2VWVA

Ephb4 kinase domain inhibitor complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
280
structure length
255
Chain Sequence
FAKEIDVSYVKIEEVIGAGEFGEVCRGRLKAPGKKESCVAIKTLTERQRREFLSEASIMGQFEHPNIIRLEGVVTNSMPVMILTEFMENGALDSFLRLNDGQFTVIQLVGMLRGIASGMRYLAEMSYVHRDLAARNILVNSNLVCKVSDFKIPIRWTAPEAIAFRKFTSASDAWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPDCPTSLHQLMLDCWQKDRNARPRFPQVVSALDKMIRNPASLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EPHRIN TYPE-B RECEPTOR 4
publication title Inhibitors of the Tyrosine Kinase Ephb4. Part 1: Structure-Based Design and Optimization of a Series of 2,4-Bis-Anilinopyrimidines
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 78
structure length 255
sequence length 280
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2008-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 2vwvA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2vwvA01
3BHHA 2QKWB 4NM0A 4ALWA 3KMWA 3L9NA 3MB7A 4EH6A 4L46A 3VBWA 4H1JA 3EN9A 3QL8A 4AZFA 3IQ7A 3HMMA 3BKBA 4O0RA 3MIYA 4O27B 4EK5A 3LLAA 1MRVA 3AC3A 2UZEA 2W1HA 3LHJA 4QMTA 5F1ZA 1Q8YA 2F4JA 3O50A 4QYEA 4DT8A 1V0OA 2QOOA 3QHWA 4DGLC 2FSOX 3UZTA 4XUFA 2CKEA 3HDMA 4JG7A 2ITUA 3GEQA 4M0YA 2W1IA 1WBVA 2XCHA 2RL5A 4AGDA 4DH8A 4AFEA 4EOQA 4O0UA 2OIQA 4XBRA 3EH9A 4F1MA 3HX4A 3M42A 3U4WA 2FVDA 3EZRA 3RINA 4I21A 5AUUA 3COMA 4TW9A 5IA0A 4YC6A 4QO9A 2JAMA 2X7FA 4GUEA 4I6HA 4C7TA 4PTCA 4KIOA 5IQDA 2OIDA 4J97A 4FZ6A 3Q4CA 4O7LA 4OTGA 3AMYA 3HV3A 4QQ5A 4RFYA 4TPTA 4FKUA 5CLPA 4AG8A 5M08A 4ZY6A 5CI7A 1APME 2R3RA 1NW1A 5JK3A 5JFSA 4EWHA 4ZP5A 4IFCA 4JLCA 4B99A 3R8LA 3KXZA 2CKOA 3SHEA 3EQCA 5AUYA 3I7CA 3KRXA 2R0IA 4ZMEA 3AMAA 4BZDA 3U8WA 1YXTA 4A07A 2Y7JA 5HX8A 3A4OX 4WOVA 3NX8A 2JDOA 3MVJA 5IQGA 4PPAA 4D2TA 2ZV2A 2BFYA 3PA3A 3Q60A 3SG8A 2PMOX 3ENMA 2CLXA 1PMVA 4F1OA 4USFA 1LP4A 1MQBA 1KE5A 2F7XE 3ORNA 3QBNA 5HG8A 2XIRA 3T3VA 1VYWA 4FNWA 3AD4A 2X8IA 4WO5A 2R64A 1QL6A 2ETKA 2XEYA 2BFXA 3H3CA 1FOTA 2F49A 2J2IB 5CF8A 4ORKA 3FYJX 3QYWA 4UB7A 3VBTA 3OTVA 3UO6A 4WG3A 2WFYA 1Y91A 3PY0A 3HP5A 4O0XA 3QZFA 2IVSA 4FNXA 5EW3A 2W17A 4P5ZA 2HAKA 3VUKA 3O7LD 3BV3A 3OY1A 5CAVA 4GYGA 4ZY5A 2R3NA 3DCVA 3R63A 3FXZA 4BCPA 4RZWA 3NYOA 4CFFA 3KMUA 4IAYA 3O23A 4FV4A 4IX5A 2GMXA 4YTIA 4AQCA 5J9YA 3HUBA 4II5A 3PXKA 5CU3A 5E8YA 1O9UA 1OL1A 3UMWA 3QWKA 1OPKA 5CAQA 3H9RA 5AUZA 2VWVA 4G1WA 2XK9A 3TZ8A 2HELA 4DBNA 3CIKA 2IZRA 2XZSA 3O8TA 4FV7A 4LFIA 3DKGA 3PWYA 4XMOA 4RX8A 4Y83A 4YO6A 5EM6A 4Z3VA 4YLLA 2PVJA 4KB8A 2VGPA 2YA9A 2HCKA 1XBBA 2B7AA 2W9FB 3KU2A 4KSPA 3FC1X 1W83A 4MQ2A 4QP4A 4CZTA 4XEYA 1REKA 4D2RA 4F09A 1U46A 2PMLX 2VGOA 1IASA 2UVZA 5FM2A 3VBYA 1XH9A 4RIYB 3E8DA 2OFUA 3Q2MA 4FKSA 3TDVA 2A4LA 4RGJA 4IB5A 3NAXA 2VTNA 3ORLA 2YHVA 3M11A 3QCSA 3VRYA 1J91A 2ZV9A 5CSXA 1GIIA 4I4FA 1WBOA 3AC1A 3AXWA 3UZPA 2Y4PA 3SKCA 4CYIA 5IMEA 5FXRA 2PZ5A 4MAOA 5K3YA 2PL0A 2QKRA 2RG6A 2X39A 1Y57A 4FZ7A 5IQCA 3OT8A 4EHZA 4HZRA 3DBFA 4ACGA 4PV0A 2UVXA 2YM7A 3KXHA 4UYNA 2UW0A 2FA2A 3UIUA 2A1AB 5CSVA 4YHJA 5TT7A 3BGQA 4I23A 4J98A 2IVTA 2HWOA 4EQCA 2C6IA 1OL2A 4E8AA 3EIDA 4MBLA 4PMPA 4NKSA 1M2PA 4D4YA 2Y8OA 5AP5A 2HY81 3F2AA 5EDPA 4D9TA 5LMKC 2E9UA 3IW4A 1JLUE 5HOAA 3W2SA 2VTSA 4FT9A 5GZAA 4YR8A 4EZ7A 4FTKA 4KBCA 4JDKA 3JXWA 3F5GA 5ANJA 3PJ8A 4MXXA 3D7ZA 3WYYA 3TCPA 3A7HA 2YAKA 4ANBA 2R3HA 4F1TA 4O22A 3H0YA 5DN3A 3PG1A 2BZJA 4IJPA 4GT3A 3UOKA 5CNNA 3SW4A 5DH3A 2C5VA 3VO3A 3VS4A 3HAMA 4GKHA 4E4MA 2Y6MA 3RP9A 5JQ8A 5EI2A 3W33A 5JN2A 5M4UA 5ETFA 2ZDUA 2QI8A 2Z7LA 3DK3A 3HMPA 2BRGA 2W5BA 4CLJA 5M07A 2JITA 1MQ4A 4PL4A 5EG3A 1PXNA 4DGGA 2EXCX 1GZ8A 2AUHA 1H27A 2O65A 4YGAA 3NEWA 3OROA 4FNZA 4RG0A 3R9OA 3S2PA 4AZVA 4BDEA 3LFSA 5CVFA 2VV9A 4BCKA 3VW6A 4XH6A 3VUIA 1ATPE 3JPVA 4JT3A 5L4QA 4XRLA 5GJGA 3GQLA 3VAPA 4X21A 5AUTA 3BE9A 4O6LA 3CD3A 5CSWA 5JH6A 3CKXA 3NRMA 4KS7A 4J95A 2R3JA 3P78A 4LUDA 3OBGA 4BC6A 3MS9A 4BIBA 4Z55A 3DBDA 1OUKA 2HOGA 1JKKA 5KMOA 3CP9A 3MW1A 1W8CA 3RAIA 2B9IA 4TYEA 2PHKA 2QURA 3Q96A 3DPKA 3HA8A 5I9ZA 1VR2A 3RPOA 3UG2A 2XRWA 2YIQA 3W2CA 1W0XC 4FOBA 4FSMA 2IO6A 5AR3A 4DINA 4DF3A 3SAYA 3IW5A 3MPAA 4FK3A 4DG3E 2GNJA 5B2MA 3LXNA 4RVTA 4LRKA 3KKVA 4EZ5A 1OIQA 4J52A 2BAJA 2O64A 3OOMA 4O0VA 4D4VA 2JIUA 2C68A 2G1TA 3F7WA 4F9AA 3EN4A 1YHSA 1GZNA 2PY3A 4ZJJA 1GZKA 2FSLX 1YXUA 1UU7A 4KAOA 4EL9A 2WMVA 4BWPA 4UX9A 4IVDA 5E8UA 4IWDA 5EI8A 1E9HA 3OXIA 4Q2AA 2JKKA 4OBQA 5FTGA 4X2GA 4FTIA 5F95A 2X4ZA 3P7CA 2FH9A 4LOQA 2O0UA 4KBAA 4PWNA 4BVUA 1DI9A 3MWUA 2XH5A 1BL6A 3I4BA 4O7VA 4JRVA 4IX3A 2B4SB 3WF6A 3R7VA 4M3QA 3VNTA 4C02A 3EOCA 2LAVA 3WZDA 5KO1A 4ZSAA 5EQPA 2BDWA 2XJ2A 3EB0A 4TWCA 2P33A 1XHAA 3UVPA 1KOAA 5CEIA 3HMNA 4O86A 2WMRA 2PVRA 1PXJA 1G5SA 2PZRA 3BLHA 3RZFA 4IWQA 3AC4A 2PULA 2XK8A 4EONA 3CTHA 2X0GA 4D2PA 4PDYA 1OI9A 1CM8A 2VTTA 3FKNA 2V22A 1UWHA 3Q32A 4XX9A 1YXVA 2W1DA 3CY3A 3VS6A 2FYSA 3ORIA 4GCJA 4K6ZA 1BX6A 5JFXA 3RBWA 3JR1A 3AC8A 1F5QA 3C0IA 3NSZA 4RX5A 2YLEA 2F2CB 5B2LA 5FXSA 2XK6A 4RJ3A 1PMEA 4WBOA 5C01A 1R1WA 3B8QA 5EW8A 1ND4A 4YMJA 3U6JA 2QODA 5FBOA 3TIYA 5EOBA 1UVRA 4HYUA 1V0BA 3BU3A 3ZZWA 3CJFA 5LMBA 5C4LA 5DG5A 5KUPA 1TQIA 2Y4IB 4ZTRA 2YZLA 3IONA 3DY7A 3QTSA 1XH4A 4YHTA 1H25A 3Q53A 1CKJA 5A6OA 5BPYA 4UZHA 3KRLA 3R7OA 3GXLA 5LWNA 4EOLA 4K9YA 2B52A 2VTJA 2W05A 3OT3A 4J1RA 3AC2A 3RHKA 5AEPA 2R3QA 4MF1A 2YCQA 3UVRA 5GINE 5H8EA 1FQ1B 5ANEA 3VS2A 4ENXA 1AD5A 5CZHA 4JNWA 5C9CA 2UZVA 3ZBXA 3DB8A 3AT3A 5EH0A 1K3AA 4O91A 3ZSIA 3BBWA 4ITHA 4IVBA 2PVKA 2QONA 3CBLA 3D5WA 5FTQA 5T6KA 4ASZA 4Q5HA 4ANLA 2HZNA 1J1CA 3LLTA 3P23A 3K5VA 3AGMA 3FUPA 4JG8A 5EM7A 4CZYB 5AV0A 3HP2A 4FKJA 3ORPA 4EK3A 4FG7A 4FIJA 3GI3A 2C0TA 4RT7A 3D5UA 4EYMA 2XKDA 1W82A 4ZZNA 2EWAA 4M12A 3E8CA 3FLNC 3NWWA 3V8TA 1B39A 1DAYA 3GFWA 4G6NA 4MTAA 5DI1A 4BIDA 4MCVA 2NRUA 3NYVA 2QHMA 3ZMMA 4FV3A 1H26A 4WNOA 4EORA 3KA0A 3PYYA 4NTSA 4YUQA 4ZAUA 2YACA 1RW8A 5KBRA 4EI4A 3WF9A 2VNWA 3OBJA 5KX8A 3SLSA 3ROCA 4UMPA 4ID7A 3QTWA 5EOLA 5LCKA 3SX9A 3FI8A 3PRFA 4OW8A 1PMNA 4C0TA 3DXQA 3P9JA 2VWWA 3RAHA 3CEKA 1JQHA 3BLQA 3DXNA 4GIHA 5DRBA 4C35A 4FZAB 4YZDA 5E91A 1BUHA 3B8RA 4MNFA 2ITVA 4ASEA 4EEVA 5HO7A 3EFWA 1YOMA 3PY1A 3DV3A 1O6KA 3TN8A 5JGDA 3D9VA 4TWPA 4OLIA 3A62A 1ZXEA 2XVDA 3C51A 5DOSA 1R39A 2BIYA 3DJ7A 4X0MA 5AWMA 4U45A 3WZKA 3NNXA 1YWNA 2Z02A 3A8WA 3BGPA 5CENA 5JT2A 4E1ZA 2IZTA 4YJUA 5JFWA 4O7ZA 3VULA 4NTTA 3CY2A 3ZLSA 2V0DA 3OUNB 4AFJA 2ZM1A 3E3BX 2CGUA 3LXKA 3EYGA 4ZTHA 2UZNA 4BICA 5I9XA 5J5TA 3TUCA 1SMHA 1OVEA 2BUJA 2XJ1A 3QALE 3QKMA 4RFMA 4CV9A 3QD3A 2HK5A 5HLNA 3C4CA 2NNWB 3II5A 4U5JA 5D41A 1XKKA 1YVJA 4EHEA 4XNEA 4P90A 4A7CA 4QNYA 5GZ9A 5AP0A 4F0GA 4YSJA 1UU3A 2E9NA 5D9HA 3GCSA 5HQ0A 4R8QA 2F9GA 3CKWA 4I6BA 4C57A 5BVNA 4OTHA 5EYDA 5T3QA 4N57A 4U97A 3SW7A 4QMXA 2B1PA 5CEPA 4DHFA 3TV4A 5HNGA 1YQJA 1R78A 3NUNA 3MYGA 1WBWA 3Q52A 2W5HA 3EKNA 5DLSA 1H1PA 4EKKA 4HVHA 4RPVA 3KXXA 2F7EE 4FSNA 2CNUA 2EB3A 5M57A 3ATSA 4IQ6A 3FMMA 2VWBA 3BCEA 5KMMA 2W0JA 5A46A 4GMYA 4FYOA 5FM3A 1Q8WA 4DBXA 3C4XA 4MXOA 4C4GA 3HKOA 3PXQA 2XKFA 4NEUA 4IADA 5AV3A 3NUXA 4BDHA 3MB6A 4I6FA 4RMZA 4EQUA 2X9FA 1O6YA 3VRZA 5HD4A 4FTAA 3KULA 4M97A 4ZK5A 2XB7A 5C26A 2CSNA 3SRVB 3DXPA 3TJDA 5AR8A 1ZYDA 2GNIA 4D9UA 4NM7A 3TWJA 4WUNA 4CLIA 4WD5A 2BRNA 5M51A 2DUVA 2W4OA 2X2MA 3HVCA 4M69A 4F9WA 3IDPA 4DFLA 3C4WA 4LQMA 4G3DA 2J0IA 4FEXA 4JQEA 4EC9A 4M66A 4DITA 2KTYA 3R8ZA 2PPQA 1ZMVA 4GS6A 4IACA 4C4HA 2IN6A 4LMNA 4E6QA 2BVAA 4I94A 4Y46A 3R83A 2C1AA 4D2WA 1PMUA 3W16A 4JOAA 3BEGA 3A7JA 3EFKA 3PSDA 5AP1A 5HBJA 4TYJA 4ACHA 3RNIA 3PPZA 4Y5HA 4AU8A 2WAJA 4BI1A 1STCE 5B7VA 4IB1A 2OG8A 4W4XA 3QCXA 3TNHA 2BRHA 2HZ4A 4RQKA 2UZOA 4IAKA 4EKLA 5M44A 4RIWA 1IAHA 2UZUE 2ZM4A 3IDCA 2ZV7A 1YDTE 1CTPE 4W4WA 4I5CA 3VUMA 4EK6A 3UQGA 4QMQA 4FTNA 5HU3A 4RX7A 4D55A 4IZ7A 1U54A 4ITJA 4TYHA 4BHNA 3ZFXA 1Z9XA 5DR6A 3QKKA 4ENYA 3FHRA 3UPXA 3F2NA 5DPVA 5J5SA 2PE0A 1ZRZA 2SRCA 3A8XA 4GT4A 4QP6A 4AZWA 2C30A 2P0CA 3K3JA 5A9UA 2W7XA 2XBAA 4DFBA 5AP7A 3NUUA 2O5KA 3FKOA 2IG7A 4FSQA 4D2SA 5CEOA 2CNQA 4CFMA 1OIRA 4DH7A 3UP7A 4IAIA 1JOWB 5HKMA 1YDRE 3KXNA 4FOCA 4CKRA 1ERKA 4PPCA 1IR3A 4DEIA 2WOUA 4NH1A 3OCSA 4R7BA 2HZIA 2IW9A 1QPCA 3KRJA 3QD0A 5FBNC 4R77A 3F3WA 1JWHA 4AN3A 3ZRLA 2A0CX 2R7IA 2PWLA 4KS8A 2BDJA 4TYGA 3LFAA 4U9AA 4F0FA 4BTKA 3I6UA 4FZFB 1M17A 2JDSA 3KF4A 4MQ1A 4GYIA 4YJNA 3ZRKA 4UWBA 2WEVA 1TKIA 3JVRA 4QPSA 4XOYA 2JDRA 5AR2A 5DWRA 3QZGA 3VUDA 2BCJA 1WBTA 2JFLA 4FSRA 4MH7A 3C50A 2JDVA 3TG1A 5HI2A 3TL8A 3W8LA 3QTIA 4W8EA 2C3JA 3SOAA 3S0OA 2VWXA 3UP2A 5AA9A 2VTLA 4G16A 5ANKA 1X8BA 3KRWA 2IJMA 3LVPA 3TNPC 4HVDA 3F5UA 5D7VA 5G6VA 2CJMA 4YSMA 5J9LA 4I5PA 4ACCA 2UZWE 3G2FA 2B55A 3R02A 2JDTA 2I6LA 2IW8A 3ZDIA 4U8ZA 1OPLA 5KKRC 2WMTA 5E9EA 3DB6A 3EQDA 3QGYA 2J50A 3R73A 2WGJA 3UOLA 2RG5A 2OSCA 3DDQA 4QMSA 5AUWA 1DM2A 3EFJA 3IW8A 3AG9A 4D58A 1IA9A 5CZIA 5KZ0A 5HE0A 4FV8A 2PTKA 3E88A 2X6DA 4FMQA 4FL1A 3FE3A 4ALUA 4E93A 3HV6A 1B38A 4BDBA 4ZTMA 3GCQA 4FT5A 3OD6X 1FPUA 2XNNA 3WZEA 3ZLXA 3U55A 4BKYA 4K33A 5M06A 3WF7A 4UBAA 4CQGA 5A4CA 2PVHA 4PNKA 3KVXA 3QX4A 4FL3A 3QU0A 4IXPA 4HCTA 5AUXA 5ANDA 3SXSA 2ONLC 3NNUA 3LFQA 2OJIA 1GJOA 4C4IA 5HIBA 4RVKA 3EKKA 4F64A 4BCIA 3VF9A 4CFNA 5A4LA 3FZSA 1U59A 1BLXA 3DU8A 4FIEA 1GOLA 1PYEA 4TRLA 2XJ0A 4F4PA 1JKSA 2YWVA 4M67A 5HLPA 4E26A 1YHVA 2GHMA 3P86A 2OI4X 2G2FA 4RRVA 3NNVA 5E8TA 4ZJIA 1KE7A 4H3PA 3FMKA 3ZH8A 4ARKA 5CU6A 3UODA 3UYSA 3UNKA 5J7BA 4ZMFA 3DGKA 3GGFA 3MY5A 3UG1A 2J5EA 3FC2A 4BCMA 3MVLA 4C2VA 4CCUA 2WQOA 4RBLA 2BZHB 2XYUA 1PXIA 3GCPA 3PTGA 4IWPA 3V5JA 4FTJA 4E5BA 3NW7A 4OR5A 2EU9A 3QHRA 2QQ7A 4EC8A 2GQRA 4YC3A 2J9MA 3D83A 1YHWA 3IECA 3Q4TA 3G90X 4X2JA 3AMBA 5JZJA 3KREA 5FUTA 5KE0A 2R3PA 4DG2E 4F9BA 2EXEA 1CDKA 1JVPP 1L3RE 2IVUA 2ZOQA 4JR7A 1PXKA 2WTJA 3CCNA 4NJ3A 4HVIA 5FDXA 3BE2A 4EH9A 3AC5A 4BR3A 4YJQA 4XLVA 3R1SA 3MV5A 5AX3A 3BYOA 4UWYA 2JAVA 4W9WA 1ZZ2A 4RC3A 2OH4A 5G1XA 3ORXA 4C34A 3DK6A 3R1YA 4QMOA 3B2TA 1WVXA 3QQUA 2JKMA 3CPCA 3E92A 3EFLA 3K2LA 4YNOA 5ANIA 3UIMA 3DK7A 4A4OA 2C6EA 1WVYA 3FXXA 5BVFA 3IK3A 4QYYA 4O84A 1QMZA 5EHOA 3EL8A 5IZFA 3EHAA 3LQ3A 2UVYA 3PXYA 3HRFA 1XH6A 4IW0A 3TIZA 5HG5A 4CXAA 2GSFA 5IDNA 4ACMA 5CU4A 4F63A 3IOKA 4IFGA 5CF6A 4G9RA 4ZZMA 2FO0A 3HNGA 1YRPA 3C5IA 2R3FA 4OTQA 5KHWA 3GQIA 2R4BA 2XCKA 3WIKA 3RZBA 1SNXA 1H8FA 4J8MA 4KKEA 2ERKA 1H24A 3D7TA 3COIA 3OWKA 4AGCA 2AC3A 2GPHA 4FVRA 2BPMA 3EYHA 3GVUA 4KIPA 4NFNA 3UOHA 4O96A 4YZMA 4DGNA 4V01A 4YJOA 2BHHA 3QRKA 5TF9A 1GAGA 4DN5A 3ZCLA 2I7QA 3GT8A 4CVAA 2W1ZA 1IA8A 1ZYJA 2OZOA 4OTPA 3CPBA 4FI1A 1R0EA 4S32A 3JS2A 2O3PA 3GU4A 1XH8A 3TZMA 3F5PA 4X2FA 4H1MA 4KKHA 5H8GA 4YBKA 4RWLA 3EQHA 4UWCA 2HW7A 3I79A 4HVSA 4JG6A 2G01A 5F20A 4KIQA 3BU6A 4M69B 4USEA 4GVJA 1H0VA 4O7TA 1LPUA 3FLZA 5CX9A 5C8MA 1ZY4A 3FMEA 2XS0A 1M14A 4FSTA 4C3FA 1A48A 1OL6A 2UW4A 3R21A 4NJDA 2BTSA 1NT2A 4FTQA 1CKIA 1EH4A 3PVUA 3GC8A 5M53A 4LV8A 3LXPA 4EK4A 4F7SA 4CT2A 4CRLA 4TY1A 4BCOA 3RJCA 5AA8A 3OEZA 5GNKA 4WT6A 4FV1A 3TZ9A 1OPJA 4BYJA 3MA3A 5KMIA 3Q04A 4L43A 3H10A 3KK9A 4FT3A 4YLJA 4BDIA 3TZ7A 2GQGA 2VNYA 2WELA 3A7IA 3FMLA 5KNJA 4YLKA 4FG9A 2WB8A 2YCSA 4RIWB 1HCKA 3ROYA 3R01A 3VC4A 2XF0A 4MX9A 2CCIA 2ONLA 5TE0A 4G3EA 3TTJA 3R1NA 3C0GA 4ITIA 3I0QA 5DIAA 4CKIA 1U54B 3MH1A 4TYHB 5CAOA 5KMLA 2REIA 3R0TA 1CMKE 4JI9A 4PDOA 3VS7A 5IH5A 3W2QA 3OOGA 4K8AA 5EYMA 4U81A 5LMAA 5F4NA 3NIEA 2OXXA 2XMYA 4BIEA 3FBVA 3HL7A 2FB8A 1QPEA 1XBCA 2JFMA 2C3IB 1J1BA 2ITYA 2RFDA 3QKLA 2VX3A 4OTWA 5ANOA 5DR2A 4EQMA 5M4IA 5BMSA 2WQMA 3UC3A 2W1FA 5IUIA 4E73A 5HG7A 4IDVA 5CI6A 4WIHA 3FY2A 4BKJA 3U6IA 2V55A 3F82A 4FKGA 4MD8E 4L8MA 3AT2A 3K3IA 4CTBA 3QTRA 2RKUA 2VTOA 3C4ZA 3R7GA 4U43A 5FP5A 2RSVA 3NLBA 1M2QA 4QTCA 4K0YA 4QYFA 4O0WA 5J87A 3DZQA 3W2RA 4HYHA 5AR7A 1NVRA 4JQ8A 3VVHA 4CRSA 4X3FC 3FJQE 5BUEA 4BWXA 2OJJA 2EXMA 4ERKA 3EJ1A 5AX9A 1FVVA 2C69A 3BELA 3LMGA 2GNFA 4CG8A 5HIEA 4IZ5A 2E2BA 3GOKA 1UNLA 3DKCA 5LVNA 2YFXA 4UY9A 4IBMA 3RK7A 4FEUA 2PVFA 4QP1A 4RJ6A 5J79A 3FPMA 3R9HA 2XIXA 3DJ6A 4S2ZA 3MFTA 4DEHA 5AFVA 3ZZEA 3ZONA 2PUPA 5DE2A 4UMRA 2WKMA 3F3TA 5AUVA 4Q9ZA 1QCFA 2KULA 4MK0A 3TTIA 4LL5A 2GNGA 5BUJA 2XNGA 4HGTA 4BCHA 4DCAA 4FV0A 2WTKC 4S34A 4FEWA 3D5XA 4C4EA 5L8KA 3ITZA 4GFGA 3UPZA 4J7BA 4RVMA 5ETIA 2IWIA 4YTCA 5DT0A 4D5HA 4FSUA 4EOMA 4MD9E 4M14A 3ZO4A 4QP8A 4PY1A 4YZBA 2R5TA 4V0GA 3UJGA 3GU6A 4G5PA 4APPA 4C62A 4ZSGA 4XBUA 4QMNA 5JKGA 4RA5A 3ZYAA 5EYKA 4C4FA 2Z7RA 3VBQA 3W18A 4ASXA 5HE1A 5C8KA 3OEFX 1NY3A 3FMJA 4NM3A 3FLQA 3NAYA 4FKTA 5L2IA 3CGOA 2BRMA 2PMNX 4GK2A 3DDPA 3QQHA 3L9PA 4YTFA 5ANGA 4DTAA 4IE9A 4GJ3A 2OXYA 4BZNA 5E8SA 4F65A 1PYXA 2G15A 2OO8X 3IW7A 3Q4ZA 4C59A 2C0IA 4CFWA 4AAAA 1BMKA 4YU2A 4A9RA 3KF7A 4AWIA 3QQJA 4KRCA 5FRIA 3VF8A 4WRGA 4DGMA 4O83A 4MEDA 2C3LA 2PZYA 5FD2A 3W2OA 3ZSHA 1ZYLA 3CS9A 3A4PA 2OU7A 3HUCA 3DBQA 4LGDA 4Z16A 4WSYA 3UGCA 1ZMUA 4AS0A 4O82A 3NNWA 2VU3A 3NUPA 4FZDB 3TKIA 5HCZA 4KRDA 4F9CA 4J53A 2C47A 2BALA 3FY0A 3QAME 5A14A 1T45A 2GU8A 2YJSA 4L42A 5JRQA 3OWJA 4RZVA 4FKQA 5I4NA 4EJ7A 1MUOA 1UA2A 3W32A 2W06A 5FDPA 5IUHA 4D1ZA 3TUDA 4NL0A 3CLYA 5BYLA 4IAFA 3MPTA 2IW6A 1DAWA 3R30A 4ALVA 1UU8A 3GUBA 4MXYA 3WI6A 5JEBA 2C6OA 4GG5A 3R8MA 3H30A 4GV1A 4IWOA 3A7FA 3EN6A 3DA6A 4R1YA 2J51A 4E4LA 3VWAA 4LG4A 3FZOA 4B8LA 3ZXZA 2B0QA 1MRUA 3EQRA 5J95A 1UNGA 3UBDA 2YM6A 1BI7A 1JSTA 2DYLA 3FI4A 4S30A 5K4JA 4FSWA 4LYNA 4BBEA 1OKZA 3EN7A 3SGCA 1UV5A 3C13A 4RIXA 3ZU7A 3UO5A 5BVWA 2GFSA 3F5XA 2VTRA 3FLYA 4I4EA 4X3JA 5CS6A 5IEXA 4GH2A 4UYAA 4CMTA 2H9VA 5L6WL 3P4KA 2P2IA 2PVLA 4WNMA 5LQFA 2Z2WA 4FV2A 3OTUA 1U5QA 3D94A 4Q9SA 3RVGA 4NSTA 3H9FA 5E1EA 3ZC6A 4TYIA 3ZM9A 4GKIA 3OXZA 3MIAA 3OY3A 1YWRA 4JAIA 5HE2A 3EQIA 4LM5A 5AR4A 5JZNA 1OB3A 5AADA 4JIKA 2NRYA 4Z7GA 4QNAA 3NIZA 2Q83A 3DBEA 2V7AA 5E8VA 4F99A 1PXPA 4BCGA 2BMCA 2RIOA 4KWPA 4EBWA 2ITNA 3V01A 4PMMA 1DI8A 4QPMA 2ETMA 2O63A 2OGVA 3OS3A 1CSNA 2P55A 3V3VA 4A9UA 3SOCA 4CQEA 3PA4A 3S3IA 3LZBA 4CKJA 3D7TB 5HHWA 1E1VA 3P0MA 5CWZA 3Q6WA 4BGHA 5AAFA 3V51A 1IEPA 3V5WA 4X3FA 4I93A 4FSZA 4DC2A 2CN8A 2PMIA 1FINA 2XK3A 3DZOA 1TQPA 2WO6A 3QXPA 5AP4A 4GFMA 5EKOA 2C6MA 4EOJA 2GNHA 5FEEA 3DKOA 3R9DA 4EK8A 3QC9A 5E8XA 3RAKA 1I09A 3RPVA 3F3VA 4U0IA 1Q8UA 3KCKA 3FDNA 3MH3A 3LQ8A 4OT6A 2W9ZB 4UEUA 4QMUA 2ITQA 4BBMA 5IQAA 4FKLA 3POOA 4F6UA 3NW5A 1UWJA 5JQ5A 1Y8GA 4PPBA 3SC1A 2YAAA 4NYEA 1Q5KA 5BVEA 1OZ1A 3RGFA 2WEIA 3R04A 5ACBC 4X6QC 3OWLA 3AGLA 4MXAA 2UZLA 3QGWA 5HCYA 2GHGA 4FA2A 3GC7A 2WMQA 5DEWA 4RWJA 4TWNA 4UXLA 3WF5A 4AE6A 5B2KA 3SDJA 4WRSA 2RGPA 3DLZA 2XYNA 3R9NA 4GSBA 3TM0A 2J90A 2IZUA 3EWHA 2VWIA 3BQCA 3ZUUA 1Y6AA 2WHBA 4G3FA 3ACJA 3DTWA 4BY9E 1XBAA 3HGKA 1H08A 1XH7A 3L8VA 4JDHA 5HBEA 5H9BA 3OF0A 3NCGA 2WZJA 2CKPA 4U3ZA 5D10A 3ET7A 4EOOA 1M7NA 4PTGA 2YZAA 4V05A 4RJ8A 4OAUC 5DRDA 4L68A 2ERZE 4U41A 2GS2A 2VAGA 3CQEA 2C6TA 3F3ZA 3HLLA 4IMYA 5HEZA 3NVKI 3Q3BA 4X7QA 3JYAA 2UW5A 1SNUA 2QC6A 3LM0A 2GS7A 2W5AA 4NIFA 1H07A 3D15A 5AMNA 4DEDA 2BKZA 4AOTA 4I5HA 4BTMA 1CKPA 2X2KA 3BGZA 5HO8A 2BR1A 2W1CA 3TI1A 3NW6A 2UW3A 3FZRA 4L7SA 1UNHA 1HCLA 2BILB 3FMHA 4IX4A 4ONAA 3R7IA 3RCDA 1U5RA 3V5TA 4BRXA 4F70A 4FX3A 1Q24A 1VYZA 5LCJA 3EQPA 3ANQA 4HYSA 5KCVA 5DEYA 4R5SA 3W8QA 5KMNA 5IQFA 2R2PA 1XQZA 2WMXA 2H8HA 2PVMA 4E4XA 1UKHA 3O8UA 4I3ZA 4LMUA 4LOPA 4DGOA 2HZ0A 2XK7A 3IKAA 2BHEA 3GP0A 3CXWA 4JX7A 4PP9A 2ZB1A 4R3PA 5E7RA 2PE2A 1JKTA 3MTFA 4MD7E 3NMUF 5L6PA 4FV9A 4BCFA 3VS5A 3FAAA 4HVGA 4XV3A 4TKSA 4ZTNA 4B6LA 4OT5A 2RFNA 2YIYA 5HG9A 3LXLA 1PJKA 4Y72A 5IH6A 2GS6A 2PZPA 3QTUA 4NFMA 5JRSA 5CF5A 3N4VA 2YABA 1XR1A 2J0LA 2UW9A 4S31A 4XP0A 2QR7A 3VUHA 4DLIA 4U40A 4N6YA 3NS9A 4RC2A 3VS0A 5LVPA 3MESA 2UW6A 2YDJA 4Y8DA 2BKKA 2FUMA 4MWIA 4FUYA 2W99B 3L9LA 4FF8A 1MP8A 4QMPA 1P4OA 5E8ZA 5EQYA 4I0TA 3FZPA 3RALA 3PXRA 4DH3A 2RFEA 3U51A 3SXFA 1BYGA 5IISA 1J3HA 4RIOA 1Z5MA 5D12A 3V6RA 3QUPA 4GRBA 3QTXA 2OXDA 3Q5ZA 5J8IA 4NT4A 5AV4A 3EQGA 3GU7A 4L9IA 3Q2JA 4JIAA 3T3UA 4DE4A 4CG9A 3BI6A 3JY0A 4FNYA 5BYZA 1XO2B 2GNLA 3I81A 3FPQA 4E5WA 2OZAA 3R7UA 1NVQA 1R0PA 3IO7A 4IAZA 4RSSA 5DR9A 4V0GB 2VTQA 4RLLA 3PY3A 3QTZA 5IF1A 5FTOA 3PDTA 4AZEA 3BV2A 4R1VA 2QOBA 3LFCA 2JEDA 4GK4A 1G3NA 2A27A 4MVFA 2JBOA 4FODA 4JAJA 5AV1A 1T46A 1OL7A 2CGWA 3BWFA 2ETRA 3LCKA 4K1BA 4YZCA 1JAMA 3NUSA 4XHKB 5HORA 3DQWA 3OUKA 3PRIA 4QMMA 2W96B 5EHYA 2B9JA 4C58A 4F7JA 4Y85A 4FIHA 4K18A 2I40A 1REJA 3O8PA 3PZEA 3E7VA 2H96A 4GU9A 5EYCA 2X9EA 3PXFA 3IDBA 2C6LA 1H1RA 4BN1A 2A19B 4D1SA 3ZEPA 4TZRA 3JY9A 5H8BA 3TDWA 3PZHA 3UNJA 4GW8A 3W1FA 4N4SA 4LI5A 2ITZA 1YI4A 3UZRA 3ATTA 3V5LA 1FVRA 2XNOA 4O1OA 5M4CA 3GBZA 1Q4LA 4DFUA 3G5DA 3LE6A 2YLFA 5DGZA 4W4YA 3CSVA 2NP8A 3OCBA 3F6XA 3UIXA 5LOHA 2CN5A 4F08A 1SVEA 2BAKA 2X7OA 2J0MB 3E7OA 4FBXA 5CVGA 5CF4A 2H34A 1OKWA 3F2RA 2WMSA 4U44A 2X4FA 4DFZE 4RJ4A 4UMQA 2DWBA 4XCUA 3LMHA 1IG1A 3QQGA 3F9NA 4G17A 4QTDA 4P5QA 4N0SA 4XV2A 2ZM3A 3RM6A 4EH8A 2CGXA 2YCFA 4PRJA 2YISA 1M2RA 1AQ1A 2JKOA 4JDIA 4YJPA 5FGKA 1URWA 1K2PA 5HGIA 4D0WA 4DLJA 4YJVA 5JFVA 2WNTA 4EOPA 3HMOA 4L6QA 3W10A 4D28A 4EOIA 4B8MA 4E3CA 4TNBA 1YW2A 3HV7A 3QD2B 4PX6A 2B53A 1ZMWA 4O1PA 3RCJA 2VWZA 1QPJA 4MBJA 3VS1A 4QTEA 4YNEA 4RIXB 3K54A 5LMKA 5H2UA 3FL5A 2XNPA 2XNMA 1J7UA 2GQSA 1Q61A 4ZSJA 2WTVA 3I5NA 3CD8A 5I3OA 3TKHA 4QD6A 5HU9A 4FT7A 5BX0A 4O7SA 4QP9A 5IEYA 3LFNA 3G15A 3PJ2A 5EW9A 2YJRA 5IPJA 3OWPA 3ZLYA 1OM1A 3CQUA 4I1ZA 4QMVA 3S4QA 3LCDA 5E4HA 5DHJA 3PVBA 4FT0A 5DVRA 5JGAA 3RNYA 2VX1A 1U4DA 4AW5A 4G31A 4U79A 2I1MA 3QD4A 2JIIA 4NK9A 5K0XA 3PWDA 5HBHA 4AW2A 5IA4A 3FLSA 5AP2A 4IZAA 3KY2A 5IG1A 2WMWA 3P7BA 4FL2A 1FVTA 1A06A 2HENA 2HXQA 3E8EA 3QYZA 4A06A 4GJ2A 2AYPA 1KV2A 3ANRA 4IVAA 3O17A 3UTOA 4BZOA 2Y4IC 2Z8CA 2PSQA 1WBNA 4BDJA 1WBSA 2XP2A 3ULIA 4XG9A 3L8PA 4X3FB 4IZYA 1YXXA 4FTTA 4AT5A 4P4CA 4BB4A 5HTCA 2WQEA 3MFSA 2UV2A 2R7BA 1YDSE 3C4FA 3KMMA 4FKRA 1RJBA 4WBBB 3HECA 5EM8A 3ZUTA 4AN2A 2JLDA 3G6GA 3T8OA 4YURA 4LUEA 3QQLA 2QG7A 4C3PA 2YCRA 3MJ1A 1H1WA 3HEGA 4ZJVA 3BYVA 3OMVA 4JS8A 4MBIA 4M15A 3PLAE 3U6HA 4DFXE 3GB2A 4N70A 4ERWA 3TNQB 4KIKA 3C9WA 2W1GA 3QXOA 4G3GA 3VJNA 3QLGA 4NM5A 2X7GA 5HVKA 1ZZLA 4BDCA 2WTKB 2XIYA 1WVWA 5A4TA 4QTBA 4F7NA 3ACKA 4GEOA 3BHVA 3P79A 3SV0A 4BWKA 3WZUA 4CFVA 1KE6A 5IA3A 3MFRA 3WARA 3HDNA 3F66A 3DLSA 1KE8A 5BVOA 3PVWA 4KD1A 3O2MA 5HTBA 3G0EA 5HVYA 5M56A 5C8NA 1YI6A 2UZDA 2WD1A 3MVMA 3BIZA 5IEVA 2BAQA 1OL5A 4EUUA 4F6WA 4HZSA 2VN9A 3UVQA 1XWSA 5DMZA 3A2CA 4C3RA 3HA6A 3CR0A 3VHKA 1J7IA 4WA9A 3RPSA 1G8SA 4EZ3A 3R22A 2ZAZA 3WOWA 4LRJA 4IVCA 4E20A 3L1SA 3U9CA 4ZIMA 1DS5A 2UUEA 3DAJA 1V0PA 4YPDA 4DCEA 5IUGA 5IQHA 4DEBA 1YOLA 3D0EA 2RFSA 3UYTA 1ZOGA 4OBOA 2BROA 3V6SA 4PQNA 4Y95A 4YHFA 4EOSA 5KBQA 3JUHA 3VQHA 4HNFA 2Y6OA 2YWPA 1KOBA 4RVLA 2C5NA 1H28A 3V04A 3AOXA 2GFCA 2OF4A 3EN5A 4FR4A 1H4LA 4DFNA 4G6LA 4BTFA 3UOJA 3LJ0A 4AXAA 5CEMA 4CFUA 2ZVAA 3ZEWA 4CEGA 1WBPA 5F9EA 3M1SA 2C5XA 4QQCA 1OGUA 5H3QA 5HCXA 4BYIA 2W4KA 3TACA 4GL9A 3RM7A 3KVWA 3MPMA 2FSMX 2R9SA 3I0OA 2XM8A 3R7YA 3LFFA 3QRUA 2BRBA 3AD6A 4AA0A 4BDFA 5CVHA 3PIXA 2WTCA 1H0WA 1A9UA 4IH8A 2PU8A 5A3XA 1PXOA 4CCBA 3LFEA 3ULZA 4WG5A 1H00A 3ZSGA 3JVSA 4U42A 2CCHA 2P2HA 4QQJA 2B9HA 2P3GX 3SG9A 4MHAA 2VTMA 4UZDA 2B54A 3VIDA 1GZOA 4O0TA 4AOIA 3HRBA 5IA1A 2ESMA 3KQ7A 2QOQA 3PG3A 5FWKK 3GOPA 3BYMA 2I0YA 2IVVA 2WTWA 2UZTA 2B9FA 1S9IA 5M55A 3BHTA 4BCJA 2OJFE 5A4QA 4IB3A 4OTRA 3HMIA 4PP7A 5CT0A 5HNIX 4YZNA 2YDIA 4TXCA 2R3LA 2WIPA 2ZDTA 4DFYA 2EB2A 3CC6A 3E93A 4YP8A 2CLQA 5J7HA 4Z7HA 3AQVA 3KULB 1SM2A 1ZLTA 5CT7A 1OECA 3OW3A 2OZAB 2QLQA 4ZZOA 4CNHA 4DG0E 3P08A 2ZMCA 4K2RA 3UIBA 2JIVA 3RAWA 4DEEA 2YIWA 3H4JA 2QOCA 3E87A 4A9SA 2ZMDA 3F69A 1R3CA 4O0YA 3Q4UA 3Q9WA 3UMXA 4EUTA 5KMJA 4HGEA 5CASA 2LGCA 3MSSA 1PHKA 2R3OA 4RC4A 5BVDA 3HAVA 3ZDUA 3PJ3A 4W8DA 4FK6A 4EH3A 1ZOHA 2Y9QA 2GCDA 3VBXA 2C4GA 4I20A 4D5KA 2JC6A 5BYYA 3IW6A 3ZFYA 5HTIA 3A61A 1LUFA 4LGGA 4DH5A 4AOJA 2ITTA 2VWYA 4EHGA 3FI2A 2QCSA 2OBJA 3DAEA 5HNBA 2OWBA 4HYIA 3ZOSA 3WE8A 2PYWA 2R3GA 3PUPA 1GY3A 3CQWA 3PSCA 1Q3DA 2XIZA 4P2KA 4A9YA 4QRCA 3A60A 4L3PA 4YC8A 1BL7A 3EL7A 4M8TA 3PXZA 3EZVA 3QF9A 2J0KA 3GFEA 4NCTC 2WIHA 1PXMA 3LMIA 3OZ6A 1LR4A 3R6XA 2O2UA 2J6MA 5AP3A 3BPRA 5GJDA 3TEIA 5KHXA 3PSBA 2QR8A 3MTLA 1KE9A 3E3PA 3LJ1A 3MDYA 4NW6A 4NZWB 4E6CA 4FEVA 4ANQA 5IU2A 2WMUA 3U87A 3F61A 4IC8A 1Q41A 3QRIA 4L01A 5IKWA 3PA5A 4B7TA 4J99A 4G5JA 2FSTX 3Q5IA 3LCTA 2E9OA 2ZV8A 4FC0A 3LOKA 1SVHA 1JSUA 4KNBA 4NWMA 5CNOA 2OJ9A 3GNIB 2PUNA 2R3IA 2Y0AA 4FUXA 4Q5EA 4IEBA 1P14A 2VTIA 4YTHA 1H1QA 3QX2A 1PXLA 1RDQE 5I9YA 3RMFA 3R9RA 5L6OA 2BTRA 4CV8A 3UQFA 3PJ1A 4PUZA 2YIRA 3OCGA 4YPSA 3GC9A 3I1AA 3QWJA 3BZ3A 4XG8A 4NU1A 5E90A 3R8PA 4APCA 3F7ZA 5CTPA 3UC4A 4J96A 4ZLYA 2XKCA 3PPJA 3Q6UA 4FV6A 4F9YA 2I0HA 3K5UA 2C5OA 2F57A 2JKQA 4KINA 4FTLA 2PE1A 1Q97A 4IHPA 2QNJA 3OXTA 3QA8A 3ZTXA 5C4KA 4PDSA 3QA0A 2YITA 4V04A 3WF8A 3N4TA 4Z9LA 5GIOE 4N6ZA 4X2KA 4JBVA 2EUFB 2UW8A 3BEAA 4HCUA 4CMOA 1E1XA 1SZMA 4G2FA 1WZYA 4U3YA 1FGKA 2PZIA 1FMKA 3DNDA 4W4VA 5K5NA 1OBGA 1LEZA 1WFCA 4ZXTA 4FIFA 2CHLA 4JX3A 3ZRMA 4W9XA 3RKBA 5LXMA 5A6NA 4B0GA 1NA7A 3TJCA 3Q9XA 3T9TA 3ZBFA 2GTMA 4RA4A 2QO2A 2WTDA 3CGFA 3PVGA 4L00A 5T68A 3SQQA 2XNEA 3DKFA 4O21A 3ZXTA 4ZSLA 2XNBA 4R78A 2R3MA 4XP2A 4IC7A 5I3RA 3Q9ZA 2GDOA 1O6LA 2QU5A 3S00A 3TNWA 4FSYA 4ACDA 2CPKE 1SVGA 3COHA 3G33A 4QMWA 2C6DA 5DFPA 2OICA 4AA5A 1RE8A 3OVVA 3DBCA 4F6SA 1H1SA 3E5AA 5EKNA 4AZSA 4QMYA 5AIKA 4BI0A 3R00A 4L7FA 4C36A 3RI1A 5L2SA 4CSVA 5DA3A 4R3RA 5ETCA 4DT9A 4CGAA 3NPCA 3PP1A 5FG8A 4CYJA 2ITWA 4TN6A 3RWPA 3DS6A 4JJRA 3ZHPC 4KIKB 3RPYA 4AF3A 3IGGA 4U6RA 1ZYSA 2X8EA 4FKPA 4BF2A 3D5VA 3ORKA 3C4EA 3FKLA 5HICA 4E6DA 3MJ2A 3B2WA 3KL8A 4H36A 4S33A 2WMAA 3HYHA 3IS5A 2VTAA 4OGRA 3SRVA 4EWQA 4PL3A 5L2QA 1Q8ZA 3D2IA 4RJ7A 4KA3A 1G8AA 1IRKA 3EMGA 5HIDA 4ANSA 3OP5A 4IM0A 4EOKA 4XOZA 2PVYA 2XM9A 3QTQA 5JMSA 3IG7A 1F3MC 3MY0A 4DEGA 1H01A 4AP7A 3RTPA 4QP2A 3TNIA 5J1WA 3I7BA 3U54A 4FICA 4G9CA 2WPAA 5FEDA 4O7YA 4ZS0A 4OTFA 3FYKX 4UN0C 4JBOA 5CYIA 4QT1A 4LOOA 3SD0A 3O7LB 4X6RA 5K4IA 3F88A 5I0BA 4R5YA 5FQDC 4H05A 4Y73A 3ZS5A 4AGUA 2VO0A 3PFQA 4AW1A 3KXGA 4MNEA 4ZTSA 4MXZA 3QZHA 2RF9A 4PF4A 1VEBA 3G51A 3ETAA 4M7IA 3MH0A 4GG7A 4NCTA 3WILA 3O96A 3QC4A 3QFVA 4LGHA 4TL0A 5CAPA 4MF0A 1KSWA 5HZNA 2JBPA 4YJRA 2QO9A 4RJ5A 3OFMA 4ZTLA 4YZ9A 4AW0A 3MH2A 1W84A 1UKIA 3FMNA 2CNVA 5AP6A 4ZEGA 5E1SA 2X8DA 4M68A 3VJOA 1P5EA 3L8SA 1M52A 3PJCA 2XK4A 4AT3A 1OKVA 5D1JA 3BRBA 3UE4A 4D4SA 1YI3A 1ZWSA 1ZOEA 5CXZA 5DT3A 3MBLA 4EHVA 4O2PA 1KWPA 2H6DA 4QMZA 4FTOA 2DQ7X 4YJSA 4EH7A 2A2AA 2GHLA 4AN9A 2WXVA 5EQEA 1OIYA 5A4EA 1KUTA 3I60A 3S1HA 2F7ZE 4D1XA 3BHYA 1XJDA 3ALNA 4YO4A 4CZUA 4QTAA 4FGBA 4A4XA 5EI6A 3ZUVA 2VUWA 3LCSA 4R3CA 2P4IA 2WU6A 2ZJWA 3D4QA 4O2ZA 5IA5A 3WYXA 4ANMA 4X2NA 3DT1A 4IM3A 3S95A 1JKLA 4AT4A 3BYSA 4CMUA 5C1QB 3R28A 3ODZX 5EDQA 3PP0A 3I5ZA 4J71A 4BKZA 1JBPE 1ZYCA 1ZY5A 2WU7A 1FBNA 4RFZA 3RK5A 4FTRA 2XIKA 3SXRA 4YJTA 3UDBA 3C5UA 4GVAA 4F0IA 4KBKA 3KB7A 3D2KA 4EBVA 5B0XA 3WBLA 1GNGA 3D14A 3PE1A 4FKIA 4LL0A 3RK9A 3H0ZA 4C2WA 1PKDA 1Q3WA 3DJ5A 5KKRB 1PKGA 4CTCA 3PE2A 4G6OA 1VZOA 1YKRA 4JBPA 2OH0E 4WUAA 3FQHA 2E9VA 2QVSE 3MGYA 1BI8A 1JSVA 4KKGA 4PNIA 2Q0BA 3FQEA 3AD5A 5HE3A 3FSFA 5KZIA 5L8JA 3VHEA 4HNIA 3NVMB 4CD0A 3IPHA 2CGVA 5CSPA 3KGAA 1PF8A 5I9UA 5K9IA 2JD5A 2NO3A 3ZO1A 1P4FA 2HYYA 5CXHA 5I5ZA 2IPXA 1PW2A 1W7HA 4C33A 4EYJA 3UQCA 3HV5A 4I0RA 2VTPA 5A54A 5LWMA 3FQSA 3TXOA 4C61A 2GTNA 4EH4A 4R7HA 5CAUA 4B4LA 3KFAA 3MFUA 4GU6A 5EDRA 2C5YA 4DEAA 3FV8A 5HD7A 5CU0A 2YERA 4HCVA 4IDTA 3FWQA 2X2LA 5L8LA 3GCUA 1V1KA 3V5QA 4HJOA 2VX0A 2J5FA 5BNJA 4L67A 3BLRA 4UMTA 5AIRA 5CQUA 5EM5A 1P2AA 3R2BA 5D7AA 5HVJA 5AAGA 5I9WA 2OLCA 3W2PA 5AAEA 4O7WA 3BBTB 4H3QA 5LVLA 4WHZA 4EH5A 5ETAA 3TKUA 2C3KA 3HZTA 4RQVA 5FEQA 3BHUA 4K77A 1VJYA 4XV1A 1HOWA 4FV5A 3WZJA 2ZB0A 3P5KA 4I92A 5M4FA 1GIHA 4C38A 3OCTA 5BUIA 2CDZA 2HXLA 3PIZA 4NW5A 4ANNA 2YM5A 3MVHA 5KMKA 3Q9YA 1GIJA 1S9JA 4I5MA 5BQ0A 2YM4A 5BVKA 3G6HA 4A4LA 2WQNA 1IAJA 3NYNA 3V5PA 2X1NA 1OMWA 4XYFA 3ELJA 4KABA 4XG7A 3ERKA 4FE2A 3G0FA 3MA6A 1BKXA 4JQ7A 2VO7A 4BL1A 3FI3A 3R2YA 2YM8A 3KN6A 4BFMA 4H39A 4ZTQA 5AJQA 5M09A 4ZS4A 4GK3A 5CY3A 4QMLA 4LRMA 4QPAA 4FTUA 1Y8YA 3KEXA 3LFDA 2QHNA 2X81A 3ALOA 5TKDA 2UZBA 2PVNA 4IJ9A 2QU6A 4I24A 4QOXA 5J9ZA 1KV1A 4FKVA 3W55A 2YDKA 4BCQA 4XS2A 4E4NA 4IIRA 4ZLOA 4FKWA 4FVPA 4FEQA 1WCCA 3QCQA 3N9XA 3OG7A 4NKAA 3PLSA 5EK7A 5ICPA 3FSKA 4JBQA 5DNRA 4IANA 2QOLA 5CANA 2HW6A 5GZ8A 2VTHA 3DNEA 3E64A 5AM6A 3DFAA 4FIIA 5L2TA 2I0EA 4J8NA 4B9DA 1M7QA 1QPDA 1FGIA 3O71A 4WSQA 4AZTA 5DYJA 3RWQA 3NCZA 3COKA 5K0KA 2QOKA 3ODYX 4WG4A 3GU5A 2O8YA 3EQBA 3FZTA 2OJGA 2C1BA 4QP3A 1YXSA 3ENHA 3MI9A 2W1EA 3C1XA 2QD9A 1JPAA 2EVAA 2BIKB 5DT4A 5FXQA 3THBA 3LKMA 3A99A 2ACXA 4U80A 1OITA 5AV2A 2XKEA 5L3AA 3MY1A 3REPA 4HPTE 2XBJA 4OTIA 4TNDA 3FLWA 3P1AA 4RWKA 4TTHB 4BDAA 3VS3A 3NUYA 4BDKA 3QLFA 3BQRA 4MXCA 4QYHA 3U9NA 3R71A 4BCNA 1J7LA 2WQBA 3VUGA 1URCA 4DYMA 4MYGA 3LW0A 3NUAA 5IQBA 2XEZA 3QQFA 3BU5A 2YEXA 4H3BA 5ACKA 2Z7QA 4BDGA 3PPKA 2G2HA 2UW7A 2ITPA 2VWUA 5FP6A 3C0HA 3GC0A 3OC1A 4RWIA 4XG6A 3FMDA 5IH4A 4KUJA 3EQFA 3CE3A 3LAUA 4Y5QA 3UO4A 3R1QA 2QOIA 3NDMA 4UV0A 3IGOA 5TO8A 1OKYA 3QRTA 2F2UA 4DAWA 2OIBA 4FIGA 4XV9A 1AGWA 2CMWA 4G3CA 3L8XA 5DBXA 1PRYA 2YM3A 4M84A 3ZM4A 4FYNA 4O0SA 2WTIA 5JSMA 3H9OA 4O6EA 4O7RA 4GIIA 5TR6A 4BGQA 5IQEA 4PTEA 3KK8A 4XJ0A 4JL9A 4IAAA 3QUEA 1YWVA 2OKRA 4L53A 3LIJA 3NGAA 3NZ0A 4PMSA 5F94A 3O51A 5LJJA 5CEQA 4KSQA 5FLFA 2Z7SA 4EJNA 4PL5A 1NXKA 1MRYA 4HOKA 4I6QA 5E92A 2I0VA 4ASDA 3R8UA 3QQKA 2XRUA 5IA2A 3ZO2A 4TWOA 2C0OA 5CEKA 3TUBA 2X6EA 3DTCA 4OBPA 4CT1A 4MNEB 4RIYA 3C7QA 1UU9A 2QLUA 4UALA 4BBFA 2J4ZA 4E6AA 1OUYA 3R8VA 1Z57A 2FGIA 3U4UA 4WKQA 2YN8A 3LJ2A 1ZAOA 3LCOA 4BI2A 2YIXA 4USDA 4XG2A 4E7WA 5BMMA 1W98A 2VO6A 3N51A 3NYXA 3KC3A 4L44A 3FHIA 4AACA 4GT5A 2PUUA 4XLIA 3FXWA 4FVQA 5HESA 3SA0A 3DFCB 2VRXA 5C27A 2BDFA 4F7LA 4XRJA 3HRCA 4R6VA 4L3JA 3L9MA 2QG5A 4P7EA 4DTBA 2J0JA 3DQXA 4AA4A 2PUIA 3V8WA 1Q99A 3ZC5A 2W4JA 4C37A 1FMOE 5EHLA 4XG3A 2R0UA 2V7OA 4FKOA 4D2VA 2C6KA 4IM2A 4AX8A 4TT7A 2ITXA 3KCFA 4FTMA 1XH5A 4M0ZA 4RX9A 5CQWA 2XUUA 4L52A 1OBDA 4E5AX 5CALA 4OAVB 3E63A 4MWHA 4PMTA 2VZ6A 2IZSA 3IOPA 4RLKA 3R7EA 3UNZA 4K11A 4XP3A 3VQUA 5GIPE 4AGWA 5AR5A 3WE4A 4M13A 5ITAA 3DAKA 5HO6A 5L2WA 3E62A 1ZARA 2JGZA 4OTDA 4DTKA 4GUBA 3CJGA 4JRNA 3LFBA 3LQ5A 4CFXA 3G9LX 4PDPA 1RQQA 3KRRA 4R7IA 1LEWA 5HX6A 4AUAA 4EH2A 4U7ZA 4O38A 1Q8TA 3FZ1A 1K9AA 1WAKA 2QOFA 2QO7A 4FTCA 1F0QA 2E9PA 2WOTA 3V8SA 4ZLZA 3HV4A 4L45A 4HGSA 1OIUA 2ZYBA 2HWPA 4YBJA 3VUTA 5C03A 5IMXA 3ORTA 4DH1A 5I9VA 4ZY4A 2J7TA 4ZSEA 2OK1A 3O0GA 4UXQA 4IX6A 1TQMA 2HIWA 4JXFA 2WMBA 5E8WA 4D4RA 4O81A 4QQTA 1I44A 1PY5A 4BDDA 4QP7A 3ZLWA 3PIYA 5LARA 3CTQA 3CTJA 3BX5A 3E8NA 4I0SA 5AM7A 2OFVA 4BHZA 3TT0A 4NUSA 1Q62A 2Q0NA 4JR3A 5GJFA 1YOJA 4H58A 4FGRA 2V5QA 4FG8A 4MKCA 5IQIA 4GFOA 3LPBA 5LVMA 2R3KA 4QYGA 5EFQA 3QZIA 2OF2A 2V62A 3FEGA 4WNKA 4D0XA 4AE9A 4I41A 4JDJA 3ORMA 2HY0A 3FL4A 5GHVA 3RPRA 4I22A 1Y6BA 5TOZA 2BZKB 3I6WA 3OHTA 3MN3A 4IB0A 5IDPA 3GENA 2CKQA 3ORZA 4BGGA 4BTJA 2AC5A 3QRJA 2VD5A 5CSHA 4OUCA 5LVOA 3QCYA 3NR9A 3QUDA 2OW3A 3VBVA 3G9NA 4ZOGA 2NPQA 3F3UA 3GU8A 3TV6A 4UMUA 3TV7A 2DS1A 3AT4A 1NVSA 3POZA 4HGLA 4G34A 1WMKA 3P7AA 3KXMA 4NIFB 4XG4A 5D11A 5HLWA 1L8TA 3RHXA 4ANOA 2BZIB 2XA4A 1SYKA 2Z60A 4C8BA 3ID6C 2G9XA 3BYUA 2QOHA 4C4JA 1TVOA 3OW4A 4L3LA 2G2IA 3WIGA 3BWJA 1B6CB 5CU2A 5JGBA 5J1VA 4DA5A 4HPUE 3ZO3A 2VO3A 3DOGA 3VW8A 4JVGA 3LM5A 2PK9A 4HW7A 5K5XA 4A9TA 3A7GA 3N4UA 1JNKA 3KN5A 3ZFMA 2ITOA 4WNPA 4LV5A 4O7NA 3SVVA 3GCVA 3VN9A 3M2WA 3T9IA
chains in the Genus database with same CATH superfamily
3BHHA 2QKWB 4NM0A 4ALWA 3KMWA 3L9NA 3MB7A 4EH6A 4L46A 3VBWA 4H1JA 3EN9A 3QL8A 4AZFA 3IQ7A 3HMMA 3BKBA 4O0RA 3MIYA 4O27B 4EK5A 3LLAA 1MRVA 3AC3A 2UZEA 2W1HA 3LHJA 4QMTA 5F1ZA 1Q8YA 2F4JA 3O50A 4QYEA 4DT8A 1V0OA 2QOOA 3QHWA 4DGLC 2FSOX 3UZTA 4XUFA 2CKEA 3HDMA 4JG7A 2ITUA 4F78A 3GEQA 4M0YA 2W1IA 1WBVA 2XCHA 2RL5A 4AGDA 4DH8A 4AFEA 4EOQA 4O0UA 2OIQA 4XBRA 3EH9A 4F1MA 3HX4A 3M42A 3U4WA 2FVDA 3EZRA 3RINA 4I21A 5AUUA 3COMA 4TW9A 5IA0A 4YC6A 4QO9A 2JAMA 2X7FA 4GUEA 4I6HA 4C7TA 4PTCA 4KIOA 5IQDA 2OIDA 4J97A 4FZ6A 3Q4CA 4O7LA 4OTGA 3AMYA 3HV3A 4QQ5A 4RFYA 4TPTA 4FKUA 5CLPA 4AG8A 5M08A 4ZY6A 5CI7A 4O4EA 1APME 2R3RA 1NW1A 5JK3A 5JFSA 4EWHA 4ZP5A 4IFCA 4JLCA 4B99A 3R8LA 3KXZA 2CKOA 3SHEA 3EQCA 5AUYA 3I7CA 3KRXA 2R0IA 4ZMEA 3AMAA 4BZDA 3U8WA 1YXTA 4O4BB 4A07A 2Y7JA 5HX8A 3A4OX 4WOVA 3NX8A 2JDOA 3MVJA 5IQGA 4PPAA 4D2TA 2ZV2A 2BFYA 3PA3A 3Q60A 3SG8A 2PMOX 3ENMA 2CLXA 1PMVA 4F1OA 4USFA 1LP4A 2XANA 1MQBA 1KE5A 2F7XE 3ORNA 3QBNA 5HG8A 2XIRA 3T3VA 1VYWA 4FNWA 3AD4A 2X8IA 4WO5A 2R64A 1QL6A 2ETKA 2XEYA 2BFXA 3H3CA 1FOTA 2F49A 2J2IB 5CF8A 4ORKA 3FYJX 3QYWA 4UB7A 3VBTA 3OTVA 3UO6A 4WG3A 2WFYA 1Y91A 3PY0A 3HP5A 4O0XA 3QZFA 2IVSA 4FNXA 5EW3A 2W17A 4P5ZA 2HAKA 3VUKA 3O7LD 3BV3A 3OY1A 5CAVA 4GYGA 4ZY5A 2R3NA 3DCVA 3R63A 3FXZA 4BCPA 4RZWA 3NYOA 4CFFA 3KMUA 4IAYA 3O23A 4FV4A 4IX5A 2GMXA 4YTIA 4AQCA 5J9YA 3HUBA 4II5A 3PXKA 5CU3A 5E8YA 1O9UA 1OL1A 3UMWA 3QWKA 1OPKA 5CAQA 3H9RA 5AUZA 2VWVA 4G1WA 2XK9A 3TZ8A 2HELA 4DBNA 3CIKA 2IZRA 2XZSA 3O8TA 4FV7A 4LFIA 3DKGA 3PWYA 4XMOA 4RX8A 4Y83A 4YO6A 5EM6A 4Z3VA 4YLLA 2PVJA 4KB8A 2VGPA 2YA9A 2HCKA 1XBBA 2B7AA 2W9FB 3KU2A 4KSPA 3FC1X 1W83A 4MQ2A 4QP4A 4CZTA 4XEYA 1REKA 4D2RA 4F09A 1U46A 2PMLX 2VGOA 1IASA 2UVZA 5FM2A 3VBYA 1XH9A 4RIYB 3E8DA 2OFUA 3Q2MA 4FKSA 3TDVA 2A4LA 4RGJA 4IB5A 3NAXA 2VTNA 3ORLA 2YHVA 3M11A 3QCSA 3VRYA 1J91A 2ZV9A 5CSXA 1GIIA 4I4FA 1WBOA 3AC1A 3AXWA 3UZPA 2Y4PA 3SKCA 4CYIA 5IMEA 5FXRA 4JMQA 3NFGB 2PZ5A 4MAOA 5K3YA 2PL0A 2QKRA 2RG6A 2X39A 1Y57A 4FZ7A 5IQCA 3OT8A 4EHZA 4HZRA 3DBFA 4ACGA 4PV0A 2UVXA 2YM7A 3KXHA 4UYNA 2UW0A 2FA2A 3UIUA 2A1AB 5CSVA 4YHJA 5TT7A 3BGQA 4I23A 4J98A 2IVTA 2HWOA 4EQCA 2C6IA 1OL2A 4E8AA 3EIDA 4MBLA 4PMPA 4NKSA 1M2PA 3W0OA 4D4YA 2Y8OA 5AP5A 2HY81 3F2AA 5EDPA 4D9TA 5LMKC 2E9UA 3IW4A 1JLUE 5HOAA 3W2SA 2VTSA 4FT9A 5GZAA 4YR8A 4EZ7A 4FTKA 4KBCA 4JDKA 3JXWA 3F5GA 5ANJA 3PJ8A 4MXXA 3D7ZA 3WYYA 4BJJB 3TCPA 3A7HA 2YAKA 4ANBA 2R3HA 4F1TA 4O22A 3H0YA 5DN3A 3PG1A 2BZJA 4IJPA 4GT3A 3UOKA 5CNNA 3SW4A 5DH3A 2C5VA 3VO3A 3VS4A 3HAMA 4GKHA 4E4MA 2Y6MA 3RP9A 5JQ8A 5EI2A 3W33A 5JN2A 5M4UA 5ETFA 2ZDUA 2QI8A 2Z7LA 3DK3A 3HMPA 2BRGA 2W5BA 4CLJA 5M07A 2JITA 1MQ4A 4PL4A 5EG3A 1PXNA 4DGGA 2EXCX 1GZ8A 2AUHA 1H27A 3VONA 2O65A 4YGAA 3NEWA 3OROA 4FNZA 4RG0A 3R9OA 3S2PA 4AZVA 4BDEA 3LFSA 5CVFA 2VV9A 4BCKA 3VW6A 4XH6A 3VUIA 1ATPE 3JPVA 4JT3A 5L4QA 4XRLA 5GJGA 3GQLA 3VAPA 4X21A 5AUTA 3BE9A 4O6LA 3CD3A 5CSWA 5JH6A 3CKXA 3NRMA 4KS7A 4J95A 2R3JA 3P78A 4LUDA 3OBGA 4BC6A 3MS9A 4BIBA 4Z55A 3DBDA 1OUKA 2HOGA 1JKKA 2IEWA 5KMOA 3CP9A 3MW1A 1W8CA 3RAIA 2B9IA 4TYEA 2PHKA 2QURA 3Q96A 3DPKA 3HA8A 5I9ZA 1VR2A 3RPOA 3UG2A 4AAYA 2XRWA 2YIQA 3W2CA 1W0XC 4FOBA 4FSMA 2IO6A 5AR3A 4DINA 4DF3A 3SAYA 3IW5A 3MPAA 4FK3A 4DG3E 2GNJA 5B2MA 3LXNA 4RVTA 4LRKA 3KKVA 4EZ5A 1OIQA 4J52A 2BAJA 2O64A 3OOMA 4O0VA 4D4VA 2JIUA 2C68A 2G1TA 3F7WA 4F9AA 3EN4A 1YHSA 1GZNA 2PY3A 4ZJJA 1GZKA 2FSLX 1YXUA 1UU7A 4KAOA 4O7ZA 4EL9A 2WMVA 4BWPA 4UX9A 4IVDA 5E8UA 4IWDA 5EI8A 1E9HA 3OXIA 4Q2AA 3PUFC 2JKKA 4OBQA 5FTGA 4DHJA 4X2GA 4FTIA 5F95A 2X4ZA 3P7CA 2FH9A 4LOQA 2O0UA 4KBAA 4PWNA 4BVUA 1DI9A 3MWUA 2XH5A 1BL6A 3I4BA 4O7VA 4JRVA 4IX3A 2B4SB 3WF6A 3R7VA 4M3QA 3VNTA 4C02A 3EOCA 2LAVA 3WZDA 5KO1A 4ZSAA 5EQPA 2BDWA 2XJ2A 3EB0A 4TWCA 2P33A 1XHAA 3W0NA 3UVPA 1KOAA 5CEIA 3HMNA 4O86A 2WMRA 2PVRA 1PXJA 1G5SA 2PZRA 3BLHA 3RZFA 4IWQA 3AC4A 2PULA 2XK8A 4EONA 3TYKA 3CTHA 2X0GA 4D2PA 4PDYA 1OI9A 1CM8A 2VTTA 5BV3A 3FKNA 2V22A 1UWHA 3Q32A 4XX9A 1YXVA 2W1DA 3CY3A 3VS6A 2FYSA 3ORIA 4GCJA 4K6ZA 1BX6A 5JFXA 3RBWA 3JR1A 3AC8A 1F5QA 3C0IA 3NSZA 4RX5A 2YLEA 2F2CB 5B2LA 5FXSA 2XK6A 4RJ3A 1PMEA 4WBOA 5C01A 1R1WA 3B8QA 5EW8A 1ND4A 4YMJA 3U6JA 2QODA 5FBOA 3TIYA 5EOBA 1UVRA 4HYUA 1V0BA 3BU3A 3ZZWA 3CJFA 5LMBA 5C4LA 5DG5A 5KUPA 1TQIA 2Y4IB 4ZTRA 2YZLA 3IONA 3DY7A 3QTSA 1XH4A 4YHTA 1H25A 3Q53A 1CKJA 5A6OA 5BPYA 4UZHA 3KRLA 3R7OA 3GXLA 5LWNA 4EOLA 4K9YA 2B52A 2VTJA 2W05A 3OT3A 4J1RA 3AC2A 3RHKA 5AEPA 2R3QA 4MF1A 2YCQA 3UVRA 5GINE 5H8EA 1FQ1B 5ANEA 3VS2A 4ENXA 1AD5A 5CZHA 4JNWA 5C9CA 2UZVA 3ZBXA 3DB8A 3AT3A 5EH0A 1K3AA 4O91A 3ZSIA 3BBWA 4ITHA 4IVBA 2PVKA 2QONA 3CBLA 3D5WA 5FTQA 5T6KA 4ASZA 4Q5HA 4ANLA 2HZNA 1J1CA 3LLTA 3P23A 3K5VA 3AGMA 3FUPA 4JG8A 5EM7A 4CZYB 5AV0A 3HP2A 4FKJA 3ORPA 4EK3A 4FG7A 4FIJA 3GI3A 3W0MA 2C0TA 4RT7A 3D5UA 4EYMA 2XKDA 1W82A 4ZZNA 2EWAA 4M12A 3E8CA 3FLNC 3NWWA 3V8TA 1B39A 1DAYA 3GFWA 4G6NA 4MTAA 5DI1A 4BIDA 4MCVA 2NRUA 3NYVA 2QHMA 3ZMMA 4FV3A 1H26A 4WNOA 4EORA 3KA0A 3PYYA 4NTSA 4YUQA 4ZAUA 2YACA 1RW8A 5KBRA 4EI4A 3WF9A 2VNWA 3OBJA 5KX8A 3SLSA 3ROCA 4UMPA 4ID7A 3QTWA 5EOLA 5LCKA 3SX9A 3FI8A 3PRFA 4OW8A 1PMNA 4C0TA 3DXQA 3P9JA 2VWWA 3RAHA 3CEKA 1JQHA 3BLQA 3DXNA 4GIHA 5DRBA 4C35A 4FZAB 4YZDA 5E91A 1BUHA 3B8RA 4MNFA 2ITVA 4ASEA 1G8KA 4EEVA 5HO7A 3EFWA 1YOMA 3PY1A 3DV3A 1O6KA 3TN8A 5JGDA 3D9VA 4TWPA 4OLIA 3A62A 1ZXEA 2XVDA 3C51A 5DOSA 1R39A 2BIYA 3DJ7A 4X0MA 5AWMA 4U45A 3WZKA 3NNXA 1YWNA 2Z02A 3A8WA 3BGPA 5CENA 5JT2A 4E1ZA 2IZTA 4YJUA 5JFWA 2XARA 3VULA 4NTTA 3CY2A 3ZLSA 2V0DA 3OUNB 4AFJA 2ZM1A 3E3BX 2CGUA 3LXKA 3EYGA 4ZTHA 2UZNA 4BICA 5I9XA 5J5TA 3TUCA 1SMHA 1OVEA 2BUJA 2XJ1A 3QALE 3QKMA 4RFMA 4CV9A 3QD3A 2HK5A 5HLNA 3C4CA 2NNWB 3II5A 4U5JA 5D41A 1XKKA 1YVJA 4EHEA 4XNEA 4P90A 4A7CA 4QNYA 5GZ9A 5AP0A 4F0GA 4YSJA 1UU3A 2E9NA 5D9HA 3GCSA 5HQ0A 4R8QA 2F9GA 3CKWA 4I6BA 4C57A 5BVNA 4OTHA 5EYDA 5T3QA 2XAOA 4N57A 4U97A 3SW7A 4QMXA 2B1PA 5CEPA 4DHFA 3TV4A 5HNGA 1YQJA 1R78A 3NUNA 3MYGA 1WBWA 3Q52A 2W5HA 3EKNA 5DLSA 1H1PA 4EKKA 4HVHA 4AXDA 4RPVA 3KXXA 2F7EE 4FSNA 2CNUA 2EB3A 5M57A 3ATSA 4IQ6A 3FMMA 2VWBA 3BCEA 5KMMA 2W0JA 5A46A 4GMYA 4FYOA 5FM3A 1Q8WA 3BL7A 3C4XA 4MXOA 4C4GA 4DBXA 3HKOA 3PXQA 2XKFA 4NEUA 4IADA 5AV3A 3NUXA 4BDHA 3MB6A 4I6FA 4RMZA 4EQUA 2X9FA 1O6YA 3VRZA 5HD4A 4FTAA 3KULA 4M97A 4ZK5A 2XB7A 5C26A 2CSNA 3SRVB 3DXPA 3TJDA 5AR8A 1ZYDA 2GNIA 4D9UA 4NM7A 3TWJA 4WUNA 4CLIA 4WD5A 2BRNA 5M51A 2DUVA 2W4OA 2X2MA 3HVCA 4M69A 4F9WA 3IDPA 4DFLA 3C4WA 4LQMA 4G3DA 2J0IA 4FEXA 4JQEA 4EC9A 4FRFA 4M66A 4DITA 2KTYA 3R8ZA 2PPQA 1ZMVA 4GS6A 4IACA 4C4HA 2IN6A 4LMNA 4E6QA 2BVAA 4I94A 4Y46A 3R83A 2C1AA 4D2WA 1PMUA 3W16A 4JOAA 3BEGA 3A7JA 3EFKA 3PSDA 5AP1A 5HBJA 4TYJA 4ACHA 3RNIA 3PPZA 4Y5HA 4AU8A 2WAJA 4BI1A 1STCE 5B7VA 4IB1A 2OG8A 4W4XA 3QCXA 3TNHA 2BRHA 2HZ4A 4RQKA 2UZOA 4IAKA 4EKLA 5M44A 4RIWA 4AXEA 1IAHA 2UZUE 2ZM4A 3IDCA 2ZV7A 1YDTE 1CTPE 4W4WA 4I5CA 3VUMA 4EK6A 3UQGA 4QMQA 4FTNA 5HU3A 4RX7A 4D55A 4IZ7A 1U54A 4ITJA 4TYHA 4BHNA 3ZFXA 1Z9XA 5DR6A 3QKKA 4ENYA 3FHRA 3UPXA 3F2NA 5DPVA 5J5SA 2PE0A 1ZRZA 2SRCA 3A8XA 4GT4A 4QP6A 4AZWA 2C30A 2P0CA 3K3JA 5A9UA 2W7XA 2XBAA 4DFBA 5AP7A 3NUUA 2O5KA 3FKOA 2IG7A 4FSQA 4D2SA 5CEOA 2CNQA 4CFMA 1OIRA 4DH7A 3UP7A 4IAIA 1JOWB 5HKMA 1YDRE 3KXNA 4FOCA 4CKRA 1ERKA 4PPCA 1IR3A 4DEIA 2WOUA 4NH1A 3OCSA 4R7BA 2HZIA 2IW9A 1QPCA 3KRJA 3QD0A 5FBNC 4R77A 3F3WA 1JWHA 4AN3A 3ZRLA 2A0CX 2R7IA 2PWLA 4KS8A 2BDJA 4TYGA 3LFAA 4U9AA 4F0FA 4BTKA 3I6UA 4FZFB 1M17A 2JDSA 3KF4A 4MQ1A 4GYIA 4YJNA 3ZRKA 4UWBA 2WEVA 1TKIA 3JVRA 4QPSA 4XOYA 2JDRA 5AR2A 5DWRA 3QZGA 3VUDA 2BCJA 1WBTA 2JFLA 4FSRA 4MH7A 3C50A 2JDVA 3TG1A 5HI2A 3TL8A 3W8LA 3QTIA 4W8EA 2C3JA 4O4FA 3SOAA 2VWXA 3UP2A 5AA9A 2VTLA 4G16A 3S0OA 5ANKA 1X8BA 3KRWA 2IJMA 3LVPA 3TNPC 4HVDA 3F5UA 5D7VA 5G6VA 2CJMA 4YSMA 5J9LA 4I5PA 4ACCA 2UZWE 3G2FA 2B55A 3R02A 2JDTA 2I6LA 2IW8A 3ZDIA 4U8ZA 1OPLA 5KKRC 2WMTA 5E9EA 3DB6A 3EQDA 3QGYA 2J50A 3R73A 2WGJA 3UOLA 2RG5A 2OSCA 3PFYA 3DDQA 4QMSA 5AUWA 1DM2A 3EFJA 3IW8A 3AG9A 4D58A 1IA9A 5CZIA 5KZ0A 5HE0A 4FV8A 2PTKA 3E88A 2X6DA 4FMQA 4FL1A 3FE3A 4ALUA 4E93A 3HV6A 1B38A 4BDBA 4ZTMA 3GCQA 4FT5A 3OD6X 1FPUA 2XNNA 3WZEA 3ZLXA 3U55A 4BKYA 4K33A 5M06A 3WF7A 4UBAA 4CQGA 5A4CA 2PVHA 4PNKA 3KVXA 3QX4A 4FL3A 3QU0A 4IXPA 4HCTA 5AUXA 5ANDA 3SXSA 2ONLC 3NNUA 3LFQA 2OJIA 1GJOA 4C4IA 5HIBA 4RVKA 3EKKA 4F64A 4BCIA 3VF9A 4CFNA 5A4LA 3FZSA 1U59A 1BLXA 3DU8A 4FIEA 1GOLA 1PYEA 4TRLA 2XJ0A 4F4PA 1JKSA 2YWVA 4M67A 5HLPA 4E26A 1YHVA 2GHMA 3P86A 2OI4X 2G2FA 4RRVA 3NNVA 5E8TA 4ZJIA 1KE7A 4H3PA 3FMKA 3ZH8A 4ARKA 5CU6A 3UODA 3UYSA 3UNKA 5J7BA 4ZMFA 3DGKA 3GGFA 3MY5A 3UG1A 2J5EA 3FC2A 4BCMA 3MVLA 4C2VA 4CCUA 2WQOA 4RBLA 2BZHB 2XYUA 1PXIA 3GCPA 3PTGA 4IWPA 3V5JA 4FTJA 4E5BA 3NW7A 4OR5A 2EU9A 3QHRA 2QQ7A 4EC8A 2GQRA 4YC3A 2J9MA 3D83A 1YHWA 3IECA 3Q4TA 3G90X 4X2JA 3AMBA 5JZJA 3KREA 5FUTA 5KE0A 2R3PA 4DG2E 4F9BA 2EXEA 1CDKA 1JVPP 1L3RE 2IVUA 2ZOQA 4JR7A 1PXKA 2WTJA 3CCNA 4NJ3A 4HVIA 5FDXA 3BE2A 4EH9A 3AC5A 4BR3A 1ST4A 4YJQA 4XLVA 3R1SA 3MV5A 5AX3A 3BYOA 4UWYA 2JAVA 4W9WA 1ZZ2A 4RC3A 2OH4A 5G1XA 3ORXA 4C34A 3DK6A 3R1YA 4QMOA 3B2TA 1WVXA 3QQUA 4QDEA 2JKMA 3CPCA 3E92A 3EFLA 3K2LA 4YNOA 5ANIA 3UIMA 3DK7A 4A4OA 2C6EA 1WVYA 3FXXA 5BVFA 4AXCA 3IK3A 4QYYA 4O84A 1QMZA 5EHOA 3EL8A 5IZFA 3EHAA 3LQ3A 2UVYA 3PXYA 3HRFA 1XH6A 4IW0A 3TIZA 5HG5A 4CXAA 2GSFA 5IDNA 4ACMA 5CU4A 4F63A 3IOKA 4IFGA 5CF6A 4G9RA 4ZZMA 2FO0A 3HNGA 1YRPA 3C5IA 2R3FA 4OTQA 5KHWA 3GQIA 2R4BA 2XCKA 1W2DA 3WIKA 3RZBA 1SNXA 1H8FA 4J8MA 4KKEA 2ERKA 1H24A 3D7TA 3COIA 3OWKA 4AGCA 2AC3A 2GPHA 4FVRA 2BPMA 3EYHA 3GVUA 4KIPA 4NFNA 3UOHA 4O96A 4YZMA 4DGNA 4V01A 4YJOA 2BHHA 3QRKA 5TF9A 1GAGA 4DN5A 3ZCLA 2I7QA 3GT8A 4CVAA 2W1ZA 1IA8A 1ZYJA 2OZOA 4OTPA 3CPBA 4FI1A 1R0EA 4S32A 3JS2A 2O3PA 3GU4A 1XH8A 3TZMA 3F5PA 4X2FA 4H1MA 4MUQA 4KKHA 5H8GA 4YBKA 4RWLA 3EQHA 4UWCA 2HW7A 3I79A 4HVSA 4JG6A 2G01A 5F20A 4KIQA 3BU6A 4M69B 4USEA 4GVJA 1H0VA 4O7TA 1LPUA 3FLZA 5CX9A 5C8MA 1ZY4A 3FMEA 2XS0A 1M14A 4FSTA 4C3FA 1A48A 1OL6A 2UW4A 3R21A 4NJDA 2BTSA 1NT2A 4FTQA 1CKIA 1EH4A 3PVUA 3GC8A 5M53A 4LV8A 3LXPA 4EK4A 4F7SA 4CT2A 4CRLA 4TY1A 4BCOA 3RJCA 5AA8A 3OEZA 5GNKA 4WT6A 2X0OA 4FV1A 3TZ9A 1OPJA 4BYJA 3MA3A 5KMIA 3Q04A 4L43A 3H10A 3KK9A 4FT3A 4YLJA 4BDIA 3TZ7A 2GQGA 2VNYA 2WELA 3A7IA 3FMLA 5KNJA 4YLKA 4FG9A 2WB8A 2YCSA 4RIWB 1HCKA 3ROYA 3R01A 3VC4A 2XF0A 4MX9A 2CCIA 2ONLA 5TE0A 4G3EA 3TTJA 3R1NA 3C0GA 4ITIA 3I0QA 5DIAA 4CKIA 2AQXA 1U54B 3MH1A 4TYHB 5CAOA 5KMLA 2REIA 3ML1A 3R0TA 1CMKE 4JI9A 4PDOA 3VS7A 5IH5A 3W2QA 3OOGA 4K8AA 5EYMA 4U81A 5LMAA 5F4NA 3NIEA 2OXXA 2XMYA 4BIEA 3FBVA 3HL7A 2FB8A 1QPEA 1XBCA 2JFMA 2C3IB 1J1BA 2ITYA 2RFDA 3QKLA 2VX3A 4OTWA 5ANOA 5DR2A 4EQMA 5M4IA 5BMSA 4QDVA 2WQMA 3UC3A 2W1FA 5IUIA 4E73A 5HG7A 4IDVA 5CI6A 4WIHA 3FY2A 4BKJA 3U6IA 4O4CA 2V55A 3F82A 4FKGA 4MD8E 4L8MA 3AT2A 3K3IA 4CTBA 3QTRA 2RKUA 2VTOA 3C4ZA 3R7GA 4U43A 5FP5A 2RSVA 3NLBA 1M2QA 4QTCA 4K0YA 4QYFA 4O0WA 5J87A 3DZQA 3W2RA 4HYHA 5AR7A 1NVRA 4JQ8A 3VVHA 4CRSA 4X3FC 3FJQE 5BUEA 4BWXA 2OJJA 2EXMA 4ERKA 3EJ1A 5AX9A 1FVVA 2C69A 3BELA 3LMGA 2GNFA 4CG8A 5HIEA 4IZ5A 2E2BA 3GOKA 1UNLA 3DKCA 5LVNA 2YFXA 4UY9A 4IBMA 3RK7A 4FEUA 2PVFA 4QP1A 4RJ6A 5J79A 3FPMA 3R9HA 2XIXA 3DJ6A 4S2ZA 3MFTA 4DEHA 5AFVA 3ZZEA 3ZONA 2PUPA 5DE2A 4UMRA 2WKMA 3F3TA 5AUVA 4Q9ZA 1QCFA 2KULA 4MK0A 3TTIA 4LL5A 2GNGA 5BUJA 2XNGA 4HGTA 4BCHA 4DCAA 4FV0A 2WTKC 4S34A 4FEWA 3D5XA 4C4EA 5L8KA 3ITZA 4GFGA 3UPZA 4J7BA 4RVMA 5ETIA 2IWIA 4YTCA 5DT0A 4D5HA 4FSUA 4EOMA 4MD9E 4M14A 3ZO4A 4QP8A 4PY1A 4YZBA 2R5TA 4V0GA 3UJGA 3GU6A 4G5PA 4APPA 4C62A 4ZSGA 4XBUA 4QMNA 5JKGA 4RA5A 3ZYAA 5EYKA 4C4FA 2Z7RA 3VBQA 3W18A 4ASXA 5HE1A 5C8KA 3OEFX 1NY3A 3FMJA 4NM3A 3FLQA 3NAYA 4FKTA 5L2IA 3CGOA 2BRMA 2PMNX 4GK2A 3DDPA 3QQHA 3L9PA 4YTFA 5ANGA 4DTAA 4O4DA 4IE9A 4GJ3A 2OXYA 4BZNA 5E8SA 4F65A 1PYXA 2G15A 2OO8X 3IW7A 3Q4ZA 4C59A 2C0IA 4CFWA 4AAAA 1BMKA 4YU2A 4A9RA 3KF7A 4AWIA 3QQJA 4KRCA 5FRIA 3VF8A 4WRGA 4DGMA 4O83A 4MEDA 2C3LA 2PZYA 5FD2A 3W2OA 3ZSHA 1ZYLA 3CS9A 3A4PA 2OU7A 3HUCA 3DBQA 3UDTA 4LGDA 4Z16A 4WSYA 3UGCA 1ZMUA 4AS0A 4O82A 3NNWA 2VU3A 3NUPA 4FZDB 3TKIA 5HCZA 4KRDA 4F9CA 4J53A 2C47A 2BALA 3FY0A 3QAME 5A14A 1T45A 2GU8A 2YJSA 4L42A 5JRQA 3OWJA 4RZVA 4FKQA 5I4NA 4EJ7A 1MUOA 1UA2A 3W32A 2W06A 5FDPA 5IUHA 4D1ZA 3TUDA 4NL0A 3CLYA 4QEBA 5BYLA 4IAFA 3MPTA 2IW6A 1DAWA 3R30A 4ALVA 1UU8A 3GUBA 4MXYA 3WI6A 5JEBA 2C6OA 4GG5A 3R8MA 3H30A 4GV1A 4IWOA 3A7FA 3EN6A 3DA6A 4R1YA 2J51A 4E4LA 3VWAA 4LG4A 3FZOA 4B8LA 3ZXZA 2B0QA 1MRUA 3EQRA 5J95A 1UNGA 3UBDA 2YM6A 1BI7A 1JSTA 2DYLA 3FI4A 4S30A 5K4JA 4FSWA 4LYNA 4BBEA 1OKZA 3EN7A 3SGCA 1UV5A 3C13A 4RIXA 3ZU7A 3UO5A 5BVWA 2GFSA 3F5XA 2VTRA 3FLYA 4I4EA 4X3JA 5CS6A 5IEXA 4GH2A 4UYAA 4CMTA 2H9VA 5L6WL 3P4KA 2P2IA 2PVLA 4WNMA 5LQFA 2Z2WA 4FV2A 3OTUA 1U5QA 3D94A 4Q9SA 3AKKA 3RVGA 4NSTA 3H9FA 5E1EA 3ZC6A 4TYIA 3ZM9A 4GKIA 3OXZA 3MIAA 3OY3A 1YWRA 4JAIA 5HE2A 3EQIA 4LM5A 5AR4A 5JZNA 1OB3A 5AADA 4JIKA 2NRYA 4Z7GA 4QNAA 3NIZA 2Q83A 3DBEA 2V7AA 5E8VA 4F99A 1PXPA 4BCGA 2BMCA 2RIOA 4KWPA 4EBWA 2ITNA 3V01A 4PMMA 1DI8A 4QPMA 2ETMA 2O63A 2OGVA 3OS3A 1CSNA 2P55A 3V3VA 4A9UA 3SOCA 4CQEA 3PA4A 3S3IA 3LZBA 4CKJA 3D7TB 5HHWA 1E1VA 3P0MA 5CWZA 3Q6WA 4BGHA 5AAFA 3V51A 1IEPA 3V5WA 4X3FA 4I93A 4FSZA 4DC2A 2CN8A 2PMIA 1FINA 2XK3A 3DZOA 1TQPA 2WO6A 3QXPA 5AP4A 4GFMA 5EKOA 2C6MA 4EOJA 2GNHA 5FEEA 3DKOA 3R9DA 4EK8A 3QC9A 5E8XA 3RAKA 1I09A 3RPVA 3F3VA 4I6LA 4U0IA 1Q8UA 3KCKA 3FDNA 3MH3A 3LQ8A 4OT6A 2W9ZB 4UEUA 4QMUA 2ITQA 4BBMA 5IQAA 4FKLA 3POOA 4F6UA 3NW5A 1UWJA 5JQ5A 1Y8GA 4PPBA 3SC1A 2YAAA 4NYEA 1Q5KA 5BVEA 1OZ1A 3RGFA 2WEIA 3R04A 5ACBC 4X6QC 3OWLA 3AGLA 4MXAA 2UZLA 3QGWA 5HCYA 2GHGA 4FA2A 3GC7A 2WMQA 5DEWA 4RWJA 4TWNA 4UXLA 3WF5A 4AE6A 5B2KA 3SDJA 4WRSA 2RGPA 3DLZA 2XYNA 3R9NA 4GSBA 3TM0A 2J90A 2IZUA 3EWHA 2VWIA 3BQCA 3ZUUA 1Y6AA 2WHBA 4G3FA