  2J34 B;  2OYE P;  1HX2 A;  4NGA L;  4XLW A;  5KIR A;  1LPK A;  4NG9 L;  3FCS B;  2Q1J B;  1N1I A;  1YUG A;  3NT1 A;  3F1S B;  2EI6 B;  3KQB L;  1KLI L;  1LMJ A;  2P26 A;  1FJS L;  1UZJ A;  3GIS X;  1YUK B;  2KB9 A;  1EMO A;  1MQ6 L;  1APO A;  1I0U A;  2UWP B;  1PFX L;  2RNL A;  4RRX A;  1HT8 A;  2VVC K;  6COX A;  1L5G B;  5L2Y L;  5JB8 E;  1CQE A;  1HAE A;  2WPJ E;  4JZD L;  4LOR A;  5JBB E;  4BTT A;  4Y7A B; 
#chains in the Genus database with same CATH topology
 2WG4 B;  1XDT R;  3N8V A;  1HCG B;  2RHP A;  1PGE A;  5IKV A;  3N8W A;  2P94 L;  1ATE A;  2VWL L;  1DDX A;  2WPM E;  1IQM L;  1HJ7 A;  3QMO A;  2I9A A;  4CUE A;  3KRK A;  1B9W A;  5IKQ A;  3KCG L;  4D0F A;  1W7X L;  2P95 L;  1V1I A;  3HO5 A;  3NTB A;  4RRY A;  1IGX A;  1DIY A;  4BXS A;  3HS7 A;  2Y7Z B;  3ENS A;  2Y81 B;  1O5D L;  3KQE L;  2MGR A;  3V65 B;  3Q7D A;  5CKM A;  2K2S B;  4ZH8 B;  3SW2 A;  4D90 A;  3OLU A;  5EGM B;  4BDW A;  2W86 A;  2VH0 B;  5KN5 C;  3KQC L;  1U8C B;  2TGF A;  3NTG A;  2P16 L;  2WPI E;  1HAF A;  3MQE A;  3CEN L;  1DQB A;  2B7D L;  1CVU A;  1FFM A;  4A94 C;  4BTI A;  1PRH A;  2W3I B;  1EMN A;  3KK6 A;  4LMF A;  3QH0 A;  3OLT A;  1P0S L;  4Y79 B;  2FLB L;  3TH3 L;  2YGO A;  3EGF A;  3FBY A;  2P93 L;  1K36 A;  2DDU A;  2W26 B;  4Y76 B;  5IKT A;  4Z6A L;  2WPH E;  2KL7 A;  4MMY B;  1SZB A;  3IJE B;  3S6X A;  2EI7 B;  1Z6C A;  3H5C B;  2YGQ A;  3MDL A;  1ATA A;  2AYL A;  5L30 L;  1MQ5 L;  1X7A L;  2H9E L;  3HPT A;  1G1S A;  1P9J A;  3SOV A;  1YO8 A;  2ADX A;  1JL9 A;  5I46 L;  1KIG L;  3ZYJ B;  2PUQ L;  1KLO A;  1NFW B;  1HT5 A;  2J2U B;  2P3F N;  4PH9 A;  3N8Z A;  4COX A;  2XC0 L;  1G2M B;  3F6U L;  2WG3 C;  3LAQ A;  4XL1 A;  1LK9 A;  1KLJ L;  1EAI C;  1IQF L;  4E1G A;  2J95 B;  2BO2 A;  2HOX A;  1QFK L;  1IQG L;  4JZF L;  4Y71 B;  3TBD A;  2J4I B;  4Z0K B;  1AUT L;  2XBV L;  1V1H A;  2BOX A;  2EI8 B;  2XC4 L;  1U67 A;  2VVU L;  5JBC E;  1IP0 A;  1NZI A;  3Q3K B;  1TPG A;  3LN0 A;  4X8V L;  3P5B L;  5JW1 A;  3HS6 A;  1NFX B;  1IQL L;  3HO3 A;  1N7D A;  1EPG A;  1Z6E L;  4ZXX L;  2HOR A;  2W2Q E;  1CCF A;  1OB1 C;  3C9A C;  2VJ3 A;  1FSB A;  2Y5F L;  2WPL E;  1IOE L;  1QIU A;  1IOX A;  1KSN B;  1HZ8 A;  1NFY B;  4JZE L;  1ZAQ A;  2W2O E;  3ELA L;  3TK5 B;  3LIW B;  1J9C L;  5L2Z L;  3SOB B;  4CSY A;  4BTU A;  2P28 B;  1F7E A;  1HRF A;  1YGC L;  1JBU L;  2Y7X B;  1IQI L;  1LMM A;  1EGF A;  2P3F L;  1CVW L;  4TGF A;  3M37 L;  1IQE L;  3U7U G;  2W2M E;  1WHE A;  1EQG A;  1URK A;  4Z0L A;  4AQT A;  4C16 A;  2VH6 B;  1IVO C;  4BDX A;  1CCV A;  4X8U L;  1F0R B;  3TK6 B;  2WYJ B;  2JJL A;  1ADX A;  2M74 A;  2FLG A;  4M10 A;  3GCW E;  1IJQ A;  1NT0 A;  2XC5 L;  2Y80 B;  4BXW A;  3POY A;  2J38 B;  4RUT A;  5JVY A;  3CA7 A;  1IQJ L;  1EPJ A;  1PTH A;  1G2L B;  4ZAE B;  2VWM K;  1TOZ A;  4XBM A;  3CFW A;  2YGP A;  4RS0 A;  1TLE A;  4D0E A;  2W3K B;  3SOQ A;  4G1M B;  3GCX E;  2WPK E;  1COU A;  1WHF A;  2K2T A;  1EBV A;  2BOK L;  2VRS A;  1K37 A;  1LPG A;  2UWL B;  1HRE A;  3LN1 A;  2XBY L;  3IIT B;  1DVA L;  1PXX A;  4Y7B B;  5JVZ A;  2BOH A;  4O02 B;  1DX5 I;  5CKN A;  4ZHA B;  3PGH A;  1F0S B;  3LTG D;  3CS7 L;  5F1A A;  3V64 C;  2WFT A;  5COX A;  1CEJ A;  2BT8 A;  1FAK L;  3K9X A;  3BT1 A;  5CKQ A;  2W2N E;  4JYU L;  4FM5 A;  1L3Y A;  1EPH A;  2WFX B;  3BPS E;  2I9B A;  2WZP P;  3N8Y B;  2FZZ L;  4RRZ A;  2FLR L;  1KKE A;  3KL6 B;  2P3T A;  2Y38 A;  1G1Q A;  4NA9 L;  2BZ6 L;  2MGP A;  1UZP A;  4O1Z A;  5JBA E;  2Y5H L;  2P3U A;  5IKR A;  3BT2 A;  2Y5G L;  3DEM A;  2J94 B;  4GU4 A;  1A3P A;  4RRW A;  5FDQ A;  1FE2 A;  5CIS A;  4CUF A;  3LTF B;  3N8X A;  2BQ6 A;  4A7I A;  1Q4G A;  1LPZ A;  5E8D A;  3FFG L;  3TZI A;  3TGF A;  3HO4 A;  1IQH L;  1NPE B;  3LC5 B;  3ZYG A;  3U73 A;  1WU1 B;  2BOU A;  3QCW A;  1G1T A;  3N8W B;  1NFU B;  4MMX B;  4Y6D B;  5K0H B;  1NQL B;  4ISH L;  2UWO B;  1IQN L;  1XKB A;  2BQ7 A;  2D1J B;  2JKH L;  3ASI A;  1FAX L;  1EQH A;  3M36 L;  1GK5 A;  1F7M A;  2PR3 B;  5JB9 E;  1M1X B;  2H9E C;  4ISI L;  1CX2 A;  1MOX C;  2FD6 A;  4X8T L;  2XBW L;  1EPI A;  4M11 A;  4YT6 L;  2F9B L;  2VWO L;  1V3X B;  2BT7 A;  2MHP A;  1W8B L;  1ATB A;  1EZQ B;  1XKA L;  3HS5 A;  2CJI B;  2WYG B;  2VWN L;  3ZYI B;  3KQD L;  3NJP C;  2G00 L;  1APQ A;  3N8Y A;  1ATD A;  1LQD A;  1IQK L;  4X8S L;  2GD4 A;  5F19 A;  2OYU P;  2PHB B;  4JYV L;  4GU3 A;  2BQW A;  4OTJ A;  1BF9 A;  2RA0 L;  2W2P E;  3LC3 B;  1RFN B;  1UZQ A;  2Y82 B;  1XFE A;  4MMZ B;  4OTY A;  2NPR A;  1UZK A;  4CUD A;  1IGZ A;  3R05 A;  1FF7 A;  4YZU B;  4YT7 L;  2XBX L;  1C5M F;  2KV4 A;  2BMG A;  1G1R A;  4ZXY L;  2VVV L;  3RR3 A;  1JV2 B;  1YUF A;  2J34 B;  2OYE P;  1HX2 A;  4NGA L;  4XLW A;  5KIR A;  1LPK A;  4NG9 L;  3FCS B;  2Q1J B;  1N1I A;  1YUG A;  3NT1 A;  3F1S B;  2EI6 B;  3KQB L;  1KLI L;  1LMJ A;  2P26 A;  1FJS L;  1UZJ A;  3GIS X;  1YUK B;  2KNI A;  2BSF A;  2KB9 A;  1EMO A;  1MQ6 L;  1APO A;  1I0U A;  2UWP B;  1PFX L;  2RNL A;  4RRX A;  1HT8 A;  2VVC K;  6COX A;  1L5G B;  5L2Y L;  5JB8 E;  1CQE A;  1HAE A;  2WPJ E;  4JZD L;  4LOR A;  5JBB E;  4BTT A;  4Y7A B; 
#chains in the Genus database with same CATH homology
 2WG4 B;  1XDT R;  3N8V A;  1HCG B;  2RHP A;  1PGE A;  5IKV A;  3N8W A;  2P94 L;  1ATE A;  2VWL L;  1DDX A;  2WPM E;  1IQM L;  1HJ7 A;  3QMO A;  2I9A A;  4CUE A;  3KRK A;  1B9W A;  5IKQ A;  3KCG L;  4D0F A;  1W7X L;  2P95 L;  3HO5 A;  3NTB A;  4RRY A;  1IGX A;  1DIY A;  4BXS A;  3HS7 A;  2Y7Z B;  3ENS A;  2Y81 B;  1O5D L;  3KQE L;  2MGR A;  3V65 B;  3Q7D A;  5CKM A;  2K2S B;  4ZH8 B;  3SW2 A;  4D90 A;  3OLU A;  5EGM B;  4BDW A;  2W86 A;  2VH0 B;  5KN5 C;  3KQC L;  1U8C B;  2TGF A;  3NTG A;  2P16 L;  2WPI E;  1HAF A;  3MQE A;  3CEN L;  1DQB A;  2B7D L;  1CVU A;  1FFM A;  4A94 C;  4BTI A;  1PRH A;  2W3I B;  1EMN A;  3KK6 A;  4LMF A;  3QH0 A;  3OLT A;  1P0S L;  4Y79 B;  2FLB L;  3TH3 L;  2YGO A;  3EGF A;  3FBY A;  2P93 L;  1K36 A;  2DDU A;  2W26 B;  4Y76 B;  5IKT A;  4Z6A L;  2WPH E;  2KL7 A;  4MMY B;  1SZB A;  3IJE B;  3S6X A;  2EI7 B;  1Z6C A;  3H5C B;  2YGQ A;  3MDL A;  1ATA A;  2AYL A;  5L30 L;  1MQ5 L;  1X7A L;  2H9E L;  3HPT A;  1G1S A;  1P9J A;  3SOV A;  1YO8 A;  2ADX A;  1JL9 A;  5I46 L;  1KIG L;  3ZYJ B;  2PUQ L;  1KLO A;  1NFW B;  1HT5 A;  2J2U B;  2P3F N;  4PH9 A;  3N8Z A;  4COX A;  2XC0 L;  1G2M B;  3F6U L;  2WG3 C;  3LAQ A;  4XL1 A;  1KLJ L;  1EAI C;  1IQF L;  4E1G A;  2J95 B;  2BO2 A;  4JZF L;  1QFK L;  1IQG L;  4Y71 B;  3TBD A;  2J4I B;  4Z0K B;  1AUT L;  2XBV L;  2BOX A;  2EI8 B;  2XC4 L;  1U67 A;  2VVU L;  5JBC E;  1IP0 A;  1NZI A;  3Q3K B;  1TPG A;  3LN0 A;  4X8V L;  3P5B L;  5JW1 A;  3HS6 A;  1NFX B;  1IQL L;  3HO3 A;  1N7D A;  1EPG A;  1Z6E L;  4ZXX L;  2W2Q E;  1CCF A;  1OB1 C;  3C9A C;  2VJ3 A;  1FSB A;  2Y5F L;  2WPL E;  1IOE L;  1IOX A;  1KSN B;  1HZ8 A;  1NFY B;  4JZE L;  1ZAQ A;  2W2O E;  3ELA L;  3TK5 B;  3LIW B;  1J9C L;  5L2Z L;  3SOB B;  4CSY A;  4BTU A;  2P28 B;  1F7E A;  1HRF A;  1YGC L;  1JBU L;  2Y7X B;  1IQI L;  1LMM A;  1EGF A;  2P3F L;  1CVW L;  4TGF A;  3M37 L;  1IQE L;  3U7U G;  2W2M E;  1WHE A;  1EQG A;  1URK A;  4Z0L A;  4AQT A;  4C16 A;  2VH6 B;  1IVO C;  4BDX A;  1CCV A;  4X8U L;  1F0R B;  3TK6 B;  2WYJ B;  1ADX A;  2M74 A;  2FLG A;  4M10 A;  3GCW E;  1IJQ A;  1NT0 A;  2XC5 L;  2Y80 B;  4BXW A;  3POY A;  2J38 B;  4RUT A;  5JVY A;  3CA7 A;  1IQJ L;  1EPJ A;  1PTH A;  1G2L B;  4ZAE B;  2VWM K;  1TOZ A;  4XBM A;  3CFW A;  2YGP A;  4RS0 A;  1TLE A;  4D0E A;  2W3K B;  3SOQ A;  4G1M B;  3GCX E;  2WPK E;  1COU A;  1WHF A;  2K2T A;  1EBV A;  2BOK L;  1K37 A;  1LPG A;  2UWL B;  1HRE A;  3LN1 A;  2XBY L;  3IIT B;  1DVA L;  1PXX A;  4Y7B B;  5JVZ A;  2BOH A;  4O02 B;  1DX5 I;  5CKN A;  4ZHA B;  3PGH A;  1F0S B;  3LTG D;  3CS7 L;  5F1A A;  3V64 C;  2WFT A;  5COX A;  1CEJ A;  1FAK L;  3K9X A;  3BT1 A;  5CKQ A;  2W2N E;  4JYU L;  4FM5 A;  1L3Y A;  1EPH A;  2WFX B;  3BPS E;  2I9B A;  2WZP P;  3N8Y B;  2FZZ L;  4RRZ A;  2FLR L;  3KL6 B;  2P3T A;  2Y38 A;  1G1Q A;  4NA9 L;  2BZ6 L;  2MGP A;  1UZP A;  4O1Z A;  5JBA E;  2Y5H L;  2P3U A;  5IKR A;  3BT2 A;  2Y5G L;  3DEM A;  2J94 B;  1A3P A;  4RRW A;  5FDQ A;  1FE2 A;  5CIS A;  4CUF A;  3LTF B;  3N8X A;  2BQ6 A;  4A7I A;  1Q4G A;  1LPZ A;  5E8D A;  3FFG L;  3TZI A;  3TGF A;  3HO4 A;  1IQH L;  1NPE B;  3LC5 B;  3ZYG A;  3U73 A;  1WU1 B;  2BOU A;  3QCW A;  1G1T A;  3N8W B;  1NFU B;  4MMX B;  4Y6D B;  5K0H B;  1NQL B;  4ISH L;  2UWO B;  1IQN L;  1XKB A;  2BQ7 A;  2D1J B;  2JKH L;  3ASI A;  1FAX L;  1EQH A;  3M36 L;  1GK5 A;  1F7M A;  2PR3 B;  5JB9 E;  1M1X B;  2H9E C;  4ISI L;  1CX2 A;  1MOX C;  2FD6 A;  4X8T L;  2XBW L;  1EPI A;  4M11 A;  4YT6 L;  2F9B L;  2VWO L;  1V3X B;  2MHP A;  1W8B L;  1ATB A;  1EZQ B;  1XKA L;  3HS5 A;  2CJI B;  2WYG B;  2VWN L;  3ZYI B;  3KQD L;  3NJP C;  2G00 L;  1APQ A;  3N8Y A;  1ATD A;  1LQD A;  1IQK L;  4X8S L;  2GD4 A;  5F19 A;  2OYU P;  2PHB B;  4JYV L;  2BQW A;  4OTJ A;  1BF9 A;  2RA0 L;  2W2P E;  3LC3 B;  1RFN B;  1UZQ A;  2Y82 B;  1XFE A;  4MMZ B;  4OTY A;  2NPR A;  1UZK A;  4CUD A;  1IGZ A;  3R05 A;  1FF7 A;  4YZU B;  4YT7 L;  2XBX L;  1C5M F;  2KV4 A;  2BMG A;  1G1R A;  4ZXY L;  2VVV L;  3RR3 A;  1JV2 B;  1YUF A;  2J34 B;  2OYE P;  1HX2 A;  4NGA L;  4XLW A;  5KIR A;  1LPK A;  4NG9 L;  3FCS B;  2Q1J B;  1N1I A;  1YUG A;  3NT1 A;  3F1S B;  2EI6 B;  3KQB L;  1KLI L;  1LMJ A;  2P26 A;  1FJS L;  1UZJ A;  3GIS X;  1YUK B;  2KNI A;  2KB9 A;  1EMO A;  1MQ6 L;  1APO A;  1I0U A;  2UWP B;  1PFX L;  2RNL A;  4RRX A;  1HT8 A;  2VVC K;  6COX A;  1L5G B;  5L2Y L;  5JB8 E;  1CQE A;  1HAE A;  2WPJ E;  4JZD L;  4LOR A;  5JBB E;  4BTT A;  4Y7A B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...