2VWTA

Crystal structure of yfau, a metal ion dependent class ii aldolase from escherichia coli k12 - mg-pyruvate product complex
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
256
structure length
256
Chain Sequence
MNALLSNPFKERLRKGEVQIGLWLSSTTAYMAEIAATSGYDWLLIDGEHAPNTIQDLYHQLQAVAPYASQPVIRPVEGSKPLIKQVLDIGAQTLLIPMVDTAEQARQVVSATRYPPYGERGVGASVARAARWGRIENYMAQVNDSLCLLVQVESKTALDNLDEILDVEGIDGVFIGPADLSASLGYPDNAGHPEVQRIIETSIRRIRAAGKAAGFLAVAPDMAQQCLAWGANFVAVGVDTMLYSDALDQRLAMFKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords YFAU, 2-KETO-3-DEOXY SUGAR ALDOLASE
publication title Crystal Structure and Functional Assignment of Yfau, a Metal Ion Dependent Class II Aldolase from Escherichia Coli K12.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Lyase
total genus 90
structure length 256
sequence length 256
chains with identical sequence B, C
ec nomenclature ec 4.1.2.53: 2-keto-3-deoxy-L-rhamnonate aldolase.
pdb deposition date 2008-06-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03328 HpcH_HpaI HpcH/HpaI aldolase/citrate lyase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.60 Alpha Beta Alpha-Beta Barrel TIM Barrel Phosphoenolpyruvate-binding domains 2vwtA00
1VBGA 4FXFA 3I4EA 5TAOA 1M1BA 3HQNA 4B5VA 1F3WA 2HRWA 3HQPA 3U2ZA 3GQYA 4TV6A 4IQEA 2XZ7A 2KX9A 4TV5A 3T05A 2VGFA 3P0XA 3QTGA 3G2GA 1AQFA 1GGOA 3QV8A 2VWTA 1A3WA 4L7ZA 4MF4A 3N25A 1M3UA 3OYXA 3EOEA 3R4IA 2V5JA 2L5HA 4KCVA 1XG3A 4MG4A 1S2VA 3KHDA 4WJ8A 5JVLA 3FA3A 1DXEA 3VAVA 2XDFA 3M0KA 4B5XA 4QG9A 4ROQA 2VGGA 3E0VA 1UJQA 1E0TA 3EOOA 4DRSA 3ME3A 1KBLA 1F61A 1U5VA 2WQDA 2ZE3A 3QV9A 3H6OA 3PUGA 1OQFA 1Z6KA 2V5KA 1S2WA 3GG8A 3SRHA 4L9YA 3OQ8A 4B5TA 2BG5A 3QQWA 3PP7A 4YNGA 1PKLA 2E28A 3SRKA 1O5QA 3E0WA 4KCWA 4QG6A 4IMAA 4RPPA 2R82A 3LG3A 1KC7A 4IQDA 2HROA 2VWSA 3M0JA 3B8IA 4LSBA 1S2TA 2X0SA 1F3XA 1ZJHA 1MUMA 1F8MA 1VBHA 1IZCA 2QIWA 4KCUA 3EZ4A 4L9ZA 1O68A 1SGJA 3FA4A 2OLSA 4FXJA 1F8IA 2DIKA 3QLLA 1S2UA 1XG4A 4B5SA 1O66A 3QV6A 4IP7A 4B5WA 2HWGA 1PKYA 3GR4A 1ZLPA 4QG8A 3IS4A 3T0TA 4B5UA 3EOLA 4HYVA 2VGBA 4B2DA 1A49A 4YJ5A 4L80A 3T07A 1JDEA 4JPGA 3E5BA 4QGCA 3BJTA 3SRFA 4KCTA 3MA8A 1E0UA 3SRDA 2DUAA 4KRZA 2VGIA 3QZ6A 1PKNA 1A5UA 1OY0A 1T5AA 3KTXA 4HYWA 3HQOA 2HJPA 1U5HA 1PYMA 3LYEA 4B2DD 1DIKA 4KS0A 1IGWA 2G50A 3OYZA 3BJFA 1PKMA 1A3XA 1DXFA 3QV7A 1DQUA 4G1NA 2XZ9A
chains in the Genus database with same CATH superfamily
3KCJA 1KM0A 2XVPA 4JN7A 3NPWA 1UASA 2CBJA 2DEPA 3D6NA 5F4SA 7TAAA 4H2HA 3IGXA 2E9LA 2YCJA 2ZTKA 3GNPA 2ADAA 4IPLA 1CXFA 1WUEA 1OGSA 3HO8A 1XYLA 4S38A 4H3DA 4AHOA 3VD7A 3W2MA 1UC4A 1TB3A 1AD1A 3L4XA 4WD0A 2YDSA 1E0TA 1T8QA 3NA8A 3CPUA 3FY1A 5HQLA 3A22A 4QQ3A 3QPYA 1KLYA 5HDRA 2DDXA 4D1JA 1VEPA 2E8ZA 5HULA 5LNRA 5FL1A 5E0FA 2QPXA 1XIGA 3VPLA 1L0PA 1ZPTA 3W81A 1KM1A 5C2GA 3E2SA 3FSTA 1ZCOA 3N73A 2XM2A 1B3ZA 3T78A 3F03K 5K7JA 4J7RA 4L65A 4IP7A 1XI3A 3O6AA 1B3OA 1E0VA 2PA6A 1TCDA 5I24A 2FZBA 2OU4A 3CYVA 1JCXA 1Z48A 3P80A 3NM3A 1BPLB 2I16A 3GR8A 3VYLA 4UFJA 3AMCA 1JGIA 4QXIA 4J27A 4U28A 3H21A 2XHYA 1PX3A 1MUCA 2P50A 3N2MA 3TC7A 4PL1A 5D32A 3WK2A 5JBDA 3APTA 2HRWA 4I6VA 3NXFA 4NNCA 4BI6A 1WZLA 3CIXA 5FJPA 2PDBA 3QJAA 3TQVA 3HGSA 3UETA 4MGGA 5K4ZA 3TN5A 4MDOA 3CUGA 2FDSA 3SQLA 3H7VA 3Q4DA 1H11A 2CIPA 5CC5A 4GJ1A 1B54A 2VGGA 5CLTA 3KVJA 4AIUA 2BGNE 4O17A 5E70A 4H9MA 3YPIA 4Q7BA 4Q7NA 1XLCA 2DZUA 1F07A 3S83A 4X2PA 2DJXA 5A8QA 1IT0A 2YDQA 3PB2A 4H8HA 3DI0A 3L0GA 2BHYA 4CNPA 4CNOA 3INPA 3M0JA 4K1WA 4JTLA 1UWSA 4F0LA 1UHVA 3R0DA 4L9ZA 3ZVHA 4ICCX 3QC0A 3ICJA 2E7FA 2A3LA 2HK0A 2JBMA 4X9YA 1JNEA 1GHSA 2A2IA 3W1RA 4WGXA 3B4YA 2FH8A 2FLIA 4PBFA 3KP0A 3NPVA 2OQHA 4Z42C 1VCFA 4FLRA 2Q3OA 1VS1A 4K8HA 2CLLA 3TLLA 1H50A 1E51A 4M6VA 3B9EA 5HNUA 3L4TA 1OX4A 1P4CA 4TU1A 1PVNA 3OHMB 1ENUA 1RQEA 2VVSA 3QYQA 2PP1A 1XYZA 4GVFA 3PBWA 3W7KA 3GDRA 3WLIA 1FXPA 3ZJ8A 2X2GA 4DUOA 3LM7A 3BV4A 5F4WA 1XLGA 3ZR5A 3LCFA 4HCLA 4LAKA 1P0NA 3SAZA 5FAJA 3ZSSA 1SJAA 4KRUA 4CVWA 1Z9AA 2QVHA 4AG0A 4E8GA 3S2JA 2RDWA 1OABA 3OTRA 2E28A 4D6JA 4A3UA 1I1WA 4P8VA 1NDWA 2YCEA 1C91A 2BXYA 2OXNA 3LTSA 4Q6XA 4GZJA 4H9YA 3AJ7A 3TFCA 4N4PA 5DMLA 3BW2A 4R9XA 2X0SA 2QLYA 1W37A 3HG4A 1OZMA 1B57A 1HP4A 1KCKA 4IP4A 3MMDA 3N4AA 5DXXA 3CMGA 2I17A 4P61A 2JFEX 3DX5A 3M7WA 3EA3A 2HQAA 4M29A 4QG8A 2WSRA 1UQZA 3TTYA 3WUBA 2J47A 2RAGA 1FY6A 7REQA 2VEPA 4JBRA 1UZDA 3CQJA 5EU9A 4PTMA 1CW2A 3RPDA 2QJJA 3WDJA 2GUYA 4FR1A 3WJSA 2D22A 2XZ7A 5HATA 5IXEA 1PZ1A 1JULA 3DFSA 1W9DM 1EUAA 1S2VA 2W63A 1U22A 5IDZA 2A3EA 4DI9A 1MXDA 2TYSA 1UKPA 4DHGA 4HNVA 3U4AA 4K7YA 2MNRA 3FVDA 2VEFA 4FR6A 2VZSA 2O56A 4MNLA 3VD3A 1QI0A 2WVSA 5FEPA 1TPH1 3R2GA 1PKLA 3G1VA 1F4HA 4LFYA 2BX7A 4R27A 1X6LA 2PGFA 2CBVA 5A95A 3LPOA 1JUBA 2G3JA 4KERA 2VR5A 1TYGA 5AHNA 2CLKA 2VXNA 3FS2A 2WNNA 2CXGA 3UJRA 1I75A 4J3TA 1KQYA 1ZBCA 3KOYA 5CSUA 2W9MA 3UCQA 1GYMA 2VFHA 4CQDA 1W3IA 5DEZA 1UKSA 3VIMA 1XCFA 4HD5A 4AEEA 3KEHA 4YVPA 3WD4A 4W84A 4EK7A 1NH6A 5AHIA 1X39A 4NF7A 3AS1A 4QX4A 3LHZA 3N4FA 5DCBA 1BAGA 2FYMA 3OZOA 2J7GA 3WH5A 1HTIA 3PNUA 1I60A 3L9CA 2CNCA 1XG3A 3N6QA 1X1OA 3W1XA 1Q5MA 3IIXA 3VA8A 4CEUC 5D2YA 2QS8A 2D2OA 1OYBA 3BLFA 5AZ1A 2NW0A 3QV9A 3OBAA 5FOOA 3FA5A 3BAWA 3CL8A 4J1OA 4GZEA 1DP0A 5JBFA 4I5UA 2GQ9A 1M6JA 1Y65A 2A3BA 3QR0A 3CV6A 1IXPA 1I0DA 3VMOA 1OCBA 2NT0A 1KC7A 3D3AA 5DT7A 2OKTA 2OYMA 2VRKA 4O10A 3II1A 3ZT5A 1CGTA 3ABSA 2V69A 1E1CB 1HKJA 5XIAA 2A4AA 2FIQA 4HMNA 4XUGA 2X05A 4LWWA 3E12A 2C0HA 1W9BM 3M5YA 4HK6A 3XINA 1U5JA 5BRPA 4KFNA 4KEZA 1LOSA 1YLVA 5LZLA 4RV3A 5TQLA 1CWYA 2E5CA 4HNCA 5REQA 3FKRA 4CNNA 5CSRA 3P6LA 4WXYA 2IUZA 3OODA 4KS0A 4TVUA 4C6LA 1VH7A 4IPJA 2FMOA 5AVHA 1VPXA 2G95A 1IEXA 3SFKA 1V0MA 4H6KA 8XIAA 1I2NA 3A64A 2VMFA 1UD4A 2IW0A 2JKPA 3LMYA 5J04A 4GVIA 1JNDA 3LQGA 3AIBA 1RBAA 4JQ2A 4EF8A 2CBIA 4GQBA 2Z0IA 4GIAA 4O12A 1QNVA 3NO3A 4P7OA 1GQLA 1BF6A 2JIEA 1LRTA 3PB0A 4KW2A 3UEQA 4UFLA 1W3TA 4S39A 2PCEA 4ZXLA 4GNVA 5D2WA 1WXZA 1QR7A 3LCIA 2EPKX 4AEFA 4UNIA 1LWHA 3WQ6A 3EOUA 2GJXB 2I57A 4NZ5A 4AW7A 4GQRA 3BK0A 3QY8A 6TIMA 2A21A 1MEIA 2IQ0A 3IS4A 3BMXA 1AODA 2EG8A 3L0NA 1E4NA 3UR7A 1XDMA 1WZKA 4MPQA 3STPA 1JXJA 4AD3A 3GXIA 1OY0A 5JIWA 3G6MA 2VUYA 1CNVA 1TRIA 1CXKA 3FIGA 1JQXA 2VCBA 1UP0A 4Y9MA 3TTOA 3C2YA 3W87A 3LUTA 1MNSA 3ARQA 4AHPA 3VGBA 3DFYA 3W02A 2VZVA 2BZNA 3HJEA 4QJ3B 2H6RA 4ENLA 4GC3A 3CUZA 3QXBA 1H7RA 5DY2A 4JHMA 3EWWA 5B7YA 2PDNA 3P8IA 3N04A 2L5HA 3T9PA 2NXIA 5A8GA 1OT2A 4J3UA 2CLFA 1CLVA 1ONEA 4LNCA 1V6UA 4AZCB 1XLBA 2GYIA 2PLKA 1SQ7A 3WMCA 1PX4A 5HJYA 4EIVA 1GW9A 3G0XA 1BD0A 1JG9A 3NSXA 1EO5A 2D0HA 1W8GA 2PRMA 3BDKA 3WQOA 1C8QA 2QCCA 3J7HA 4PEEA 3TYZA 1KNWA 4NJHA 4IF2A 1XHGA 1JPIA 4IQDA 4X22A 1XQKA 3P14A 1ZQ5A 4UQCA 1OFDA 3VFLA 3U57A 1PIGA 5JUVA 1QI3A 3TXZA 3UZYA 1Q7ZA 4E3VA 3N12A 5GNYA 3GXPA 1SZGA 3IARA 4HU3A 1CLXA 3TK7A 3R0UA 1FCUA 1AW5A 2GK1A 1TUXA 3IUDA 3TSBA 4AXNA 2Q01A 2ZRYA 1MFVA 2J7EA 1OC5A 3KOXA 4GMEA 4NZ3A 1HKMA 3W25A 3S9ZA 5C2XA 3M07A 3KBMA 4GXPA 5J5RA 3PJTA 3B0YA 3UCDA 4LVBA 2G50A 4QNEA 3IK2A 1RVGA 1H2JA 3LDVA 4LNYA 4P2VA 5A5WA 2Y85A 1OWQA 2X40A 4LYQA 1E6RA 1VB9A 3E2QA 4Z1BA 2ZX5A 4TV5A 4IQLA 1WXYA 3IV8A 4FSAA 3FNDA 1MRQA 3ITYA 3WENA 1GG1A 2F9RA 3NWRA 3PBYA 3UWYA 4B4FA 5I00A 3GD6A 3WNPA 1ZENA 2F6XA 4RNFA 3KCLA 1P43A 3MUXA 1ISYA 3WLTA 2NUWA 3KLKA 1DL3A 2ATMA 4H7CA 4C65A 3E74A 3VC5A 2YA1A 2C15A 3IANA 3AU2A 5G2IA 3MYPA 2JKEA 2IPWA 1AJ0A 1R3VA 3R94A 3S2CA 1KRBC 4DWSB 1V8EA 4NXKA 1YTEA 2ACQA 2VWSA 3G0SA 4WOZA 4WGHA 2C3ZA 4BI7A 2F38A 2E67A 2DT2A 4B9ZA 2R1PA 1QPRA 1PKYA 1RZMA 2OX1A 4MY1A 2X09A 1F2JA 3WEMA 4JEJA 1T99A 3T4CA 4WK9A 3CAQA 1RK5A 4NNBA 3SRFA 1F3TA 5C71A 5KTLA 4Y2WA 4S3JA 3QZAA 5AYYA 1FWTA 3H7RA 2Z1KA 1IEIA 3K5XA 5CSYA 3QMTA 3I3EA 4HTYA 1ITCA 2FPTA 1PCKA 1O60A 5E0CA 3TKFA 3WQ4A 4LPCA 2WMHA 1P7TA 3CV7A 3W1NA 4FP1A 2O4QA 2POZA 4MPKA 2X2YA 3H2OA 2VDHA 1UKOA 1OT1A 1P48A 3IJLA 5BWAA 3WMBA 2WLZA 4H9UA 2UZ9A 1A5AA 1WCGA 4JYFA 3GG0A 4AD2A 4YWIA 5BMWA 1H0IA 1SW0A 1DXEA 3O15A 4QCEA 1SJDA 3EB3A 4F40A 5DRCA 4IGMA 2DQWA 3N2CA 4F9DA 4UOZA 5CC7A 4GVGA 4PMNA 4PUMA 2HCVA 2XSXA 4YPJA 3ZJ7A 2Y5SA 3NZGA 1JCMP 1K3UA 3DG7A 1LG2A 3NNTA 5FA5A 4AD1A 3W83A 2OSXA 4ZFCA 2E3ZA 1FWNA 4XKYB 5IRPA 1CBGA 2GVEA 1TE1A 3BLLA 4C1NB 3ZO9A 4QJ1A 1IZCA 1E43A 1BYCA 5E9AA 4RK8A 3TOPA 3VDCA 5CJ5A 3VIGA 2YL9A 5FJRA 4DJFC 1NFBA 1HF6A 2WZTA 2WYSA 3UR8A 3UBPC 1IZJA 3LZ3A 2WV8A 5BCAA 1A5UA 1GYLA 3WH9A 3N13A 5FF2A 4AIEA 2BFGA 2P76A 1FCVA 5CH9A 2OLHA 4GBDA 4Z1YA 4AUBA 4BS0A 3EEZA 1F6KA 2QIIA 4QJ5B 1P6CA 3T05A 3K30A 3KZSA 4ORIA 4PCTA 2WSKA 4D8ZA 2AMXA 1W1B1 1LLWA 3VIOA 5C6MA 2A5HA 2NX1A 4XAFA 1JYNA 3NSMA 3DIPA 3UZ5A 1H7XA 1E1EA 4GCAA 2KZHA 1KFCA 3UPMA 2QAPA 2XIBA 1Q6RA 4KIEA 5LA2A 4IPPA 4JTGA 4MJ4A 1XH1A 3LHTA 1K6AA 4BI5A 3URNA 4NILA 4DPPA 1DJWA 3IJ9A 5CPLA 3PPCA 3KTCA 3S5NA 1K8ZA 4JYDA 3UXAA 1OYAA 2OYLA 1GUVA 3RLGA 1EX1A 3N6HA 1A5KC 4XIMA 3UG8A 3DENA 4IMDA 4GQGA 1IXQA 4KGLA 3QN3A 4N6EA 4MKVA 2WM1A 4MLJA 4P5UA 1ISXA 1CXEA 3ZLFA 2PS2A 3M0LA 3SEPA 4HPXA 3E96A 2CZFA 3HBLA 1W1IE 3VCRA 1C7SA 1JCJA 4DN1A 4EPKA 1XH2A 4CQ9A 1EWDA 1XGDA 3RG6A 4PB5A 1EKOA 1WX0A 2YCIX 3K46A 1K4GA 2CEQA 2FZDA 4WUIA 1TQJA 3MZNA 1J10A 2DUXA 1GGOA 1EFZA 3S6OA 3QYSA 3N29A 1TWIA 1AJ2A 2C8NA 5F7UA 3EWDA 2WB5A 4QP0A 4H01A 1T6MA 3DBNA 3WD1A 1VEOA 3DEQA 2FZ9A 1VCVA 3TLQA 3W6LA 4U2ZA 1EBGA 2I1OA 1NWRA 3AAMA 3K2GA 3LPGA 3VOGA 7CGTA 1S5VA 5EPDA 3CQ0A 5LYRA 3T42A 2C1IA 3VKKA 4K3ZA 4EXBA 2YBUA 3G1SA 3VGDA 4FX7A 1MWOA 3DKLA 1VIWA 4F48A 4ADTA 1S2CA 2AL2A 4QDWA 1S2UA 4PA8A 1NOWA 2BHUA 4XKMA 3ENLA 4HYVA 4LQ1A 4DQWA 4LCRA 1G4PA 2Z6IA 2XIMA 4ZQOA 3LTYA 1CB2A 2DW7A 3W1QA 1H4PA 1NOFA 2E9MA 2XH2A 1DEDA 1EYEA 4P7LA 2FTWA 5BXPA 1XX1A 3F7JA 1V3JA 5A2CA 3LYEA 3GTIA 3LGGA 5AYZA 4PMZA 4FXFA 1FRBA 3MB9A 1J11A 1E6XM 5CQ1A 5HJLA 3RM8A 3B0PA 4O50A 1W1VA 5CBJA 4HCHA 1PJ9A 1RA5A 5BRQA 1Z89A 3EX2A 1XLFA 3SJ3A 3NDYA 3Q58A 4QNWA 5MKGA 5ABTA 3JW7A 3W7NA 1D8WA 4KWSA 1QXLA 4C6PA 1B4EA 1QW8A 3TSMA 3LN3A 3MKKA 2OTDA 2ZX6A 1EL3A 4DRSA 2WJEA 3S1XA 2H8ZA 1K9EA 4A8RA 3MY9A 2NVDA 4GK8A 2XH7A 3PFMA 3SRHA 1IWBA 3GYEA 2I9EA 1GJWA 4P8XA 4DF0A 2DGAA 1XISA 2EPMX 3E0WA 3U8GA 1IWAA 4IJRA 4AWEA 2P1FA 3PN8A 3FK4A 1J0ZA 2BOFX 2RJGA 4J9JA 4S2BA 3VK5A 3NEHA 1YTKA 3MW7A 3ARSA 2GVGA 1BKSA 4BJHA 4G1KA 2XGBA 4AMAA 3WDRA 2A7NA 3MHUA 1TVNA 5ECVA 1YPIA 3UESA 2NQZA 3W4RA 3CLMA 1LRQA 4O0KA 3BH4A 2OCZA 1ALDA 2WAGA 3OLGA 4ZXOA 3W74A 3AMGA 3AROA 4B92A 4V1YA 1PYMA 1ELSA 4MHBA 5I3IA 3NQ2A 3C61A 3QLDA 4A4AA 1S3TC 1GKQA 4MYAA 2HBXA 4EPEC 5G1TA 3I10A 3A4WA 2V5DA 2Z6JA 3HGOA 2P53A 4A3RA 1CGWA 1TPC1 3G1DA 1A0EA 2XG9A 4C6OA 5DMNA 4X3ZA 2XJ7A 3FXGA 1KTNA 5CG0A 1A4LA 1RY0A 3OYXA 2NXHA 1J12A 1W9PA 3UXKA 3USBA 3IVUA 7XIMA 3SUSA 3PPHA 3LS9A 2ZA1A 4U3AA 2E68A 1I2QA 3WLSA 1ZSXA 3KX6A 2DU2A 4V1XA 4F2BA 4GCXA 4LRTA 2IQDA 3OGRA 5AHMA 2HS8A 5FEZA 3OBKA 3MUAA 1WDRA 4QDPA 4DXKA 3ARUA 4XUYA 2ZADA 2CZEA 4DLMA 1EHAA 2EBNA 3I7SA 1OM0A 1GHRA 2H8XA 3GXNA 3WL0A 5I79A 2JEPA 1XG4A 1XIDA 2TPSA 3FYOA 2XU2A 2WQPA 4DB7A 1HJXA 3QY6A 1GOKA 2ZX8A 4Z1CA 1JYXA 3P74A 3SCWA 4IG2B 5LNWA 2E25A 1CDGA 3QHMA 2J13A 1W0MA 3WJXA 1W3KA 1UD3A 2ZRZA 5H91A 1S5WA 4GQQA 2AGTA 1Y5WA 2FTYA 4UTTA 3CB3A 3U5YA 4UZSA 3K8LA 3P5ZA 3GIYA 4HHLA 3BE7A 4NG3A 3FYPA 4RXGA 1PWLA 3BSHA 1KXQA 2RUSA 4HA4A 1A3WA 2INFA 2PU1A 1IWPA 3NUKA 2C13A 5GJMA 3GK0A 3LM3A 3VKCA 3RNDA 2FJUB 2WMIB 2WQDA 3STCA 1JAEA 4ZEPA 1B3WA 5A8NA 1XKJA 4KESA 1XH0A 2ZUSA 2FB3A 5CLWA 1Q8AA 3B9NA 2ZA3A 4HPGA 3QOMA 4MYXA 3RR4A 4GA8A 4WDUA 1Q3NA 4GJJA 2HNEA 5DX7A 1VKFA 3S4TA 1BYDA 3GWQA 4JIIX 1YBQB 3VGGA 2BVYA 2J88A 1REQA 1ZNNA 3CK5A 3WMLA 3R43A 5G4EA 4N9CA 1NFGA 4H83A 2CITA 1RA0A 4WSHA 5T9BG 2R91A 4A29A 1ESWA 1Q6LA 3H55A 2FH6A 4M82A 5HK4A 1AL8A 3WLOA 4LC6A 1C8XA 2ONEA 4XAPA 3UJEA 2DSZA 5EB8A 3NQBA 3WBEA 3P60A 3CHFA 4CQAA 3PPFA 2PTZA 3L65A 1Z7AA 1CT5A 4L6HA 1PZ3A 4JHOA 3GZ3A 3W28A 1KFKA 4IISA 3ZOAA 3U2ZA 3MSRA 3AUJA 2YR1A 4XVEA 1ZBWA 5HQEA 3RFAA 4M81A 1GTEA 4TX9A 1Z41A 1XD0A 4G7EA 3LRLA 1J93A 4GYKA 3ZWTA 4S3EA 4UWMA 5CC3A 3PUDA 4P7QA 5G2WA 4CGTA 4FALA 3GTFA 1A53A 2YDAA 3WN6A 1ONRA 4FB7A 2W6RA 1GVRA 1UBPC 4ERGA 1Z44A 1TA3A 1AQ0A 1NF0A 2VDIA 4JQ1A 3HG5A 1UR1A 1W2PA 3BL3A 1XLKA 5EBUA 1TRDA 3LMZA 1KBBA 4XZLX 2WW5A 1JYVA 1RVKA 4KKXA 4QG6A 1I0BA 1UWQA 1S5NA 3FX4A 4ICMA 2QJHA 2DVUA 4PB3A 5F2MA 3NZRA 1PTDA 3OA5A 2PDJA 2IKIA 4E2VA 1H5VA 1NSJA 4E2OA 2VC5A 4A21A 3AS0A 1HGWA 4DNHA 1MDLA 1HKVA 4UUIA 4XD6A 3SCOA 3U2EA 1CIUA 3UWQA 2V0TA 4HPNA 4ZMGA 3MVTA 1FWJC 5LGXA 4LU0A 4BWLA 5FEXA 3V1HA 5A6BA 4XZ9A 3BJFA 3DBPA 2XSBA 1BWVA 1LZOA 3NQMA 5KETA 1V3IA 4PMRA 4V33A 3LK6A 3WQGA 4PYSA 1ZS2A 4HHHA 5HBFA 4DUXA 2ISVA 1JPHA 2YIHA 3O16A 2CFFA 3G2GA 3AALA 2ZZ2A 3VUSA 5FF4A 2BV9A 2VOMA 3IIVA 1DWJM 4L6DA 2BXZA 4KF1A 4ROQA 1UWTA 4JFTA 1H60A 3NEVA 4QITA 3SGUA 1J5TA 1PL9A 4ZCWA 3MT1A 1L2UA 3UA3A 4A3YA 1TPWA 1FHUA 1AMYA 2V5CA 3EMQA 4Q8TA 5CSSA 3TWAA 3AIUA 3B03A 1JAKA 3MV11 2OELA 2ZTJA 3KZPA 4W89A 1ZCCA 4FK9A 2C19A 1CGUA 3HFTA 3O6CA 5D02A 4JN6A 2W79A 4TQTA 3C0SA 4H9ZA 3V7PA 1BWKA 4L4OA 4IJBA 3HPAA 2VP8A 1OK4A 2EXOA 3EWUA 3PBVA 2VR2A 2OO0A 2A1YA 2Z25A 2WMFA 4YJ5A 4CN4A 3WH8A 1TWDA 5BWFA 2E09A 3AWOA 3A21A 3T55A 2QEZA 1UD2A 3QZ6A 4WHBA 3K1DA 3GHRA 5E0KA 4JFWA 4O8RA 4NJJA 2QNEA 3T7VA 4G2DA 1YDOA 1DHPA 3W2KA 2LLEA 4JTFA 2WKLA 5PTDA 4M7SA 3MYOA 1KFBA 2R14A 1CLKA 4LXFA 2Y89A 2J79A 4IMCA 1ZL1A 2E4TA 2QDDA 3HQ1A 3W70A 1SPQA 5KZEA 2HVNA 4AX6A 4ACZB 1KFJA 1RD5A 1UD6A 3DFHA 1VRDA 4Q4PA 2GVJA 4QE5A 5BU6A 4FX6M 2V5KA 3KW3A 3LV6A 1JRBA 2WNZA 3CL6A 1G94A 3GKFA 3DYOA 1EA9C 5LKYA 1EO7A 3GTXA 3DI1A 2G0WA 2NLIA 1W5MA 2PODA 8TIMA 4LUYA 3VNMA 3O9NA 4H41A 3AIQA 4WQ6A 2GJLA 2PP3A 4WJXA 2J7BA 4JTUA 2ZRWA 2INEA 1W9VA 3QM3A 5EMYA 4I8DA 2B7QA 4AMCA 1PPIA 1RD6A 1FCBA 4RV8A 5I2UA 3FXYA 1E55A 3G3MA 1F9CA 4JCLA 3NCOA 3T08A 3MKVA 1DIEA 3OA3A 2Y62A 1O7AA 1SFLA 1GCYA 2R1LA 2POTA 4BWLC 1C8YA 3URAA 1LWIA 4LYPA 5JBEA 3BGJA 4POCA 2PFHA 1UB3A 4GJIA 4UTLA 4UCFA 5L9FA 1AG1O 4EKJA 4N02A 5DCDA 1XIJA 1JL8A 2ISDA 4IH3A 2WK2A 1TV8A 1X8CA 3JS3A 3I3BA 3K4AA 2NXGA 2NLYA 1QNRA 3IEBA 1W17A 2XM1A 1YX1A 3MBDA 1UWAA 2WMGA 1F61A 3EDKA 4CD8A 3DHUA 4O13A 3GNDA 5AHLA 3G1XA 3TQ0A 4TR9A 1OFBA 1GOWA 4HSHA 4JIEA 2Z1BA 1O5KA 1F05A 2GDVA 4I7UA 2BNJA 2DJLA 1FWSA 3M0ZA 1E3XA 4U4MA 4UMCA 2C91A 4V2XA 4PMOA 2Z4GA 2NUYA 4UMAA 3W7PA 4N7QA 3A4XA 1O66A 4CCEA 4QSHA 4I9JA 3EOLA 2PTWA 3IGHX 1EDQA 3ZSTA 4Z08A 5EY5A 4XQ6A 3T0AA 2PWGA 3T07A 3GIQA 1R7AA 3UGRA 3GXDA 1QHPA 3A24A 3IRSA 4R88A 5KZDA 2VENA 7PTDA 4QISA 3THCA 2WMKA 2Y70A 3VM7A 2GOKA 3F5JA 1GVQA 2D2HA 2D0GA 2H9AB 4FOUA 4O1BA 1H7NA 2BXVA 3BPWA 1V3MA 3I6RA 4W8AA 4AF0B 2Y24A 1WBHA 4MWAB 5M5DA 3VKAA 3VOFA 1HKIA 4OV9A 4IWWA 2TSYA 1FCQA 1QNOA 1Q7QA 1VFLA 4UQ9A 3WQWA 5BOFA 5HNTA 3MPGA 1KA9F 5LNVA 2YB4A 1U1JA 3UVAA 5CAKA 4QR6A 1Q4NX 3WQPA 1OC7A 3WNKA 1VFSA 3B8DA 5CJNA 1TIWA 4B16A 3RX2A 1A5MC 4OGZA 2G3IA 9RUBA 4YNGA 2V2DA 1KBIA 1UC5A 1QOQA 2G3MA 2EKCA 1QPNA 2QGHA 1SO3A 2HROA 3W37A 4RXFA 1VIZA 3RF9A 1DTUA 2XSAA 4NY2A 1FVPA 1JRCA 1MUMA 1V6WA 2Y8KA 2Q8LA 1R85A 3P93A 4JIRA 1EDGA 5FF0A 3O0KA 1I45A 1RCOB 3MSGA 1DIOA 5HNNA 1VC4A 3GTHA 3ZVIA 1OBAA 3BJTA 3TVAA 1AD4A 3MHGA 5DLCA 3I7RA 4IXXA 2WC4A 4GC4A 4NT0A 1E71M 1W1A1 1ITUA 2W27A 3NAVA 1GPFA 1EF3A 3KE0A 3ZM8A 2OX4A 3M0MA 1ADSA 3WFLA 7A3HA 4GZ7A 2FVLA 2ZXBA 3WF3A 1AQFA 2DSWA 3M16A 4NHVA 4DZHA 1THFD 3SUTA 1EGMA 4IHCA 4L1GA 3S47A 1VQTA 4XX6A 1QI4A 2DSKA 4O1EA 3REQB 3V0TA 4S2CA 1WYIA 2QAFA 4CQBA 2G41A 1TZ9A 2ZIDA 3RILA 1UJQA 3AYSA 3ARRA 3N2BA 4XD5A 3O2LA 1EGZA 2ZVRA 2DIJA 4DYEA 4RE3A 4AQLA 1S2WA 3B40A 3E2VA 4AU0A 4JXCA 1OF8A 3C3UA 1XUUA 4M80A 4S3DA 3LCGA 1UUMA 5FJJA 1R86A 3Q65A 2DZXA 3A5VA 2V8ZA 1Y7VA 4S3AA 5D2TA 3TROA 3M4HA 2Y0FA 4LT9A 4U5IA 3H12A 3WBXA 4I5XA 2UY4A 1J0HA 5GVJA 1OFQA 1UP2A 4RCXA 4U3CA 2IPGA 3EX1A 1KM2A 3QKZA 2REQA 3KFTA 3MJMA 5ABHA 3MP4A 4HNLA 3W85A 3GC5A 1MDRA 2ALDA 2ZX7A 2YDRA 3LHWA 3MCMA 3V1PA 4AWUA 2DT0A 3D0CA 3LLDA 1OJXA 5IM51 5EFDA 1JCTA 1WAUA 1YQ2A 2V3FA 2CCRA 4RZ5A 3F1QA 3T09A 1H09A 1HG3A 3NIYA 1ZFJA 1XC6A 5HUPA 3RLVA 1J18A 3QV8A 4I3GA 4JTTA 1LOQA 3BLKA 3IJ7A 2WC3A 2VFEA 1QATA 1Q6OA 3CO8A 2OWXA 2V6AA 3SCRA 4DI8A 4PUDA 1NF7A 4I9MA 3GFZA 1RCXB 3KOWA 3WQVA 4O57A 4JTSA 2XFFA 4FNSA 1V6VA 3DH7A 3EA2A 2NSXA 1E0XA 1Z6KA 1XICA 4M7TA 2FTPA 3PY2A 3GKAA 1B3VA 2AOSA 1WBJA 5KSWA 4OWGA 3JZUA 3LX9A 5K9XA 3PNZA 3THUA 3AHYA 1OX6A 3RMJA 3ITGA 3BO9A 3VNIA 2EJAA 2DP3A 3DDMA 1J6PA 3L4WA 3SGGA 4YCOA 3SECA 3LXBA 4HZ8A 3GW0A 3QPEA 1PIIA 3GU1A 4M24A 4LBRA 4PUEA 2H3DA 1O5RA 4C1KA 4MNKA 1DWFM 2DV0A 2F6UA 2WZMA 5EMKA 3H4WA 3EB4A 1E6QM 2JE8A 3I3DA 3NQ8A 1Q66A 1MO0A 2PF0A 1B90A 2BOEX 5CZJA 3PANA 3ZWSA 1C9DA 4FX8A 4C7DA 5G2HA 2FPVA 2R24A 4RZ6A 5ECUA 4C6EA 3EKZA 3C5QA 1FXQA 2P0OA 1JYWA 4F0HA 3AXXA 4ZE5A 1XPGA 4GIYA 4HBKA 2XFWA 3S5SA 2Y61A 1LOLA 3VDAA 4X0NA 3WD0A 2CYGA 4RDYA 2GWNA 3QRHA 3SJNA 5DANA 3W1LA 1MW0A 3MSYA 2I56A 4QIUA 4W5UA 2B7OA 1MZHA 4ZOAA 5HANA 4QJ4B 3FOKA 1M53A 5GNXA 2Y4SA 4QSFA 1FHLA 6TAAA 5DELA 2F2KA 1R2RA 5AYIA 4LAOA 3CH9A 2W5FA 4RJEA 2BY1A 2WKGA 2NQLA 3QGKC 4IJCA 4NI3A 1FWAC 3W1UA 1Q6DA 2PB1A 1MW1A 4LVAA 4F8XA 4PCNA 4H6EA 2ZQ0A 3PZVA 5JU6A 1AFSA 1UWRA 3D46A 3BMVA 4KGJA 2YKKA 3WY1A 1WKDA 3SUWA 4YTTA 4ZZ9A 4R9OA 4KCTA 4NX5A 3HV8A 4B4HA 4W93A 4OZOA 4DO5A 2DUAA 2BASA 1WDDA 4XISA 4ML4A 1KD0A 3JR2A 3M9YA 4QAWA 1A5OC 4B5VA 2ZXQA 1TMQA 2BSLA 3AHVA 3CLWA 1RQHA 3URBA 3W1PA 2E5DA 3OG3A 3GAKA 3L5LA 5A6BD 1W91A 3CQIA 3MTWA 5A8MA 4MADA 2CU0A 5D9PA 4N42A 1XBZA 4KCVA 1E5NA 2Q8XA 2QV5A 3VI2A 5D9OA 3SUUA 3HPZA 3F4VA 2XISA 3QZEA 5HWNA 1E1FA 2GJXA 4K8EA 7TIMA 3BLDA 1RQBA 3UR2A 2W0UA 1ZBKA 2VFGA 1W5QA 3GDKA 3UPWA 3IK4A 1UZHA 4AISA 4U10A 4M8UA 4L1XA 4DF2A 4R33A 3IIOA 2DQXA 1GONA 4HQVA 2QCDA 5I3FA 1KFWA 3WEOA 4A22A 4GYPA 3M43A 4B9YA 4W7UA 2VEMA 1OX4B 1S2TA 4OTKA 1W6TA 3GE7A 3M0XA 4N4QA 4MJ2A 3GZAA 3LGDA 3RMEA 3R58A 4JFVA 1QW9A 4FNUA 1V77A 1UQYA 3H2EA 3TNBA 3UNTA 1FHDA 2FGLA 3F4NA 4TX8A 5IBXA 2ICSA 4C6KA 4GFIA 5L6UA 2FVMA 1VBRA 1H1NA 3W29A 3VABA 1OX5A 1JCNA 1MXGA 1OFRA 3HPSA 3RU8X 3DERA 2O92A 4PBGA 4Y9AA 3DESA 3JRKA 5AHFA 3LNMA 3BCJA 4A8NA 3D47A 5DCEA 2OZTA 4MUZA 3M6YA 5I03A 3AUOA 2FQIA 3KBJA 5C5YA 1JZ8A 3GC4A 5T9CE 3CWNA 4LTSA 1CTNA 3TN6A 4CD4A 4M0XA 2J9XA 3WQCA 4K37A 2VI0A 4GNJA 4H6RA 3TTEA 2VX7A 4KFPA 4ZE4A 1AQHA 3L21A 1OG6A 1ODZA 1ZP3A 1TX0A 3FSUA 1GVYA 3RU6A 1UUOA 4E8DA 4HCDA 3VIIA 3N1AA 1J96A 4PUJA 5BW6A 4UQDA 5CBIA 2B0MA 4E4UA 1UJPA 1NM9A 2BY0A 2ODOA 3VGEA 4O1AA 4CKQA 4Q4KA 2Q3RA 2W3ZA 2P8BA 4FNPA 5EA9A 1EXBA 4X61A 5G4WA 1TZ7A 1ZP4A 1OIMA 2E8YA 4DZAA 4Z2HA 2XH4A 1H63A 5D33A 4IP5A 1UW9A 3SN4A 1OHLA 1H51A 1R9XA 5TF0A 3KOFA 4GI6A 4MIMA 3B3DA 4ZQRA 3EXSA 1ZAHA 3P67A 3HQOA 3LI0A 3WBAA 3OVGA 4UTUA 1L2QA 1HL9A 2D3NA 4BK9A 2JK2A 2XIIA 4LVFA 3CUXA 4OOUA 5LXEA 5C9WA 2EQDA 3TCEA 4MB5A 1ME9A 3VMPA 3E5PA 3ARVA 3LA4A 4DLFA 3UERA 1SMAA 4WRHA 1M03A 1TPVA 2ZUVA 1KGXA 4W87A 5J5DA 3WFAA 4IIBA 1X38A 4OIFA 1VHNA 3HA1A 4KWUA 3TTQA 3KXQA 4ZO9A 4YYCA 3GXMA 1F73A 1WOAA 1IXOA 4MFEA 2XVNA 1IYXA 1XW8A 1S5MA 2P3EA 3P3BA 3L2IA 3CO4A 4RDZA 1PS9A 4UTHA 4YS1A 2ZC1A 3W7JA 3C0LA 8RUCA 1UH4A 1WB0A 2TMDA 4GYPC 1DIDA 4DJDC 1BTMA 3H2FA 3ISIX 1GOIA 1IHIA 3GS6A 4LUTB 1B1YA 2OEMA 3ALFA 1JDEA 2I5IA 4Y8FA 4CEXC 5IBXC 3ZR6A 4HU4A 2AAMA 4LJ3A 3OW1A 4KPLA 3CUHA 3OO2A 1S2AA 5EYWA 1GWJA 4O16A 4HKPA 1F3WA 4N2YA 2NSOA 1ZZMA 3CYJA 1I1XA 4NP7A 5AB3A 4KFOA 1MQPA 3DHDA 1YHTA 4HMCA 3ZR4A 1VYSX 2GWGA 3L2LA 3M0HA 3SBFA 3ZLHA 3SGZA 3T4WA 5LA0A 3TXVA 2OB3A 2HVMA 4H9VA 2IXUA 3H24A 4GUFA 2VURA 1GG0A 4JIHA 1XPYA 2PGEA 5F2IA 1Z8AA 1JPMA 3B8WA 4JTIA 1SR9A 4NAFA 3NTYA 3M0IA 1LWJA 2R94A 2FGZA 4S3CA 4LB3A 3L4YA 4TO8A 2ISSA 3AOFA 3VX1A 3RPMA 4D6HA 2DT3A 3ZIZA 1J9YA 1VJZA 2GDQA 4ERIA 3CNYA 1KKRA 1XCXA 4WY0B 1XBXA 2YSWA 3P82A 3AHZA 3PZTA 4ZGYA 3FJLA 1GVOA 2PWVA 3CUIA 3GX9A 1O1ZA 1K03A 5B80A 2PDGA 4GGHA 3U7VA 4BQ2A 4D1IA 1HP5A 5JXQA 3LERA 1Q7MA 4RL3A 5I5RA 3AS3A 1W5OA 2ZRVA 3RCYA 1VCGA 1VBJA 4Y7EA 3CMJA 4HOWA 1I2PA 1NVMA 2CESA 2PRHA 4GHRA 2GGIA 2OO6A 3VIJA 3V5FA 1EZWA 4BQ5A 3KBVA 5LA1A 4E6MA 1GW1A 3H22A 3T8LA 1EPVA 4DWSC 1FFRA 2WJZA 4FIQA 3CM4A 4UCGA 1XQLA 3T40A 5FI8A 2A85A 5CGTA 1DYSA 3TMLA 3BQ5A 5LIXX 1R2SA 5EGRA 3TQKA 2ZRXA 2P88A 3LHVA 3QSRA 2ZVIA 5IHSA 4DBUA 4GIEA 4FXSA 3QOKA 2DT1A 1VYRA 1VF8A 1EBHA 5CZKA 2JALA 2JEQA 4HPJA 1J0KA 5U7SA 3R79A 1S1PA 3ATZA 3WUGA 4ZODA 2UV8G 1AUSL 3M41A 3OP2A 4PTDA 4XTIA 2VRJA 4LALA 1XLLA 1WO2A 1O4UA 4YU1A 1UH3A 5XINA 3HG2A 3HTWA 4GUHA 2HZGA 2WVUA 3Q2DA 1XXXA 4FAMA 1UMLA 3MQTA 4JFUA 4ONVA 4LX4A 2DZBA 3VC6A 3Q45A 4M3PA 2X0HA 2SFPA 2PZNA 4WY0F 1W8SA 2OVLA 1IGWA 5C8BB 3FVMA 2EG7A 1VJSA 3QV7A 4QTGA 4AVFA 3FGCB 3AXHA 1QVBA 1QI2A 1WE5A 2F2HA 5I6SA 1IR2A 4NZ1A 5FIPA 4XAZA 1BXNA 3T0DA 1QWKA 1L8NA 1XJBA 1P0DA 3AYTA 3NR0A 1UYQA 4NSBA 4HK7A 2XYLA 3TE9A 1TPFA 2IKGA 1W5PA 4AZ6A 3PSWA 4QM1A 1FH7A 1HNYA 1CGXA 1EF2A 4GIRA 3EDEA 2D2GA 2BP1A 3N34A 5I02A 1L6GA 5I3HA 2GK1B 3K8MA 1FWRA 2GL5A 1E15A 3M6DA 2X1SA 3TIMA 3DZ1A 5A8OA 1E56A 1LLOA 2QCEA 2GOUA 2HMCA 4DYKA 2RFGA 3H53A 1KR1A 1H62A 2IXVA 3PFRA 2TODA 1U1UA 3E0FA 4IIGA 3T0BA 1EJRC 5GQBA 3BW4A 1XRTA 3FJ4A 4R7WA 3S0CA 1IZKA 4AWTA 1UR0A 2RHGA 3F2DA 3EXRA 1KM3A 3GUWA 1UCWA 4JYEA 1SZEA 1Q13A 4MZ8A 4UTMA 2ZDRA 3MA8A 3VCNA 2Y5JA 1XLIA 3CU2A 1IIGA 1FOBA 3GUGA 3QVQA 4BQ3A 4PODA 4RLIA 2PU0A 1H7OA 1XD1A 1AH0A 9XIMA 4GGBA 3S6DA 4J4KA 1SO4A 1KO0A 2CZ5A 2W92A 3UXIA 3GNOA 1PDZA 5GJPA 4J3ZA 1AW1A 2FZ8A 1NY1A 1TR9A 4M19A 1BYAA 4IQEA 1DHKA 2IPFA 1UKQA 4DAFA 3N9RA 4FMVA 3S2MA 3WX7A 4BEQA 2PAJA 2CPUA 4DF1A 1FWIC 3ANVA 4XV0A 3ARPA 3QQ0A 1W9UA 4J28A 1AW2A 1JJKA 1G0CA 3CAKA 1BGGA 1HKWA 4XB3A 2Y7EA 3U7BA 2PPGA 4JKLA 1VZWA 4Q4SA 3R5EA 4O52A 1PO9A 1S38A 3EWXA 6REQB 4AY8A 5B7ZA 1V02A 1PYFA 1FX6A 3CQKA 5TD4A 5JIPA 4JTJA 2R1MA 6PTDA 4Y9PA 3SW6A 4DEFA 1Q6EA 5HWJA 2PDUA 4KBXA 1V93A 3RX3A 3NOEA 4HPHA 5M2FX 3NYZA 3A12A 4IT1A 3XIMA 2XN0A 4YN5A 1ML1A 4C6BA 2WMJA 2GZXA 3P62A 4MDPA 3GB6A 3UYIA 2DUZA 2PURA 3R7MA 3PWAA 4FF5A 2J74A 4N6FA 1P6BA 1ME7A 3PZMA 2TAAA 1M1BA 1EA0A 3MZ2A 1S5TA 3TYBA 2B4GA 1VFMA 1HJVA 1FQ0A 4LAZA 3BAKA 1CXHA 4C6QA 3QTGA 5DQPA 2OSWA 3BGAA 1QJWA 3V75A 1KWGA 3UZZA 3ZXWA 1YXYA 2F84A 3H70A 4P7NA 1XRSA 4WKHA 4NAEB 3ME3A 1QNQA 4PMQA 3LPPA 3BAYA 3PG9A 3DKJA 3IJQA 1W1YA 4L6OA 2QMJA 3UGVA 4UFIA 3AHXA 2VL4A 4ERAA 2ZFAA 1DQXA 4O11A 4RZ4A 5D38A 3O1NA 4JTAA 4PUUA 2V5BA 1XIBA 4F66A 4IFRA 3W7RA 5LNSA 4JEQA 1LBLA 1U83A 1XDLA 2CC0A 3VDGA 2QUMA 4OECA 3PWIA 3VOCA 5KZMA 4O0ZA 2AQWA 3CAVA 1PHQA 3ZJKA 3GW3A 3UWEA 3PZNA 1J5SA 3TH6A 4HYWA 5MHBA 2BBFA 4W4QA 2CLHA 4M6PA 3OYZA 2Z24A 2Y8UA 4WDXA 4AXKA 3KWSA 2XZ9A 3E0LA 2W4XA 1GKRA 2YCKX 2WMIA 3W2JA 3M7SA 1WOBA 3W7HA 1MXSA 3QEZA 1UR2A 2G96A 1PAMA 2PBOA 1MQQA 3UU0A 1DPMA 4EPBC 1F3EA 6XIMA 1A5NC 3KHDA 2CHOA 3B97A 3BVJA 2X1TA 3E0VA 3WF4A 4Q8MA 1YBQA 2C0AA 4B3LA 5A2AA 3AFBA 5SWUA 4PCPA 4OOZA 3BG3A 2PDHA 4NRSA 2ASHA 3OQ8A 3PP7A 3R25A 3TFXA 4QFUA 3WDHA 3NO5A 2D24A 4XO6A 4NASA 4O19A 2YCLA 3OZYA 4JX4A 4YXGA 2YW3A 1W32A 3WF1A 4XZHA 4UTIA 4J35A 3U5UA 4YHEA 2YXOA 3A4JA 4H4IA 4ZR8A 1QHOA 2WHJA 3IVSA 2HWGA 3KBNA 3W38A 4R34A 3HZ3A 1JEZA 4Q3MA 3A9BA 2I5GA 4D72A 3COTA 1C3FA 4NZCA 4B3ZA 4MY9A 3E02A 2G4FA 1FH8A 5IOBA 3PJXA 3C2EA 2YPIA 3IACA 4O18A 1SZNA 3SADA 3RJYA 1OG0A 3W7EA 1VD6A 3VNJA 3QKEA 1XV8A 3EKGA 4WXZA 4L4LA 1M5WA 1TJ2A 1XL9A 3PZQA 4PL2A 1JZ5A 4G7FA 1J01A 3MDWA 3RLUA 1TJ1A 2YOCA 4Q8NA 4JQAA 1E6ZA 3MCOA 4JTDA 5I3DA 5C9UA 4FIRA 4MOZA 4C6DA 4CCCA 3HFYA 1TTJA 1DJZA 3M0VA 4F0SA 1W9XA 4Z0JA 1C93A 1T40A 2OQLA 1PUDA 5RUBA 2ZA2A 3N3TA 4Z1DA 3QGAC 3UJ2A 1BFNA 2OR2A 4MNJA 2IKJA 2YZ5A 3S2LA 3RCMA 4US6A 1ECEA 3W72A 3DYMA 4TVDA 5HMDA 3GVGA 4ACYA 1ZB5A 1H5YA 1JVNA 3MCNA 4ECLA 3LI1A 2J66A 3W7LA 3VO0A 4FXJA 1XDJA 1MI3A 3QLLA 3KS5A 4J2MA 4PZVA 3GR4A 3B8SA 1GQKA 3WDIA 4CVUA 1KM5A 4TIMA 1VAHA 3FLUA 3UYCA 1D7KA 1FH9A 2HPIA 4US5A 1RBOB 4S23A 1PBGA 4JHZA 4EVZA 1X8FA 1V79A 4JDYA 1M7XA 1YTDA 5CCZA 1LTDA 1PKMA 1QK0A 1DQUA 2NV2A 3PBUA 5TAOA 1BVWA 3WL1A 4EXQA 2J7FA 1VP5A 3KDOA 4LY8A 5H8UA 1FWWA 3A3HA 1QBAA 3KL3A 1HO4A 1B9BA 1MUWA 4GINA 3SIMA 3AI0A 3B9DA 4ICNA 1FTXA 1G69A 3MWAA 2G8ZA 2JF7A 1TZZA 4G8TA 2A79A 3QHOA 1QK2A 4D6GA 1SSGA 1UA3A 5HA7A 1WNOA 3WLRA 3UPBA 3APGA 4HNNA 4L61A 4MFDA 4OU1A 3TX9A 1U5VA 2ZE3A 4FZIA 3V18A 4C1LA 4MUPA 1RUSA 4NZJA 3AHTA 1M01A 1POKA 3C8FA 1SJBA 3SI9A 1R9ZA 1Q6FA 1R0MA 5A94A 2ISWA 1E72M 4LY4A 4Q8OA 4NU7A 3ABXA 4Q32A 4R7JA 3ONBA 4S3KA 4GFSA 2DIKA 1PX8A 2PUZA 2DZAA 2OZ0A 3KAOA 2EHHA 4UC5A 3GHTA 3CHEA 2J4GA 3N15A 4F2UA 5K2ZA 3EB2A 3CT7A 3CZJA 4C90A 3FHAA 3GY1A 4B15A 4PRRA 3IPWA 1LL6A 4U31A 3MV01 2VUNA 3PZIA 3AYRA 3W3OA 2R1NA 1HL2A 4DJEA 4K7VA 5DO8A 1UROA 5FAGA 4AZIA 1EJSC 1T0OA 3WLKX 1D7FA 2QJNA 3OHIA 4NJIA 2V67A 5AYBA 4ACZA 3NYDA 1KTCA 3HOJA 2WNWA 2VJXA 4LEQA 4YIWA 4TMCA 3SCVA 1SUXA 1ITQA 2F61A 1NIUA 1P0KA 3CUFA 3SB0A 1X7IA 4A2SA 2OEKA 4FLOA 3SCPA 4I5RA 2Z2BA 4RX0A 1T41A 3MS8A 1XLJA 1BHGA 1UP3A 2XN1A 1B0IA 1R8LA 2CHRA 1EC8A 3GRIA 1LROA 1UR8A 3Q37A 1XLDA 4MJZA 1SVDA 4GPNA 3VZZA 1S39A 2CZDA 4REQB 3UQNA 1OQFA 1WDSA 2P8CA 3UY8A 4DX3A 4JGDA 3GVQA 4DBEA 1UBSA 1HVQA 2ABAA 4DJFA 1DV7A 3BW3A 2EO7A 5DT5A 3GR7A 2QGYA 4B90A 2CLOA 2ISFA 1OF6A 1HGYA 1AQMA 4BF9A 4YMZA 4EE9A 3CB8A 1O95A 3WG6A 5C0QA 4OBSA 1UD5A 4M1BA 2OGYA 1YDNA 3HMJG 3T0TA 3AXKA 3ARTA 3CAWA 1TR1A 4WDWA 1GOQA 5C7VA 2Y5EA 3WD2A 4BR1A 1E4IA 3UP8A 3N9KA 2GQ8A 4HHPA 1Z69A 2HJPA 2RJHA 1VENA 5CEWA 4O4VA 2BHZA 5A1AA 4HSOA 5D2XA 2C79A 4J3WA 1M7PA 3O8AA 3OLIA 1ZAIA 4PUWA 2KX9A 1SSDA 3K4DA 2E5BA 5JH1A 2WJFA 3OB8A 4UMBA 1Q63A 1FKWA 2WWDA 3IV3A 3DG6A 3CIVA 2DH3A 1REQB 3SCTA 4Q8VA 4U33A 3GYCA 1BG4A 3N14A 2J8FA 3OGVA 4D6IA 3AS2A 3ES8A 2QDHA 3BG5A 1LQ2A 4HZ6A 2XIJA 3PULA 3G1RA 1C90A 1G67A 1E70M 5AHEA 2VNCA 4O54A 4W88A 1OSEA 2ZZ7A 4QS6A 3SO7A 1DWHM 2EGZA 2JKAA 4YTUA 3DFOA 3RIKA 5IFTA 4R5EA 1FWHC 2PC4A 1PB0A 3VZXA 1U1HA 3O63A 4GI8A 4GXWA 4OT7A 1J79A 3GXFA 1ME8A 3EZ4A 5CAHA 2Y2WA 1GOMA 2ACSA 3GVVA 1FFQA 3QV6A 3B05A 4OBRA 4NVTA 5A6AA 2H9AA 1TV4A 1A49A 4P8WA 4MB3A 2RKXA 3ERPA 4AF0A 1B5TA 2NQ9A 5I78A 4MWAA 1TA3B 4RPQA 2NVAA 1G01A 3IIPA 4XD4A 4H8UA 3TDFA 1HJSA 4DJEC 5EKYA 4NX0A 4TX6A 3RR1A 1GOXA 3THAA 2VX5A 2ZZ4A 4H9TA 3LD5A 3O6DA 1FWFC 1Z42A 2HNHA 1IT7A 2B7NA 3NZQA 2EPHA 5C9XA 5ABFB 3B8TA 3CXOA 2CWNA 1EXPA 3TP4A 4IOTA 3UNDA 1PE1A 3SY1A 2YL8A 1FWCC 1XINA 4Q4QA 3AWNA 1HKKA 3FA3A 3W00A 2VEIA 3VU2A 4LUSB 3QC3A 5AKQA 5BYWA 4KWVA 1YIXA 1B30A 2VTFA 4V28A 2CKSA 4LANA 4LH8A 3MP3A 2OEJA 3JU2A 1JI1A 3CEPA 1KFEA 4AFYA 3SUVA 2E6DA 4LUIA 1E9LA 3W1TA 3BAJA 2A3HA 1ZJHA 3W86A 2O7SA 2XVKA 1XBVA 1RPXA 1P0BA 1R38A 2V3GA 3TZFA 3PBGA 3P61A 4FNTA 2B7PA 2J77A 1TJ0A 4DYJA 3CZLA 4HA0A 4JTRA 4Q6JA 1NAL1 3N3MA 1PWMA 4WSJA 3NZPA 1AH3A 1QPKA 2FB2A 4Y8EA 3LPFA 2IKHA 2IMRA 2IPJA 3N11A 1LT8A 2YGYA 5C7HA 3MO7A 1UOKA 1QCWA 3O7UA 4PMJA 4BQ4A 3REQA 4GKLA 3WF2A 1QNPA 4K38A 2WWCA 1N7KA 1KFLA 1SO5A 3H26A 2YXGA 1J2WA 1HX0A 2QW5A 3MBFA 3TEVA 1WV2A 1TKKA 3BSMA 5F1VA 3VKDA 4C6JA 1GEHA 4E5TA 4CU7A 2CXEA 1VEMA 1F4AA 1QUMA 2XVGA 3CL7A 3C2VA 1IF2A 1SMDA 3DHFA 5M3WA 2BOGX 5LIYX 3I6TA 3S3GA 1BGAA 3PZ9A 3GVWA 4LW7A 4M1RA 1E6SM 3ARXA 1TREA 1XBYA 3CT2A 1SZRA 1E6NA 2XFRA 1UWUA 2VKZG 4OKDA 2YFNA 3F2CA 2AAAA 4IQJA 2UY5A 1V4YA 2RGMA 3CV1A 2DH2A 3W07A 1DJNA 2W91A 3P7YA 5HAOA 3CHVA 2Y7GA 1I2OA 5E93A 4N9DA 2WANA 3QSTA 3RITA 3U2CA 4UIOA 3S9IA 2D3LA 4LEFA 2WOQA 3KRUA 3SR7A 4DXXA 1GQJA 1G4SA 3S42A 2QCLA 4QQUA 4ZBCA 3PTKA 3R13A 3S1VA 4MWAC 1U5HA 3SN0A 5TBOA 2G37A 1UR9A 3NL6A 2DPEA 5G5IA 4DVOA 3DAQA 3GO2A 1ZY9A 4WF7A 3G5EA 3W88A 3NO1A 1KV5A 2AMGA 4UTKA 2AQVA 1F76A 2WHLA 1DJQA 1IE7C 2VQUA 3FFSA 5HPCA 3TUUA 2V5JA 4MG4A 3EX3A 5CZ0A 1WQ5A 1JZ3A 4F0KA 3MMUA 1KW1A 1KLZA 3LXAA 2INZA 2CW6A 1R3SA 4XSMA 4RR4A 4P7RA 2X1IA 2DZSA 3FW6A 4RDWA 1XSIA 1LLZA 1BG9A 4JTHA 3WUEA 2JGYA 2E0PA 4I7WA 5BXTA 4GE8A 3SFWA 3GSMA 4JNYA 2W62A 3R8GA 3XISA 3WNOA 2V68A 2UY3A 3ABRA 4INFA 3AC0A 4IUGA 1B31A 2PDFA 2D0FA 2VZOA 3KRZA 4HZ7A 3SQMA 5H6HA 3TW7A 2J9YA 1EGVA 6CGTA 4B2DA 1GYNA 2XWDA 3G1YA 1RK6A 1W1TA 2XIOA 3MI2A 3LZ5A 2QDGA 4HN4A 4R7OA 2YA2A 1JQVA 2I9UA 5FACA 1ZBVA 5D37A 4AZBA 3ATYA 3TYAA 3S2NA 4C6IA 1FDZA 1CYGA 3CPRA 1UUQA 4EWJA 1CXIA 1AMKA 1TELA 2VM8A 4D6DA 2WCAA 4K1GA 4IL0A 1RJPA 2XDFA 4F79A 1HUVA 4L64A 5GPRA 5D03A 2QT3A 3C52A 1TIMA 1G6CA 4IX0A 1JXKA 4GLEA 4H7VA 4C6FA 5D09A 1WDWA 1D2KA 3B06A 2UY2A 5BNKA 4L9YA 3CJPA 4WR3A 2QQ6A 1LQ0A 3L0KA 4ZOBA 1SJCA 1NWTA 2PDIA 3EWYA 4EF9A 2V3EA 5D04C 2R82A 3LG3A 3O07A 1JPDX 3RO8A 3EXTA 2TRSA 4GO9A 4KWOA 3NQEA 1W31A 5C2CA 3HN3A 1FP9A 3MI3A 4KCUA 4ZQMA 5LSMA 3UFYA 3G8EA 1TO3A 4B5SA 2WBKA 1MVYA 3GDLA 4W8LA 2Z7KA 4C6MA 3LRKA 4Q8PA 3ANUA 1QU4A 4J3VA 4JPGA 3T1GA 3AZRA 1R3YA 3A9IA 4Z2LA 4FI4A 5E9XA 3S5YA 2VZUA 1GK8A 4MLRA 2VFDA 4F0MA 2G4JA 4IX2A 2GFTA 2UWFA 2YL5A 4JN8A 4US5D 3A3XA 3RAOA 4O0QA 3KS6A 1XGEA 4DM2A 4HYRA 4PMUA 4QROA 1SYTA 4ZA0A 3L12A 1XCWA 3V36A 4IM4A 1A3HA 1M3UA 3EAUA 1W3HA 4NI8A 1W54A 3RCNA 3BZJA 2GQAA 2PD5A 2QJIA 1KCXA 1JZ7A 2OQYA 3MC5A 3TJLA 1A5SA 2J8GA 3N18A 4KH2A 1W3NA 4BF7A 2WNQA 2VR4A 4KT2A 4Q8WA 3W7GA 2VYOA 4WIWA 1AZ2A 3ES7A 5DMYA 4AHQA 3W0KA 3NDOA 4X0VA 3NQAA 4UR8A 1Q8JA 1RXOB 5LIKX 4ATDA 5AC4A 2HK1A 1LP6A 4HVXA 5DF0A 1IGSA 1OGGA 3AIWA 2NZLA 1XYFA 1WKEA 4B5UA 2BGQA 4MVAA 3GFXA 1E5JA 3U0HA 3CBWA 3TR2A 3DG3A 4AD0A 2QZRA 1J0YA 3U9IA 2PZ0A 5A6SA 2ANUA 5CZTA 3S6TA 5I23A 4IXHA 3VGHA 1VPQA 1YNYA 4FS9A 3V16A 5AFDA 3EOSA 1GVSA 2FFCA 1EPXA 1UPMB 1L6WA 3O05A 3WCZA 2PLJA 3Q94A 3QFEA 4AIOA 1A0DA 1G4TA 1OADA 4DJED 2ZWYA 3SY8A 4WOQA 3VUPA 3GXTA 1FWBC 2NV1A 1UPPA 1D8CA 1L6YA 4PMVA 1QFEA 1XUZA 2QUNA 3TN4A 5JQ9A 3L2MA 1B4KA 4DBSA 1WUFA 3SQSA 4AD5A 1V7AA 3AIEA 2PDCA 5AOUA 3W7OA 2DW6A 1V03A 2PRLA 3NURA 1GQIA 3FKKA 1KM4A 1ZHAA 4H6QA 1EJUC 1TPB1 3A3WA 3C3NA 2REQB 2V82A 1LBMA 5DMMA 1GKPA 4GG9A 4HN8A 3B0VC 3PUEA 1MZRA 4CCZA 4LYKA 3TTSA 1BVNP 2RH9A 4Q8QA 5FJUA 1WKYA 3S46A 1JDFA 5EMLA 4XO7A 1K7EA 3KBWA 2Y6ZA 3ID7A 5IHRA 3P81A 3I6EA 4DJFD 3K13A 1K1DA 2VRQA 3WD3A 1HW6A 3WLNA 4MJMA 1B2YA 2J9ZA 5AZ0A 3BUVA 1TV5A 1TWWA 2XINA 1GZGA 2WCGA 4F9JA 5T8GA 1DVJA 3BLIA 3VE9A 3WQ5A 3V35A 3HJZA 2O4MA 4LV9A 5CPOA 1LORA 3AZSA 4R85A 1D3GA 2BGSA 2PF8A 4ASTA 1KBJA 1TV3A 2DSVA 3BJSA 3L4VA 3PTQA 1YYAA 4PBEA 4OE7A 2FKPA 2Z1WA 4IGNA 3O6YX 3GDTA 3QW3A 4TUFA 1AA1B 3GQYA 4PTXA 5FJOA 3FN9A 1H3GA 3S5OA 2PDQA 4ZO8A 1JPKA 3EOEA 1FA2A 3FEMA 4H2CA 5JVLA 1U30A 3P0WA 3WZ0E 4QG9A 3KP1A 8CGTA 2Z29A 3TA9A 4JY9A 3LENA 3IGUA 4H04A 2AQOA 4B91A 3VOJA 5DY3A 4YYFA 4CQ8A 5I06A 3NQGA 4U2YA 4B5TA 1ICSA 3GNXA 4NYUA 4PUNA 4LUTA 2BVTA 3T2OA 4WZHA 1TQXA 2FFIA 2YBVA 5DBUA 3UWZA 3ZZ1A 5A6MA 1EH9A 5A6JA 1GTHA 1LUCB 4N0RA 3EEGA 1DXIA 4FEZA 1XLAA 1EWEA 3TA6A 4HT3A 2X8RA 3UWVA 1LDCA 1EJVC 1O68A 2QMKA 1DWIM 2CHNA 5AVNA 2VO5A 1Q85A 4E3TA 3BLOA 5CGMA 5FJTA 1LG1A 4D6EA 1L6FA 3LB0A 3WJZA 3V3WA 2YA0A 4IL2A 3WDQA 1LT7A 3WBWA 2QUVA 4FA3A 2YL6A 4MAVA 5HMFA 1EX5A 4K8GA 2D69A 3MO4A 5D2VA 2GGGA 4J2PA 1V02E 1FWEC 3W82A 3IJIA 2Z2UA 4GD0A 1US0A 3E6EA 2V63A 3U48A 5CPSA 3BGGA 1HL8A 4MWAD 3EDDA 3SSZA 3WELA 4NJGA 2X7WA 4A3QA 2VWTA 1BF2A 3N25A 3QPZA 1SO6A 4S3FA 3OG2A 1V3LA 3QFWA 2QUTA 3HMCA 4O1FA 4PRTA 3PZOA 4WJ8A 1ZJIA 1DJIA 1TX2A 1PZ2A 3D3FA 1NEYA 2R6OA 3H2NA 2NVCA 3C6CA 2G3NA 3UWUA 3OQEA 4WY0A 1Y8BA 1U33A 3W1MA 3EMCA 3UZWA 3QGVA 1EQPA 3MSDA 2X30A 1H0GA 2J7HA 4W5ZA 3W53A 1V6XA 2PTXA 4PSRA 3WMSA 1RLCL 3FA4A 4UXDA 4EPDC 3CHCA 1GQNA 4AX7A 4HNTA 4B5WA 2X1RA 2QCMA 3LCWA 5ABEA 3MVIA 1ZLPA 3FV9A 1X98A 5AN7A 3A23A 2CKRA 3M64A 4GH3A 3N2XA 3CH0A 3KVMA 4IPNB 1F6PA 4UFKA 5AC7A 4KEMA 3OLEA 1XM3A 2OFJA 1SM9A 4JX5A 3BQ6A 5CPNA 2GSEA 1ICPA 1TWZA 1NDYA 5K3VA 1MFUA 1PKNA 4L4PA 1US3A 4W7VA 3AIRA 3CASA 2CLIA 1T96A 1N8IA 3UJSA 4DAIA 3NQFA 3PZGA 2EPLX 1VHCA 4EAMA 1DXFA 4PTNA 4ZTYA 4ES4A 5M1TA 5BOOA 3QMRA 4OVXA 1MW2A 4HNOA 1KXHA 3HQPA 2QCDB 1ZJBA 1EDTA 4UR7A 2QPSA 3P0XA 4AZHA 3C8NA 5DBTA 3GDMA 2WVVB 5XIMA 1R30A 1IQ8A 1OCQA 2DY3A 4UNLA 1TFVA 4GACA 4HA1A 4JTEA 1KB3A 4WKAA 3EPOA 1YW1A 1NQ6A 3WO8A 3ARZA 2ALRA 5AECA 5T26A 3M0YA 4M51A 4I9AA 1POJA 3TAKA 2ZUNA 4PR4A 3VVGA 2NX3A 1JDAA 3S1WA 2RGLA 1VR6A 1H1YA 4IMAA 3HGJA 4KEUA 3DFPA 3E0IA 4LUJA 1WDPA 4YTSA 1UIPA 4JL1A 4HK5A 4ATWA 2FHBA 2QVNA 1L8PA 2V81A 4ZVJA 3H54A 4GWEA 5BXSA 1TVPA 1JCLA 4YL2A 5HMSA 1ISZA 4I8YA 2V9DA 3VKBA 3FGCA 3FJNA 4AZ5A 4KQNA 2FJKA 3WJWA 3MP5A 1GEQA 5LGZA 2OWCA 3SIZA 2YLLA 4ZTXA 1PSCA 4LVDA 3GDBA 4DXVA 3UT0A 1F6YA 3CWOX 3FDKA 3HQNA 5EMJA 1EOMA 3GHUA 2CBUA 1TVLA 4A3HA 3IJ6A 3GBDA 2CLEA 3T81A 2WM0A 3GLCA 4JNMA 2O9TA 4UBPC 2V30A 3DFNA 3VNDA 4NNAA 2I7GA 3ITLA 4LYRA 3OU8A 3VD5A 4G5DA 2WBGA 4GX8A 4BF5A 1JIBA 3LTPA 2QPUA 4S3GA 1ZGDA 3H4GA 3GU9A 4PFMA 3WNLA 1TTPA 3ABQA 3W7IA 1UD8A 3MDUA 1B3YA 3TAOA 3V5OA 3ZMRA 2X41A 2CETA 5AYXA 1K7XA 1BRLB 1K8YA 5BU9A 3G3DA 4UZUA 1QNSA 2DSUA 3FDGA 3MWCA 2OOGA 1Z3NA 5DFAA 4W9TA 3ARYA 1XIEA 1DJGA 4EP8C 3C56A 1IEQA 4H9XA 2DZWA 1TWSA 3ZT7A 3W27A 1H61A 3PPGA 4O1CA 4NUWA 3BC9A 1X6NA 4LB4A 3LLXA 3QW4B 4YWSA 1JF5A 2GVYA 3TV8A 1LBFA 3W76A 2OZ3A 1P6WA 4NRRA 4B2DD 3NQVA 4C6CA 3BAIA 1OC6A 1V3KA 3H2MA 5JH2A 1V0KA 4AYGA 4G1NA 3KBSA 4O28A 3G1HA 3PR2A 5FSDC 4HJWA 1JUKA 1SFTA 2CWXA 3ITOA 2E40A 4ZQPA 4LBSA 4QE4A 5G1YA 2E6AA 3EWZA 6REQA 1G7UA 4OV4A 3W73A 3R8HA 1H7WA 5LXXA 4CU8A 2ZXAA 2J6XA 4O1DA 1OIFA 5HXMA 3DUGA 2HBVA 2Y7FA 4RNIA 2ZE0A 1BTCA 3UF9A 2H3BA 2WSPA 3TJ4A 3S8HA 1YE6A 3EX6A 4K6AA 4DIAA 1N82A 3C86A 1LL7A 3DOPA 4DO7A 2HISA 3V0SA 3LGEA 1PZ0A 1CEOA 3WKZA 4J3SA 4OQVA 2GSHA 3BV7A 1C9WA 2ZDSA 5G4HC 3JZEA 2BB0A 2Y8VA 2Z28A 2PDMA 2OLSA 1Q6QA 3V4BA 2OPJA 1K4HA 1TJPA 1DOSA 2HXUA 4UTWA 4IIHA 4RNJA 1HFBA 4E8CA 2PSNA 4DNMA 2PDPA 3QH2A 2PMQA 1J0JA 1KCLA 1GZ1A 1WAWA 1NQKA 1FHVA 3K8KA 1GVEA 3S9YA 2A7PA 2E6FA 4JTQA 5C55A 1YEYA 1EJWC 1GVFA 5LIWX 4BHYA 1IXNA 2J25A 4NAEA 1TPUA 3VNZA 4C7GA 4NAFB 4EWND 4QLLA 3RXZA 4BEUA 1OCJA 4IMFA 4PUKA 3ZT6A 1BKHA 4ROPA 2OJPA 4IFKB 3NQCA 4JFSA 3M5XA 4XZMX 5D9NA 1RSCA 3LCLA 4WCJA 4WSKA 7ODCA 1KBLA 3PUGA 4LBUA 5HQMA 1JUEA 3WQDA 5T91A 4LVGA 2V2CA 2FHFA 3A5FA 1M7JA 3ZFHA 1A0CA 1R5YA 5F2LA 3UZJA 4XAYA 5D9MA 2VZTA 3VCCA 1B9ZA 1VFUA 3HF3A 1QMLA 3NL2A 4HIBA 1K9FA 4MTVA 1L9WA 2PE4A 4UB9A 4PMXA 1CGVA 2R1KA 1I9CB 4AZ7A 3BOLA 1V6YA 1AL7A 2HPMA 2ZUTA 4G56A 1P1MA 1EYWA 4FLSA 4JICA 5HUOA 1BQGA 1N2VA 4RE4A 3L7RA 3CPGA 4GNKB 4DZIA 3FJ6A 1KWKA 1LCOA 1DE5A 3KTXA 3W9ZA 5C54A 1QO2A 5I09A 4FLQA 2VC6A 2G97A 3DN5A 3OLDA 3N9SA 4AAJA 3QY7A 2H90A 1BXBA 2ZZ5A 3A6OA 1G7VA 4DBDA 3LV5A 1XIMA 2OKOA 3OIHA 5FKYA 3TCSA 1WZMA 2PTYA 4MF4A 1W5NA 3PM6A 1CCWB 1P5BA 4JD4A 4HU0A 5CPTA 3WK0A 3GNNA 3C2RA 3AZTA 3UR5A 2C16A 3EOOA 1H41A 5HR7A 2DZVA 1I6NA 2OOFA 3PAJA 1U2YA 3NM1A 4BCEA 4M5PA 1NWUA 3BLPX 1UR4A 2ZYFA 1AJZA 4UQBA 1W3LA 3VKJA 4BY3A 3QQWA 4ZB2A 3TMQA 4DY1A 1TCMA 3VIFA 1DWGM 3BCFA 3T6CA 4TMBA 3AXMA 1EEXA 3NOYA 4P8UA 3CHDA 4WJEA 5DRIA 3H4XA 4Z2IA 4M6QA 1F8MA 2ZWZA 1E9YB 3QTPA 4PTVA 4X60A 4WVXA 1TUFA 2O9OA 1KM6A 4MNMA 3LBMA 3WFZA 1E9IA 5A6LA 4HA3A 3MMWA 1Q6CA 1AH4A 5E1QA 3BICA 4UTWC 4WLCA 1UZ1A 4LAMA 5M17A 3WLHA 3I7QA 1QPQA 3ONCA 5HMEA 2WLYA 2PC8A 1WXJA 4GY1A 4NZ4A 3AO0A 1OK6A 2R8WA 3EPMA 4GZIA 2C7FA 2XN2A 2WC7A 2C6QA 1JZ6A 4LCQA 3OZPA 2KAUC 5D4YA 1ISVA 3G18A 2V3DA 1DJYA 3NQ6A 4MM1A 3NVDA 1ZRQA 5H8PA 1E1CA 1QBBA 3GAYA 4V15A 1YKWA 1Q2SA 2Y63A 4ILSA 1IV8A 4UTJA 4CD5A 4MZ1A 1FBAA 3W7MA 5ABGA 4MWAE 3B4UA 1YDYA 2ZZ3A 1M04A 1EJXC 2E77A 1SU5A 2ZICA 2VD9A 1UH2A 4ZENA 3P2VA 3V0UA 4L1WA 4HTBA 4N9EA 2O9PA 4O53A 3ECQA 2DZPA 3GH4A 4IMGA 1HVXA 1OFPA 3U4FA 2BMBA 1G1YA 1YNQA 3PTMA 2Z1VA 4UQAA 4Q4OA 1OGBA 3RPTA 4D2JA 1V7YA 3NXLA 1DBTA 1QDSA 1CZ1A 3KRBA 3H2AA 3B8VA 4ZQCA 5BMXA 5HPOA 3G77A 3T44A 1O12A 3ZJ6A 1QASA 4Y9OA 1PCWA 4F0RA 4YVXA 2ON3A 2OT1A 4CQCA 2WZHA 2PP0A 2J62A 6ENLA 4Q7IA 2NT1A 1T5AA 4AB4A 2PEVA 4Q4MA 3UY7A 3KL0A 3ZVHB 1HZYA 2WZEA 3I4EA 4GQ0A 4K36A 4CN6A 3PHAA 2A7RA 2DVXA 2BY2A 4DO4A 3PBMA 2R9RA 5FESA 2IS7A 2VGFA 4HMDA 4AD4A 1YXDA 3UW6A 3C0QA 1UA7A 1VGAA 3P8JA 3TONA 4L4MA 2AKMA 3CC1A 3JUGA 1TPEA 3TYEA 4QHRA 1NDVA 3M5VA 4PN2A 4D6FA 3STGA 3NVTA 1RHCA 3EDFA 5TIMA 4DJDA 5KINA 5H1WA 1NTHA 4IIDA 3UCCA 3CZGA 3KWXA 2YFOA 3DXIA 1ZJAA 3C0JA 4XZBA 4LAUA 2BG5A 1UMYA 1XLHA 1WA3A 4KCWA 2E9BA 4Z0SA 3VXGA 3LCXA 3CMFA 3R1ZA 4BA0A 2EEXA 4DPQA 4PH6A 4H00A 4LSBA 5K9DA 2WHMA 1YXCA 5ENLA 1MQRA 4A8LA 1M65A 3LU2A 4XTDA 1RBLA 3WH6A 2GGHA 2Y88A 2BWGA 1ECQA 4M6UA 4IUOA 4L56A 4BKNA 5KEZA 3VD9A 4AZCA 3PS7A 2Q02A 4DBWA 4IGSA 4IIEA 2EG6A 4WDTA 5A2BA 2ZRUA 3O0FA 4OFCA 1BVZA 2A3AA 4EX4A 1T8XA 3G1AA 2GVLA 3I68A 4FNQA 4B5NA 5CPQA 4CNSA 2VFFA 1ONXA 3WIJA 1G4EA 2XFYA 4DWDA 1A3XA 1QW7A 1HJWA 3NFUA 1HT6A 3EDJA 3BWWA 3UXLA 2F6KA 4REQA 1B3XA 3AISA 1I4NA 4E4FA 4JNZA 1IEVA 3N19B 7REQB 2QCNA 2J24A 4HP5A 5KZ6A 3NL3A 1VJIA 3E38A 3N17A 4ZOCA 3AICA 2WXDM 1GT8A 4URIA 2FZMA 2QV4A 4X2RA 1SW7A 4ZB5A 3EKLA 3USZA 3UWWA 3KLLA 1JDDA 5E09A 1RR2A 3GFYA 3P5YA 2I5QA 4GBUA 4JOMA 3KDNA 1M9HA 1GJPA 2D1ZA 1X6UA 3RRAA 4JY8A 3SRKA 3GU2A 4CUCA 5F2GA 3W01A 3LBOA 2GJPA 2OGJA 2XUCA 2VQTA 3W71A 4PCFA 2ZUWA 2VC7A 3WLLA 4C6NA 2C18A 2DIEA 4UFMA 4YVVA 3GTNA 1VLWA 4D6CA 1PIFA 5CXPA 2C1GA 5I07A 4GUGA 3N2OA 1MSSA 1RV8A 2VGBA 1KCZA 3R6IA 4AYSA 1W56A 2HV5A 4TTUA 3PWGA 4MB4A 3MUCA 1GORA 1IR1A 1WP6A 4O8AA 4XD3A 1BQCA 3LLFA 4DWSA 5H2ZA 1F5ZA 2V2HA 3DC0A 4LGXA 4XBSA 1QO5A 3W7DA 2Z1SA 3TR9A 1UZ4A 4TV6A 2IQTA 2MANA 1KGUA 3MJYA 2YCLB 3GNRA 4MKNA 5BZAA 5AY7A 4L7ZA 2E1DA 1RY8A 1NU5A 3R4IA 5A6TC 2ZOXA 4AC1X 2HEJA 2YX0A 1EB3A 4NIRA 2RDUA 4IZGA 4E2DA 4A8IA 4GI9A 1KV8A 2NWSA 2PGWA 1PXGA 3C4UA 4CCDA 4LS2A 5K4XA 3H6OA 2A0NA 3CZ8A 4JTCA 4NYYA 2HVOA 4OUEA 1BWLA 3BG9A 1D3CA 3DCPA 3MU7A 4JDBA 1YRRA 3HIJA 1E4MM 4PEKA 1NARA 4GO8A 4H8VA 2WPBA 1V0LA 2GUBA 5DXYA 1BXCA 3G6LA 2VT0A 2FGBA 3ITCA 1G9HA 4I7VA 1XWYA 4MZYA 4D71A 4DM1A 4I9TA 4YLWA 4PMDA 3CIWA 4CN1A 3W6YA 4LV4A 1QOXA 1R46A 2WKJA 4XZIA 5FSEC 5ABFA 4NZFA 2Q71A 2J78A 3K1GA 1NDZA 1IEWA 2F7FA 1X97A 1ZAJA 2GUUA 2YBTA 5AC6A 1X1ZA 9XIAA 2Z00A 1K02A 4GRSA 5FJIA 1M68A 1CENA 3OBEA 4XKYA 1JGMA 5CGQA 4FO4A 4PTWA 4O4WA 4QLKA 4LUSA 3I4KA 3G8RA 4HZMA 4C1NA 1H49A 1X1NA 1R9YA 2WVTA 2VEKA 1KQZA 1QOPA 2F8QA 4M56A 3SCQA 3KL5A 4EXAA 5REQB 2B31A 3VTRA 3RDKA 2BY3A 1YE4A 4UTTC 1EC9A 5EFFA 1K7FA 1P1XA 2HSAA 5FF7A 4UR9A 4RZBA 1YMYA 1YADA 3OVRA 4LCSA 4XG1A 3BARA 4DELA 2WJDA 3M46A 1C8VA 2PWUA 3STEA 2VHLA 2AKZA 2VDGA 3F5KA 5CC6A 2EF9A 1AVAA 3VDHA 1PTGA 3OEXA 1UKTA 2NQHA 1XSKA 2QIWA 3EMZA 4CNUA 4YCPA 5CPMA 3KTSA 3E2RA 3F4WA 1MMFA 4CD6A 2XGIA 2A6LA 2QCGA 1HN1A 1XIHA 4DUWA 5HJXA 3DU0A 1E6PA 3BSGA 3NPXA 1UWIA 4RKAA 3OIXA 4E4PA 3L5MA 4GY7A 2PD9A 2YYUA 4TOQA 5AC5A 2HS6A 1C92A 4UTFA 3MKCA 5FD0A 1SW3A 5J8LA 1C7TA 1V5XA 3W26A 1ZU8A 2VX4A 1ADDA 4GISA 4HMEA 2EPOA 2ZZ6A 3NZ1A 1LL4A 1CPUA 1L6SA 1JCYA 3BMWA 3W7QA 3T2QA 3TYDA 1O6IA 1MYRA 4X63A 4EAYA 1HXJA 4JX6A 3L66A 3LBCA 5H8MA 5EL1A 4FOKA 3NGJA 4E2BA 5EBAA 5K9CA 3DHPA 4QRNA 2FVKA 3W84A 1Z32X 3W24A 1TE6A 3IUHA 5BRBA 3HPXA 3GVRA 4KRTA 4IFOA 4PC8A 1NP0A 2GSJA 1NWSA 5CBBA 1NOUA 4ATLA 6XIAA 3ZYZA 2C14A 2ZXDA 4XIAA 1R3WA 2OLAA 1NJJA 5BOEA 3AJXA 1E9ZB 3V5CA 2GJNA 3M44A 5HNRA 4HNUA 1N55A 1EZ2A 3EWBX 3VZYA 4TTGA 3RK8A 3BLEA 2FMNA 5A3HA 1JD7A 2VD8A 1N8FA 1RJQA 3NL5A 3UA4A 4QEHA 1VRXA 4PB4A 3IWPA 1F74A 4FNRA 3WNNA 1OEPA 3HB9A 2VC9A 2QCFA 3SRDA 1W1PA 4JL2A 1FDJA 3IJDA 4GH1A 3B9OA 3ALGA 2XPKA 3ZS4A 3THDA 1MEWA 4ZSTA 2HXTA 2OYKA 2Q09A 4Y96A 2V38A 4UQEA 1PEZA 1E40A 4S1FA 3K4WA 3GH5A 4KEVA 5E6YA 1R6WA 3LSCA 4F4RA 1V08A 4JTKA 4QDMA 3D5HA 1LYXA 3TQPA 1CECA 2HTMA 3C2OA 3WQ8A 1WZAA 2VVNA 4CNTA 1JFXA 1GNXA 4CD7A 1X7FA 8A3HA 2ZX9A 4NKCA 1MW3A 4J5NA 4RDVA 1SZFA 3VIHA 1J0IA 3OVQA 1TTIA 3AXIA 3H8AA 4PGLA 1FUYA 4MY8A 1OVDA 3WLMA 4GXMA 3HURA 3FCPA 4NJKA 1GPWA 1CGYA 5LHFA 4QAIA 2DFAA 5I3GA 2CLMA 1LM1A 2BLEA 5D8WA 1BSLA 1XIFA 2D23A 1PV8A 2ESCA 1K6WA 1YNPA 3G0UA 4L80A 4U5KA 3HV9A 1JD9A 4HOXA 2GPTA 3SCSA 4TVCA 4LF1A 4HU8A 5M03A 3KUMA 4XVDA 2P3ZA 3DGBA 4UOJA 5HINA 1TMLA 2FDMA 4XAGA 3WYZA 4RW5A 2I14A 2GLKA 1I8JA 3LRMA 2ZBTA 1K9DA 4AY1A 1MRAA 2ZZ1A 3TZNA 4N9BA 1QWGA 1JFHA 1RALA 1NFPA 1ZTVA 3KHJA 3H2CA 1VLIA 4CLMA 4FOJA 2OWWA 1P7TB 1SFJA 4XSLA 4H19A 5BROA 3LHUA 5G1MA 1CI1A 3PF3A 1OCNA 5HWMA 3WLQA 3AMLA 3W1AA 3VOIA 1CB7B 1FKXA 3NSNA 4GI4A 4RW3A 2VFIA 3APYA 1QI5A 1A47A 4G9PA 1DORA 3QHNA 2GQ3A 2J7CA 4WX2A 4EACA 3WDPP 3B8UA 2NWRA 4UOQA 4C91A 1TV2A 3W2UA 4K39A 3ZLGA 2OODA 4A05A 4W85A 3R0KA 1F7BA 1BEUA 4AC7C 1OYCA 1EC7A 3VOHA 1XKYA 1KXVA 2X1UA 1VFOA 1BYBA 3L5AA 2RDXA 4AVNA 1N8WA 4KETA 2QDEA 2P0IA 4GOAA 1VYPX 4UNKA 2C71A 2WO5A 4FPSA 4EOUA 2PDLA 2AL1A 1EOKA 1G5AA 1XLMA 1EEPA 4HOZA 1J2BA 1TSIA 4F2TA 1KKOA 3Q67A 5BXRA 2UBPC 3ORWA 3RM9A 4L9XA 4QE1A 3QR1A 2HDJA 3HPFA 2PDYA 4H7ZA 1KTBA 1XSJA 3WH7A 1P0EA 3BOXA 4A6GA 3POHA 3U3HA 2NUXA 3G1FA 5KITA 4IG2A 5D8ZA 1CXLA 3DFTA 5C9ZA 3DYPA 1ZUAX 5CKSA 1DQWA 3ITTA 1SR0A 5CZSA 5EMUA 3RX4A 3N4EA 3F5LA 1UIOA 4J3XA 1DJHA 2PCQA 3H7UA 5FEWA 2GGEA 3VILA 2DORA 3RUBL 2WZIA 3FAXA 4A35A 1R3RA 4DJDD 3L4ZA 4AZGA 3R89A 1EIXA 2BTMA 3BANA 3B8IA 3L67A 3LCHA 5E6ZA 3ABZA 5I0DA 2WPGA 5I3KA 1VBHA 1R7OA 1US2A 1XLEA 4DUVA 4BZYA 4RUBA 5FF3A 3VFCA 3O06A 3EBVA 1EJ7L 2ZCGA 5JMUA 2EAWA 3VNLA 4QEEA 4XZNX 3E5BA 4GY0A 3NQ7A 4J40A 1E0UA 3IAPA 4Z2KA 4JR5A 2QF8A 1V6TA 1R87A 1V0NA 2X7VA 3OZMA 4FF7A 4IICA 3KVKA 3FEQA 1IIHA 5HOSA 1W1ZA 2QXWA 2DVTA 3DC8A 1DWAM 4LOCA 1VBUA 4C60A 4LF2A 5CG7A 3LSBA 2ACUA 2W67A 2XH0A 3KOZA 5GJNA 5KMYA 3IIZA 3VIPA 1ICQA 3BURA 4AIBA 3OVPA 3G22A 3FYYA 3BTNA 4O14A 5HR6A 2A6NA 4GABA 2Y7DA 4LS0A 3IJ8A 3M47A 1JR1A 3E9AA 3SURA 3VD4A 1XS2A 2QJGA 5MF5A 3N6JA 1A5BA 1AK5A 3L68A 3IRDA 1KXTA 1K70A 3VINA 1RCQA 4RPPA 4AEOA 1YPXA 4K68A 2ZUMA 1J8VA 3PJWA 4I90A 3LEPA 3UVIA 3WNMA 4PFHA 1AZ1A 1ZALA 4LRSA 3MUY1 2YYTA 3KCOA 3POCA 4JQ3A 3OOQA 3CGTA 4JQ4A 4W7WA 5I7GA 3A47A 3NPUA 2OZ8A 1C29A 3ARWA 1YDVA 1Y0EA 3T8QA 1HJQA 2QR6A 1I2RA 2FHCA 4KRZA 3WK1A 4QBXA 1D3HA 3BZGA