2VXFA

Solution structure of the lsm-domain of zebrafish rap55
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
88
structure length
88
Chain Sequence
LEDPSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCEPPKPIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LSM14A PROTEIN
publication title Similar modes of interaction enable Trailer Hitch and EDC3 to associate with DCP1 and Me31B in distinct protein complexes.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transcription
total genus 10
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vxfA00
1BIBA 3HFNA 4QVCA 2VXEA 4C8QF 4Y91A 4C8QD 5GMKe 5GAN4 3SWNA 5GMKj 4J6XA 4J6WA 5GAMh 5GAMg 4M7DC 4RCCA 5GAOm 2DTIA 3QSUA 2DTOA 2E41A 2DTHA 2DEQA 2HNIA 3QO3A 4XTUA 2JN0A 1X01A 4C92G 3BY7A 4DQ2A 3JCMd 4M7AA 4M7AE 5GAMe 5GAN2 2FB7A 4M78B 1BIAA 1B34A 4MMKA 4J5YA 1HXDA 5GAOn 2QTXA 4C92D 4M75B 3JB9I 1M8VA 4EMGA 4XU3A 1D3BA 5LJ5h 5LJ5g 5GANj 5GMKm 5GANg 5GAN3 3JCMc 5GAOl 4HT8A 4C92C 2FYKA 4M7DB 2DXUA 3V8KA 4M7DG 5LJ3h 5LJ3g 4PJOB 5LJ5e 5GANe 1WNLA 1KQ2A 1LJOA 3FJPA 4N0AC 3AHUA 1I4K1 2DJZA 3QHSA 5GANf 4M7AG 5LJ3e 4V2SA 4XQ3A 1JBMA 4M7DF 1U1TA 5GAN7 4M7DD 3FB9A 1H641 3QUIA 1N9RA 4JUVA 3JCMV 4C8QB 3SWNC 1WQWA 4XTYA 4NL3A 3JB9H 4PNOA 5GAMj 4F7UB 4M7AD 4HA8A 4M77A 4M77E 4A53A 2EJFA 2EJ9A 4M75A 4M75E 5GAOq 4M7AC 4X9CA 4EMKA 3V8JA 3BW1A 1WQ7A 4RCBA 2E64A 5GAMf 4C92F 4XU1A 4PJOA 1U1SA 4PJOE 1I5LA 3L1AA 3JCMh 1LOJA 3JCMg 5LJ5j 4XU2A 4EMHA 1Y96B 5LJ3j 3JCMe 4XTZA 4NL2A 1N9SA 4XU0A 4M77G 2DXTA 2I2LA 4C8QA 4C8QE 5LJ5f 4M75G 3JCMb 3V7SA 4XTVA 4F7UA 4F7UE 3JCMX 2ZGWA 5LJ3f 4OP0A 4M77F 4J6YA 3SWNB 5GMKl 1WPYA 2DZCA 2EJGA 4M77D 5GANd 3GIBA 4PJOG 2YLBA 4M75F 4M78E 4M78A 4M75D 4QVDA 2RM4A 3JCMW 3JCMJ 2EWNA 4M77C 4JRIA 4WF2A 3RESA 4M75C 2EAYA 4JLIA 4MMLA 3JCMQ 4EMKC 4PJOD 1B34B 2RD1A 3BDUA 4C8QG 2RB6A 4M7AF 4F7UG 4PJOC 1D3BB 1KQ1A 4NOYA 3RKWA 3SB2A 4C92B 5GAMd 3HFOA 5I21A 3JB9J 3RERA 3INZA 3EFSA 4M78G 2K57A 1M5Q1 2CGHA 3V7CA 1LNXA 3EFRA 4XTXA 3V7RA 4F7UF 1HK9A 3JCMf 5GAN8 1I81A 3V8LA 4HT9A 2E65A 4M7DA 3FIFA 4C8QC 5CAIA 4M7DE 4XTWA 4M78F 1MGQA 2DVEA 4M78D 5GAOr 2DZ9A 1I8FA 2YHTA 3RUXA 5LJ5d 2RA2A 4X9DA 3RKYA 2VXFA 5GAN5 3RIRA 4A54A 1TH7A 4M78C 5DY9A 5LJ3d 1JRIA 2Y90A 4M77B 3HSBA 5GAN6 2E10A 3M4GA 3JB9F 4M7AB 3JB9D 3JB9G 4PJOF 4EMKB 2VC8A 5GANh 2E1HA 4C92E 4C92A 2DKGA 1Y96A 3RKXA 4JRKA 3PGGA 3VU3C 4N0AA 3L2ZA 5GMKi 1YCYA 3JCMP 5GMKh 5GAOp 3BFMA 2YLCA
chains in the Genus database with same CATH superfamily
5J3BA 2HL5C 4L6V5 1FYNA 1PKSA 3EGDB 4J9FA 1VQPQ 1UFFA 3GPLA 1MMNA 3JB9I 1M8VA 4NS5A 2WSFE 4N0AC 4BACA 2M02A 2AZVA 2EIFA 4M7DF 4LE9A 1G3YA 3QZ5B 3A8GB 4J9GA 3I55A 5FU7C 2DEUA 3CCLQ 4JJNK 1WQ7A 4BD3A 2K3XA 5KE2A 2SRCA 1WFWA 3G7ZA 2EKOA 4C5EA 1VQ4A 5LJ3j 5ECAA 2MAMA 3C95A 1Q81R 1WZOA 1KSWA 5CCAA 4DBQA 2YRDA 4JPBW 5GMKl 4J6YA 4ATOA 2PUKB 2PTKA 2EWNA 1VQ8Q 2VASA 1KFZA 2RB6A 1SSFA 2BTTA 1QVGA 2CH4W 4NOYA 3VYHB 2XI9A 5GAMd 3JB9J 3UATA 1YITA 4B6MA 2DA9A 1OI1A 1XTDA 2EYXA 2E4HA 3R6OA 2DVEA 1I8FA 2QGFB 1NM7A 4OMNA 1ZA2B 4IIOA 3HSBA 4FIBA 1VYTA 1WGSA 4MDXA 3PE0A 2QAZA 1EIFA 3PT9A 3H0IA 4Z02A 3HKSA 2H3JA 1SF9A 1YP5A 1ZSZA 1FWZA 2P4TA 2RQRA 4ANJA 4FM4B 4Y91A 1JO8A 4RG2A 1W2BA 4J6WA 5GAMg 2JTFA 5GAOm 5C0MA 3I56T 3QSUA 4DQ2A 2KNBB 2QDYB 4JS5A 5GAN2 1Q86R 2QA4A 1BI3A 4RUGA 2D8JA 2RK2A 1NYGA 4Q5WA 5KYYA 1ZSZC 4V2SA 5FU6B 1JBMA 1D09B 2EGCA 2CUBA 1WQWA 4F7UB 1JU5C 2MIOA 4X9CA 2DILA 3V8JA 3BW1A 3ER0A 5CKEA 3CCRA 1YI2Q 1M1KC 1PHTA 3L2VA 1Y57A 1C1AA 2JTMA 2ZPGB 1Y07A 1AD5A 3EAEA 1WJSA 1SG5A 2DXTA 2HKNA 2LCLA 3DB3A 3JCMb 1NJIU 3L42A 2RHYA 4IUUA 2P0KA 3CCLT 3GIBA 4XAXB 2AZSA 1OX8A 3PIOA 3RESA 4KGZB 1PKTA 1E6GA 1N27A 4PL6A 1K76A 1VYVA 1Q82C 1VUBA 2V1RA 2QEXA 1IHWA 4BI3A 3QYGB 4J7FA 3NFCA 2RQTA 4LDVA 4C5IA 1RL2A 2YHTA 2DPPB 1K4US 1XJWB 5FU7B 5LJ3d 1KQSP 1IRXA 4R0KA 3OYAA 1Q7YU 1YBYA 2NUZA 3EGXA 4QW2A 1M3CA 4O5VA 2LQNA 3MEWA 4BY6C 1CKAA 2FB7A 1OEBA 1IGUA 1M8MA 1AWJA 5GANg 5GAN3 4PLLA 3EG1A 2RNAA 5LJ3g 3A8MB 3LGFA 2RI5A 2FZGB 2XHCA 4KUDK 1H92A 3JB9H 4HA8A 3CCST 1OPLA 1JJ2A 2X35A 1TG0A 2COWA 3GBQA 4RCBA 1RLQC 2XU8A 3M5AA 4PJOA 2JXBA 3CCVA 1PD0A 4A63B 4ZGEB 3LWHA 2L5QA 1LVKA 1K9AA 2F1LA 4C8QE 4CRIA 1YJWQ 3HL8A 3CXCA 2Z0WA 2XMFA 1E6HA 4BDZA 9ATCB 1KK7A 1OYXA 5KYWB 2J6FA 1BU1A 1YI2T 1GBRA 3ULRB 1GBQA 2CREA 3C12A 1D1BA 1X43A 2CH4A 3CMAQ 4FU6A 4C8QG 2XDDA 2X4JA 4IURA 4ZN3A 4LUEA 1BCMA 1V29B 4PJOC 3OBYA 4OMFB 4QQDA 5CQYA 2O31A 3GP8A 1AZGB 3EFSA 3V7CA 3OYGA 3A8OB 2D6FA 5KYUA 1R77A 3CMET 4M78D 2GQIA 3FLGA 2LZ6B 3RKYA 3ZBDA 1WHJA 2QYZA 5FROA 2K79A 3VYGA 2X9HA 3MEUA 2EQUA 5D6YA 2IPOB 4DBFA 2LMJA 2VC8A 1PCXA 3SFMA 1CSKA 2CP2A 1I5OB 5GMKh 2DL5A 1HJDA 2DYBA 1PSFA 2QQSA 2FPEA 3OB9A 3CBOA 5KYYB 4DEXA 1PNJA 2OTJT 1ZHIA 2L89A 5AT1B 4CI0C 5LL6S 3EG9B 5AYFA 5GAMe 3C94A 3X20B 2DERA 1HXDA 4CC7A 1X2QA 1Y7XA 2CT4A 4GLKA 4PFPA 3M4YA 1OZ2A 2VUBA 1M90U 2RHIA 1UGQB 1U1TA 2LNHB 3TVTA 4M7DD 1VQKA 2WSEE 2DYIA 1AT1B 1VQLQ 5A0DA 2L2PA 3LYIA 2M1HA 2EJFA 2ZCFB 4DBRA 4M75A 2RPNA 5DLOA 1M1FA 4C0ZA 2LJ3A 1I1JA 2JVVA 3C0CA 3JCMh 2KT8A 4XU2A 1Q81C 1DJ7B 1MV3A 2O2OA 2OAUA 2NUPB 3S6WA 4J9HA 2FL7A 1KG1A 4ZGDB 3G71A 1K8AR 5IT9E 1YCSB 2M16A 3EGDA 1ZQ1A 4M77F 2JUFA 1WPYA 2MI6A 4FW2A 4Z8AA 1SEMA 4M78E 4QVDA 2YRVA 1TUCA 3META 3KXTA 4M75C 1Q95G 3HRTA 4MMLA 4WTOB 2G3RA 1TXQA 1YIJA 3JAME 2FRYA 5CKFA 2PVGB 2EQKA 4OB0B 2EYZA 4HVWA 2CDTA 1D3BB 3RMSA 4LDUA 4JZ4A 2DFUA 1I07A 3OS5A 4M78G 2OAWA 4AFQC 4F7UF 3JCMf 3H0HA 1NEBA 1PWTA 1AZEA 2O4XB 4X9DA 2J06A 3CMAT 1N6AA 3OYIA 1SSHA 3JB9F 2X4WA 4ZNXA 2DBMA 2X3WD 1M4ZA 4EMKB 1X69A 2DJQA 4J9IA 5IH2A 4JJCA 1MMGA 4JRKA 2K6DA 2E3IA 2R5MA 5GMKj 2ESWA 4M4ZA 4C8QF 1M30A 3VS7A 1BYMA 4HCZA 4E7JA 4GLMA 3CD6T 7AT1B 1HYOA 4R55A 2DEQA 3VS4A 1Q86C 1SRMA 2E5QA 4AT1B 2RQVA 1KQSS 2BIVA 4C92D 3GNFB 2DX1A 3PVQA 2F2WA 3QJ6A 4E7ZA 4HT8A 4M7DG 4PJOB 5KYXB 1QKXA 1Y0MA 5GANe 4MZTA 4GY5A 5LJ3e 3SEMA 2DL4A 1HD3A 1N5ZA 1N9RA 1VQ6Q 3I35A 4FCYA 3VUBA 3CEYA 5CVIA 3REAB 2RMOA 3HPWA 3TU4K 2EW3A 2K5IA 2RH2A 1QVGP 3JV3A 2LDMA 1KD1C 2LJ0A 2VV5A 3X25B 1RI0A 3UA6A 3CPWA 1T0JA 2CP0A 3HP9A 2A08A 3TEEA 1FMWA 1VQLT 4RG8A 1RAIB 2F5KA 2JZ2A 1MNDA 4IUPA 3FEOA 1IZ6A 5KYUB 4KT0E 4JDSA 1MMDA 1SKUB 4AFZC 1YFNA 1VQOA 3OYDA 5EG2A 2KXDA 1WDXA 2KMTA 4J9EA 2RQUA 2DNUA 2H8HA 3X26B 2HBPA 1VQOQ 4C5GA 1H8KA 1QCOA 1LNXA 2E65A 1M2OA 3M0RA 1D0ZA 2DXCA 1VA7A 5GAN5 2K5FA 3CCEQ 4F14A 1TH7A 1E7OA 3ZEHA 1BI2A 1S72Q 4LD6A 3A98A 4C92E 2CS7A 5GANh 2RN8A 3A8HB 2KT1A 1VQNQ 5DLQE 1VQ5A 5GMKi 5CK9A 2J05A 3L2WA 1NJIR 2KSSA 3OSVA 1IXDA 2V8JA 5FU6C 1NBEB 4OB2B 2HMAA 2IG0A 2W10A 4AG2C 2KBTA 3FDRA 4C92G 1X01A 2EQJA 3CCJQ 1WXTA 2A7YA 2QG9B 3CPFA 3QDRB 4MZPA 1I0CA 4IUQA 4M75B 3FRNA 5LJ5h 2FEIA 5GAOl 2FYKA 5KH6A 1NPRA 2YDLA 2QK0A 1BB9A 4JRQA 2FHDA 5GANf 4HVVA 3G4ST 3UF4A 3NTKA 1V1CA 2R5AA 3J81E 1C6VX 4M7AD 3QG1A 3CC2A 3WXMB 3TQ7P 1N8RU 1VIFA 2C06A 1G3TA 2LQKA 5HKCA 2ECZA 3F70A 2P0QA 1VQ6T 3CBMA 3PFSA 5LJ5f 3OMCA 3JCMX 2RI3A 3CC4A 1MNEA 3A5ZB 3GNGA 3SWNB 3L2QA 4PJLA 3QIIA 3OS2A 1UHFA 3M59A 3DLLA 1YJNA 4J7IA 2FO0A 3CC4Q 2RD1A 4CC4B 1Y71A 2HEQA 3I55Q 4ORZA 1M1KU 1GL5A 2EYYA 3OYJA 5CR2A 2IVWA 1HK9A 1YHQT 4BE2A 2DZ9A 2L3PA 1VQ4Q 4A54A 2HL3A 1PM3A 1G8XA 1WHMA 1YNZA 2A28A 1G5VA 2DMOA 2RHZA 5KYNA 5FLXE 4E7SA 4C0GA 2JMAA 2YLCA 1Q82U 3CCET 1QP3A 4BUGA 1JJ2P 1VQ7T 4BB7A 5KYWA 3CCQT 5GJVB 3QO3A 3E19A 1RAFB 2VGNA 4M7AE 1RADB 3E9GA 1VQNT 2ZPEB 2HBWA 1YITQ 4B9WA 5I22A 3EHRA 2DXUA 3VS6A 4E2FB 3CXCP 2KQWA 2CT3A 3QHSA 4M7AG 2L0AA 2M9UA 4XQ3A 2F5TX 4UC4A 1JXMA 2BUDA 3CCJT 3FB9A 3MEVA 2JM9A 4FT4A 3A1PA 2EJ9A 4OMLA 4J9CA 2XK0A 4C92F 3EG3A 1I5LA 2AHJB 1M2VA 3QBYA 2KI7A 4KGVB 2AT1B 1K8AC 2QA4Q 1VQPT 2R57A 4KH1B 4F04B 3EG9A 3MO8A 5FRNA 5C6SA 4M77D 1IO6A 2BE9B 1WX6A 3J7AF 3EHQA 3ASKA 1RUWA 5A2QE 1ABQA 1D1AA 2HSEB 3OY9A 1QVGS 3JSCA 4E7IA 4F16A 1WHKA 2VWFA 3BDUA 4PLIA 1H3HA 3RR6A 1RABB 3OA6A 1TS9A 1KD1R 1M90R 3REBB 3V7RA 3OMGA 1W70A 1D0YA 3TSWA 4M7DA 1JEGA 4OMMA 2RO0A 3QKJA 3CCRQ 1VQMA 1FMKA 2HKQB 1B3QA 1R0BG 2FPDA 1G3WA 3CBPA 5L23A 2CZ0B 1O9SA 2FZKB 3JB9D 1G83A 1WXBA 4N4HA 2JW4A 2KR3A 4OVAA 2GFUA 1WA7A 2NUPA 2PZ1A 2LCSA 3CCMA 1W2BS 2CZ7B 2QXFA 4QVCA 3BDLA 2HQXA 1R0CB 4C8QD 3DKMA 1UGSB 1VQ4T 1K73U 5GAN4 4J6XA 4PJJA 4K11A 3OYFA 2RJFA 2OTLA 4KBMB 4M7DC 1ZX6A 1VQ8T 2DLPA 2QEXQ 5IAYA 3PIPA 1BIAA 1X6OA 4O6JA 2KK4A 3E2UA 3OQ5A 2OTLQ 1D3BA 3THKA 2EGAA 5GMKm 1UJ0A 2XKOC 4FL6A 2OTJA 2DO3A 4RTZA 2ROLA 3M9QA 3CCUA 1QVFA 4N4IA 2O4XA 5HCKA 3UPUA 2MOXA 2BKDN 1YITT 2XD0A 4M77E 2YUNA 1ZUUA 3H6ZA 4EMKA 3CCUQ 5HK3A 5CKBA 4Y92A 1GXIE 2CSIA 3GLXA 3OYMA 2AKKA 1WI7A 2DRMA 5A0LA 2NYSA 4M77G 3O5ZA 4FYWB 1UDLA 2A0FB 3IQLA 1AWWA 2LJ1A 4F7UE 2ZGWA 2PVDB 2ZPBB 3VS1A 4M7AF 2YLBA 4M75F 5IHKA 3JCMW 3C4SA 2K7AA 2SEMA 2HCKA 2HDAA 4EMKC 2CP6A 2MCNA 1KHCA 5KYXA 1OZ3A 4F7UG 1WIEA 2YWWA 2JS2A 4RTXA 2KROA 4C5HA 4KGXB 2K57A 2LX9A 4XTXA 1Q81U 2FG0A 5GAN8 1UB4A 2A36A 5GAOr 3CCVQ 3JB9G 2RJEA 1G2BA 4XK8E 2DL7A 2V8KA 2GF7A 4D8KA 5J26A 3LW5E 4EPCA 2DKGA 3VS2A 1NJIC 2KE9A 3PGGA 1K9MR 1YCYA 2EKHA 1PSEA 3JCMP 1YJ9A 3CCRT 4KULA 4RTUA 2X3XD 2BZ8A 2JJ9A 4LN2A 2NLUA 4JZ3A 2CSQA 2F69A 2KAFA 2YT6A 2DTHA 2GFAA 3Q1JA 4AMCA 1Z9QA 2C0IA 2ED1A 4M78B 5FWCA 1IHVA 5GJWB 2IIMA 3CPWP 1WHGA 1NG2A 3JCMc 4J8OA 3E9FA 2E6NA 2GCXA 1M2VB 3R6NA 3CD6A 2PU9B 2CZ1B 2MPXC 2JTEA 2LQ8A 2HSPA 3M58A 2QEXT 1JJ2S 2LRQA 3J80E 1ACMB 2BE7D 3I5SA 3OYLA 1Q7YC 4A53A 2GTOA 2W0ZA 2QI2A 2K2MA 3KBGA 5L8RE 3M54A 4OMOA 1WXUA 1Q86U 2HAXA 3CXCS 4IKFA 2KRSA 2I2LA 1KJWA 2OJ2A 4XTVA 2O01E 1PRLC 4D6WA 2DBKA 3ZFJA 4M7DB 2CKKA 3DB4A 1KC8R 2CP5A 1QP2A 1VQKQ 2OI3A 2ATCB 5CO7A 4LD9K 2FPFA 1KQ1A 2X4YA 4GBQA 4LDXA 4FSXA 4FSSA 3OYCA 2VXFA 1IGQA 3U23A 1N8RR 2Y90A 2EGEA 3G71Q 4QQGA 4RMOA 4KRTA 3HHTB 2EFIA 2JOYA 3RKXA 1VQ9A 4KH0B 3SHWA 3CC7A 1YJWT 1OV3A 5DM7R 3EH2A 3CCVT 1OOTA 3QYHB 4E7HA 1YIJQ 2DE0X 3SWNA 4D8DA 5GAMh 1M3AA 3CC7Q 1QLYA 3X24B 2WACA 3LH0A 2FRWA 3EG2A 4MDWA 4C0DC 4XU3A 1UGRB 3VKIA 4MZMA 4WCIA 1RAGB 1WNLA 3FJPA 2VB6A 1X75C 2QDLA 5D6XA 5HY6A 3N5BB 2YXYA 3NHNA 2LNVA 4JUVA 3G6EA 3I5RA 3SWNC 3MP1A 3AT1B 3LX7A 4QKUA 1O75A 2KGTA 2QQRA 3P8BB 2E5KA 5GAMf 1OU9A 2DRKA 1ARKA 1UG1A 1NE8A 2GQVA 4Z88A 3ZL7C 1ZA1B 1X2KA 3SDZA 3S3MA 4LUDA 3V7SA 1J3TA 4RTTA 1PD1A 1SRLA 2DZCA 2K5LA 2DL3A 3M57A 1CKBA 3HRUA 4JLIA 3JCMQ 4PJOD 1B34B 3D7SB 1M90C 5HK0A 2JT4A 3A8LB 3SB2A 3HFOA 3INZA 2K9GA 3QPHA 3QJYA 1QKWA 5A0GA 2NWMA 2ED0A 2Y4YA 1VQKT 1MUZA 1VYUA 2K2VA 2RJDA 2KEAA 2LQWA 1QWFA 1NYFA 2VXEA 1BI0A 3OS1A 2ZPHB 2B8AA 2DIGA 3M0QA 3TSZA 3G71T 4YTLA 2FVUA 2ENMA 2F2VA 4FYXB 1NLPC 3OYNA 3KUFA 2QTXA 4DOVA 4PKCC 2GNCA 3M0TA 2DAQA 1RAAB 3PMTA 4BE1A 3DLMA 3NPFA 3NTHA 3OSSC 1WYXA 2L3RA 5LJ3h 1YIJT 2AKLA 4ESRA 3AHUA 1I4K1 2EPDA 2ZZDA 1H3ZA 8ATCB 1IB8A 1X6GA 2LVMA 5GAN7 4OMQA 5I2MA 1M27C 2LP5A 1VQ5Q 2MMPA 5GAOq 4TVRA 4IUTA 4A4EA 1OQKA 3CPWS 2E64A 2COZA 4PJOE 2DXBA 3L1AA 1W1FA 2GGRA 3EH1A 4XU0A 3I56A 4C8QA 3NGPA 5LJ3f 4OP0A 2J6KA 2EJGA 2V1QA 4PJOG 4M75D 3JCMJ 3PNWC 4JLGA 2EQMA 4WF2A 2VGMA 4J9DA 2EAYA 2MWPA 4C0DB 1Q7YR 1NPPA 2D9TA 1VQPA 3RKWA 1QCFA 1Z9ZA 5D7UA 5IN1A 5I21A 3L2RA 3CC2Q 2GBQA 2KY9A 1RACB 2CGHA 3V8LA 1K8AU 3FIFA 4C8QC 1RAHB 1AWXA 2YSQA 1M9SA 1PG5B 1UECA 3RIRA 2XG8D 3OW2P 1RAEB 1JRIA 3NMZC 3MPUB 1K9MC 2JS0A 2M0OA 2E1HA 3FC3A 5FRMA 5IHNA 3L2ZA 4X1VA 4L5GA 1QVFP 1OPKA 3CCLA 1BIBA 2M51A 1KIKA 1YJNQ 3M53A 3UDCA 3H0FA 2E70A 2C0TA 2DTIA 2PUOB 3JCMd 1P92A 2D0NA 4KUIA 4MMKA 1QVPA 1U5SA 2JMCA 2CP7A 1EFNA 5GANj 1VQOT 4RKUE 5FWBA 1LJOA 1VQ8A 4JJDA 4Z89A 3QUIA 4NL3A 2DM1A 4PNOA 1MMAA 1S72T 4QT7A 3EFOB 1SPKA 4M75E 3X28B 2HQHA 2ROTA 2DK3A 2L8DA 4E7LA 3JCMg 4JJBA 5LJ5j 3M0UA 1Y96B 4BI8B 1EZZB 2RHXA 3MJXA 1ZUYA 3P8DA 4M75G 1VQ5T 3OYKA 4DA4A 1XNIA 3TCJA 1KC8C 5KCOA 4M78A 2RM4A 1OU8A 1XQHA 2YRCA 1TUDA 4ME7A 3VS3A 2XICA 1OX9A 4PFZA 4ELZC 3FJ5A 1MHNA 1NLOC 3VRYA 3CCSA 2D8HA 2ZAEA 3RDVA 1N8RC 2R58A 4PJNA 3L2UA 4OB1B 1IREB 2KRMA 2WSCE 4M78C 3MEAA 2RQWA 4M77B 8AT1B 5GAN6 1NZ9A 3CCSQ 2LTOA 3OYHA 4PJOF 3CC2T 3M56A 4P5NA 1GCQA 2LT4A 4HCBA 2H3EB 3QXEB 4CC3A 1U8RA 5GAOp 2AK5A 1B7TA 3KFVA 5CQXA 3BE3A 4C0FA 3VRZA 2BZYA 3H9NA 1YI2A 1G3SA 4HT9A 1BKBA 2DTOA 2E41A 2HNIA 2YUOA 1AVZC 1M3BA 3CC4T 1B07A 1JQQA 2LT1A 3RNJA 5GAOn 1BI1A 1SHGA 1AEYA 3I55T 2B86A 3G1JA 4HVUA 2O9SA 1VQMQ 1TUGB 1YJNT 1GCQC 1ZSGA 2GTJA 2CP3A 3E1SA 3CMEA 2DJZA 2LCCA 3VJPA 2KDSA 4X34A 2LC4A 4C8QB 3ME9A 4XTYA 3GF5A 4E47A 3CCMQ 3CMEQ 1X6BA 3UA7A 4RTYA 2P4RA 4FYYB 3OW2A 5I11A 3WVDB 2CUDA 1U3OA 5D6WA 3RBBB 2X51A 2NUTA 4A4HA 2K3YA 2J6OA 5GANd 2O88A 2OTJQ 3RMQA 2J7IA 5CIUA 1PC0A 2EYWA 2VYTA 3T9NA 4B9XA 1I81A 5CAIA 2QQBA 5LJ5d 3OYEA 2KXCA 1TU0B 1UHCA 5DY9A 1GCPA 2E10A 3M0SA 3VV0A 2JM8A 2XDPA 4C92A 2XDBA 2ZPIB 1WJRA 3VU3C 1ZBXA 1UEBA 4ZN1A 2QA4T 3BFMA 2C0OA 5GMKe 3OS0A 4DOWA 4A4FA 2YUPA 3WVEB 4J83A 3OW2S 2EYQA 1VIEA 4RTWA 1B34A 1YJWA 3EG0A 4EMGA 2COYA 1BK2A 5LJ5g 1WHLA 2DD5A 1UTIA 4C92C 4II1A 3LWIA 3V8KA 1QVFS 1FMVA 1ZLMA 4DEYA 3HRSA 3CMAA 1H641 3JCMV 1XOVA 4ZTFA 4VUBA 1YJ9Q 2K4YA 1RI9A 1VQMT 4E7KA 2QGGA 1QW1A 4EMHA 3OBWA 1K73C 4QVZA 4OF1A 2F2XA 3JCMe 2Y4XA 1N9SA 1ZSZB 3M0PA 2P84A 1EX4A 4LDYA 3CCMT 3P8HA 1LCKA 5FW9A 3EGUA 4A4GA 3TREA 2A37A 5IXFA 2EBPA 3CD6Q 3PTAA 1YN8A 2RF0A 2OTLT 4DBHA 3QWYA 3OYYA 1TWBA 3QZ9B 2E12A 4HCCA 1YWPA 1QMCA 2I0NA 3LLRA 2OX7A 3EFRA 1PRMC 4LNPA 1BBZA 2RI2A 2K3BA 1MGQA 3MP6A 3SD4A 1WHHA 2CYZB 3CCUT 2EQIA 4EIKA 1R8OB 3M4GA 2L3QA 2ABLA 1UJYA 2MK5A 2QQAA 4HKEA 1VQLA 2DD4A 3MP8A 3VS0A 1HSQA 3QDFA 3M55A 1KD1U 1K0XA 3MHXA 2V26A 4BI4A 3NTIA 1TOVA 2FZCB 1KHIA 1V76A 2QTVA 5J39A 2VKNA 1VOMA 2JN0A 4M7AA 2PNIA 1OULA 4Y28E 4JRPA 3VS5A 1M1GA 4PK4A 2QQ9A 2DF6A 3S3OA 5CKDA 1LPLA 1KQSA 2D1XA 2DVJA 5KCHA 1TTHB 2DETA 2XIDA 1KQ2A 2KRNA 2JNGA 3H8ZA 2O9VA 1F1BB 2ZPFB 4JS4A 1D1CA 1JXOA 2NUTB 4BY6B 1T3LA 1VQ9Q 4M7AC 4ZGJB 1WJQA 1QQJA 1M1KR 2VVKA 4J9BA 3EGXB 2HD0A 3O8VA 1GRIA 5CKHA 1YJ9T 1U06A 4PFOA 4JRIA 4A4KA 1GFCA 5IXBA 2HZYA 3G6EQ 3G4SA 1QCNA 4C92B 1ZBJA 4BDYA 1UGPB 2AIRB 1M5Q1 1Q82R 2D0QB 3MKDA 4M7DE 4XTWA 3G4SQ 4N4GA 1X27A 3EFOA 3RUXA 4FT2A 4F17A 3GOXA 4RTVA 5IHIA 2MF2A 2RK1A 1K0SA 3UT1A 1A0NB 1D0XA 1T0HA 5EC7A 4L59A 4AG1C 2EVRA 2L3SA 1VQ6A 1Y96A 4CC2A 1JB0E 2MYSA 3VUZA 4ZTJA 4AFUC 1UUEA 4HCKA 3HFNA 3CQTA 2RJCA 2A3LA 3PVLA 3LGLA 2BZXA 4AFSC 4IIMA 4RCCA 1BCOA 4XTUA 1FXXA 3JRZA 1W6XA 3BY7A 1T3SA 2MWOA 1FX7A 4J5YA 2P0PA 1C0MA 3S3NA 3MCAB 2KVQG 3HTRA 5M9OA 2V8IA 4LDWA 1K9MU 3PMIA 1YWOA 3QWXX 5LJ5e 1YHQA 1K1ZA 1AWOA 1TSFA 2M0YA 1S1NA 4IUVA 1NEGA 2PQWA 4R56A 2G6FX 5I2SA 4PJMA 3URGA 5GAMj 4M77A 1YHQQ 2DL8A 4FW1A 1SHFA 1UGVA 2HQEA 2DIQA 4XU1A 1U1SA 1ABOA 1LOJA 2CZ6B 3UWNA 3CCEA 4OB3B 4XTZA 1W2BP 1VQ7A 4NL2A 2LX7A 1S72A 3CCQA 1VQ9T 4EDUA 4F7UA 3CC7T 4OGCA 1VQNA 4OGEA 1ZUKA 4QQ6A 1GFDA 1AOJA 3LH5A 1VQ7Q 2KYBA 4M77C 3CCQQ 4HXJA 4BE0A 4E6RA 2PVOB 1AHJB 3I9QA 1UE9A 6AT1B 3RERA 3CCJA 1QWEA 5KE3A 2RHUA 1MV0B 4LXCA 1K73R 1W4SA 1RLPC 4M78F 2RA2A 2QASA 3OYBA 2E3HA 2KYMA 3G6ET 1KC8U 3I56Q 4M7AB 2E6ZA 4OMPA 4FYVB 4ELYC 1WLPB 2YUQA 3H41A 4N0AA 2X4XA
chains in the Genus database with same CATH topology
4C8QF 5CQXA 2NLUA 4C0FA 5J3BA 4L6V5 1BYMA 4HCZA 2F69A 1YI2A 2KAFA 4E7JA 3CD6T 1G3SA 4R55A 4HT9A 1BKBA 2DTOA 2DTHA 2DEQA 2E41A 2GFAA 2HNIA 3Q1JA 1Q86C 2E5QA 4M78B 3CC4T 1KQSS 3GPLA 2LT1A 5GAOn 2BIVA 1BI1A 4C92D 3JB9I 3GNFB 1M8VA 3I55T 4NS5A 3QJ6A 3JCMc 4J8OA 3E9FA 3CCRT 4HT8A 2E6NA 2GCXA 1YJNT 4M7DG 2WSFE 4PJOB 5GANe 3CD6A 4MZTA 4N0AC 3E1SA 3CMEA 2PU9B 2CZ1B 2DJZA 4BACA 4GY5A 5LJ3e 2LCCA 2LQ8A 2EIFA 3VJPA 3M58A 2QEXT 4M7DF 1G3YA 2KDSA 4X34A 1JJ2S 2LRQA 1N9RA 2LC4A 3QZ5B 4C8QB 3A8GB 3ME9A 4XTYA 3GF5A 3VUBA 4E47A 3J80E 3CEYA 5CVIA 3I55A 3HPWA 5FU7C 4A53A 3OYLA 3TU4K 1Q7YC 2QI2A 3KBGA 5L8RE 2K5IA 3M54A 4JJNK 1WQ7A 2RH2A 4BD3A 1Q86U 2LDMA 2K3XA 1KD1C 3OW2A 2VV5A 3X25B 1RI0A 5KE2A 2HAXA 3G7ZA 2EKOA 3WVDB 4C5EA 3CPWA 1VQ4A 3HP9A 3CXCS 5LJ3j 3TEEA 5D6WA 2MAMA 1VQLT 4RG8A 4IKFA 2F5KA 3C95A 2I2LA 4A4HA 5CCAA 2JZ2A 2O01E 4XTVA 4D6WA 4IUPA 5GMKl 4J6YA 2K3YA 5GANd 4ATOA 3ZFJA 4M7DB 3FEOA 2PUKB 1IZ6A 4KT0E 2CKKA 3DB4A 4JDSA 2EWNA 3RMQA 1VQOA 3OYDA 5EG2A 5CIUA 1QP2A 2KMTA 5CO7A 2RB6A 1SSFA 4LD9K 1QVGA 1KQ1A 2X4YA 2XI9A 4NOYA 3VYHB 5GAMd 3JB9J 3X26B 2VYTA 3T9NA 2HBPA 4C5GA 1LNXA 1YITA 4B9XA 1I81A 1OI1A 1XTDA 2E65A 4LDXA 3R6OA 5CAIA 4FSXA 2QQBA 2DVEA 2DXCA 5GAOp 1I8FA 5LJ5d 5GAN5 2K5FA 3OYCA 2VXFA 3OYEA 1TH7A 3ZEHA 5DY9A 3HSBA 2Y90A 4FIBA 1BI2A 1WGSA 2E10A 4QQGA 3VV0A 4MDXA 4RMOA 2XDPA 4LD6A 4C92A 4C92E 2CS7A 5GANh 2XDBA 3A8HB 3HHTB 2EFIA 2JOYA 2ZPIB 1EIFA 3RKXA 1WJRA 3PT9A 5DLQE 1ZBXA 4Z02A 3HKSA 1UEBA 3VU3C 2H3JA 5CK9A 4ZN1A 5GMKi 1VQ9A 3CC7A 1YJWT 2P4TA 1FWZA 3BFMA 2QA4T 3L2WA 4FM4B 5DM7R 2KSSA 4Y91A 3OSVA 3CCVT 2V8JA 5FU6C 3QYHB 5GMKe 3OS0A 4OB2B 4E7HA 4DOWA 2IG0A 4RG2A 3SWNA 4A4FA 1W2BA 4J6WA 5GAMh 5GAMg 2JTFA 3FDRA 5C0MA 5GAOm 3I56T 4C92G 3WVEB 3QSUA 4J83A 3OW2S 4DQ2A 1X01A 2EQJA 2QDYB 2EYQA 4JS5A 3X24B 1VIEA 2WACA 3LH0A 2A7YA 5GAN2 4MDWA 1B34A 3CPFA 4C0DC 3QDRB 4MZPA 4M75B 4IUQA 1BI3A 2QA4A 4EMGA 4XU3A 1YJWA 3FRNA 5LJ5h 5LJ5g 1UGRB 5GAOl 2RK2A 2DD5A 3VKIA 4C92C 2FYKA 4MZMA 4II1A 3LWIA 3V8KA 1QVFS 4Q5WA 5KH6A 1NPRA 1WNLA 3FJPA 3HRSA 1X75C 2FHDA 5GANf 3G4ST 5D6XA 4JRQA 5FU6B 1JBMA 5HY6A 4V2SA 3CMAA 3N5BB 3NTKA 2LNVA 1H641 4JUVA 2R5AA 3G6EA 3J81E 3JCMV 3SWNC 1WQWA 1XOVA 4M7AD 3QG1A 4F7UB 3MP1A 4ZTFA 4VUBA 3CC2A 3WXMB 2K4YA 3LX7A 4X9CA 1N8RU 3V8JA 3BW1A 1O75A 1VQMT 2QQRA 3ER0A 1VIFA 3P8BB 5GAMf 4E7KA 5CKEA 2C06A 1G3TA 3CCRA 1M1KC 1QW1A 3L2VA 4EMHA 3OBWA 2LQKA 5HKCA 2JTMA 4QVZA 2ZPGB 1Y07A 3F70A 1K73C 4OF1A 1NE8A 2GQVA 3EAEA 3JCMe 2P0QA 2Y4XA 1VQ6T 1N9SA 1WJSA 3CBMA 2DXTA 2LCLA 3DB3A 3PFSA 3SDZA 3S3MA 5LJ5f 3JCMb 1NJIU 3OMCA 4LDYA 3L42A 2RHYA 3V7SA 3CCMT 4IUUA 3P8HA 2P0KA 3JCMX 2RI3A 3CC4A 3CCLT 3A5ZB 3GNGA 3SWNB 4A4GA 2DZCA 3GIBA 3TREA 4XAXB 3L2QA 2K5LA 3QIIA 3M57A 3OS2A 3PTAA 2OTLT 3M59A 3RESA 3PIOA 3DLLA 3HRUA 1YJNA 4JLIA 3JCMQ 4PJOD 4J7IA 1B34B 3OYYA 1N27A 2RD1A 4PL6A 1Y71A 1M90C 5HK0A 3QZ9B 3A8LB 1Q82C 1VUBA 2E12A 3SB2A 2QEXA 4HCCA 3HFOA 1M1KU 3INZA 3QPHA 3QYGB 4J7FA 4BI3A 3LLRA 3OYJA 3NFCA 3QJYA 3EFRA 5CR2A 2IVWA 1HK9A 5A0GA 4LDVA 1YHQT 2Y4YA 2RI2A 4C5IA 1MGQA 3MP6A 4BE2A 1RL2A 2DZ9A 2DPPB 2CYZB 2YHTA 3SD4A 3CCUT 4A54A 1VQKT 5FU7B 5LJ3d 1R8OB 3M4GA 2K2VA 2RJDA 3OYAA 1G5VA 1Q7YU 2QQAA 4HKEA 1VQLA 2RHZA 2DD4A 3MP8A 1YBYA 5FLXE 3M55A 4C0GA 1KD1U 2YLCA 4QW2A 2VXEA 1BI0A 3OS1A 1Q82U 4O5VA 3CCET 2ZPHB 3MHXA 1QP3A 2B8AA 2DIGA 3MEWA 3NTIA 4BI4A 1KHIA 4BUGA 1VQ7T 4BB7A 5J39A 4BY6C 3CCQT 3G71T 3QO3A 2JN0A 3E19A 2VGNA 4M7AA 4M7AE 4YTLA 2FB7A 2FVUA 1VQNT 3E9GA 4Y28E 2ZPEB 3OYNA 4JRPA 3KUFA 2QTXA 1M1GA 2QQ9A 4PKCC 4B9WA 3PMTA 2DAQA 4DOVA 3S3OA 5CKDA 4BE1A 3DLMA 3NTHA 5GANg 1KQSA 5GAN3 3OSSC 4PLLA 2DXUA 5KCHA 2L3RA 5LJ3h 5LJ3g 1YIJT 2XIDA 1KQ2A 3A8MB 3AHUA 1I4K1 2JNGA 2ZZDA 2KQWA 3H8ZA 1H3ZA 3QHSA 4M7AG 3LGFA 2M9UA 4XQ3A 2F5TX 2LVMA 2RI5A 2ZPFB 4UC4A 5GAN7 2BUDA 2XHCA 3CCJT 4JS4A 3FB9A 5I2MA 4KUDK 3MEVA 3JB9H 4BY6B 4HA8A 2MMPA 3CCST 4FT4A 1JJ2A 2EJ9A 2X35A 5GAOq 4TVRA 4M7AC 4IUTA 4A4EA 3CPWS 4RCBA 2XK0A 2E64A 4C92F 4ZGJB 2XU8A 3M5AA 1WJQA 4PJOA 2DXBA 1I5LA 2AHJB 3L1AA 3QBYA 4PJOE 3CCVA 4ZGEB 1K8AC 1VQ5A 3LWHA 2L5QA 4XU0A 2HD0A 3I56A 4C8QA 4C8QE 3O8VA 4CRIA 1VQPT 3HL8A 2R57A 5CKHA 3CXCA 1YJ9T 5LJ3f 4OP0A 3MO8A 5FRNA 5C6SA 4M77D 2EJGA 4M7DC 4BDZA 4PJOG 4M75D 1OYXA 3JCMJ 3PNWC 3J7AF 3ASKA 1YI2T 4JLGA 5A2QE 2EQMA 3C12A 4JRIA 4WF2A 4A4KA 3OY9A 2VGMA 3JSCA 4E7IA 1QVGS 2EAYA 2MWPA 4C0DB 3BDUA 4FU6A 4PLIA 4C8QG 1NPPA 2XDDA 2X4JA 4IURA 4ZN3A 3G4SA 2D9TA 1V29B 4PJOC 3OBYA 3OA6A 4OMFB 3RKWA 4C92B 3L2RA 5IN1A 5I21A 4BDYA 1VQPA 4QQDA 5CQYA 3GP8A 3EFSA 1UGPB 2KY9A 3V7CA 1M5Q1 2CGHA 3A8OB 3V7RA 3OYGA 2D0QB 3OMGA 3V8LA 1K8AU 4M7DA 4M7DE 3FIFA 4C8QC 2RO0A 3QKJA 2D6FA 4XTWA 3CMET 4M78D 4N4GA 3RUXA 3FLGA 1VQMA 1M9SA 3RKYA 4FT2A 3GOXA 3RIRA 2XG8D 3ZBDA 1G3WA 3CBPA 2MF2A 2RK1A 5FROA 1JRIA 3VYGA 2CZ0B 3UT1A 1O9SA 3MEUA 2EQUA 3JB9D 5D6YA 1K9MC 4L59A 2VC8A 2M0OA 2E1HA 4N4HA 3FC3A 1VQ6A 1Y96A 4OVAA 5FRMA 3SFMA 2GFUA 1JB0E 4ZTJA 3VUZA 3L2ZA 3CCMA 4L5GA 5GMKh 1W2BS 2CZ7B 2QXFA 3CCLA 1BIBA 3HFNA 3BDLA 4QVCA 1PSFA 2HQXA 2QQSA 4C8QD 3DKMA 3OB9A 1UGSB 3CBOA 1VQ4T 2RJCA 3M53A 3UDCA 2A3LA 5GAN4 1K73U 2OTJT 3LGLA 4J6XA 2OTLA 1ZHIA 2E70A 2L89A 2RJFA 4KBMB 4RCCA 4CI0C 2DTIA 3OYFA 4XTUA 1FXXA 3JRZA 2PUOB 3JCMd 5LL6S 1VQ8T 5IAYA 1P92A 3BY7A 5AYFA 4KUIA 3C94A 2MWOA 3X20B 5GAMe 3PIPA 1BIAA 4MMKA 1FX7A 1X6OA 1HXDA 4J5YA 4O6JA 2KK4A 2P0PA 3OQ5A 1QVPA 1Y7XA 3S3NA 1D3BA 3MCAB 2KVQG 5M9OA 5GMKm 5GANj 4GLKA 1VQOT 2XKOC 2V8IA 4FL6A 4LDWA 4RKUE 1K9MU 3PMIA 5LJ5e 2OTJA 1YHQA 1LJOA 2DO3A 3M4YA 1OZ2A 2VUBA 1M90U 2RHIA 3M9QA 1VQ8A 1UGQB 3CCUA 1U1TA 1QVFA 4IUVA 4M7DD 1VQKA 2WSEE 2PQWA 3QUIA 4N4IA 2O4XA 4R56A 3UPUA 5A0DA 5I2SA 4NL3A 4PNOA 2BKDN 3URGA 5GAMj 1YITT 3LYIA 1S72T 4M77A 4M77E 2M1HA 2XD0A 2EJFA 2ZCFB 4M75A 4M75E 4EMKA 3H6ZA 5DLOA 1M1FA 3X28B 2HQEA 2DIQA 4C0ZA 5HK3A 2DK3A 4XU1A 5CKBA 2L8DA 1U1SA 1GXIE 3GLXA 4E7LA 2JVVA 1LOJA 3JCMh 3JCMg 5LJ5j 2CZ6B 3OYMA 4XU2A 1Q81C 1Y96B 1DJ7B 2OAUA 3UWNA 4BI8B 3CCEA 5A0LA 4OB3B 4XTZA 1VQ7A 3S6WA 4NL2A 2RHXA 4M77G 2FL7A 1S72A 3CCQA 1KG1A 3P8DA 4ZGDB 3G71A 4M75G 1VQ9T 1VQ5T 4EDUA 3OYKA 4F7UA 4F7UE 1XNIA 4DA4A 2M16A 2ZGWA 5IT9E 1ZQ1A 3CC7T 3TCJA 4OGCA 1VQNA 4M77F 1KC8C 4OGEA 2JUFA 1WPYA 2MI6A 2PVDB 2ZPBB 5KCOA 4M7AF 2YLBA 4M75F 4M78E 4M78A 2YRVA 4QQ6A 2RM4A 3C4SA 4QVDA 3JCMW 1XQHA 4M77C 3META 3KXTA 4M75C 3HRTA 4BE0A 4MMLA 4ME7A 2G3RA 4EMKC 1YIJA 3JAME 2PVOB 2XICA 1AHJB 2PVGB 5CKFA 2EQKA 4OB0B 1KHCA 1OZ3A 4ELZC 4F7UG 1D3BB 3RMSA 3RERA 4LDUA 3CCJA 1MHNA 3OS5A 4C5HA 5KE3A 2RHUA 4M78G 2K57A 2LX9A 4XTXA 4F7UF 1Q81U 3JCMf 5GAN8 3CCSA 1UB4A 1W4SA 4M78F 1N8RC 5GAOr 3JB9G 2R58A 2RJEA 2O4XB 2RA2A 4X9DA 4OB1B 4XK8E 3L2UA 3CMAT 1IREB 2WSCE 3OYBA 4M78C 3G6ET 3MEAA 4M77B 1N6AA 3OYIA 1KC8U 2V8KA 5GAN6 2GF7A 1NZ9A 2X4WA 4M7AB 3JB9F 2LTOA 2E6ZA 3OYHA 1M4ZA 4PJOF 5J26A 4EMKB 3CC2T 3LW5E 4EPCA 3M56A 2DKGA 4ELYC 4P5NA 1NJIC 2LT4A 3PGGA 4JRKA 2R5MA 4N0AA 4HCBA 1YCYA 3QXEB 1PSEA 5GMKj 3JCMP 1YJ9A 2X4XA 1U8RA 4KULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIB A;  3HFN A;  4QVC A;  2VXE A;  4C8Q F;  4Y91 A;  4C8Q D;  5GMK e;  5GAN 4;  3SWN A;  5GMK j;  4J6X A;  4J6W A;  5GAM h;  5GAM g;  4M7D C;  4RCC A;  5GAO m;  2DTI A;  3QSU A;  2DTO A;  2E41 A;  2DTH A;  2DEQ A;  2HNI A;  3QO3 A;  4XTU A;  2JN0 A;  1X01 A;  4C92 G;  3BY7 A;  4DQ2 A;  3JCM d;  4M7A A;  4M7A E;  5GAM e;  5GAN 2;  2FB7 A;  4M78 B;  1BIA A;  1B34 A;  4MMK A;  4J5Y A;  1HXD A;  5GAO n;  2QTX A;  4C92 D;  4M75 B;  3JB9 I;  1M8V A;  4EMG A;  4XU3 A;  1D3B A;  5LJ5 h;  5LJ5 g;  5GAN j;  5GMK m;  5GAN g;  5GAN 3;  3JCM c;  5GAO l;  4HT8 A;  4C92 C;  2FYK A;  4M7D B;  2DXU A;  3V8K A;  4M7D G;  5LJ3 h;  5LJ3 g;  4PJO B;  5LJ5 e;  5GAN e;  1WNL A;  1KQ2 A;  1LJO A;  3FJP A;  4N0A C;  3AHU A;  1I4K 1;  2DJZ A;  3QHS A;  5GAN f;  4M7A G;  5LJ3 e;  4V2S A;  4XQ3 A;  1JBM A;  4M7D F;  1U1T A;  5GAN 7;  4M7D D;  3FB9 A;  1H64 1;  3QUI A;  1N9R A;  4JUV A;  3JCM V;  4C8Q B;  3SWN C;  1WQW A;  4XTY A;  4NL3 A;  3JB9 H;  4PNO A;  5GAM j;  4F7U B;  4M7A D;  4HA8 A;  4M77 A;  4M77 E;  4A53 A;  2EJF A;  2EJ9 A;  4M75 A;  4M75 E;  5GAO q;  4M7A C;  4X9C A;  4EMK A;  3V8J A;  3BW1 A;  1WQ7 A;  4RCB A;  2E64 A;  5GAM f;  4C92 F;  4XU1 A;  4PJO A;  1U1S A;  4PJO E;  1I5L A;  3L1A A;  3JCM h;  1LOJ A;  3JCM g;  5LJ5 j;  4XU2 A;  4EMH A;  1Y96 B;  5LJ3 j;  3JCM e;  4XTZ A;  4NL2 A;  1N9S A;  4XU0 A;  4M77 G;  2DXT A;  2I2L A;  4C8Q A;  4C8Q E;  5LJ5 f;  4M75 G;  3JCM b;  3V7S A;  4XTV A;  4F7U A;  4F7U E;  3JCM X;  2ZGW A;  5LJ3 f;  4OP0 A;  4M77 F;  4J6Y A;  3SWN B;  5GMK l;  1WPY A;  2DZC A;  2EJG A;  4M77 D;  5GAN d;  3GIB A;  4PJO G;  2YLB A;  4M75 F;  4M78 E;  4M78 A;  4M75 D;  4QVD A;  2RM4 A;  3JCM W;  3JCM J;  2EWN A;  4M77 C;  4JRI A;  4WF2 A;  3RES A;  4M75 C;  2EAY A;  4JLI A;  4MML A;  3JCM Q;  4EMK C;  4PJO D;  1B34 B;  2RD1 A;  3BDU A;  4C8Q G;  2RB6 A;  4M7A F;  4F7U G;  4PJO C;  1D3B B;  1KQ1 A;  4NOY A;  3RKW A;  3SB2 A;  4C92 B;  5GAM d;  3HFO A;  5I21 A;  3JB9 J;  3RER A;  3INZ A;  3EFS A;  4M78 G;  2K57 A;  1M5Q 1;  2CGH A;  3V7C A;  1LNX A;  3EFR A;  4XTX A;  3V7R A;  4F7U F;  1HK9 A;  3JCM f;  5GAN 8;  1I81 A;  3V8L A;  4HT9 A;  2E65 A;  4M7D A;  3FIF A;  4C8Q C;  5CAI A;  4M7D E;  4XTW A;  4M78 F;  1MGQ A;  2DVE A;  4M78 D;  5GAO r;  2DZ9 A;  1I8F A;  2YHT A;  3RUX A;  5LJ5 d;  2RA2 A;  4X9D A;  3RKY A;  2VXF A;  5GAN 5;  3RIR A;  4A54 A;  1TH7 A;  4M78 C;  5DY9 A;  5LJ3 d;  1JRI A;  2Y90 A;  4M77 B;  3HSB A;  5GAN 6;  2E10 A;  3M4G A;  3JB9 F;  4M7A B;  3JB9 D;  3JB9 G;  4PJO F;  4EMK B;  2VC8 A;  5GAN h;  2E1H A;  4C92 E;  4C92 A;  2DKG A;  1Y96 A;  3RKX A;  4JRK A;  3PGG A;  3VU3 C;  4N0A A;  3L2Z A;  5GMK i;  1YCY A;  3JCM P;  5GMK h;  5GAO p;  3BFM A;  2YLC A; 
#chains in the Genus database with same CATH topology
 5J3B A;  2HL5 C;  4L6V 5;  1FYN A;  1PKS A;  3EGD B;  4J9F A;  1VQP Q;  1UFF A;  3GPL A;  1MMN A;  3JB9 I;  1M8V A;  4NS5 A;  2WSF E;  4N0A C;  4BAC A;  2M02 A;  2AZV A;  2EIF A;  4M7D F;  4LE9 A;  1G3Y A;  3QZ5 B;  3A8G B;  4J9G A;  3I55 A;  5FU7 C;  2DEU A;  3CCL Q;  4JJN K;  1WQ7 A;  4BD3 A;  2K3X A;  5KE2 A;  2SRC A;  1WFW A;  3G7Z A;  2EKO A;  4C5E A;  1VQ4 A;  5LJ3 j;  5ECA A;  2MAM A;  3C95 A;  1Q81 R;  1WZO A;  1KSW A;  5CCA A;  4DBQ A;  2YRD A;  4JPB W;  5GMK l;  4J6Y A;  4ATO A;  2PUK B;  2PTK A;  2EWN A;  1VQ8 Q;  2VAS A;  1KFZ A;  2RB6 A;  1SSF A;  2BTT A;  1QVG A;  2CH4 W;  4NOY A;  3VYH B;  2XI9 A;  5GAM d;  3JB9 J;  3UAT A;  1YIT A;  4B6M A;  2DA9 A;  1OI1 A;  1XTD A;  2EYX A;  2E4H A;  3R6O A;  2DVE A;  1I8F A;  2QGF B;  1NM7 A;  4OMN A;  1ZA2 B;  4IIO A;  3HSB A;  4FIB A;  1VYT A;  1WGS A;  4MDX A;  3PE0 A;  2QAZ A;  1EIF A;  3PT9 A;  3H0I A;  4Z02 A;  3HKS A;  2H3J A;  1SF9 A;  1YP5 A;  1ZSZ A;  1FWZ A;  2P4T A;  2RQR A;  4ANJ A;  4FM4 B;  4Y91 A;  1JO8 A;  4RG2 A;  1W2B A;  4J6W A;  5GAM g;  2JTF A;  5GAO m;  5C0M A;  3I56 T;  3QSU A;  4DQ2 A;  2KNB B;  2QDY B;  4JS5 A;  5GAN 2;  1Q86 R;  2QA4 A;  1BI3 A;  4RUG A;  2D8J A;  2RK2 A;  1NYG A;  4Q5W A;  5KYY A;  1ZSZ C;  4V2S A;  5FU6 B;  1JBM A;  1D09 B;  2EGC A;  2CUB A;  1WQW A;  4F7U B;  1JU5 C;  2MIO A;  4X9C A;  2DIL A;  3V8J A;  3BW1 A;  3ER0 A;  5CKE A;  3CCR A;  1YI2 Q;  1M1K C;  1PHT A;  3L2V A;  1Y57 A;  1C1A A;  2JTM A;  2ZPG B;  1Y07 A;  1AD5 A;  3EAE A;  1WJS A;  1SG5 A;  2DXT A;  2HKN A;  2LCL A;  3DB3 A;  3JCM b;  1NJI U;  3L42 A;  2RHY A;  4IUU A;  2P0K A;  3CCL T;  3GIB A;  4XAX B;  2AZS A;  1OX8 A;  3PIO A;  3RES A;  4KGZ B;  1PKT A;  1E6G A;  1N27 A;  4PL6 A;  1K76 A;  1VYV A;  1Q82 C;  1VUB A;  2V1R A;  2QEX A;  1IHW A;  4BI3 A;  3QYG B;  4J7F A;  3NFC A;  2RQT A;  4LDV A;  4C5I A;  1RL2 A;  2YHT A;  2DPP B;  1K4U S;  1XJW B;  5FU7 B;  5LJ3 d;  1KQS P;  1IRX A;  4R0K A;  3OYA A;  1Q7Y U;  1YBY A;  2NUZ A;  3EGX A;  4QW2 A;  1M3C A;  4O5V A;  2LQN A;  3MEW A;  4BY6 C;  1CKA A;  2FB7 A;  1OEB A;  1IGU A;  1M8M A;  1AWJ A;  5GAN g;  5GAN 3;  4PLL A;  3EG1 A;  2RNA A;  5LJ3 g;  3A8M B;  3LGF A;  2RI5 A;  2FZG B;  2XHC A;  4KUD K;  1H92 A;  3JB9 H;  4HA8 A;  3CCS T;  1OPL A;  1JJ2 A;  2X35 A;  1TG0 A;  2COW A;  3GBQ A;  4RCB A;  1RLQ C;  2XU8 A;  3M5A A;  4PJO A;  2JXB A;  3CCV A;  1PD0 A;  4A63 B;  4ZGE B;  3LWH A;  2L5Q A;  1LVK A;  1K9A A;  2F1L A;  4C8Q E;  4CRI A;  1YJW Q;  3HL8 A;  3CXC A;  2Z0W A;  2XMF A;  1E6H A;  4BDZ A;  9ATC B;  1KK7 A;  1OYX A;  5KYW B;  2J6F A;  1BU1 A;  1YI2 T;  1GBR A;  3ULR B;  1GBQ A;  2CRE A;  3C12 A;  1D1B A;  1X43 A;  2CH4 A;  3CMA Q;  4FU6 A;  4C8Q G;  2XDD A;  2X4J A;  4IUR A;  4ZN3 A;  4LUE A;  1BCM A;  1V29 B;  4PJO C;  3OBY A;  4OMF B;  4QQD A;  5CQY A;  2O31 A;  3GP8 A;  1AZG B;  3EFS A;  3V7C A;  3OYG A;  3A8O B;  2D6F A;  5KYU A;  1R77 A;  3CME T;  4M78 D;  2GQI A;  3FLG A;  2LZ6 B;  3RKY A;  3ZBD A;  1WHJ A;  2QYZ A;  5FRO A;  2K79 A;  3VYG A;  2X9H A;  3MEU A;  2EQU A;  5D6Y A;  2IPO B;  4DBF A;  2LMJ A;  2VC8 A;  1PCX A;  3SFM A;  1CSK A;  2CP2 A;  1I5O B;  5GMK h;  2DL5 A;  1HJD A;  2DYB A;  1PSF A;  2QQS A;  2FPE A;  3OB9 A;  3CBO A;  5KYY B;  4DEX A;  1PNJ A;  2OTJ T;  1ZHI A;  2L89 A;  5AT1 B;  4CI0 C;  5LL6 S;  3EG9 B;  5AYF A;  5GAM e;  3C94 A;  3X20 B;  2DER A;  1HXD A;  4CC7 A;  1X2Q A;  1Y7X A;  2CT4 A;  4GLK A;  4PFP A;  3M4Y A;  1OZ2 A;  2VUB A;  1M90 U;  2RHI A;  1UGQ B;  1U1T A;  2LNH B;  3TVT A;  4M7D D;  1VQK A;  2WSE E;  2DYI A;  1AT1 B;  1VQL Q;  5A0D A;  2L2P A;  3LYI A;  2M1H A;  2EJF A;  2ZCF B;  4DBR A;  4M75 A;  2RPN A;  5DLO A;  1M1F A;  4C0Z A;  2LJ3 A;  1I1J A;  2JVV A;  3C0C A;  3JCM h;  2KT8 A;  4XU2 A;  1Q81 C;  1DJ7 B;  1MV3 A;  2O2O A;  2OAU A;  2NUP B;  3S6W A;  4J9H A;  2FL7 A;  1KG1 A;  4ZGD B;  3G71 A;  1K8A R;  5IT9 E;  1YCS B;  2M16 A;  3EGD A;  1ZQ1 A;  4M77 F;  2JUF A;  1WPY A;  2MI6 A;  4FW2 A;  4Z8A A;  1SEM A;  4M78 E;  4QVD A;  2YRV A;  1TUC A;  3MET A;  3KXT A;  4M75 C;  1Q95 G;  3HRT A;  4MML A;  4WTO B;  2G3R A;  1TXQ A;  1YIJ A;  3JAM E;  2FRY A;  5CKF A;  2PVG B;  2EQK A;  4OB0 B;  2EYZ A;  4HVW A;  2CDT A;  1D3B B;  3RMS A;  4LDU A;  4JZ4 A;  2DFU A;  1I07 A;  3OS5 A;  4M78 G;  2OAW A;  4AFQ C;  4F7U F;  3JCM f;  3H0H A;  1NEB A;  1PWT A;  1AZE A;  2O4X B;  4X9D A;  2J06 A;  3CMA T;  1N6A A;  3OYI A;  1SSH A;  3JB9 F;  2X4W A;  4ZNX A;  2DBM A;  2X3W D;  1M4Z A;  4EMK B;  1X69 A;  2DJQ A;  4J9I A;  5IH2 A;  4JJC A;  1MMG A;  4JRK A;  2K6D A;  2E3I A;  2R5M A;  5GMK j;  2ESW A;  4M4Z A;  4C8Q F;  1M30 A;  3VS7 A;  1BYM A;  4HCZ A;  4E7J A;  4GLM A;  3CD6 T;  7AT1 B;  1HYO A;  4R55 A;  2DEQ A;  3VS4 A;  1Q86 C;  1SRM A;  2E5Q A;  4AT1 B;  2RQV A;  1KQS S;  2BIV A;  4C92 D;  3GNF B;  2DX1 A;  3PVQ A;  2F2W A;  3QJ6 A;  4E7Z A;  4HT8 A;  4M7D G;  4PJO B;  5KYX B;  1QKX A;  1Y0M A;  5GAN e;  4MZT A;  4GY5 A;  5LJ3 e;  3SEM A;  2DL4 A;  1HD3 A;  1N5Z A;  1N9R A;  1VQ6 Q;  3I35 A;  4FCY A;  3VUB A;  3CEY A;  5CVI A;  3REA B;  2RMO A;  3HPW A;  3TU4 K;  2EW3 A;  2K5I A;  2RH2 A;  1QVG P;  3JV3 A;  2LDM A;  1KD1 C;  2LJ0 A;  2VV5 A;  3X25 B;  1RI0 A;  3UA6 A;  3CPW A;  1T0J A;  2CP0 A;  3HP9 A;  2A08 A;  3TEE A;  1FMW A;  1VQL T;  4RG8 A;  1RAI B;  2F5K A;  2JZ2 A;  1MND A;  4IUP A;  3FEO A;  1IZ6 A;  5KYU B;  4KT0 E;  4JDS A;  1MMD A;  1SKU B;  4AFZ C;  1YFN A;  1VQO A;  3OYD A;  5EG2 A;  2KXD A;  1WDX A;  2KMT A;  4J9E A;  2RQU A;  2DNU A;  2H8H A;  3X26 B;  2HBP A;  1VQO Q;  4C5G A;  1H8K A;  1QCO A;  1LNX A;  2E65 A;  1M2O A;  3M0R A;  1D0Z A;  2DXC A;  1VA7 A;  5GAN 5;  2K5F A;  3CCE Q;  4F14 A;  1TH7 A;  1E7O A;  3ZEH A;  1BI2 A;  1S72 Q;  4LD6 A;  3A98 A;  4C92 E;  2CS7 A;  5GAN h;  2RN8 A;  3A8H B;  2KT1 A;  1VQN Q;  5DLQ E;  1VQ5 A;  5GMK i;  5CK9 A;  2J05 A;  3L2W A;  1NJI R;  2KSS A;  3OSV A;  1IXD A;  2V8J A;  5FU6 C;  1NBE B;  4OB2 B;  2HMA A;  2IG0 A;  2W10 A;  4AG2 C;  2KBT A;  3FDR A;  4C92 G;  1X01 A;  2EQJ A;  3CCJ Q;  1WXT A;  2A7Y A;  2QG9 B;  3CPF A;  3QDR B;  4MZP A;  1I0C A;  4IUQ A;  4M75 B;  3FRN A;  5LJ5 h;  2FEI A;  5GAO l;  2FYK A;  5KH6 A;  1NPR A;  2YDL A;  2QK0 A;  1BB9 A;  4JRQ A;  2FHD A;  5GAN f;  4HVV A;  3G4S T;  3UF4 A;  3NTK A;  1V1C A;  2R5A A;  3J81 E;  1C6V X;  4M7A D;  3QG1 A;  3CC2 A;  3WXM B;  3TQ7 P;  1N8R U;  1VIF A;  2C06 A;  1G3T A;  2LQK A;  5HKC A;  2ECZ A;  3F70 A;  2P0Q A;  1VQ6 T;  3CBM A;  3PFS A;  5LJ5 f;  3OMC A;  3JCM X;  2RI3 A;  3CC4 A;  1MNE A;  3A5Z B;  3GNG A;  3SWN B;  3L2Q A;  4PJL A;  3QII A;  3OS2 A;  1UHF A;  3M59 A;  3DLL A;  1YJN A;  4J7I A;  2FO0 A;  3CC4 Q;  2RD1 A;  4CC4 B;  1Y71 A;  2HEQ A;  3I55 Q;  4ORZ A;  1M1K U;  1GL5 A;  2EYY A;  3OYJ A;  5CR2 A;  2IVW A;  1HK9 A;  1YHQ T;  4BE2 A;  2DZ9 A;  2L3P A;  1VQ4 Q;  4A54 A;  2HL3 A;  1PM3 A;  1G8X A;  1WHM A;  1YNZ A;  2A28 A;  1G5V A;  2DMO A;  2RHZ A;  5KYN A;  5FLX E;  4E7S A;  4C0G A;  2JMA A;  2YLC A;  1Q82 U;  3CCE T;  1QP3 A;  4BUG A;  1JJ2 P;  1VQ7 T;  4BB7 A;  5KYW A;  3CCQ T;  5GJV B;  3QO3 A;  3E19 A;  1RAF B;  2VGN A;  4M7A E;  1RAD B;  3E9G A;  1VQN T;  2ZPE B;  2HBW A;  1YIT Q;  4B9W A;  5I22 A;  3EHR A;  2DXU A;  3VS6 A;  4E2F B;  3CXC P;  2KQW A;  2CT3 A;  3QHS A;  4M7A G;  2L0A A;  2M9U A;  4XQ3 A;  2F5T X;  4UC4 A;  1JXM A;  2BUD A;  3CCJ T;  3FB9 A;  3MEV A;  2JM9 A;  4FT4 A;  3A1P A;  2EJ9 A;  4OML A;  4J9C A;  2XK0 A;  4C92 F;  3EG3 A;  1I5L A;  2AHJ B;  1M2V A;  3QBY A;  2KI7 A;  4KGV B;  2AT1 B;  1K8A C;  2QA4 Q;  1VQP T;  2R57 A;  4KH1 B;  4F04 B;  3EG9 A;  3MO8 A;  5FRN A;  5C6S A;  4M77 D;  1IO6 A;  2BE9 B;  1WX6 A;  3J7A F;  3EHQ A;  3ASK A;  1RUW A;  5A2Q E;  1ABQ A;  1D1A A;  2HSE B;  3OY9 A;  1QVG S;  3JSC A;  4E7I A;  4F16 A;  1WHK A;  2VWF A;  3BDU A;  4PLI A;  1H3H A;  3RR6 A;  1RAB B;  3OA6 A;  1TS9 A;  1KD1 R;  1M90 R;  3REB B;  3V7R A;  3OMG A;  1W70 A;  1D0Y A;  3TSW A;  4M7D A;  1JEG A;  4OMM A;  2RO0 A;  3QKJ A;  3CCR Q;  1VQM A;  1FMK A;  2HKQ B;  1B3Q A;  1R0B G;  2FPD A;  1G3W A;  3CBP A;  5L23 A;  2CZ0 B;  1O9S A;  2FZK B;  3JB9 D;  1G83 A;  1WXB A;  4N4H A;  2JW4 A;  2KR3 A;  4OVA A;  2GFU A;  1WA7 A;  2NUP A;  2PZ1 A;  2LCS A;  3CCM A;  1W2B S;  2CZ7 B;  2QXF A;  4QVC A;  3BDL A;  2HQX A;  1R0C B;  4C8Q D;  3DKM A;  1UGS B;  1VQ4 T;  1K73 U;  5GAN 4;  4J6X A;  4PJJ A;  4K11 A;  3OYF A;  2RJF A;  2OTL A;  4KBM B;  4M7D C;  1ZX6 A;  1VQ8 T;  2DLP A;  2QEX Q;  5IAY A;  3PIP A;  1BIA A;  1X6O A;  4O6J A;  2KK4 A;  3E2U A;  3OQ5 A;  2OTL Q;  1D3B A;  3THK A;  2EGA A;  5GMK m;  1UJ0 A;  2XKO C;  4FL6 A;  2OTJ A;  2DO3 A;  4RTZ A;  2ROL A;  3M9Q A;  3CCU A;  1QVF A;  4N4I A;  2O4X A;  5HCK A;  3UPU A;  2MOX A;  2BKD N;  1YIT T;  2XD0 A;  4M77 E;  2YUN A;  1ZUU A;  3H6Z A;  4EMK A;  3CCU Q;  5HK3 A;  5CKB A;  4Y92 A;  1GXI E;  2CSI A;  3GLX A;  3OYM A;  2AKK A;  1WI7 A;  2DRM A;  5A0L A;  2NYS A;  4M77 G;  3O5Z A;  4FYW B;  1UDL A;  2A0F B;  3IQL A;  1AWW A;  2LJ1 A;  4F7U E;  2ZGW A;  2PVD B;  2ZPB B;  3VS1 A;  4M7A F;  2YLB A;  4M75 F;  5IHK A;  3JCM W;  3C4S A;  2K7A A;  2SEM A;  2HCK A;  2HDA A;  4EMK C;  2CP6 A;  2MCN A;  1KHC A;  5KYX A;  1OZ3 A;  4F7U G;  1WIE A;  2YWW A;  2JS2 A;  4RTX A;  2KRO A;  4C5H A;  4KGX B;  2K57 A;  2LX9 A;  4XTX A;  1Q81 U;  2FG0 A;  5GAN 8;  1UB4 A;  2A36 A;  5GAO r;  3CCV Q;  3JB9 G;  2RJE A;  1G2B A;  4XK8 E;  2DL7 A;  2V8K A;  2GF7 A;  4D8K A;  5J26 A;  3LW5 E;  4EPC A;  2DKG A;  3VS2 A;  1NJI C;  2KE9 A;  3PGG A;  1K9M R;  1YCY A;  2EKH A;  1PSE A;  3JCM P;  1YJ9 A;  3CCR T;  4KUL A;  4RTU A;  2X3X D;  2BZ8 A;  2JJ9 A;  4LN2 A;  2NLU A;  4JZ3 A;  2CSQ A;  2F69 A;  2KAF A;  2YT6 A;  2DTH A;  2GFA A;  3Q1J A;  4AMC A;  1Z9Q A;  2C0I A;  2ED1 A;  4M78 B;  5FWC A;  1IHV A;  5GJW B;  2IIM A;  3CPW P;  1WHG A;  1NG2 A;  3JCM c;  4J8O A;  3E9F A;  2E6N A;  2GCX A;  1M2V B;  3R6N A;  3CD6 A;  2PU9 B;  2CZ1 B;  2MPX C;  2JTE A;  2LQ8 A;  2HSP A;  3M58 A;  2QEX T;  1JJ2 S;  2LRQ A;  3J80 E;  1ACM B;  2BE7 D;  3I5S A;  3OYL A;  1Q7Y C;  4A53 A;  2GTO A;  2W0Z A;  2QI2 A;  2K2M A;  3KBG A;  5L8R E;  3M54 A;  4OMO A;  1WXU A;  1Q86 U;  2HAX A;  3CXC S;  4IKF A;  2KRS A;  2I2L A;  1KJW A;  2OJ2 A;  4XTV A;  2O01 E;  1PRL C;  4D6W A;  2DBK A;  3ZFJ A;  4M7D B;  2CKK A;  3DB4 A;  1KC8 R;  2CP5 A;  1QP2 A;  1VQK Q;  2OI3 A;  2ATC B;  5CO7 A;  4LD9 K;  2FPF A;  1KQ1 A;  2X4Y A;  4GBQ A;  4LDX A;  4FSX A;  4FSS A;  3OYC A;  2VXF A;  1IGQ A;  3U23 A;  1N8R R;  2Y90 A;  2EGE A;  3G71 Q;  4QQG A;  4RMO A;  4KRT A;  3HHT B;  2EFI A;  2JOY A;  3RKX A;  1VQ9 A;  4KH0 B;  3SHW A;  3CC7 A;  1YJW T;  1OV3 A;  5DM7 R;  3EH2 A;  3CCV T;  1OOT A;  3QYH B;  4E7H A;  1YIJ Q;  2DE0 X;  3SWN A;  4D8D A;  5GAM h;  1M3A A;  3CC7 Q;  1QLY A;  3X24 B;  2WAC A;  3LH0 A;  2FRW A;  3EG2 A;  4MDW A;  4C0D C;  4XU3 A;  1UGR B;  3VKI A;  4MZM A;  4WCI A;  1RAG B;  1WNL A;  3FJP A;  2VB6 A;  1X75 C;  2QDL A;  5D6X A;  5HY6 A;  3N5B B;  2YXY A;  3NHN A;  2LNV A;  4JUV A;  3G6E A;  3I5R A;  3SWN C;  3MP1 A;  3AT1 B;  3LX7 A;  4QKU A;  1O75 A;  2KGT A;  2QQR A;  3P8B B;  2E5K A;  5GAM f;  1OU9 A;  2DRK A;  1ARK A;  1UG1 A;  1NE8 A;  2GQV A;  4Z88 A;  3ZL7 C;  1ZA1 B;  1X2K A;  3SDZ A;  3S3M A;  4LUD A;  3V7S A;  1J3T A;  4RTT A;  1PD1 A;  1SRL A;  2DZC A;  2K5L A;  2DL3 A;  3M57 A;  1CKB A;  3HRU A;  4JLI A;  3JCM Q;  4PJO D;  1B34 B;  3D7S B;  1M90 C;  5HK0 A;  2JT4 A;  3A8L B;  3SB2 A;  3HFO A;  3INZ A;  2K9G A;  3QPH A;  3QJY A;  1QKW A;  5A0G A;  2NWM A;  2ED0 A;  2Y4Y A;  1VQK T;  1MUZ A;  1VYU A;  2K2V A;  2RJD A;  2KEA A;  2LQW A;  1QWF A;  1NYF A;  2VXE A;  1BI0 A;  3OS1 A;  2ZPH B;  2B8A A;  2DIG A;  3M0Q A;  3TSZ A;  3G71 T;  4YTL A;  2FVU A;  2ENM A;  2F2V A;  4FYX B;  1NLP C;  3OYN A;  3KUF A;  2QTX A;  4DOV A;  4PKC C;  2GNC A;  3M0T A;  2DAQ A;  1RAA B;  3PMT A;  4BE1 A;  3DLM A;  3NPF A;  3NTH A;  3OSS C;  1WYX A;  2L3R A;  5LJ3 h;  1YIJ T;  2AKL A;  4ESR A;  3AHU A;  1I4K 1;  2EPD A;  2ZZD A;  1H3Z A;  8ATC B;  1IB8 A;  1X6G A;  2LVM A;  5GAN 7;  4OMQ A;  5I2M A;  1M27 C;  2LP5 A;  1VQ5 Q;  2MMP A;  5GAO q;  4TVR A;  4IUT A;  4A4E A;  1OQK A;  3CPW S;  2E64 A;  2COZ A;  4PJO E;  2DXB A;  3L1A A;  1W1F A;  2GGR A;  3EH1 A;  4XU0 A;  3I56 A;  4C8Q A;  3NGP A;  5LJ3 f;  4OP0 A;  2J6K A;  2EJG A;  2V1Q A;  4PJO G;  4M75 D;  3JCM J;  3PNW C;  4JLG A;  2EQM A;  4WF2 A;  2VGM A;  4J9D A;  2EAY A;  2MWP A;  4C0D B;  1Q7Y R;  1NPP A;  2D9T A;  1VQP A;  3RKW A;  1QCF A;  1Z9Z A;  5D7U A;  5IN1 A;  5I21 A;  3L2R A;  3CC2 Q;  2GBQ A;  2KY9 A;  1RAC B;  2CGH A;  3V8L A;  1K8A U;  3FIF A;  4C8Q C;  1RAH B;  1AWX A;  2YSQ A;  1M9S A;  1PG5 B;  1UEC A;  3RIR A;  2XG8 D;  3OW2 P;  1RAE B;  1JRI A;  3NMZ C;  3MPU B;  1K9M C;  2JS0 A;  2M0O A;  2E1H A;  3FC3 A;  5FRM A;  5IHN A;  3L2Z A;  4X1V A;  4L5G A;  1QVF P;  1OPK A;  3CCL A;  1BIB A;  2M51 A;  1KIK A;  1YJN Q;  3M53 A;  3UDC A;  3H0F A;  2E70 A;  2C0T A;  2DTI A;  2PUO B;  3JCM d;  1P92 A;  2D0N A;  4KUI A;  4MMK A;  1QVP A;  1U5S A;  2JMC A;  2CP7 A;  1EFN A;  5GAN j;  1VQO T;  4RKU E;  5FWB A;  1LJO A;  1VQ8 A;  4JJD A;  4Z89 A;  3QUI A;  4NL3 A;  2DM1 A;  4PNO A;  1MMA A;  1S72 T;  4QT7 A;  3EFO B;  1SPK A;  4M75 E;  3X28 B;  2HQH A;  2ROT A;  2DK3 A;  2L8D A;  4E7L A;  3JCM g;  4JJB A;  5LJ5 j;  3M0U A;  1Y96 B;  4BI8 B;  1EZZ B;  2RHX A;  3MJX A;  1ZUY A;  3P8D A;  4M75 G;  1VQ5 T;  3OYK A;  4DA4 A;  1XNI A;  3TCJ A;  1KC8 C;  5KCO A;  4M78 A;  2RM4 A;  1OU8 A;  1XQH A;  2YRC A;  1TUD A;  4ME7 A;  3VS3 A;  2XIC A;  1OX9 A;  4PFZ A;  4ELZ C;  3FJ5 A;  1MHN A;  1NLO C;  3VRY A;  3CCS A;  2D8H A;  2ZAE A;  3RDV A;  1N8R C;  2R58 A;  4PJN A;  3L2U A;  4OB1 B;  1IRE B;  2KRM A;  2WSC E;  4M78 C;  3MEA A;  2RQW A;  4M77 B;  8AT1 B;  5GAN 6;  1NZ9 A;  3CCS Q;  2LTO A;  3OYH A;  4PJO F;  3CC2 T;  3M56 A;  4P5N A;  1GCQ A;  2LT4 A;  4HCB A;  2H3E B;  3QXE B;  4CC3 A;  1U8R A;  5GAO p;  2AK5 A;  1B7T A;  3KFV A;  5CQX A;  3BE3 A;  4C0F A;  3VRZ A;  2BZY A;  3H9N A;  1YI2 A;  1G3S A;  4HT9 A;  1BKB A;  2DTO A;  2E41 A;  2HNI A;  2YUO A;  1AVZ C;  1M3B A;  3CC4 T;  1B07 A;  1JQQ A;  2LT1 A;  3RNJ A;  5GAO n;  1BI1 A;  1SHG A;  1AEY A;  3I55 T;  2B86 A;  3G1J A;  4HVU A;  2O9S A;  1VQM Q;  1TUG B;  1YJN T;  1GCQ C;  1ZSG A;  2GTJ A;  2CP3 A;  3E1S A;  3CME A;  2DJZ A;  2LCC A;  3VJP A;  2KDS A;  4X34 A;  2LC4 A;  4C8Q B;  3ME9 A;  4XTY A;  3GF5 A;  4E47 A;  3CCM Q;  3CME Q;  1X6B A;  3UA7 A;  4RTY A;  2P4R A;  4FYY B;  3OW2 A;  5I11 A;  3WVD B;  2CUD A;  1U3O A;  5D6W A;  3RBB B;  2X51 A;  2NUT A;  4A4H A;  2K3Y A;  2J6O A;  5GAN d;  2O88 A;  2OTJ Q;  3RMQ A;  2J7I A;  5CIU A;  1PC0 A;  2EYW A;  2VYT A;  3T9N A;  4B9X A;  1I81 A;  5CAI A;  2QQB A;  5LJ5 d;  3OYE A;  2KXC A;  1TU0 B;  1UHC A;  5DY9 A;  1GCP A;  2E10 A;  3M0S A;  3VV0 A;  2JM8 A;  2XDP A;  4C92 A;  2XDB A;  2ZPI B;  1WJR A;  3VU3 C;  1ZBX A;  1UEB A;  4ZN1 A;  2QA4 T;  3BFM A;  2C0O A;  5GMK e;  3OS0 A;  4DOW A;  4A4F A;  2YUP A;  3WVE B;  4J83 A;  3OW2 S;  2EYQ A;  1VIE A;  4RTW A;  1B34 A;  1YJW A;  3EG0 A;  4EMG A;  2COY A;  1BK2 A;  5LJ5 g;  1WHL A;  2DD5 A;  1UTI A;  4C92 C;  4II1 A;  3LWI A;  3V8K A;  1QVF S;  1FMV A;  1ZLM A;  4DEY A;  3HRS A;  3CMA A;  1H64 1;  3JCM V;  1XOV A;  4ZTF A;  4VUB A;  1YJ9 Q;  2K4Y A;  1RI9 A;  1VQM T;  4E7K A;  2QGG A;  1QW1 A;  4EMH A;  3OBW A;  1K73 C;  4QVZ A;  4OF1 A;  2F2X A;  3JCM e;  2Y4X A;  1N9S A;  1ZSZ B;  3M0P A;  2P84 A;  1EX4 A;  4LDY A;  3CCM T;  3P8H A;  1LCK A;  5FW9 A;  3EGU A;  4A4G A;  3TRE A;  2A37 A;  5IXF A;  2EBP A;  3CD6 Q;  3PTA A;  1YN8 A;  2RF0 A;  2OTL T;  4DBH A;  3QWY A;  3OYY A;  1TWB A;  3QZ9 B;  2E12 A;  4HCC A;  1YWP A;  1QMC A;  2I0N A;  3LLR A;  2OX7 A;  3EFR A;  1PRM C;  4LNP A;  1BBZ A;  2RI2 A;  2K3B A;  1MGQ A;  3MP6 A;  3SD4 A;  1WHH A;  2CYZ B;  3CCU T;  2EQI A;  4EIK A;  1R8O B;  3M4G A;  2L3Q A;  2ABL A;  1UJY A;  2MK5 A;  2QQA A;  4HKE A;  1VQL A;  2DD4 A;  3MP8 A;  3VS0 A;  1HSQ A;  3QDF A;  3M55 A;  1KD1 U;  1K0X A;  3MHX A;  2V26 A;  4BI4 A;  3NTI A;  1TOV A;  2FZC B;  1KHI A;  1V76 A;  2QTV A;  5J39 A;  2VKN A;  1VOM A;  2JN0 A;  4M7A A;  2PNI A;  1OUL A;  4Y28 E;  4JRP A;  3VS5 A;  1M1G A;  4PK4 A;  2QQ9 A;  2DF6 A;  3S3O A;  5CKD A;  1LPL A;  1KQS A;  2D1X A;  2DVJ A;  5KCH A;  1TTH B;  2DET A;  2XID A;  1KQ2 A;  2KRN A;  2JNG A;  3H8Z A;  2O9V A;  1F1B B;  2ZPF B;  4JS4 A;  1D1C A;  1JXO A;  2NUT B;  4BY6 B;  1T3L A;  1VQ9 Q;  4M7A C;  4ZGJ B;  1WJQ A;  1QQJ A;  1M1K R;  2VVK A;  4J9B A;  3EGX B;  2HD0 A;  3O8V A;  1GRI A;  5CKH A;  1YJ9 T;  1U06 A;  4PFO A;  4JRI A;  4A4K A;  1GFC A;  5IXB A;  2HZY A;  3G6E Q;  3G4S A;  1QCN A;  4C92 B;  1ZBJ A;  4BDY A;  1UGP B;  2AIR B;  1M5Q 1;  1Q82 R;  2D0Q B;  3MKD A;  4M7D E;  4XTW A;  3G4S Q;  4N4G A;  1X27 A;  3EFO A;  3RUX A;  4FT2 A;  4F17 A;  3GOX A;  4RTV A;  5IHI A;  2MF2 A;  2RK1 A;  1K0S A;  3UT1 A;  1A0N B;  1D0X A;  1T0H A;  5EC7 A;  4L59 A;  4AG1 C;  2EVR A;  2L3S A;  1VQ6 A;  1Y96 A;  4CC2 A;  1JB0 E;  2MYS A;  3VUZ A;  4ZTJ A;  4AFU C;  1UUE A;  4HCK A;  3HFN A;  3CQT A;  2RJC A;  2A3L A;  3PVL A;  3LGL A;  2BZX A;  4AFS C;  4IIM A;  4RCC A;  1BCO A;  4XTU A;  1FXX A;  3JRZ A;  1W6X A;  3BY7 A;  1T3S A;  2MWO A;  1FX7 A;  4J5Y A;  2P0P A;  1C0M A;  3S3N A;  3MCA B;  2KVQ G;  3HTR A;  5M9O A;  2V8I A;  4LDW A;  1K9M U;  3PMI A;  1YWO A;  3QWX X;  5LJ5 e;  1YHQ A;  1K1Z A;  1AWO A;  1TSF A;  2M0Y A;  1S1N A;  4IUV A;  1NEG A;  2PQW A;  4R56 A;  2G6F X;  5I2S A;  4PJM A;  3URG A;  5GAM j;  4M77 A;  1YHQ Q;  2DL8 A;  4FW1 A;  1SHF A;  1UGV A;  2HQE A;  2DIQ A;  4XU1 A;  1U1S A;  1ABO A;  1LOJ A;  2CZ6 B;  3UWN A;  3CCE A;  4OB3 B;  4XTZ A;  1W2B P;  1VQ7 A;  4NL2 A;  2LX7 A;  1S72 A;  3CCQ A;  1VQ9 T;  4EDU A;  4F7U A;  3CC7 T;  4OGC A;  1VQN A;  4OGE A;  1ZUK A;  4QQ6 A;  1GFD A;  1AOJ A;  3LH5 A;  1VQ7 Q;  2KYB A;  4M77 C;  3CCQ Q;  4HXJ A;  4BE0 A;  4E6R A;  2PVO B;  1AHJ B;  3I9Q A;  1UE9 A;  6AT1 B;  3RER A;  3CCJ A;  1QWE A;  5KE3 A;  2RHU A;  1MV0 B;  4LXC A;  1K73 R;  1W4S A;  1RLP C;  4M78 F;  2RA2 A;  2QAS A;  3OYB A;  2E3H A;  2KYM A;  3G6E T;  1KC8 U;  3I56 Q;  4M7A B;  2E6Z A;  4OMP A;  4FYV B;  4ELY C;  1WLP B;  2YUQ A;  3H41 A;  4N0A A;  2X4X A; 
#chains in the Genus database with same CATH homology
 4C8Q F;  5CQX A;  2NLU A;  4C0F A;  5J3B A;  4L6V 5;  1BYM A;  4HCZ A;  2F69 A;  1YI2 A;  2KAF A;  4E7J A;  3CD6 T;  1G3S A;  4R55 A;  4HT9 A;  1BKB A;  2DTO A;  2DTH A;  2DEQ A;  2E41 A;  2GFA A;  2HNI A;  3Q1J A;  1Q86 C;  2E5Q A;  4M78 B;  3CC4 T;  1KQS S;  3GPL A;  2LT1 A;  5GAO n;  2BIV A;  1BI1 A;  4C92 D;  3JB9 I;  3GNF B;  1M8V A;  3I55 T;  4NS5 A;  3QJ6 A;  3JCM c;  4J8O A;  3E9F A;  3CCR T;  4HT8 A;  2E6N A;  2GCX A;  1YJN T;  4M7D G;  2WSF E;  4PJO B;  5GAN e;  3CD6 A;  4MZT A;  4N0A C;  3E1S A;  3CME A;  2PU9 B;  2CZ1 B;  2DJZ A;  4BAC A;  4GY5 A;  5LJ3 e;  2LCC A;  2LQ8 A;  2EIF A;  3VJP A;  3M58 A;  2QEX T;  4M7D F;  1G3Y A;  2KDS A;  4X34 A;  1JJ2 S;  2LRQ A;  1N9R A;  2LC4 A;  3QZ5 B;  4C8Q B;  3A8G B;  3ME9 A;  4XTY A;  3GF5 A;  3VUB A;  4E47 A;  3J80 E;  3CEY A;  5CVI A;  3I55 A;  3HPW A;  5FU7 C;  4A53 A;  3OYL A;  3TU4 K;  1Q7Y C;  2QI2 A;  3KBG A;  5L8R E;  2K5I A;  3M54 A;  4JJN K;  1WQ7 A;  2RH2 A;  4BD3 A;  1Q86 U;  2LDM A;  2K3X A;  1KD1 C;  3OW2 A;  2VV5 A;  3X25 B;  1RI0 A;  5KE2 A;  2HAX A;  3G7Z A;  2EKO A;  3WVD B;  4C5E A;  3CPW A;  1VQ4 A;  3HP9 A;  3CXC S;  5LJ3 j;  3TEE A;  5D6W A;  2MAM A;  1VQL T;  4RG8 A;  4IKF A;  2F5K A;  3C95 A;  2I2L A;  4A4H A;  5CCA A;  2JZ2 A;  2O01 E;  4XTV A;  4D6W A;  4IUP A;  5GMK l;  4J6Y A;  2K3Y A;  5GAN d;  4ATO A;  3ZFJ A;  4M7D B;  3FEO A;  2PUK B;  1IZ6 A;  4KT0 E;  2CKK A;  3DB4 A;  4JDS A;  2EWN A;  3RMQ A;  1VQO A;  3OYD A;  5EG2 A;  5CIU A;  1QP2 A;  2KMT A;  5CO7 A;  2RB6 A;  1SSF A;  4LD9 K;  1QVG A;  1KQ1 A;  2X4Y A;  2XI9 A;  4NOY A;  3VYH B;  5GAM d;  3JB9 J;  3X26 B;  2VYT A;  3T9N A;  2HBP A;  4C5G A;  1LNX A;  1YIT A;  4B9X A;  1I81 A;  1OI1 A;  1XTD A;  2E65 A;  4LDX A;  3R6O A;  5CAI A;  4FSX A;  2QQB A;  2DVE A;  2DXC A;  5GAO p;  1I8F A;  5LJ5 d;  5GAN 5;  2K5F A;  3OYC A;  2VXF A;  3OYE A;  1TH7 A;  3ZEH A;  5DY9 A;  3HSB A;  2Y90 A;  4FIB A;  1BI2 A;  1WGS A;  2E10 A;  4QQG A;  3VV0 A;  4MDX A;  4RMO A;  2XDP A;  4LD6 A;  4C92 A;  4C92 E;  2CS7 A;  5GAN h;  2XDB A;  3A8H B;  3HHT B;  2EFI A;  2JOY A;  2ZPI B;  1EIF A;  3RKX A;  1WJR A;  3PT9 A;  5DLQ E;  1ZBX A;  4Z02 A;  3HKS A;  1UEB A;  3VU3 C;  2H3J A;  5CK9 A;  4ZN1 A;  5GMK i;  1VQ9 A;  3CC7 A;  1YJW T;  2P4T A;  1FWZ A;  3BFM A;  2QA4 T;  3L2W A;  4FM4 B;  5DM7 R;  2KSS A;  4Y91 A;  3OSV A;  3CCV T;  2V8J A;  5FU6 C;  3QYH B;  5GMK e;  3OS0 A;  4OB2 B;  4E7H A;  4DOW A;  2IG0 A;  4RG2 A;  3SWN A;  4A4F A;  1W2B A;  4J6W A;  5GAM h;  5GAM g;  2JTF A;  3FDR A;  5C0M A;  5GAO m;  3I56 T;  4C92 G;  3WVE B;  3QSU A;  4J83 A;  3OW2 S;  4DQ2 A;  1X01 A;  2EQJ A;  2QDY B;  2EYQ A;  4JS5 A;  3X24 B;  1VIE A;  2WAC A;  3LH0 A;  2A7Y A;  5GAN 2;  4MDW A;  1B34 A;  3CPF A;  4C0D C;  3QDR B;  4MZP A;  4M75 B;  4IUQ A;  1BI3 A;  2QA4 A;  4EMG A;  4XU3 A;  1YJW A;  3FRN A;  5LJ5 h;  5LJ5 g;  1UGR B;  5GAO l;  2RK2 A;  2DD5 A;  3VKI A;  4C92 C;  2FYK A;  4MZM A;  4II1 A;  3LWI A;  3V8K A;  1QVF S;  4Q5W A;  5KH6 A;  1NPR A;  1WNL A;  3FJP A;  3HRS A;  1X75 C;  2FHD A;  5GAN f;  3G4S T;  5D6X A;  4JRQ A;  5FU6 B;  1JBM A;  5HY6 A;  4V2S A;  3CMA A;  3N5B B;  3NTK A;  2LNV A;  1H64 1;  4JUV A;  2R5A A;  3G6E A;  3J81 E;  3JCM V;  3SWN C;  1WQW A;  1XOV A;  4M7A D;  3QG1 A;  4F7U B;  3MP1 A;  4ZTF A;  4VUB A;  3CC2 A;  3WXM B;  2K4Y A;  3LX7 A;  4X9C A;  1N8R U;  3V8J A;  3BW1 A;  1O75 A;  1VQM T;  2QQR A;  3ER0 A;  1VIF A;  3P8B B;  5GAM f;  4E7K A;  5CKE A;  2C06 A;  1G3T A;  3CCR A;  1M1K C;  1QW1 A;  3L2V A;  4EMH A;  3OBW A;  2LQK A;  5HKC A;  2JTM A;  4QVZ A;  2ZPG B;  1Y07 A;  3F70 A;  1K73 C;  4OF1 A;  1NE8 A;  2GQV A;  3EAE A;  3JCM e;  2P0Q A;  2Y4X A;  1VQ6 T;  1N9S A;  1WJS A;  3CBM A;  2DXT A;  2LCL A;  3DB3 A;  3PFS A;  3SDZ A;  3S3M A;  5LJ5 f;  3JCM b;  1NJI U;  3OMC A;  4LDY A;  3L42 A;  2RHY A;  3V7S A;  3CCM T;  4IUU A;  3P8H A;  2P0K A;  3JCM X;  2RI3 A;  3CC4 A;  3CCL T;  3A5Z B;  3GNG A;  3SWN B;  4A4G A;  2DZC A;  3GIB A;  3TRE A;  4XAX B;  3L2Q A;  2K5L A;  3QII A;  3M57 A;  3OS2 A;  3PTA A;  2OTL T;  3M59 A;  3RES A;  3PIO A;  3DLL A;  3HRU A;  1YJN A;  4JLI A;  3JCM Q;  4PJO D;  4J7I A;  1B34 B;  3OYY A;  1N27 A;  2RD1 A;  4PL6 A;  1Y71 A;  1M90 C;  5HK0 A;  3QZ9 B;  3A8L B;  1Q82 C;  1VUB A;  2E12 A;  3SB2 A;  2QEX A;  4HCC A;  3HFO A;  1M1K U;  3INZ A;  3QPH A;  3QYG B;  4J7F A;  4BI3 A;  3LLR A;  3OYJ A;  3NFC A;  3QJY A;  3EFR A;  5CR2 A;  2IVW A;  1HK9 A;  5A0G A;  4LDV A;  1YHQ T;  2Y4Y A;  2RI2 A;  4C5I A;  1MGQ A;  3MP6 A;  4BE2 A;  1RL2 A;  2DZ9 A;  2DPP B;  2CYZ B;  2YHT A;  3SD4 A;  3CCU T;  4A54 A;  1VQK T;  5FU7 B;  5LJ3 d;  1R8O B;  3M4G A;  2K2V A;  2RJD A;  3OYA A;  1G5V A;  1Q7Y U;  2QQA A;  4HKE A;  1VQL A;  2RHZ A;  2DD4 A;  3MP8 A;  1YBY A;  5FLX E;  3M55 A;  4C0G A;  1KD1 U;  2YLC A;  4QW2 A;  2VXE A;  1BI0 A;  3OS1 A;  1Q82 U;  4O5V A;  3CCE T;  2ZPH B;  3MHX A;  1QP3 A;  2B8A A;  2DIG A;  3MEW A;  3NTI A;  4BI4 A;  1KHI A;  4BUG A;  1VQ7 T;  4BB7 A;  5J39 A;  4BY6 C;  3CCQ T;  3G71 T;  3QO3 A;  2JN0 A;  3E19 A;  2VGN A;  4M7A A;  4M7A E;  4YTL A;  2FB7 A;  2FVU A;  1VQN T;  3E9G A;  4Y28 E;  2ZPE B;  3OYN A;  4JRP A;  3KUF A;  2QTX A;  1M1G A;  2QQ9 A;  4PKC C;  4B9W A;  3PMT A;  2DAQ A;  4DOV A;  3S3O A;  5CKD A;  4BE1 A;  3DLM A;  3NTH A;  5GAN g;  1KQS A;  5GAN 3;  3OSS C;  4PLL A;  2DXU A;  5KCH A;  2L3R A;  5LJ3 h;  5LJ3 g;  1YIJ T;  2XID A;  1KQ2 A;  3A8M B;  3AHU A;  1I4K 1;  2JNG A;  2ZZD A;  2KQW A;  3H8Z A;  1H3Z A;  3QHS A;  4M7A G;  3LGF A;  2M9U A;  4XQ3 A;  2F5T X;  2LVM A;  2RI5 A;  2ZPF B;  4UC4 A;  5GAN 7;  2BUD A;  2XHC A;  3CCJ T;  4JS4 A;  3FB9 A;  5I2M A;  4KUD K;  3MEV A;  3JB9 H;  4BY6 B;  4HA8 A;  2MMP A;  3CCS T;  4FT4 A;  1JJ2 A;  2EJ9 A;  2X35 A;  5GAO q;  4TVR A;  4M7A C;  4IUT A;  4A4E A;  3CPW S;  4RCB A;  2XK0 A;  2E64 A;  4C92 F;  4ZGJ B;  2XU8 A;  3M5A A;  1WJQ A;  4PJO A;  2DXB A;  1I5L A;  2AHJ B;  3L1A A;  3QBY A;  4PJO E;  3CCV A;  4ZGE B;  1K8A C;  1VQ5 A;  3LWH A;  2L5Q A;  4XU0 A;  2HD0 A;  3I56 A;  4C8Q A;  4C8Q E;  3O8V A;  4CRI A;  1VQP T;  3HL8 A;  2R57 A;  5CKH A;  3CXC A;  1YJ9 T;  5LJ3 f;  4OP0 A;  3MO8 A;  5FRN A;  5C6S A;  4M77 D;  2EJG A;  4M7D C;  4BDZ A;  4PJO G;  4M75 D;  1OYX A;  3JCM J;  3PNW C;  3J7A F;  3ASK A;  1YI2 T;  4JLG A;  5A2Q E;  2EQM A;  3C12 A;  4JRI A;  4WF2 A;  4A4K A;  3OY9 A;  2VGM A;  3JSC A;  4E7I A;  1QVG S;  2EAY A;  2MWP A;  4C0D B;  3BDU A;  4FU6 A;  4PLI A;  4C8Q G;  1NPP A;  2XDD A;  2X4J A;  4IUR A;  4ZN3 A;  3G4S A;  2D9T A;  1V29 B;  4PJO C;  3OBY A;  3OA6 A;  4OMF B;  3RKW A;  4C92 B;  3L2R A;  5IN1 A;  5I21 A;  4BDY A;  1VQP A;  4QQD A;  5CQY A;  3GP8 A;  3EFS A;  1UGP B;  2KY9 A;  3V7C A;  1M5Q 1;  2CGH A;  3A8O B;  3V7R A;  3OYG A;  2D0Q B;  3OMG A;  3V8L A;  1K8A U;  4M7D A;  4M7D E;  3FIF A;  4C8Q C;  2RO0 A;  3QKJ A;  2D6F A;  4XTW A;  3CME T;  4M78 D;  4N4G A;  3RUX A;  3FLG A;  1VQM A;  1M9S A;  3RKY A;  4FT2 A;  3GOX A;  3RIR A;  2XG8 D;  3ZBD A;  1G3W A;  3CBP A;  2MF2 A;  2RK1 A;  5FRO A;  1JRI A;  3VYG A;  2CZ0 B;  3UT1 A;  1O9S A;  3MEU A;  2EQU A;  3JB9 D;  5D6Y A;  1K9M C;  4L59 A;  2VC8 A;  2M0O A;  2E1H A;  4N4H A;  3FC3 A;  1VQ6 A;  1Y96 A;  4OVA A;  5FRM A;  3SFM A;  2GFU A;  1JB0 E;  4ZTJ A;  3VUZ A;  3L2Z A;  3CCM A;  4L5G A;  5GMK h;  1W2B S;  2CZ7 B;  2QXF A;  3CCL A;  1BIB A;  3HFN A;  3BDL A;  4QVC A;  1PSF A;  2HQX A;  2QQS A;  4C8Q D;  3DKM A;  3OB9 A;  1UGS B;  3CBO A;  1VQ4 T;  2RJC A;  3M53 A;  3UDC A;  2A3L A;  5GAN 4;  1K73 U;  2OTJ T;  3LGL A;  4J6X A;  2OTL A;  1ZHI A;  2E70 A;  2L89 A;  2RJF A;  4KBM B;  4RCC A;  4CI0 C;  2DTI A;  3OYF A;  4XTU A;  1FXX A;  3JRZ A;  2PUO B;  3JCM d;  5LL6 S;  1VQ8 T;  5IAY A;  1P92 A;  3BY7 A;  5AYF A;  4KUI A;  3C94 A;  2MWO A;  3X20 B;  5GAM e;  3PIP A;  1BIA A;  4MMK A;  1FX7 A;  1X6O A;  1HXD A;  4J5Y A;  4O6J A;  2KK4 A;  2P0P A;  3OQ5 A;  1QVP A;  1Y7X A;  3S3N A;  1D3B A;  3MCA B;  2KVQ G;  5M9O A;  5GMK m;  5GAN j;  4GLK A;  1VQO T;  2XKO C;  2V8I A;  4FL6 A;  4LDW A;  4RKU E;  1K9M U;  3PMI A;  5LJ5 e;  2OTJ A;  1YHQ A;  1LJO A;  2DO3 A;  3M4Y A;  1OZ2 A;  2VUB A;  1M90 U;  2RHI A;  3M9Q A;  1VQ8 A;  1UGQ B;  3CCU A;  1U1T A;  1QVF A;  4IUV A;  4M7D D;  1VQK A;  2WSE E;  2PQW A;  3QUI A;  4N4I A;  2O4X A;  4R56 A;  3UPU A;  5A0D A;  5I2S A;  4NL3 A;  4PNO A;  2BKD N;  3URG A;  5GAM j;  1YIT T;  3LYI A;  1S72 T;  4M77 A;  4M77 E;  2M1H A;  2XD0 A;  2EJF A;  2ZCF B;  4M75 A;  4M75 E;  4EMK A;  3H6Z A;  5DLO A;  1M1F A;  3X28 B;  2HQE A;  2DIQ A;  4C0Z A;  5HK3 A;  2DK3 A;  4XU1 A;  5CKB A;  2L8D A;  1U1S A;  1GXI E;  3GLX A;  4E7L A;  2JVV A;  1LOJ A;  3JCM h;  3JCM g;  5LJ5 j;  2CZ6 B;  3OYM A;  4XU2 A;  1Q81 C;  1Y96 B;  1DJ7 B;  2OAU A;  3UWN A;  4BI8 B;  3CCE A;  5A0L A;  4OB3 B;  4XTZ A;  1VQ7 A;  3S6W A;  4NL2 A;  2RHX A;  4M77 G;  2FL7 A;  1S72 A;  3CCQ A;  1KG1 A;  3P8D A;  4ZGD B;  3G71 A;  4M75 G;  1VQ9 T;  1VQ5 T;  4EDU A;  3OYK A;  4F7U A;  4F7U E;  1XNI A;  4DA4 A;  2M16 A;  2ZGW A;  5IT9 E;  1ZQ1 A;  3CC7 T;  3TCJ A;  4OGC A;  1VQN A;  4M77 F;  1KC8 C;  4OGE A;  2JUF A;  1WPY A;  2MI6 A;  2PVD B;  2ZPB B;  5KCO A;  4M7A F;  2YLB A;  4M75 F;  4M78 E;  4M78 A;  2YRV A;  4QQ6 A;  2RM4 A;  3C4S A;  4QVD A;  3JCM W;  1XQH A;  4M77 C;  3MET A;  3KXT A;  4M75 C;  3HRT A;  4BE0 A;  4MML A;  4ME7 A;  2G3R A;  4EMK C;  1YIJ A;  3JAM E;  2PVO B;  2XIC A;  1AHJ B;  2PVG B;  5CKF A;  2EQK A;  4OB0 B;  1KHC A;  1OZ3 A;  4ELZ C;  4F7U G;  1D3B B;  3RMS A;  3RER A;  4LDU A;  3CCJ A;  1MHN A;  3OS5 A;  4C5H A;  5KE3 A;  2RHU A;  4M78 G;  2K57 A;  2LX9 A;  4XTX A;  4F7U F;  1Q81 U;  3JCM f;  5GAN 8;  3CCS A;  1UB4 A;  1W4S A;  4M78 F;  1N8R C;  5GAO r;  3JB9 G;  2R58 A;  2RJE A;  2O4X B;  2RA2 A;  4X9D A;  4OB1 B;  4XK8 E;  3L2U A;  3CMA T;  1IRE B;  2WSC E;  3OYB A;  4M78 C;  3G6E T;  3MEA A;  4M77 B;  1N6A A;  3OYI A;  1KC8 U;  2V8K A;  5GAN 6;  2GF7 A;  1NZ9 A;  2X4W A;  4M7A B;  3JB9 F;  2LTO A;  2E6Z A;  3OYH A;  1M4Z A;  4PJO F;  5J26 A;  4EMK B;  3CC2 T;  3LW5 E;  4EPC A;  3M56 A;  2DKG A;  4ELY C;  4P5N A;  1NJI C;  2LT4 A;  3PGG A;  4JRK A;  2R5M A;  4N0A A;  4HCB A;  1YCY A;  3QXE B;  1PSE A;  5GMK j;  3JCM P;  1YJ9 A;  2X4X A;  1U8R A;  4KUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...