2VWTA

Crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12 - mg-pyruvate product complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
MNALLSNPFKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQRIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDTMLYSDALDQRLAMFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Assignment of Yfau, a Metal Ion Dependent Class II Aldolase from Escherichia Coli K12.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords YFAU, 2-KETO-3-DEOXY SUGAR ALDOLASE
total genus 90
structure length 256
sequence length 256
chains with identical sequence B, C
ec nomenclature ec 4.1.2.53: 2-keto-3-deoxy-L-rhamnonate aldolase.
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2vwtA00
2DUAA 1VBHA 2WQDA 3HQOA 4QGCA 2E28A 2DIKA 3KTXA 4IP7A 4QG9A 3GQYA 4QG6A 4IQEA 3LYEA 2QIWA 3H6OA 3E5BA 3ME3A 3QQWA 3FA4A 2V5JA 1U5VA 1ZLPA 1O66A 4B2DA 3FA3A 1IZCA 3QV9A 3EOEA 4IMAA 1XG3A 1OY0A 3M0KA 3G2GA 4TV6A 2VGFA 1JDEA 3HQNA 1ZJHA 3R4IA 4B5UA 2OLSA 4KRZA 4B5VA 3OYXA 3T05A 3SRDA 4B2DD 1M3UA 4KCTA 1AQFA 4HYVA 3GG8A 1M1BA 3QV8A 4JPGA 4L7ZA 1PKMA 1DIKA 3PUGA 4B5XA 3PP7A 2G50A 1O68A 3T07A 1KBLA 4MF4A 1XG4A 3QV7A 1OQFA 1E0UA 4TV5A 1PKNA 3EOOA 2HRWA 2HWGA 2VWSA 3P0XA 1A5UA 2KX9A 2ZE3A 3I4EA 1DXFA 2VWTA 1PYMA 1A3WA 2XZ7A 1PKYA 1GGOA 3SRFA 4B5WA 2VGIA 4L9YA 3KHDA 2VGBA 3BJFA 4KCUA 4KCWA 2L5HA 3M0JA 4IQDA 1IGWA 3OQ8A 2X0SA 1O5QA 1E0TA 1DQUA 1UJQA 1F3WA 4LSBA 4L9ZA 3LG3A 3EOLA 3N25A 3B8IA 1S2UA 1F3XA 4RPPA 4MG4A 3BJTA 4ROQA 4B5TA 4DRSA 1KC7A 4L80A 1F61A 4YJ5A 4B5SA 1PKLA 3U2ZA 2XZ9A 3E0VA 3T0TA 2VGGA 4HYWA 1F8MA 4WJ8A 2V5KA 2XDFA 4KS0A 5TAOA 1SGJA 1MUMA 1Z6KA 2HROA 1VBGA 3HQPA 1S2VA 3EZ4A 3MA8A 4FXFA 3SRKA 3SRHA 1A3XA 5JVLA 3VAVA 4G1NA 1DXEA 1S2WA 1F8IA 1S2TA 1A49A 1U5HA 3QV6A 3QTGA 1T5AA 2BG5A 2R82A 2HJPA 3QZ6A 4YNGA 3IS4A 3QLLA 3GR4A 3E0WA 4KCVA 4QG8A 4FXJA 3OYZA
chains in the Genus database with same CATH superfamily
1G7VA 3LPOA 1SZGA 4JFTA 1XIMA 4QEEA 2Y88A 2GVLA 4F2UA 5EB8A 3VUPA 4MNJA 2E8ZA 1UWAA 2QCFA 3H12A 5I3JA 5CLTA 4A3YA 1SW0A 3QRHA 4UTWC 3ES8A 3LHVA 3FAWA 3SCSA 1G69A 2WO5A 4QCEA 1HNYA 5E93A 2VGFA 1QW8A 4TMCA 5BYWA 3V1HA 4QX4A 4Y6GA 4MNLA 1RY0A 3THUA 3P60A 4B5XA 2Y63A 5HINA 4KEMA 4MFEA 1VFLA 4DJDA 1JCJA 1JCYA 3WEMA 2W27A 4QHRA 3O9NA 3MSDA 3AS0A 2I9UA 1NF7A 1TV2A 1PS9A 3LCLA 2PDXA 5DXXA 2ZYFA 1VFFA 1H7NA 4GQ0A 4HZ7A 2J6XA 4XBKA 3WLSA 5LIYX 1G4PA 4CCDA 5GPRA 4Y90A 3SW6A 2VFGA 5HQLA 4HNTA 3K4WA 4NG3A 1T0OA 3MA8A 1XFBA 2VOTA 3B8TA 2TMDA 2XYLA 2QZRA 3WBWA 1RVGA 3ITXA 1MRQA 3FSTA 1W1VA 4LC8A 4JQAA 3PAJA 4LWWA 5HK4A 4LB4A 4K68A 1HTIA 4NZ5A 4Y2WA 4JNZA 1G94A 1ZGDA 1XSJA 3OQEA 3EPOA 3LYEA 1UC4A 1FX6A 2GK1B 1N7KA 2NQHA 2YA0A 4JKMA 3OBKA 3PZNA 4PMYA 2NVDA 4JX5A 5D9OA 5CCZA 1ADSA 3N3TA 3HQNA 1NOWA 5AHMA 3W6LA 3W1TA 1M65A 1KRAC 4HNOA 1HJQA 1DWGM 3MI3A 4P61A 1TYGA 4PUEA 4PODA 4GIEA 1HVXA 4JXCA 4YVPA 1W9VA 4JIEA 1CB7B 3BJFA 1H49A 1R2RA 2X1TA 2WHLA 1TVPA 3FX4A 4ZE5A 3VGGA 4HNCA 5I3IA 3N25A 3FKKA 4FA3A 2EF9A 1B2YA 2PRHA 1SO5A 4RJEA 3PZQA 4EPDC 1IXOA 4O12A 4FX7A 5A6SA 2HQAA 2IKIA 3DFYA 2FLIA 3CIWA 4F79A 4X0NA 5FAJA 5LXEA 1XRVA 3HV9A 3LXCA 3FJ6A 1XHGA 2ESCA 3I65A 4L64A 2Y89A 1B3VA 1K4GA 4RKAA 2DY3A 4XO7A 3W7NA 4DUOA 2Q71A 4WHBA 3V35A 7XIMA 1W1ZA 1XJBA 4FR6A 2AL2A 3IARA 3PB0A 1XLGA 3DXIA 3VIJA 3CUHA 1GOOA 2AOSA 3VILA 3WIJA 3O16A 1JYVA 2CHNA 2CLPA 1T8XA 5XINA 4Z2JA 5CAKA 2DQXA 3RXZA 1V0MA 3M4HA 3PHAA 2OLAA 2NUYA 3PG9A 3NQVA 4B5UA 3GK0A 4XZIA 1EC9A 4DQWA 1O60A 5DX7A 4FLOA 1DWJM 3MTWA 2FZNA 4FK9A 2VWSA 1M03A 1V77A 3VZZA 4DO4A 3SQLA 3F03K 4L61A 1W3IA 3WUBA 3WBXA 1QPKA 1BVZA 5H8MA 4ZOAA 3F4CA 1IQ8A 4PTNA 5K9CA 4ZQPA 4WOZA 2POTA 2JIEA 3TVAA 1YBQA 4H9UA 1E43A 2C1IA 4F2BA 1R85A 2QV4A 4KS0A 1N82A 4LF2A 4QLLA 3QY8A 5AB3A 4HNUA 3N9RA 3ZS4A 1Y65A 2X1IA 2HVNA 5DF0A 2WVSA 1B9BA 6ALDA 3A4AA 3VO0A 1T5AA 3MU7A 4RZBA 3IS4A 1I45A 3DOPA 1JDCA 4XTIA 5A5WA 1FWTA 4QROA 1ZS2A 1XPYA 1DXIA 2Z6IA 1RD6A 2HBVA 1O7AA 2Q6ZA 3BLFA 4I5RA 4ZR8A 1TPC1 4QIUA 4I7UA 3VDAA 4ZQOA 2OODA 2AAMA 4LW7A 4IIBA 1VLWA 2P3ZA 3W01A 3M0YA 4KWSA 1XH0A 2BVTA 4GQGA 4QCFA 3QY7A 2HBXA 2VHLA 2NX3A 4JHMA 4J40A 2DW6A 1B31A 4M0XA 3W88A 4O15A 4G6CA 2YPIA 1TUFA 2YB1A 1UKTA 1WKEA 2ATMA 1NEYA 4HZ8A 1FH9A 4IMCA 4H9VA 1RCXB 3VIMA 3SUVA 4DAFA 3MWAA 1BWVA 1W6TA 2A1YA 4NZFA 2J75A 3W87A 4E2OA 1W9PA 1XLDA 4PUWA 2FQIA 3L0NA 4KPLA 3IAQA 5D30A 3NQEA 4NX0A 1XLJA 3VCCA 3LMYA 1MQQA 3URAA 2AKZA 3CQKA 3M16A 1OHLA 6TIMA 2ZX5A 4PMDA 4W8LA 2HNEA 5DMMA 1IIHA 2PBOA 4GYFA 3QW4B 4OV9A 4AH7A 3LCFA 4PE8A 1I1XA 1I6NA 5CZSA 1TIMA 3WD3A 3VDBA 5ABTA 1I2PA 2PU0A 1QNSA 3L5LA 4U4MA 5EMJA 1MFVA 4DZHA 2UV8G 5DBUA 4Z1CA 2BMBA 3L21A 3KXQA 3N9SA 2ZIDA 1TV7A 3W82A 3A3HA 1SW3A 5K7JA 1CWYA 1OG0A 2XN0A 4M6PA 3ARVA 4XK2A 1P5BA 2VX7A 4EKJA 3WJSA 1DV7A 3WN6A 3SCQA 2OEKA 3OLIA 1QASA 1H41A 1EQCA 4QQUA 3FXGA 3SB0A 2QCHA 1V7YA 1PCKA 3IRDA 4O0QA 3NQ7A 4DBWA 3HMCA 1B4KA 5D09A 3N04A 1ZQ5A 3R58A 4O0ZA 1WCGA 4UTJA 1J0HA 4N02A 4Q33A 2CWXA 2J13A 5C0QA 4ACYA 2TSYA 2CIPA 2AKMA 3REQB 5GNXA 1JCMP 1R8LA 4NF7A 2PWHA 4FNUA 4LUSA 3THDA 4ZO7A 1EO7A 3EWWA 4LXFA 5DANA 1H09A 5DXYA 4GJ1A 4PTMA 1R3RA 3ZIZA 1P48A 3U57A 2XUCA 4F2TA 5IHRA 1BF2A 1BXNA 2NSXA 1EC7A 5PTDA 4XAYA 3OTRA 1UZDA 2F38A 1E70M 1OVDA 4CQ8A 2DORA 3GQYA 1YTEA 3VKKA 3N18A 3CZEA 5A8NA 3A6OA 3TROA 1J79A 4D9PA 1BVWA 4H00A 4ICCX 2VT0A 4IG2B 1BXBA 4H6KA 1VFTA 2WC3A 1TPB1 1P1MA 1P0DA 1TZ9A 3AHYA 1HKMA 5LGXA 4FB7A 2BHUA 3WQ8A 4M19A 3WDQA 4DJFC 1GW9A 4JNYA 4X22A 3G77A 3UR8A 1FWNA 2FZDA 1K02A 1XP3A 4QDPA 2GGIA 4Z1AA 1LM1A 1YNYA 4C7DA 3CB3A 2D22A 4PC8A 3WY1A 4AYGA 2FGZA 2EBNA 4R9OA 5A95A 2C18A 4G8TA 3L2IA 3TFXA 4KEUA 2QCDA 2VMFA 1D3GA 3KP0A 4RNFA 3GXTA 3AXHA 2YL5A 3QGAC 1PZ3A 5CGTA 4O10A 1ZBWA 3QLDA 1SYTA 1IEVA 1H1YA 3AS1A 3WQEA 1G1YA 3FKRA 1EP1A 2PAJA 3SADA 1TMQA 5JIPA 1V08A 5I03A 4GNJA 1JYXA 1V93A 3VM5A 4I5UA 3WLRA 4Z17A 3RCMA 1ZJAA 3ALGA 2YBUA 1C9DA 1FHDA 3DX5A 5HNTA 4TVUA 3F7JA 1FA2A 1A80A 3LNMA 5CBJA 4DXXA 1HG3A 5K4ZA 4TR9A 1XPGA 1OFDA 4RW5A 3OZYA 4DYJA 1OBAA 1W3HA 3UPWA 2W62A 3W7MA 1AD4A 4QJ5B 3FIGA 3Q4DA 2Y62A 4P7LA 1VRXA 3WO8A 4O4WA 2HVMA 4OVXA 4W5UA 2GUBA 2CHRA 5G2IA 4AEOA 1KD0A 3W7HA 2B4GA 3UFYA 1IV8A 1N2VA 4A8RA 1UIOA 2KX9A 3PK7A 1WDPA 3KS6A 3IJ8A 2PDMA 3JW7A 5DQPA 2BXVA 3NZQA 2P5NA 1YNQA 2B7NA 1THFD 1LORA 5HR7A 4W8BA 3GWQA 1PJ9A 4UTFA 3U4FA 1O5QA 3RDKA 2V2CA 4H41A 4D72A 1X39A 4PEEA 3WYZA 3KBWA 1HF6A 4V1XA 5HA7A 3NZRA 2HISA 3DAQA 4MGGA 2Y5EA 3B04A 1WAUA 4QJ3B 2VEMA 2IS7A 4J3XA 4E8CA 4N9CA 1VPYA 2XFRA 4PMZA 2Q8LA 4RDZA 4AAJA 1LZOA 1KFWA 2PGRA 4JCMA 4AHOA 1FVPA 3WDJA 1B3ZA 1SR9A 3E12A 5EGRA 3S9IA 2GJPA 5C54A 3G3DA 4HNLA 4JFUA 4LS1A 2NQLA 2PI6A 3MVTA 4ZQMA 2J9XA 1QI0A 1AL8A 3FA3A 4EXAA 1KCXA 1G01A 3O1NA 3KHJA 1CPUA 4HHLA 3KVLA 1MRAA 4S38A 2DT0A 5K9XA 1R3TA 1RUSA 1H0GA 5ENLA 1GZGA 1FUYA 1Q6LA 2CLMA 5BXTA 2TAAA 5H2ZA 2SFPA 1WB0A 2HVOA 2QULA 3BGAA 1M7OA 1JQVA 1G9HA 1NELA 1XH1A 1W1A1 4JIIX 5C2XA 3SRFA 3EXSA 5L6UA 2YBVA 5D9PA 3VOGA 4TX8A 1BFNA 2A7NA 5D4YA 2A85A 1VFMA 3LBCA 4I90A 3GDLA 1XLBA 3NQBA 3TV8A 3WQ6A 1KWGA 1X97A 1XIEA 1FH7A 4F40A 5HWNA 1MXGA 1E51A 1PE1A 4MJZA 1JZ6A 3UJSA 1DTNA 4FX8A 1T6MA 2DQWA 3H26A 1R47A 1O5RA 2O9OA 3LI0A 4LEQA 1JCLA 1TPUA 3NO5A 1KRMA 4MDOA 3NUKA 1LQ2A 2AGTA 3TAOA 1KGXA 3B9EA 4NXKA 1GORA 2DP3A 3VGBA 3W70A 4R9XA 1SFLA 1R9ZA 1CT5A 1R2TA 3SQMA 1RXOB 2PBGA 2QMKA 1SZNA 4RUBA 4PMOA 3T09A 3U9IA 2PDQA 4CLMA 3EB3A 2OTDA 5B80A 1A0DA 1LTDA 5HUOA 4ZVJA 1TKKA 3PBGA 4PZVA 3DFNA 1U5JA 1UQZA 3OOQA 5D03A 3N17A 3TMQA 4NY2A 3GHUA 1W3TA 1K77A 3PAOA 2DSWA 1VBJA 2QJJA 2O4MA 3HA1A 3UXIA 2C71A 5DY2A 3CS2A 4C6JA 3PZOA 4W89A 3UWQA 1T40A 1MUWA 2NUXA 5BRBA 1ZPTA 2YL6A 4IHCA 1PHWA 2G96A 3C6CA 3W6MA 3QN3A 1OF8A 3T7VA 3HOJA 3TTOA 4TX9A 3V5CA 1F9CA 4DBDA 3L0GA 2D1ZA 3MMWA 3SCUA 1R38A 1Z32X 1TA3B 4GX8A 4PUDA 1V51A 4A3UA 3BAIA 1O1ZA 3KCJA 1DYSA 1LWHA 4QDMA 1R0MA 3S5ZA 4EANA 4YCOA 1QW7A 1H63A 1ITUA 3C56A 1KKOA 1CEOA 3A12A 4NL1A 2YCKX 1EHNA 3UT0A 2D73A 3ABQA 1MXSA 3ATYA 2J78A 4TX6A 1R7AA 4XISA 3OHIA 4JTSA 2BS9A 3E74A 3IK2A 1YXYA 1YYAA 2FZBA 1KKRA 3P62A 4CQDA 4O1BA 4UR9A 5E0CA 4IMEA 4R88A 3PTDA 4W8AA 3HURA 4CNOA 1JNDA 4BCEA 3SFKA 4Q8VA 5C7VA 1NJJA 4LBUA 1J12A 4QITA 3TSDA 4ZXOA 1JXJA 1QWKA 2VR2A 3W7CA 1DJQA 3M5YA 3ISIX 2Z2BA 1CGXA 1A0CA 2PTXA 3GH5A 3WNKA 3BH4A 4IIGA 1QCWA 5HBFA 1UUQA 1PTDA 2ZZ4A 4ZENA 4C6FA 1OD0A 2PWEA 2FVKA 4BF5A 3U2ZA 3FNDA 1WBJA 1XRSA 1W1YA 3T44A 3TYUA 4UMAA 1SGJA 2OQHA 4AY1A 3H4XA 1TWDA 1VBGA 3FVDA 3R0UA 1D8CA 1UR2A 1C8YA 1S1RA 2POZA 4PUJA 1P0BA 3OZPA 3P67A 5AVNA 2XH2A 3WNLA 3N4AA 4A05A 3ABZA 3W76A 4YTSA 4FP1A 4MMWA 4L1WA 2GYIA 3OU8A 4ZA0A 4US5D 5C55A 4GZEA 3N11A 3WFAA 2YL8A 1YNPA 4XG1A 2E1WA 1HX0A 1RJPA 3G0UA 3WBYA 2G97A 1PWMA 2Y0FA 1HO4A 4LB3A 5D33A 2C1HA 2YYTA 4QS5A 2WW5A 3CQJA 1XGEA 2QCGA 2Y2WA 3ZR5A 3B8SA 5C2CA 1MQPA 2WLYA 3LCIA 2OVLA 3OYXA 4JN6A 4JY9A 5HPCA 4UOZA 3O0KA 3QPZA 3UWUA 1JD7A 2XH7A 3GE7A 3L4YA 4AISA 1PKNA 3A5VA 1YX1A 3E2QA 3KCLA 3HTWA 3OBAA 3CQ0A 4HMEA 1SMAA 1W9BM 4GI8A 3IANA 4NSBA 1EL3A 4I5XA 2GVJA 4YL2A 4LSBA 3AZSA 3QR3A 1US2A 3FJNA 1OT2A 1X1ZA 2OG9A 4JQ3A 3EBVA 4CNPA 2BXZA 4FOUA 2YCIX 3OG2A 3DESA 2GSHA 4QNWA 2YGYA 1K03A 3AC0A 4JKKA 1MUMA 1E55A 5TNVA 5CC5A 3STPA 2QDHA 2QQ6A 4CKQA 2Y70A 4LPCA 2H3DA 3BQ5A 4LF1A 5BRPA 1WDQA 3QZ6A 2CXGA 4HU8A 2XIIA 3M7SA 3KP1A 1YTKA 4BHYA 3EWBX 4AHPA 1E1CA 5AC7A 1EPXA 1NY1A 3C0LA 2PC4A 2O9TA 3TJ4A 3AYTA 1Z8AA 3AISA 4IUGA 3R12A 1MUCA 1M5WA 3GO2A 3GDRA 7ODCA 4OBSA 1VHNA 3H8AA 3NPXA 3G8EA 1UC5A 1XXXA 3W27A 3MKVA 1ZJHA 5ECUA 4RCXA 4JTQA 4ZBCA 3STFA 1XG4A 2PDPA 2CZFA 3GY1A 2D0FA 3C2FA 2DVUA 3UWWA 1A5LC 4Q32A 3K4DA 3LDVA 3OHMB 4LUTA 2CZ5A 2QDEA 1DWAM 4E5TA 1O94A 5AHLA 4WY0B 4LVDA 2E6YA 5EMUA 1MEIA 3KVJA 2ZUVA 3E0LA 3ZQ9A 2HNHA 4ZE4A 3Q37A 4RZ4A 4W4QA 4XZMX 1MI3A 3MP5A 4ZSTA 4PYSA 1KM1A 4Z0SA 1RQEA 2IPJA 5CPMA 4AUBA 4WUIA 3P80A 4G2DA 4UTUA 4A35A 3WBEA 3TC7A 1GPFA 3W7RA 1WXJA 3AIBA 3LD5A 3VAVA 2CLKA 1BSLA 4GIRA 8A3HA 2W4XA 1E0WA 1GKPA 5BRQA 1BVNP 3HO8A 2EHHA 4CEXC 3QF0A 2R9RA 3TJXA 4OBRA 1DJZA 4XBJA 3IJ6A 3GTXA 1E4IA 3W7QA 1PX3A 2GLKA 1H61A 1S5MA 5HPOA 1PXGA 2J66A 5AHFA 4KGJA 1R6WA 4NYUA 1ISWA 3S3GA 5I3KA 1HXJA 1PIGA 4HU0A 4G7FA 2XFFA 4JGDA 2BASA 1K6WA 4WOQA 3UD6A 5FF0A 3VIKA 4DJDC 2WC7A 3RX3A 3S4TA 1UYQA 3S5NA 3C0JA 1SR0A 4B5VA 3GHTA 3GKFA 3MO7A 2YW3A 2ANUA 3ECQA 3R8GA 3BANA 1ESWA 4ZB2A 5EBAA 1W3JA 2X1UA 3QZEA 5T8GA 1CGTA 1W5MA 2A3BA 3N13A 3MO4A 1GVOA 3QOMA 4R27A 5A2CA 1EJWC 1XKYA 4C6PA 3S83A 3P7YA 4IPPA 2X0SA 4XVEA 1M01A 4RE2A 3W2LA 4NXSA 1B3XA 4W5ZA 3RX4A 1WPCA 4WKFA 1HJXA 3P82A 4E4UA 4QP0A 2Q8XA 3FA5A 4QJ4B 1K8YA 3TN3A 3RO8A 3SUWA 3V7PA 3SFWA 1YADA 3GHRA 1K6AA 3HQPA 2BLEA 1S3TC 2ISSA 4GUHA 1IIGA 2PDBA 4FHAA 4AVOA 3NZ1A 4ZGYA 1TV5A 1JDFA 1F8IA 3AMGA 3GAYA 3RF9A 1A49A 3ANUA 3GFYA 4IP5A 3RPTA 5BWAA 1S5VA 4JDBA 4IT1A 1FWEC 4LYKA 3HM7A 1IT0A 2QUTA 2I5QA 3RNDA 3W22A 2Z00A 1UWQA 2JEQA 1SO4A 3RR1A 3CUZA 4UTTC 1LG1A 1A5BA 3RRXA 3GBDA 3IPWA 3PBUA 1QAPA 3EDFA 3T2PA 3BAKA 3B8DA 3QV9A 4YTQA 4D6FA 2JALA 4GKLA 5F2LA 1V6VA 5C9UA 3NXFA 3VNDA 4PGLA 3TQ0A 4MAVA 2PA6A 3KOXA 5GQBA 1VCVA 1PZ2A 3IEBA 1CXIA 1H1ZA 1UBSA 3QFWA 4H83A 2W91A 1W1IE 1Q6QA 1KXHA 1Q2SA 2C16A 1F73A 2WK2A 1X8CA 3VGDA 3CV6A 1JULA 3B97A 3C2EA 2QEZA 1GYLA 3C8NA 5U7SA 1RA0A 1WYIA 2J88A 4ONVA 3CO8A 4KWVA 4HJWA 3GC2A 2G4FA 3EA2A 4X61A 4V1YA 1Z6KA 4PCNA 1M7JA 3NL2A 4N6FA 4R7WA 3WD2A 4HCDA 2DVTA 2NZLA 4JTGA 4NZ3A 1W5NA 2W67A 4GRSA 3W74A 3IJ7A 5LXXA 2PD9A 4FXJA 1OX6A 3TLLA 3O6AA 3OG3A 3TTSA 4BF7A 2RDTA 3GXIA 4K8EA 5ABFB 1TRIA 4M24A 4HCHA 2W63A 1CI1A 4LAZA 1JF5A 3W73A 4CVWA 2W0UA 4R33A 4FZIA 3M43A 3D47A 4S3DA 5E6ZA 2PZ0A 4YTTA 3KE0A 1I0DA 3TYZA 4EPEC 4GY1A 3BLIA 1VPQA 5AHNA 3S2LA 3N1AA 1KA9F 3QR1A 5G4EA 5I23A 2Q09A 1W54A 1WDSA 2X7VA 1WNOA 8TIMA 1X6LA 1S1PA 1ONEA 4LY8A 3QH2A 3DFQA 3ZR6A 4CUCA 2FIQA 1OX5A 3NZPA 4YU1A 3QYSA 4L6OA 1GTHA 3GTIA 4WSHA 1EZWA 2RHGA 1SJAA 4AX6A 4CQBA 3QVQA 1B5TA 3NA8A 1Z42A 1US3A 1WZAA 4J27A 3D3AA 3QMSA 2GSEA 4LUTB 5AVHA 3OJGA 3UZXA 2ZA3A 3DYMA 4UTTA 4GXWA 1OFBA 3AHVA 3GIPA 1VBUA 3QLLA 3R5EA 1VLIA 4XZNX 3T07A 4WKHA 3CBWA 3VNJA 3OZOA 4D1IA 1MNSA 4U2ZA 3TTQA 1F6YA 2R1LA 1KBKA 1UD8A 3V1PA 1DP0A 4DWDA 3EWCA 2WWCA 3EX4A 3OBEA 3SURA 4A29A 1AODA 1JGMA 5L9FA 1XYCA 5FL1A 3IIPA 4LS2A 4LAUA 2FGBA 4BI5A 1TTJA 3NVDA 2ZICA 1JZ7A 4JCLA 1XISA 4M7SA 4OOZA 2WKGA 4YIWA 1U22A 3EOUA 1BXCA 5HXMA 4L9YA 3LGGA 3O6DA 3E2RA 3LHUA 3OEXA 2ZZ7A 5LIKX 2PDKA 3KOFA 3AIRA 1VFSA 2VELA 4H7VA 1G67A 4NI8A 5FEWA 3NWRA 4URIA 5CXPA 2QYGA 5M1TA 4ZXLA 4IGSA 1L2QA 2E6AA 1EIXA 2GL5A 2PD5A 1MEHA 1YXDA 1DJIA 1Z69A 1H5VA 1VEMA 2R91A 4KF1A 4JTRA 2BBFA 3MUXA 2YCJA 3ITYA 3TN4A 1FWIC 3D0CA 2E28A 1WZKA 2DT3A 3WLQA 2I9EA 2H9AA 4IQEA 4O1AA 4XUGA 2E6FA 3F5JA 3GDBA 4WDWA 3HPSA 4UFMA 2JIWA 4B90A 1DIEA 2QLYA 4W7UA 1IEWA 1KBJA 4NNBA 3LRMA 3LERA 4IPJA 3W7PA 3QEZA 3M64A 5AYXA 3MHUA 1QI4A 2E6DA 1GOMA 3R8RA 4DUXA 2PWDA 4D6JA 1OK4A 3PZMA 4PB4A 1DL3A 4GVGA 1Q6OA 4NZ4A 2IPWA 2Q02A 3UR5A 4DWSB 1KM4A 1QBBA 1PZ1A 2H8XA 1NAL1 4PBEA 2QV5A 3FY1A 4J3ZA 4JYFA 1MQRA 2ZQ0A 2VOMA 3ZJ7A 5DFAA 5I3FA 4YJ5A 4NX5A 1NWUA 3D3FA 3VKBA 4DZIA 1QOPA 4MWAA 4Y7EA 3THAA 4KETA 2OSYA 5E0KA 2CXEA 1LBLA 3KDNA 3UGVA 3SRKA 4DEFA 1VKFA 2DV0A 1G6CA 1OF6A 3SUUA 1GHRA 4TVCA 2I57A 3PBWA 3MMTA 1EF2A 1YMYA 2J7HA 1I2RA 2NLIA 1EJVC 1KM3A 2YOCA 2XH4A 3NSNA 1XSKA 5GNZA 2GUYA 3L66A 3OGSA 3H55A 7ENLA 1TTIA 1ZBKA 2EGZA 3RG6A 2A0NA 4D6CA 3WLKX 2XSBA 2HPIA 3B9DA 3A9BA 5A6AA 5GVJA 2X40A 3JVAA 5FF2A 2VENA 1DE5A 4MJ4A 3E38A 3PTMA 5J04A 4ALDA 4LCQA 1XBXA 1P6CA 3NGFA 2R8WA 4IISA 1G4EA 1FP9A 1S38A 3S1WA 1PTGA 1M7XA 4A2SA 4UFHA 3EOLA 4D6HA 2ZRVA 1NQKA 1OT1A 1UPMB 5EMYA 1KFBA 2JKEA 4XAFA 1R87A 1JZ8A 1ZJBA 1YRRA 3QW3A 4M82A 1V3IA 2EG8A 2XTKA 1FDJA 3S1VA 1FWSA 4LNYA 5FACA 4O18A 2VEGA 2NX9A 2RFGA 1Q7QA 1W8SA 4RL3A 4UZUA 3GUGA 4OT7A 3BL3A 3EAUA 2WVUA 4WEVX 5LIWX 1HW6A 5AY7A 1TREA 3L23A 4Y8EA 1PPIA 4WY0A 3QQWA 3G3MA 4CQAA 4JL2A 2YFOA 3CTTA 5G2HA 5LHEA 3KWSA 3I68A 4TUFA 2EPKX 1IZCA 3CM4A 2ZE0A 4AF0A 4XKMA 3VMOA 4Q8QA 1OY0A 1FTXA 1IF2A 2GQ3A 3WCZA 3W2UA 3NDYA 1W3NA 2D3LA 1LOSA 1XIJA 2IKGA 4KCTA 3VUSA 3KVMA 3HV8A 4N7QA 1GVQA 4LCRA 4TV5A 3A5FA 4WJXA 3DCPA 1TJ0A 5CPQA 4GC3A 4I6VA 3GDMA 3CL7A 1UWRA 3AHTA 2E68A 2YBTA 5C9RA 3MDUA 2FHCA 1W2PA 1VFUA 3SY8A 3OODA 3JUGA 3SIZA 1F5ZA 1Q65A 4XZLX 2CW6A 3WJXA 1ML1A 4OIFA 5CSSA 2A3AA 2YW4A 5FCZA 3KBVA 3TA9A 1TTQA 3J7HA 3GXNA 3C2RA 4JDYA 3ENLA 3T81A 1C9WA 4QBXA 5KITA 3RRAA 2J7FA 1DXEA 2CCRA 3N2MA 3C52A 3WQ4A 2HDJA 5IDZA 5FJJA 1KRCC 4XD5A 3URQA 3S46A 1TPEA 2J25A 2VDIA 4CEUC 1TPFA 2ZFAA 4X63A 2ZDRA 4CNSA 5E5CA 1F3EA 8XIAA 1S3HA 3VC5A 4CU7A 2DSZA 2PF0A 3E96A 3BG9A 5LKYA 1PV8A 1OM0A 3OB8A 4TV6A 1UZHA 3WH6A 5I09A 2FPVA 2X0HA 2X2GA 4R7OA 3KTCA 3AO0A 3UGRA 3HGRA 1LT7A 3CHDA 4PFHA 4K1WA 2EG6A 4D1JA 2E77A 1CDGA 1XM3A 4UTKA 4Y8FA 1E9IA 2CBUA 2FH8A 5F1VA 4OQVA 4WDXA 3B8WA 4PRRA 1CIUA 1YDYA 3BCDA 4J2PA 4AZ6A 1ECQA 2I16A 5I24A 3RYSA 2WLZA 1Z9AA 4KQNA 3L7RA 5DO8A 4GUJA 2FZ8A 3CAKA 2OZ8A 1FH8A 3IJ9A 3K1DA 4W88A 3TE9A 4B92A 3GDTA 2QUMA 3H2EA 4KMQA 2VTFA 2WSYA 3IRSA 1AW1A 2Z1KA 3U4AA 9XIAA 5BOFA 3IIVA 4K38A 1TQXA 7TAAA 3W86A 1KXTA 3TQVA 2PWFA 5EMKA 3L68A 5A6JA 3R94A 4YXGA 5K4XA 1E40A 1UUMA 1F2JA 1BKHA 3VGHA 1DWHM 4O4VA 3VOCA 1X6UA 1AG1O 5FSEC 2X0YA 2VXNA 2INFA 1UA3A 3AMKA 1SO6A 3W1UA 1JF6A 3VOFA 1OFPA 1UR8A 3RCYA 5TBOA 1RBLA 1KXVA 4AZIA 4PA8A 4S3FA 3NTYA 3N6HA 1J0YA 3NQMA 2J79A 7REQB 4B91A 3AIEA 5DCEA 4ORMA 1TO3A 4H8VA 1A5UA 3P5YA 3VNZA 1K7XA 2OFJA 1A3WA 3W2KA 4BR1A 1CCWB 3VINA 4GG9A 4OUIA 4LANA 2L5HA 1HKJA 2OQYA 2YA2A 4RE4A 1NM9A 1DE6A 1F3WA 3WX7A 2H90A 2NXGA 3VX1A 4GI4A 4AU0A 1CNVA 4N0RA 3VZYA 3TJIA 3OVRA 4M56A 1EFZA 4MNMA 3B9NA 4S3KA 3CO4A 4OU1A 1K9FA 4H6QA 2XIJA 1XCXA 3M1ZA 3PPGA 2GGJA 4FNRA 2XVLA 4BJHA 2I5GA 4MPKA 3T0CA 2ACRA 5DT7A 3TA6A 1WBHA 2PU1A 4A3RA 4LTSA 4QG9A 1I4NA 4MNKA 3GTNA 3OO2A 3HMJG 3BUVA 1BG4A 4NAFB 4EPBC 2VJXA 5E1QA 2A7PA 2ZA2A 1EXPA 4S3AA 2GVGA 1GVIA 1CECA 1E9YB 4QE1A 3QR0A 3M5XA 4U2YA 3I7QA 1OGBA 2O9PA 3D5HA 5U4NA 3W37A 1A5SA 3NJ3A 4NI3A 5AYBA 2TRSA 3BSMA 2D2GA 3MS8A 4W84A 1NOUA 2ZZ3A 2BGQA 2G3JA 2VURA 1FKXA 4NIRA 3UCQA 3TC6A 4H9XA 1EHAA 1DEDA 5D38A 3PJXA 2FH6A 3NCOA 1DKWA 5I3HA 1VBRA 5FJTA 5CEWA 4PRTA 3PC0A 2BHZA 5A6BA 1DQUA 3UJEA 3GVWA 1EF3A 1E6NA 4L4PA 1ZALA 2HZGA 4MG4A 3B06A 4JFSA 2Z7KA 1P0EA 1JRBA 2QNEA 3VD3A 4F48A 2NV1A 2OLHA 2BVWA 1XX1A 2OXNA 4UUIA 5T9BG 2GWGA 3UVIA 5C5YA 1QU4A 4HSHA 2EPLX 4BFAA 3P8IA 5J8LA 4E4PA 4W86A 4YS1A 4JQ2A 3GTHA 2A79A 4IGHA 3H7RA 2ZADA 3DDMA 2XGZA 2DFAA 4WLCA 5CKSA 4LAMA 4KFNA 3CZ8A 3WLTA 1VRDA 2NVAA 3R89A 4DN1A 3GZ3A 5M03A 5D02A 3HZ3A 1IWPA 4CU6A 4PUUA 3VNIA 5C2GA 2OMAA 3ZSSA 1C93A 2GQ8A 4ADTA 1D7KA 2WBKA 4ECLA 2DPEA 4J3VA 3GG7A 1J2WA 4MJMA 2OU4A 4Y9NA 5LNWA 4BEUA 3UU0A 3LNPA 1W17A 5IM51 2B7OA 4M81A 1XCWA 1E1FA 3AU6A 2R24A 4KCWA 5TF0A 2WYSA 4LT9A 3B0VC 3IUIA 3SBFA 4Z2HA 3HGSA 3LM7A 1MZRA 2FZMA 3CHVA 1POJA 4IFOA 3BJTA 3QHNA 3BMXA 3EX1A 3E0VA 5D04C 3QKZA 1NFGA 4OGZA 1VFHA 2P3EA 3VTRA 2DZVA 3C0SA 3N9KA 4GZJA 1G4SA 4YTUA 4IL2A 4Q8TA 4XZ9A 3THQA 4DHGA 3LHYA 1DJNA 3BMWA 2F84A 3ZJ6A 3PZTA 4C6IA 4YMZA 4GX9A 1VJIA 3V36A 4BQ5A 2B7PA 4QSHA 6CGTA 1XBZA 4GISA 3ME3A 2UY2A 3DBPA 2QCNA 2QCDB 2Z25A 4NUWA 4B2DA 1EUAA 1OYCA 1LF1A 1RPXA 2NVCA 2VZVA 4RPQA 2WMJA 3EKGA 3EOSA 3TMLA 2H3BA 4Z08A 3UJRA 5D2YA 4G9PA 1AFSA 4D8LA 3VIOA 3MBFA 1WDWA 2VZSA 3P14A 3W1XA 1HQTA 1A5OC 2FFCA 1NDWA 1WXYA 3N73A 1RZMA 2IW0A 1GGOA 4DO7A 3PPCA 3BURA 3BW4A 2EPHA 2Y5JA 2ISVA 3DFOA 4J5NA 3FVMA 1VP5A 3UXAA 1UJQA 5KSWA 3KBMA 1AH4A 2VRKA 4ZO9A 3AWNA 4EAYA 1KR1A 1RJQA 1ITXA 1EDGA 3BICA 3PFMA 5I06A 1XYMA 3G1SA 5F2GA 3W1NA 4YVXA 4X0VA 5D8WA 3NDOA 1VZWA 2ALRA 5LNSA 3R11A 1ADOA 5CZJA 4Q8NA 2DZAA 3PN8A 3PG8A 4DZAA 2BG5A 3U6WA 3VA8A 3TYAA 4YN5A 3CHCA 3BZJA 3L9CA 1PX8A 3KEHA 4KEZA 3W38A 4TMBA 4UTHA 3W1MA 2A21A 5FD0A 1L6GA 3QOKA 4LUIA 2NLYA 1E4MM 4JBRA 1TPH1 2J74A 4JTLA 3H54A 5JQ9A 4R53A 3PS7A 3GS6A 5DLCA 4HSOA 1VYSX 1GOXA 2Y8UA 5A8GA 3P6LA 1ME8A 2GVYA 3W25A 4YHEA 2CLLA 4NAEA 1KQYA 3FDKA 1W5OA 2DZTA 1H7OA 3S1GA 3RK8A 2O92A 4NJGA 3S1XA 3EWYA 3WMLA 3ZXWA 4PCTA 2X8RA 2YDSA 3ZMRA 4FX6M 1F3TA 1GQLA 2EG7A 3S42A 1OB0A 1E6XM 1D7FA 4EWJA 3SUSA 4GOAA 3PWIA 4G1KA 3HPXA 1JJKA 3MCNA 1TJPA 1HJVA 2Y61A 1F8MA 4WJ8A 1YPIA 3ZM8A 4L65A 1FWCC 1Q6GA 1LUCB 5JVLA 4DB7A 4W7VA 1EJTC 1B4EA 3QV6A 3F1QA 3SN1A 2ZZ6A 4C6QA 2VEIA 2DZWA 1UWTA 4HTYA 3C2YA 4DJDD 1BSIA 3ARQA 3MT1A 5AOUA 4AY7A 4RXGA 1N8WA 4HPJA 3NURA 1EA0A 3RU6A 3H70A 1OFEA 1U5VA 1UH3A 5MF5A 1GZJA 3L4XA 3VGFA 1J0JA 3IWPA 2PLMA 3T08A 1QNPA 1OGGA 2Y7FA 1M04A 2V3EA 4ZZ9A 5A6LA 3RFAA 4M1RA 2Y24A 5KZ6A 3S5OA 5F2IA 2GVEA 4G56A 5FJRA 3QSRA 1ZJIA 2FHFA 4KRUA 4M51A 3LX9A 1K8ZA 3VOJA 7CGTA 3LV6A 3NVTA 2YKKA 3WSUA 4QAIA 2OX1A 2QAPA 1JPHA 3O6CA 4PFMA 4BI6A 1YTDA 1V0KA 3BPWA 1CX9A 3ARUA 5M2FX 1CLVA 4D6DA 2HROA 3TDFA 3L2LA 3BC9A 2X1RA 1SJDA 3MZ2A 4HNNA 2RDUA 4MVAA 1LLOA 1VENA 3TYBA 2QGHA 1OZMA 4UB9A 3APYA 5A94A 4LV9A 1TPWA 1W8GA 4Z2LA 5AN7A 5KZDA 2XJ7A 1XCFA 1A5CA 3CH0A 3WLNA 1SPQA 3EMCA 3SGGA 3URBA 3BO9A 3DENA 4M6QA 4Y96A 2V63A 3ARXA 3U2OA 3SZ8A 1V5XA 3JRKA 5FL0A 1FP8A 3K1GA 4AX7A 4OJYA 4R34A 3CUJA 1K70A 1DBTA 4PN2A 3MANA 1XINA 3AICA 3F4WA 3MYOA 5H1WA 1VEOA 5E9XA 4C1NB 2OKTA 1FXPA 2FPYA 3GDKA 3P0XA 5KETA 3CQIA 2JF7A 4HOZA 4QJ1A 4X2PA 1FWBC 2IXUA 3UG4A 2H6RA 3M0JA 3PWGA 2VX5A 3OQ8A 2OKOA 1SU5A 2Y1HA 2YCLA 1P0KA 3GG1A 4EX4A 1XC6A 3NQAA 3HQ1A 4JN8A 4DRSA 4JTIA 1OX4A 1Q6DA 1ODUA 5GJPA 4IFKA 3E5PA 1XQLA 4H6EA 1GW1A 2MUCA 3SRHA 4S3CA 2DZUA 4P7RA 4WRHA 2GGGA 3E1F1 5F1UA 1PDZA 1TIWA 4OV4A 3CB8A 4XZHA 4YWIA 1XRTA 3I3EA 3K46A 3UETA 2GJXB 4Z42C 1H2JA 4GYPA 2BHYA 1BGGA 3VDGA 1VC4A 2OOGA 3QKEA 2F7FA 1X1NA 3RIKA 2PWUA 2VL4A 4GMEA 1HJWA 1A5MC 3TX9A 3TH6A 1H7WA 3GXMA 4G7EB 2V5JA 3JR2A 4OWGA 2BGSA 1AVAA 4XAGA 4DX3A 2NUWA 3G2GA 1QPNA 3EEZA 1NWTA 3NM3A 4F0RA 2PF8A 1TJ1A 2PWVA 3T0AA 2E25A 4BKNA 4GXPA 4PUNA 4A21A 3F2DA 4QQ3A 1KR0A 4Z0JA 1UROA 2JK2A 1ITQA 4A8IA 3VABA 1V6YA 1UB3A 1ICPA 1O5XA 4F0KA 5CPTA 3RN6A 2ISWA 4GC4A 2D20A 1UD2A 1VYPX 4K7YA 3ANYA 1UIPA 3WUEA 2OO6A 3FYYA 4RDVA 4AWEA 4H9MA 1T8QA 1R2SA 1LDCA 4GCXA 5ABHA 3E6EA 4HA4A 1OCBA 1OYAA 3VKDA 2DSKA 2BVDA 5B7ZA 4IOTA 4UFIA 4GXMA 2YDRA 4C6OA 3I7SA 1ZNNA 1C92A 1I2NA 2PGWA 4Q8MA 3Q2DA 2FDMA 4DBSA 1R9YA 4XKYB 2DZSA 1GVYA 1MO0A 3ZOAA 1XDLA 3GNNA 3ZZ1A 4CCEA 2BOEX 4TXEA 1H0IA 4L4MA 1B30A 1W3KA 1J6PA 2RJGA 2ZUMA 1UH2A 3WD0A 1GOQA 4LYQA 2JFEX 3O2LA 4XIAA 1GEHA 3GVGA 4H3DA 3MJYA 2ZXQA 2VEFA 3HG2A 3VOIA 4DXVA 2CBIA 3M7WA 5K9DA 1F74A 5E70A 1YLVA 1P6WA 1U2YA 3N12A 3MMDA 3L5MA 4LC6A 2G3IA 2WXDM 3BLDA 3TJLA 3DI0A 4JR5A 3DEQA 3H24A 5FF7A 3II1A 4JICA 3KUMA 3KLKA 2CITA 4HZMA 3B9OA 3CMJA 4BZYA 1H51A 2GQ9A 3K13A 5MKGA 3VYLA 2OZTA 4FF5A 4LNCA 1HN1A 2QGYA 5E09A 3QZAA 1QNVA 4UQAA 1ZAIA 3WDRA 3GR4A 1BYAA 3WEZA 3CWHA 3G6MA 2IQTA 3VM7A 5CJNA 1RVKA 4IGNA 2PC8A 2NQ5A 1KRBC 3K5XA 1V3MA 4C6CA 1OEPA 2V3GA 3ICJA 1E71M 2CPUA 3V16A 1EOKA 1XW8A 3W2NA 4I9MA 1GKQA 4DWSA 2PP1A 3BLPX 4C6LA 3AMLA 4C91A 1W1B1 3MC5A 4REQB 3ZT7A 3GW3A 2ZC8A 1EBHA 2DZXA 2VUYA 1L6WA 1ITCA 3A47A 3IJIA 1XD1A 4IICA 1XLAA 2DIJA 4DJED 3BVJA 1E0XA 3W7GA 4NKCA 1A50A 5I77A 2F6UA 4TTUA 4C6BA 1CGWA 4FF7A 4UNIA 2RAGA 3AQUA 4DYEA 1JYNA 3DC8A 1L9WA 1PEZA 2ZX6A 4IG2A 2B81A 2QJIA 3BE7A 1GQNA 3BV4A 4EXBA 1MW0A 5HMDA 4IM4A 4PEKA 2NT1A 3APGA 3CYVA 3SN4A 3NAVA 3L5AA 1NU5A 4AIUA 1REQB 4LYRA 2ZXDA 4AD0A 3UR7A 5DRIA 3HGJA 3WF4A 3UZZA 4XIMA 1H50A 4FR1A 4JS3A 4JY8A 5LNVA 3PFRA 3MWCA 2FVLA 3ARTA 4DLFA 3FW6A 4FI4A 4KKXA 2Z2AA 5BU6A 1YE6A 3IVTA 1VR6A 3K30A 5DT5A 1Y8BA 2O7SA 4GNVA 6XIAA 1EX1A 3EA3A 5G5IA 5CBIA 2OR2A 4MKVA 2Y5SA 5I6SA 3TWAA 3UW6A 1QBAA 5TD4A 1LG2A 5A2BA 3IAPA 3UR2A 1EB3A 1UOKA 1CGVA 4INFA 1IWAA 1JZ3A 3M5ZA 4H9TA 3NSMA 5H91A 2O7QA 2PODA 3PUEA 1I0BA 3EOOA 2HWGA 3EEGA 4WDUA 2VR5A 3NYZA 2IPGA 2WKJA 1Q5MA 5EPDA 4OE7A 1EGZA 2ZKMX 3CYJA 1K8CA 2ACQA 5KZEA 1HP4A 1RQBA 3CT2A 2RKXA 1RP9A 4L6HA 2WJDA 4WGXA 4DI8A 3CZGA 4WJEA 3VX0A 4EPKA 3BAWA 5A6MA 1M9HA 2ZTKA 4UWMA 1JI1A 4ZL1A 4ZOEA 2QF7A 4QFUA 2VUNA 3SUTA 2OWWA 3M0HA 3CQHA 1EIBA 3ZWTA 1HL9A 4C5ZA 3QY6A 4WDTA 5LNUA 4PMNA 2XFYA 3S6OA 4WK9A 2NQ9A 2OOFA 4MWAC 4EF8A 4WKAA 4MY1A 3OYZA 3WLLA 1Q66A 4TU1A 3AS3A 2QS8A 3PANA 1ZP3A 4WVXA 1CXKA 5DRCA 3AS2A 2XGIA 3BZGA 3T0BA 3PB2A 4IIEA 1VS1A 4GWEA 3ZVHA 2FKPA 1XLMA 4H8NA 5D37A 3I7RA 4EACA 1EGVA 1PIIA 2Z0IA 4JQ4A 3DFPA 4PL2A 2B0MA 2HEJA 3LTPA 1J0ZA 3AXXA 4D2JA 3IJQA 5C9XA 3T4WA 3GG0A 4RZ5A 2ICSA 1JPDX 4AMAA 3MJMA 3M0IA 4GO9A 4DWSD 2VYOA 4IPLA 2QKFA 1BD0A 1RQHA 1XYBA 3IUDA 4KFOA 4I9TA 3TQKA 1UHVA 3OLGA 2VGIA 5IBXC 4MTVA 3JS3A 4MIMA 1SW7A 3ARSA 4Y9MA 2E40A 2C8NA 3N2OA 4MJ2A 4H2CA 2WZTA 4GZ7A 1JPIA 1TVLA 4M5PA 5ABFA 1DOSA 4C5YA 2RGMA 3LS9A 5F2MA 5G1TA 2XZ9A 4ERIA 2WSQA 4A8LA 3TZNA 2MANA 4PMUA 4PSRA 4Q8OA 2WANA 3VI2A 1EDTA 4ZOCA 1JFHA 2AMXA 4HGXA 4DJFD 3PUDA 3M07A 5EMMA 1I8JA 3LSBA 3TXZA 2VZOA 4XWUA 5FOOA 2FHBA 2VX6A 4F3HA 4LJ3A 3SY5A 4QE5A 1KFEA 3VOHA 1HL8A 1VBHA 3FN9A 1JD9A 2E09A 1QXLA 4K2SA 3G1VA 2QCLA 2GDUA 4AHQA 3Q58A 1MNZA 3SCWA 4HK5A 2CETA 2ZUSA 3C0QA 3S6TA 1GYMA 3EDKA 4JTHA 1F05A 1BWKA 4FXSA 2PUZA 1TV8A 2GSJA 5BNKA 1BTMA 5JH1A 1QVBA 5KINA 3G8RA 2J7DA 1AZ1A 2J8TA 3E2SA 3TU9A 2WZEA 3R4IA 4D6EA 3LBOA 4WF7A 3PZUA 3KZPA 1V6UA 1KM0A 2QPUA 1O68A 1F4HA 4AZ7A 2BOFX 5HULA 2V5CA 3PSVA 4JX4A 3A4XA 3C5QA 3LXBA 1IEXA 3KRSA 3QXBA 4FNQA 4S23A 1P6BA 2GOUA 3PPHA 2OGYA 3GXFA 4ES4A 1V4YA 3MUY1 1V03A 3AU2A 2IMRA 3U5YA 3SO7A 1KFJA 3QM3A 3SCOA 4L4LA 4A6GA 4E8DA 4KIRA 1VH7A 2RDXA 4Q8PA 2X16A 1MW3A 1Z48A 5HMEA 2V8ZA 3O05A 1IXNA 4E38A 1TA3A 2HCVA 4M6VA 2EQDA 4R3UA 2G4JA 3P5ZA 4DO5A 2FTPA 4EWND 1HKKA 4QG8A 5ABEA 2V67A 3GIQA 4ZCWA 3CHEA 3S47A 3WQDA 4YYFA 4PBFA 4IZGA 2V5BA 5IDIA 1RH9A 5REQB 1FQ0A 3FYPA 3BQ6A 4IJBA 3WNMA 5H8PA 4H1ZA 5LA1A 1MSSA 2QJGA 2VM8A 3AI0A 1ZU8A 2PURA 1ZP4A 2CWNA 4N2YA 2WMGA 1VF8A 3HN3A 1AMKA 3FEQA 3LUTA 4NRRA 1J96A 3P81A 3WK1A 1JDEA 4AWUA 1R3WA 4PULA 3V18A 3DHFA 5CZ0A 4IXXA 1E56A 1QNRA 5REQA 2P8BA 4LY4A 4LFYA 1PZ0A 4GZIA 1GONA 3DN5A 3VIIA 4PTDA 3IGUA 1P1XA 1W0MA 2VZUA 3LLDA 3SAZA 3QGVA 2GZXA 4YCPA 4MB5A 2H9AB 2QR6A 4AWTA 1KM5A 3GAKA 2CC0A 2E67A 3S8HA 3ZO9A 1QDSA 3I6EA 2REQB 4GINA 1UKPA 2A3LA 3DECA 3LG3A 3M0VA 4H9YA 5JUVA 4CGTA 5A8MA 1GYNA 1H7XA 4ROQA 1IZKA 1KXQA 1X7IA 3V0TA 2Z27A 3ARPA 4AZCA 3S0CA 4RNJA 1S39A 3MV01 2P76A 4RR4A 2VC9A 2C1GA 3AYSA 2PDWA 1A4MA 4ERAA 4P5UA 4Y9AA 2VO5A 4MYXA 3F2CA 4LGXA 5D2TA 1ZCCA 1EO5A 1H4PA 4IJCA 3R13A 1D9EA 1XLCA 2EPNA 3TYDA 3MV11 4ATLA 3MPGA 3QJAA 3WF3A 5M3WA 3GR8A 3UEQA 1K1DA 1B3WA 2PDUA 3VNMA 2VP8A 1TUXA 2DH2A 3ES7A 1O6IA 1UJPA 1QW9A 3CWNA 1ZFJA 3WMBA 3IV3A 4KESA 4HA0A 1A3HA 4FXRA 2DEPA 1WO2A 1PVNA 1AA1B 3LPPA 4KRZA 4MZ8A 3GIYA 3NSXA 3KCOA 4PSPA 1WKDA 1KW1A 4B3ZA 4GH1A 2ZRZA 2V2DA 3SCVA 5AC5A 1B3OA 4I7VA 1V3JA 1UR1A 3KHDA 5C70A 3AYRA 1J6OA 1LLZA 2CEQA 4NZ1A 1WX0A 1B90A 4K39A 2V5DA 4OUEA 2VC6A 5HNNA 1B1YA 2OYKA 1XGZA 3N2BA 3NR0A 4S3EA 1P0NA 1QPQA 3MHFA 1P4CA 2Q3RA 4I8DA 3DGRA 3BSHA 5TAOA 5LZLA 1G5AA 4U5IA 1C91A 2CKRA 2F6XA 1IE7C 1F6KA 1JQXA 2EO7A 4Q6XA 2PLJA 3CL6A 3DGBA 2FB2A 4ATWA 2MNRA 2W3ZA 4F4RA 4NU7A 1UH4A 4V2XA 2I5IA 3H4WA 4FSAA 1E6PA 3G6LA 1DVJA 2A5HA 2FJKA 1TELA 5CZTA 5DY3A 3DKJA 3KM8A 1JUBA 2C15A 1IT7A 1OADA 2Z7GA 4H19A 4JAWA 2WHMA 3BDKA 4EE9A 2V9DA 4FAMA 2RUSA 2OO0A 1E9ZB 4O11A 1WDRA 4QAWA 3MCOA 3GG8A 4Q4PA 2CFFA 3K8LA 2FTYA 3VNKA 2WMFA 3IIZA 1RCQA 4GQBA 5JBFA 1JZ4A 3I4EA 5LGZA 2A4AA 4XUYA 1RALA 1X1OA 1DTUA 3FGCB 1W91A 1LOQA 1GHSA 1WP6A 2QCEA 3R10A 3CIXA 2J24A 3GC5A 1IGWA 3T55A 3NQFA 2BSLA 3IGXA 3CEPA 3BAJA 3U7BA 3USBA 3TXVA 5EA9A 1Q45A 1FHLA 3NPVA 4AIOA 5M5DA 1RLCL 3V75A 4DPQA 3E49A 1QNOA 3GXDA 3CWOX 1R3SA 3P2VA 2P0OA 2PGFA 2QJNA 3URNA 4NJHA 4HOXA 4JNMA 3W72A 2YLLA 4AG0A 2V38A 2YX0A 1GK8A 3RO6A 3LY0A 4RV3A 1UOZA 1J5TA 1OCQA 1OG6A 4PUMA 4WD0A 3UY7A 3DUGA 2VD8A 1QO5A 2DVXA 1WUFA 3HPZA 3NQCA 3DI1A 3BG3A 4E2DA 1EJSC 3VK5A 2FDSA 3UWYA 2D0HA 5FJIA 1PTAA 3WH7A 1LLWA 1XIFA 3KWXA 2PP3A 1AJ0A 3PZGA 2ZOXA 3TNOA 3ABSA 3Q65A 3MBDA 3WH9A 2WMIA 3XISA 4AD1A 1ISXA 3PR2A 4KEVA 2YCLB 2YXOA 4LYPA 4N6EA 3M0KA 5EMLA 1HZYA 4HIBA 4E2BA 3K8MA 1J0IA 4C6NA 3APTA 4J1OA 4FO4A 1M3UA 3KS5A 2HS6A 3HFTA 1Q7MA 3OIXA 3UZJA 2C0HA 4ERGA 3W2JA 4B4FA 4JL1A 4DLMA 2ZX7A 5I78A 3BLOA 4PL1A 3CXOA 1FCQA 5FJOA 3RLUA 1J5SA 1E0TA 3W6YA 1ZBVA 1F7BA 3H22A 2P8CA 3OVQA 4F0MA 5HMSA 4MKNA 1IWBA 4JYDA 5A69A 2NV2A 3LCWA 2QF8A 1X6NA 3N2XA 1S5NA 1VQTA 4LUSB 1K3UA 1CGYA 1E5JA 3TR9A 3TQPA 1S2VA 2NX1A 2B31A 4AZGA 3REQA 3TYCA 4YVVA 3LQGA 1Q6CA 2ABBA 3GX9A 1Z44A 3OLDA 4S1FA 3RCNA 3UERA 5AC4A 1TQJA 4UIOA 2D23A 2R14A 4O14A 4DM2A 1HGYA 1JG9A 4MB3A 4LVBA 3ZT6A 4RW3A 3MKKA 3ZVIA 1U1UA 2WJZA 4R7JA 1GZ1A 4MFDA 2VFHA 1QATA 1RK6A 1TJRA 1QUMA 2J8GA 4RE3A 3R79A 5HR6A 4NJIA 4V28A 3SCNA 4NNCA 3R0DA 3Q67A 2VD9A 1KFCA 4NAEB 3CIVA 5CPOA 4QE4A 4L7ZA 5BMXA 3G1RA 4NHVA 2ABAA 1YIXA 3LGDA 4LV4A 1FWGC 3JZUA 2WVTA 3CPUA 4I7WA 2VWTA 4LOCA 1O1HA 1IYXA 4F0SA 2VGBA 2ON3A 1SJBA 2GGHA 3UWVA 3W7LA 4AB4A 4UQ9A 1MMFA 4O17A 3T6CA 3W07A 4J3UA 3E2VA 5H6HA 1PAMA 3LPFA 1KTNA 3VD7A 4LRTA 3AXIA 2ZX8A 1XQKA 5CSYA 2W92A 1NF0A 4W9TA 5HDRA 2C0AA 3H2MA 2VGGA 4XKYA 2CNCA 3TCEA 5CC3A 2BFGA 3UESA 2GK1A 3HBLA 4KH2A 3T40A 3VKJA 5HNRA 4JHOA 3NL6A 3BLEA 2PDHA 4IQLA 3WLMA 1Y5XA 1S2TA 3WQVA 2D2JA 4JIRA 3NXLA 4DUWA 3EXTA 4YNGA 2HJPA 4UNKA 6REQA 2AQOA 3NM1A 3WF0A 5AECA 4JTJA 3UCCA 3NQGA 1PIFA 5KEZA 1RJRA 3A21A 4IFRA 1OCNA 3WFLA 4MWAE 4S2CA 7REQA 1V6WA 3KTSA 2BV9A 4EAMA 4KWUA 4A3QA 1KFLA 3WQOA 4IMFA 3BLLA 4L1GA 4JOMA 5HQMA 2O4QA 2Y8KA 2EKCA 2YSWA 3DERA 3AFBA 3WQFA 3LCGA 2A3EA 1PYFA 2VFEA 2GUUA 5E0FA 1QWGA 1EJ7L 4E2VA 1KNWA 3GH4A 1XFCA 5KTLA 4FPSA 2X2YA 1AH0A 1QPRA 2ZTJA 3PY2A 1PKYA 2QUUA 3C86A 2ZWYA 2OWCA 3FK4A 4WY0F 4HN4A 3CMGA 1OK6A 3UWZA 4AD4A 5G4HC 1QRQA 1TFVA 4IPNB 4AZCB 3I6TA 3DKLA 4BQ3A 3TTYA 2XVGA 4KIEA 2VVSA 3VC6A 5I07A 2XM2A 3FFSA 2CBJA 5FF4A 4O50A 1TWIA 3DC0A 3HJZA 3ZWSA 4CD6A 4MADA 1AD1A 3UG3A 3W02A 3EWXA 3TR2A 4K1GA 1GNXA 4ACZB 4XZWA 4GPNA 3KL5A 2WM0A 2XN1A 1J0KA 3FA4A 3OGVA 2OGJA 4E3TA 2HSAA 2YJQA 2J62A 3PJTA 3LZ5A 2AQWA 4JYEA 2AGKA 1RP8A 4CD4A 1NIUA 2ZZ5A 4KFPA 5A3HA 3N2CA 4MPQA 3S6DA 3WQPA 4YPJA 1TTPA 5D9MA 3WUFA 3RM4A 2J7CA 1JXKA 2YFNA 4EOUA 4UFJA 1GQIA 3C3NA 3WQGA 3PUGA 1W31A 4HMNA 2XFWA 4HPXA 3UPMA 3FCPA 5EFDA 1GG1A 2QDDA 3AYVA 2BVYA 1PYMA 2XZ7A 3ARWA 1VYRA 3G5EA 2Z1BA 4OKDA 1NWRA 4IMDA 5D32A 3CC1A 1VPXA 4HTBA 4OOUA 3TOYA 1HKWA 1XLFA 1Q63A 1ME7A 1SZEA 2G95A 3AOFA 2DUXA 1XIBA 4XB3A 4DJFA 2OJPA 1O4UA 2R94A 1MEWA 3ZYZA 3UBPC 1GOWA 3MW7A 3V0UA 2I7GA 6PTDA 1OC6A 3PZ9A 1YDNA 2DU2A 4CD8A 3XINA 4MY8A 5C8BB 3MVIA 4J3WA 1WKYA 3H53A 3GH7A 5I0DA 1UASA 1YDOA 2E1DA 1UD3A 1EWEA 5D2VA 4UTMA 1XLHA 3L67A 2Z4GA 4JN7A 1FDZA 2BY2A 1RCOB 1LT8A 2I1OA 1ZSXA 2D3NA 1IHIA 4HMDA 4L1XA 3V5FA 4CVUA 2X05A 3DHUA 3HU7A 3G0SA 4N42A 1YW1A 1D3CA 2QPXA 4J9JA 1EZ2A 3W2MA 2XN2A 1ME9A 2VC5A 4FEZA 3RAOA 4IJRA 3LRKA 2PWGA 3POCA 5T9CE 1W1PA 3ARYA 3H21A 4GYPC 4TOQA 5HOSA 2Q8ZA 3E0FA 1FFQA 3GYEA 2ALDA 3QBUA 4LX4A 3TSMA 1H62A 4NT0A 3W26A 3W81A 4RDYA 1ZAJA 2ZXAA 3NEVA 3VMNA 3KRUA 1R30A 1A5NC 5J5RA 2ATSA 3GVRA 1Q6FA 4H01A 2J77A 5FKYA 3MY9A 2D2OA 3UG5A 2AMGA 4ZB5A 1JFXA 3NDZA 4MZ1A 4RE0A 4FLQA 1CTNA 3CZKA 1OWQA 4O13A 2WVVA 1UWUA 2HTMA 4QLJA 4P2VA 3F4DA 3CEUA 3AUJA 2I17A 3GNXA 3H4GA 2PDFA 3M41A 4O16A 2XG9A 1RAKA 4LBSA 4WZHA 3GNPA 4DPPA 4DBUA 3V3WA 4D6GA 3SECA 1H11A 1U5HA 2DGAA 3EX2A 3M6YA 3T2OA 2PLCA 2R82A 3ZVHB 1V6XA 2P10A 2XWDA 3CPGA 4FNPA 4FNSA 3GVQA 2Z29A 5HUPA 4CQCA 2QUVA 4M29A 5KMYA 5D2WA 5BOEA 4IP7A 4FIRA 4GLEA 2DJXA 2WMIB 4YTRA 4HYRA 4W85A 3VIGA 4HNVA 2WNWA 3G1FA 1ZLPA 4YHGA 5A2AA 3ANVA 4HK6A 2OSWA 1H7RA 2VZTA 4AD5A 4GUIA 1J8VA 1UMLA 4LUJA 4ZOBA 4GQRA 5IFTA 1EBGA 4Q8UA 2Q01A 3WDPP 5DBTA 3O3RA 3R25A 3MP4A 2CLEA 2PCQA 1GVRA 3DYOA 3WDHA 4UTWA 1AMYA 2OEJA 3TN5A 2G37A 2AQVA 1YKWA 2QXWA 4D71A 1IEIA 2J9ZA 4B5WA 2NWRA 3ZLFA 2DSVA 3P0WA 5G1MA 5F7UA 4UTIA 1AQMA 1ECEA 3B0UX 1Q8JA 3O0FA 3TK7A 4DF1A 5CBBA 1EA9C 4H7CA 2QUNA 3B8IA 3CLMA 3G1AA 4B4HA 1O12A 3UYCA 1FXQA 4X9YA 2PTYA 4N9EA 4DF0A 4GGBA 3R1ZA 3WG6A 3C8FA 4GQQA 1AZ2A 5AC8A 3S5YA 2BWGA 1TVNA 3W7IA 2NT0A 1JI2A 4C6MA 2HE8A 1CBGA 5T26A 1AUSL 3H2FA 4PH6A 5JU6A 3VCRA 3WQCA 3E02A 1FWRA 3KLLA 5FEZA 1V7AA 4DJEC 4WIWA 3USZA 4EXQA 3VCNA 2Y6ZA 4XV0A 4Z1YA 3WLJA 4LH8A 3GYCA 1MDLA 1EH9A 3MUZ1 4QR6A 2E9MA 3D46A 1RHCA 1ELSA 1NOFA 1RLDA 3CU2A 4L9XA 4AZHA 3DIPA 1DIKA 3AMCA 5FA5A 3L4UA 2GQAA 4XO6A 4ZB0A 3RITA 1TRDA 4WGHA 1OQFA 1RA5A 2R1KA 1P43A 2WQPA 1GTEA 5TIMA 3QSTA 1KGUA 4Y9PA 1UMYA 4KCUA 4AVNA 3W1LA 3W7DA 4K3ZA 4CU8A 4AWSA 3W1QA 3ARRA 1UR4A 3POHA 4L9ZA 1JDAA 1XLEA 5FJUA 3AUOA 2BOGX 2A2IA 9CGTA 1NWSA 2VRQA 3IVUA 3V5OA 4AC1X 3AIUA 4LBRA 4BWLA 4MOZA 1E5NA 3R8HA 2YYUA 1IZJA 2V5KA 1TCMA 4IL0A 3HIJA 2UY3A 3VD5A 3STGA 3CPRA 2WKLA 1ALDA 1XYFA 2WPBA 2YXGA 1UZ4A 2CYGA 3N34A 2E9BA 3DBNA 3NPUA 3KRZA 4FMVA 1W56A 2DUAA 4L56A 1X98A 3HQOA 4QGCA 1J2BA 1R3YA 4HJFA 1CXFA 3QQ1A 2PS2A 1S2CA 4O8RA 3HG3A 3H2NA 4Q4OA 1FBAA 3BOFA 3WH8A 2OZ3A 3UZYA 3RJYA 3LOTA 1PCWA 2PRMA 3INPA 4Q4QA 4C60A 1UR0A 5I7GA 5CLWA 1F76A 3QV7A 2A7RA 3V0SA 1V02E 1TWZA 1EYEA 1NARA 3GNRA 4ADSA 2PDLA 3AJ7A 4HP5A 4HBKA 3GR7A 4JD4A 3EGJA 3VU2A 4C6KA 4ZEPA 3FSUA 3T9PA 3OVPA 1E4NA 2DT1A 3E0IA 1PSCA 4WXYA 3U8GA 1SSDA 4AC7C 1MDRA 2IQDA 1ONXA 2WVVB 4AXKA 4EIVA 4MWAD 1BEUA 2AL1A 3N19B 1E6ZA 4X9SA 3SY1A 4IP4A 2DIEA 3U2CA 1I9CB 4GE8A 1YPXA 1EGMA 1TX2A 3EA1A 3BGJA 4NNAA 5G4WA 3TNBA 2EPMX 1KCLA 3B3DA 4PB3A 1DQWA 4OFCA 4O1DA 3OGRA 3M0XA 4RK8A 2NWSA 1V02A 1NDVA 1R7OA 2OB3A 1S46A 2A6NA 2DIKA 2XWEA 2C13A 2E7FA 5C7HA 2PP0A 5D05A 4H2HA 4AY8A 4E0CA 3MKCA 1D3HA 1BQGA 4J7RA 1GPWA 3CK5A 3UCDA 1T99A 3I4KA 3ITLA 4GJJA 3Q45A 3UXDA 1XG3A 4HK7A 1HIZA 4GHRA 1KV5A 2JGYA 4KRTA 3TZFA 4NASA 2OLSA 2J8FA 4P8VA 5CPSA 5LA2A 1GQKA 4LVFA 5LA0A 1KFKA 3OPSA 3OA3A 2JF6A 3BSGA 3AALA 3EX3A 2ZX9A 4DBEA 3A9IA 1Q13A 4XSMA 3WD4A 1CXHA 1UG6A 1LRQA 1J10A 1EEXA 1MVYA 2OX4A 3IACA 4OHQA 4IFKB 1HL2A 2V68A 5FESA 1GVEA 3IGSA 4DVOA 3ONCA 1RSCA 2JEPA 3WMSA 1UKQA 5DCDA 2X41A 2XIOA 4HHMA 3W28A 1GJUA 2E5DA 3WQ5A 1WQ5A 1Y5VA 2I56A 3ELFA 1WKFA 3MDWA 4ASTA 2ZRXA 4Z2IA 4X60A 5CPLA 4QISA 3SJNA 3LA4A 3BTNA 2ZBTA 1IGSA 3VNLA 4EF9A 2PDIA 4ZFCA 3EPMA 3UVAA 3K4AA 4LAOA 4JKLA 3GZAA 2XHYA 2VCAA 3IIOA 1OC7A 2HV5A 3PJUA 2QVHA 3RHGA 1IR1A 2PDJA 2BNJA 3NQ8A 3LLFA 3W4RA 3EWDA 1ONRA 2QJHA 3LQLA 1E72M 1EEPA 2VFFA 3EYPA 3S2JA 4P8WA 2G5WA 2XVNA 3LN3A 2PRLA 1HP5A 1UBPC 2J7EA 1MYRA 4QXIA 1H3GA 4N9BA 5EL1A 1E73M 3TN6A 1PDYA 2ACSA 1V0LA 2CLFA 3MI2A 2XIQA 2RGLA 1XYAA 1RK5A 1KBIA 3WUGA 6REQB 1GG0A 1V3HA 3DU0A 2YLAA 1LL7A 2PDYA 1OZQA 1XH2A 1KO0A 1WXZA 3F5LA 2XM1A 5D8ZA 2BB0A 3AZTA 3CTLA 3B8VA 4HB7A 3VMPA 3BWWA 5AFDA 3QMRA 3A23A 1VCGA 1AJZA 2VFDA 2Y8VA 4I9AA 3NQ2A 4TQTA 3UPBA 3HG5A 1WZMA 2F2HA 5BZAA 1A5KC 3P61A 3N2TA 4JQ1A 4RXFA 5DMYA 3O06A 1EUNA 3KTXA 3MCMA 4V33A 1LQ0A 2BGNE 1SSGA 1RR2A 4XQ6A 2X09A 1GUVA 3ZSTA 3GW0A 3H2AA 2XIMA 2TYSA 1OSEA 4DYKA 2O0TA 3RM9A 2VQUA 3W24A 1VGAA 4ZODA 4HU3A 2GFTA 3LTSA 3SSJA 2ZWZA 2DUZA 1KBBA 1QI5A 4AQLA 1RBOB 2H8ZA 3NPWA 3RLGA 2G50A 4PRWA 4HT3A 1QNQA 3LHWA 4R5EA 4U5KA 4DM1A 2TPSA 3L0KA 3O63A 3UG8A 4PMVA 5EY5A 1IT8A 4UR8A 4ZO8A 3W7JA 2PPGA 1K7EA 4JEJA 2X7WA 2XPKA 1L6FA 2NSOA 3VIPA 1PB0A 1M53A 4CNUA 3U0HA 1GQJA 3STCA 4PCPA 1PKLA 3PTKA 3ZFHA 4UNLA 4CN6A 4NYYA 3STEA 1ISZA 1A47A 1X96A 1EOMA 3KBNA 4ENLA 1T96A 3MP3A 1JVNA 4ZTYA 3B0XA 2G0WA 1PHQA 2E3ZA 1XSIA 3IGHX 2ZRYA 1UP0A 1SM9A 3NEHA 1XDMA 4U3AA 1A5AA 3G18A 1Q2RA 3LXAA 4GBUA 4XVDA 3LB0A 3GLCA 2EXOA 1X8FA 2HK0A 2Y85A 2BX7A 5HJYA 1ZUAX 1FWAC 3L4WA 5J5DA 3NZGA 4HCLA 4ZFMA 2YIHA 1LL4A 3QFEA 5AC6A 1I60A 3CLWA 1TB3A 1R5YA 3GNDA 1KTCA 3MSYA 3AAMA 4AD3A 1QJWA 4O1EA 2WSRA 1TMLA 4ZQCA 2E5CA 3UZWA 4HYVA 1DJWA 3GU1A 2V30A 3GTFA 4P7OA 2ZCGA 3BAYA 3PWAA 4W87A 3LGEA 5BCAA 2YCEA 3VZXA 3VPLA 3TCSA 3NL3A 3CV2A 2IKHA 1Z89A 1HGWA 2ZUWA 4GUFA 2DZBA 1XR2A 2CZEA 3B4UA 1JPKA 4CD5A 5HMFA 1XD0A 4L6DA 3TONA 1L6YA 4O0KA 4POCA 3O07A 1BQCA 5AYZA 1QHPA 4S39A 2F61A 1POKA 4O52A 1HJUA 3TLQA 2O9RA 3SEPA 1J18A 2IPFA 1SMDA 5LIUX 4B5SA 3H2CA 1UKSA 2G3NA 3A13A 4RNHA 3WLHA 3CT7A 1UP2A 2CKSA 4JTEA 4F0LA 5LHFA 1Q8AA 3NOEA 2EEXA 4O1FA 2QVNA 4F8XA 2VNCA 2V69A 4ILSA 1OFQA 1NSJA 4GBDA 2J9YA 1OFAA 1VJSA 3AZRA 1GT8A 1Q6RA 5JIWA 3G1YA 6XIMA 3ITCA 1UWSA 1W5QA 2OT0A 4CN4A 4UBPC 1QFEA 3T42A 1QHZA 3CJPA 1M68A 2HPMA 3VD4A 3SR7A 2R6OA 1I75A 2VCBA 1HKIA 3VFCA 5IXEA 5AYYA 1SFTA 3ZT5A 3U2EA 2ONEA 3HPAA 3T0DA 3WJZA 1WV2A 4HPNA 3CAVA 4K36A 3LM3A 1Q85A 2FFIA 3UJ2A 5EBUA 1C8XA 1UW9A 5DEZA 4WSJA 1KBLA 2BODX 3F5KA 2QCMA 1XDJA 4IMGA 1E1EA 4RV8A 3KVKA 3TFCA 1KM6A 4C1NA 3ZR4A 3OA5A 3EDDA 1CB2A 2YL9A 4GFSA 5XIAA 3F4VA 1LRNA 3DHDA 4GGHA 4ACZA 3UYIA 2CESA 1TWSA 4C65A 4B5NA 1UD5A 4HA1A 1TX0A 1OJXA 4JTAA 4RPPA 3WK0A 2B7QA 1A4LA 1DORA 2KAUC 3VNYA 3K2GA 3CH9A 1QT1A 3NL5A 5F4XA 5JBEA 4Q7IA 1JPMA 1HVQA 3WNPA 1TSIA 4DIAA 2P50A 4DELA 4WCJA 5T91A 2VFIA 1GJWA 7PTDA 1O5KA 5ABGA 3ERPA 1AQ0A 1XIIA 1W3LA 3AWOA 1JEZA 4GH3A 5LSMA 3M0LA 4H4IA 2INZA 1XYZA 4AYSA 4Z1DA 1K4HA 3P3BA 2D0GA 3XIMA 4JTTA 3MZNA 2WZIA 4KW2A 3GFZA 4PTXA 4A4AA 3UA3A 3SQSA 2Y7DA 3EOEA 2FVMA 2QAFA 4XX6A 3AROA 3VKAA 1ICSA 3CNYA 1H60A 3E9AA 4P8UA 4IIDA 1MXDA 4PBGA 3WZ0E 4M80A 3EMQA 5CSRA 3IV8A 4HKPA 3C4UA 1LBFA 1C29A 2A3CA 3S9YA 3NO1A 3CAWA 1FWFC 4MB4A 4O28A 1W9DM 1R86A 3TKFA 2WCSA 4GA8A 2XINA 2UY5A 3DFTA 4QEHA 1T41A 4P8XA 1RV8A 3RLHA 1P7TB 3W53A 3GXPA 2HMCA 2HXUA 4M3PA 3W1AA 4I9JA 4S3BA 2C19A 2NXIA 2BY1A 4HD5A 3AIVA 1E4LA 1O95A 3KDOA 1OYBA 2HXTA 4NILA 1FWJC 1AH3A 1IEQA 1V0NA 1BRLA 1PWLA 2ZXBA 8XIMA 2PZNA 2PGEA 3OW1A 4D8ZA 4G1NA 5SWUA 3A64A 1DJHA 4Q4RA 1FFRA 5K2ZA 2WC4A 3WFZA 1RBAA 1LQAA 4ZSUA 4HA3A 1U33A 3HG4A 1SO3A 4GK8A 1K8XA 2LLEA 2NXHA 2OCZA 2W9MA 1YQ2A 2CLIA 1K9EA 4Q4SA 2RDWA 3ZJKA 1XICA 2E5BA 1XLIA 5MHBA 1PO9A 5I5RA 1K9TA 1SUXA 3DFSA 4HHPA 4Q7NA 3E3HA 3B03A 3MYPA 1JRCA 4CN1A 3WL0A 4ML4A 3FEMA 1DIOA 1VD6A 3QV8A 4OBTA 5JH2A 3T8LA 1HJSA 1QOQA 2FTWA 1H5YA 4BF9A 2PSNA 4NQ1A 4US5A 3KX6A 1XUZA 3LMZA 1R46A 3ITVA 2Y4SA 1LL6A 2W79A 1G7UA 3BW2A 2XISA 3M46A 2GOKA 3G0XA 2FPTA 2PLKA 3N6QA 4QNEA 4MKSA 4G5DA 1ZZMA 1H7PA 3KOYA 1NDZA 1L0PA 4C6DA 1N8FA 5H8UA 1QI2A 2V3DA 2C6QA 4IUOA 2NQJA 1IXPA 4E6MA 2Z6JA 4MB1A 1TZ7A 1SZFA 2P1FA 4RNIA 3ABOA 3PZVA 1R3VA 4AZ5A 4K8GA 3MMUA 2DT2A 5FSDC 3SM0A 4GVIA 1I2QA 1E9LA 1KM2A 4GYKA 3RJXA 3N14A 1LOLA 4Y9OA 4Q3MA 4QG6A 3WD1A 3CGTA 1YHTA 1VFOA 1NQ6A 3RPMA 3T2QA 4ICNA 1Y0EA 4HZ6A 3AJXA 3SJ3A 3VIFA 3UY8A 3VIHA 4AXNA 3QPEA 3VE7A 3EXRA 1NP2A 3GUWA 3LSCA 2OYLA 3CUGA 3VFLA 3WQWA 1TG7A 1ENUA 3LBMA 4MHBA 1EPVA 4NVTA 3RUBL 4M8UA 3TTEA 3SGZA 3MB9A 5EKYA 5HJXA 3W7KA 4BI7A 2Z1XA 3MUAA 3W85A 4H04A 5HAOA 3PUOA 1LP6A 4GACA 4NRSA 5G2WA 4C6EA 1Q4WA 1QHOA 1TMHA 3GNOA 4UZSA 2AL2B 1XC4A 4J4KA 4IQDA 5ECVA 1V8EA 4LEFA 2R1MA 3EMZA 1EJRC 4NJKA 3S5SA 1IXQA 2R1NA 2DDXA 3RR4A 3TSBA 1G4TA 1VIWA 1H1NA 3SCPA 4Q7BA 3WK3A 1BYCA 3JU2A 3KBSA 3R0KA 1F61A 2G8ZA 1WZLA 3WEOA 3N6JA 5GJNA 1L2UA 3GU9A 1DHPA 1KWKA 2V5LA 1OC5A 1EDQA 2YDQA 1DWFM 3KW3A 2OQLA 3O15A 1S2WA 1YE4A 4GFIA 3KL3A 9XIMA 4CNNA 1K7FA 1WA3A 3W84A 1W5PA 3VDCA 1XS2A 2XU2A 4PB5A 1EJXC 1YEYA 5C71A 9RUBA 4YYCA 1UD4A 3CMFA 4YWSA 4DI9A 4OTKA 1DPMA 2PCEA 1US0A 1MW2A 2FGLA 6TAAA 1MFUA 5G1YA 1EXBA 4IXHA 1ZBCA 4M7TA 7TIMA 4I6KA 2V82A 1OFRA 4LRSA 1OIMA 4IX0A 1N55A 2G3MA 5CZKA 5BMWA 4LALA 4Q4MA 1JZ2A 2WM1A 3KL0A 4Q6JA 5FJPA 4IWWA 2GWNA 2QMJA 3W83A 3KOZA 1FWDC 2VDHA 3W1RA 4KGLA 3D6NA 2OZ0A 3W00A 2X1SA 4UFLA 2V6AA 3F2BA 5FF3A 2VC7A 4WQ6A 4HVXA 3PNUA 1TJ2A 4I8YA 3FHAA 4B5TA 1BTCA 3FV9A 2WMHA 4RLIA 1E3ZA 2ZVRA 2YB4A 1EC8A 5LNRA 1EX5A 1XWYA 1OD8A 4UOJA 3COTA 3GD6A 3G1DA 4GI9A 5IBXA 3K8KA 1W37A 3RX2A 5EFFA 3L4ZA 3BG5A 4JTUA 5JBDA 2RH9A 2ZZ2A 4AFYA 5D9NA 3TIMA 4UR7A 4IF2A 1XBYA 3E0WA 3V4BA 2XVPA 3CHFA 5CSUA 4CQ9A 2WJFA 4N4QA 1EYWA 1WAWA 3PF3A 4AEEA 4B3KA 3C2VA 2EJAA 3H6OA 2W66A 1SFSA 3DHPA 2JE8A 5A6BD 1O66A 5DMLA 4TVDA 5FAGA 2DH3A 1XKJA 4IMAA 2BP1A 1CLKA 4CCZA 2V81A 3BV7A 3LU2A 3VXGA 4A8NA 3LHTA 1TR1A 3TWBA 3GFXA 2WCAA 4JIPA 4HN8A 1U1JA 1CLXA 2JKPA 1WOAA 4O19A 4FIQA 3RMEA 4K7VA 4MLJA 5BU9A 1HO1A 1UA7A 4EK7A 5BOOA 2F2KA 2P88A 4GIYA 1CZ1A 1GCYA 3EB4A 3KFTA 4BWLC 2E8YA 3H2OA 3HFYA 2D24A 1FHVA 1TV3A 1U30A 1B3YA 2R1PA 1S2UA 4Z1BA 2OEMA 4HQVA 3WL1A 2GJRA 4MWAB 2WJEA 1ONWA 5HJLA 3B4YA 1I1WA 1ADDA 1LROA 2W6RA 3OLEA 6A3HA 1XLKA 3TW7A 1LBMA 3NO3A 2J7BA 2VDGA 3OZMA 1CXLA 3N29A 3SDOA 3DH7A 3M0MA 1JCNA 4W93A 1B0IA 2PDCA 4A2RA 5TQLA 3QTGA 2IQ0A 1JL8A 4FLRA 1X7FA 3AIWA 1JR1A 1V6TA 2J47A 3KRBA 1T7LA 2VRJA 4UFKA 3LCXA 4HSNA 2QIWA 1ICQA 1SFJA 2P53A 2ZA1A 4MDPA 1UD6A 4UQDA 4UMCA 4ORIA 1TZZA 3P93A 2W5FA 4HOWA 4U10A 4AW7A 2GJXA 2XIBA 3PBYA 5I00A 1E0VA 1D8WA 4B2DD 4ZQRA 3I6RA 1M1BA 4JPGA 1S2AA 3QYQA 4C7GA 1J4EA 1Y5WA 4QTGA 1IR2A 3O6YX 3QMTA 4IQJA 1LYXA 2BY3A 1E15A 2J4GA 4XTDA 1SVDA 3GKAA 3MUCA 5BROA 4B3LA 4K37A 4JHZA 4G7EA 4PMQA 3S1UA 2ZZ1A 1UWIA 3BK0A 2PMQA 4KT2A 2O55A 3L4VA 1Q7ZA 4Q8WA 3YPIA 1QMLA 4KWWA 5K3VA 2QJMA 1JDDA 3KZSA 2QDGA 3AMDA 1KC7A 2PB1A 4ZQNA 2CERA 1AW5A 3EKLA 3TAKA 1C3FA 3FJ4A 4QDWA 1LWIA 2FZ9A 2GJLA 3QGKC 1L6SA 3GU2A 4JFVA 1L8PA 4O8AA 4KCVA 1KTBA 1ZAHA 5M17A 3ZJ8A 2WQDA 5F4SA 4J35A 4XD4A 4LS0A 4LVGA 2WZMA 2BDQA 2E0PA 2FMOA 4S2BA 1YXCA 4DAIA 1JNEA 2WSPA 5CPNA 1WOBA 1YPFA 2DW7A 3LPGA 3UXLA 3PZIA 4YLWA 5BXPA 3MQTA 3HGOA 3TW6A 2PTWA 3ITOA 4AIBA 1PL9A 2V2HA 1XF0A 4O53A 2F6KA 3LI1A 2QHAA 1NTHA 5BW6A 5JMUA 4LU0A 5CGMA 1FY6A 4QS6A 3DG3A 3L12A 1ZTVA 4F66A 2UBPC 3P74A 1VHCA 2PTDA 3ONBA 4LCSA 5CJMA 4WX2A 1JAKA 5DN1A 3RILA 4F9DA 5A6KA 2WCGA 1E6SM 1XIDA 4B9YA 2BY0A 2JQXA 3N4FA 1OX4B 2V3FA 4L5ZA 1BPLB 1FDYA 3CV1A 3N15A 3CUIA 4FALA 2C7FA 2D2HA 1UQYA 1LJYA 2HE5A 3TEVA 4DZ5A 4DO6A 3NNTA 1GWJA 1XLLA 3EDJA 3WENA 3IUHA 4UQEA 4HU4A 3PJWA 1S5WA 4GY0A 1HT6A 3IJLA 2REQA 1BGAA 2DJLA 1KQZA 2BXYA 1CENA 2ZDSA 2UWFA 3A22A 1DJXA 2YZRA 4O1CA 3VVGA 2X42A 1QR7A 3MUIA 4IIFA 3P84A 3PULA 2ZUNA 3UJFA 3WH5A 5A8PA 4V15A 2CLOA 3R43A 4H7ZA 1XV8A 2CZDA 3MHGA 3I10A 3LCHA 1JUEA 1HFBA 2Z24A 1W9XA 5HWJA 4PMJA 5DCBA 4E3VA 2FJUB 3G1XA 4PTVA 2PFHA 3THCA 3GM8A 1AJ2A 3S9ZA 2JKAA 3DZ1A 3DYPA 1QTWA 4F0HA 3GRIA 1NFPA 4PCFA 3UWEA 5FEPA 5DELA 1K9DA 1BRLB 3MI6A 4AD2A 5CGQA 2VEKA 4MM1A 4J3TA 3QHMA 4C7FA 1JYWA 3HB9A 5BXSA 3T0TA 3NGJA 1QK0A 1DJGA 3UA4A 1CXEA 1UKOA 4BK9A 5C9ZA 5DMNA 5XIMA 1LUCA 3EWZA 4EP8C 4IGMA 3QPYA 4KWOA 4QSFA 4JFWA 1U83A 1RY8A 3VDHA 3R6IA 3B05A 4BQ4A 4S3GA 3CZLA 1ZY9A 5E9AA 3UNDA 3GVVA 4JZ5A 4NZJA 1W9UA 1L8NA 4GABA 2ZC1A 1DQXA 1KCZA 3CUFA 2G3FA 5I3GA 5CC6A 1BYBA 3T8QA 2X30A 2VX4A 2A3HA 5FI8A 3EWUA 4DXKA 1E3XA 1JUKA 4V27A 3FLUA 3WNNA 1KB3A 1UPPA 3NQDA 3BOXA 3N3MA 1P7TA 1VJZA 3OP2A 4HHHA 2YDAA 2P0IA 2XSXA 3ITTA 2EJ1A 1LCOA 4MYAA 1QK2A 1TCDA 1CYGA 3IK4A 2WNZA 2ZE3A 4AVFA 3TC3A 1RPKA 2DZPA 2PEVA 3L4TA 2HK1A 5HWMA 3U3HA 2ZRWA 2QW5A 3O8AA 3WLOA 4DNHA 1NVMA 4AMCA 5RUBA 1SZRA 1E6RA 3H23A 3O7UA 4O57A 3C3UA 3M9YA 1KCKA 1SJCA 4RX0A 1QI3A 1BHGA 2WB5A 1HUVA 3C2OA 3DFHA 1FCBA 1DIDA 1XI3A 3BW3A 3FS2A 4KERA 3M0ZA 4GD0A 3QHOA 1FOBA 3T1GA 3VKCA 4HYWA 4A22A 1Q3NA 2XDFA 2OYMA 4DUVA 1M7PA 1GKRA 3FAXA 1UP3A 3PBMA 4DWSC 2DSUA 1A3XA 2OSXA 1ODZA 4I3GA 1WUEA 4RDWA 4ICMA 1U1HA 3RM8A 3L2MA 4EVZA 3VE9A 3P8JA 4OZOA 3SN0A 4W7WA 1PBGA 5A8OA 4UQBA 2J6VA 1CGUA 2NW0A 3CL8A