2VWTA

Crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12 - mg-pyruvate product complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
b'MNALLSNPFKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQRIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDTMLYSDALDQRLAMFKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YFAU, 2-KETO-3-DEOXY SUGAR ALDOLASE
publication title Crystal Structure and Functional Assignment of Yfau, a Metal Ion Dependent Class II Aldolase from Escherichia Coli K12.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 90
structure length 256
sequence length 256
chains with identical sequence B, C
ec nomenclature ec 4.1.2.53: 2-keto-3-deoxy-L-rhamnonate aldolase.
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2vwtA00
3M0KA 1U5VA 3EOLA 4FXFA 4B5TA 2BG5A 4KCUA 1MUMA 3LYEA 4IQEA 4QGCA 4B5UA 2HRWA 1M3UA 3FA3A 1F8MA 2HWGA 1VBHA 3IS4A 1VBGA 3PP7A 3QV7A 2DIKA 4KRZA 4RPPA 3E0VA 4WJ8A 2DUAA 2HROA 2R82A 4ROQA 4QG8A 4KS0A 2KX9A 3B8IA 3EZ4A 4B5WA 5JVLA 1ZLPA 2ZE3A 2WQDA 2E28A 1S2TA 4TV5A 2XZ9A 1AQFA 3QV8A 3T0TA 3I4EA 4IP7A 3MA8A 3VAVA 1PKLA 3M0JA 1O5QA 3QLLA 1O66A 3QV9A 4L80A 4QG6A 4L9ZA 1A49A 3OYZA 1OY0A 1PKNA 4JPGA 3GQYA 3SRDA 2XDFA 1IZCA 4KCVA 4B2DD 3HQOA 3ME3A 4HYWA 4TV6A 3SRKA 2L5HA 4B5SA 3SRFA 1KBLA 3R4IA 4IMAA 4B2DA 1JDEA 1OQFA 3PUGA 4LSBA 1M1BA 1A3WA 3QQWA 3E0WA 4HYVA 3OQ8A 3LG3A 4B5VA 1DQUA 1Z6KA 3EOOA 1U5HA 1F3XA 4G1NA 3T07A 2V5JA 1S2VA 1PYMA 1PKYA 4MG4A 2XZ7A 4KCTA 1XG3A 1O68A 3QTGA 1E0UA 4YNGA 4DRSA 1F8IA 3SRHA 4L7ZA 3OYXA 2X0SA 3GR4A 3EOEA 1S2UA 2VGFA 4MF4A 1UJQA 4KCWA 3H6OA 3N25A 4L9YA 4IQDA 1A3XA 1E0TA 1IGWA 3FA4A 3BJTA 4QG9A 1S2WA 3G2GA 3KHDA 2V5KA 2VWTA 1KC7A 1A5UA 2HJPA 1T5AA 2VGGA 3E5BA 2G50A 2VGBA 3QZ6A 3U2ZA 2VWSA 3KTXA 3HQNA 4B5XA 3BJFA 1SGJA 1PKMA 5TAOA 3T05A 1F61A 1XG4A 2VGIA 3GG8A 1DIKA 1F3WA 4FXJA 3QV6A 2OLSA 1ZJHA 4YJ5A 3P0XA 1DXEA 3HQPA 1GGOA 1DXFA 2QIWA
chains in the Genus database with same CATH superfamily
3UVAA 2VEMA 5CC6A 2HPMA 1Y5XA 5D9MA 5HATA 3RRXA 5C9RA 4B5UA 1R9ZA 2V3GA 3ABZA 1QNVA 4GIEA 1L8NA 1DJXA 2EG8A 3MUXA 1W31A 3DENA 3NOEA 2V0TA 2W67A 3TC3A 1XRTA 1E3XA 3T0CA 5HXMA 3QLLA 2VEPA 2GJRA 2OU4A 2V5DA 1XKYA 1H51A 3GDBA 4S3KA 3RLHA 4TV6A 5CZ0A 4E8DA 3CTLA 1F9CA 1X6LA 1SZEA 3KBNA 3M0YA 4LPCA 1W0MA 1GWJA 4XZMX 4KCTA 2REQB 4HZ8A 3AMKA 4UQCA 2P0OA 4RNFA 3P60A 1R3TA 1XW8A 1LM1A 2VR2A 2VEGA 4QQ3A 3A22A 1CGUA 4R9OA 1TO3A 1V77A 3PJTA 2PGRA 1ZP3A 3NA8A 4DI8A 4JHZA 3F4NA 2UY4A 1KCXA 1XRFA 3W28A 2J6XA 4MNJA 3U2ZA 1JDCA 5H1WA 2ZXBA 1BKSA 1S5MA 1XGDA 3U2CA 2BWGA 3UZWA 3OVQA 3E6EA 4WY0B 4JFVA 1CCWB 4UR8A 2HVMA 3BOXA 4RZ5A 5FF4A 2HE5A 2EPOA 4PBFA 4X60A 3PJXA 1W2VA 1I9CB 3MJMA 5CSRA 2E6DA 1TQXA 4GH1A 4NAFB 1TIWA 4R7OA 2J7HA 4ZTXA 1VHNA 1RA0A 1QT1A 2IPWA 4IP7A 5C7VA 3IJ8A 3APTA 1AH0A 4JIEA 1T6MA 4H9UA 3RIKA 1KW1A 3QGKC 2YB1A 2QCNA 4P7NA 2HE8A 4QNEA 3WLHA 3QR0A 2QUUA 4CD6A 1H7RA 1QOXA 4IMAA 3B04A 3CV6A 2WWCA 1JUBA 4D6DA 1V3IA 2G3IA 3UGVA 2BDQA 3O7UA 1WNOA 3WH8A 4QE1A 4XBKA 1OADA 2PP1A 1W8GA 1OD8A 4M51A 1F05A 3UCQA 1XYBA 1CECA 1EF3A 1Z8AA 4KCWA 2FZNA 1P6WA 3SCQA 1JRCA 3SCRA 3CIWA 1AJ0A 3PTDA 1XUZA 1JI2A 3T7VA 4L1XA 3U5YA 1THFD 4CCZA 3CB8A 3TH6A 4EXQA 4ATLA 2BOGX 3H54A 2INZA 1JUKA 1ITUA 1CT5A 2I5QA 4O0KA 4QNWA 4ZO8A 1J12A 3LGGA 2V3EA 4DQWA 1XYMA 4JL2A 5U4NA 1XP3A 4QDMA 4GNVA 3SN0A 5GVJA 4AYGA 2HRWA 1GQKA 3QV7A 1E9YB 1CXIA 3WNMA 1E0WA 3SUVA 5EA9A 4AZHA 2HTMA 3DN5A 2PTZA 3AHVA 4IT1A 3POCA 1K77A 4AVFA 2HVOA 4MLJA 4L6DA 2HK0A 3ABXA 2C8NA 1DIDA 2B7NA 1FWJC 1UIOA 3GVQA 1S5TA 3LXCA 6A3HA 4MNKA 2FPTA 1P6BA 1WDSA 5AYYA 1W1PA 1UWSA 1JGIA 1ZJIA 5HPOA 5F2MA 4JN7A 3VVGA 4YWSA 2TRSA 2ZIDA 4OFCA 2NV2A 2R1LA 4AIOA 4XTDA 5HJLA 8A3HA 4KWSA 2X16A 2PDNA 3PBVA 5DCDA 4UFKA 4BQ5A 1TIMA 4DI9A 1BVWA 1TPFA 3K46A 1RXOB 2J9XA 3MMTA 1R85A 3Q45A 3TR2A 1T96A 1OK4A 4J4KA 3TW6A 2OYMA 3PY2A 8XIAA 1J93A 3K8MA 2OXNA 1CXEA 2NX3A 5G2WA 3TJXA 5D2VA 3HGJA 2GLKA 4ILSA 1TV5A 3VM7A 3J7HA 4XZBA 1JCJA 1EEXA 2PDBA 1XIEA 2HPIA 1V0MA 4QS5A 3C2FA 4QEEA 1S46A 2YCLB 3HJZA 4C6JA 3CT2A 1H7PA 4D6EA 4QSHA 3UJ2A 1F8MA 1E1CA 5AOUA 1PSCA 3OLGA 3A4XA 1HQTA 1YADA 3EWBX 2PWDA 1BQGA 3VIMA 1NOWA 2FMNA 4E4PA 3CLWA 2E28A 4WY0F 5I00A 4H9MA 1PB0A 1V3KA 2G3JA 2P3ZA 3LRMA 3PUEA 1TPWA 3WY1A 4EP8C 1WXZA 3MSGA 5C2CA 4WK9A 5HJXA 1E73M 5HBFA 1S5WA 3BMVA 4UFMA 4C7GA 4IIGA 3QXBA 2QCDB 3B06A 1MQQA 2DV0A 1M9HA 3FA5A 4DZIA 1IEQA 4NI3A 3GXIA 3URQA 4MKSA 3R0DA 3ONCA 1Z89A 1JYXA 2VQUA 1XS2A 1JDAA 4MJ4A 1MYRA 1B90A 3KW3A 4JTQA 3G1FA 4GLEA 1QHPA 5FF2A 4HZ7A 1WCGA 3L4WA 4RE3A 4CCDA 3CPRA 3HQ1A 2H90A 1BGAA 1J6OA 1A80A 1YTEA 2HNEA 3DUGA 4XAPA 4PCNA 3HQPA 4AWSA 4H8VA 1QUMA 5CBBA 1RLCL 4YCPA 4GY1A 1W9BM 2WBKA 1HW6A 4L9XA 3UNDA 2R1KA 1FUYA 3GVRA 5T8GA 1RD5A 5A1AA 3HG3A 1XCFA 3UT0A 1EYEA 3WDQA 1HJSA 4OBSA 4MY1A 4TV5A 1NOFA 4TVDA 3Q65A 4JTDA 4K7VA 2YYUA 4X0NA 4F79A 2CETA 4HMNA 2B7OA 3FS2A 3N6QA 3HN3A 3T78A 1YXCA 2X0HA 3HPFA 4W5ZA 2AQOA 4IFRA 3G1VA 1Q6CA 5CSUA 5DF0A 3L0GA 1XIBA 2QULA 2QCGA 3H7VA 3CL7A 4E38A 2O4QA 3EOOA 2PP3A 3OW1A 2NQ5A 3KBVA 1V93A 4NZ1A 7CGTA 1LBMA 3HF3A 1V51A 1RUSA 3UXAA 3KOWA 4YU1A 2GGGA 2ZTKA 3S9IA 4GBDA 1RVKA 5HNRA 4G2DA 1IHIA 4AXNA 1UKSA 4A3QA 2ZUTA 3DC8A 3W25A 1EA0A 3NDYA 3CWHA 5JH2A 1W3LA 2P3EA 5CCZA 3GE7A 3ARTA 5G4HC 1B3WA 3WENA 3GU1A 2F6KA 4U4MA 3SEPA 3PNUA 2D20A 1DJGA 1E6XM 4LVBA 4EVZA 2XVLA 3A21A 4CQBA 2OB3A 2OG9A 4WKFA 1SJAA 2WKJA 4N9DA 3CTTA 1GKQA 3WNOA 4N4PA 4LW7A 2DORA 2OEMA 3KRUA 3C3NA 2C13A 1W2PA 2W5FA 4J3ZA 4JQ2A 1NDWA 1DL3A 4H7CA 1B0IA 2UY3A 1XLLA 1VKFA 5HINA 4AF0B 2BFGA 3SRFA 3LOTA 3R4IA 1QXLA 1UMYA 3LV5A 4JTKA 5HAOA 1YRRA 3SIZA 1ZPTA 1R2RA 4P7LA 3OTRA 3SFKA 4GUIA 4A8IA 1S39A 2J66A 4H8HA 1J2BA 3MANA 4K1WA 2XN2A 3OBKA 4J40A 1Q7ZA 4HK5A 1JZ8A 5A6LA 3GDMA 2J25A 2EKCA 3PF3A 2Y62A 3EPNA 2HISA 1V5XA 3KP0A 3LCWA 2QMKA 3RX2A 4KETA 7TAAA 4X2RA 1VCVA 3NL3A 1OFOA 1WDRA 1B3OA 3D47A 4QLKA 5H8PA 1V0KA 2FZDA 2QJJA 4IFKA 3MVIA 3EXSA 3VD9A 2DSWA 1C7SA 4NNAA 2DZTA 3MUZ1 2WC4A 3VGDA 3LSBA 3MSYA 4DBSA 1MI3A 2GWGA 3N1AA 1C90A 1RK5A 4PGLA 2KZHA 3ZT6A 2WMHA 1QI2A 4AU0A 1RY8A 1RBOB 1UZ1A 3CIXA 3WH6A 4V15A 2PF8A 1BWVA 3CS2A 4TIMA 4BHYA 4JY9A 4OIFA 4IWWA 1RBAA 4ZOAA 4UQAA 3BMWA 3TN5A 1YEYA 5EB8A 2H9AB 3PBUA 4G5DA 4Y9PA 1JNEA 4Z1YA 1PPIA 1VR6A 3FJNA 3DOPA 2PZ0A 1FWSA 3NJ3A 3S47A 1PDZA 1I0BA 3ZYZA 1IXNA 1QATA 3VGGA 1ZBCA 2V2DA 3Q4DA 4E6MA 4A3HA 4YTRA 1KKOA 2AAAA 3NL6A 4RZBA 1EQPA 3G1YA 3GXPA 2IPJA 2V63A 4CN1A 1X7FA 3QC0A 4X0VA 3EX4A 4TQTA 4M29A 4BI5A 1LQAA 1G7UA 4GUFA 1EOKA 2GJNA 4F0RA 4ERGA 2GWNA 3KTSA 3RMEA 4M5PA 2CLIA 2OKTA 1EKOA 2QUNA 2YA2A 4JTFA 1DWHM 4FLSA 1AVAA 3L68A 5BNKA 1E56A 3QV6A 1H09A 5A94A 1AQMA 4S3DA 3N12A 1W1IE 3W87A 4AIUA 3LHWA 4WJEA 2R14A 1M3UA 5D2XA 3WLKX 2CZEA 1KBJA 2IXUA 3CHCA 3AOFA 1B54A 2CKSA 2O9OA 2J7DA 5A8OA 7ENLA 3D6NA 2XVNA 4B4HA 1AUSL 3GW0A 2WM0A 1DQWA 3IGHX 5TIMA 2J27A 5LA2A 3RLVA 1OCJA 4WLCA 1VJSA 4RDVA 5C5YA 3QW4B 5FL1A 1HKKA 1EJSC 1H41A 3FDGA 1GVEA 4PBGA 1RCQA 4JTLA 4NJIA 3RN6A 3UZ5A 3RU8X 5LXEA 1TA3A 5MHBA 3AMLA 3KUMA 2PC4A 3GKFA 2FGBA 2NQ9A 3W00A 2EKGA 3BG5A 3VDCA 1E0TA 4UBPC 1MW0A 3G2GA 3E0LA 2XFWA 4S23A 3S2LA 8TIMA 1QBAA 2PDYA 3WLPA 1W9PA 2ON3A 1WXJA 2CEQA 3TTEA 4ADSA 1LOSA 4DJDC 4ACYA 1UD4A 2J47A 2VNCA 5E5CA 2QPXA 1AW2A 4L64A 5AZ0A 5AN7A 1MVYA 3EB2A 4HA0A 3KFTA 1O6IA 1XLMA 3UJRA 1PZ1A 4NUWA 4HSOA 3WQ4A 4FAMA 5BXRA 3FW6A 3G22A 4A8RA 4MADA 4NYUA 4ZOBA 4FX6M 2XGIA 3N2BA 1TPDA 4XAZA 1H1ZA 4HA1A 3TONA 1FHDA 1V08A 1DIOA 2CIPA 1ZLPA 4IMDA 4KF1A 4RNIA 3VDBA 5JMUA 1HJWA 4HSHA 3GDLA 4UMAA 3VI2A 1SR0A 3L2IA 1EGMA 4S3JA 4L4PA 3VE9A 2POTA 4HBKA 1OIFA 1D8WA 3B8UA 3HFYA 4US5D 4B3ZA 2Q01A 1A3WA 1UH2A 2RDUA 3BLKA 1SYTA 2CZVA 4H6EA 2XFFA 3NQAA 3V36A 1O68A 4MB1A 3BMXA 1W3IA 1UJQA 3GC5A 4RXFA 3HPXA 5KINA 1W1TA 2PWHA 4AYSA 1ISXA 4K2SA 3BANA 1IEXA 3QOKA 1O5XA 2OT0A 4RV8A 1I6NA 5HMEA 5BU6A 1A5UA 3VIKA 3ALFA 4QCFA 1OB0A 2EAWA 3HPZA 2Y6ZA 2QR6A 3VTRA 4GABA 1Q66A 1XJBA 3O6DA 3ES7A 1GHSA 2VT0A 1XXXA 4W7UA 7XIMA 1NP2A 4C6QA 2VDIA 2FVKA 1ZCCA 4JFWA 2V9DA 1GQIA 3PHAA 4GVIA 4ROQA 4KS0A 3ZS4A 1PCKA 5AC5A 3EOSA 7PTDA 3A23A 1J11A 1IWAA 4H19A 2OOGA 2QT3A 3N2OA 5EKYA 1NOUA 3W85A 4AQLA 4J9JA 4ZODA 3K1GA 1I1XA 5FL0A 7REQA 3KRZA 3TFXA 4GXPA 2V82A 5D05A 1QK2A 2VD9A 3IIZA 1RJQA 3GYCA 2QVHA 2XN0A 3NXFA 4I9MA 3RDKA 2E0PA 5D9OA 1RBLA 4H1ZA 4FNSA 2GK1B 3ARWA 4BA0A 4P7QA 2A6LA 2WZIA 3KZPA 1FDYA 2GSEA 3N4AA 3EGJA 1CXHA 1LORA 3CMJA 2CYGA 1FHVA 2H8ZA 3WLNA 4CQ8A 3RR4A 3WD2A 3EX2A 1ZGDA 1QVBA 1A3XA 4US5A 3C2EA 4R7JA 4RXGA 1QR7A 3VOCA 4O14A 2PURA 5AYBA 3UA4A 2XIBA 3P74A 1SMAA 3MSDA 2O7QA 3MDUA 3NPUA 2OWCA 1UR0A 3BSMA 4AD0A 1PTDA 4JGDA 4O50A 4U3AA 4R85A 3O9NA 3PBMA 3I3BA 2CKRA 5AVHA 1J0JA 2E6FA 1XIIA 1MEHA 1TR9A 1AD4A 4IMCA 3WLLA 3DH7A 1GZ1A 4IPJA 5A8MA 3B8IA 1LQ2A 1UASA 3R10A 1Q6GA 2Y24A 3W72A 3QEZA 4UTWA 2UY2A 1JULA 4MWAC 1DWJM 1A5NC 2EF9A 1H50A 3GNXA 1MXSA 3QOMA 5L6UA 3TN6A 1NSJA 4PRWA 4QJ1A 3LCXA 1XIFA 4W8BA 3IAQA 4XSLA 1GVRA 1JVNA 3QHNA 3EA2A 4PE8A 2FTWA 4KKXA 1TPB1 4JAWA 1SJDA 3SRHA 1XPGA 4EANA 3RG6A 4S3CA 3PAJA 4IM4A 1YBQA 2C15A 2PDUA 3AYSA 4Z08A 3DI0A 5I0DA 3Q67A 1Q8JA 4Q8MA 2G50A 4US6A 3K1DA 3ZO9A 2HDJA 5TAOA 2VZTA 1ICPA 1H3GA 3QH2A 5CGQA 4EPKA 3B8WA 5AECA 4AX6A 3B4UA 4CNTA 1DE6A 1IQ8A 5LSMA 3UWVA 1VFFA 5EU9A 5D09A 4DJFD 3PS7A 2TMDA 1FA2A 3WNLA 3PP7A 1NDYA 1FKXA 4L56A 1SZNA 2GOKA 3V5OA 2C0HA 4QJ5B 2ZX7A 4LC6A 2XIOA 3GTNA 3W1LA 2D2OA 1FWTA 3AI0A 4MAVA 1FRBA 1EQCA 1SQ7A 3GHRA 4F66A 2RDWA 3XINA 1QFEA 3G3DA 3UCDA 1FCQA 5IM51 3EDDA 2UV8G 5G1MA 2ATSA 4L6OA 4ICMA 1A5KC 3WLMA 1H60A 4H2HA 3UA3A 1KM2A 2L5HA 3CT7A 3AJ7A 4C1KA 2EQDA 2B0MA 2ZRUA 5C70A 4HNVA 2J88A 4FMVA 4AZ7A 2WNWA 4LALA 1UCWA 2HV5A 2C71A 3OGRA 3L12A 1RY0A 3IUIA 4DBEA 5CBIA 2YCKX 4DBUA 5HQMA 4QJ4B 2BS9A 2DP3A 4D8AA 1E40A 4BF9A 3UP8A 1XLBA 3OA5A 3ZJ7A 4DY1A 5I3IA 3V0UA 1GOXA 4WVXA 5D30A 1GJPA 2PLJA 4EE9A 5K2ZA 3S1VA 3EWWA 3PAOA 5LKYA 1UA7A 5BXTA 3P67A 4ZB0A 1IYXA 1EP1A 4FIQA 2GOUA 1DXEA 1TQJA 1VP5A 4JTTA 1G4SA 3TXZA 2VZOA 3SB0A 4UCFA 5MF5A 4NG3A 4N9BA 3EPOA 3FHAA 2QXWA 4JZ5A 2OODA 1C8YA 4QXIA 3MV01 4G9PA 1XIDA 4C5YA 4OQVA 1ZS2A 5F4WA 3L66A 1NU5A 1X98A 4X2PA 2VFEA 1KFKA 2EXOA 1D7KA 3TCSA 1J5TA 1OEPA 3WNPA 1MWOA 6TIMA 3STFA 3M0IA 4WZHA 4DJFA 3LQGA 4N7QA 5M03A 2OWXA 3G0XA 3TLLA 3UG5A 4JNYA 5KEZA 4KEUA 2DZAA 3D3AA 1XLHA 2INEA 3F2DA 3GAKA 5FJPA 1E6QM 3RILA 4NP7A 4O17A 1OJXA 2QHAA 2BLEA 3IIXA 2NVCA 3IVSA 2ZXQA 4KRTA 4XAFA 4GXWA 1X1NA 4C1NB 1EWDA 3WBYA 2V5KA 4EPBC 1YDNA 3M16A 5KETA 2IW0A 2XJ7A 4AVNA 3O2LA 4AZGA 4HJWA 5IDIA 1OF6A 3USZA 4JS3A 1WV2A 2YW3A 3QPEA 1GTEA 1ZAHA 2YBVA 3W2MA 4F0HA 2ZZ4A 3KTCA 1EC7A 2ZRZA 3WDJA 1KV8A 2GDVA 1UW9A 1H0GA 4CU7A 4GISA 3DGRA 4FX7A 3IS4A 4JXCA 1O1ZA 3VCNA 5DCBA 1C9WA 3I68A 3A13A 4R34A 3FN9A 1QU4A 3V1PA 4GO8A 3TTSA 4G7EA 1PHWA 3LXAA 3I4EA 4MJ2A 4HJFA 4FNPA 3LS9A 4ICNA 2NX9A 4Q6XA 1GYMA 2Y63A 4ZENA 5BWAA 2V2CA 1BF2A 1IZCA 4JTIA 3W88A 3FYOA 4MY9A 3O6CA 5HA7A 5EMJA 2ACQA 3CWOX 3SCSA 1PDYA 1EJRC 4HHLA 3WDHA 3LRKA 3VNJA 3INPA 3W6YA 1JZ6A 3G0UA 5CGMA 3DFQA 2WMIB 3W7RA 3EWUA 4DWSC 3AU6A 5CC5A 1B5TA 4MF4A 2QPUA 2H8XA 3UXDA 3FFSA 2ZZ7A 1SU5A 1UIPA 1I2RA 3EOUA 1LL4A 2DUZA 4ACZA 4IQJA 3DGBA 3VNZA 3BLEA 3GC4A 3HFTA 2OSYA 2Q71A 3URAA 1XICA 3SY5A 4AB4A 1ZSXA 1D3HA 2VGIA 2W62A 5GNYA 2NUWA 5KMYA 3WLSA 5M5DA 4IPLA 1JAEA 2VRQA 2B7QA 2ZDRA 4K8HA 1W1VA 3MSRA 3QZAA 3O63A 4HMEA 1H1NA 3WEMA 1ZQ5A 3KX6A 3B8DA 3PSVA 3PN8A 1UKPA 1EXBA 2E9BA 3WFLA 1AJZA 4LCQA 3IIPA 1UP2A 3U0HA 1A5OC 4E3VA 1HJXA 2AAMA 5EMUA 1MNSA 4ZBCA 4C60A 1W5NA 4DAIA 3PWIA 1F6KA 2C1GA 2G37A 1M7PA 1LG1A 5G2HA 3KL5A 5FAJA 1WDPA 1G5AA 1R3VA 1ADSA 5D04C 3W38A 2CU0A 1OG0A 2VRJA 2YFOA 1L2QA 2XH2A 3FGCB 1Z6KA 1TX2A 4CU6A 1HGWA 4IUOA 4HVXA 1NQKA 3NL2A 4HHPA 1BYDA 3QTGA 4KFNA 4M82A 4RKAA 5ABFA 2WQPA 2XVGA 4MWAE 4O52A 4NJGA 4TU1A 5HNNA 3V18A 3PZNA 4S3BA 5DANA 2YX0A 2PLCA 2QGHA 3AUOA 5FD0A 1JZ2A 4NNBA 4JQAA 3KTXA 2JF7A 3IPWA 3N14A 2VURA 2WC3A 3AS1A 2A3EA 5HANA 2QDGA 3BAIA 3HA1A 4I5RA 2PD5A 3QGVA 3F5KA 5I3GA 4LANA 2V5BA 3K4AA 5E0FA 4GI8A 3KS6A 1OGGA 3TZFA 3B8TA 3F4DA 1X8FA 4WCJA 1XDJA 4ZQRA 3OVRA 3CU2A 4DF1A 4BK9A 3G8EA 3AS3A 2VOMA 4H41A 2NSOA 3AAMA 2KX9A 2EPLX 5ENLA 3EPMA 4N6FA 1KLYA 3WIJA 3U2EA 1VFHA 1TR1A 4PL2A 3N34A 2CBJA 1PWLA 4C6BA 2FKPA 2TSYA 4P5UA 4EPDC 4ZR8A 2C14A 2PE4A 3G6LA 3VABA 1XX1A 3CB3A 3L5AA 4I6KA 4EAMA 3KOFA 3AO0A 1RHCA 1JD9A 1JFXA 2CLFA 2Z1WA 2GJLA 2XUCA 4TVUA 4O4WA 4PUDA 1LTDA 3M07A 4MG4A 3DX5A 3EB3A 1GVIA 4N0RA 3AUJA 4ZQMA 5EMYA 3O3RA 4GQ0A 2EG7A 1J9YA 4JFTA 2NWSA 3I4KA 3ARZA 1GQLA 2PWVA 4AY8A 4V1YA 5K3VA 1F4HA 2VWTA 5T26A 5ABEA 1UP0A 4WR3A 4UZSA 3VUPA 4CD5A 4LUYA 1Z42A 1C29A 2REQA 3FY1A 2VEKA 4FOUA 1X1OA 4NX0A 3AXKA 1GGOA 5E0KA 1W91A 1R30A 4S3AA 4MSSA 3ZT7A 2BX7A 4IISA 2WZEA 1HXJA 4Z17A 4B5TA 4ZFCA 3SN1A 3VGBA 2BP1A 1Z9AA 5HWNA 1QPRA 1SO5A 1S38A 2E7FA 4E4UA 4GGBA 1L6FA 5C9XA 1J5SA 4DO6A 1SUXA 1O5KA 2H3BA 4WY0A 1A5AA 2GFTA 3HG5A 4Q4PA 4LYKA 3VO0A 1MO0A 4HU0A 4M6QA 5F2LA 2ZRVA 4X22A 3VNYA 2V5LA 4NAFA 2J24A 1F7BA 2JKAA 3FSUA 2C6QA 3JZEA 3V5FA 1BG9A 1OYBA 2ZFAA 4GCXA 3TAOA 1QNOA 2XSXA 3TYEA 2P50A 3TA6A 3PUDA 2Q6ZA 4W5UA 3UJSA 4PCPA 4RJEA 1T8XA 4O8RA 5LHFA 4GH3A 2OT1A 4PYSA 5LA0A 3H7RA 1RA5A 3BAKA 1IT8A 3TSDA 1WAWA 2VWSA 4JTGA 3ZM8A 3DKLA 1F76A 4L1WA 4L65A 5AC4A 4KFOA 5TD4A 3I6RA 4O28A 1ISZA 1R3SA 4I6VA 4GG9A 3CWNA 3PPFA 1XF0A 2GVEA 3ARQA 3W84A 1POKA 2GYIA 3MP4A 2ZZ6A 4DJEA 2PDKA 3ITGA 4C6PA 3G5EA 1U33A 2ZC8A 4OU1A 2CHOA 4K1GA 3U57A 3W71A 3BLPX 1EXPA 1OX4B 4KW2A 3H4XA 1PWMA 2VD8A 5LHEA 1D3CA 4AIEA 4EX4A 1JXKA 3BK0A 5TQLA 1OINA 3TQ0A 3CYVA 3NQGA 1IEIA 1MZHA 2VOTA 4NF7A 4E2BA 2CPUA 4F2UA 4PMDA 5EBUA 1E6NA 1H7NA 3UWUA 2OEJA 4AX7A 4PMUA 1BD0A 1LOLA 3UFYA 1HKMA 1E5JA 1PYMA 3VFCA 3EDFA 3QFWA 4AEOA 3LB0A 1HTIA 4HGXA 3W1MA 1XQKA 2EPNA 2DZPA 4CQ9A 4H04A 3WD4A 4REQB 3UQNA 3ANYA 2PDLA 5AHIA 5CPQA 2CWNA 4BR1A 1TJRA 4EWJA 3ZJ8A 2BV9A 2VUYA 1JF5A 4GKLA 1KXTA 4AD5A 3BGJA 1CTNA 2V69A 2OYKA 1XG4A 4NT0A 3SCOA 3QC3A 2QVNA 1ESWA 2XIMA 2Y70A 3THQA 1DHPA 3R58A 3NNTA 1NEYA 1HFBA 1LP6A 5FJOA 5H91A 1TJ2A 3VC5A 2WVUA 5A2BA 1KM6A 3W23A 4J3XA 4OBTA 1HN1A 3UWZA 1P5BA 3SURA 1H7WA 1EIBA 4WD0A 3TYBA 4UTKA 3NQEA 4AZIA 1KM4A 4O18A 4Z1AA 4XZWA 5LGZA 2ALDA 2GQ3A 1PYFA 1XLIA 2GVYA 3WQ6A 3LK6A 4L5ZA 2VC6A 4LU0A 3W7KA 1KCLA 3AIWA 1Q6RA 4QM1A 3T2QA 3BL3A 4KWWA 1MQRA 4FOKA 4N42A 4TMBA 2QS8A 3LTPA 1ME9A 2PD9A 3N17A 5JIWA 4BWLC 3ARXA 4Q8UA 3EOEA 1TTQA 3MS8A 3MPGA 4AZ5A 2A85A 6XIMA 3GG1A 2ADAA 1VYRA 1EZ2A 1QNPA 5BMXA 1IZKA 4F4RA 2PDWA 3PBGA 4AMAA 3TJIA 2XU2A 9XIMA 5EMKA 2YDQA 2RDTA 4KMQA 4Y9AA 3STEA 2HJPA 3BGGA 1NP0A 1HF6A 3W86A 5D8ZA 3B0VC 1JXJA 2QCDA 4WSHA 1VRXA 4LY4A 4NIRA 2GJXB 1DIKA 4HCLA 4JOMA 4FXJA 3S1UA 4DX3A 2AL2B 3GVWA 4Q8PA 1ZJHA 2IKGA 3ZVHA 3H8AA 1UWAA 2CZ5A 4ORIA 1ZZMA 2FPYA 2OGJA 3TJLA 2J9ZA 2W4XA 2PRLA 4CEUC 1ONWA 1XLFA 4I5UA 3AHXA 4MDPA 4QGCA 3W1XA 4H6KA 3A3WA 2A0NA 3WDPP 1BSIA 4N9CA 3C0SA 2WBGA 3FV9A 3GVGA 4BJHA 2A7PA 2Y4SA 4XZIA 4MNLA 3OHMB 3TW7A 3H26A 1VHCA 1FWGC 4CU8A 3OLIA 3RCMA 4HD5A 4GNKB 3BG9A 4GI4A 1PKNA 4DYJA 1KRBC 4Q4MA 3QTPA 1X6NA 5A8NA 4X61A 1M7XA 1TVPA 1Q4NX 1W1ZA 4GIAA 3PB0A 3IARA 2G3MA 4LC8A 2WHJA 5E1QA 1F8IA 1WDDA 3TNBA 3USBA 3V7PA 4Z1BA 2BASA 4P8XA 2A4AA 3P5ZA 1ZALA 3II1A 4O8AA 3WH5A 1KM5A 5LYRA 3WN6A 3QZ6A 3EKGA 3EX6A 3RM9A 2J9YA 1HO4A 5B7ZA 4PMRA 3QHOA 1NQ6A 3ID7A 4YJ5A 1GOMA 2PDFA 2JFEX 4XK2A 3PC0A 3BAWA 4GI6A 4M56A 3LCIA 1JG9A 3BQ6A 4MFDA 2RHGA 1CGXA 4IQLA 1JCTA 4DYKA 1A53A 2DSVA 2I9EA 5I3DA 5HMSA 4Q22A 2D2GA 4JHMA 3ECQA 5GJNA 1TV8A 5JVLA 4S2BA 4WHBA 5D02A 4FOJA 4GKTA 3L7RA 1V3MA 5E6YA 1G7VA 2ASHA 4LEQA 4PEEA 2WMGA 3MV11 3GTHA 1H61A 1CLVA 2CBVA 2XDFA 3E9AA 2ZQ0A 1QHZA 3K8LA 5LNSA 4KGJA 2A2IA 5LNWA 2RAGA 2WCSA 1UA3A 3GK0A 3PK7A 3HURA 3B8VA 3DCPA 3ATYA 1VBJA 2JKPA 1HVXA 1XG3A 4Z42C 3TWBA 4Z2KA 4WUIA 1RH9A 3M7WA 2PRMA 3NL5A 2J7BA 4IQDA 3WCZA 1I1WA 4AF0A 3P3BA 1UKTA 4CQCA 1TRDA 4NAEB 5I24A 4Q4OA 3JR2A 3UXIA 2HEJA 2HQAA 1KRMA 1UUOA 3MO7A 3S3GA 4ZQNA 3F2CA 2VHLA 5I03A 3LHZA 3MTWA 1J0HA 1FCVA 2NV9A 2XVPA 3DFOA 1HP5A 2QAFA 3GWQA 1N55A 5EY5A 1G6CA 3N4FA 5DEZA 1UR2A 4LGXA 2VZUA 1HL8A 1EJ7L 1FKWA 1R5YA 2E09A 5D32A 1XLCA 2J8TA 3DBPA 3KVKA 1OYCA 2W3ZA 5IXEA 3WF4A 4WXYA 4BF7A 4ZO7A 3AMGA 1AW1A 2HBVA 2WZHA 4JYEA 3BQ5A 2QJIA 3TMLA 4W84A 1AK5A 1ZL1A 4TMCA 3O6YX 4FF5A 1OFRA 4FP1A 4BQ3A 3T44A 3UZJA 1FTXA 3GQYA 2V3DA 2NVDA 1TRIA 2FJKA 5BXPA 3NZGA 3IIVA 5ABGA 1KFEA 2C18A 2ANUA 1U5JA 4QDPA 2HXUA 1EEPA 4XKYB 3S46A 3LZ3A 3W26A 4DF0A 2DDXA 3DXIA 4GACA 3FCPA 3IANA 1R3RA 2Z0IA 1E0XA 5AB3A 1MW2A 3ARVA 4C6OA 3S6OA 4JY8A 4UTTA 2PEVA 4W8AA 2FLIA 2G97A 3E5BA 1T5AA 1B4KA 2VGGA 4Y2WA 3NZRA 1FFQA 3M5YA 4F9JA 1XR2A 4AZCB 1WZMA 2NQHA 2E40A 1SR9A 3N73A 3CK5A 5FEPA 3VDHA 2A7NA 3QKZA 2YBUA 4GBUA 1MSSA 1AQ0A 4UR9A 2Z2BA 2POZA 3VIJA 3VMOA 1TWZA 3ERPA 3QYQA 4ONVA 3WJSA 2DVTA 2QCHA 4PSRA 2QJGA 4H9YA 2X1UA 5JBEA 1FOBA 2Q3RA 4NZCA 3PFMA 1Q7QA 3RGTA 5HQEA 4F0SA 3UR7A 1LUCB 3WQOA 4S2CA 1I60A 1JPKA 2R24A 1DHKA 3DYOA 3SO7A 1E5NA 1UD5A 1VPQA 3R89A 3TYAA 1OY0A 2PRHA 5CLTA 9RUBA 3LX9A 5I7GA 1DJIA 1AL7A 1ITXA 5C8BB 4C6EA 3NO3A 1BWKA 1PX8A 1XH0A 3MCMA 5A6AA 2YKKA 2WKLA 3T42A 1A0EA 3LCGA 5F2IA 1VZWA 5HK4A 3EKLA 2BSLA 4KRUA 4IPIA 3MHFA 3N2XA 3I6EA 1WKYA 3HPAA 4YNGA 3RPDA 4G1KA 4ZXOA 5EYWA 1R3YA 3VKBA 1AZ1A 1G4PA 1YDOA 6TAAA 4HA3A 1TSIA 5CSSA 4Y9NA 1JNDA 2VL4A 2GDUA 2OWWA 6XIAA 2HVNA 3W70A 5XIMA 3CMGA 3W7MA 3M41A 3K4DA 3D5HA 3AIQA 4NASA 1UHVA 3NQMA 3W29A 3W7JA 2D3NA 3KDNA 4HA4A 1VFUA 1X97A 2CWXA 2O0TA 1F61A 3CEPA 4GZEA 3TROA 3MW7A 4QIUA 4DIAA 3L4TA 3E02A 5BOOA 4GX9A 1B1YA 4GYKA 3QYSA 2PU1A 1DOSA 2DT3A 3UETA 2W27A 3MBFA 1P0KA 3BLFA 4KH2A 1A0DA 2JK2A 3QZEA 2BHZA 4A05A 3BXWA 4CEXC 4LVGA 3CGTA 3OLDA 1NJJA 4OHQA 2I5GA 1FWAC 4FS9A 2C7FA 2WJZA 4K39A 1OT1A 1X1ZA 3AS0A 1P0EA 4C6DA 1REQA 4ES4A 4LAKA 1TZZA 3KS5A 4NX5A 3M47A 2P76A 1UOKA 3QQWA 3PSWA 4H9TA 3W73A 1B3ZA 3FNDA 4D8ZA 3SZ8A 2B31A 5I78A 3P0WA 4DUVA 2ZYFA 1B31A 1H11A 5I5RA 3R43A 5CLWA 2OMAA 4Q33A 1RQEA 2QQ6A 3VPLA 1W5OA 4U2YA 2OCZA 4LUSA 5A8GA 1HKVA 3OB8A 3PZUA 2Y61A 1J18A 3CZEA 1XISA 1WP6A 2ZA3A 4HN8A 3MZNA 2YLLA 3C52A 3SADA 4JX4A 2DPEA 2FZMA 4F2BA 3AS2A 4HNOA 1JDFA 4D8LA 3W7OA 2HCVA 2ZZ2A 2ESCA 3CAVA 3KM8A 1W1YA 3CV1A 4MB3A 4A8NA 2WNQA 1XFBA 4HHMA 3T8LA 3MMDA 4HCDA 3T2OA 4F2TA 4ATWA 2CC0A 4WIWA 4WJ8A 3ONBA 4H6RA 3W1NA 3WDRA 4C6MA 4QAWA 1MXGA 2ZTJA 1JCMP 4Q8VA 1PZ2A 3P14A 2OTDA 5D4YA 4Z0JA 5TNVA 1BWLA 4B5NA 1HL9A 3P93A 2XZ9A 1KTNA 2H3DA 3NEHA 4N4QA 2ISWA 3UWWA 4EWND 5JQ9A 2Z4GA 3E12A 1WZLA 5I07A 5LIUX 2PS2A 1GPFA 5BMWA 2ZZ5A 1TPC1 1V8EA 4MKVA 2FZBA 1LT7A 3L0NA 1Q6EA 3BG3A 3NAVA 1XFCA 2V68A 2TODA 1K6WA 3K4WA 2Z1KA 5CPNA 4PCSA 3B9AA 3R5EA 1C8QA 3OGVA 3NPWA 3RCNA 2X05A 2PSNA 2Y5SA 3L4YA 3P8IA 5XINA 5CZKA 2BVTA 4H01A 1XH1A 3EWYA 3FA4A 1HX0A 4J3UA 4QROA 4ZCWA 4NRRA 3C6CA 3TDFA 1YPFA 4DNHA 3LCFA 3LCLA 4KWOA 3LCHA 1US0A 1QMLA 5D9NA 1JZ7A 4HIBA 3AZSA 4H83A 3KRSA 1C3FA 3KXQA 3FKRA 1VQTA 4IF2A 1E1CB 3E2QA 2PDMA 1BAGA 4UFLA 1BYBA 4HU4A 1FX6A 1G9HA 3RJXA 2X1SA 4JIPA 2YPIA 1NELA 3SI9A 4PUMA 3OQEA 5DO8A 2CESA 4UFHA 3LNPA 4LH8A 4YHEA 1JRBA 1QBBA 5CAHA 3H55A 3KP1A 1E1FA 5FI8A 4J27A 1NTHA 1GQNA 3WQWA 1KM1A 1RCOB 2C1IA 3FXGA 2XHYA 1K70A 1K02A 3QMRA 3LEPA 3WF2A 1PXGA 1KRAC 2BOFX 2PPGA 5AHNA 4QAIA 3REQB 1CNVA 2F8QA 2QDHA 5F4SA 2ISSA 2EO7A 3VUSA 5IFTA 2DJLA 4UTUA 4R88A 3NUKA 3B0YA 3HM7A 4KEMA 2XIJA 2Y5EA 1EGVA 3GXTA 4HU3A 1VIWA 4O4VA 1MW1A 1CGYA 2C19A 1LWIA 1J01A 4M6VA 4Q4QA 3H22A 3W37A 4R3UA 3HV9A 3GYEA 3RMJA 4LVDA 3TFCA 2J6VA 4AD1A 1DWGM 3CZKA 2ZOXA 1TTPA 4AEFA 4K6AA 2WPBA 3BW4A 2V6AA 3W9ZA 1A5LC 1VEPA 1EJWC 4YMZA 2X2GA 3JS3A 3WDIA 2VCBA 1QPKA 3ITCA 3BW3A 3MB9A 3FYYA 4FXFA 4F0MA 3UPBA 4XZ9A 3ABOA 3HGOA 3GZAA 4YN5A 2JF6A 1RALA 3IRDA 2WJFA 3QPZA 2A7RA 1FWWA 5J8LA 2BVYA 2EHHA 4OV4A 2PC8A 4MPQA 4AZBA 3LBCA 4JBRA 3TUUA 1GEHA 4JTSA 4H7VA 4N2YA 1S3TC 3K2GA 3WBEA 1BVZA 3R6IA 3HU7A 3LUTA 3NQDA 3T0BA 4FNRA 3LENA 1UWIA 4JTHA 1WPCA 4O1FA 4B2DA 3WELA 3OBAA 3CNYA 1FWEC 2PTYA 2NZLA 1Z32X 2V5CA 3SGGA 4AAJA 1AA1B 1J0KA 4PMZA 2FB3A 4Q8TA 1KQYA 1W56A 3VX1A 3KCOA 4GVHA 4EF8A 4HSNA 1XYAA 1SPQA 1CPUA 2VDHA 1UR3M 3AIBA 2NW0A 3NVDA 5K9DA 4C91A 5DN1A 4WDUA 5C54A 4JCMA 2WSKA 1IGWA 3L21A 3LZ5A 3HGSA 3MWAA 3WUBA 1VJIA 3DG6A 4DZHA 3CUHA 3IJIA 1XM3A 4ZMGA 3EWZA 1R7OA 3MWCA 4GCAA 4A2RA 5AHEA 1Y7VA 1QW9A 4IMEA 4JQ3A 1LT8A 1ZU8A 2QJHA 8XIMA 1XLEA 2BG5A 5HQLA 3CZJA 3DIPA 4B4FA 4GMEA 4L4MA 2J4GA 4B3LA 1HIZA 2BODX 1A0CA 4PUNA 4CVUA 2VX4A 1DIEA 1K9DA 3MCOA 1CEOA 3FXYA 1BFNA 3M0ZA 4JTJA 2PU0A 4WX2A 1U22A 4INFA 2VFFA 3SRDA 5I09A 1LRQA 3ITXA 4GZJA 1R9XA 5DT7A 2HNHA 2VFIA 1BQCA 3AHTA 3E0WA 1JYVA 1PO9A 3FJ4A 3QHMA 1XD1A 1XDLA 5CPTA 4J35A 3W6LA 2J7FA 1MEWA 2YZRA 4XBSA 5HNTA 1EO7A 2ZDSA 3FAWA 4QSFA 3H2AA 2DJXA 4TX8A 3CASA 1WDQA 3G8RA 3CUJA 2ISDA 4HQVA 5EL1A 3CUZA 2XPKA 1L6GA 1V4YA 1WB0A 3DG3A 3AICA 3ARSA 4ZOCA 4U2ZA 2FGZA 2ZZ1A 1NARA 3DU0A 3A4JA 1VBUA 4MM1A 1X96A 1Y5VA 2IKIA 4M7SA 5I3HA 1GOOA 2IMRA 2WHMA 1I4NA 4C1NA 2OZ3A 2DZBA 4PBEA 2GUYA 5FAGA 1VBGA 2DIKA 2BY3A 1J0ZA 4NHVA 3W7EA 4NU7A 4GZIA 4AC7C 5IFPA 3CUIA 2BXVA 2I7GA 1CW2A 1CX9A 5EMMA 2ONEA 2PCQA 2Y7DA 3S8HA 4PTWA 2R1PA 1TMHA 2GDQA 2Z27A 3W1AA 4AFYA 1L0PA 3P8JA 2XH0A 3GHTA 5CSYA 3DFSA 1RD6A 3FVMA 1MDLA 4TTGA 3Q94A 1ECEA 5JUVA 3T81A 3W4RA 1F6YA 1CIUA 4HTYA 4NI8A 4ERAA 1XUUA 1H7XA 2CLOA 4WGHA 3COTA 4DRSA 2QV4A 4LWWA 1EB3A 3GM8A 4J1OA 1TJPA 1UP3A 1JCXA 4R53A 3N13A 7A3HA 4A8LA 1ME8A 4H3DA 2NLIA 1W3HA 1NWSA 3NZQA 3EEGA 3KZSA 3KWSA 5KZ6A 2F6XA 3IJLA 5M2FX 2PDXA 2CXGA 4B5XA 5J5RA 1LRTA 1XKJA 2WMIA 4GA8A 2WW5A 4CKQA 3GDTA 5G1YA 4CCCA 2XFYA 1C9DA 2R6OA 1K9TA 1E0VA 4X3ZA 3P2VA 1QDSA 2YL9A 4JTUA 3I65A 3AMDA 5AVNA 1GUVA 3AZTA 1EPXA 3OZPA 1UBSA 3A64A 2BHUA 3UYIA 4JR5A 5M17A 4EF9A 1TPUA 3IUHA 2CW6A 1Y65A 3N19B 4D6CA 2DSZA 4XD6A 3PBYA 3PPCA 2XWDA 3G18A 1MQPA 2JIEA 4XVEA 1TVLA 3CQIA 3TC7A 4YYCA 4O16A 1GZJA 3ABQA 4DXKA 2FHCA 1OX6A 4CN6A 1M65A 2JGQA 5DFAA 3PZIA 1G4TA 3M5ZA 4JIHA 3F4WA 2XZ7A 1E0UA 2D3LA 3SCPA 3AZRA 4WXZA 1YKWA 1W3KA 5IBXA 4AWUA 5D38A 1UC4A 3ANUA 2FZ8A 4Q32A 4OTKA 2ZA2A 5DX7A 5IRPA 2VDGA 2YDAA 2X41A 1QI4A 1CYGA 3RU6A 3VNLA 2HK1A 2BHYA 3UZXA 1Q65A 5GPRA 1M41A 4CQDA 4GE8A 3CL6A 4W86A 1VAHA 2PI6A 5DMYA 2ZUVA 5JBDA 4MWAB 4XIAA 2I1OA 1E4NA 1VFMA 4C90A 1IWBA 2QUVA 3T55A 1ECQA 2DU2A 2PBOA 3CZLA 4RZ6A 3WBXA 4GQQA 1YTKA 2W61A 4UFJA 2OO0A 5BYWA 2E25A 2ACUA 4YYFA 5A2CA 1K7FA 5DQPA 5LIYX 3Q58A 1CI1A 3CHEA 1IEWA 2V8ZA 4W85A 1V6WA 2W91A 1IR1A 1JF6A 4MLRA 1GK8A 3SN4A 3LU2A 4HN4A 4OWGA 5IHSA 1GVFA 1TJ0A 3GXNA 5CG0A 2X1TA 1UWRA 4PA8A 4DO4A 4LYQA 1H4PA 2Z2UA 4LF2A 2D24A 4LYRA 3BZJA 3ITTA 2NXHA 3GUWA 3SUWA 9XIAA 1F3XA 2ZX6A 4FXRA 1EWEA 2WHLA 4BI7A 3SQLA 1EF2A 1AODA 2OJPA 4RNHA 2W92A 2VEIA 4UNIA 1C8VA 1QPQA 3IK4A 1EC9A 2WSQA 1PTAA 2IQTA 1MDRA 4IJCA 4ERIA 3BCFA 3HB9A 1TYGA 3TN3A 1SO6A 2CZDA 5PTDA 4ORMA 1W9DM 3RUBL 3TQPA 3UY7A 5C0QA 1HKJA 4HPNA 2HMCA 1NFBA 1AH4A 3HIJA 4EK7A 1GNXA 4ZA0A 1TWIA 4OECA 3SCWA 4PTNA 3LYEA 2PDPA 4P8VA 1K8XA 2GSJA 1Y8BA 1JYWA 4MHBA 1KXQA 3EYPA 3NOYA 2Z7KA 3KVMA 3VILA 1TE1A 2DY3A 1E71M 5CKSA 4GIRA 1WUFA 4PC8A 4NQ1A 2G8ZA 3GC2A 4JKLA 2CCRA 3KVLA 1AQFA 1GYNA 4V33A 1QWKA 7REQB 4LBRA 3O05A 5HMFA 4JIRA 3GFYA 4KCVA 4C5ZA 3VGEA 1U1JA 3ISIX 4Y9OA 1X6UA 4ATDA 3NQBA 1UG6A 2P8BA 2WOQA 4F48A 4K37A 1TELA 3VOHA 1VH7A 4LT9A 4CN4A 4NL1A 2GVJA 3H2OA 1KXVA 3NPVA 1ZRQA 2WVSA 2X42A 1OFPA 3S2NA 2CNCA 3G24A 3WEZA 2RGLA 3R13A 1OZQA 1KCKA 1IXPA 5DMLA 2E4TA 3ZWSA 2C3ZA 1E4MM 2E6AA 2J7EA 2OGYA 3KHDA 4AZ6A 4ALDA 1YHTA 2X0YA 4A3YA 1RPXA 1ITCA 3NDZA 4I7WA 4RE4A 3NTYA 3LBMA 4GJ1A 2IUZA 2EPMX 4FXSA 2VO5A 1R2TA 2IPFA 2V81A 1P0BA 2YLAA 1J96A 4O1DA 4YCOA 4PMXA 3NXLA 1YIXA 3FYPA 1N2VA 3B03A 3GX9A 3LV6A 3BCDA 3THCA 4B9ZA 2P5NA 2FJUB 3WD0A 3T0DA 2F7FA 1GG0A 4H7ZA 1JFHA 4D2JA 3VIOA 3W1PA 4Q4RA 2Y89A 2E1WA 1H5YA 4O1BA 4O15A 3DFYA 1E4LA 3PPHA 4A3RA 1HJUA 3VGFA 3K13A 2ZRYA 1GJUA 1OX4A 1K3UA 5G4EA 4ICCX 4Q8QA 2WSRA 4RR4A 1SFTA 2FYMA 4E5TA 1KGWA 4N02A 2BVWA 3O16A 4MY8A 1EHAA 2Y7EA 3PBWA 1S2UA 5I3JA 1OK6A 3DHUA 4BS0A 4C7DA 1YBQB 3H12A 4CNPA 3CAWA 2ODOA 1ME7A 1K8CA 2OZTA 4IG2A 1VLIA 2PBGA 1H5VA 2ZUWA 1ZFJA 4PB3A 1V3HA 1KC7A 4H2CA 5G5IA 3F7JA 1R9YA 4EOUA 4CUCA 3G1XA 1TUFA 3DYPA 4ZVJA 3SBFA 4Q8OA 2AOSA 3NQ7A 1US2A 2PGFA 3TWAA 3MP3A 1CLKA 1IE7C 3M0MA 3DECA 4NKCA 4REQA 3VXGA 2PDQA 3IWPA 1UZDA 4OV9A 1FWCC 5JIPA 2DSKA 5A2AA 2DUAA 3B9NA 2PCEA 3OLEA 4FZIA 1ZB5A 1BSLA 2XINA 1FDZA 4ZXLA 1I2PA 2WQDA 3UU0A 2MUCA 2ABBA 4RCXA 4J5NA 3TR9A 5C55A 1OFDA 3BW2A 4DWSB 4R27A 4AWTA 1DYSA 3FOKA 1XV8A 5FJUA 1QOQA 3QMTA 3BPWA 4B90A 3NSXA 3APGA 4ADTA 1H1YA 2R94A 3ME3A 1LWHA 4MJMA 2R1MA 5FJJA 5E9AA 3IJDA 3JUGA 1MFUA 2Y1HA 4PSPA 3DERA 4HOZA 1GOQA 2PWGA 2WAGA 1JYNA 1IR2A 3E0FA 3VKDA 4Z0SA 4UIOA 3I7QA 4IUGA 3VD7A 2I14A 1ADDA 1VS1A 1I0DA 1U1UA 3WQGA 1L9WA 3PUOA 5A6BD 1KFJA 4O54A 4FNTA 4UTFA 1EP3A 4GVGA 4J3SA 2RUSA 5DBUA 4IOTA 1E15A 4XTIA 1E55A 4MGGA 4PMQA 3DC0A 3MI3A 2EBNA 1B9BA 3P80A 1W6TA 4GRSA 2VQTA 4PFMA 3S2CA 3LM3A 3QRHA 1EUNA 2ZUSA 3EOLA 4MFEA 1B2YA 1OCNA 2ZWZA 4C65A 4DXVA 3IVUA 1VBHA 1W3JA 3N4EA 4GXMA 5C7HA 4BI6A 1S5NA 3OJGA 4ML9A 3T4CA 1Q45A 4GYFA 1N8WA 2D69A 2QJMA 4XUYA 5MKGB 3GR8A 3CM4A 3ZSSA 4FPSA 1PZ0A 2YL5A 1FWBC 2AL2A 4S3EA 2X7WA 3VM5A 2FDMA 3VAVA 5DLCA 4NRSA 1O66A 3WJZA 1MNZA 1OC7A 3EA1A 2ZA1A 8RUCA 2PODA 4Q3MA 4HPXA 1G4EA 3TYDA 1BEUA 1K03A 1CB2A 1E72M 2JQXA 2DEPA 5I6SA 4IICA 2V67A 2Z1BA 3OPSA 3DEQA 3GRIA 3T0AA 1XIJA 1XRSA 3A3HA 4IMFA 1LLZA 2WLZA 3V16A 4PMVA 1WE5A 1GVYA 1QI3A 3D3FA 2I57A 1AH3A 4W93A 1PJ9A 1LL7A 3OA3A 4KQNA 2ISFA 3WSUA 3NYZA 3RAOA 1JCYA 3VNKA 1XYLA 3E0IA 4MUPA 4JCLA 1IV8A 3LPPA 4D72A 1ML1A 3UWYA 5EBAA 1W9VA 3L65A 1M7JA 1KFCA 4FA3A 2G4JA 5HWJA 3VIGA 4UMCA 2OOFA 1C92A 1UOZA 4DEFA 4RDZA 3OOQA 3AXMA 2BXZA 1EO5A 4L6HA 3TTOA 2IQDA 3QY8A 4GFIA 3WK0A 1B9ZA 1TFVA 4Q7IA 3E0VA 3KRBA 3P6LA 2FVLA 3I10A 4QG8A 4LV4A 1TPVA 2WXDM 2YXXA 1AD1A 1VFLA 3OIXA 1E9ZB 3MY9A 4XD4A 3CMFA 3VD3A 2IQ0A 1ZUAX 3QV9A 1JQVA 2EEXA 4Z2JA 2E6YA 3HMCA 1PIIA 3BAJA 4O13A 5I3KA 4IXHA 5AC6A 5BW6A 3QMSA 1PHQA 1KFLA 4KGLA 1MRQA 3L2MA 1QO2A 3ZZ1A 4LBSA 4XIMA 5E6ZA 4UNKA 1KFWA 2V5JA 3TEVA 1MW3A 3QR3A 3NQ8A 4Q8NA 3E5PA 4ZQCA 2ZADA 3R1ZA 5H2ZA 4BZYA 1XYFA 4GGHA 3H2CA 5D2YA 3RNDA 3JZUA 2O92A 1DTUA 1BYCA 3AHZA 1HT6A 3TP4A 5CPLA 2ICSA 1ZJAA 5IHRA 3UCCA 3AWNA 5CQ1A 4GINA 4JN8A 4P7OA 4WRHA 3CUGA 3BARA 5A6MA 3CUXA 1B4EA 1BRLA 3O0FA 3BURA 3GW3A 2VC9A 5LIXX 1XYCA 1F3WA 2WVVB 3UF9A 5HOSA 3LLXA 3CO8A 1DXFA 1U30A 4FX8A 3NG3A 1S2AA 3KBMA 2GL5A 4JQ4A 3MI6A 4IQEA 2WB5A 4UTHA 1KD0A 2FQIA 1VFTA 2R82A 3A12A 2WZMA 2C1HA 1G01A 1E6SM 1YPXA 3SW6A 2X2YA 3LMZA 2PGEA 2VFDA 1S2TA 3QVQA 3T0TA 3VX0A 4ZQPA 1QK0A 3UEQA 1DWIM 4DB7A 4O57A 2BGNE 4FK9A 4XUGA 5HWMA 4P8UA 4URIA 4Y7EA 2WWDA 1F73A 4B5VA 4IHCA 1YE4A 1IF2A 4GC4A 4WQ6A 1CGVA 3O6AA 2QNEA 2CLHA 4KWVA 1A4MA 4PULA 1KFBA 4CNNA 4HPGA 1K9EA 3BSGA 1LDCA 3TQVA 2B7PA 2HZGA 3PR2A 1PBGA 4MZ1A 3UZZA 4J3VA 2QF8A 3EX1A 3C0QA 3BJFA 1P48A 1V7YA 4I90A 1MFVA 3EDEA 2GUBA 4GI9A 1VPXA 3GD6A 1AMKA 3V4BA 3RCYA 1QPNA 1VFOA 4Z2GA 2NQJA 3W7IA 3U4AA 2QV5A 1QASA 1QJWA 5I23A 4HKPA 4ZSUA 4O11A 4IIDA 3AROA 4LX4A 4YVPA 3ALGA 3NM3A 3FK4A 1EYWA 4GO9A 1AW5A 4O1AA 1EL3A 3LQLA 2ABAA 1Z44A 3SM0A 2AL1A 1OT2A 4PL1A 4IGHA 3TE9A 2ALRA 3GIPA 1BHGA 4L80A 3BGAA 4E8GA 1US3A 3NCOA 4A6GA 5HULA 2VXNA 1JR1A 2X1IA 3BUVA 2CXEA 3N15A 3TYUA 1KBLA 4K8EA 5D2WA 4JFSA 3WJWA 1FFRA 1JI1A 4HK6A 1JGMA 4TVCA 1DQXA 3STGA 1LUCA 1V02E 1EIXA 3CJPA 4X9YA 1LROA 1GT8A 5K7JA 3ZQ9A 3A4WA 1XCXA 2WO5A 2W63A 3S5SA 4IL2A 4D6JA 2CLPA 2VX7A 1KTBA 2FGLA 2PWUA 4KBXA 4WDWA 1W9XA 1WQ5A 2FPVA 4ZEPA 3LPOA 1IGSA 2VGBA 3TSMA 3LHUA 1DVJA 3TXVA 1CB7B 3C56A 3H23A 1CGTA 3TTQA 4OUIA 1XBVA 1TVNA 2PLKA 2A3AA 4H8UA 3ZT5A 4YLWA 2PLMA 1PS9A 1LZOA 1XLAA 3N2MA 3GZ3A 1AMYA 1V6VA 1GKPA 1P7TB 4E4FA 4OJYA 1OF8A 3ZMRA 2DW7A 1TMLA 2VC5A 2AGKA 4TXEA 2GUUA 4NJHA 1R47A 1TWDA 2WJDA 3RRAA 2PDCA 1PVNA 1RLDA 1CZ1A 4LOCA 4WSJA 5A69A 4J7RA 3N29A 3AIEA 3GNNA 1ZAIA 4JKKA 2D0FA 2NT1A 2OQHA 4XD3A 4QG6A 3GBDA 2PMQA 3R0KA 1HL2A 1O12A 4UWMA 3MKVA 1WOAA 2ISVA 1VYSX 2W79A 4M7TA 2YL8A 3T07A 4Q4SA 1POJA 2FFCA 3AQUA 3LA4A 4M19A 4C6KA 4WSKA 3CHFA 2Z00A 3SCVA 3DFNA 2ZUUA 2QW5A 1GTHA 3VDGA 1OC6A 1MRAA 4MZYA 3MI2A 4XWUA 2XIQA 4CCEA 2D22A 3WQ5A 5GQBA 3ZJ6A 4R7WA 3TKFA 4DZ5A 1SW3A 1RP9A 4MYXA 3BOLA 2W66A 2J74A 2VP8A 3WF3A 1PZ3A 2QAPA 4PMOA 1WBHA 4LAMA 3NIYA 4AH7A 1DJQA 3WLIA 3M5XA 3NQVA 5T9BG 1NWRA 4XG1A 5G1TA 3BE7A 3W53A 3WNNA 1AQHA 1SVDA 2QCCA 3W7DA 1C91A 1R0MA 4HMDA 5ECVA 4TX6A 4P7RA 2YZ5A 3FJ6A 3PNZA 3GH7A 4HK7A 2FTYA 1OYAA 1Q7MA 3LHTA 2GPTA 1CBGA 4D6IA 2QUTA 3V1HA 4UTWC 3PZMA 4OBRA 3L4UA 1DXIA 3C0LA 5JBFA 1ISWA 2EJAA 3RO8A 1F2JA 5CZJA 1O60A 1OHLA 4GY0A 2ZRXA 2ACSA 1JDEA 3WH7A 2KAUC 4PZVA 2QGYA 3CEUA 2LLEA 4C7FA 3LG3A 4U5IA 4WKHA 4POCA 5TBOA 4A35A 1AFSA 4LF1A 1MXDA 3LMYA 3M46A 3EBVA 4MZ8A 2RDXA 3EWXA 1PL9A 1PX3A 3ITVA 2P10A 1F3TA 3OGSA 3CQ0A 5KSWA 2R91A 1KA9F 3BVJA 3N25A 3NGFA 4UC5A 2DIJA 4I9TA 4UQ9A 1V3JA 2CLKA 3S0CA 3DESA 4AG0A 1GYLA 2RKXA 3MMWA 4V1XA 3H2EA 4QE4A 4RNJA 6CGTA 4YS1A 3GIYA 4MYAA 1MEIA 1DP0A 1L6SA 2OQYA 1O7AA 1XWYA 3R7MA 4M3PA 3ORWA 3V0SA 4ZE5A 4MMWA 3U6WA 1NF0A 2VX6A 4U10A 5G4WA 3VMNA 2YBTA 1LYXA 4FR1A 4RZ4A 1JEZA 3ZLGA 3Q2DA 1H62A 1LF1A 1V3LA 3QQ0A 3L4XA 1VRDA 2XM2A 4AISA 1MMFA 3TOPA 5LNVA 1FCUA 1I2QA 1ISYA 4UTMA 4BQ2A 3VCCA 5M3WA 4ZB5A 1PKLA 3MYPA 1EH9A 4M24A 2VKZG 3VMPA 3E2RA 5DMMA 5AYZA 5L9FA 4TUFA 4MB4A 7ODCA 1GW1A 2DT0A 2DQWA 3VKKA 1L6WA 3EDKA 4JTAA 3GDKA 2X1RA 2P88A 2F2HA 2VUNA 2MANA 1GVSA 3E2SA 3H4WA 1S2VA 1QOPA 2QEZA 5D8WA 1QRQA 4Q6JA 1Z48A 5C9ZA 2CLMA 4S38A 5GJPA 2EPKX 2E9LA 5BCAA 4GPNA 5AFDA 4EIVA 5CJMA 1XLGA 1ZAJA 3REQA 1TCDA 2R9RA 1K4GA 1JZ4A 2B4GA 1YW1A 4IGNA 3DG7A 1UPMB 2UWFA 4IX2A 2TPSA 3ZXWA 3GNOA 2P8CA 3TX9A 5ABHA 4ML4A 3ZVHB 3UG4A 4AW7A 1UKQA 4JL1A 3LHVA 3W1UA 1Q8AA 4M1BA 2E68A 3BLLA 1F74A 4FHAA 5BU9A 2VR5A 1T7LA 1XPYA 1FBAA 3W2UA 4S39A 3W6MA 4IL0A 4IGMA 1TX0A 4IP4A 4CD4A 3N3MA 1RPKA 5C9UA 3N04A 4H8NA 3PZQA 2BB0A 3TYZA 1SFJA 1BXBA 4MAZA 2G4FA 1V6XA 3VZYA 2Y7FA 4JEJA 3W02A 3WQDA 3KBWA 1N8IA 4QRNA 1UWUA 4HNTA 3EMZA 1CGWA 1YTDA 1T40A 4JICA 3BSHA 4NXSA 5FF3A 2D23A 2RJGA 2JGYA 4HZ6A 5FF7A 4DJFC 1V02A 2UBPC 3H53A 4LXFA 3AALA 1A4LA 1P0NA 2HBXA 3PJWA 4JQ1A 3RX4A 4YVXA 2YR1A 4WDXA 3OQ8A 3GFZA 5CXPA 2GJPA 2ZX9A 2FVMA 1QI5A 1OX5A 2UZ9A 4PH6A 4DJDD 4AXKA 2DH3A 5AHLA 5LNUA 3M0LA 2YFNA 4XQ6A 4RDYA 2PB1A 3VIHA 2F2KA 4EPEC 4QLJA 3EMCA 4Y96A 4H4IA 4MB5A 2J7CA 3OVPA 4U33A 1W9UA 1FH8A 3A9IA 4D6FA 2CBIA 3TTYA 5C6MA 2A3BA 2WVTA 2OX1A 2QDEA 5ABTA 3W2KA 4O53A 3QY7A 2F9RA 3GY1A 5I79A 1XSJA 3BCJA 3C2YA 3P7YA 2GQ9A 3IJ7A 2XISA 4B3KA 1Q6FA 2OLHA 1JJKA 1ICQA 1F6PA 1UZHA 3HPSA 3N6HA 5FKYA 3I6TA 4CGTA 1DJWA 1DKWA 1PTGA 1S1RA 3B9OA 3BLDA 1K7EA 4PN2A 2HROA 5T9CE 1W32A 3AMCA 4FO4A 2OSWA 3B9DA 1K6AA 1UKOA 1HJVA 3IUDA 5FF0A 1TB3A 4GYPA 3QSTA 3FLUA 2Y8UA 2Z6IA 3CQKA 4WEVX 2G3NA 5LIKX 4CNUA 2DQXA 3BJSA 4Z1CA 1FWHC 2CHRA 3E38A 3UR5A 4LSBA 6REQB 3UPMA 2I16A 2ZRWA 3CHDA 3KDOA 2WC7A 4JEQA 2WMKA 1A47A 1N8FA 4HNLA 1YYAA 1YLVA 3WH9A 1RR2A 4V27A 5CAKA 1TE6A 1UZ4A 2IPGA 3K8KA 2A5HA 1OGSA 4O1CA 1HUVA 3CQJA 3PANA 2D2HA 1XGEA 4W7WA 5EMLA 3GBEA 3KVJA 3V35A 2E5CA 4LTSA 1KR1A 3S4TA 4UR7A 5GJMA 3GH5A 3VOIA 4L1GA 3QSRA 2G3FA 5A95A 3RFAA 3IJQA 4LNYA 1SGJA 3R0UA 4DJDA 4QTGA 4IGSA 2F6UA 5I06A 3PZ9A 2FH8A 4X63A 3MCNA 2PTWA 5G2IA 2Z25A 3GUGA 4MDOA 4AY1A 1AJ2A 2J8GA 5CH9A 1EZWA 1O4UA 4HPHA 3KE0A 3DAQA 4G6CA 1ZBWA 3RJYA 1HKIA 1W3NA 3CPGA 3STCA 3PPGA 4GOAA 3W2NA 1YNQA 4PTMA 5KZMA 4LUTB 3S5ZA 4NJJA 3U2OA 3ZLHA 2A3LA 3WQVA 3LRLA 2E67A 2VZVA 1LBFA 4WF7A 3M5VA 4RE2A 5I2UA 3JRKA 1DTNA 2A6NA 1JPIA 2O55A 3ZR4A 4A22A 3CYJA 1E70M 1NH6A 2Z24A 4DYEA 5FJIA 3UWEA 4UB9A 1J2WA 4QBXA 1GG1A 3P84A 1UWQA 5F2GA 2SFPA 2BVDA 2PDHA 4AHPA 4PTXA 3IEBA 2OKOA 4UTLA 2X0SA 3BWWA 6ALDA 2CITA 3UR2A 4GZ7A 3S5OA 1KBIA 2QMJA 3MP5A 5LA1A 4RPQA 4AUBA 2OR2A 1WDWA 1HG3A 4AMCA 1M68A 2G95A 1CXLA 3LD5A 3BICA 1YNPA 1S2WA 3GHSA 1UR8A 1Q13A 1DJYA 3CHVA 3SFWA 3B05A 5REQB 2RH9A 4IX0A 3GG8A 1HGYA 3O8AA 1SFSA 3D46A 1IIHA 4G8TA 3PB2A 4IZGA 2OLSA 4MWAD 4O19A 2MNRA 1LLOA 3KBJA 1SSGA 1O5QA 4UQDA 3W01A 3AHYA 3FSTA 4D1JA 3NPXA 2DVUA 3DHPA 2WNZA 3TAKA 3WF0A 1BKHA 3ANVA 3RYSA 3AIUA 1EP2A 3UG8A 4DWDA 1V6UA 2WK2A 5BRBA 3GG7A 3WLTA 3PTQA 3WQFA 3S6DA 3R94A 4W9TA 1UQYA 3PWGA 4LYPA 5K9XA 4L9ZA 1OCQA 2OO6A 4PRRA 4JIQA 4DO5A 4JYFA 3ARRA 2I56A 3SRKA 2RJHA 4JIIX 1HKWA 5DXXA 2TAAA 4Y9MA 3F1QA 1SW7A 4ZE4A 4LS2A 4L4OA 3NYDA 3LSCA 2Z1SA 4PUKA 1CXFA 1JDDA 1H0IA 2BNJA 2AKMA 5H8MA 1XBXA 2WPGA 1JQXA 4GYPC 4PB5A 5LXXA 4PEKA 1SM9A 5HUPA 4IMGA 3S2MA 5FEXA 4YTTA 4CD7A 2CZFA 3GS6A 2DZVA 2I5IA 1WBJA 4F0LA 2Z2AA 1WZKA 4J3WA 1KM3A 3TK7A 4PMNA 4LRTA 3UR8A 1TMQA 2NX1A 1OFAA 3C2VA 3OBEA 4I7UA 4CD8A 4ZL1A 3OODA 4E2VA 1TPEA 1I2OA 1T0OA 3UNTA 5AHFA 3F4VA 1H63A 3GAYA 1XIMA 3U7BA 3VOFA 4QFUA 1E51A 2V2HA 3BLOA 3ZSTA 1EGZA 1QAPA 2YCLA 3AXHA 1UYQA 2NQLA 4QITA 2CLLA 2O7SA 3I3EA 4XD5A 2V3FA 1XCWA 5DELA 3JU2A 5AYIA 4MWAA 3W76A 3WMSA 2DH2A 1REQB 1M03A 4DLMA 1PAMA 4NXKA 4M81A 2FZ9A 3RXZA 1W1A1 1NDVA 3QM3A 1X38A 4D9PA 4ENLA 2Q3OA 2WNNA 1XBZA 3GFXA 4B15A 3T9PA 1OM0A 3W1QA 3CZGA 4ZFMA 2BXYA 2Q8XA 1PKYA 2FMOA 4PB4A 2BY1A 2I9UA 1UJPA 2OEKA 2VZSA 3OYXA 4LUSB 3GR4A 3P61A 1EDTA 1FHLA 4YVVA 4PMYA 5FOOA 1PX4A 3EWCA 1VD6A 3NQ2A 1I75A 3GNDA 1S5VA 1KLZA 3ARUA 3R79A 5M1TA 3SSZA 1K4HA 3TA9A 3OVGA 4YXGA 3SCNA 3UXKA 3WQEA 1UD8A 2QIWA 1B3VA 3AJXA 4JFUA 2ZKMX 1U5VA 4TR9A 3CXOA 3OO2A 1YXYA 4DJEC 2PF0A 4AHQA 3FJLA 1S1PA 5HUOA 4AIBA 2XFRA 4KESA 4MPKA 3EDJA 2GGEA 5EGRA 1GOWA 1QW8A 2E1DA 3SAZA 1ONRA 3AISA 1ITQA 1AZ2A 1UB3A 1V7AA 1TJ1A 2WZTA 4GUGA 1XBYA 2GVGA 3B3DA 2Y2WA 4LVFA 2EG6A 4HYWA 4CNSA 3M6YA 4R9XA 4FLOA 1XLJA 2FB2A 4ZO6A 1UR4A 4GUHA 3MDWA 4YTSA 3WLQA 4XX6A 2NWRA 4GYJA 2AGTA 3THUA 4QISA 3IVTA 2ZC1A 1NF7A 7TIMA 4LAOA 6PTDA 3KL3A 1LL6A 1P1MA 3H2MA 3OZYA 1R46A 3AXIA 3QF0A 1T8QA 3WK2A 4LEFA 1D3GA 4GX8A 1SFLA 1GOIA 3E96A 3G3MA 2OELA 3MO4A 3TIMA 4CVWA 1J4EA 2BMBA 6ENLA 4ZQOA 4ZGYA 4Q7NA 4K3ZA 3WL1A 3PFRA 4H6QA 3WZ0E 2Z1XA 3CL8A 1WA3A 4NJKA 4UTIA 3DKJA 3TQKA 3W22A 1NIUA 4FLQA 3UG3A 3S9YA 1RSCA 1TV4A 2QDDA 4I9JA 1G1YA 3SQSA 4RPPA 4WGXA 5CGTA 3WYZA 3VFLA 1KWGA 2IXVA 4K7YA 1I8JA 1YDVA 4NSBA 3RO6A 4C6CA 4PCTA 3VNMA 3FVDA 3WNKA 3WJXA 4DWSD 3MHUA 1ODUA 1OSEA 4G7FA 3MYOA 2OYLA 5TF0A 4P8WA 3ICJA 3IK2A 3SECA 1KXHA 2CBUA 4PFHA 2HXTA 3QY6A 3IACA 3A4AA 3YPIA 1A5MC 2O9TA 3H7UA 3V5CA 2F38A 3TJ4A 3H24A 1IT7A 3A5FA 2FH6A 3P62A 2PZNA 2QPSA 3CUFA 3KCLA 1SW0A 1XINA 4X9SA 4YIWA 4HP5A 1CENA 3L4VA 4D6HA 4M0XA 4UCGA 2Y8VA 3BJTA 1DJZA 1TWSA 1W8SA 4XZNX 2J7GA 3E1F1 4XKMA 3WF1A 3WEOA 1LQ0A 3NQCA 4LCRA 1WX0A 2J75A 4LB4A 1LBLA 2DIEA 1OFEA 1SZGA 1FWDC 1KR0A 1BXNA 1PUDA 1P4CA 3NDOA 2FDSA 2PWFA 5AKQA 5CJNA 1HVQA 4IJBA 5HDRA 5I77A 1RQBA 3SCUA 3BO9A 1TKKA 2ZVRA 3W7QA 4PTVA 5JU6A 3RLUA 3VGHA 3F4CA 2Y5JA 3HV8A 2WM1A 3R2GA 4E0CA 2NVAA 3T4WA 1Q6DA 3XISA 2ZE3A 4UQEA 2IS7A 3KLLA 4Z2HA 4AY7A 4UQBA 3CBWA 3WQ8A 1N82A 5BOEA 3WQCA 2A1YA 3A6OA 3URNA 2OX4A 1W54A 3RPMA 2H9AA 3W82A 2PDIA 1Q4WA 3W7GA 3PZVA 3VD5A 1JCNA 1EJTC 3WBWA 3S5YA 1OD0A 2ATMA 4DWSA 3S5NA 2WANA 4L7ZA 4ZSTA 3SSJA 1VEOA 2E5BA 1TWWA 3XIMA 4JTRA 1KB3A 3KOZA 3HTWA 3GIQA 1TG7A 4PUJA 3W27A 3E3HA 3E2VA 2V30A 4J28A 3VIFA 5CPSA 3BAYA 4OVXA 2VVNA 3H70A 2OZ8A 2YW4A 8CGTA 3RLGA 1AL8A 1W17A 3F5JA 3DI1A 5C2GA 3LI1A 3BLIA 1L6YA 3U4FA 1RZMA 3NR0A 3VYLA 1XC4A 1VF8A 4KCUA 1VFSA 1U83A 3OIHA 1Z41A 3C86A 3HBLA 2OLAA 3K5XA 3AIRA 1EBHA 2DUXA 1RJRA 2XWEA 4LJ3A 3W7NA 3LLFA 4HMCA 1M01A 1V79A 3MQTA 3ZWTA 3M64A 4PUUA 2G96A 5H8UA 3SR7A 3WX7A 1GQJA 4HNCA 1ZTVA 4D1IA 3GU9A 3ZLFA 4BCEA 5BWFA 5DY2A 1WZAA 4LFYA 3G6MA 1UR1A 1OZMA 4DUXA 1OWQA 3KL0A 3B4YA 1M53A 1UQZA 1W3TA 3IGUA 1JL8A 4RW3A 3F2BA 3NGJA 3DHDA 1K1DA 1UD3A 4O0QA 4WJXA 4P2VA 3VZXA 5MKGA 4HCHA 1KBKA 3QQ1A 3MUCA 3G1RA 3M9YA 3ELFA 3I7RA 1Z7AA 1GOKA 4IIFA 5HPCA 4A21A 1JAKA 5CJ5A 4GIYA 4JNMA 2YA1A 3TSBA 5A8PA 4DF2A 2XSAA 2G0WA 3BZGA 3CPUA 4K8GA 4DELA 4XSMA 3A9BA 4J2PA 2AMXA 3H4GA 3ES8A 2W0UA 2Z28A 3B97A 3N9SA 4UNLA 4JD4A 3B0UX 1O95A 1A3HA 5DXYA 3ABRA 1WOBA 3ZR5A 1R87A 3QLDA 1WKDA 3N2TA 4QEHA 3UERA 1EUAA 4U5KA 3VKCA 4B9YA 3LNMA 3FA3A 2YOCA 5D37A 3BAXA 4DM1A 2YCEA 4W8LA 3HOJA 2A3CA 3OZOA 2WMFA 5SWUA 3SIMA 2C0AA 4ASTA 3OP2A 3OEXA 4AC1X 5K9CA 3W83A 5AY7A 2VENA 3VZZA 4FF7A 2VM8A 1XIHA 2QKFA 4R5EA 1W5QA 2WSYA 2DGAA 3NWRA 1XRVA 1BYAA 1HZYA 2VEFA 1ZJBA 2WMJA 4F3HA 5IOBA 1IIGA 2BZNA 2XM1A 3LLDA 3NZ1A 5FSEC 4IIHA 1QI0A 4BFAA 2TYSA 4LUIA 3VA8A 4DPPA 4H9VA 5DBTA 4HNNA 1R7AA 1I45A 4R33A 2PTDA 3V0TA 3U5UA 2E5DA 3MC5A 3EEZA 4RE0A 1E6PA 2X09A 2DZUA 3GKAA 3VDAA 2XG9A 2XN1A 1OFQA 1O5RA 1V6YA 4QG9A 4UTTC 3HGRA 1DWAM 1XDMA 4H9XA 4ZO9A 2QLYA 2VJXA 3ZVIA 3Q37A 4EXAA 4I9AA 4BY3A 1D8CA 1R8LA 3R25A 3AWOA 2NUXA 3NFUA 2OFJA 2ZXAA 3LTYA 4RLIA 4GUJA 1JZ3A 1KQZA 3M0HA 1MUMA 2YIHA 1X8CA 2PP0A 3UBPC 4I3GA 4ZZ9A 1E1EA 1C8XA 3ZIZA 1Q85A 1SSDA 3WO8A 2PWEA 2VVSA 3ITLA 4B5WA 3L5LA 3PZOA 2WVVA 3B9EA 1MUWA 5A6JA 3OHIA 1Y5WA 4O0ZA 1V0LA 1AG1O 1JD7A 1D2KA 1VEMA 1A5CA 2FHFA 4XBJA 4UOJA 2C91A 2WYSA 3EWDA 3WUGA 4B5SA 4GD0A 3C2OA 2JEPA 4C6LA 1ALDA 4MOZA 2YCJA 5BXSA 3ZJKA 2Y0FA 2X30A 5D9PA 4HNUA 4UOZA 2GK1A 4GHRA 3IIOA 1C93A 2OZ0A 1B3YA 4QR6A 3C5QA 1B57A 1UBPC 1XSKA 2HSAA 5GNXA 5FESA 4Y90A 2Z6JA 4Y8EA 4I7VA 4FALA 3WUFA 3IGXA 3VOGA 4IIEA 3NZPA 4Z1DA 3D0CA 2P53A 5A6SA 3TLQA 3THDA 4RX0A 3KBSA 3M43A 1DORA 2OPJA 1TPH1 3PJUA 1VBRA 3U48A 4YTQA 1Q2RA 3K30A 3P5YA 1EDQA 4EAYA 3PZTA 4DLFA 3BV7A 3M1ZA 3U3HA 1IXOA 1EBGA 4GQBA 4GQRA 2OQLA 4IFOA 1EJVC 4KPLA 4FB7A 1WXYA 3KAOA 4KFPA 5F1VA 1RAKA 3CLMA 3TMQA 1LG2A 5BROA 5KTLA 2WCGA 3PULA 1LLWA 3C8FA 1DJNA 3VK5A 2NSXA 4Q4KA 3VC6A 2XH4A 1FH7A 1VJZA 1HO1A 4HPJA 1GKRA 1ZCOA 3GH4A 3VIIA 4JNZA 1NDZA 1GVOA 1VLWA 3SJNA 1OGBA 4QHRA 4DVOA 2PDGA 3L67A 4BKNA 4QCEA 1TCMA 2PGWA 1MZRA 1HP4A 1I2NA 3UW6A 2BBFA 1JPHA 1LWJA 1FDJA 1QWGA 5DMNA 4CNOA 1QNRA 2Q8ZA 3EKZA 2QIIA 4GK8A 1OC5A 4AD2A 1E6RA 3WLJA 2XVKA 3WBAA 1QNSA 4B91A 3GHUA 2FTPA 5B80A 2UY5A 1XL9A 3KLKA 4JTCA 3W81A 3BTNA 1TREA 1YNYA 1FHUA 1M5WA 1Q3NA 5CZTA 1BGGA 3R8HA 5ECUA 3GDRA 4D6GA 1QNQA 9CGTA 5DCEA 3CZ8A 3EXTA 4DJED 3LGEA 2I17A 1FWNA 4XISA 3I3DA 3W75A 1E43A 3GLCA 2JE8A 5A8QA 5C2XA 2DSUA 5CZSA 2CFFA 1UH4A 3W2JA 1TV2A 3OG3A 5C9WA 4LQ1A 1FWRA 3R8RA 4OE7A 3UWQA 1P7TA 3AFBA 1FVPA 4HB7A 1OVDA 5J5DA 2QCEA 2X8RA 1CXKA 1TTJA 3CV2A 3TN4A 1ONEA 4I5XA 3AYTA 2DZWA 3PWAA 4TOQA 3TC6A 3T8QA 4CQAA 3GTIA 1PCWA 3QBUA 4G56A 4XZHA 3LN3A 3T1GA 5A6TC 5T91A 4L4LA 3W24A 4QE5A 4BWLA 1DBTA 2QUMA 5CBJA 3RHGA 4WDTA 2QJNA 4YHGA 5K4XA 3L2LA 3WUEA 5C71A 3RM8A 3L9CA 5AYXA 4WOQA 3CO4A 1P1XA 3M7SA 2P1FA 2NQZA 3UD6A 3T05A 1F07A 3KOXA 4S3FA 3S83A 1EX5A 3VNDA 3S1GA 3NVTA 5A6KA 1A5BA 3M0KA 3T6CA 4FNQA 2ZX8A 4PUEA 2WKGA 2VFGA 2HS8A 4QX4A 2R8WA 3SCTA 2A79A 3MU7A 3GTFA 3PTKA 5HR6A 3VKJA 2YSWA 3M44A 3UYCA 1BVNP 5CEWA 3QKEA 3BOFA 3AXXA 4HZMA 3N11A 1CLXA 3BDKA 3W07A 4NZ3A 3CAKA 1YQ2A 3EAUA 2Q09A 4RUBA 1Q6LA 1JCLA 3NEVA 1WUEA 3URBA 3RF9A 3VD4A 3SUSA 4BF5A 4M1RA 1EJUC 1PIFA 2NXIA 3EB4A 1KKRA 2YJQA 4DPQA 2VMFA 3FEQA 2XH7A 4IFKB 1QPOA 2Z1VA 5HR7A 1T41A 3NURA 4RDWA 1KRCC 1ONXA 1VCGA 2JIWA 4GVFA 5A3HA 2A3HA 4DM2A 3SGZA 2AKZA 4IG2B 2BTMA 5XIAA 1R86A 4JDBA 4YTUA 4H9ZA 4WOZA 1RJPA 3GSMA 4QQUA 4LRSA 3PG9A 4A29A 1GONA 4KT2A 2F84A 2VRKA 4IP5A 1NFPA 2EJ1A 2Y88A 4GC3A 4FNUA 4K38A 1UUMA 3LY0A 3GG0A 4H00A 1GVQA 1ZENA 2B81A 4DXXA 4F0KA 3VNIA 4JKMA 1IZJA 5E0CA 1OG6A 2ZBTA 1XSIA 2PDJA 3GXFA 5FACA 1W37A 3W1TA 2JEQA 1KNWA 3LDVA 2Z29A 1YPIA 2VI0A 3M0JA 1J0IA 3T40A 4UTJA 3U9IA 3FIGA 4MNMA 2DVXA 4W89A 3AC0A 3TV8A 4MJZA 2Y8KA 3ITOA 4NNCA 3QR1A 1N7KA 2FIQA 1O1HA 1WYIA 1EDGA 1FWFC 5BZAA 3GVVA 1GHRA 3MKCA 1BG4A 3O1NA 3VIPA 3R8GA 1HNYA 4KIEA 1J10A 3PM6A 1T99A 2BY0A 1DEDA 1K9FA 3FEMA 2AQVA 4J3TA 4O12A 3F03K 4OT7A 4L9YA 2E77A 2EPHA 2Y85A 5D03A 1YDYA 2D0GA 3FX4A 3PG8A 3QN3A 5D2TA 3RX3A 1VYPX 1VGAA 2JKEA 3NM1A 3HQNA 1E6ZA 4RK8A 1R6WA 4W4QA 3RITA 3AYRA 1DE5A 2YYTA 2O9RA 3L5MA 1X7IA 3POHA 5LZLA 1M04A 5DRIA 4UXDA 1W5PA 3S1WA 5FIPA 1FXPA 3LBOA 4PCFA 1XLKA 3M6DA 1G94A 3GNRA 1ZBKA 4JHOA 3L4ZA 4JX5A 1TUXA 3WLRA 4AVOA 1FP9A 3QW3A 3SUTA 4W87A 4KRZA 4M6PA 4OZOA 1A50A 1G69A 4FEZA 4HTBA 2H6RA 4FI4A 5KZEA 5JXQA 2YGYA 4IIBA 1CWYA 1NY1A 1GEQA 3S9ZA 1TA3B 3ZOAA 3VKAA 1KTCA 1UD6A 3APYA 2R1NA 3MMUA 1WAUA 2Q02A 3MKKA 3W74A 2GQAA 2RFGA 3B0PA 4A4AA 3CAQA 3PUGA 4AWEA 4E2DA 2NV1A 3SY8A 3C4UA 1U5HA 2AQWA 3MVTA 4G1NA 5KITA 1NM9A 1LCOA 3FGCA 1XGZA 3NQ6A 1NAL1 2DT1A 3V3WA 1Q5MA 4JDYA 3QFEA 3T09A 1LOQA 1BPLB 2YXGA 2WCAA 4PR4A 3MBDA 3O0KA 1FWIC 4XZLX 1QTWA 2G5WA 5FSDC 1TV3A 1L2UA 5FJTA 3RM4A 5FJRA 3WK1A 4NZFA 1B3XA 1TV7A 3GB6A 3C0JA 5EFDA 3U8GA 1R2SA 5HJYA 3TOYA 3P0XA 1WKEA 1ZY9A 3HMJG 4NILA 1SO3A 4LY8A 5K4ZA 3T2PA 1EX1A 1ADOA 4EXBA 5AZ1A 4C6FA 2DZSA 4P61A 2VR4A 5H6HA 5GNZA 3KOYA 2PA6A 2QZRA 4C6IA 4LNCA 3SY1A 4OOUA 3QJAA 2V38A 3GR7A 4JYDA 4FSAA 1V0NA 2P0IA 1UR9A 2J62A 3H21A 3WK3A 2ZWYA 1QHOA 4TX9A 1UUQA 3M0XA 2WJEA 3N9KA 3B0XA 3LM7A 5FCZA 2O4MA 3PZGA 4KEVA 1G0CA 3LERA 3G77A 2D2JA 2BGQA 1KM0A 1VC4A 3A5VA 2C16A 3CH0A 3WMBA 3G0SA 4O1EA 1EHNA 2VX5A 4PTDA 4S3GA 4HYVA 1KGUA 3GTXA 3HZ3A 3JW7A 1E4IA 3VE7A 1FH9A 5LIWX 3S1XA 1PIGA 1ENUA 3UJFA 3MUY1 3GNPA 4I8DA 3O06A 1RK6A 1R38A 3UESA 1ZNNA 4E3TA 3A3XA 4MUZA 4LUJA 3W7PA