2VWQA

Haloferax mediterranei glucose dehydrogenase in complex with nadp and zn.
Total Genus 117
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
117
sequence length
357
structure length
357
Chain Sequence
MKAIAVKRGEDRPVVIEKPRPEPESGEALVRTLRVGVDGTDHEVIAGGHGGFPEGEDHLVLGHEAVGVVVDPNDTELEEGDIVVPTVRRPPASGTNEYFERDQPDMAPDGMYFERGIVGAHGYMSEFFTSPEKYLVRIPRSQAELGFLIEPISITEKALEHAYASRSAFDWDPSSAFVLGNGSLGLLTLAMLKVDDKGYENLYCLGRRDRPDPTIDIIEELDATYVDSRQTPVEDVPDVYEQMDFIYEATGFPKHAIQSVQALAPNGVGALLGVPSDWAFEVDAGAFHREMVLHNKALVGSVNSHVEHFEAATVTFTKLPKWFLEDLVTGVHPLSEFEAAFDDDDTTIKTAIEFSTV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active site dynamics in the zinc-dependent medium chain alcohol dehydrogenase superfamily.
pubmed doi rcsb
source organism Haloferax mediterranei
molecule tags Oxidoreductase
molecule keywords GLUCOSE DEHYDROGENASE
total genus 117
structure length 357
sequence length 357
ec nomenclature ec 1.1.1.47: Glucose 1-dehydrogenase (NAD(P)(+)).
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08240 ADH_N Alcohol dehydrogenase GroES-like domain
A PF16912 Glu_dehyd_C Glucose dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2vwqA02
3.90.180.10 Alpha Beta Alpha-Beta Complex Quinone Oxidoreductase; Chain A, domain 1 Medium-chain alcohol dehydrogenases, catalytic domain 2vwqA01
4OYRA 1B2LA 2DBRA 2ZJ0A 3FTNA 3QLJA 1HETA 1CEQA 2Y66A 3INGA 4DC1A 3JD0A 9LDTA 4EJ0A 2IXAA 1PR3A 1EVIA 4J4BA 5A9TA 5A4DA 1IZ0A 4TZKA 2YZ7A 4J0FA 2Y0CA 3K5PA 3U09A 2JHGA 3PGXA 3SEFA 1DEHA 3LF1A 2AQKA 2B37A 1TVEA 3WFJA 4BO3A 1HSOA 4E21A 1IE3A 4CM9A 2Y1DA 4AJHA 4Z0TA 3VZQA 1I3NA 2VYVA 1BRMA 4XB1A 3DBHB 4L4RA 1MFZA 4PLGA 3RD5A 3B6ZA 4OQYA 4BO1A 5DOZA 4RF3A 4RF5A 4F6CA 4BL5A 1EMDA 3TZCA 1RKXA 1GUYA 2GRAA 3TL2A 5KJ6A 1LC3A 3OEWA 4TWRA 1ADFA 1E6EA 1M67A 2E82A 3LT0A 3WYEA 2Q2WA 2QW8A 2H1SA 1FXSA 4HY3A 3DTYA 3G0OA 4ALLA 1DAPA 3PHGA 4PG4A 4BNXA 4R3WA 4W7IA 4XR4A 4OAQA 1LBEA 2H6EA 4I08A 2D1YA 1SEPA 1HL3A 4R1UA 1HTBA 4CM8A 5B4VA 4Y98A 1R4NA 2Q4EA 4G81A 3KUXA 4BNKA 2Y1OA 3GDFA 5JS6A 4CMHA 2BRUA 3UGKA 3L9WA 5MGBA 1JVBA 1P1HA 5JCJD 3HDQA 1I3KA 2ZB3A 4ID9A 4TRNA 3ZNOA 4HNGA 1HDGO 3HDYA 5DCYA 1GV0A 3DWFA 4JCOA 4RL6A 4BNWA 2FWMX 1K5HA 1XHLA 2HSDA 4II2A 4OIMA 3Q6IA 1UXKA 3WNQA 4UVDA 2GPTA 4CLOB 3KBOA 4JIGA 1ISFA 1NASA 4GX5A 4XQCA 2EW2A 2NU6A 4GKBA 4XEHA 1E3JA 1JA9A 4YAGA 3E9QA 4MVJA 5CDUA 3BIOA 4TROA 1E1MA 4ALMA 1P31A 2EWMA 5TF4A 5CDTA 3KYBA 1E7SA 4DQXA 5JYDA 3KLPX 4NPCA 5L45A 1YXMA 1T4BA 3NKLA 3E5RA 1JKIA 4HFJA 3ZWYA 5L7YA 2X58A 1PJTA 1ZK3A 4OSOA 3CKYA 4BQRA 2A92A 4PLWA 1PQWA 2P2SA 1HEUA 3QJ5A 1JDJA 1NM5A 4PZEA 5JY1A 1K89A 1NHGA 2HMUA 2HMTA 3WS7A 1N9GB 4DPKA 3TZHA 4AL4A 4E0BA 4ZQBA 4BNVA 3UW3A 4XIYA 1HYHA 2EP7A 3ABIA 4BMNA 1SC6A 1DC6A 1SCUA 2X9VA 1H0KA 2X0RA 3CUKA 1N2SA 3WIEA 3JQAD 3GDOA 1E7QA 3MJVA 4TMFA 3F3SA 1NQ5A 4IIVA 4MP6A 1M2WA 3WMWA 4B4WA 4MVJI 1JQBA 1NWCA 1DFIA 5DNAA 3AM3A 3K96A 4YR9A 4TZTA 4DUPA 3B20A 3VDQA 1XWFA 1H2HA 1YBAA 2YFQA 1LA2A 4PZDA 3WGZA 2VWPA 4D3SA 5IDQA 2PTGA 2VYND 3NDRA 4L76A 2WMDA 3H5AA 1M75A 5JPIA 3TZQA 1NTOA 3GDGA 3QWBA 3I4FA 3OF2A 2C29D 4XQ9A 3JQGB 3H3JA 4IY1A 2X0NA 2JAHA 1ADBA 3ZNNA 2GUGA 1QXSA 3SC6A 1NFRA 3FI9A 2FR8A 1ZH8A 5I9NA 1E1KA 4NR0A 2B36A 4ZQEA 5IZ4A 3FBGA 2AG5A 1YB5A 3MCVA 3DB2A 3DMTA 1V8BA 3ITDA 5JDIA 3WFIA 4A5OA 3OJ0A 3GUCA 4WNCA 5TQVA 1VM6A 3AY7A 1RM5A 1KY5A 4NIMA 4OSPA 1C0KA 4GX0A 1HDOA 4JROA 4Z9FA 3VTZA 1AE1A 5DBGA 1U8FO 1KERA 3RKRA 2PK3A 1Y81A 3T7CA 2CDCA 3EMKA 4BMVA 1JLLA 1DHTA 3QWIA 4YACA 1BSVA 3VH4A 1E3WB 4MDHA 4EUEA 1UDCA 5ITVA 4Z9XA 5THKA 2DPGA 3KEQA 3PJEA 4Q9NA 3VVCA 3KYDB 2DTXA 3BTVA 1WLYA 4EBFA 4FB5A 4M8SA 1PS9A 4R3NA 3ZW9A 5H81A 3RUEA 1A9YA 2FPGA 4R68A 1VJTA 3E82A 1QRRA 2GGSA 4GGOA 4MVJP 4KMSA 1NNUA 1Y8RA 5A05A 3ZDFA 1U3VA 5KJFA 2C2XA 4NBTA 2G5CA 1LDBA 5KIAA 2VWGA 1KC1A 1KYQA 1TEHA 3LZ6A 5DULA 3F1KA 4BIIA 1XKQA 3QW2A 2BKAA 4KTTE 3EW7A 4DREA 4P22A 5K1SA 1HDZA 3G49A 1A7KA 5ICSA 1HYEA 1EBUA 1XQ6A 1VKOA 2PA3A 3JQFA 2D4AA 2I3AA 1Q7GA 2ET6A 4DIBA 3WGIA 3JYNA 4J91A 4OJNA 1CERA 3F5QA 4P4NA 2Y99A 4Z9YA 3ZNPA 2O23A 1U3UA 5A04A 5BNIA 1ZEMA 4BGIA 4A26A 3LVFO 1B3RA 1GY8A 1EK5A 4RVGA 3I9OA 1I33A 1SB8A 1O95A 3GH3A 3WBBA 2P9GA 3RJ9A 3PP8A 4TRRA 3C85A 3BXXA 2FY8A 3N7UA 4MVJG 3K30A 1EUZA 1Q1NA 3WSWA 2BF7A 1GQ2A 3CPSA 3H6KA 4YRDA 2CF6A 4JLWA 4PZCA 3F46A 1LJ8A 3EZYA 2Y1EA 4H16A 4CM4A 1FMCA 2X5JO 1ZCJA 4WOJA 3I6IA 4IDCA 1GUFA 5I8ZA 1DIAA 4GX2A 5KVCA 1CIVA 3PJFA 1XA0A 4Z3DA 3VZPA 5HBRA 1RM0A 1K0UA 3ST7A 1EFLA 3ETGA 1KS9A 1LSJA 1P44A 1R12A 2RBEA 4IDAA 5K6AC 5KNLA 4B8WA 4J9VA 1SB9A 1U5AA 1ENZA 3KM0A 1O9BA 4E6PA 2GO1A 4NK4A 4PVDA 4KOAA 1K6JA 5L3ZA 2GCGA 3DQPA 1PJBA 4MP8A 1I30A 2C82A 4WLVA 8ADHA 3EUWA 5H82A 2W2KB 2WM3A 3PXXA 2BI8A 3PIIA 5TIIA 4UVIA 2W4QA 4DLBA 1EUCA 5ADHA 1UP4A 3MEQA 2VNSA 2JJYA 4J49A 2I9PA 5L95A 3ZWNA 3JQAB 4NBRA 4EDFA 3GEMA 3NT2A 4CMKA 2VZ9A 4DVJA 1A4IA 4RPHA 3TRIA 3I23A 2AQHA 3ZWWA 1H9BA 1QR6A 4IXWA 4Q3DA 4RZIA 4X54A 5EPOA 3FSRA 3UICA 2HUNA 1YQDA 4RLSA 1IHXA 1MP0A 4P4LA 4ZQFA 2FR0A 1C1XA 1HE5A 3SBOA 3EY4A 3JQ7A 5H83A 3BMNA 3ZWVA 2CVZA 4WCFC 3R1IA 1PGJA 1E5QA 1ZBQA 5TNXA 5A1TA 2JL1A 3MOIA 1DOHA 2GR9A 4JP3A 5CFZA 2EKLA 4G2NA 1X0XA 4ZGWA 5DN9A 3DBLA 4M87A 1DXYA 4YEDA 4WE3A 2DAPA 2R2GA 5G4LA 1YB1A 5I7FA 4L73A 1Q7CA 1MXFA 4FFRA 4LSWA 4LGVA 2H63A 4HX5A 4OXYA 5T64A 4UEOA 3V1TC 5DP1A 3ROQA 4DLAA 1R16A 4W4TA 4J0EA 3MJSA 4UAGA 3C1TA 4ITUA 4M55A 4I5GA 3GG9A 4RCVA 3GPIA 3GLQA 7ADHA 5T5QA 1PZFA 1C1DA 3HNPA 3S2FA 4XRRA 3ULKA 2DT5A 3AOEC 2VT2A 2P4QA 1KC3A 2OUIA 3MJCA 4YT8A 1I3LA 2DKNA 2EEZA 1PU2A 3BMOB 3IOYA 1H6BA 3GAZA 3PWKA 1DFHA 3SVTA 4DRYA 4JXKA 3C24A 1LSSA 3QV1A 4OKNA 1UXGA 1D1TA 4R51A 1X7DA 5F3RA 5L53A 4KWIA 3IIEA 2QRLA 2YV2A 3O03A 3FRJA 1IY8A 3AUSA 1T2AA 4D79A 4U0JA 4TKMA 5B1YA 5KJCA 1CRWG 3WTBA 3I9NA 5COQA 1ZSNA 3BMNB 1IHYA 4OOEA 4D3DA 3QP9A 4R9SA 4BNTA 1ZKMA 4TQGA 3I1JA 4H7PA 2PR2A 1O8CA 2PGDA 4BKOA 4EGFA 5T8KA 3ONEA 1HKUA 3SX2A 3NJ4A 1KEVA 1WWKA 2IXBA 2J3KA 2YY7A 2YHUA 1X0VA 1GZ6A 4JQCA 2X5KO 1VL8A 1MA0A 2X6TA 1BDBA 4R41A 4H15A 2JHFA 3LT1A 1Y5RA 3ZU5A 3H3FA 2P9EA 1X7HA 4JNKA 4YJFB 1PZHA 1V9LA 3QVOA 2C07A 1CWUA 4ALJA 4ZU3A 2NLOA 2W2KA 1DIHA 1ZSVA 1JWBB 1L1FA 4BNNA 4U6QA 3AI3A 2ZB4A 1T1RA 1BGVA 2WD8A 4BVAA 4UUNA 4HV4A 4XRGA 4ESOA 1C0PA 4NBUA 3ZWBA 3JQ7B 5EN4A 4AJ4A 5TLSA 4CQMD 3WXBA 4ZJUA 2X4GA 5JCJA 4BO8A 5GZ3A 1CF2O 3F4BA 3PWZA 4TVBA 1RJWA 2CFCA 1BW9A 1V3TA 3MTJA 4R1NA 3GGGA 2UDPA 3JD3A 4YJHA 5TT1A 2B4RO 3W4KA 1OI7A 1PGPA 3WGTA 4E2WA 1MC4A 4YVFA 5L9AA 4XYBA 3AM5A 5GY7A 5F1KA 2POQX 3RUIA 4A10A 1DAOA 3AU9A 4BB6A 5KJEA 3WGYA 1LRLA 4WUVA 1OC4A 4IZIA 4Y6SA 4JX8A 3DBLB 4IGFA 1E92A 4CLEA 5HS4A 1ZMTA 2R00A 3GC6A 3AJRA 5A3JA 4XB2A 3DZKA 3I52A 5I8WA 2DC1A 4CODB 3HDHA 5AXCA 3GFGA 2FR1A 3L0DA 3WOHA 1A71A 5ICMA 4OL9A 1U2GA 1G1AA 4DC0A 3VKUA 2FPIA 4I5FA 2NQTA 1MX3A 4A27A 4YB8A 1QMGA 4CQLB 3ASUA 1VPDA 5EMHA 1LDYA 3ENNA 1GPJA 3WGOA 4ZRNA 5IN5A 3WSVA 2VT3A 2ZCUA 3KOUA 2X23A 1E7WA 3PK0A 1OZAA 4FFLA 1JTVA 4EZBA 5IG2A 5LDHA 3UAGA 1QYVA 3GGOA 1NHWA 1B3BA 1DRUA 3DC2A 3PEFA 3QVXA 5AXDA 4BNYA 5IZCC 2DFDA 1B15A 4KQWA 2BMAA 4WOKA 2CDAA 3FBTA 1PS0A 4R69A 1EK6A 5DZSA 1NAHA 2JAPA 2HQ1A 3RFVA 4HFRA 2ZIZA 3KXDA 2XXBA 1YOVA 2NWQA 3DMYA 1FK8A 1KOLA 5L4NA 3OQBA 2Q3EA 1I3MA 1R6DA 2ZTVA 3VTFA 3W6ZA 2FZEA 2QHXA 2Q1SA 3KO8A 4QECA 2PZKA 3JD1A 3VH1A 1B7GO 1ULUA 4CMGA 1JAXA 2RAFA 3OECA 3NDIA 3TPCA 4FGSA 3KETA 2PH3A 1UP6A 1ENYA 4RZHA 1IPEA 4GLOA 5F1PA 5EL0A 4B7UA 2D8AA 4Q3BA 4R1TA 2PH5A 1U3WA 5IZCA 3PQDA 4HFMA 2E6UX 1PTJA 4J4HA 4NJOA 2A4KA 3R6DA 1P9LA 2DVMA 5JBIA 3E9MA 3KSDO 2VHXA 1NVTA 4PFJA 1H94A 2AEFA 4PRKA 3H7AA 4YAIA 4YT5A 3ON5A 2IDZA 2IYOA 2OOSA 5T67A 1P1KA 1CJCA 3QVTA 4IJUA 4R16A 1I01A 1KVRA 4ZQGA 2G76A 2BLLA 2EGGA 5F1OA 4YJFA 1P0FA 3PVZA 1GCOA 2OFPA 3JQ8B 3TZKA 1E6UA 3Q11A 4OGWA 3VZRA 1UAGA 4MO2A 3F4LA 4URFA 3JD4A 3TZ6A 4CMIB 4F46A 4XQEA 1M66A 2GF2A 4J1QA 4DLLA 2B35A 2P5YA 4S3MA 1P1FA 3DBVO 1PJQA 5L40A 3F5SA 3RKUA 3HG7A 4ZD6A 2HU2A 2WE7A 4LMRA 4Q3EA 3KYDA 4PLVA 1VJ0A 3VDRA 4EYEA 3V1YA 2DUWA 4INAA 3BYZA 1JKFA 2EV9A 4YAEA 4B3JA 3H9UA 3Q1LA 4GSLA 4L4SA 5IDXA 4BV8A 5C7OO 3G3EA 3HJAA 2V65A 1VI2A 3EC7A 3H65A 3RUFA 3VPHA 3WGHA 1W0CA 5IXYA 4NNJA 4TSKA 2C7GA 5A06A 3U4IA 2XF8A 2W90A 5C7LO 4XWYA 1U4OA 3QY9A 1QV6A 2AE1A 1H2BA 3LC7O 3H9GA 1D8AA 4HP8A 4BO0A 5KOIA 6ADHA 1U28A 3JV7A 3O8QB 2FN7A 5JMPA 3PZBA 2CSUA 4XZ3A 3ZWOA 4MKXA 3ANLA 4UEJA 4EITA 5A03A 3NJ8A 1SAYA 2HK7A 1ZK1A 3VPSA 4J3FA 2W98A 3DONA 3DZHA 3V1UA 5BQFA 3U49A 4O5OA 4L9RA 2PD3A 2ZYDA 3WWYA 3MWDB 3PFFA 4D46A 2OZPA 3PDJA 4PLFA 2Y05A 1HT0A 5A9RA 4NMHA 1Y6JA 1WP4A 3FCOA 4AJLA 4WASA 4UULA 5JLAA 1NQTA 2UVDA 4LVUA 5JCXA 4KQXA 4K6CA 3FTPA 1U7HA 4MVJH 1ZK0A 1X1EA 5ES3A 2VUUA 2P91A 4EJMA 2YQ4A 4PG5A 1YDWA 5EESA 5MDHA 1SEVA 1LC0A 4DWVA 2LDBA 1EQ2A 5KVSA 1YL5A 1Y8QA 2TMDA 3PTZA 1PL6A 5EINA 3PLNA 1T2DA 4MIOA 5IF3A 2YHIB 4O63O 1E0DA 4IGEA 3AU8A 1HRDA 2X7HA 4WKGA 2O50A 1DBVO 2G17A 3B1KA 4ZQHA 3DEYX 1E1NA 4BQPA 1FF9A 2A35A 3RBVA 2IE0A 4J7CA 5EERA 3AK4A 4MIYA 3TOXA 4M86A 1E1LA 5AOVA 5K9ZA 3I9JA 2BGKA 1U5CA 3E03A 2O3SA 1ADCA 4I5DA 2JFFA 3R3SA 1K3TA 5DT9A 5HS6A 4B4UA 4IDEA 1YS4A 4J7UA 4UVHA 3DAGA 1NWHA 5IJZA 1J5PA 5I7EA 4CLOA 2Y1GA 3GPDG 3RC9A 3SJ7A 3TWOA 3WYBA 4CMAA 3S1LA 1EE9A 4FDAA 3G1UA 2Y67A 5JAMA 1T1SA 4E2XA 5C5IA 1WMAA 2VTEA 2BHLA 2X5OA 3OA0A 4Z0PA 5JXWA 1VLLA 2PD6A 1H5QA 3D4NA 1LRJA 1Z7BA 3Q3CA 4L8VA 5G0VA 2EXXA 3RI3A 5A9SB 2HLPA 1IULA 3NRCA 1IZ9A 1WZEA 3HHPA 4M89A 3A28A 5HWSA 4RVUA 3V2GA 3AFNA 3HB5X 3ZHXA 3DTTA 2OP0A 4K9DA 5IDWA 4LSMA 1OBFO 5GMOA 5KCZA 1ADGA 1R4MA 1YJQA 4WECA 4A03A 3OICA 1M76A 3EAGA 1ONPA 2PD4A 1U8XX 3ROPA 3I5MA 4RF2A 3C1AA 2W2LA 3Q2KA 1TT7A 2H5LA 2PZJA 4Y9DA 3E6AA 3EK2A 1NP3A 2YV1A 3QVWA 3KYCA 2A94A 1HF3A 2NVUA 3UN1A 4CM5A 5A5FA 1J4AA 5L7TA 2VYVD 5LC1A 3HB4X 1EEHA 3ONDA 4PVCA 3Q9NA 2OBYA 3RUCA 1LQUA 1UAYA 4ND2A 3GZ4A 4PG8A 3WMXA 4E12A 3OM9A 2WTBA 4ZHSA 4MVJE 4TKLA 4XD2A 1M6HA 1WDKA 1E3LA 3QVSA 4MOWA 1BWSA 3WX0A 1DPGA 1H6CA 2RCYA 3D1LA 3HZZA 1GL3A 5B4UA 7MDHA 3HN2A 2PZMA 1I2BA 2I66A 4XCVA 1Q7BA 4XDYA 4PN3A 1XCBA 2YQ5A 3KZVA 1NVMB 2CNBA 1MC5A 1D4FA 1SOWA 3ZW8A 3UCFA 1AUPA 5F5LA 3ROKA 4E4YA 5JW6A 1KIFA 2V6MA 4XGKA 1LX6A 1P77A 1DC5A 1I0ZA 2B83A 3OQ1A 2WYVA 4WCFA 5B4TA 4BNMA 3D3WA 2FRDA 4PCVA 4TVOA 4CM7A 3CE6A 2VRBA 3KHUA 4U5QA 1YQGA 4KWHA 1ISGA 4BKPA 1IB6A 4OH1A 4NK5A 4PRLA 1CYDA 1YOVB 3L6EA 1I10A 1YB4A 4NU6A 5TRTA 3ANNA 3JCZA 3I4CA 3AI2A 2GERA 2D5AA 4RJTA 3OJEA 4EI2A 3QA9A 1FJHA 4FC6A 4IBOA 4WK6A 3GK3A 4NJMB 3W4IA 4B3IA 1TLTA 4IS3A 2ILTA 5JAZA 3DZGA 4CV2A 1HYGA 2OO5A 2JFHA 3K73O 2C5AA 3GZNB 2DTDA 4G65A 2DBQA 3DZBA 3BHIA 2E37A 4NDNE 2Q45A 2VQ3A 2LDXA 4CR8A 2B4QA 4XR9A 2UYYA 2Y1CA 3JQDA 1GEEA 4IMRA 2I76A 4Q3NA 4YJHB 1MB4A 2FZWA 4RO0A 4RQUA 4W99A 4R1SA 3IUPA 1Q0LA 5DDIP 3O38A 2EG9A 4FS3A 3Q9UA 2OORA 3K6JA 4NI5A 1H6DA 5IAAA 1QKIA 3ICCA 2C2YA 5CEEA 1LQTA 3GMSA 4B79A 5CDSA 1Y5MA 2X0IA 4RORA 3WJAA 3G17A 4RLHA 3K2EA 5IN4A 1GQYA 1YBMA 1MLDA 4HNHA 1GQQA 2X0JA 3IJPA 4GSKA 1ZIDA 1HWYA 4E5PA 3O4RA 3UHAA 5CAEA 3ZZNA 3CINA 1A9ZA 4LCJA 1PJ4A 4M49A 4UVGA 1O0SA 2WD7B 1HZZA 1B0AA 2QYTA 4W9NA 2HJSA 3IQDB 4RPJA 1C3VA 1YKFA 1XR3A 4BKRA 5DP2A 1U9JA 2GASA 5JAQA 3U62A 1YWGO 4J1SA 3INRA 1M6WA 2XXJA 2WDZA 2VOJA 1PZGA 4W6ZA 5CG2A 1AGNA 4CLRA 4E31A 5FF9A 3M1LA 3ZU3A 3QWAA 4E3ZA 3C7DB 4B4OA 1Z45A 2ZYGA 4PLTA 1KY4A 2AEMA 1LDNA 3N74A 3P19A 4IDDA 3WDSA 3WQSB 2A9FA 2I5PO 3C1OA 3PHJA 4B8ZA 5KKCA 3SC4A 4RF4A 2DPHA 5U1PA 3ZHBA 4XYGA 4F3YA 4ND1A 4MINA 4D44A 1Z82A 3GNSA 2BFPA 4GMGA 3G79A 4XKJA 1FDWA 5F5NA 5BT9A 5A02A 1PGOA 4GI2A 4IUYA 3DXFA 4NJMA 3ZV4A 2YUTA 1NAIA 5TX7A 4ZN6A 2C59A 1QYDA 5C7IO 1P1IA 3IJRA 5ER6A 3NTRA 3KLMX 4JJGA 4LW8A 3ZWAA 1DB3A 4K1LA 3OA2A 5I7SA 3I83A 5BSEA 1FDSA 4IJWA 1BW9B 3GRPA 4YPOA 2ZKLA 4BNLA 3D5QA 4Y67A 3WQQA 2GYYA 3MJ4A 4N5NA 4E2ZA 1CETA 2NVUB 1IUKA 1O5IA 4E5MA 4PLPA 4IXTA 3EGOA 3FF4A 1ZZEA 4J1NA 5COBA 5GZ6A 2EJVA 4CPDA 2JCYA 1H93A 1SPXA 5DBIA 2WE8A 1SBYA 3Q0EA 3MZ0A 4DTIA 1EFKA 1AN9A 3ZU4A 4DXHA 1SOVA 4W7HA 1Y9AA 3KRTA 1ONNA 1ZFNA 3ZV3A 1GYPA 5CG1A 3ZI0A 1PZEA 2W8ZA 4YAKA 3NTQA 1EDZA 4NH4A 3VKVA 5L4LA 4L4XA 3IS3A 2PFGA 1B8UA 2QZZA 4L75A 4ND4A 5CDGA 3GVXA 1HLDA 5AXBA 1YONA 5JE8A 3S55A 3NGXA 5U4QA 3IP3A 3JQBC 4R54A 3I9KA 2WWRA 5HA5A 2DFVA 2FSVA 1MXHA 2NSDA 4BO7A 3GA0A 5LDGA 1I2ZA 2ZCVA 4Q39A 2ZATA 2NVWA 1KETA 3A06A 1T2FA 4NBWA 4E2YA 2AHRA 1R0SA 1O6ZA 1XYGA 4PGFA 2Y0EA 3S8MA 4AJ2A 4BUCA 4YCAA 1SMKA 3GFBA 4FR5A 4J7XA 3ETEA 2UUOA 3JQBA 3CH6A 4ALNA 2X1HA 2BGLA 1NR7A 1C14A 1F17A 3ADPA 3W4JA 1YO6A 3H2ZA 1DDOA 1N9GA 1HE4A 1I24A 2NVBA 3JQGA 3P5SA 4LK3A 1B8PA 1GR0A 1NFFA 3GUYA 4N5LA 4JGBA 3WGQA 1Z75A 1Z73A 3ZH2A 1ZNQO 1C0LA 2ZQZA 1CDOA 3W8DA 4B3HA 2EW8A 2J5KA 4PIVA 4AJEA 2J3IA 5EIOA 3P2YA 3RCBA 3BAZA 1HDXA 1Z74A 3FPLA 1LDEA 4E32A 4R9RA 2EHDA 1JW9B 2DUUA 2OXIA 4ILKA 1B8VA 3ZN2A 4FJ2A 4WLNA 1LDMA 5TS3A 3IP1A 1Q0HA 3WLEA 1P33A 1E7YA 1Z6ZA 4ZA2A 3UH1A 3M2PA 3RC2A 2F00A 4NZ9A 1J6UA 2BD0A 3LF2A 4IJVA 2XPCA 4N54A 2GN4A 2XAAA 3F1LA 3WBFA 2P4HX 5J23A 1HDRA 2HCTA 3FPCA 1JAYA 4CM3A 2VN8A 4FSHA 1QYWA 3BHMA 2IRWA 3BMCA 2GD1O 4QFDA 2I99A 1BVUA 3JQEA 1K2WA 3GAFA 3CTMA 1J0XO 1GEGA 1WXDA 3TQHA 2NU8A 2OMEA 5T6BA 1KEUA 4O0LA 1Y8QB 5BNFA 3IL2A 4HWKA 3ZNQA 4NG5A 2VZ8A 3H2SA 2QRJA 1X1TA 4XJSA 5T57A 4E5YA 3TL3A 2O2SA 4YDRA 2QX7A 2YFHA 3KYCB 3MJEA 4XJTA 3L4BA 3BHJA 1C1DB 4CMEC 1WVGA 1X14A 3D4OA 4Y6PA 3HADA 3A4VA 3KB6A 1YBVA 1PIWA 4GQAA 1BHSA 2Q99A 4CLXA 1ISIA 3GOHA 3GF4A 4FBGA 3BA1A 5JFOA 4MKZA 3NEPX 4AG3A 3A9WA 1TT5B 1PL7A 3E9NA 5T8KC 2J3HA 1UR5A 2JD0A 1K6XA 3IKVA 3OJLA 1YJ8A 1PSDA 3KEOA 3OMLA 1AXEA 3M1AA 3UCXA 2IEBA 1LEHA 2HMSA 2O7QA 4CQMB 1NX6A 4EW6A 1U3TA 3EYWA 3DDNA 2X9GA 3QHAA 4MJLA 4OHUA 5TJHA 4FW8A 3C8MA 2TMGA 1U4SA 2AXQA 1UZNA 2IODA 4J9UE 3GZNA 4DMMA 3PJGA 1XELA 5FI5A 5TC4A 1OOEA 3CEAA 4DPMA 4BGUA 3A1NA 2B5WA 2NTNA 2PNFA 3AOEA 3FWNA 2EGHA 1GUZA 4ZICA 1NQAO 4FJ1A 1VSUA 1R15A 1ZSYA 4OM8A 1IOLA 3GG2A 2VOEA 3I9MA 3O26A 4O59O 4FFOA 4E5KA 4I9HA 1F8FA 1XDWA 3AW9A 3DBRA 3GVPA 4WEOA 1T26A 1Y9EA 1UZMA 3FNGA 5JAIA 2WYUA 4DL9A 2R00C 1GPDG 3CZRA 4EEXA 2AEJA 2NV6A 2DM6A 3JSAA 5A3VA 5CHEA 4CUJA 4WPGA 3TNLA 5ITWA 4CLDA 4QQRA 3VH2A 5JDCC 3VHRA 1ULSA 3FD8A 4KDFA 2HAEA 4CR6A 3AFMA 3S2GA 3PFWO 1RM4A 4BMSA 1PWZA 4YYZA 4DBZA 3QWFA 2PLAA 5G0WA 3IMFA 3JQ8A 1PQUA 3WLFA 1G0NA 3TFQA 1PJ3A 1VE9A 2XOXA 4AJ1A 5EQDA 1YE3A 4HBGA 4IMPA 4RVSA 1F8GA 4I9NA 1CQJA 2BFAA 1O89A 3AUUA 4GMFA 4CJXA 3ZCXA 3C7CB 3K9QO 2ZYAA 4MPDA 3GN1A 5DOVA 3KSUA 2O7SA 4E5NA 3H9QA 4FQ8A 4J43A 3B1JA 4FOOA 3RJ5A 1DC4A 3DFZA 1GV1A 4ALIA 1W4ZA 3TSCA 1W6UA 2ZK7A 4U7WA 4BO6A 2PZLA 1DC3A 2NM0A 2Y0DA 2CMDA 3DAPA 1PWXA 4J90A 5G4KA 3ETDA 4CLHA 3DZJA 4CQLA 3WICA 3TN7A 4CM9D 1I5RA 3ENKA 3MOGA 1XQ1A 4JBGA 3ASVA 4XYEA 2IZ0A 2QG4A 4AICA 3RU7A 3LSYA 1NPDA 3O9ZA 3D0OA 3OP4A 4UUPA 4JN6B 4DGSA 2VRCD 5IDYA 3U9LA 2J3JA 5HRUA 2Q4BA 5FYDA 4BNHA 1DIGA 5JO0A 2EKQA 2GN9A 2Q50A 4F45A 4BB5A 5A5EA 4K26A 3GQVA 5JO9A 2AW5A 1R0LA 2D0IA 2J6IA 3H8VA 3CXRA 3ZU2A 2ZB8A 4DYVA 1NPTO 4BNUA 3N58A 2C54A 3ZV6A 2YW9A 2FSSA 4FC7A 4GWGA 1PS8A 1ZMOA 3U3XA 5I9MA 1AXGA 3OEYA 3OETA 3DFUA 4YBZA 1E3SA 3R3JA 4E30A 3VPXA 2ZTMA 3V2HA 1ENPA 2WSBA 3RFTA 1DSSG 5KTKA 5G0TA 4CM6A 4CMJA 4FFPA 2BFOA 3FNFA 5HTOA 2V6GA 4OO3A 2I6TA 1DIRA 4IS2A 2GN6A 4AVYA 1ZJYA 4BKUA 1UXIA 3MTGA 5IXSA 2JFGA 2RIRA 4XGNA 1XLTA 1MG0A 4AJIA 1VKNA 1R4NB 4P4GA 4UEKA 3U4DA 5CP8A 3LT2A 1RM3A 3WJ7A 1KEWA 2HRBA 4HADA 1KVQA 4OQZA 4C7KA 1D7OA 4QX6A 2E48A 2VWHA 1I8TA 4MVJF 2IZ1A 3GHYA 4MVJD 1I36A 2QZ9A 4XQGA 5KWEA 2AG8A 2BI7A 3S2IA 4WEQA 2JCVA 3WWZA 2FPPA 3E8XA 1V3UA 5EQFA 5AYVA 4JJIA 4AJNA 1KVTA 1A7AA 1Y7TA 2BFMA 2GDZA 4GGPA 4HXYA 3BMQA 3D64A 4YQZA 8LDHA 2DBVO 3LC2O 2V6BA 2Y68A 1B16A 3CZMA 3QWHA 1RWBA 3JQ6A 3A14A 4P8RA 5AQ1A 3RBXA 1DIBA 3OIDA 2I65A 3DMTC 1ZXBA 1LLCA 3RUHA 2Q2QA 3AY3A 1A5ZA 4HUJA 4CL3A 1TI7A 1WPQA 5K6AA 3LK7A 2FOIA 3JQAA 4RVFA 4XA8A 2G82A 3ORFA 4G5HA 4AJKA 1HE2A 1OFGA 2AQIA 3RBZA 3TJRA 2WEKA 1P0CA 3QRWA 3H9EO 2IEDA 3PIDA 3GMDA 2NUAA 4IM7A 3JQ9C 3IAHA 4N7RA 4CL8A 3PQFA 4IQGA 4XX0A 2EERA 4R4JA 1EE2A 5ENDA 1TA4A 3RU9A 1PL8A 3SJUA 3CIFA 1EVYA 1JN0A 4UREA 1R37A 1B14A 1GYRA 1BDMA 2J8ZA 2CY0A 4RV9A 2GN8A 3ZHZA 1GADO 1WDMA 4N5MA 4I1IA 1ZW1A 3W1VA 5TSDA 3IDSA 5KVVA 3PLRA 3GRKA 3PWSA 2NU7A 3ZGYA 3R0IA 3DZFA 4DMLA 1ISHA 2VCYA 3PHHA 3ADOA 3DHEA 3KV3O 1X7GA 2OBNA 4M1QA 1D1SA 1AHIA 3W8EA 4TRMA 1JWAB 4WLUA 4FCCA 3WTCA 3U4CA 1A27A 3I9LA 2X9NA 2NQ8A 4U6SA 1ZO8A 3LT4A 1LRKA 2GZ1A 1DJNA 1P74A 2FP4A 4QO7A 2VHVA 3PPIA 1PGNA 1LLQA 2BH9A 1A72A 1J49A 1PJLA 3BZUA 1E3IA 3GGPA 3KVOA 2VHYA 2Z95A 4MVJM 4WJZA 4OMUA 1LLDA 4BO9A 3FR8A 4A7PA 4KP7A 5EJ2A 1LI4A 4MIEA 1Z7EA 3LQFA 4DQUA 1PEDA 4JBHA 2O3QA 4I8XA 4IIUA 4ND3A 4W82A 3LYLA 5A9SA 1WNTA 1QV7A 1U7TA 3BTOA 5JC1A 4WLOA 1RYDA 4KUGA 2VTDA 3VZSA 3D5TA 4BO2A 1BXKA 1T4DA 3L9XA 1WDLA 2ZJ1A 4KTVE 3H5RA 3X2FA 3D3WB 3JYOA 1NQOA 1P1JA 2E4AA 3AY6A 4HKTA 1MG5A 1W73A 4B7CA 3NV9A 3BTSA 3L77A 4GKVA 4CMEA 4WNIA 1PJCA 4AFNA 4KUEA 2EJWA 3SLGA 1XU7A 3AUTA 5C37A 4Z6KA 4YJGB 4FIZA 2NU9A 3MWEB 3PYLA 3ROMA 5KVQA 4D0RA 1Q2XA 3UFXA 1D3AA 2Q1WA 1EQUA 5JDIC 4L74A 3GY0A 5COAA 3GEDA 5DCWA 3D3EA 4XYLA 1FDTA 1PQPA 4ZRMA 1I2CA 1ZK2A 3KSZO 2B5VA 3W6UA 1PJ2A 3WR5A 4D45A 2DQ4A 1A4UA 3CSDA 3LC1O 5JYEA 3OH8A 4OXNA 4QFCA 5TGDA 1YRLA 3EHEA 4JJFA 1YGYA 1DLIA 1LDGA 2Y93A 3DBHA 3BTUA 1YL7A 4WGGA 2AQ8A 3PJDA 1UXJA 3LDHA 4BNZA 1HXHA 3DBRB 4TRJA 3OHSX 5AXAA 1DLJA 1UH5A 5FI3A 1XG5A 4FFNA 2Q49A 2D3TA 1LSUA 1N1GA 2NTJA 2O48X 2Q2VA 3LU1A 2PKQO 4D43A 2V7PA 3FNHA 2RHRA 2W2LD 1EVJA 4RDIA 3M2TA 1OC2A 2CZCA 1BXZA 4J1TA 4R5MA 2O3TA 1N8KA 3OBBA 4RDHA 5B12A 3GHHA 1QP8A 2EP5A 2HK9A 2PY6A 3DOJA 4OOFA 3DAFA 3Q2IA 3L6DA 1MGOA 2X22A 1PGQA 3GEGA 1X15A 1MV8A 1UZLA 3VH3A 1WZIA 2HJRA 2C20A 1P3DA 2GZ3A 2UUPA 3DHYA 1ORRA 1DRWA 3GVIA 1LLUA 3C7AA 3K2BA 2PGLA 3ZWPA 2VNAA 3D4PA 3PHIA 3T4XA 4YT4A 2VUSA 3NT5A 5FFFA 3H9JA 3HFSA 3FNEA 3RROA 1ARZA 1ZUD1 2E49A 3HN7A 2PKQP 1IL0A 3JYQA 4AJJA 1PJSA 4MKRA 3STHA 2VWQA 3ZV5A 3ZWCA 3QIVA 4NBVA 4PLYA 3QSGA 2EF1A 1E7MA 1OAAA 4EUFA 1E6WA 2UV8A 1HSZA 3T4EA 1Y8RB 4Q3CA 4K6FA 4YA6A 1JKJA 3WNVA 1UUFA 4RQTA 3B70A 1ML3A 1MFPA 4U0KA 4BV9A 4CMBA 4YXFA 4UUMA 2IYPA 1HDYA 4BHTA 2EIHA 2Y1FA 5IFLA 4GWKA 3OJOA 1P45A 2HMWA 3TDKA 4YT2A 4BKQA 1HE3A 1CQIA 4CMIA 1AHHA 1T24A 2AE2A 1G6KA 2O2YA 3K31A 3MJTA 4DBVO 1NPYA 4GVXA 1E3EA 1GDHA 3AWDA 1VJ1A 5ENVA 4CM8B 4YRBA 3RVDA 2OP1A 4K28A 4BS9A 1GD1O 4DIFA 3DHNA 1LXCA 3UUWA 1KVUA 5G0UA 3NUGA 3ZHYA 4A73A 2NTVA 1DHRA 4D3FA 3UXYA 5CEFA 5I7VA 1SNYA 3OIGA 1ENOA 2YV3A 1IYZA 1GU7A 1LNQA 4GX1A 2EKPA 1GYQA 4I5EA 4MP3A 4D7AA 1QLJA 3COSA 1SO8A 2I3GA 2OGUA 2ZTUA 1T2CA 1BXGA 2G0TA 3G1TA 4QXMA 2CD9A 4D41A 2HK8A 2DTEA 4ND5A 4YJGA 2QRKA 5LCXA 3DR3A 1YH3A 3CMMA 2FMUA 3NDJA 4GL4A 2ZQYA 4RPLA 1NBOA 1ONOA 3PYXA 4GBJA 4Z3KA 1RYEA 4QO8A 3HQ4O 4BGVA 4DIOA 4YQYA 4A0SA 3OQ6A 3F9IA 3T7EA 4F6LA 1Q0QA 1LTHR 1P1RA 5ER9A 2YYYA 2Z5LA 1JU9A 1T25A 2GZ2A 2NNLD 1QORA 3E18A 4U8GA 2C0CA 1E7RA 4ZVVA 1GZ4A 2VRCA 3WQRA 5U9CA 3ZWXA 3H4VA 2OHXA 1TXGA 2Q1TA 4EUHA 2O4UX 2B0JA 4LVCA 4C4OA 3EVTA 1ISJA 1V6AA 2PV7A 1F12A 1KVSA 2D59A 1ZEJA 4XIJA 3PGJA 4W9NC 2YJZA 5G2OA 4O1MA 1VC2A 2QIOA 1QSGA 3X2EA 2NADA 1F14A 4CUKA 1E5LA 1GFSA 2BELA 3GT0A 4DYDA 3ICPA 5FWNA 2JCXA 3L07A 2H9IA 2SCUA 3JTMA 2Z1NA 1YQXA 4EJ6A 4E13A 4CQMA 1BVRA 4XYMA 4IDGA 4C7JA 2ZB7A 3DOOA 4NQZA 4JP2A 3UF0A 3WIDA 2I67A 5JC8A 1C1XB 1UDBA 1E77A 1EVZA 1UP7A 1YDEA 4KZPA 1H6AA 1GAEO 2RH8A 3B1FA 1UXHA 2YDYA 4GPD1 5GZ1A 1NFQA 2CVOA 3U4HA 2O3UA 3K8ZA 3WG9A 3JQ9A 5DBFA 3IUSA 5F21A 2JKVA 3L6OO 3NGLA 1GTMA 1XU9A 3GR6A 4J6FA 1ISMA 3HSKA 5JY6A 1NYTA 3RIHA 3JYPA 3RFXA 3ITKA 4Q3AA 1WW8A 1WMBA 1ZVMA 4XGIA 2GLXA 3DOCA 4PLHA 3WYCA 1VL0A 3BMQB 3F6YA 4LRTB 3RASA 2PWZA 4R01A 4CR7A 4YRAA 3RSHA 1PX0A 5I9LA 3PDUA 3INTA 5BNTA 3IKTA 4XDZA 2P68A 2JD2A 3LLSA 4D42A 4JK3A 2CUKA 3FR7A 3AI1A 4WCFB 2YHIA 1ZXLA 1QG6A 3HWRA 3OFSA 1HDCA 5BSGA 2WYWA 4GVLA 4WLEA 3U5TA 4AJPA 1U1IA 4CM1A 4IJKA 1BXGB 4NFHA 4QUKA 5DF1A 3DO5A 5KJ1A 2DBZA 3GVHA 4YJDA 1F0YA 1NVGA 2AA3A 1ID1A 4LCEA 3GNTA 1N92A 1LSOA 4PG7A 3EDMA 4PLZA 4BGEA 3F47A 4BNIA 4RPKA 3AUAA 2HKIA 2VYNA 3NYWA 4FGWA 4DA9A 5L51A 1WAMA 1S6YA 5TT0A 1Y1PA 1XIVA 2VZ0A 3WB9A 2QQ5A 4D0SA 3EZLA 3LLVA 4FOSA 1KBZA 1DFGA 1I32A 1X13A 4RVHA 1N7HA 5CDYA 1EDOA 3FN4A 3VVBA 5K0ZA 1DO8A 1IPFA 4LISA 3I6QA 1BG6A 2DU8A 2Q46A 1LUAA 4IDBA 4GH5A 2JD1A 3HFGA 9LDBA 1FDVA 2PKRA 5G4KB 3GN2A 3NT4A 4L0QA 3HDJA 4BO4A 2WD7A 4LRSB 1F06A 2AMFA 1VRWA 2PGJA 2D5CA 2F1KA 4H3VA 3OSUA 4NFSA 2FHSA 1NR1A 3JQCA 3OIFA 3E1KA 3JQFC 5AVOA 3NX4A 3U0BA 4B4VA 3ZWMA 3E48A 3JYLA 1R4MB 1ZK4A 2WJPA 1L7DA 2GSDA 4UUOA 4CUZA 1V0JA 2D2IA 4WCDA 5KKAA 3V8BA 2J5QA 2BGMA 1YVEI 3C3XA 3VC7A 3NAQA 4I9UA 1DRVA 4RGBA 1V3VA 2NACA 2UAGA 3OJFA 3TFOA 4O6VA 1S7CA 3SLKA 3S2EA 4KUHA 2ZTLA 4EEZA 1U2DA 2R6JA 3H5NA 1V35A 1RPNA 4DPLA 3PYMA 4RVDA 1QYXA 1GCUA 2QYSA 4YWJA 4UVEA 3AOGA 4IDFA 4CM4B 3BMCB 4LN1A 2CDBA 2RHCA 4J16A 4RPGA 4AJOA 4Y8VA 3P7MA 2X86A 3O8QA 3JD2A 4GAEA 1PR9A 1R0KA 1VSVA 1XGKA 2CVQA 5L7WA 2GNAA 3VPGA 1HLPA 2HDHA 1TB4A 1EUDA 3UKOA 3VPFA 1B26A 3AM4A 5TJ9A 4NU5A 4YAJA 2G1UA 3KTDA 5JSFA 3CMCO 4J2HA 3UCEA 3IC5A 3PZRA 3K92A 3M6IA 3RWBA 5HM8A 1MUUA 1UJMA 4BNFA 2VHZA 1H9AA 3DZIA 3HUDA 2Z1MA 5JMWA 1T2EA 1KEPA 1QYCA 4J2OA 4KDEA 1N5DA 5B37A 1YL6A 2C7VA 4FN4A 4FD3A 1LU9A 2HMVA 3P2OA 4QT0A 3BMOA 4ONEA 5L4SA 4N18A 4Y6RA 4OKIA 4BOYA 1VL6A 4IQ0A 4BNJA 3SXPA 5FEUA 1XSEA 1JVSA 4R5HA 4E33A 3PHLA 4BO5A 3PRJA 4LMPA 4OXKA 3QE3A 5BSFA 1UDAA 1GZ3A 3RAJA 4S1VA 1L7EA 3RUDA 2O4CA 4J4TA 3L4SO 3DL2A 3RC1A 4PLCA 1W8DA 5BSHA 1OMOA 5G0SA 2CF5A 4B7XA 1BTOA 5BR7A 1TT5A 2VUTA 5CEJA 3RUAA 5C3MA 1DJQA 2O3JA 4CV0A 3HE3A 5DCUA 6LDHA 2VHWA 2RH4A 1EZ4A 1K6IA 4DQVA 5CPFA 1SZJG 2IZZA 4CLRB 3WGGA 4FFMA 4Z0HO 4WLFA 2V6FA 3RC7A 2DLDA 1G0OA 5CPBA 2B4TO 4YTEA 2Q1UA 3EVNA 5ILOA 4FJ0A 1QLHA 4NHEA 4QTZA 5THQA 4II3A 2P5UA 4CMCA 1XEAA 4NFYA 1N7GA 3UVEA 3TOZA 2P9CA 2X8LA 3ONFA 4CV1A 1N1EA 2B69A 3GNQA 4ROSA 4A2CA 4JBIA 4ALKA 1NXQA 4CV3A 4PG6A 1FDUA 3V2UA 4P38A 4BNGA 1BMDA 3GVCA 3RQSA 3UOGA 2O3RA 2HO5A 2HRZA 3ANMA 3FWZA 1E3WA 4FPXA 1HZJA 4QSMA 3TF5A 2C5EA 3D7LA 3VAZA 1R66A 2J5RA 3W8FA 3E5MA 3V5NA 5JDCA 3FHLA 4IQ8A 4IZHA 3I3OA 4M54A 4IPTA 5ILGA 4IINA 3VOSA 4HFNA 3L4BC 3NTOA 1C0IA 3PQEA 4GLLA 4QEDA 1ZJZA 5JNLA 3QQPA 2YDXA 2OL4A 1O94A 1EBFA 3PI7A
chains in the Genus database with same CATH superfamily
1H5UA 1KZ7B 3FTNA 3IEUA 4C30A 5JPCA 4X6YA 3INGA 9LDTA 2XITA 3BGWA 4EJ0A 1RAGA 4NU8X 2IXAA 3FAZA 1AKUA 1PR3A 2DGDA 2WT9A 4LGMA 5FBWB 3UHOA 1DWPA 1U98A 1VI5A 1IZ0A 4TZKA 4BVLA 3B9RA 2YZ7A 4G0QA 1PR2A 3NIGB 4AKSA 3B1VA 1N0HA 3GUUA 2I78A 3L02A 2WA2A 4B31A 1SKUA 1BDIA 1V9SA 3LF1A 2B37A 4BO3A 1LPSA 1HSOA 3EQ6A 1BU8A 3DKRA 4DV4B 4L4UA 5BYKA 1NXPA 2E0IA 4Z0TA 1RQXA 3DCYA 3VZQA 2DWCA 3AJ8A 1ZC4A 3N1UA 3QU9A 5F4BA 3ZKWA 5HE9A 1Z3CA 3RD5A 2HN9A 1CTQA 2YWHA 2QR2A 4OQYA 5DOZA 4BO1A 1FZTA 4MI6A 2UXCB 1EMDA 3JVIA 3TZCA 1RKXA 4IVPA 1LC3A 2WUDA 3GA5A 3NOXA 4TWRA 2AIRA 3C8DA 5GJBA 1M67A 3HLKA 3RLIA 1DQYA 1ADJA 3LT0A 4GUDA 4HEHA 3WYEA 4AG6A 2R8XA 3PGMA 2EF0A 3ILHA 4HY3A 3OFND 4EUSA 4GNRA 1M1ZA 5BSKA 4R3WA 2XE7A 3TCNA 4L02A 1E2FA 5CK4A 4BMPB 4FMPA 4OAQA 1RC8A 2PAFA 3DKKA 3PENA 2TECE 2R60A 1WULS 2J08A 4BE4A 4NXNB 3P9IA 4RY9A 1SEPA 3SIXA 3HH8A 3LPAA 2WA1A 5KYKA 2JHCA 3I8XA 3FMGA 4H35A 2I8AA 2UZ4A 1R4NA 2AFHB 4AY3A 4BNKA 3H19A 5GINE 2BEKA 2W6CX 4CKEA 5JS6A 4CMHA 1IOWA 3B6IA 2G6TA 5JYCA 1IATA 3RU2A 3BFXA 4WFJA 5BSVA 1OI2A 1ICIA 4IJ6A 1I3KA 2AMJA 4OHVA 3ZNOA 4ZHQF 1GQOA 3R0QA 3H2KA 1IWBB 1GV0A 3DWFA 5EA2A 1SG9A 5TQ0A 2VTVA 3FDJA 4HUQA 1XHLA 4UD6A 1FP2A 4II2A 1AA6A 1KO1A 4D4KA 1RRFA 2DMRA 3SE7A 1P2TA 3WNQA 2IHYA 3MINA 4C0BA 1JDVA 2GPTA 2WHEA 2R0QC 2Q1YA 3KHTA 3OLYA 4HNVA 1N5RA 1VBNA 2QRPA 1NASA 4GX5A 4G41A 4XQCA 5F2NA 2JRLA 2VSNA 4Q21A 2K7FA 4C0XA 5BR4A 2VSOA 2LKDA 4KRYA 4ZCPA 2YMMA 3HYTA 2BBTA 3IVGA 1E3JA 4W5NA 4J3JA 3FDZA 3E9QA 4TV9A 3SBDA 1U5BB 4ALMA 2HT6A 4EMSA 3QOFA 5AM3A 1VMDA 1D9XA 1GTZA 1P31A 2RGCA 3CCCA 5TF4A 2WWXA 4U5XA 4YALA 2VYQA 3DTVB 4ARCA 3QVMA 5JYDA 2NG1A 5L6MB 3NKLA 3CW8X 1JKIA 1P9RA 4CIXA 1DP4A 3ZWYA 5JJLA 1FTWA 1UMDB 9GPBA 5L7YA 1GPAA 1OI4A 2IEIA 3KXIA 5HCUA 3QHPA 1ZK3A 1O4WA 1F7UA 2AZMA 3GMIA 3EULA 1L7VC 4JJ7A 2VHJA 1RLMA 1LX7A 3VU3A 1PR5A 2OB1A 3QJ5A 2VCHA 1THMA 1A1SA 5M3BA 1THZA 5JY1A 3WIOA 1VBKA 2HMTA 3RC8A 3A32A 3IPYA 2OGTA 4E0BA 3U5ZB 1QRDA 4EI7A 4ZO8A 1XRLA 4FFBB 1AQJA 2JLWA 3O73A 1XVTA 3W34A 2AFIA 3FOAA 1NE7A 5AJYA 3DSRA 4EO7A 1QHIA 2C00A 1AKRA 1N2SA 4IH4A 3S2YA 1E7QA 3VDNB 2W0MA 2AFHE 1TJPB 3F3SA 3H8SA 4BTEA 1UC5B 4RLFA 4YGYA 3NTLA 5DNYB 4AZVA 4GZ6A 4MVJI 4RKEA 1NWCA 3HJUA 4M0CA 4NAHA 4WESB 4JP1A 1NX9A 4M8NE 4PQGA 3U9TA 1M0WA 4D3ZA 3W06A 4R2KA 4PZDA 3KEMA 1RCTE 5IDQA 3NDRA 1USKA 4XJVA 1Q3HA 3RVLA 1M75A 3TZQA 3CO0S 1NTOA 3HMKA 3I4FA 3W5DA 2PFSA 2HRRA 3OF2A 2C29D 1N0IA 2ZBVA 1AA9A 1TQHA 3LCRA 3LPLA 4P7GA 5AJWA 7MHTA 3HNRA 3ZY5A 3ESCA 4B5KA 4MAMA 1MEJA 2GUGA 1VG8A 2HC9A 2HJ9A 3EDRA 3IAS1 3IE2A 3P9CA 2AJDA 3FI9A 4LC9A 2L2QA 3PQ5A 3SJZA 2ZVDA 2R68A 2YWCA 2IP2A 4I4TF 3USZA 5IFKA 3T7SA 3H86A 3Q40A 4DR2B 2EKBA 2POCA 4XASA 4QGSA 5EIAA 4MS1A 3UXEA 1R6VA 3DMTA 3TCXB 1OH7A 3MD9A 4FSXA 5AOCA 1PO7A 3ETCA 4KIUA 3MQ4A 2N3ZA 1B23P 2X3YA 1CNEA 4WD3A 5GOZA 3K5HA 1C0KA 2BSXA 4A0GA 3KL4A 1U8FO 4U9HS 4D9GA 1FVFA 2PK3A 4TUYF 5CIQA 3QU4A 3KR2A 3EMKA 3UT5B 4CTMA 3JWEA 3OZTA 5JU6A 1JLLA 4MPRA 2A1TR 1WR8A 3FUVA 4NJEB 5KNCH 4Y2YA 3VH4A 2EFGA 2VXBA 5CX4A 4YIHA 2RONA 2VFAA 4LF9B 5THKA 1ZD4A 4ZKEA 1EXNA 2BR5A 1KPHA 1JEQB 2F3UA 3FPBA 5IJ0A 4PO8A 2DTXA 3BTVA 4MCIA 4EBFA 4FB5A 4JP5A 5KU7A 1Y1LA 4N6NA 2JLXA 4NV3A 2GCEA 1ZIYA 5K3AA 2OAEA 2R8EA 4L2IA 2H00A 1U2DC 1VJTA 4W7SA 5K0GA 3R3ZA 4MVJP 1QRRA 2EL9A 2WSSD 4TTAA 1USWA 2JW5A 2PR7A 3B3GA 3L3BA 3P4UA 3HDGA 4KMSA 2QENA 1XP5A 4QU0A 5A05A 5C8DA 2C2XA 4Y1EA 1TJ5A 2EQAA 3L7LA 1KC1A 1KYQA 1T5LA 3HBMA 1K8XB 2BGRA 3B8EA 3IOMA 5LMZA 4GR5A 2BKAA 4FGKA 3SYRA 1E79A 4AMZA 4DREA 1RC1A 3HYLA 4JUBA 3U6BA 3JQFA 5LYYA 2PA3A 5IC6A 1IN1A 3LWBA 4ABTA 2RGAA 3EE6A 5CDFE 5JFGA 5CCXA 4BP9A 3B7WA 1E61A 1L7QA 1PT8A 3D6TB 3KQWA 4IVRA 4LF7B 3DZ8A 4UBJA 4OJNA 3VHXB 1C4WA 4JELA 3F5QA 4P4NA 1B93A 2IHUA 2Y99A 2O23A 5JCOA 3T6KA 5A04A 5BNIA 1ES9A 2W8BA 5FADA 2PJUA 5ALNA 3UAVA 1ZEMA 5L3QA 4N12A 4QJ3A 1YOBA 1SCQA 3AEKB 1B3RA 1E6CA 3RT9A 4RVGA 3O7WA 5JEEA 2JJ1D 1I33A 1CUYA 1SB8A 2OK7A 1J9ZA 4KR7A 3GH3A 2RK6A 3CRQA 4FQ5A 4G56A 5JQWA 2WJ4A 2P9GA 3RJ9A 2XOEA 1CQJB 1SR8A 4JGIA 3BXXA 3D6HA 1EFDN 2XIQA 3T3OA 1PFWA 3ICVA 4X6XA 3K30A 2E1RA 4OQXA 3OMWA 2QN2A 1WOMA 1EUZA 2CFRA 1ZLXA 2GPAA 1GZ7A 2J85A 3CPSA 3I2HA 3PQ7A 4KLRA 5FA6A 5IJ9A 1QRSA 5KWIA 1VTKA 3GBSA 3SYKA 5CXUA 2QS9A 2XDWA 4CM4A 3HXLA 2IUEA 2GBIA 1BE1A 2QL7A 4WOJA 4Z7JA 3CCBA 4GX2A 3W5AA 2QLLA 5FB3A 3DHVA 1CIVA 2ODWA 3N8IA 4Z3DA 3OM1A 1UKAA 4R1PA 1RM0A 1Z8FA 2A5GA 5HBRA 3E05A 2B1RA 1KGDA 1EFLA 1SWWA 3ACCA 2YJ5A 5LVAA 1LSJA 1W36B 2XMQA 5LQRA 1CKEA 4R6WA 2CHQA 1SB9A 3GJ8A 1NV8A 2A9PA 1TC1A 2L42A 4HQNA 3I6YA 1ENZA 3KM0A 4QNMA 5JECA 1KAQA 1O9BA 3G0IA 1DO0A 4J0CA 3TGLA 5L3ZA 4PVDA 3B13B 3LVBA 2COEA 5TQJA 5B30A 4GT1A 1GKIA 4JJAA 3A37A 4D82A 2XJ9A 1VLZA 3ECCA 4J3NA 1N0UA 5SYMA 2W2KB 8ADHA 5ADWA 2WM3A 2XCRB 3BFVA 3UMVA 4F8JA 4OJYA 1VCNA 3JAWA 4UVIA 4DLBA 3K35A 5GOTA 2FZ4A 3SC3A 2JZNA 3URKA 4HCJA 4A0FA 4KU4A 3ZWNA 1P7VA 3OLZA 2NZXA 4U39A 4DVJA 3GGJA 3VR4A 2C95A 2PT5A 3W5CA 2X1VA 2HSWA 1H9BA 1WUHS 4CHGA 3WY9A 4DNOA 3K6RA 2XIJA 4RD1A 3UICA 1YQDA 2C58A 3FE2A 1CZKA 4L15A 3FUXA 4FCWA 4CKYA 4ZQFA 2FR0A 2WWVD 3KQUA 4U7HA 3JQ7A 3ZTTA 3CVJA 1MQ8B 2CVZA 3P0EA 3PC8C 3R1IA 4WCFC 4ERXA 2NO7A 5DSTA 1E5QA 1ZBQA 2OHJA 4MLCA 2UZ1B 1SULA 5IARA 1VFPA 3R7BA 2ZI5A 4R8VA 2ST1A 2XKJE 1G8AA 5CFZA 2QMQA 3DBLA 2CL6X 3J7AC 3RJZA 1CJUC 1FNNA 4CEJA 1JDBC 3ZJYA 5A4JA 2I7DA 2D8MA 1Q14A 2C4HA 2JH3A 4WE3A 1OPXA 5A6SA 2BHTA 2Y6VA 1NI3A 2ERYA 2AL7A 1H8HA 1RAIA 4DLAA 4UEOA 4K9MA 2FU5C 3MJSA 4ITUA 2HU8A 5GIOE 1C29B 3N8HA 3GG9A 2QQEA 4UCWA 2FRXA 4K7JA 1CUJA 2IEYA 3HNPA 1AS3A 2J7KA 4EY3A 1OIWA 1U0RA 1RWQA 2B7BA 5BSUA 3U1TA 1KC3A 1TX4B 1CUZA 1JGTA 1EK0A 1MBZA 5KYVA 4YMVA 3MJCA 4PWZA 3RHSA 4O8ZA 4YT8A 3SS9X 3K8QA 1FQWA 1O77A 4XARA 4KR3A 1JFRA 2RK3A 1H6BA 3TAHA 1DFHA 3D6AA 4N6OA 4L0MA 1R9MA 2QLNA 4K05A 1UXGA 1D1TA 1ZGHA 2V7VA 1U0EA 2EBFX 2OVFA 4M0PA 5F3RA 3V8QA 5L53A 4M2LA 4MUJA 2BP7B 3IIEA 3O03A 1OVGA 3B6KA 1NYRA 3GEPA 3T9AA 1IY8A 3AUSA 2YXLA 1G3IA 3TRFA 4D79A 2GBLC 3SIPA 1IRXA 3CY6A 1ML4A 4TKMA 1OF1A 2ZT8A 4G89A 4JD5A 3TNYA 5HZMA 5KYXB 1CRWG 2J9YB 3WTBA 3PICA 5COQA 3EGXB 4C01A 4LMAA 1W48A 1IHYA 4P92A 5IJ0B 2GRUA 1YR8A 5CA0F 3AKCA 3M5DA 1S8AA 4OJKA 1ZKMA 4S1TA 2PR2A 1RNLA 2R5NA 5TEVA 4HZIA 2PGDA 2JDIA 2X6RA 1VA5A 3CLTC 1E1CA 3ONEA 1Z38A 4X1KA 4EGFA 2Q5HA 3S2ZA 3SX2A 3SJCA 1RACA 2GEVA 1AHPA 1GZUA 5C52B 3TD6A 4NQRA 1I3CA 1EVLA 5CNIA 4XOUA 2OCXA 4Z51A 3ZI4A 1NUHA 2NUPB 4MW1A 1EWVA 5CMLA 5C81A 2WSLA 3WSTA 2YOFA 3LT1A 1GG5A 5K8CA 2P9EA 1UODA 4BO0A 4YJFB 1N6IA 4M9ZA 1QVAA 4ZU3A 3R9WA 4KVFA 3C45A 1L1FA 2IYYA 2FPSA 1X74A 4LOIA 2AKEA 1E0KA 3NHPA 1BGVA 5DB4A 3RYIB 2H1LA 2QR5A 3ENWA 4UUNA 3TM4A 1OFHA 3OAAA 4ESOA 2NUTB 3BK1A 4NBUA 3I2FA 3EFBA 1CZRA 3URMA 2QMUA 4NEGA 1Y63A 4R2IA 5EMNA 2IV2X 1HFEL 4AJ4A 5KPDA 3DKPA 4CQMD 3BF7A 4ZJUA 3U2QA 4BO8A 1T3GA 5CT8A 3N6RA 1C8KA 4DV6B 3VSDA 2IZOA 1IBLB 1CF2O 1K7FB 1GNLA 3F71A 3O94A 1RJWA 4RK7A 1QU3A 4DA4A 1QF9A 1F9EA 1I1HA 2CZGA 2DHEA 1W7AA 1U3GA 3CRRA 1AF7A 5L9AA 3DV2A 3AVXA 3AM5A 5GY7A 3KLBA 4A10A 1KEEA 1PLLA 2H9AA 1DAOA 1JHDA 3AU9A 1HOXA 4MO9A 4BB6A 5IUJC 3QE9Y 1GPUA 4FLEA 4MQLA 2YXDA 4G8JA 2ESRA 1E6LA 1ZMTA 1KARA 1Y7IA 1EDDA 1TKCA 3BERA 3T3IA 3GFGA 3FRIA 1IN6A 1M8JA 2IYFA 3L0DA 3LT5A 3WOHA 4BLOA 4EY7A 4DUYB 3KKZA 4LFAB 5CNJA 2ZAMA 3JR7A 5D5PA 3D6MA 1SHKA 3IPCA 4DJ5X 5AVQA 3C6ZA 4HSGA 3E1GA 3LDGA 1BQ4A 1U2GA 4KAAA 3VOAA 2QZSA 4WXMA 4Y1GA 2OC9A 1I4WA 2GEJA 2IT1A 5EUQB 1APBA 1QUEA 4WOPA 2FPIA 1Y1QA 5ITSA 1U0LA 3DV0A 4PZAA 4UEWA 2B1GA 3ZCUA 4DG5A 4G5GA 4A27A 4LZNA 4ZTUB 4NULA 4CQLB 4F5ZA 3E22A 2ZRBA 1Q15A 3TTYA 1I7PA 3S1AA 2DCMA 2IZ7A 3IVXA 2IH2A 2X0FA 3ZBTA 3LQ1A 2NN3C 3PK0A 4RV4A 4MS3A 3L82B 1JTVA 3HWX1 3KPJA 1DCMA 2ALJA 1USGA 1Z35A 3OKFA 1L3CA 1OYVA 3LUGA 2UZ3A 2ISSD 3PEFA 2R8PA 3NIFB 4XFDA 4CTKA 1NNLA 2GAAA 4KQWA 4NZZA 3QY0A 1E4EB 2BMAA 3ELUA 2CDAA 2YS6A 1HL7A 4I50A 1Z8HA 4C0SA 5F4ZA 2JRCA 1XPJA 3H1BA 3C7KA 4DLSA 3OE7D 2PT7A 1EUYA 3T5TA 2FOXA 2HQ1A 1K8ZB 1EI9A 1DCFA 1KHTA 1TC2A 2FCRA 3BCHA 3PFGA 3PGVA 3JASB 4KQHA 4PSKA 4W5RA 2XXBA 2OD2A 2ZBQA 1YOVA 3FNIA 1IB0A 3K1AA 5EE3A 4IZ6A 3ZY4A 2R4TA 1QGDA 1R6DA 2YN4A 1KF0A 4Y6GB 5B64A 4X94A 2GZDA 3PKIA 4LDRA 3UAWA 3DH0A 2RH9B 2W48A 5EZSA 5FPQA 4Y2VA 2HZ7A 2OC4A 1MTZA 1L8OA 1R5BA 5IH7A 3VH1A 2BI4A 5LKRA 5J2TB 5B2EA 1QRAA 1NJ5A 5GONF 3CUUA 1IC6A 3AR6A 2RAFA 2BR4A 4OHWA 3TPCA 3IUYA 1C3XA 2XF2A 3AILA 2C96A 1VPLA 4CKXA 3KETA 1ENYA 2KBFA 4PONA 4R8LA 5CA1A 2GM9A 3OQMA 2NSLA 4GLOA 3WRYA 4MW0A 4K8OA 3H1PA 5JS8A 2I2XB 3HUEA 4Q3BA 1LW7A 5L3RA 3HC7A 4C7OB 4R1TA 4FMBB 2AFIE 5IZCA 3CRW1 2CV2A 1G6Q1 5DXAA 1P39A 4H1HA 3V4SA 4BZWA 2O8EB 1ESEA 4NJOA 3WNCA 2A4KA 1LFDB 4ZMSA 1DKNA 2DVMA 4IO0A 1M9NA 4OY3A 2XCUA 2E7ZA 3E9MA 4MVWA 4WNAA 4XFKA 4CL2A 1T4CB 3FNQA 1DAKA 2R6FA 2BJWA 4A15A 4BLUA 1U8ZA 2J0QA 1JJFA 3H7AA 3P71T 4JXXA 4YT5A 3ZDAA 3ON5A 2PSFA 1XRMA 1UBUS 2IYOA 2OOSA 4CQMA 4IFTA 2HEIA 3L40A 4ENQA 4R16A 3BDIA 4FZJA 1KP9A 4HAYA 4J0JA 3PDHA 5B7GA 2VQSA 3JSXA 3KSRA 4L51A 1MTOA 2BLLA 2IIQA 3FGNA 2Q4RA 3JQ8B 4AIIA 6CHYA 4PBSA 1KYIA 3DD1A 3TZKA 1X7XB 3UC9A 1UAGA 4HAZA 1O94C 3JWHA 3WRYC 3RG2A 3TH5A 1U0GA 1W75A 4KV9A 3TZ6A 2NPOA 4W8HA 4CMIB 4F46A 4YMLA 2OWEA 3OZAA 3SYNA 1M66A 3CNQS 3LDAA 4J1QA 5TQ2B 4EYOA 1U94A 3IQZA 5D87A 2XOKD 1P1FA 1D2RA 2Q3BA 3CG0A 4Q01A 5EWJB 4BLWA 1M1YB 4JI7B 3U31A 4KSBA 1DBRA 1EGQA 3V1YA 4GWLA 3ZY6A 2ZREA 2DUWA 4PYNA 1D09A 4EYEA 2C7PA 2IV7A 2C2OA 3U39A 1QU2A 3QLVC 2ZSJA 4RQAA 3L4KA 2VZEA 4MVXA 4TMXA 4B3JA 1XF9A 4H1UA 2HLDD 3QYJA 1SZCA 1LBSA 3L6CA 3HJAA 2FQ1A 1JB1A 2Q9BA 3EC7A 5JPDA 3SZUA 3MWKA 1RZRD 3VPHA 3IHTA 2XKAA 2PT6A 1W0CA 3FXAA 5DT2A 1UEXC 4AS2A 5A06A 1ABBA 1HR0B 1H2XA 5C5DA 1V4NA 1U4OA 1RYFA 3K09C 3ONNA 3PEWA 3LHFA 4CU5A 3H9GA 2FDXA 4GMKA 4ZAFA 3O8QB 4BV3A 4DYHA 4WKBA 3O4VA 1V45E 4EVIA 1GLVA 3KB1A 3LGAA 4ZK6A 1G41A 3KX2A 1LS6A 1NF8A 2P7IA 1DXOA 3CU5A 3M6FA 4LJAA 3X1DA 1WXEA 2HK7A 1ZK1A 2Y2VA 1QMPA 3IERA 3ZVKA 3DZHA 3GH1A 3X1MA 5DLDA 3OEEA 4WBNA 2RHWA 4L9RA 3GRUA 3CW2A 4L5YA 1BS2A 4O2RA 3M6AA 3TB6A 2PD3A 1JRLA 3HI4A 4D46A 1VYVA 5BSFA 1U11A 4WAUA 5A9RA 3G8BA 1NMEA 2NPIA 3SXUA 3RSZA 5JLAA 1SQ6A 1NQTA 2PVSA 1EVEA 4LE0A 2PS1A 2A9VA 3ABOB 1XZBA 4K6CA 3UQYS 3FTPA 1U7HA 2C31A 3LM8A 5F33A 2BSQA 1U4NA 2OA0A 2VUUA 2P91A 1LWNA 3HEAA 1AOXA 3GFVA 1YE5A 2CK3A 2PZBA 2WG2A 4URHA 5EESA 4BQNA 1IDOA 4ZMRA 3ILVA 3NWPA 5ITZB 1ZWLA 3ZTWA 2GT1A 1KFCB 3G2KA 2EBUA 4Q7JB 3WADA 3RADC 5EINA 2JI8A 2YV4A 3PLNA 4LX0A 1UFQA 3T15A 5HDQA 5G41A 4X9XA 1HRDA 1KR2A 3HJBA 3WRWA 4TXHA 2G17A 4BEWA 5HVNA 3I73A 4YO8A 4ZQHA 5I01A 4O0MA 2CNKA 521PA 1EGHA 4ZQCB 4BQPA 4MI9A 3UV7A 1HNWB 3R7FA 2A35A 2D5BA 4ZTBA 1CZNA 2Y76A 3BL5A 4MIYA 5AOVA 1A2QA 1BJRE 3DE0X 5IKOA 5C8VA 2MU1A 4XUDA 4BVFA 1U5CA 2VHEA 2F67A 1EM6A 3G9UA 4OXXA 5K3OA 3SWWA 1K8QA 1O0BA 3AKZA 2VAMA 3ESQA 3LG2A 5IUKC 4I5DA 1KJIA 2IYZA 3G2NA 3L79A 4RACA 1RLJA 4E5SA 2GJSA 3V7WA 4JLDA 3VOBA 1YS4A 4H4EA 4J7UA 3ETHA 4JUDX 4WCVA 3VAAA 4CN8A 2WM8A 4EB6A 3QOYA 1ZP6A 1NWHA 3R0ZA 3CVUA 1P61B 2J3MA 4TLLB 5B3JA 5I7EA 2O52A 3TAXA 1OH6A 2FQWA 3ACDA 3DM9B 3SJ7A 4DJDC 1KA9H 4FP9A 4CMAA 3Q8WA 4TLEA 4EGAA 4I50B 3U3DA 2QLFA 2HPZA 1T1SA 1H0RA 3PFCA 3THSA 1WMAA 2PRSA 2BHLA 2X5OA 1LVHA 4OREX 3V2IA 5C5IA 1PFKA 2PMFA 1VLLA 1Q11A 2PD6A 2WLTA 3D4NA 3Q3CA 2F3SA 4HXEB 3NUQA 4GC9A 4DJTA 4R1LA 2MR5A 2VSQA 3K4HA 2DKFA 3MC1A 5A9SB 5KB3A 2HLPA 4RE6A 4J2TA 1X1DA 3CZ4A 3LX5A 3HHPA 1ATZA 4OJTA 1NT2A 5HWSA 4RVUA 5AKYA 3PC8A 2ETVA 3PC7A 4WK4B 3ZHXA 5CIWA 1AO0A 4MKGA 9ATCA 1PUXA 3DTTA 4K9DA 4TTIA 1OBFO 2DZDA 2I6QA 4LYHA 3SM3A 1GG2A 3BWEA 1Q1EA 3IUMA 2MSNA 3R5TA 1B4DA 1ADGA 1H85A 1HQYE 4WECA 4EQZA 1UBLS 2QNIA 3IR5A 2ROQA 3KKLA 5KHLB 2XA2A 2PDAA 3LWDA 5KMGA 3F7TA 1YAJA 4CFYA 1XP8A 2YIVX 4BZQA 3DVQX 2PZJA 3KUKA 4YRZA 2BLNA 5HPYB 1P6XA 1MIOB 1X38A 2JJ2D 1JHXA 1NP3A 4NBSA 4ZVOA 3UN1A 3R7SA 3THYA 1ZOLA 5EIWA 5LC1A 2B1QA 2AI2A 5EYPA 4PVCA 3SU8A 3LCJA 1TF2A 3M5CA 3Q9NA 1FNBA 2OBYA 1LI5A 2BVNA 3BULA 3KFLA 3ZVLA 3U6KA 2PRZA 3WMGA 3ELWA 3EOZA 3TDMA 5ADVA 4PG8A 4YV1A 5IDVA 1X8JA 2GS9A 1F60A 1RWKA 2F9MA 5AT1A 3CNEA 2ZROA 4TKLA 4C6RA 1T8YA 1Q0UA 4OV6B 3G9TA 3ZHQA 3I04A 1J5EB 1C7ZA 1DPGA 5DX0A 5JCZA 1XXHB 1H6CA 1Z4IA 2AXPA 2HDOA 5JASA 1R64A 1GHTA 2RCYA 4PZZA 1SA0A 3D1LA 4UHHA 4V0LA 5KI6A 4BFZA 1M1XB 2C2BA 4EKEA 5B4UA 1DEXA 2ZRGA 1Q7BA 3OUUA 2X1LA 2XI4A 2W2MA 1D4ZA 2ZAYA 3FNRA 4ZWNA 1XCBA 3B6JA 5FLKA 5IJXA 3NTXA 1D4FA 1PQYA 1V7ZA 3GFQA 5ED4A 1L7NA 1UM9A 1KFJB 3CRZA 3DLBA 4E4YA 2QIPA 4XGKA 1SHUX 4WZBA 1DC5A 2INGX 4UHJA 1YS6A 3TIXB 2WI8A 2P5TB 2WYVA 3MA0A 4WCFA 2PT9A 4WN9A 3LX8A 3HCDA 3D3WA 2FRDA 4PCVA 1UBGA 4Y2TA 2PYIA 2VRBA 2ECKA 3OTWA 4U5QA 4CVNA 2GF0A 5H5JA 5HIKA 1YQGA 3TJMA 4OH1A 4A9AA 1VLMA 4NK5A 5KWVA 5JISA 2OCBA 3EAQA 4EA6A 5CK5A 2HB6A 2FRDC 2D74A 4NU6A 1V8FA 3N59A 4CYMA 3ANNA 3BUSA 2GERA 3I30X 4D96A 4WXHA 1TFUA 4N6GA 1TDJA 1VGRA 3BE5A 1OAKA 1QTRA 3O1IC 4RD4A 1UADA 2WYIA 4QUDA 4WINA 3ZV7A 3A58B 4MDFA 1RLUA 4EHLA 1D8TA 4KNVA 5MF6A 2M6RA 2PX5A 5HE8A 3I53A 3LWNA 3KELA 4G65A 2EFYA 2ZRFA 3DZBA 3ZUPA 2VHCA 3S1SA 2UU9B 1KNQA 4E6EA 3K1TA 3HYCA 4P53A 4WOCA 4R2WA 2LDXA 4K9RA 1A9OA 1FUKA 3B51X 4COKA 5FWXB 1IBCA 1N6PA 1D4AA 1ZY2A 2B4QA 4QOFA 1VKHA 4ZU1X 5C1OA 5J4LA 4OI0A 3PFBA 4V0NA 3IVRA 1TM2A 3SHTA 3ORHA 3VKWA 3DLIA 1XNHA 2FQXA 4KVZA 3KQOA 5AHXA 3VR2D 4YJHB 2BFFA 3E9ZA 4RABA 4CEIB 3EXEA 2J4DA 3S2UA 2A1UB 3H2GA 3LVQE 2B2NA 2GQ0A 4W99A 4FOTA 2JIDA 4NEQA 4D0GA 3OI7A 5FI0B 5J4HA 2WFLB 2NAFA 1B76A 3Q9UA 1FTYA 3K6JA 1II9A 5DLPA 3TQFA 1SJ9A 1BJKA 3ICCA 3IEKA 1OU0A 3GUVA 4FHEA 1LQTA 4S2UA 3BG5A 2OPHA 1LLFA 4B79A 1Y5MA 5FQOA 3CH4B 3GROA 4RORA 5CR9A 1Z6QA 5BSWA 5BMVB 1TVKA 3FOBA 3G17A 3MBIA 3EODA 2VK1A 1L5ZA 4JLPA 4ZP1A 1IK4A 4IEIA 1H2RS 3SYMA 5KNCA 3GEEA 2II6A 1RTKA 4KYUA 2A0YA 1GQQA 2IKSA 4IWXA 3V80A 3KQVA 3TL6A 2DWOA 1YIDA 1HWYA 3O4RA 3UHAA 1G7SA 4FONA 4LOJA 3FX2A 1V6SA 2G7ZA 2ZSAA 3G5TA 5DYWA 5J47A 1A9ZA 2XGGA 4M49A 1O0SA 4UMEA 4ZVNA 1HZZA 1HE8B 2QYTA 3OX2A 4W9NA 3O8DA 2YMQA 3TDNA 5H68A 1Z07A 2D00A 3LQYA 3JS5A 4MV1A 5J40A 4M7OA 4BKRA 4YHHB 1P2VA 1WB4A 1U9JA 2GASA 3CPHA 3OLCX 5DP2A 4DCPA 4F0JA 5KTSA 1S2NA 1DOAA 1M6WA 2WDZA 1PZGA 2YINC 5CJPA 2OBMA 3M1LA 3ZU3A 3QWAA 1O1YA 1UMCA 4UNPA 4B4OA 4IKPA 2C3OA 1P2UA 2WK1A 5HQ3A 2BGNA 1Z4OA 1X8KA 4IDDA 3GJ0A 1OGIA 1W93A 5JG7A 2I5PO 4YFYA 3RHTA 5KKCA 1A82A 3GV0A 5IKXA 3ANTA 1T8WA 4RF4A 3ZWKA 1Q77A 5CU7A 4B7AA 3CVYA 3EGDB 5KX5B 5H3CA 3TTUA 2GVNA 4ND1A 1QH8A 5DVZA 4MINA 4C22A 3E70C 2JPDA 1K5GA 4G9GA 1Z82A 4YCMA 2F48A 5JLJA 4AQYB 2BFPA 1X9GA 5LYJF 1O5TA 2ZRPA 3HUUA 4TM7A 3VHXA 3BDAA 5EEGA 3AL2A 3PDCA 4BMZA 4M1SA 4R9UC 2WT8A 4AULA 1NAIA 1ACJA 3A9CA 4Q9HA 4P5PA 4YUXA 4A36A 2C59A 3O4JA 4MR8A 3TW4A 1RCFA 3LDFA 4MIKA 1EUDB 3U3ZA 5C7IO 3UMYA 3DZCA 1AQUA 3DYVA 4JJGA 3IIKA 4EGSA 4EWLA 2YJGA 5H9WA 2JEYA 4R98A 5SYAA 1YZHA 3LXUX 4IH1A 4Q5IA 1EIZA 1EP1B 3G85A 1SVKA 2AXEA 3GRPA 4IJWA 4XB6B 5T4BA 5DRTA 4EG0A 2ZJ2A 1PHPA 3R9KA 3E1SA 4CI0B 2NOAA 4N5NA 4IICA 1K68A 1I9GA 4P4UA 1BE6A 2Z56A 2CNLA 5INTA 2WM9B 3R24A 4ZPXA 3EGOA 2GX6A 1ZZEA 4L5IA 5CB6A 6Q21A 1VHDA 4BB9A 1JHZA 3BIFA 4E88A 4I1UA 5DHFA 2JCYA 3W6PA 1VIAA 1J2JA 3UBMA 4DXHA 4MITA 4O4JB 5EVJA 2D1TA 5IK2D 1Y9AA 4LXTA 1M0EA 1BVHA 5F3DA 4JI6B 2DP4E 4G26A 1ONNA 4FQ7A 4X90A 5LMUB 3FSJX 3LX6A 3JATB 1Y1TA 3GRFA 2AR9A 3EZNA 3R77A 5CG1A 4EFKA 2REQA 3NHMA 3NTQA 4NH4A 5CURA 4NU0A 4L4XA 3IS3A 2JATA 5JD3A 3VKVA 2ES4A 1GR1A 1SA0B 5DMXA 2VNIA 2IQIA 3L04A 1PFVA 2QAJA 2VI5A 4AYTA 3D8NA 5JE8A 3BXPA 1JR2A 1AURA 3NGXA 5U4QA 3IP3A 1OYYA 2MSWA 3C3CA 3PCXA 5CB4F 3I9KA 3IBCA 1TIBA 3V4PB 2NSDA 2CLLB 2W6OA 3LP5A 1I2ZA 2OXEA 5DLQC 4QVIA 4XM0A 2NVWA 1KETA 3HPRA 2TSYB 2GFIA 4W5TA 3LKVA 4M1ZA 3C5HA 4EG8A 1GLGA 2FG6C 1M2GA 4PGGA 4RK6A 1MW8X 3ZDBA 2Y0EA 4NG4A 3HFRA 5BW8A 2CHFA 1SCJA 3FLMA 3G2JA 2ZRJA 4B35A 4BCDA 4YMUA 5K3EA 2QRZA 4UDNA 1ZNYA 2FF5A 1JFFA 2IITA 3CH6A 1NF9A 1ZD8A 2C9MA 2RC6A 1ZG3A 4L6CA 2C5BA 4MNTA 1JKJB 1K9SA 1KY3A 1TM1E 1UPCA 3AKYA 3BF8A 3DV9A 4GHWA 1H1LB 1YO6A 2DOKA 1DDOA 3H2ZA 3OC0A 1HE4A 4GU5A 4LK3A 1B1AA 5J4VA 4F7DA 1NFFA 4I1YA 1ZNWA 1OFIA 4ZCRA 4FDTA 4JGBA 4TKVA 4LF4B 1J24A 3OOEA 3DTVA 3DMRA 3SKVA 4CKEB 2PAAA 2V58A 3OEED 3QEMB 3ZHVA 2QEQA 3P2YA 3DP9A 1BKYA 1QQ5A 4OH7A 1M10A 1Z74A 3CS3A 5CITA 4F93B 1BS1A 1LDEA 1HQKA 3PQ2A 3PVCA 2DUUA 1FRNA 1KZ9A 3TI7A 1A9XA 1WQ1R 3HCBA 4ILKA 4HWGA 3RQIA 2ZCJA 4ZYYA 1WQ4A 3COVA 3MINB 3MTBA 3IP1A 1O6BA 4HK4A 3UIEA 1MQSA 4UTVA 3K70B 2QP9X 1CRPA 5ESRA 1P33A 3OE1A 4EYGA 3EDOA 1E7YA 4JI3B 1GRVA 4EG4A 2D54A 4C03A 5D5QA 4ZZIA 5B57C 2F00A 4LPSA 1XT6A 3WL6A 3LF2A 4N54A 2XAAA 1GA6A 1I6KA 3PCRB 4BE9A 5B3LA 5A3QA 2Z3WA 5E6RA 2C8KA 4NAUA 1HDRA 1NUTA 2IGBA 1U04A 1JBKA 4CM3A 4FSHA 3CONA 3NTVA 2O59A 2IRWA 3BMCA 3OM8A 3UA3A 2GD1O 5E6SB 3WLMA 2ZUFA 3VFDA 3A6GA 1K2WA 1P0MA 2D7JA 3JQEA 3R40A 4B75A 3S8YA 2GKGA 3EIUA 1WXDA 4IG4A 1DS6A 2WBLC 1XCOA 1KI6B 1ATIA 3EVFA 4IHAA 4FWIB 3ZCTA 1BEUB 4MQFA 4ZOLF 4XJSA 4X3CA 1IY9A 4I1OA 4MV4A 1YFLA 1AT1A 1ECPA 8GPBA 4AS1A 4F4UA 1L3BA 4HWOA 3B8HA 4PC2A 2QX7A 4XJTA 1YGPA 5C4IA 1FJGB 1C1DB 2CCGA 2VAPA 3EFOB 3SHFA 4CMEC 2XTZA 1G63A 3V4FA 1F5NA 2BGIA 2ZYHA 3HADA 1KMCA 3FW1A 2G08A 4D57A 3IPLA 4IF4A 1X94A 2GK7A 3GF4A 4QUBA 4RJ2A 4JUFA 3BA1A 4R71A 1FFEA 4Y2XA 1OA1A 3A9WA 4NV0A 1R0YA 1T6NA 3E9NA 4JITA 5T8KC 3TNJA 2ZJAA 5KYUA 1HOTA 3H1FA 3AIKA 1PSDA 5ALSA 4C2AA 3N2NA 3HVRA 1HPLA 3TECE 1X42A 4L6AA 1BIFA 2A5FA 2FGKA 2J6CA 3OMLA 4HB4A 4B3CA 2X0KA 2QVXX 1N0WA 4JS0A 5CLLA 4OVKA 2HMSA 4MW9A 4CQMB 1NX6A 1UK8A 3HKCA 2A14A 4EW6A 3ICEA 4LHXA 1ZR2A 1Y8AA 3GNLA 2OBXA 2FLKA 1Y1RA 2JFVA 1V16B 2ZOSA 3EGIA 3EYWA 1B73A 4G5SA 4JL5A 5AK0A 2LIPA 3AFIA 3WJ1A 2XZOA 1WHTB 3N0TA 5ESXA 4OHUA 1US8A 5LUBA 4FW8A 3QPAA 1PZMA 2IODA 4J9UE 4K9SA 4IAOA 5KC9A 1XELA 2G9VA 2EC5A 3E35A 5F64A 1FNCA 3HBJA 1ZLYA 2IHKA 3I1IA 3R6WA 4OP2A 2BTQB 4OLHA 1I6LA 2WPDD 2DWUA 3A1NA 1EFPA 3OIUA 1WCYA 2G4CA 3EEYA 2QSJA 4BFVA 1KO4A 1CJKC 1NQAO 4FJ1A 3OOSA 2XTAA 2JLYA 1Q2UA 3LY5A 4P7FA 4UTZA 4OGFA 2AUMA 5E9WA 2W11A 1I94B 2XGJA 1OYWA 1IOLA 2O14A 2VOEA 3GG2A 3H1TA 3H5TA 3N70A 4RIFA 3GLGE 2W71A 3AW9A 3DBRA 5BN1A 2RE8A 3GVPA 4G5FA 4Q47A 2GPNA 1UZMA 2B6NA 3ZOZA 2JASA 4HRXA 3VO1A 2JGRA 2QTBA 4YAOA 4EKNB 5JAIA 4YRFA 5MFPA 1I4TD 1ZIOA 5F7XA 4ZOLB 4YP6A 2JI9A 1Y9ZA 2NV6A 2IIPA 1UBCA 3LKDA 4PPFA 3WYGA 3NU1A 4QQNA 2CSXA 1JIVA 3UFBA 2OQRA 4CUJA 1YU9A 1HYBA 4CG2A 4CLDA 1CUEA 1QRTA 4KDFA 4DTCA 1JHPA 4IFEA 3EZXA 5IBPA 2JIMA 4LDPA 1RM4A 4O3FA 4TN1A 4DBZA 1TZKA 2ZT7A 3X44A 1CU1A 2MYNA 3Q6MA 1G7RA 5HF8A 3VUFA 3JQ8A 2PRJA 1PQUA 1W85A 4KN5A 1G0NA 1F1JA 3GJZA 4QGFA 5TGTA 4BFWA 5AESA 3AR7A 2KSQA 1VE9A 2WU3A 3N8NA 3P9NA 1CDDA 3QA3E 4V0OA 4HBGA 3S8EA 4GLBA 4IMPA 1ITZA 3GJ3A 1F8GA 4MXDA 4IIJF 2AC2A 3T41A 2MYPA 5GM2A 3SSOA 3AUUA 4GMFA 3STYA 4CJXA 3FPEA 3ZCXA 1T5OA 3K4PA 1T9GS 3B36A 4ENPA 1IEVA 3K0SA 2QL9A 2ZYAA 2DKOA 3GN1A 3N6XA 4PANA 2O7SA 5DOVA 3EXIA 3NAMA 1L5NA 4ER5A 4J43A 4M9RA 4QIHA 1MPTA 4R2MA 4OA5A 1V8PA 4DSAA 3EQ8A 5LUAA 1O4VA 1Z6PA 3H17A 5F9HA 5AVKA 1N36B 1UJ6A 2WF6A 2F8TA 6REQB 1DC4A 3DFZA 1GV1A 1O97D 3OZCA 3UMGA 2OENG 4YMGA 1W5SA 2Y0DA 1KE1A 2FFBA 5AW6A 5G4KA 2Y3IA 1EX9A 4CLHA 1C81A 1R6UA 4CQLA 1GAQA 4M9XA 5LXTF 3TFWA 1S3FA 3P96A 4TT3D 3WICA 4CM9D 1I5RA 1V1JA 4DZRA 2GD0A 1EXVA 3ZE7A 3ITEA 3IQGX 4PU0A 3SEAA 3HJRA 5E7IA 4QOJA 1QQ7A 3WAJA 3AIMA 2IZ0A 4JVSB 4TL6A 4C4ZA 1GZVA 2XUOA 1Z3IX 5K03A 3WL8A 4DQKA 2VRCD 3ABQB 5AKHA