2VWTA

Crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12 - mg-pyruvate product complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
MNALLSNPFKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQRIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDTMLYSDALDQRLAMFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure and Functional Assignment of Yfau, a Metal Ion Dependent Class II Aldolase from Escherichia Coli K12.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
molecule keywords YFAU, 2-KETO-3-DEOXY SUGAR ALDOLASE
total genus 90
structure length 256
sequence length 256
chains with identical sequence B, C
ec nomenclature ec 4.1.2.53: 2-keto-3-deoxy-L-rhamnonate aldolase.
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2vwtA00
3FA3A 4HYVA 4KCWA 4B5SA 1PKLA 3KHDA 4JPGA 4B5WA 3H6OA 3SRKA 3VAVA 4L80A 3M0JA 4IQDA 4L7ZA 1S2WA 4TV6A 3QV6A 1F8MA 1PKYA 1PKMA 1XG4A 2G50A 4FXFA 3E0VA 4WJ8A 2WQDA 2VGIA 4QGCA 3QV8A 4IMAA 3HQOA 1GGOA 2OLSA 3N25A 1PKNA 3QLLA 3P0XA 3BJTA 4KCVA 4L9ZA 3FA4A 1E0TA 1O68A 3EOEA 3EOLA 1M1BA 4B5XA 4LSBA 2XDFA 1KBLA 2V5KA 1SGJA 2XZ9A 3M0KA 1E0UA 4B5UA 1T5AA 2XZ7A 3HQNA 3OYXA 2X0SA 1DIKA 3E5BA 3HQPA 2L5HA 1ZLPA 4ROQA 1S2UA 4MG4A 1DXEA 4YNGA 4KRZA 3SRDA 4G1NA 1U5HA 3LYEA 4MF4A 3IS4A 1VBHA 3E0WA 1F61A 2HROA 2R82A 4L9YA 1DXFA 1A3WA 1F3XA 1KC7A 2VWSA 1AQFA 1F8IA 4YJ5A 4KCUA 4B2DA 1Z6KA 4DRSA 1OQFA 2DIKA 2HJPA 4RPPA 3T0TA 1O5QA 2KX9A 2E28A 3OQ8A 5TAOA 3U2ZA 1UJQA 4B5VA 1DQUA 3QV7A 1XG3A 3R4IA 3BJFA 2VWTA 4IP7A 2BG5A 3GQYA 3PP7A 2VGGA 3GR4A 2V5JA 1IZCA 1VBGA 2VGFA 1PYMA 1M3UA 2ZE3A 2DUAA 4KS0A 4IQEA 4KCTA 3GG8A 3QZ6A 1A3XA 3B8IA 4QG6A 4QG9A 4TV5A 3T05A 3OYZA 3G2GA 4HYWA 1F3WA 3SRFA 1A49A 1S2TA 1U5VA 3I4EA 3T07A 1ZJHA 4B5TA 1A5UA 1IGWA 3QTGA 4FXJA 3QQWA 1JDEA 3SRHA 3LG3A 4QG8A 4B2DD 5JVLA 2HRWA 2VGBA 1MUMA 1OY0A 3PUGA 3MA8A 1S2VA 3EZ4A 1O66A 3QV9A 2HWGA 3KTXA 3EOOA 3ME3A 2QIWA
chains in the Genus database with same CATH superfamily
3PJXA 3T0CA 6CGTA 5IOBA 1K8YA 4QBXA 2WZEA 3CEUA 2YB4A 1LL4A 4GX8A 2VX7A 3FEQA 4W7WA 4AZHA 4G8TA 3OIXA 3LI0A 2PRMA 3VUSA 5BOOA 3LBCA 3W3OA 2OVLA 3HM7A 4WK9A 1WA3A 1MW1A 1GTHA 1QI2A 4M5PA 4HNLA 3H7UA 1DWAM 1QPNA 3QBUA 4INFA 5LIYX 2G3JA 3M0MA 4DWSD 3P5YA 4XZMX 3EWBX 1D9EA 3WNPA 4IJBA 3N3TA 3TSBA 4IP4A 1GVEA 3NQBA 3AU6A 1F6PA 3IAQA 3MWAA 4NAEB 3DN5A 1JGMA 1UWSA 3MUIA 4P2VA 4WGHA 3WX7A 2EPMX 4UCGA 3UR7A 1ISWA 1XDJA 2C7FA 4CNUA 1OD0A 2AGKA 2Z29A 2TYSA 3MUZ1 4US5A 1EIBA 2A3CA 3F2BA 4R34A 3PTDA 3M5XA 4HT3A 4P8WA 5JU6A 1VC4A 5F2IA 3GU1A 3FK4A 5DCEA 4A8NA 1AD1A 2ZX6A 3FEMA 5FIPA 5TIMA 3T09A 3L5LA 3DBNA 4FS9A 1OFAA 4NXKA 3LEPA 1NWSA 1XSKA 1POKA 1SZRA 4CD7A 2XWDA 2AL2A 4YVVA 4NXSA 1JJKA 1ZGDA 4AC7C 1PKNA 4JTSA 1HG3A 1E6QM 1N8FA 1D3CA 1K7EA 3IEBA 1DWHM 1XRVA 1KV5A 3QW3A 3HPXA 5T26A 3NQMA 2QVHA 4G56A 1LRTA 1OC6A 3RX3A 1JCTA 3OIHA 3R79A 4MYXA 5I78A 1OSEA 3J7HA 3QY8A 1QO5A 1FWAC 2FZDA 4ADUA 2FHFA 3KS5A 2R94A 2QJIA 4REQB 1CXFA 4MYAA 3QXBA 3KLLA 4A3RA 3HV9A 2TPSA 4O15A 3PZGA 4WIWA 2GJNA 4TV5A 3G2GA 4YS1A 4XZLX 3N18A 1XLJA 1EC8A 2ANUA 3MP3A 2VCAA 3VIFA 2KZHA 3OB8A 4AZIA 3W9ZA 3ZR6A 4ATLA 3SRHA 4YPJA 2D0FA 2CBJA 3NM3A 4TVCA 3AS1A 4F9DA 2FGZA 3OBAA 3HPAA 3QLDA 4G5DA 4PSRA 3H23A 2EPKX 3TYDA 3MY9A 4AFYA 3UZ5A 3Q94A 3EMCA 3PB0A 5D30A 1HVXA 3UG4A 1KO0A 3LD5A 1VPXA 1UZ1A 2J62A 1E5NA 4IPJA 4E2VA 1CLXA 3EX4A 3LLDA 5I3DA 1DEDA 1HKIA 1XRFA 3UD6A 2O9PA 1VR6A 3K30A 3CB3A 3HFYA 4FHAA 4PRTA 3QC3A 5KSWA 1XIEA 5BWAA 4ZR8A 1CXLA 3GIQA 1XS2A 1IEVA 1OJXA 5IDIA 1W9DM 4F79A 4Y8EA 3AC0A 3T78A 1QBBA 4UBPC 5K9XA 1RQEA 4L6DA 3KW3A 5GNYA 5C0QA 2REQB 1P0EA 4AG0A 4POCA 4K36A 1V77A 1KQZA 3MANA 1XBVA 1EWEA 3BGAA 3QMTA 1UPMB 3ABZA 3ES7A 3TOPA 2BOGX 2CBVA 5E6YA 5E9AA 4WR3A 1PIGA 3O06A 3GTHA 3DHPA 1DVJA 3GXIA 2GJLA 3IANA 4PFMA 1QOQA 3ATZA 1G0CA 3QHMA 1TQXA 2D1ZA 3BSMA 2QW5A 4OOZA 2W61A 3BL3A 4M6UA 2VL4A 5EY5A 3CQJA 5C5YA 2OQLA 1P4CA 2X16A 4ACZB 1B9BA 1PZ0A 4HNCA 3OW1A 4D1JA 5CJNA 1HP4A 1UBPC 1IT8A 5DO8A 4JTFA 5TNVA 4CQDA 3SM0A 2J25A 3GFZA 3QZAA 4PCSA 4R88A 2OGJA 5I6SA 4ZQPA 1ITUA 5LSMA 1EBHA 3ANUA 5I79A 4Q4PA 4NJHA 1R3QA 3ABOA 2WW5A 4JGDA 4AHPA 4NRRA 3AMGA 3TLLA 3N34A 3TAKA 1J0KA 2X1TA 1T5AA 3E2RA 4XKYB 4N2YA 1TJ2A 2Y2WA 1NFPA 1K7FA 1W1PA 3LCXA 4ZXLA 3W82A 3WFZA 2ESCA 4IHCA 1AQFA 1BTMA 3L2MA 1FQ0A 4YIWA 1OYAA 3EXSA 4EOUA 1WUFA 3ATYA 5LA2A 4CQBA 2PBOA 3T2QA 3W84A 3I7RA 1ZBKA 1JFHA 1LZOA 3VKKA 4CNPA 2VM8A 3TE9A 4R3UA 2P0IA 3F4WA 3PULA 4A4AA 3N13A 2CIPA 2G8ZA 3BGGA 3WEMA 1QRQA 1A0CA 1H3GA 1R3VA 2J13A 3T6CA 5LKYA 1RCOB 4AWSA 2EG8A 2BVDA 5HK4A 2X2YA 3ARQA 2OWCA 2CLFA 3B03A 1VQTA 1U1JA 3E2SA 5A8QA 4TV6A 3THDA 2V69A 3WF2A 1KFLA 4IMCA 3OJGA 1IR2A 1UKPA 1N55A 4W5UA 1K9FA 4ZXOA 2BODX 4L9XA 4BF9A 5FEWA 4H9YA 4M56A 2ZDRA 3ITLA 3LXBA 1E4NA 3REQA 4FALA 4DUOA 2W9MA 3B06A 1V5XA 3APTA 1J5SA 3AMKA 2W79A 1DPMA 3EB4A 1H1NA 3S1WA 3TSDA 4O1BA 3BG5A 1Z89A 1Q63A 3WLKX 3QKEA 1E6NA 3G22A 1EC7A 3U4FA 3LCHA 2HK1A 3A24A 1TYGA 2Z6JA 2PTZA 2UY4A 5EBUA 8XIMA 5I7GA 3VNJA 3ZQ9A 3WK0A 5K4ZA 1IZCA 1TELA 2WHJA 3ITXA 2ZUTA 1UD6A 4RE4A 4H04A 1TZ9A 1QNVA 3TW6A 2XVLA 3UY7A 3MKCA 3CHDA 4LALA 3RLVA 4S23A 2CZDA 4QJ5B 1EO7A 5DMLA 3C0SA 1E1FA 4RL3A 4CKQA 4CUCA 4UQDA 3WZ0E 4NT0A 4OE7A 4LY8A 1NF0A 2O55A 4CQ9A 3RUBL 2CESA 4R27A 4TMCA 5A6MA 2W4XA 1J11A 1TWWA 3UG3A 3S5SA 4M82A 2DW7A 4R7OA 1TTQA 1Q6RA 1I0BA 4HTBA 4CNOA 3WBWA 1XGZA 3VGFA 3QM3A 1VPQA 1DIOA 2ZFAA 1X1OA 1WQ5A 4GY0A 4IG2B 4QIUA 2ZXDA 4RZ6A 3FDGA 5CSYA 2PI6A 4MB3A 5CC6A 3NCOA 4KCUA 5A6KA 4ZA0A 3P2VA 2X8RA 1RK5A 5D9PA 1XGDA 4EACA 3TTOA 4I9TA 3WDJA 1V02A 3LHZA 5C2XA 2BFGA 4YLWA 1YDYA 1NWUA 3TN4A 2Z00A 1B3OA 1V3JA 3CWNA 5FL0A 1XSIA 4ZE5A 3PBGA 3RO8A 3ZT6A 3L4VA 1R38A 1KNWA 3MB9A 1W54A 1XRSA 1ZZMA 3W6YA 2B4GA 4NG3A 4U4MA 3LHVA 1E55A 2V6AA 1TJ0A 4XBSA 4H4IA 1VFFA 3UPWA 3MVTA 3NEVA 1RLCL 4QGCA 1X39A 5IDZA 4XVEA 3IUIA 4Y9NA 2OSYA 4YTRA 5G2IA 4L7ZA 1R87A 5G2HA 2J6VA 1PTGA 5FJRA 1UP0A 3PWGA 1NY1A 3DZ1A 3VZXA 4QISA 1QW7A 1F07A 1E0TA 1LWHA 4UTWC 5I09A 3R13A 2R9RA 2RUSA 4LSBA 3T0BA 2I9EA 4BCEA 1W3KA 4X0NA 3UZYA 1OCBA 1ZBVA 1E73M 4JYDA 1G7UA 4KFNA 4ERIA 4B3KA 2ZZ3A 2FGLA 5HR6A 3WF1A 3GLCA 1HXJA 1UZ4A 3W7EA 3OHMB 3W75A 1XG3A 3CMGA 1JZ5A 1P6BA 1XIHA 5H6HA 4KWWA 3N4FA 1ZFJA 3PUOA 3QW4B 4PTNA 2GUBA 2HTMA 3W0KA 2FJUB 1W1VA 3M0ZA 2GUYA 1C7SA 4XWUA 1CNVA 1LL6A 3W72A 1IF2A 1OFQA 3ZYZA 2ISWA 5LYRA 1XYAA 4BWLA 1TIWA 4HK5A 1NTHA 4UQEA 4H01A 2WWDA 3QPZA 1XC4A 4NZJA 3CM4A 2V2HA 9XIAA 3HPZA 3CU2A 4V1XA 3USZA 3ID7A 1V0LA 5JQ9A 1E43A 3LOTA 1UC4A 3MBFA 4M6QA 3L65A 3LHYA 5ABFA 3OPSA 2RDXA 4Q4MA 1CB7B 4ZTXA 3NPVA 2XFFA 2OQHA 2PUZA 2D69A 1HUVA 4PMYA 4KMQA 1V4YA 4C1LA 4WDXA 1WAWA 2XDFA 4PUMA 3S5OA 2OQYA 1SFLA 3SSJA 3K46A 3QQ0A 4DJDC 2QJNA 3LCLA 4JYFA 2HISA 3PZMA 1JZ7A 2PTXA 4IUGA 3URNA 4GKLA 2R1NA 3BVJA 1CGUA 1QTWA 4C6OA 4BEQA 2VFDA 3W2UA 1Q6GA 3PTKA 2GZXA 4GQ0A 4IJRA 2C0HA 1G5AA 1TE1A 2GQ8A 2VC7A 1RAKA 4HA3A 4AIUA 1X7IA 1F3WA 4RE3A 2O7SA 3B8DA 1YNPA 3W7LA 2QUVA 4LV9A 3G77A 1ZUAX 3V5CA 2PC8A 1WKYA 4MADA 1WZMA 5D8ZA 1YE4A 2VFIA 5F1VA 3RFAA 1GCYA 4HKPA 2O9RA 3GVWA 2Z1VA 3GTXA 1XYBA 3E38A 3FFSA 1W3HA 4R9XA 4LWWA 3HGOA 5E0CA 3SY1A 1XL9A 4D2JA 4Q8WA 1RP9A 2QCGA 4JX4A 4QDPA 1V0MA 3RM4A 5EMUA 3N9KA 1LBLA 2XPKA 4M7SA 3L0NA 1K1DA 4XQ6A 7ODCA 1RHCA 3VKCA 4GUHA 3SR7A 1K8XA 3VUPA 2Y61A 3A9BA 3TQPA 4A2RA 1XFBA 3LPFA 3RR4A 3RXZA 1XPYA 3BW2A 4JTGA 3KUMA 3VDGA 2Q8XA 4JY8A 5LXEA 3ERPA 3AHZA 3UNTA 5LA1A 3GYEA 1D8CA 4B2DA 1YDNA 3S6TA 1UWAA 4AIBA 4P7OA 2JKAA 2CITA 2F9RA 2WHKA 3UGVA 4CQ8A 5KZDA 3KCLA 3DCPA 1I4NA 3RNDA 2B7PA 2YYUA 3IACA 3A64A 2VZSA 5LXXA 2J6XA 1XLFA 1XYLA 3G1RA 3CXOA 5HULA 5MKGA 3LHUA 1R3TA 3NM1A 4HSOA 4OTKA 2BHZA 3B8SA 1FDZA 4WZHA 4MJ2A 1C8YA 2ZDSA 4FEZA 1B90A 2CLHA 3GXTA 3QPEA 4HN4A 4Z0JA 3VDBA 3QTGA 2DU2A 1D7FA 1JQVA 2PDHA 2OFJA 3OG2A 2DZAA 2W0UA 3ARWA 4NVTA 3FVDA 2V3DA 3IJLA 4IIEA 1US3A 2GGHA 3GVRA 2ZICA 3GWQA 1SJCA 2BSLA 3WN6A 3TNOA 3LCWA 4CCDA 4ZB0A 3WMBA 2JKPA 5E09A 5CSRA 4KGLA 4JS3A 2NV9A 2Q71A 1Q6LA 4I7WA 3NOYA 1G01A 3Q67A 2OXNA 2GFTA 1H60A 2DFAA 1LQ0A 3MW7A 2VUNA 3QR3A 4RV8A 2XIQA 3VO0A 1MI3A 4K8EA 2HBVA 2R1PA 5FF2A 2ZZ7A 1C91A 2ZRYA 2BB0A 2OEJA 4TO8A 2YGYA 2BXZA 2Z1WA 3O9NA 2HZGA 3MHFA 4QSFA 4IFKA 2XVNA 4O12A 2BP1A 2YSWA 1V3HA 1GJUA 3TNBA 3BJFA 1BG4A 5ABEA 2VENA 1LDCA 3C0JA 2ACQA 3W1UA 3IGUA 1UR1A 5D09A 4YYCA 1JPKA 1EYEA 2SFPA 2VX5A 5BYWA 4K8HA 4M51A 1VB9A 1BQGA 5KEZA 1GEHA 3MI2A 3NG3A 1BAGA 3M9YA 3FCPA 3PJUA 4XO7A 1UWQA 4OBSA 2WVVA 1CXEA 3TYZA 3UJSA 3BE7A 1J01A 2GGEA 4QTGA 2FLIA 3QV9A 4PMUA 4HPGA 3B8WA 1V8EA 7XIMA 3LZ5A 3WNNA 4JOMA 4HNVA 1CWYA 2X05A 3DU0A 4LBRA 2ZRVA 1F8MA 3TR2A 4KESA 4HQVA 1PIIA 1HKWA 3CIWA 3VCNA 1LOSA 2MANA 2E68A 3G8EA 4P7LA 3P5ZA 4C1NB 3G0SA 4RZ5A 2E6FA 4K7VA 1WZKA 5D33A 3W7KA 1EGZA 5B7YA 4D1IA 4DXKA 2DZBA 5CCZA 1UR9A 4QAWA 3SB0A 2J9XA 5IBXA 1QASA 5M3WA 1O12A 4FNQA 4A3UA 1IIHA 1XW8A 2HXUA 4LRSA 1AH0A 2QYGA 1NDYA 3EKGA 4M0XA 2I7GA 4WX2A 1UBSA 3AZTA 4H6RA 1WDDA 4EPEC 2HVNA 1XH1A 4ORMA 3GNOA 3WIJA 1EP2A 4HHHA 3GZ3A 1JCMP 1H09A 5JUVA 3C2VA 3AS3A 1VFUA 1QW8A 1AL7A 3E12A 4IGMA 3ITOA 3VD7A 5JMUA 3ZT7A 2QCMA 2V2DA 1UD5A 1VJIA 1SQ7A 3QMRA 3S5NA 1VHNA 2OLHA 3N6QA 2BY0A 2VT0A 1GVIA 3WBAA 2R1KA 4LS2A 1HFBA 1LG1A 2PODA 1LROA 2DZUA 3OZYA 4MAVA 2HRWA 1XLKA 1YHTA 1R3RA 3N17A 3S42A 1DJHA 2WJFA 2VFGA 3KOWA 1ICQA 2DV0A 1DWFM 4NJIA 2BASA 4GXWA 2PGRA 2OZ0A 3CWOX 4NZ3A 2E9BA 3TC3A 3OVPA 1UIOA 3G18A 2JEPA 1HJQA 1LBFA 4LS1A 2OGYA 3CTTA 3BLKA 3L4ZA 5FJTA 1UHVA 1W32A 2AAMA 4JQ2A 3MO7A 1IE7C 4FXRA 4OGZA 3UR8A 2YL6A 1KQYA 8A3HA 4J3SA 3B3DA 3SUUA 5DCDA 4YN5A 3E6EA 3EX3A 2DDXA 1GZ1A 4MOZA 4UOQA 4KWSA 1YTDA 4WJEA 4U33A 1RCQA 3VFCA 2XFYA 4XZWA 4UXDA 4JX5A 5AHMA 3LM3A 1DJZA 1FX6A 3APYA 4TX6A 4TTUA 3EGJA 3PPCA 4QP0A 4PFHA 3M5ZA 2G3MA 5HQMA 4CN4A 4V27A 1CGXA 2WB5A 2RDWA 1EJVC 1HGWA 2XSAA 4Z1YA 3LRKA 5XIMA 5H8PA 4U3CA 4JCMA 4FI4A 3LGDA 4EP8C 2PTDA 3GR7A 4JHMA 1UYQA 1XLLA 3ZWTA 4AZGA 4D6GA 1WXYA 4QHRA 3LBMA 4HGXA 3T0AA 5A95A 4LQ1A 1JFXA 4AD0A 3UR2A 4UTHA 4PYSA 5FJPA 3TZFA 2X0YA 4LCRA 4ZTYA 3IJ6A 1AJ0A 2OSWA 5FCZA 3EMZA 4L80A 1WOBA 3JUGA 3ZZ1A 1SMAA 3HU7A 1S38A 3WBYA 4QR6A 3RLHA 3L9CA 3VIOA 5FL1A 2WXDM 4F4RA 3N3MA 4HMEA 3EOLA 3VNDA 2QCDB 1F3EA 4UCFA 4GC4A 4CD4A 3BG9A 3DFPA 1BKHA 3SZ8A 2QLYA 5C9WA 3HQPA 3LNPA 5CBIA 4GGBA 2WANA 1JCLA 1UR8A 4LJ3A 3G0XA 4AC1X 2VDHA 3MP5A 3CL6A 4DRSA 1OB0A 2WNZA 3T08A 5AZ1A 3TWAA 2DVTA 2PDYA 1L2UA 2Y89A 4AD4A 1XUUA 4LUSB 3CK5A 5DCBA 5CBBA 3V1HA 1AZ1A 4QLKA 4J35A 3CH0A 2X09A 1J8VA 4BF5A 2H8XA 4GIAA 4S3AA 3B8IA 4C60A 1ZHAA 4GD0A 1F4AA 2OG9A 2PURA 1G4SA 3CIXA 3L0GA 1B2YA 1PL9A 3IIPA 1KKOA 3CTLA 5IXEA 1LLWA 3M47A 4IXXA 4AVFA 1IWBA 1XV8A 3GDTA 4R7WA 1TZ7A 3ZLGA 3L66A 4C7GA 3HGSA 3M0HA 1RD5A 1QI3A 4X63A 1HW6A 4ZENA 3O7UA 3FNDA 1PSCA 1T8XA 2X7WA 1DV7A 3KHDA 3GW0A 4NZ1A 4PL2A 1V7YA 5HMDA 4O8AA 1FH7A 1OGGA 4OBRA 4NI3A 3OU8A 2EPOA 1JR1A 3TXVA 2G4JA 3ARVA 2WOQA 1VEOA 3A9IA 4O1DA 3M7WA 3PM6A 4J7RA 4Z2HA 4OFCA 2BZNA 1LRQA 1FWJC 1TRDA 2ISFA 4OQVA 2V30A 3A5FA 3G8RA 4LYPA 4MFDA 1PX4A 3DYPA 3GC2A 1FCVA 4X2RA 1KCXA 4YJ5A 1ZSXA 1FCQA 3SW6A 4Y9PA 4CQCA 3TYCA 4QX4A 4PUEA 2BG5A 1Y8BA 1GORA 3UETA 3GQYA 1W6TA 3KL3A 1T7LA 4MWAA 1S2AA 1F6KA 5GVJA 1CW2A 1VF8A 2TMDA 4LCSA 3WBEA 4GNVA 3VVGA 2CERA 3QPYA 1TO3A 3P7YA 5GNZA 2VD8A 3RLUA 1M7OA 2AAAA 3FW6A 1FHVA 4IPPA 2WZIA 2IPWA 4O8RA 1LM1A 3W1LA 4ECLA 5JBEA 3TYBA 3THUA 3DOPA 4E2BA 4NYUA 4UTMA 1WNOA 3STFA 3GNPA 4GE8A 4H7VA 2HWGA 3DHFA 4EXBA 5LZLA 1RXOB 4XKYA 3PC0A 2GDQA 1XX1A 1MEWA 5FESA 5C9XA 1Q4WA 1XPGA 1W1ZA 4TMBA 2QGYA 3WDIA 4XUGA 3S9IA 3LDVA 2CLKA 4XIAA 1YBQA 3GAKA 8TIMA 1U1HA 3CQKA 2OYLA 4NAFA 5G4WA 4XD5A 3EDEA 4JN7A 1HL2A 4MF4A 1XUZA 1V6XA 1RVGA 4NY2A 4Q3MA 1J0HA 3GW3A 1I6NA 3QY6A 1SZGA 1LL7A 4M24A 4IPLA 4J9JA 4XTIA 5I23A 3GO2A 1W1B1 1ITQA 8RUCA 5HNNA 5HPCA 4GBDA 4Z1BA 3S2MA 1JDCA 3SRFA 4AF0A 5GJMA 2XG9A 4K1GA 3FX4A 4WLCA 4RKAA 3GUGA 4BI6A 2JFEX 3I10A 3UCDA 1JDEA 2QNEA 3OBEA 4QG8A 3VD9A 3VX0A 3BOXA 2H8ZA 4GY7A 3H55A 2OZTA 3QY7A 5H91A 1L8NA 3S9YA 4PCPA 2RHGA 1S39A 4W93A 3NQCA 3A22A 1F74A 2J78A 1VFTA 3LTYA 1K02A 3QV8A 2FPVA 3VC6A 2FH8A 4TIMA 1YIXA 2UBPC 5U7SA 3SIMA 4H7CA 3TJ4A 4S3EA 5BXPA 1OYCA 2XIJA 4FIRA 5G1MA 2VUYA 1DJWA 2DZXA 1C8VA 3R0DA 4L4OA 3T9PA 3CQ0A 1XBYA 3SCSA 3GBDA 1CI1A 3VDHA 3VZZA 1DIDA 5CQ1A 3H4WA 1I8JA 1BF6A 3CWHA 2V67A 1X7FA 4DJED 4B4HA 3RCMA 1C93A 1K7XA 3WENA 1AQ0A 3CHVA 4PE8A 2QCEA 3EDKA 1T6MA 3L4XA 4UFIA 4NJKA 4AIEA 3S8HA 3TDFA 4GQBA 3UWVA 1SO3A 3KOFA 1ZJAA 3P93A 4QJ3B 4OV4A 2GVGA 2XH4A 1W8GA 2WKLA 4XK2A 5XIAA 4H7ZA 3LBOA 2PWEA 2DT1A 1WE5A 1B4KA 5LHEA 2XIBA 2PBGA 4L1WA 3Q37A 4AXKA 4KW2A 2E67A 1EJUC 1MDRA 4JHOA 4PRRA 1VRXA 1VPYA 3VOGA 1UH2A 5EMKA 2YDRA 5FOOA 4JIQA 1MFVA 5BU6A 5CBJA 3QQ1A 3TXZA 3R89A 3XISA 4GCXA 4A29A 3OG3A 3OQEA 4DY1A 3UGRA 1BYAA 3TP4A 2YXXA 4XBJA 1ZP4A 1A47A 4JTQA 1T41A 2JF7A 3WLJA 3KE0A 3UXIA 3N6JA 3BH4A 2NV2A 3M0IA 2NUYA 3MZ2A 5K3VA 2HSAA 7REQA 1NEYA 4JNYA 4FNUA 3DFYA 2OTDA 3E96A 3VE7A 2I5QA 1UUOA 1UP3A 3UFYA 3C8NA 1MNZA 3TVAA 3OTRA 3HV8A 3IIOA 2R82A 2NUXA 1AQMA 1RBOB 1ZJBA 3ZVHA 1XH2A 1ALDA 3HF3A 1TUXA 3KRUA 3U2EA 5A6BD 3GC4A 1B5TA 3KOZA 3GVQA 3EOSA 3PHAA 5SWUA 3P8IA 2D2GA 4RDVA 2CKSA 1VFSA 3W29A 3EXRA 3IPWA 4U2YA 3P3BA 2GLKA 3DC8A 5CPNA 2P53A 1S1PA 1I45A 1IEWA 4PULA 3H4XA 4LV4A 3EPOA 2XGIA 3P6LA 1Y5WA 1WDSA 2QCDA 3CIVA 4S2CA 3T42A 3IUHA 1EOMA 2B81A 3DC0A 4CVUA 1AJ2A 5F2GA 3EOOA 4FOJA 3NOEA 3MCOA 4GQRA 4GJIA 1OVDA 1CBGA 5TF0A 1OF8A 4JTAA 2Z4GA 5D04C 1SO4A 2FB2A 1MW2A 1YXCA 2IKGA 2WLZA 2CLLA 2ZRWA 1QFEA 4AD5A 1AH4A 5AC4A 1P7TB 3KBWA 4YXGA 2J79A 3UYCA 2GJXB 3TJIA 3NXLA 1YXYA 2GOKA 2JF6A 4W86A 5DMNA 2TODA 1YDVA 3U0HA 3IUDA 4Y7EA 3NQ8A 2YXGA 5G2WA 2RH9A 1JUEA 1VKFA 1EFZA 1CXHA 6XIAA 4BEUA 2E8YA 4C65A 2PDWA 2BX7A 4Z2IA 4Y2WA 4X61A 3ZJ8A 2X30A 3W25A 3BQ5A 4WJXA 1UW9A 3FJ6A 2ZE3A 4EXQA 3N2OA 4HA4A 5TQLA 4P7RA 1KRAC 4X22A 3H21A 4P7QA 4TVUA 2GGGA 3AXIA 3HZ3A 3CUIA 4BKNA 3O8AA 1YEYA 3AYRA 4NX5A 3W7QA 1CCWB 1AW5A 2GWGA 4GUIA 4EIVA 4E4UA 5JXQA 1QNQA 1FHDA 2WMFA 4KCWA 1VLIA 4N9CA 4W4QA 1A0DA 4NX0A 4NQ1A 4BA0A 5LNWA 1V7AA 5A3HA 1R8LA 4O16A 4JIRA 5DY2A 1WCGA 3OLIA 3RCYA 5AHNA 4KIEA 3LRMA 2HS6A 2PFHA 1EXBA 2XVPA 1XIFA 2YA2A 5BRBA 1TE6A 1W0MA 4DWSC 5LHFA 1UKOA 1UJPA 3U7VA 3VNLA 2XZ9A 2H90A 1TPB1 1VD6A 2CEQA 1JCJA 5DF0A 4DAFA 4Q8QA 1EX1A 2H6RA 3V75A 1I60A 1XISA 1KKRA 2YCLA 2G3FA 2GGJA 5BMWA 4IH3A 4D6EA 3C6CA 1VYSX 3EAUA 3WDQA 4NZ4A 4XX6A 3IJIA 4KIRA 2DIKA 4V28A 3LPGA 3T0TA 3WD4A 1D8WA 1GYNA 2CFFA 2ZZ6A 5CPQA 4FIQA 3W7DA 2VVNA 1P6WA 4J4KA 2OMAA 2R1LA 2Z1BA 1KRMA 3F5KA 4LUJA 3VCCA 3T05A 1W3TA 3VIGA 5EMYA 2A7PA 4FLRA 2O4QA 1BG9A 3AYTA 3ARXA 3M6DA 3D47A 3FDKA 3HMCA 2PSNA 1OFBA 4N7QA 1H61A 3NAVA 2CZFA 1ONRA 3VYLA 4B2DD 2F6UA 4LPCA 4BY3A 2P76A 2FKPA 4Y9MA 4JEQA 1QMLA 3S83A 1EGMA 2RJGA 1HJUA 2ZADA 4AZBA 2PPGA 3QOMA 4YHGA 4HD5A 4YHEA 6PTDA 3EDFA 3EKLA 3TMQA 2UY2A 1H5YA 1JYXA 3BW4A 2GPTA 3BO9A 4J2MA 2YKKA 2PGEA 3Q2DA 3CPUA 2C0AA 4W5ZA 4GI4A 3LNMA 5KZ6A 2PWHA 1NSJA 4GG9A 1JPDX 2ADAA 3WQDA 4LVFA 4IIFA 1TIMA 2WSYA 4DF1A 3S46A 4E8CA 1DL3A 4P8XA 1QOPA 2PP1A 5EU9A 3W24A 2FDMA 2ZCGA 1EC9A 4KRTA 3WQPA 3GTIA 2UWFA 5KTLA 4D8ZA 3R6IA 2GVJA 5JH1A 3B97A 1GQIA 2GK1A 2A5HA 4ZB2A 4DJEA 3L5MA 2YA0A 3AI0A 3F03K 4JTTA 5AC7A 2Y88A 1IXNA 4J2PA 1U30A 3SUWA 4JTHA 3RU6A 4ZVJA 3T0DA 3CUZA 1WYIA 1BVZA 3CB8A 3RCNA 4CLMA 1IQ8A 4MPQA 1S5WA 3UXDA 2JALA 2EG7A 2C3ZA 1U5JA 4QNEA 4J3XA 3BK0A 3LY0A 4AVNA 4D8AA 3R11A 1OCQA 1A5BA 2F61A 1RJPA 1Q4NX 4RV3A 3G1XA 2VZOA 5FJIA 1TWZA 4IGNA 2C15A 3RITA 1RBAA 2HPMA 3LV5A 4L56A 1A5MC 4Q8NA 1LLOA 4FO4A 2YBTA 3U2CA 3LRLA 2QJGA 3W88A 1AK5A 3GIPA 3PUDA 4L65A 5F4SA 2VJXA 1IXPA 3UWYA 3ANVA 3VABA 4LCQA 4EXAA 4PUDA 1CT5A 3L12A 7PTDA 1CDGA 1KA9F 3VXGA 1ZLPA 3O6CA 3I6EA 5J5DA 3NL5A 1FHUA 4O13A 1XGEA 3A3XA 1GQNA 2WV8A 5J8LA 1W17A 5DELA 2D20A 4LXFA 5HPOA 3V18A 4FNTA 2CHNA 4O1CA 3UJRA 3TEVA 2G4FA 4WKFA 1VBGA 1G9HA 4A05A 4GO9A 1Z8AA 1A50A 4C6LA 4CNNA 1OX5A 3T4WA 2ZZ4A 1SFJA 2AOSA 5EMMA 4K37A 2FZ8A 1VENA 1KBIA 3CJPA 9RUBA 4RXFA 3BLFA 2EEXA 5JVLA 2QJMA 3MUCA 4ZOCA 1GOQA 4MSSA 2BVWA 1O66A 1TJRA 1X8CA 3KTXA 2XHYA 2POZA 3E49A 1J10A 4Q8PA 4ROPA 5AVHA 3VMPA 5K2ZA 3BC9A 3TTSA 1P0BA 1HKJA 3CYJA 1TV2A 5E0KA 5CGQA 1W9VA 1WP6A 5I06A 4I9AA 7TIMA 1DJXA 4Z1CA 3N6HA 2BMBA 4A2SA 3QLLA 4KWUA 1J18A 4MPKA 4NAEA 1WX0A 2J27A 3DHDA 3B8UA 1GHSA 3OGVA 2WSPA 2CBIA 3B0VC 3CC1A 1E70M 2Q09A 1GQJA 3N14A 4HOZA 4GVIA 2IKIA 1WXJA 3W26A 1FUYA 1CGTA 2ABBA 4G1NA 1XLAA 3QKZA 3KS6A 4AX7A 1TV3A 4JIPA 1SSGA 3IARA 4CD8A 5JBFA 2QIIA 1XQLA 4GYFA 2IQ0A 3FHAA 3U48A 1XH0A 2WVSA 1H1YA 3MWCA 1EYWA 4L6HA 3NJ3A 1G6CA 4I8DA 8XIAA 4IGHA 3LUTA 1O6IA 2GSJA 3ARTA 1E1EA 4C5YA 3BXWA 4EF9A 5HMSA 5D9MA 2FFCA 2FHBA 3AROA 3ICJA 3H26A 3UZWA 3T44A 4Z08A 5ECVA 3EDJA 3GZAA 4MKVA 1MUMA 3VDAA 1QHZA 3W2LA 1ISVA 3IVUA 4JTCA 2FDSA 3CASA 2CLPA 3VNKA 3R0KA 1V3MA 3W1RA 3LGGA 3WDHA 1E4MM 2I1OA 1S2WA 1L2QA 4ZQOA 4FLQA 1G1YA 2BS9A 3L21A 4HIBA 5BMXA 4HSHA 5CZTA 2Z27A 4C6BA 4J5NA 3D5HA 3IGSA 3SY8A 4ML4A 4XZBA 2XISA 2ATMA 3NQEA 4M1RA 3KOXA 1X1NA 3LPOA 4EF8A 3AYSA 3WJSA 2CZ5A 2OZ3A 4TUFA 2X2GA 3QVQA 4PR4A 4IPIA 4MZYA 2OKOA 3NO1A 3QN3A 2GDUA 1F61A 2Q8LA 2FZBA 3OLGA 4UQCA 2WC4A 1VJZA 2XIOA 1L6WA 3GB6A 3S1GA 2E25A 3NQ7A 1UWIA 2QCCA 5A2AA 3LGEA 4B3LA 1TR1A 3MMDA 4F0RA 3TWBA 1ZL1A 2EJAA 3WSUA 4QEEA 4XIMA 4HVXA 1JDAA 3S2JA 3DHUA 3SCRA 3V0TA 1TA3A 1IGWA 1HF6A 1B9ZA 2O9TA 4FR1A 4ZQRA 1KM1A 1MMFA 3MA8A 3IIXA 3HG2A 1SW3A 1FKWA 1OADA 1PZ3A 5M5DA 3GHRA 1MUWA 1DXIA 4KFPA 4Q32A 1W3NA 4JKLA 3VAVA 2JBMA 3VNIA 4IL2A 3ZLHA 3IJ9A 4JD4A 2WMHA 4UNKA 3HQOA 5LGZA 3FYOA 5FJOA 1OWQA 1TZZA 4LS0A 3HJZA 4DB7A 1O68A 3SUTA 5CG0A 1M1BA 3KVJA 4UUIA 3WH8A 1MRAA 4GBUA 3ZS4A 1OT1A 1R2RA 3LK6A 2YL5A 1BD0A 3K8MA 4MWAE 5BNKA 3AU2A 3BLLA 2Q3OA 3PFRA 2NSOA 4B90A 2NQZA 1Z41A 4WSHA 5T91A 4DWDA 2E4TA 1K3UA 1KM0A 3AS2A 2OOGA 3B4YA 4L9YA 3NQGA 1PIFA 4Y6GA 4E3VA 1MWOA 4IMGA 3NURA 3U2ZA 3NIYA 1LF1A 1OZQA 1KFEA 3GKAA 1EO5A 4IP7A 1FVPA 4GRSA 4HZ7A 2CC0A 2WMJA 1SZEA 3QJAA 3NA8A 3N9SA 2QUMA 2GSHA 3RAOA 2X40A 1VZWA 4WSJA 4ATDA 3O3RA 3WLRA 2IQDA 3LQGA 4CEXC 1A5NC 1D7KA 1EA9C 4UTTC 3SJ3A 1IWAA 2IQTA 1TMHA 1VBUA 3GHTA 4AYGA 2WHLA 1TTJA 2HVMA 1QPRA 1QO2A 3HURA 3O05A 1C8QA 2DSVA 2X1IA 2IS7A 3D3AA 4KGJA 4MLRA 3UA3A 1O5XA 4O1EA 1HZYA 1ZB5A 5CPTA 2UV8G 4XUYA 3OODA 5CPSA 2D73A 1OFEA 3KVLA 3INPA 1ZCOA 2CZVA 4LAMA 4RR4A 3E3HA 1DJIA 3W02A 3F2DA 1H7NA 4E4FA 4U5KA 4MWAB 3SN4A 2XTKA 1FWTA 3E5BA 2D2HA 1GTEA 2GYIA 3PK7A 1K4GA 1P0NA 1G67A 4E38A 4QJ1A 4NILA 2R24A 5I3IA 1BVNP 4DYJA 4R53A 4RPPA 1K77A 4DO7A 2F38A 4HHMA 1W31A 3E2VA 1JIBA 5A8PA 3TN6A 1JYVA 4GJ1A 4QG6A 1QI4A 1AZ2A 2HMCA 2XYLA 1Q7QA 2ZUMA 1EA0A 2B31A 1PXGA 5D03A 4DPPA 4ADSA 1J0ZA 1T8QA 2WSKA 4MDOA 2J47A 3QGAC 4MKSA 2AL2B 4UFHA 1JD7A 2QMKA 1UD4A 3H22A 3PF3A 2Y5EA 3B04A 3MBDA 1HKVA 2PTWA 4ZCWA 3QH2A 1EZ2A 1ZCCA 3MHGA 1KTCA 3E0LA 4XAZA 1ODUA 3SADA 3WDRA 1GOWA 1W9XA 2G3IA 1AJZA 5A69A 2G37A 4EVZA 4I7VA 4HMNA 1T99A 4JICA 1SMDA 1P1XA 1FKXA 3FOKA 3CHCA 4WDUA 1BYCA 3WG6A 2VZVA 5DT7A 2VEFA 2IKHA 2E1DA 1IIGA 2EKGA 1XIIA 1B3YA 3NPXA 3OYXA 4W9TA 1XXXA 3ZOAA 5KZMA 1SR9A 1SFTA 1UA3A 3SY5A 4F0SA 3WUGA 5D02A 4CU8A 4R9OA 3SRDA 1RSCA 4JIHA 1YRRA 3C2YA 5HA7A 5GPRA 3CHEA 4GVFA 4M80A 3W76A 3ARRA 4GABA 2GQ9A 4KWOA 3KTSA 4AWUA 4CEUC 4WF7A 5BU9A 2P88A 4LRTA 2B7QA 3W7OA 1ZAIA 1BWVA 4CCCA 4K39A 2WCGA 3BPWA 1QU4A 4A8IA 3EXTA 4UC5A 1F76A 3WNOA 3QGVA 3S0CA 3G1VA 2C1HA 3V4BA 2JGQA 1OK6A 4IM4A 3ZLFA 3BUVA 1O94A 3ME3A 3STCA 2HE5A 1XD0A 5HAOA 3CV2A 4IQDA 3ZFHA 1PKYA 5A6TC 2JKEA 3WQVA 4QNWA 1GVFA 1Q3NA 3K1GA 3UG5A 3FYYA 5T8GA 2TAAA 3RG6A 4JQAA 3KLKA 1KXQA 2QUUA 3GXPA 3MSGA 4MNKA 3MUY1 3FS2A 1WKFA 2O56A 4UFLA 4PCNA 1SJBA 3WJXA 4C6FA 1R47A 3TTEA 3AQUA 1EWDA 3W01A 3MU7A 3MVIA 3GDMA 4FAMA 3GR4A 4P5UA 1XIGA 2ZX5A 4XBKA 3E5PA 5F4WA 4CU7A 2EKCA 1S5NA 2VCCA 4GVHA 5CZSA 3DX5A 4Z2JA 3AICA 4WGXA 2VO5A 4HZ8A 3AJXA 5CC3A 1KGUA 2QQ6A 3KFTA 1DJNA 2BVYA 2VGBA 2NSXA 3L4TA 2X1RA 3NVDA 3VZYA 4CD6A 4HU0A 4LYRA 2ZTJA 1RUSA 1DE6A 3BV7A 2INFA 2ZA3A 1PV8A 4DIAA 4S3FA 1GVSA 4U2ZA 1OX6A 3FAXA 2FTYA 3TAOA 1GG0A 3NZGA 1EJSC 4H8NA 2A6NA 4JY9A 1TCDA 2FMNA 4L4LA 4H8HA 3DG7A 3E2QA 1BGGA 4HU8A 2B7OA 1M53A 5REQB 3L4UA 2NQJA 1QDSA 2YA1A 2FH6A 4AEFA 3F5LA 4D71A 4TTGA 2YIHA 4AEOA 1KGXA 4PMDA 3ARUA 3GM8A 2BTMA 4L64A 4B9ZA 1VIWA 3ORWA 1JGIA 4PN2A 4E0CA 1W37A 3AZSA 1HTIA 4YNGA 3BAXA 4PTMA 5F7UA 4HNOA 3EA1A 4HNUA 3CUFA 1TVLA 4RW5A 2Y8VA 4ZSTA 3ZR5A 2WJEA 4GX9A 1VCFA 2E5BA 2CPUA 3BAKA 1K9TA 5DBTA 3HPSA 1RVKA 1KBJA 5EMLA 4JFUA 3APGA 3BCFA 3MQTA 5DXYA 3RMEA 2GUUA 4M8UA 1JAKA 3WQ6A 5AHLA 3EWZA 4GYKA 4C6EA 1A5LC 4KT2A 4HYWA 2F8QA 3P74A 3W7IA 1KD0A 1GVRA 4HMCA 3UNDA 5A94A 1W2VA 3ARSA 2IPFA 3OVGA 5T9CE 3CAVA 4ERAA 2A3BA 2DIJA 1R85A 1BVWA 2DSWA 1QUMA 4LU0A 1GQKA 1XYZA 3UBPC 3AALA 5FD0A 5AC8A 5IRPA 4IJCA 1QI0A 4RJEA 4JL1A 4MWAC 1PTAA 1RJRA 1I2RA 1J6OA 3N9RA 4WEVX 4PB5A 4FX7A 4JKMA 3ITYA 2VKZG 4ERGA 3C8FA 2AL1A 3DFHA 2VNCA 3UXAA 1FY6A 3VIPA 4JN8A 2VC6A 3NO3A 3OA5A 3V36A 3T81A 2XN0A 1HX0A 3W38A 3FXYA 3LSCA 2E9MA 4MIMA 1OCJA 5HNUA 1ECEA 1YPFA 5LIWX 3GVVA 2DGAA 4MG4A 5CZJA 3DGBA 4QLLA 2PZ0A 1F73A 4IG2A 4YWSA 4HMDA 2WJDA 1CTNA 1EPVA 1J93A 1F4HA 2YL9A 3EDDA 2VHLA 1QR7A 2YJQA 5HWMA 3GU2A 1P7TA 4S3DA 3TQKA 1LQ2A 3GR8A 1IT0A 2ALRA 3LU2A 3VMOA 4AWTA 2Y8KA 1KTNA 1UUMA 4H3DA 3WQ5A 1IEXA 2PDXA 3UCQA 2DQWA 1R86A 3IAPA 3I6TA 3GNRA 2VZTA 4YYFA 4Q22A 4MB1A 3DECA 2EXOA 3MKKA 4D6HA 4FXJA 4NZ5A 1KM4A 4MY8A 2WHMA 5AY7A 1FCUA 4PEKA 2OEMA 3W1AA 3W1NA 3B9AA 2QAPA 3I3DA 1SR0A 3WLNA 3WNKA 3IRSA 5M1TA 1GT8A 4AD1A 4O19A 3W4RA 1PKLA 2RJHA 2OWXA 2HCVA 3G1DA 4LEQA 4AY7A 3O07A 4UZUA 5D9OA 3T2PA 1OZMA 1EX5A 2WSQA 4TVDA 4V15A 3W74A 2PLKA 5MKGB 1Z42A 3I65A 3PBWA 3STEA 1HO1A 1IGSA 3EEGA 4ZBCA 3CZ8A 5C7HA 1IR1A 3Q65A 4KPLA 1AL8A 2DSZA 4ICCX 2QXWA 3ES8A 4BHYA 1QBAA 1BYDA 2GOUA 3BTNA 5RUBA 3SECA 2YDAA 4RPQA 1RV8A 2QDHA 1JI1A 3MTWA 4OVXA 3RO6A 3SCPA 1GJWA 4N9DA 4JFWA 1XIDA 2W67A 1WO2A 4N9BA 4IIBA 5G1TA 2FQIA 1H1ZA 3QOKA 2WNNA 1VHCA 3CQHA 3I4EA 4JX6A 2VR4A 2BY1A 1FWGC 1PWMA 1V6WA 5E0FA 2H9AB 3WH5A 1EQPA 3K4WA 3D6NA 3H4GA 1CGYA 1W5PA 2CLEA 5GQBA 3GXNA 2RDTA 4DQWA 3NQ2A 4GKTA 1MYRA 2XVKA 2V2CA 2Y24A 3KP0A 4NNBA 3DESA 3SUVA 2HE8A 5BXTA 3CO4A 3S5YA 1BFNA 4X9YA 4MJZA 1MQPA 4K3ZA 3QEZA 3GU9A 2YX0A 4P8VA 2OLSA 2Z1KA 3E02A 4MAZA 3UZZA 4L1GA 1QPKA 1OFDA 2VXNA 4GY1A 2ZC8A 3EBVA 2X0SA 1DIKA 5AHFA 5AYXA 3U5YA 3RX4A 1S2UA 2NWRA 3N15A 2CLMA 2C18A 1P48A 1UD3A 3R58A 4ZOEA 3V3WA 1Q6FA 4G6CA 4IWWA 1M7PA 1TPWA 2A3AA 2WVVB 1RJQA 2R1MA 1B57A 4M19A 4AMCA 4S3CA 1L6GA 3D46A 2VGFA 2GJPA 1ZNNA 1W3LA 4YL2A 2DH3A 3B9EA 3VU2A 1NJJA 2R8WA 4I5UA 3LHWA 2EPHA 2VEPA 3UP8A 4K6AA 4DJFD 1UOZA 1Q2RA 5D2XA 1V0KA 4UMAA 5DMYA 1C90A 2W66A 3SQSA 4TX9A 1UD2A 5CPMA 1E6PA 4PBGA 3HQ1A 1W9UA 4JIIX 3THCA 4ZSUA 1ZAJA 4ACZA 3EZ4A 4A22A 2OJPA 2B0MA 3KBSA 2X7VA 4GWEA 4GC3A 5HNRA 1EHNA 3W71A 5HANA 4D6DA 3ZJ6A 2V68A 3FKRA 5CLWA 1NIUA 3AXXA 4CCEA 4AUBA 1X8FA 1V0NA 5K4XA 3UPMA 1OINA 4M81A 3KCJA 4EWND 4MHBA 3JU2A 1NM9A 1JYNA 3HA1A 3WQ4A 1NP2A 1R3YA 2FTPA 1JPIA 1SU5A 1IEQA 3WLPA 1TTIA 3CAQA 1WB0A 2XU2A 2AGTA 3UA4A 4AAJA 4XZNX 3G0UA 2OKTA 4I6VA 3VOJA 2J7BA 1IT7A 4A8LA 4C7FA 3WQFA 4F2BA 3VD4A 2W63A 1W5QA 3UVAA 5AC5A 1U22A 1WAUA 3DENA 3A13A 1V02E 1K4HA 4EX4A 1R7AA 1XR2A 4FK9A 2GVEA 4AD2A 1JUKA 1FP9A 5REQA 1LRNA 3VM5A 4PMRA 3A3HA 3HFTA 4JBRA 4O11A 2BY3A 3WFLA 3JRKA 4NSBA 1CX9A 3A4JA 1QK2A 1GW1A 4UFJA 1ZBCA 1GKRA 4LGXA 1EQCA 4H9ZA 4DWSB 4PZVA 1KFJA 3POCA 2YDQA 1Q45A 4L4MA 1XLBA 3TW7A 5I03A 4GO8A 2Z25A 1L0PA 2YZ5A 3BMWA 1G4TA 3KP1A 6ENLA 5JIWA 4PCFA 1A5AA 3T8LA 3VKJA 4Q6JA 3N4EA 2HDJA 1PZ1A 2XFWA 1FTXA 4Z2GA 3AFBA 4IZGA 1REQA 1FOBA 2PCQA 2YFOA 3ELFA 4U31A 1M7JA 4FZIA 5I07A 4ZO7A 3HBLA 2VFHA 2ZZ1A 3TYEA 3REQB 2WKJA 2WMIB 4Y9AA 4DN1A 1N82A 2PLMA 1SGJA 4PBEA 1SM9A 3I7SA 4AZCB 4Y90A 3WLQA 2CKRA 1W5NA 2OEKA 4QDMA 3GH4A 4DXXA 3H53A 2WKGA 2FPYA 1N8WA 3URBA 1A3WA 5TBOA 4XISA 3NZRA 1XLHA 4HPNA 2PDKA 2VTFA 1GVOA 1LT7A 4AQLA 3OQ8A 4MDPA 4ZOBA 2A85A 4OUEA 3S9ZA 1UMLA 3VMNA 1XLGA 3L2LA 1XIBA 2ZC1A 2YW3A 4F8XA 1KGWA 3GBEA 5CZKA 4AIOA 3LQLA 5L6UA 2BHYA 4YCPA 3QR1A 2DP3A 3GX9A 3NL6A 1JXKA 4DI8A 3S2CA 2TRSA 2EJ1A 3UR5A 2CLIA 1SVDA 2AQOA 2OWWA 1RPKA 2ZX8A 5HWNA 4AY1A 4GZIA 4GFIA 1XICA 4ZO6A 3M16A 5DLCA 4A8RA 4B4FA 4R7JA 4GQGA 2J9ZA 4HK7A 1MXGA 2HVOA 4IIHA 2ZTKA 4RNHA 3W70A 4I6KA 2Y7GA 4UNIA 3T40A 1EL3A 4HA1A 3N2BA 1EJXC 1EP3A 2QCNA 3VC5A 1YPXA 4K2SA 4F2UA 4ZEPA 3TTQA 1K6AA 1AMYA 2QV4A 2J9YA 4E8GA 1EPXA 2E3ZA 3TUUA 2WNQA 1FH9A 3DAQA 1TCMA 3HTWA 4JAWA 3RJXA 3JZEA 3S1UA 3G5EA 1BWLA 4UQAA 4B92A 4FLSA 2XIIA 4AWEA 4OIFA 4JZ5A 2J7FA 3AIWA 4F0MA 3PVFA 4TR9A 2NVDA 4WKHA 2BXYA 4DUXA 4Z42C 1C3FA 1POJA 4DJFC 1L6YA 3UG8A 1HJSA 4DZAA 3DERA 1E5JA 3PANA 3PZUA 3R7MA 3G1YA 1GOKA 5PTDA 3CPRA 1ONXA 2ZUVA 4JQ1A 1RA5A 1S3TC 1KRBC 1J4EA 1GG1A 2DPEA 2FVMA 4H9UA 2PD9A 1W56A 1LBMA 2YDSA 3N1AA 3TC6A 5DX7A 1J12A 3OLDA 1ZENA 4BQ3A 5LIKX 1X38A 1GONA 2F84A 1SJAA 3GNXA 4ZQNA 4LYQA 2GWNA 1G94A 1YE6A 4MJMA 2WQPA 1E0VA 3B9DA 1OC5A 2DQXA 3GXMA 3B0PA 1HNYA 4N42A 3NL2A 1OM0A 1F05A 1G69A 1UH4A 4H8UA 3TYUA 5D38A 1M04A 3UWWA 3AXMA 2FVLA 3BJTA 2B7NA 1P43A 3OZPA 3KEHA 1XCXA 1JNDA 1IXQA 2C14A 1WZLA 2Z2BA 1CB2A 1G4PA 4V2XA 3M0VA 1ITCA 2ZXQA 1ECQA 3LN3A 3W07A 3KAOA 3O1NA 1OX4A 3KCOA 3W7NA 2HROA 4RDWA 1RALA 1DQXA 1Y7VA 2Y5JA 3PS7A 1ENUA 3JS3A 5C7VA 4GZ7A 1HL8A 2PGWA 3LCGA 1EJ7L 2I16A 4PEEA 4WXZA 1BGAA 3G1SA 1O60A 3CMFA 4IXHA 1EUAA 2FB3A 4K1WA 5FI8A 3DI1A 1H7RA 1AW2A 4DO5A 3U5UA 5CZ0A 3P81A 4S38A 2GVLA 4D6FA 3THQA 1A5UA 3KRBA 1GKQA 3FLUA 1MNSA 2E0PA 3TKFA 3E0IA 4O4VA 1TPVA 2J74A 4ZQCA 3CBWA 2QVNA 1U2YA 4H2HA 5A5WA 3CS2A 5FAJA 3PWIA 5A8NA 2W3ZA 3PTMA 4D6IA 4JPGA 2IW0A 1V3KA 3CZGA 1UR2A 3GS6A 4AMAA 5CH9A 3R12A 4LNYA 3WQEA 2P10A 4QS6A 5G4HC 3PR2A 3BZGA 1ZALA 3CHFA 1VFHA 1J5TA 2BGNE 2VYOA 2J66A 1NVMA 1RP8A 2DVUA 4DX3A 1KR1A 3EOEA 3LXAA 2PDGA 4BK9A 1RQHA 1CLKA 4DJEC 3W22A 4JTJA 3G1FA 1B0IA 2FPTA 4I5RA 1M6JA 2WCAA 4IQLA 1SPQA 1UOKA 4ZFMA 3ALFA 2BGQA 1WZAA 4BWLC 2C71A 4IIDA 3AMDA 2GJRA 4F3HA 4GIEA 3W1MA 1V51A 2CXEA 2GVYA 4P7NA 2VOMA 2A79A 4YTSA 4F0HA 3WNLA 3QV7A 3PZNA 2J7EA 1X97A 1ODZA 3H2NA 3H24A 3PY2A 1Z32X 3ABRA 4HA0A 1QNSA 3VIJA 3PBYA 3BANA 4NASA 3GDKA 1AFSA 2BGSA 2V3EA 4RX0A 3NFUA 4XD6A 3FA5A 1UR0A 1YTEA 3QQWA 1DTUA 1GVYA 1VIZA 3F4CA 4LBUA 2NZLA 4LF2A 2BBFA 4C5ZA 5IHRA 1B3VA 1ZAHA 3A5VA 3JR2A 3MKVA 3PTQA 3NGJA 5I02A 1MQQA 3CYVA 3LA4A 1LORA 3C52A 4PODA 3LV6A 1I0DA 2P0OA 1XWYA 2QT3A 1JZ3A 4FR6A 3BZJA 5XINA 5HDRA 5B7ZA 1RA0A 1NOUA 3PSVA 1M9HA 1XKJA 1TG7A 2RDUA 3K4AA 3VGBA 4JTKA 5C6MA 1XBZA 1OHLA 3AWNA 2PWDA 5BROA 1Q2SA 2AKMA 1PTDA 4XTDA 2G96A 2QPXA 4LANA 2CNCA 3EWYA 2XFRA 3R2GA 2V81A 1LCOA 4S1FA 4D72A 2VVSA 2PGFA 3QSTA 3ZJ7A 4KS0A 5A6BA 3WDPP 1L6SA 4ZOAA 3CMJA 3KBNA 1QNPA 3M5YA 3P84A 2NW0A 2IMRA 2YR1A 3VINA 4H6EA 2G97A 1SO6A 1WKDA 4DAIA 3OVQA 4FNSA 1F5ZA 1H2JA 3OVRA 4JIEA 1VH7A 2R91A 3Q45A 3WKZA 4Q4SA 4AU0A 1FWRA 1VRDA 3O6DA 5EYWA 1CXKA 2PU0A 3G24A 2PDLA 1E56A 2BOFX 1H49A 1Q13A 1S2VA 3OBKA 2IXUA 2PDPA 4S3GA 4JQ3A 2V0TA 2QCFA 3WD1A 3QTPA 4HZMA 3NXFA 9CGTA 3GFYA 1JZ8A 1MZRA 5LNUA 2W6RA 1H7WA 4DYKA 4IMAA 1BPLB 1GGOA 1J2BA 2I14A 5GJPA 3MV11 1DBTA 4PUUA 3UESA 1ADOA 1PJ9A 3P80A 3B9OA 1NH6A 2YXOA 5CSSA 4G7EB 2Y4SA 1VGAA 3B0YA 2VRKA 4GYPC 5FACA 4F9JA 1DKWA 2PLJA 2PLCA 3DIPA 2YCIX 1RQBA 4HJFA 2E9LA 3MYOA 3NQ6A 2HNEA 3SFKA 3L23A 4GINA 3M43A 4Q8UA 1E40A 5CAHA 3MZNA 3K4DA 1UPPA 5B80A 4IQEA 3AHXA 2XN1A 4YTUA 3CZJA 1VS1A 4G2DA 4LT9A 3EWWA 1GWJA 3IJ8A 2VD9A 4D6JA 4GOAA 4FNPA 4AEEA 4UTFA 1FH8A 4URIA 4WRHA 3AIUA 3FIGA 4PUKA 1L8PA 4DBEA 4RE0A 2Z7GA 4IISA 4MMWA 3VE9A 4G9PA 1E1CB 1KLYA 3C3NA 3GNNA 2QCHA 3M64A 2VOTA 2F7FA 3EX2A 2J77A 3EB2A 2DJXA 3C0QA 4IL0A 3ECQA 4B5WA 4NAFB 1QVBA 4AZ7A 2E77A 1LWIA 4EK7A 4UTUA 4A3HA 1A53A 3LLFA 5CG7A 2ZUSA 3C2EA 3JVAA 6ALDA 1QNOA 4MLJA 4W8LA 3LM7A 3MDWA 3SURA 3WQGA 2PDFA 2OOFA 2Y7FA 4LAOA 1OYBA 4IMEA 1IEIA 2NXGA 1WXZA 4GYJA 1LT8A 2PB1A 5FF7A 4ALDA 2PDBA 5A6AA 1P6CA 2WZHA 3GHUA 3UYIA 1XLIA 3W7CA 4LBSA 3SSZA 1R2SA 4C91A 5DRCA 1FHLA 1GQLA 3QMSA 5HQEA 2QPSA 2E6YA 2DH2A 4IT1A 5EA9A 4RK8A 1SW0A 1HKKA 1SW7A 3FYPA 3V0UA 2PDIA 4H8VA 3UWQA 5C9RA 2WMIA 2Z2UA 3DG3A 1KTBA 4OUIA 3W7HA 1O1ZA 1TX0A 4MY9A 4DZHA 3BSHA 3W1XA 4S2BA 3WK1A 3LCIA 3OLEA 4ZO8A 3VOHA 1UCWA 3TLQA 3AIQA 4TQTA 3TU9A 4B9YA 2F6KA 1LYXA 4Z2KA 3U7BA 1KCLA 3NPUA 3NZ1A 3W2NA 3E74A 4HNTA 5CC7A 3M0YA 5AYZA 2DIEA 3BCDA 3K8LA 5D37A 3H2AA 1BWKA 1DOSA 3HJEA 5FA5A 1RZMA 3E0VA 5H8UA 4LVDA 2I9UA 3AXHA 2OR2A 3BMXA 3U9IA 4Y96A 4AH7A 4PUNA 4V33A 1I2QA 5TD4A 1GEQA 2CW6A 4LX4A 4CN1A 4GNKB 3RYSA 3JW7A 1ME9A 1WOAA 1RH9A 5E9XA 2CWNA 3EX6A 5ABFB 5IM51 1W1YA 2VP8A 4QCEA 5HBFA 1IZKA 3BMVA 2GQ3A 1NF7A 2WCSA 2ZXBA 3MV01 1TX2A 2FHCA 3V1PA 3QFWA 1Q85A 2V82A 4ENLA 1V3IA 3KRSA 1MEHA 4I9MA 3N2CA 2PP0A 5EL1A 4XZIA 1E0WA 1UQZA 1HQTA 2P3EA 3MS8A 5C9ZA 1R0MA 4JYEA 1JD9A 2XWEA 4MZ1A 1QWKA 3UWUA 1UZDA 1UH3A 1F3TA 3Q58A 3II1A 2QV5A 5DRIA 1KM5A 1TVNA 1TPFA 1DWJM 3MC5A 3VGHA 3C2RA 3AIEA 2X1SA 1DQWA 4ICMA 2ISDA 4DM2A 2GSEA 4DJFA 1QCWA 2A0NA 1TTPA 2ABAA 4EWJA 4KEMA 3T2OA 2NQ5A 1ZRQA 2FGBA 4F66A 4OWGA 3SN0A 3HO8A 1EF3A 2DUXA 4ZFCA 1JF5A 5DBUA 3QYQA 4ZMGA 2DSKA 3R0UA 1IZJA 1UB3A 2XZ7A 2VRQA 4B5NA 3ZSSA 4IOTA 1HJXA 3A4AA 2VCBA 3SQMA 4LF1A 1F3XA 4NF7A 4DYEA 1D3GA 1Z6KA 1A5SA 1VYRA 4HPXA 3GYCA 3QC0A 2CHOA 5BOFA 3AMLA 4WOZA 4FB7A 1NARA 1P5BA 4HOWA 1M3UA 4ASTA 4O17A 2NQLA 1FXPA 1ZJIA 3K5XA 5HJYA 1R9XA 3EWUA 2V5DA 3P60A 1EJWC 3WLSA 3VNYA 1GOOA 3P82A 4L61A 2QGHA 4DXVA 4DWSA 4ZL1A 2C13A 3TTYA 4BR1A 3W87A 4RUBA 4NZCA 1SZFA 2HNHA 3PZVA 3HG4A 2YL8A 1XM3A 2WZMA 1GVQA 1NQKA 3W27A 3VKDA 3XIMA 4BQ2A 2UY3A 3H70A 1JZ2A 2Q02A 2A1YA 1XCFA 3WLLA 2WNWA 3N73A 5HATA 3UZJA 1A80A 5HOSA 3IRDA 1BRLB 4PSPA 2J7GA 1PYFA 2O7QA 2H9AA 4F0KA 1Q7ZA 1SUXA 4C90A 3K2GA 1MXDA 3K13A 1J9YA 3M1ZA 2P8CA 1JYWA 1VEMA 4PBFA 2AQVA 1AUSL 1YX1A 5GNXA 4NJJA 1OIMA 1MDLA 4JL2A 3B0UX 3L68A 3RR1A 3KBVA 4JNMA 4J3UA 1UIPA 1BYBA 2I56A 1H63A 2VWSA 3MUXA 5FKYA 2HJPA 4WXYA 3L2IA 4GHRA 1SFSA 1F6YA 1V03A 4BI7A 3BLPX 4OECA 3CNYA 4EE9A 1KB3A 1A3XA 1C9DA 2YCJA 1ONEA 4I8YA 1OD8A 4HYRA 2QPUA 4GGHA 2ZX7A 3CV1A 5A8OA 3H2FA 2FMOA 3TYAA 1YW1A 3CZKA 1V6VA 5CPOA 3TV8A 2NWSA 3QF0A 4IMDA 4J27A 3H8AA 2BY2A 4ZO9A 2ZWYA 4LUTB 2Z2AA 4A6GA 4DBWA 3A3WA 3V0SA 2C79A 2OODA 1TVPA 2WBGA 2ACUA 2ZYFA 1E6SM 1SO5A 1BF2A 3DG6A 4MY1A 1CENA 1S46A 4K8GA 4NYYA 5FSDC 2REQA 3C2FA 2G50A 4Z2LA 1T0OA 1NOWA 2IPGA 3W6MA 4E5TA 3LXCA 2NX3A 1W8SA 1XINA 3IWPA 1KFKA 3PAJA 4WDTA 2A7RA 1GPFA 4Q4RA 2C16A 1ADSA 1TV4A 1B30A 4JTEA 5C71A 4CVWA 4FOKA 2JK2A 3HPFA 6TIMA 7TAAA 3M44A 3WD0A 1H7OA 3R94A 3GDBA 3SCVA 1O4UA 3SQLA 2Q01A 1S2CA 3ZM8A 3TFCA 3GK0A 4KRUA 1U1UA 1ITXA 2ZUUA 4S3BA 2CWXA 3FVMA 5AN7A 4GNJA 3UVIA 4DHGA 4PB3A 2R6OA 3CT2A 1DTNA 4H6QA 2DVXA 4Q8OA 3SGGA 4QAIA 3PPFA 3R25A 2YLAA 3LPPA 4F0LA 2A7NA 1JRBA 2DJLA 4Q4QA 1E6ZA 4AZ6A 4Q8TA 5AB3A 2BOEX 3WLHA 5ABGA 4DPQA 1OX4B 1XRTA 3LENA 4LC8A 3YPIA 4FX6M 3DI0A 1HP5A 4ATWA 3OO2A 4H19A 2E40A 1SZNA 1ISYA 3KVMA 5DANA 3KRZA 5I3GA 4NZFA 2INEA 3CUJA 3V5FA 4J28A 4Q6XA 3VPLA 3KTCA 4GQQA 4J3WA 3R10A 2X0HA 1EDTA 4UTTA 1S3HA 3MSDA 2DEPA 1VP5A 3QZEA 2XIMA 1W1A1 4B3ZA 4H2CA 4EPDC 1H62A 4AVOA 5G1YA 5DQPA 5ABHA 3UXLA 1K6WA 3NSNA 1UR3M 3VD3A 2V5BA 1PCKA 3T7VA 4UTJA 2Z7KA 3V16A 2PC4A 1LG2A 1M68A 4FP1A 4I5XA 5A8MA 1DXFA 4YTQA 2Y6ZA 2ZIDA 1ZU8A 2XGBA 1KW1A 1PB0A 3BOFA 4H9XA 5LIXX 4LAKA 2G5WA 1LUCA 4E6MA 4PMNA 2WWCA 4WKAA 1DP0A 3LX9A 1X1ZA 2DZVA 4N4QA 1H5VA 2C6QA 2DUAA 1RD6A 2QUNA 5EFDA 3GE7A 2VMFA 3MI6A 4DLMA 4LUSA 3UU0A 1W1TA 3AZRA 1YADA 4I7UA 1Q65A 1Q6CA 1A5OC 1I2NA 2OO6A 3G6MA 3WF3A 3QSRA 4CU6A 4CNSA 5GJNA 1WKEA 3STGA 4R85A 1K70A 3QHNA 3ZSTA 3WQWA 2E6DA 3B9NA 1A5CA 1EIXA 3PBVA 1VBJA 3ITTA 2J8GA 2W5FA 4C6QA 3URAA 2PU1A 5I3HA 5IFTA 4QE1A 1EGVA 1ZY9A 1PS9A 1MFUA 1OFPA 1TQJA 1UUQA 2RGLA 1TA3B 4H00A 2PRHA 2E5DA 4BQ5A 1MSSA 3DEQA 3PB2A 2A4AA 4US5D 2WMKA 4MNJA 3P0XA 4Q7IA 3DKLA 3FGCA 1NFBA 2DT0A 2XM2A 4Q8MA 3O6AA 4GCAA 4H83A 4QJ4B 1X96A 3L5AA 2J7CA 1LJYA 4HHPA 4HK6A 3W1PA 2Q3RA 4WSKA 5E1QA 3IVTA 1K9EA 3ALGA 4NI8A 3ZVHB 5A8GA 2BV9A 4KEZA 1QWGA 4PUJA 3PG9A 2I57A 5MF5A 2G0WA 1XLEA 5AHIA 1V08A 2AMGA 2ASHA 4XKMA 2NLYA 3T4CA 1TMQA 3M0XA 3FN9A 3S6OA 2VC5A 3L0KA 4PTVA 1XYCA 1TRIA 3RPTA 4D6CA 3EMQA 3PWAA 3S1VA 2WVTA 3TQVA 1WPCA 3O0FA 3NZPA 5EGRA 1ZQ5A 6TAAA 4FF7A 3GXFA 3OYZA 4IICA 1MVYA 1XLCA 4H41A 1U5VA 4I3GA 2CHRA 3S4TA 4C7DA 1PDZA 3NL3A 4HHLA 5I00A 3BW3A 4LH8A 4JTDA 4PMVA 1KWKA 1DJGA 4JFVA 5C54A 1CXIA 4BF7A 3IGXA 1PHWA 4ML9A 4OOUA 3WD3A 3PZOA 2BXVA 4AYSA 2WLYA 4AZCA 1GOXA 3GNDA 1UA7A 3R43A 3W7PA 1I2OA 4B16A 4XSMA 4H9MA 3ZVIA 2OYKA 1UWTA 4FXFA 3BWWA 1NP0A 1Q66A 4GISA 3NSXA 3GHSA 2NVCA 1MEIA 4IFOA 5KINA 1G7VA 2YOCA 3CH9A 3P0WA 4W87A 4L9ZA 4UTLA 2YZRA 1XJBA 2D0HA 3W6LA 3W86A 3VKBA 1FXQA 3F4DA 4Z17A 4QCFA 1FRBA 1IWPA 3M5VA 1M01A 3MHUA 1PX8A 4C6KA 3HOJA 4LUTA 4WVXA 2LLEA 2QEZA 3MT1A 1UKSA 3VTRA 4PMQA 3A12A 3IV8A 2KX9A 5LNVA 4IFKB 3WMSA 1VBRA 3CV7A 2VWTA 3AYVA 4Y9OA 3VA8A 3DKJA 1Q8JA 4I90A 4G1KA 2NT1A 6REQA 2CYGA 4Y8FA 5HJXA 4GYPA 5IBXC 2AMXA 4RDZA 2J75A 2PDUA 3IK4A 2VZUA 2XINA 4QEHA 4QM1A 5KITA 2GDVA 1E4LA 1I1WA 1W91A 3AHTA 1HJVA 2YLLA 3RRAA 3BLIA 1ELSA 1EJTC 1NDWA 3MSRA 8CGTA 1BXCA 3PUGA 1O5RA 2RAGA 1XC6A 2E5CA 1ESWA 4JN6A 3KXQA 3TMLA 1JQXA 2KAUC 1F2JA 4OU1A 2NV1A 2XH2A 3EYPA 5C2CA 4PRWA 5A6SA 4QLJA 5MHBA 4LVBA 2FTWA 4M6VA 1R30A 4PCTA 3NO5A 4R5EA 4WQ6A 3FA4A 4GUJA 1D3HA 2D2JA 3H2MA 2V3GA 1E6RA 3THAA 3MP4A 1AMKA 1BLIA 4GIRA 4QS5A 1R46A 2V63A 3NUKA 2FVKA 3EEZA 4UTIA 4WHBA 1FWHC 1U5HA 1B3ZA 3IS4A 4UTKA 5I77A 3NDZA 2Z26A 2ZVIA 2G3NA 1EF2A 1FWWA 2EPLX 3VGEA 1D2KA 4PL1A 4B5VA 1VEPA 3BGJA 1PPIA 3AHVA 5AECA 4PTWA 3ISIX 4RW3A 4E8DA 4LOCA 2GL5A 4EKJA 3VILA 3GDRA 4QE5A 2RKXA 4N9EA 2OT0A 5AFDA 4GI6A 2NXIA 5D4YA 4PTDA 3GTNA 4ZB5A 3P14A 2XH0A 1L6FA 4DVOA 1ME7A 3SAZA 4NNAA 4C6DA 3LTSA 5L9FA 3WJWA 1EJRC 1GNXA 2INZA 3DXIA 1JCXA 1TWIA 3TJLA 5HUPA 2Y5SA 2TSYA 2J88A 2WZTA 4J3ZA 3PBMA 3M6YA 5EPDA 3QV6A 3WYZA 4OKDA 5ABTA 1OC7A 1KXVA 5F2MA 4MGGA 3UJ2A 3SCNA 1OIFA 2QZRA 2HEJA 3XINA 2C91A 1XKYA 2VX4A 4S3JA 1S5VA 4JHZA 4KH2A 1MQRA 1VFOA 4PMOA 4M1BA 2D3LA 1JULA 1TV5A 1RY8A 4UR7A 1E6XM 3U6WA 1ISZA 1BXBA 4O1FA 4FA3A 1E9YB 4HNNA 4XSLA 2BDQA 5DEZA 3E0WA 3DYOA 2ZVRA 1PVNA 1NQ6A 4GMEA 3B4UA 1EHAA 2WSRA 3WJYA 4BZYA 3IV3A 1MUCA 2X42A 3MMUA 1E1CA 1KRCC 1XI3A 2RGMA 3C0LA 3BURA 1BTCA 1CIUA 1FWCC 3MYPA 4O28A 3R8RA 2VDGA 1V6TA 2QF8A 3CGTA 3N2XA 1JPMA 4IF2A 2IUZA 4AZ5A 4IX0A 3IVSA 1DHPA 3T07A 1H0IA 3AIVA 1OFOA 3CUGA 1PDYA 2WMGA 1WV2A 3G6LA 3F4NA 1A4MA 3UJFA 1QOXA 1YBQB 3B40A 1Q6OA 3S47A 4ORIA 1Z69A 2C19A 4GFSA 3SCUA 3TK7A 4MM1A 5BWFA 3BICA 1R9YA 2PDQA 4R33A 3CAWA 4NP7A 3BOLA 3H2CA 3N25A 3TFXA 5HJLA 3EPNA 4J3VA 1HT6A 1UASA 2OCZA 2QDEA 2EBNA 3N11A 1KBLA 2PE4A 1X6UA 3N4AA 3OGSA 4C6IA 5KETA 2ZA1A 3WY1A 5FJUA 1YYAA 1HVQA 1N7KA 3POHA 3AHYA 3W53A 5A2CA 1EDGA 4YWIA 4AHQA 5HQLA 4OT7A 1TJ1A 1FWSA 2OELA 3WQ8A 4DF0A 3C86A 1P1MA 3ABXA 5CGTA 3N2MA 4HSNA 4JEJA 2YFNA 5CJMA 4G7EA 2IKJA 3TZNA 4W84A 1VCGA 2E8ZA 4DO4A 3CL8A 1U33A 1TB3A 4UQBA 2W27A 3WK2A 7A3HA 3GC5A 3ABSA 1KBKA 4OZOA 1MRQA 3BLEA 2NX9A 3WFAA 1W1IE 4DELA 3FGCB 3U8GA 3TN5A 5I2UA 3AOFA 4BJHA 1W3IA 3A21A 5U4NA 1T40A 5DFAA 4B5SA 3PNUA 4PA8A 3R8GA 3WLIA 2OYMA 1RK6A 4AW7A 1TWDA 3AWOA 5J5RA 3P8JA 1REQB 3SI9A 4YMZA 1I75A 4Z1AA 4DBSA 4NKCA 4GPNA 1AA1B 4FLOA 3AMCA 3FY1A 4L4PA 4EAMA 3W2KA 2HPIA 3RRXA 2F6XA 1US0A 3V5OA 4RCXA 2VEKA 1HGYA 1YMYA 4ZQMA 3U4AA 1Q6EA 2O9OA 3UCCA 4B15A 3LMZA 3DFOA 1UG6A 5AYIA 2PDMA 1WDPA 3GY1A 3CO8A 1X6LA 3NEHA 1XP3A 3WK3A 3PPHA 1KXTA 1GPWA 1WDRA 4UWMA 1E9IA 4CD5A 1XIJA 3CL7A 4AY8A 3MMTA 4O0ZA 1HIZA 4RNJA 3W85A 2JGYA 5I3KA 3N29A 3QHOA 3OZMA 3SGZA 3O6YX 4US6A 1YDOA 1ZS2A 4WY0F 2A3HA 3AISA 3RILA 3AAMA 2CCRA 4XO6A 1FWEC 3W2MA 5JIPA 4YTTA 3WD2A 1AG1O 3GIYA 1M03A 2BHUA 7REQB 5BXSA 1KBBA 5E6ZA 2QIWA 3WQOA 4HYVA 3WLMA 2H3BA 1KM2A 1KWGA 3UWEA 3MPGA 3TCEA 4FMVA 4L5ZA 5DY3A 5D2TA 2VGIA 1Q7MA 4W88A 5LGXA 3VX1A 3RU8X 1K9DA 5BRPA 3TCSA 3WUBA 2ISVA 1EDQA 4KCVA 1QT1A 1O5KA 4V1YA 1N2VA 2VR5A 4B5XA 4ZGYA 4A35A 3SCQA 1PEZA 2DUZA 3BLDA 1E0XA 5FF3A 4RZ4A 5DXXA 4HP5A 4K7YA 4OJYA 2ACRA 1BXNA 5FEZA 3RJYA 3O63A 3DBPA 3RM8A 3TROA 2VX6A 2R14A 3R4IA 4ONVA 1W3JA 2PTYA 3WNMA 2YCEA 2JIWA 1BSIA 3VKAA 4QITA 1K8CA 3AS0A 5FEPA 4LC6A 1AH3A 4UOZA 3FXGA 4A21A 2W62A 5KMYA 4Q7NA 4E2DA 1UR4A 1JAEA 3A4XA 1A4LA 2WPBA 1WUEA 4DEFA 6A3HA 1FWNA 1OABA 2HS8A 1FWIC 2OB3A 2Y7EA 3TW9A 4UQ9A 4K68A 3PBUA 3LMYA 1JL8A 6REQB 1Q6DA 1RPXA 1XCWA 2OSXA 3CT7A 3W2JA 4QE4A 4B91A 1PO9A 1UD8A 4TU1A 4U28A 4RDYA 3NVTA 3GG1A 3TSMA 3SN1A 3BAJA 1AVAA 4O14A 4JTIA 1QHOA 4GUFA 1TV8A 2WM0A 3AIRA 4M3PA 1QK0A 3NQVA 2OX1A 2CETA 5EBAA 4HPHA 2ZXAA 4RXGA 1H7PA 4U10A 1BKSA 1W2PA 4AHOA 1EZWA 2VEMA 2XVGA 4D9PA 1OEPA 1DXEA 4QSHA 3TOYA 4C6CA 4GXMA 2NXHA 3T55A 2AQWA 4XAPA 5I0DA 3UY8A 2PP3A 3W1TA 1EEPA 3VM7A 1QAPA 3PNZA 3PAOA 3VFLA 4N6EA 4ADTA 4L6OA 2DW6A 3CPGA 2VEGA 4U3AA 4C6MA 3IK2A 3HN3A 5H2ZA 2J4GA 3W1QA 3C4UA 3PFMA 1UWRA 3MMWA 3TR9A 3FHQA 1GOMA 4KWVA 3FAWA 3K8KA 1PUDA 4J40A 3CZLA 5FAGA 5HR7A 1UKTA 4KERA 1DE5A 3O0KA 3TX9A 2UY5A 1VCVA 3RDKA 4IMFA 1NAL1 4J1OA 3VIKA 1YKWA 3SRKA 4Q33A 2ZZ5A 4HPJA 1EUNA 3EX1A 1DIEA 4U5IA 4WJ8A 1V6UA 3VGDA 3BAIA 4JTUA 1KFWA 1Z44A 1VJSA 2X41A 4JNZA 1OFRA 2HV5A 4GXPA 4IGSA 2FJKA 1E72M 3WMLA 3WLOA 3LSBA 4UFMA 3GVGA 2PAJA 4GJJA 4XB3A 3WL1A 1LLZA 3LTPA 3RM9A 2P5NA 1R2TA 4UZSA 1OT2A 1VBHA 3TONA 2DZPA 4IFRA 1B4EA 4ZE4A 3IJDA 1PCWA 3UXKA 1I9CB 3SUSA 3ITVA 4NU7A 4GIYA 2JQXA 1EH9A 2W92A 4WCJA 3S3GA 2V5JA 4DBUA 3DH7A 1ZBWA 3CUXA 4QQ3A 2PA6A 1M7XA 5C9UA 2E09A 2Z0IA 2ZOXA 4UFKA 1AQHA 4X0VA 4PMZA 2OU4A 5AYBA 4Q4KA 3HB9A 4JDBA 2PF8A 3R1ZA 1S5TA 1JCNA 1CGVA 2VC9A 1G4EA 1QATA 5F1UA 1FWDC 1ZPTA 4JTRA 7ENLA 1EXPA 1XSJA 5HINA 2J7DA 2PEVA 3H7VA 4GACA 5T9BG 4AX6A 3CV6A 3VDCA 5F4XA 5JBDA 1UWUA 1EBGA 3MJMA 2J8FA 4LAZA 1GZGA 3GSMA 3GH7A 3K1DA 5K7JA 1XFCA 2IPJA 4LB3A 1Z9AA 3BV4A 2Z6IA 5KZEA 4J3TA 1NDZA 3BQ6A 5H8MA 1H0GA 3I4KA 2QULA 4KBXA 4TOQA 3WQCA 1Y65A 4GZJA 4QQUA 1U83A 2P1FA 1TV7A 3O16A 2I17A 4OHQA 4B5UA 2VURA 4IUOA 4HU3A 4RLIA 2V8ZA 2VFFA 5DMMA 2DORA 2Y70A 3VNMA 3HGJA 1V79A 1NWRA 3M07A 2YB1A 4UR8A 1BHGA 1QW9A 1Y0EA 4GUGA 4EANA 5A6LA 4E3TA 2ZBTA 3WELA 4DO6A 1PZ2A 2VGGA 2PWGA 1GK8A 4MB4A 1TREA 4DBDA 1V93A 4N6FA 2PZNA 1Y5XA 4KQNA 4IPNB 2Y1HA 1JNEA 3NWRA 2AKZA 4O4WA 2PS2A 5D2YA 5BOEA 1YXDA 2BWGA 3LZ3A 1T96A 1XBXA 3JZUA 4RE2A 1P0KA 3OZOA 1IYXA 3TJXA 1DJYA 1P0DA 1GYLA 1V3LA 3W7MA 3TA6A 3NSMA 3S2NA 2QJHA 3WUEA 3U57A 1B31A 2PF0A 2H3DA 3CAKA 1Q5MA 3AO0A 3BCJA 4KKXA 2J7HA 5LA0A 3UT0A 4WD0A 3PJWA 3TIMA 2VR2A 1XDLA 1KM6A 4QXIA 1E3ZA 1LWJA 3GRIA 3VCRA 2ATSA 3M0KA 3AIBA 4ZODA 3BDKA 1ME8A 5M2FX 3L4YA 3E0FA 2P8BA 3H12A 5HNTA 4XAGA 2HBXA 3PJTA 4MUPA 4RZBA 3UW6A 3WF4A 2ZUWA 1CLVA 1TKKA 3GD6A 1FA2A 4HB7A 4X2PA 3USBA 1MW0A 4UOJA 1TFVA 4PH6A 3Q4DA 3DFTA 4W8BA 4FSAA 1MZHA 3CEPA 3UQNA 1E51A 2YW4A 4MUZA 3O2LA 4O52A 3UZXA 3UEQA 3IJQA 2ONEA 3LLXA 1NOFA 3RF9A 4YU1A 3ZO9A 3WEOA 3PN8A 4QG9A 3OGRA 3H2EA 1E15A 4XAYA 1KLZA 4ACYA 3W00A 2QDDA 4C1NA 5C2GA 2JIEA 2E7FA 2ZX9A 1ZP3A 1GJPA 3NQFA 2DY3A 3VIIA 4EAYA 2DSUA 3I6RA 4S39A 1WDQA 4ILSA 5M03A 2D2OA 3WJZA 4O0KA 1C8XA 5D9NA 1A5KC 3KL0A 3NGFA 5FJJA 1PHQA 4NHVA 3E9AA 1F7BA 3H6OA 1UQYA 1IHIA 2VI0A 3M0LA 3KM8A 3WL0A 2WQDA 5K9DA 3BSGA 4DZIA 5D8WA 4X60A 3VD5A 4LB4A 2PCEA 1OBAA 2Q6ZA 4W85A 5FF4A 4LUYA 4NRSA 4YVXA 1H7XA 4UNLA 3QFEA 3COTA 3HQNA 1J0IA 1OG6A 2XJ7A 5AOUA 4ZZ9A 3EA3A 1PAMA 4IQJA 5EFFA 3VOIA 2POTA 1PX3A 4HCLA 3LYEA 1FFRA 1F8IA 1QI5A 1HO4A 2Z1SA 1EP1A 2OO0A 1TPH1 2QDGA 3W83A 1UJQA 4W7VA 5BCAA 2FZMA 4MNLA 2E6AA 3EKZA 3GG8A 4JTLA 3G3DA 4JDYA 3PUEA 3QRHA 1HN1A 3W7RA 5BZAA 3AUJA 4KETA 3N04A 4PGLA 1O95A 5E5CA 3A47A 3ONCA 4KF1A 3N2TA 4OV9A 4TXEA 1JCYA 5CC5A 3LG3A 3WH9A 4K38A 1H4PA 4D8LA 5K9CA 1DWIM 2WYSA 4UTWA 2OLAA 3C56A 5CSUA 4LAUA 3HMJG 1CECA 2WC3A 3ITGA 1QNRA 2EG6A 3PG8A 4O54A 3EPMA 4XV0A 1FBAA 5ECUA 1Y5VA 4M29A 4DI9A 2BLEA 2ZZ2A 1NDVA 3A23A 1V6YA 5EB8A 1B1YA 2QUTA 1LTDA 3HG5A 1YNQA 4FPSA 1A0EA 1DJQA 2PRLA 2ON3A 1R9ZA 1R3WA 4CCZA 1LOLA 3KVKA 1YLVA 3GG7A 1H11A 1KR0A 3F4VA 4UB9A 3LI1A 5HWJA 2A3LA 1OF6A 3NZQA 3FJ4A 3RK8A 1RR2A 3CLMA 2Y63A 2FZ9A 3F1QA 1J79A 2A3EA 2G95A 1JG9A 3MUAA 4P8UA 2DT2A 1S1RA 1BQCA 4DUVA 1JEZA 3SO7A 1NFGA 4DLFA 4LW7A 4IX2A 2V38A 4JFSA 3DFSA 2HXTA 4W8AA 3PP7A 1LP6A 5E93A 1DORA 3AJ7A 1I1XA 1DWGM 4MZ8A 1M65A 3WLTA 5CEWA 4GI9A 2J8TA 4GH3A 3C3UA 2MNRA 4BI5A 5CLTA 5M17A 3RGTA 1XD1A 3KHJA 4X9SA 1LUCB 4PUWA 1CEOA 4HJWA 1OY0A 4KFOA 1UKQA 2OZ8A 1QPOA 4LVGA 3UJEA 2F2HA 3W28A 4DJDD 3KL5A 4MWAD 3OA3A 1KCKA 4HN8A 1Z3NA 2PWUA 1H51A 2QF7A 1TMLA 5AZ0A 2Y0FA 1W5OA 1ICSA 5CGMA 4MTVA 2P50A 2DZTA 4XVDA 3I3EA 3WEZA 2PDCA 3M7SA 3KWSA 2D0GA 4G7FA 3VOCA 3I68A 4REQA 1MW3A 4HOXA 1C92A 1ZTVA 1GHRA 4LFYA 2V5CA 4XG1A 1FDYA 2VELA 4LEFA 4BQ4A 2CU0A 4XAFA 3GG0A 4M7TA 3W7GA 2WK2A 1X98A 2EGZA 4FX8A 3RMJA 4Q8VA 3KOYA 2F2KA 2OT1A 1DYSA 2C1IA 3ZMRA 1FWFC 3W7JA 3P67A 5DT5A 1TJPA 3NR0A 2Y62A 4KEVA 1ONWA 4CQAA 2PWVA 3P61A 1IV8A 2WJZA 4JQ4A 4Z0SA 1HJWA 1JZ6A 3CLWA 2CLOA 4JFTA 2V5LA 4E4PA 1VYPX 4ICNA 4C1KA 1JVNA 4O53A 4MNMA 4ES4A 5BRQA 3RPDA 1E71M 5AYYA 2WBKA 3KZSA 3CUHA 1OK4A 1UC5A 4O57A 3ZXWA 3B0XA 4DJDA 1DHKA 1F9CA 4S3KA 1PWLA 3TQ0A 4DUWA 1RBLA 4MVAA