2VXFA

Solution structure of the lsm-domain of zebrafish rap55
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
88
structure length
88
Chain Sequence
LEDPSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCEPPKPIM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Similar modes of interaction enable Trailer Hitch and EDC3 to associate with DCP1 and Me31B in distinct protein complexes.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transcription
molecule keywords LSM14A PROTEIN
total genus 10
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vxfA00
4XTZA 3SWNC 3FIFA 3JCMJ 4M78A 2K57A 2DVEA 4X9CA 4M75D 5LJ3h 5LJ5g 4EMKC 5GANf 5GAN4 2EWNA 1WPYA 4C8QA 3JB9I 4M7DB 1KQ2A 2DEQA 2EJGA 3V8LA 2E1HA 5LJ3e 4NOYA 4PJOA 1U1SA 3EFSA 2DZ9A 3L1AA 4HA8A 3HSBA 3AHUA 1WQ7A 4JLIA 5GMKi 5GAMh 1Y96B 4XQ3A 3V7SA 4PJOE 2DJZA 1YCYA 5GANe 4C8QC 2E10A 5GAN2 2EJFA 3FJPA 3V7RA 5GAN7 2ZGWA 4M78G 4M75C 4M7DE 4M78D 2RM4A 1N9SA 4XU3A 5GAMf 4XTUA 4PJOB 4RCBA 3L2ZA 3JCMf 4C8QG 5GAOp 4PJOF 3HFOA 4M7AD 2FYKA 3RUXA 5LJ5e 2CGHA 1WNLA 5DY9A 5GAN5 1B34B 3RKXA 3V8JA 3JCMQ 2E64A 2DTOA 3RIRA 4M75A 4M75B 4MMLA 5LJ5h 1HK9A 2DZCA 4C92F 5LJ3g 5I21A 5GAOr 4NL2A 2E41A 4RCCA 3V7CA 4C92C 3VU3C 4QVCA 5GAMd 2YHTA 2YLCA 4J6WA 2E65A 2HNIA 4M77C 3RKWA 1HXDA 5LJ5f 3QSUA 4XTXA 3JCMX 3SWNB 4M75F 4M7DG 1D3BB 4EMHA 3JCMP 4M7DD 3V8KA 4C92A 4C8QE 1I5LA 4NL3A 3JCMg 4M7AB 4HT8A 1JRIA 4M78E 4M77A 5GMKj 3QHSA 1M8VA 2QTXA 4J6YA 5GAMe 5GMKl 1X01A 3JCMb 1H641 4XU0A 2DXUA 2VXFA 5GAOm 3JB9D 2JN0A 5LJ5d 3QUIA 4F7UE 4XTYA 1B34A 4OP0A 4F7UF 2VC8A 4PNOA 1I8FA 1U1TA 1LOJA 4JRKA 1WQWA 4MMKA 4XU1A 4WF2A 4JRIA 4M77G 4M77B 2FB7A 1D3BA 3PGGA 3QO3A 4M77F 3JB9F 1BIAA 4J6XA 4DQ2A 4F7UG 2DKGA 2RD1A 2RA2A 5CAIA 4JUVA 5LJ3f 3JB9J 5GAN6 2YLBA 2EJ9A 4F7UA 4Y91A 2DTHA 2VXEA 3JCMe 1I81A 4XU2A 3JCMc 4C92B 5GMKh 1TH7A 5GAOn 1Y96A 3JB9H 5GMKm 4M7AE 2RB6A 3JCMh 1I4K1 4C8QB 4PJOG 4C92E 4M7AF 3JB9G 4M7AG 2I2LA 3JCMW 5GANg 3INZA 2EAYA 3BFMA 4XTWA 5GAOq 5GAOl 5GANj 1LJOA 4M77D 3RERA 5GAN8 5GANd 1M5Q1 1KQ1A 1BIBA 4N0AC 3RKYA 4V2SA 4M75G 4M77E 4C92G 4M7DF 1MGQA 4M7AA 1LNXA 2Y90A 4C92D 4M7DC 5GMKe 4PJOC 5LJ3j 5LJ3d 5GAN3 5LJ5j 4HT9A 3JCMV 4F7UB 4EMGA 3JCMd 5GAMg 4N0AA 5GAMj 3EFRA 3HFNA 4A54A 4QVDA 4M78B 4A53A 4M7AC 3SWNA 1JBMA 4M7DA 4M78F 1N9RA 3RESA 4PJOD 3SB2A 4M78C 4X9DA 2DTIA 4XTVA 4C8QF 4EMKA 4EMKB 3BY7A 3FB9A 3GIBA 3M4GA 4C8QD 2DXTA 4M75E 5GANh 3BDUA 4J5YA 3BW1A
chains in the Genus database with same CATH superfamily
3BE3A 2E6NA 3CXCS 5KCOA 4OB3B 4ELYC 3THKA 5GANf 3JRZA 2DETA 2EYYA 2KNBB 3V8LA 1WJQA 2E5KA 4DBFA 1E6GA 2DZ9A 3VS3A 5GMKi 2OAUA 1Y96B 1R8OB 2CSIA 2O4XA 3QJ6A 2LNHB 1B3QA 4RCBA 1OEBA 1LVKA 4ESRA 3OYCA 2YRVA 1YFNA 3G4SA 1JJ2A 3VUBA 5KCHA 4QQDA 3ER0A 5I21A 4HCCA 1HJDA 3GOXA 5GAMd 2CH4A 2O2OA 3CPWS 2E6ZA 4DEYA 1BI3A 4Z02A 2LVMA 3CCRT 4VUBA 4DBRA 4E6RA 1VQNT 3QDRB 1PSEA 2K2VA 2P84A 3G4ST 1M1KC 1SKUB 2V26A 1QCNA 1VQNQ 4XTYA 1QWEA 2OI3A 1NEBA 1BB9A 1EZZB 2EKOA 4M77B 2FB7A 2R57A 2CP0A 2XDPA 4LDWA 3FLGA 1QVFA 1MNEA 1BKBA 2HQEA 4Y92A 2CP2A 5CAIA 2MYSA 2OJ2A 1YJNT 2L3PA 2QQRA 3I35A 4BUGA 2L2PA 3X25B 1I4K1 4C8QB 1H3ZA 3TCJA 4LE9A 2EAYA 3CCEQ 2MK5A 4HCKA 5KE3A 2AK5A 3N5BB 2YUPA 4R0KA 3MEAA 3RKYA 4IUVA 3H6ZA 1NYGA 1QMCA 1LNXA 1K0XA 5ECAA 3G7ZA 1OQKA 1VQ5Q 1VUBA 2HDAA 1K1ZA 4OB0B 5GAMg 2DL5A 1VQOA 3PIPA 4AMCA 1T0HA 2KRSA 3RESA 2HSPA 1BYMA 1D0YA 1ZUKA 2AZSA 2H3EB 3CMET 2DXTA 3M55A 4QQ6A 2A28A 1JB0E 5LJ5g 4X9CA 1BI1A 2DRKA 3JB9I 2GFAA 2XD0A 1SRLA 1KQ2A 1I1JA 2DRMA 3OYYA 5LJ3e 2DYIA 2HBWA 1WQ7A 3QWXX 2CT3A 3M57A 4C5HA 3HFOA 2QEXT 5C6SA 2L3QA 2HSEB 1QKWA 1X2QA 3E1SA 2D8JA 2QYZA 2CZ7B 5CCAA 1VQ9Q 3OMCA 4C92C 3EAEA 4C0DC 3NHNA 1GXIE 2PNIA 5LJ5f 3QSUA 3ZEHA 2ZPIB 1D3BB 4C92A 3GPLA 4RKUE 5KYYA 1XJWB 1I5LA 4HCBA 4AFUC 1O75A 2DL7A 3FC3A 1H641 4E47A 4N4GA 5I22A 2M02A 5J39A 2JM8A 1G2BA 2NWMA 3OYEA 3PGGA 3OY9A 3QBYA 3ZFJA 2MIOA 2AT1B 4FU6A 2NUPB 4A4GA 1G83A 3QDFA 3CCJT 4C92B 5GMKh 1KIKA 5GAOn 4M7AE 4OMNA 1GRIA 1Q7YR 2JMAA 2HBPA 3OW2P 1WA7A 2M9UA 4KGXB 3A1PA 2GTJA 1D0XA 1U8RA 1TS9A 2RHXA 1M2OA 3X26B 3VS4A 1WX6A 4C0GA 3M0UA 1VIFA 3JSCA 2X3WD 2B86A 4M78F 3S3NA 1RLPC 3KFVA 1OV3A 2KI7A 3NTHA 4JPBW 3OYAA 4BB7A 1ZSZA 2OTLT 3CCMQ 2DMOA 2CP7A 5I2MA 2DILA 3RR6A 2DEQA 4PLLA 4QVZA 4RUGA 3M53A 1K4US 2LCLA 1XOVA 3HRTA 1YI2Q 3V7SA 4J9BA 5HCKA 1PNJA 1Q82R 1OZ2A 1B34B 2JZ2A 2DERA 3MPUB 1NLOC 4MZMA 4J9FA 2FZCB 2BIVA 1WHLA 5LJ5h 2OTLA 2V8KA 1T0JA 1VQ4Q 3EG2A 3IQLA 4BDYA 2WSFE 3TSWA 1R0BG 1QP3A 1B07A 1M8VA 1YCSB 2RJCA 4J6YA 4XU0A 2DXUA 5CR2A 4ZN3A 4HVWA 2E12A 1D09B 1B34A 1K9MR 3LLRA 4P5NA 1C6VX 4XU1A 3G6EA 4M77G 4HVUA 2NUTA 3CMAQ 4J6XA 3QG1A 5GAN6 2YLBA 1S72Q 3G6EQ 1VQ7T 4PFZA 2RQWA 3REBB 4PJOG 1GFCA 2KT1A 2YUNA 4FL6A 3UATA 1J3TA 4JZ4A 1NLPC 1LJOA 3I55A 1YITA 2PU9B 4N0AC 2JTFA 4M7DF 1CKBA 2Y90A 1SSFA 3CCLQ 1AWJA 2NLUA 2DXBA 1VQMT 1WXTA 4EMGA 2HZYA 2D0NA 2MOXA 1YBYA 3CQTA 3HRSA 4QKUA 1K9MU 2DTIA 4E7IA 3FB9A 1C1AA 1SSHA 2KY9A 4KGZB 1VQ7Q 2YWWA 1GCQC 5LJ3h 3EH2A 3CMEA 3CMAT 4NS5A 1H3HA 3A8OB 3C94A 3HSBA 1VQ6T 1UGVA 1VOMA 5IXBA 4E7ZA 5D6YA 4IKFA 5GAN2 1WJRA 1VQLA 2R5AA 3P8HA 4ELZC 4D8DA 4XU3A 4PJMA 1M2VB 4PJOF 2FYKA 3ZBDA 1AVZC 2BE7D 3CCQT 1Q82U 4ATOA 1HK9A 1W2BP 1M90U 2BZXA 3LH5A 3O5ZA 1X2KA 2FZGB 3CC2Q 1WJSA 2YHTA 2CP5A 1OPLA 4M77C 1RAAB 1UE9A 3SWNB 2K3BA 3QZ5B 4LDUA 1RAGB 1ZHIA 1Q81U 1TWBA 2V1RA 1VA7A 1UTIA 2FVUA 4DEXA 1VQPT 1ZX6A 4F7UE 1KFZA 3CC7T 2ED1A 2DL3A 2GQIA 2V1QA 1TSFA 2L0AA 2WSEE 4A4FA 1ARKA 3TREA 1M1GA 1M1KU 2LQNA 3OYIA 3LWIA 2DL4A 2EJ9A 3M56A 2ZCFB 1X75C 2X4JA 3JCMe 1VIEA 4E2FB 1YHQA 1WZOA 3SFMA 5GMKm 2RB6A 4JRQA 4ANJA 2LC4A 3JB9G 1KQSA 2JOYA 3LWHA 3BFMA 1WIEA 1RLQC 3G71Q 1PSFA 5LJ5j 1YHQT 5GAMj 4J9GA 1QVGS 5IH2A 1KD1U 3SD4A 2EW3A 3CXCA 2GF7A 1B7TA 1MMGA 1Y7XA 2LJ3A 3FRNA 1SF9A 3EG3A 2ED0A 4ZGDB 1YJWA 3F70A 4PFOA 1D1CA 2DYBA 1X6GA 1WPYA 4C8QA 1EX4A 1TU0B 2JMCA 2HQHA 4J9HA 4GBQA 4PJOE 2EJFA 2XKOC 4FM4B 3D7SB 2ZZDA 1N9SA 5L23A 5HK3A 3C12A 4RTYA 4N4HA 3I5SA 4OF1A 5KYXA 3DLMA 3VU3C 2XK0A 1TXQA 1ZSGA 3CCSQ 3BDLA 1BCOA 3JCMX 4GY5A 1UB4A 2FG0A 1S72A 2ROLA 1KQSS 1OOTA 2DO3A 4RTXA 4ZNXA 2QEXQ 1WHHA 2EYXA 2KDSA 4AFQC 2O31A 2V8JA 1W2BA 3DB3A 2RI2A 1TUDA 2DJQA 4M77F 3GP8A 2M16A 2YUOA 4OVAA 1BIAA 4DQ2A 3EGUA 1YNZA 1H8KA 2JW4A 2MWOA 1NG2A 1WDXA 5IHIA 3VS0A 2ZPFB 4AG2C 3NPFA 4C92E 2VB6A 3LYIA 3JCMW 3CC2A 1QQJA 2KXCA 1RAHB 3RDVA 5CKHA 3OB9A 2H3JA 4BACA 3NMZC 3RMQA 5GAN3 1D0ZA 3DKMA 3JCMV 1Z9QA 3JCMd 3GBQA 3PNWC 3REAB 2E4HA 2XIDA 3SWNA 2OAWA 1ZUUA 3ASKA 4GLKA 1Q7YC 3QYHB 5FWCA 3GIBA 4C8QD 3EGDA 2P4TA 5GANh 3QZ9B 4CRIA 2RHUA 4R55A 1VQ7A 2FPDA 1VQ6A 6AT1B 4LUEA 5AYFA 1YHQQ 1E6HA 2A36A 2RI5A 2RK2A 1U3OA 2NUZA 3H8ZA 2CT4A 4PJOA 3CCVT 5FRNA 3M54A 2DJZA 3C0CA 1ZA1B 2E3HA 2ECZA 3L2ZA 4PJJA 3TQ7P 1Q81C 2EFIA 1K73C 2HD0A 8ATCB 1MNDA 2SEMA 3PMIA 1FMWA 1MUZA 2DPPB 5AT1B 4QVCA 5EC7A 2JXBA 2QXFA 2RPNA 3V8KA 1YJ9Q 4FYYB 3CCVQ 4HT8A 4M78E 4E7LA 2RK1A 1HD3A 3TU4K 5CO7A 5EG2A 4ME7A 4JJNK 1CKAA 2DAQA 4X1VA 1U1TA 3EGXA 2PQWA 4KULA 2RN8A 4F17A 3CCMA 2ZPGB 4QW2A 2CZ1B 2MPXC 3RMSA 1PM3A 1TOVA 2RA2A 3CCMT 2W0ZA 1PWTA 2G3RA 1UGRB 1YI2A 1MMDA 2KBTA 2X9HA 1TH7A 2XI9A 1QWFA 5D7UA 2I2LA 3MHXA 3LW5E 2HQXA 5GAOl 5GANj 4M77D 1KQ1A 4M75G 4M77E 4C92G 1ABOA 3VJPA 2AHJB 2LP5A 8AT1B 4Z88A 3GF5A 2RHYA 1M90R 2QI2A 4PJOD 1KHIA 4EMKA 2DEUA 3CMEQ 3EGDB 3M4GA 1P92A 4L59A 1GBRA 3BDUA 3QWYA 4A4KA 3CCJA 4PFPA 3I56A 4DOWA 4JDSA 2JT4A 4LDYA 1VQMQ 1V29B 1R77A 3CMAA 3OW2A 2EBPA 3CBMA 1RABB 3QIIA 3P8BB 4XQ3A 2OTJT 4KT0E 2QA4T 2CZ0B 2KMTA 2VASA 5IN1A 3RUXA 1ZBJA 2CGHA 2FZKB 2IG0A 1M1FA 3HRUA 1RAFB 1VQ9A 1SHGA 2EGEA 1S72T 1IO6A 3A98A 1VQ9T 1AOJA 4M4ZA 1UUEA 1RL2A 3JCMP 1RUWA 2EQUA 2JM9A 5GMKl 3JB9D 3QUIA 1KG1A 2FL7A 2W10A 3H0HA 3I55T 5FU7C 1YITT 1M3CA 3VRZA 4B9XA 4MDXA 1KQSP 2DTHA 4D8KA 1WHGA 3R6NA 2F5TX 3L2RA 1I5OB 2LX9A 1YJWT 1KHCA 1RAIB 1D1BA 2K5LA 3RERA 1VYUA 2LJ1A 4V2SA 1UGPB 3NTIA 3EG1A 3A8HB 1NYFA 2XHCA 1YJNA 2K79A 4N0AA 1AT1B 4M7AC 4OMFB 2M0OA 1WHMA 3CCET 3BY7A 3JV3A 4BE2A 1UGSB 3CCST 1JEGA 1UDLA 3G1JA 4OMPA 1ACMB 1IRXA 4TVRA 4FYWB 4BI4A 3OYHA 3OYKA 3PIOA 1VQPQ 3A8GB 4J9CA 1KJWA 1U1SA 1VQ8T 3CCRA 3AHUA 2O9VA 4LD6A 1Q86C 4PJNA 2ZGWA 4C0DB 3LGLA 1V1CA 5GAOp 3CCVA 1QVFP 4JJBA 1QVGP 2L3RA 1MV3A 3RKXA 2JVVA 3JCMQ 4M75A 2AKKA 2OTLQ 3H9NA 3PT9A 1XTDA 2HNIA 3HTRA 3QKJA 1M1KR 2MI6A 2XICA 1TG0A 4M7AB 1QCFA 3NFCA 2A37A 2EYQA 4F7UF 2VC8A 3G71T 2DX1A 3I9QA 1M9SA 2HL3A 4LDXA 1YWPA 1SPKA 3CCUQ 2QDYB 2VKNA 2M1HA 2QGFB 1NJIC 1M3AA 3PE0A 2KR3A 3H0FA 1N27A 1M3BA 1XQHA 1WHKA 4RTVA 1KD1R 1AZEA 1BCMA 1X6BA 2LT4A 5GAN8 1BIBA 3OQ5A 4CC2A 2QQBA 3M5AA 3H41A 4JZ3A 4CC4B 2DE0X 2EYZA 1SG5A 1MV0B 2DFUA 5KYNA 4M78B 1RI0A 1JU5C 2V8IA 2PUOB 2FO0A 4C0ZA 1ZSZC 2K3YA 3PFSA 9ATCB 4X9DA 2Z0WA 2P0PA 4PJLA 3BW1A 1QP2A 4ZGJB 3PVLA 3M0QA 2ROTA 3MP8A 1UFFA 3VS2A 3CCUT 2ZPEB 2AZVA 1NJIR 1ZBXA 3EFSA 2GCXA 3LGFA 2NUPA 3FJPA 4MDWA 4M78G 2GTOA 4M7DE 4X34A 4C8QG 3HKSA 4O6JA 1AWOA 1K73R 5GAN5 2IIMA 2RH2A 2FPFA 3RIRA 4FSSA 3OSSC 2EGAA 2PVOB 1YJNQ 3OBYA 2DF6A 2PVGB 4IURA 3SEMA 4BI8B 3RKWA 1TUGB 1G3TA 2KT8A 4AFZC 4IIOA 4NL3A 3A8LB 4OB1B 2EQIA 2DBMA 1NPPA 1O9SA 1QKXA 4MZTA 1GL5A 1M27C 4Q5WA 1IHWA 1RACB 3EG0A 3CCEA 2L89A 2DKGA 2K6DA 2RD1A 1C0MA 1BBZA 1N8RU 4C0FA 2CUDA 3EG9A 3JCMh 3FEOA 3A5ZB 4M7AF 2P0QA 5J26A 1W6XA 1UJ0A 5I11A 5CKBA 2YXYA 2CKKA 1E7OA 3U23A 2QA4Q 1RAEB 2HL5C 1Y71A 2X51A 2DD4A 1MGQA 2ZAEA 1K8AU 1VYVA 2CDTA 4KGVB 2ABLA 1M4ZA 3M59A 4OMMA 4HXJA 3I5RA 2QK0A 1NJIU 2RHZA 3UA7A 1Q86U 1OZ3A 4JLGA 3L2WA 2QQ9A 4BDZA 3FIFA 3HL8A 4M75D 3J81E 2QG9B 2LT1A 1VQOQ 2E1HA 3EHRA 4RTZA 3CC2T 3CCLA 1VYTA 4CC3A 4AG1C 1OU8A 4FYVB 2RM4A 3WVEB 5GAMf 2DLPA 2YDLA 1KC8U 2YT6A 1NM7A 4RMOA 1MHNA 1XNIA 3NGPA 1IXDA 2JTMA 2DZCA 4C92F 3I56Q 2SRCA 5KYUB 2YLCA 3GLXA 3VS5A 2E65A 4MZPA 2XDDA 1QVFS 4M75F 3OSVA 1QW1A 1BI0A 2VV5A 2BZ8A 4IUPA 2RO0A 3JB9F 1GCPA 4PKCC 2K7AA 2X4XA 1LOJA 5M9OA 2HKNA 1FXXA 2J6KA 4FT4A 3M0RA 1PRMC 2GQVA 4QQGA 5C0MA 4LD9K 4XU2A 4WTOB 3JAME 1Y96A 2ENMA 2DM1A 1DJ7B 3OYDA 1I07A 4ZGEB 1N8RR 3MEWA 3INZA 3PVQA 3M0TA 4FT2A 3AT1B 4JS4A 3CC4Q 1R0CB 3C4SA 5LJ3j 3FDRA 1VQLQ 1X6OA 1YI2T 3VS6A 2GBQA 3QYGB 4WCIA 2IPOB 2JTEA 3GNFB 4J5YA 2LX7A 2COWA 3LH0A 1KD1C 1PKTA 1WI7A 4EMKC 4BE1A 2XG8D 5IAYA 3LX7A 3J7AF 1UEBA 4B6MA 2DVJA 1YJ9A 1VQ4T 4DBQA 4XTUA 3JCMf 3MP1A 1PD1A 4KUIA 4BE0A 4M7AD 3CXCP 5HK0A 3UT1A 4XK8E 1PRLC 2ATCB 2A08A 2GFUA 1YN8A 2F5KA 2LQWA 3CPFA 5FU6C 2JS0A 4ZTJA 3FJ5A 2VUBA 4FW1A 4M7DG 1MMAA 1TTHB 3E9GA 2X35A 3QHSA 3DB4A 3MEUA 2VXFA 2RQRA 4OP0A 2F2VA 3GNGA 2PVDB 2QAZA 4WF2A 3CD6Q 2QA4A 1NPRA 2R5MA 2CYZB 1K9AA 2KEAA 3EFOB 3KBGA 1K8AR 4BY6B 4F7UA 1N6AA 1UJYA 2VGMA 1Q82C 2OTJA 2KRNA 1T3LA 2RQUA 1WXBA 3OS0A 4OB2B 1JJ2P 4XTWA 2QASA 2EYWA 3CCJQ 3S3MA 1WHJA 2RJEA 4M7AA 3S6WA 2LCSA 2LCCA 2KSSA 2RQVA 4J83A 2K5IA 3EFRA 1AEYA 4A53A 1H92A 2CSQA 3QXEB 4F16A 2BKDN 5CK9A 3UDCA 5A0DA 1ZSZB 3T9NA 2K57A 3CD6A 5GAN4 1NZ9A 2EWNA 4EPCA 3CCUA 3E19A 4N4IA 1G3SA 3CD6T 2EQKA 4JLIA 4KH0B 3TEEA 2KK4A 4LXCA 2QGGA 2D1XA 4DA4A 4M75C 1AZGB 4PJOC 2CP6A 5CKEA 5LL6S 2DA9A 1PCXA 3OYBA 3M0PA 3ME9A 5CVIA 5L8RE 2CZ6B 3P8DA 1Q95G 5KYXB 4QT7A 1GFDA 3HPWA 1K76A 1FMKA 1VQ6Q 1YWOA 3MJXA 2J05A 5CQYA 3WXMB 1G5VA 1K8AC 1HXDA 1JXMA 4PL6A 2B8AA 2F2XA 4KRTA 2DBKA 2JS2A 1RI9A 1JJ2S 3EHQA 2WSCE 5GMKj 4M77A 5GAMe 2JN0A 4FW2A 5IHKA 1FYNA 3WVDB 1EFNA 4PNOA 4L6V5 5KYYB 1OPKA 1WQWA 2DXCA 2KRMA 3R6OA 1D3BA 2DNUA 1X69A 4B9WA 2EGCA 1UHCA 3RBBB 1QVPA 2C0TA 2RI3A 1OI1A 2VXEA 2DIQA 2J06A 1WFWA 4DBHA 4JJCA 3TVTA 2YRDA 5KYWA 1NBEB 1IGQA 4FCYA 1NE8A 5GANd 2C0IA 3ZL7C 1VQLT 1VQ5A 1VQPA 1YIJQ 1OU9A 3M4YA 4A54A 3CC4T 3OW2S 4FSXA 4M7DA 4Y28E 2KYBA 3CEYA 5GJWB 1G8XA 2EIFA 2LJ0A 2LQKA 2M51A 2P0KA 3A8MB 5DLQE 4XTZA 5GJVB 5KH6A 1PG5B 5FLXE 2K2MA 3Q1JA 3EGXB 2KYMA 3MCAB 4IUUA 1VQNA 2JUFA 2J6OA 2VWFA 3DLLA 4AFSC 5A2QE 3RNJA 1X27A 3O8VA 4J9DA 4C8QC 4IUTA 4KBMB 2QDLA 4M78D 3MKDA 4RTWA 4CI0C 4CC7A 2QQAA 5KYUA 4C5EA 5KE2A 1UG1A 3TSZA 4ORZA 1VQKT 4J6WA 1IGUA 1PC0A 1VQMA 5CQXA 3L2UA 1NEGA 3OMGA 4EMHA 3OYMA 2C0OA 5FU7B 4J7FA 4XAXB 4C8QE 2O88A 2HCKA 2K9GA 1KSWA 1JRIA 1GBQA 3JCMb 5CIUA 1ZLMA 1Q86R 1OX9A 4MMKA 4OGCA 4FYXB 4ZTFA 1VQKA 1ZUYA 1YP5A 1RADB 2LQ8A 4EIKA 1T3SA 4F7UG 1WYXA 3OA6A 1M8MA 2G6FX 2RNAA 4Y91A 2QTVA 1VQOT 5FU6B 5HY6A 3CBOA 3VYHB 1JXOA 5I2SA 2CREA 3C95A 3SDZA 2FRWA 3META 4E7HA 5FRMA 4LDVA 5KYWB 1U06A 1M5Q1 3M58A 2COYA 2LNVA 3CPWA 1TUCA 5GMKe 2KE9A 2RMOA 4HT9A 4OMOA 1WGSA 2LDMA 2DK3A 3OS1A 1YIJT 1KC8C 4M78C 2A0FB 2CS7A 3PTAA 1Z9ZA 4EMKB 2BUDA 4E7SA 1LPLA 4RTUA 3X28B 2MAMA 1OX8A 2RJFA 3JCMJ 1W70A 1VQKQ 1QCOA 1G3WA 1V76A 1FWZA 4EDUA 2HMAA 3URGA 3L1AA 3OYLA 2Y4XA 2RJDA 5GAMh 2F1LA 3OBWA 2C06A 1G3YA 1YCYA 5IXFA 2E10A 1JQQA 1AWXA 3VYGA 2Y4YA 2L8DA 5LJ5e 1YIJA 1UHFA 5GAOr 3HHTB 2CH4W 4J9EA 1VQ8Q 1YJWQ 1M30A 2FRYA 2ESWA 3H0IA 1SRMA 3X24B 5FROA 1SEMA 1WLPB 4XTXA 1A0NB 2XMFA 3L42A 4M7AG 1X01A 2K3XA 3X20B 5GAOm 2D8HA 4FIBA 2AIRB 2XDBA 2E70A 3VKIA 2XU8A 4JRKA 4LNPA 2EVRA 4HCZA 3QO3A 3ULRB 2KQWA 3VRYA 1FX7A 1UECA 3J80E 3MP6A 3JB9H 2RHIA 3VV0A 3CCSA 1S1NA 1UGQB 2MCNA 1IHVA 1Q81R 1M90C 2FHDA 2O9SA 3S3OA 1I0CA 4D6WA 2PUKB 4C5GA 3L2QA 4M7DC 1AHJB 4A63B 3UWNA 2F2WA 2VVKA 5HKCA 2QQSA 1JBMA 1WXUA 3SB2A 5D6WA 4XTVA 4C8QF 1VQ4A 2E3IA 2DD5A 4M75E 1U5SA 2EKHA 3M9QA 1Y0MA 2EQMA 2RF0A 2F69A 4UC4A 2D0QB 2DVEA 4PK4A 2BZYA 2K4YA 1IZ6A 4M7DB 2EJGA 1ZQ1A 4NOYA 3CCLT 3PMTA 2X3XD 2KXDA 4J7IA 4BI3A 5CKDA 4KH1B 5GAN7 3G6ET 4GLMA 1CSKA 4HKEA 2X4WA 3CPWP 2I0NA 4LN2A 1AD5A 1OULA 4RTTA 1Q7YU 1HSQA 3V8JA 4OMLA 4M75B 4NL2A 2E41A 3V7CA 1ABQA 3M0SA 2O01E 4C5IA 4IIMA 4M7DD 1MMNA 4A4EA 7AT1B 2WACA 2AKLA 2D9TA 2QTXA 4ZN1A 4O5VA 3G4SQ 2JNGA 5LJ5d 1BU1A 2CP3A 1PD0A 2J7IA 2LRQA 4JRIA 2L3SA 4Z89A 1PKSA 5IHNA 1W4SA 5DM7R 3QJYA 3JB9J 3CC4A 2YUQA 3OYJA 1I81A 3SHWA 3JCMc 2D6FA 2RQTA 4OMQA 2X4YA 2LTOA 3NTKA 4K11A 3VS1A 3EH1A 2LMJA 1VQ8A 1N8RC 5CKFA 2A7YA 1X43A 5FWBA 2HEQA 2VYTA 1ZA2B 3G71A 2VGNA 1VQ5T 2GGRA 2KVQG 5IT9E 2KGTA 3HFNA 4QVDA 4F04B 3KUFA 2FPEA 3OS5A 1GCQA 1D1AA 2A3LA 5FW9A 2P4RA 1IB8A 2MMPA 4PLIA 2FEIA 1Y57A 4F14A 3UF4A 3SWNC 1W1FA 2EQJA 1JO8A 4M78A 2J6FA 2PTKA 3CC7Q 2JJ9A 4Z8AA 2PZ1A 1FMVA 4LUDA 1M2VA 3OYNA 1BI2A 4HA8A 4IUQA 2IVWA 2ZPHB 4J8OA 2KAFA 3CC7A 1LCKA 5GANe 1YJ9T 2CUBA 4JJDA 3V7RA 2O4XB 4PJOB 1K9MC 1WNLA 3E2UA 5DY9A 2E64A 1SHFA 2DTOA 4JS5A 4MMLA 2DIGA 5LJ3g 3CCRQ 1Y07A 4RG8A 4RCCA 1AWWA 2OX7A 3L2VA 2MF2A 2ZPBB 1IREB 2M0YA 5D6XA 1K0SA 2BE9B 4AT1B 1PHTA 2R58A 3JCMg 4YTLA 2COZA 3CCQA 4A4HA 3I56T 2OTJQ 3HP9A 4KUDK 1I8FA 3MO8A 1KK7A 3OYFA 2LZ6B 3CCQQ 2KROA 3KXTA 1QLYA 4RG2A 4L5GA 2QEXA 4JUVA 5LJ3f 2NYSA 3UA6A 4HVVA 3QPHA 3UPUA 5A0LA 1EIFA 4J9IA 1N5ZA 4E7KA 3E9FA 4E7JA 4JRPA 1K73U 2MWPA 5A0GA 2NUTB 2HKQB 4DOVA 1F1BB 3VUZA 5GANg 3VS7A 2YRCA 4OGEA 1BK2A 4BD3A 5GAOq 4BY6C 3MEVA 2HAXA 2L5QA 3EG9B 5DLOA 4C92D 2YSQA 3EFOA 4R56A 2BTTA 5LJ3d 1OYXA 3CBPA 4F7UB 1HYOA 3OS2A 2GNCA 3I55Q 1YITQ 3OYGA 4II1A 2E5QA 2H8HA 2DL8A 1N9RA 1KC8R 5J3BA 1W2BS 2EPDA 1QVGA 2K5FA
chains in the Genus database with same CATH topology
5DLQE 1YJWA 4XTZA 3F70A 4ZGJB 5KH6A 2E6NA 3CXCS 5FLXE 5KCOA 4OB3B 4ELYC 3Q1JA 3MP8A 5GANf 3JRZA 1WPYA 4C8QA 3CCUT 3MCAB 4IUUA 3V8LA 2ZPEB 2JUFA 1WJQA 3DLLA 1ZBXA 1VQNA 5A2QE 3EFSA 2DZ9A 5GMKi 2OAUA 1Y96B 2GCXA 3O8VA 1R8OB 4PJOE 3LGFA 4C8QC 2EJFA 2XKOC 3FJPA 4FM4B 4MDWA 4IUTA 4M78G 2O4XA 4KBMB 4M7DE 2ZZDA 3QJ6A 4M78D 1N9SA 4X34A 4RCBA 5HK3A 4C8QG 3C12A 3HKSA 3OYCA 4CI0C 2YRVA 2QQAA 4O6JA 4N4HA 4C5EA 5KE2A 3G4SA 5GAN5 1JJ2A 4OF1A 2RH2A 3VUBA 3RIRA 5KCHA 3DLMA 3ER0A 2PVOB 3OSSC 4QQDA 1VQKT 3OBYA 5I21A 4HCCA 2PVGB 3VU3C 3GOXA 5GAMd 2XK0A 4J6WA 4IURA 1VQMA 4BI8B 5CQXA 3RKWA 3L2UA 3CPWS 3BDLA 1G3TA 2E6ZA 3JCMX 1BI3A 3OMGA 1UB4A 4GY5A 4Z02A 4EMHA 2LVMA 5FU7B 3OYMA 4J7FA 4XAXB 4C8QE 4VUBA 3CCRT 2DO3A 1KQSS 4NL3A 3A8LB 1JRIA 2KDSA 4OB1B 1VQNT 3QDRB 3JCMb 1PSEA 5CIUA 2K2VA 3G4ST 1M1KC 1NPPA 1O9SA 2V8JA 4MZTA 1W2BA 4XTYA 3DB3A 4Q5WA 2RI2A 4MMKA 4OGCA 4ZTFA 2EKOA 4M77B 2FB7A 2R57A 4LDWA 2XDPA 1VQKA 3FLGA 4M77F 1QVFA 3CCEA 1BKBA 2HQEA 2L89A 2LQ8A 2M16A 3GP8A 4OVAA 1BIAA 4DQ2A 4F7UG 2DKGA 2RD1A 5CAIA 3OA6A 4Y91A 2MWOA 1VQOT 5FU6B 1YJNT 2QQRA 5HY6A 4BUGA 4C0FA 1N8RU 3CBOA 3VYHB 3X25B 3JCMh 1I4K1 4C8QB 5I2SA 2ZPFB 3FEOA 3A5ZB 4C92E 4M7AF 3C95A 3LYIA 3SDZA 2P0QA 3META 5J26A 4E7HA 3JCMW 3CC2A 5FRMA 3TCJA 1H3ZA 2EAYA 5CKBA 4LDVA 1QP2A 2CKKA 5KE3A 3N5BB 1M5Q1 1Y71A 3M58A 2DD4A 3MEAA 2LNVA 3H6ZA 4IUVA 5CKHA 3OB9A 3RKYA 1MGQA 3CPWA 1LNXA 2H3JA 4BACA 5GMKe 1K8AU 3RMQA 3G7ZA 5GAN3 1VUBA 3DKMA 3JCMV 4HT9A 1M4ZA 3M59A 1WGSA 4OB0B 3JCMd 5GAMg 1VQOA 2LDMA 2DK3A 3PNWC 3PIPA 2RHZA 3OS1A 1NJIU 2XIDA 3SWNA 1YIJT 1Q86U 3RESA 3ASKA 1KC8C 4GLKA 4M78C 2CS7A 3PTAA 1Q7YC 3QYHB 1OZ3A 1BYMA 4EMKB 4JLGA 3GIBA 3CMET 4C8QD 2BUDA 2DXTA 2P4TA 5GANh 3L2WA 3QZ9B 3M55A 4CRIA 2RHUA 2QQ9A 3X28B 2MAMA 2RJFA 4BDZA 4R55A 1VQ7A 1VQ6A 3FIFA 4QQ6A 3JCMJ 5LJ5g 1JB0E 4X9CA 3HL8A 4M75D 3J81E 5AYFA 1BI1A 2LT1A 3JB9I 1G3WA 2GFAA 2XD0A 4EDUA 1FWZA 2RI5A 1KQ2A 2RK2A 3OYYA 2E1HA 5LJ3e 3H8ZA 4PJOA 3URGA 3L1AA 3CC2T 3OYLA 3CCLA 2Y4XA 3CCVT 2RJDA 1WQ7A 5GAMh 3OBWA 2C06A 1G3YA 5FRNA 3M54A 2DJZA 1YCYA 2E10A 3M57A 3VYGA 4C5HA 2RM4A 3WVEB 5GAMf 2Y4YA 3L2ZA 2L8DA 3HFOA 2QEXT 5C6SA 1Q81C 5LJ5e 1KC8U 2EFIA 1K73C 2HD0A 4RMOA 1MHNA 1XNIA 3E1SA 2JTMA 3CCRA 1YIJA 2DZCA 3PMIA 4C92F 2CZ7B 5CCAA 3HHTB 5GAOr 2DPPB 3OMCA 4C92C 3EAEA 4QVCA 2YLCA 4C0DC 3GLXA 3X24B 2E65A 4MZPA 5FROA 1GXIE 5LJ5f 3QSUA 3ZEHA 2XDDA 4XTXA 1QVFS 2ZPIB 4M75F 2QXFA 3OSVA 1D3BB 1QW1A 1BI0A 3V8KA 4C92A 3GPLA 2VV5A 4RKUE 4IUPA 1I5LA 2RO0A 4HCBA 3L42A 4HT8A 4M78E 4E7LA 2RK1A 1O75A 3JB9F 4M7AG 1X01A 2K3XA 1H641 3X20B 5GAOm 5CO7A 4E47A 3FC3A 4N4GA 4FIBA 5EG2A 3TU4K 4ME7A 2XDBA 5J39A 2E70A 4JJNK 3VKIA 2DAQA 2XU8A 4PKCC 1U1TA 2X4XA 1LOJA 2PQWA 4JRKA 4KULA 3OYEA 4HCZA 3CCMA 2ZPGB 5M9OA 3PGGA 3QO3A 1FXXA 3OY9A 4QW2A 2CZ1B 3QBYA 3RMSA 4FT4A 2KQWA 3ZFJA 2GQVA 4QQGA 2RA2A 3CCMT 1FX7A 4FU6A 2G3RA 1UGRB 4A4GA 5C0MA 3MP6A 4XU2A 3JAME 3J80E 4C92B 5GMKh 3CCJT 4LD9K 1TH7A 5GAOn 1Y96A 2RHIA 3VV0A 3JB9H 4M7AE 2XI9A 3CCSA 1DJ7B 2HBPA 3OYDA 1UGQB 2I2LA 4ZGEB 3MHXA 2M9UA 3MEWA 3INZA 3BW1A 3LW5E 2HQXA 1M90C 4FT2A 2FHDA 5GAOl 4JS4A 5GANj 4M77D 1U8RA 2RHXA 3S3OA 1KQ1A 4D6WA 4M75G 4M77E 4C92G 3VJPA 3X26B 2PUKB 4C5GA 3C4SA 3L2QA 2AHJB 4C0GA 4M7DC 5LJ3j 3FDRA 1AHJB 1VIFA 3GF5A 3UWNA 3JSCA 1X6OA 5HKCA 2RHYA 1YI2T 2QI2A 2QQSA 1JBMA 4M78F 3S3NA 4PJOD 3SB2A 3QYGB 1KHIA 5D6WA 4XTVA 4C8QF 4EMKA 1VQ4A 2DD5A 3M4GA 1P92A 4L59A 4M75E 3GNFB 3BDUA 3NTHA 4J5YA 4A4KA 3CCJA 3LH0A 3OYAA 3M9QA 4BB7A 3I56A 4DOWA 1KD1C 2EQMA 4UC4A 2F69A 4JDSA 2D0QB 2DVEA 4LDYA 2OTLT 2K4YA 4EMKC 4BE1A 1IZ6A 5I2MA 4M7DB 1V29B 3CMAA 2DEQA 2XG8D 2EJGA 4PLLA 4QVZA 5IAYA 1ZQ1A 4NOYA 3CCLT 3OW2A 3PMTA 3LX7A 3CBMA 3J7AF 4J7IA 1UEBA 3M53A 2LCLA 1XOVA 3P8BB 3QIIA 3HRTA 4BI3A 5CKDA 4XQ3A 2OTJT 4KT0E 3V7SA 2QA4T 2CZ0B 5GAN7 3G6ET 1YJ9A 2KMTA 1VQ4T 4HKEA 2X4WA 4XTUA 3JCMf 3MP1A 4KUIA 4BE0A 5IN1A 4M7AD 5HK0A 3RUXA 1OZ2A 2CGHA 4XK8E 3UT1A 1Q7YU 1B34B 2JZ2A 3V8JA 2IG0A 1VQ8T 1M1FA 3HRUA 4M75B 2BIVA 2GFUA 4MZMA 5LJ5h 1VQ9A 2OTLA 2F5KA 4NL2A 1S72T 2E41A 3V7CA 2V8KA 3CPFA 1VQ9T 5FU6C 4ZTJA 2O01E 4C5IA 1RL2A 2VUBA 4M7DG 4BDYA 3JCMP 4M7DD 2WSFE 3E9GA 4A4EA 2EQUA 2WACA 1QP3A 2D9TA 1M8VA 2RJCA 2X35A 3QHSA 2QTXA 3DB4A 4J6YA 4ZN1A 5GMKl 4O5VA 4XU0A 3MEUA 2DXUA 2VXFA 3JB9D 5CR2A 2JNGA 3QUIA 5LJ5d 1KG1A 4ZN3A 2E12A 1B34A 4OP0A 2FL7A 3GNGA 3LLRA 2PVDB 4P5NA 2LRQA 4XU1A 4WF2A 4JRIA 4M77G 3G6EA 2QA4A 3I55T 5FU7C 1YITT 1NPRA 2R5MA 2CYZB 1W4SA 4J6XA 4B9XA 5DM7R 3KBGA 3QJYA 3JB9J 3CC4A 3QG1A 5GAN6 2YLBA 4BY6B 4F7UA 4MDXA 1VQ7T 2DTHA 3OYJA 3L2RA 1I81A 2F5TX 1N6AA 3JCMc 2D6FA 2VGMA 2X4YA 2LTOA 3NTKA 2LX9A 1Q82C 2OTJA 4PJOG 4FL6A 1YJWT 1KHCA 1VQ8A 3OS0A 4OB2B 4XTWA 2K5LA 1N8RC 5CKFA 1LJOA 2A7YA 3I55A 3S3MA 1YITA 2PU9B 3RERA 4N0AC 2JTFA 4V2SA 2VYTA 2RJEA 4M7DF 4M7AA 2Y90A 3S6WA 1UGPB 3NTIA 1SSFA 3G71A 2VGNA 2LCCA 2KSSA 3A8HB 2NLUA 1VQ5T 2XHCA 2DXBA 1VQMT 4J83A 2KVQG 1YJNA 4EMGA 4N0AA 2K5IA 3EFRA 5IT9E 3HFNA 4QVDA 4A53A 4M7AC 4OMFB 1YBYA 3HRSA 2M0OA 1K9MU 3KUFA 3OS5A 2BKDN 3QXEB 5CK9A 2DTIA 3CCET 2A3LA 3BY7A 3FB9A 4E7IA 4BE2A 1UGSB 4PLIA 3CCST 2MMPA 3UDCA 5A0DA 2KY9A 3SWNC 2EQJA 4M78A 2K57A 3T9NA 5LJ3h 5GAN4 3CD6A 1NZ9A 2EWNA 3CMEA 4EPCA 4TVRA 3OYHA 4BI4A 3CCUA 3OYKA 3CMAT 4NS5A 3PIOA 3E19A 3OYNA 4N4IA 3A8GB 3A8OB 1G3SA 1U1SA 3CD6T 3C94A 1BI2A 2EQKA 4HA8A 4IUQA 2IVWA 2ZPHB 4LD6A 4J8OA 4JLIA 2KAFA 1S72A 1Q86C 1VQ6T 3AHUA 3CC7A 3TEEA 5D6YA 4IKFA 5GANe 1YJ9T 2KK4A 5GAN2 1WJRA 3V7RA 1VQLA 2R5AA 2ZGWA 3P8HA 4M75C 4C0DB 2O4XB 4ELZC 4DA4A 4XU3A 4PJOC 3LGLA 4PJOB 5CKEA 5GAOp 3CCVA 4PJOF 5LL6S 2FYKA 3ZBDA 1K9MC 1WNLA 2L3RA 5DY9A 3CCQT 3OYBA 1Q82U 3RKXA 3ME9A 4ATOA 2JVVA 2E64A 5CVIA 3JCMQ 2DTOA 5L8RE 4M75A 4JS5A 2CZ6B 3P8DA 4MMLA 2DIGA 1HK9A 1M90U 5LJ3g 3HPWA 1Y07A 4RG8A 4RCCA 5CQYA 1WJSA 3L2VA 3WXMB 2YHTA 1G5VA 3PT9A 1XTDA 2HNIA 2MF2A 2ZPBB 1HXDA 4M77C 1K8AC 4PL6A 1IREB 2B8AA 3QKJA 5D6XA 3SWNB 3QZ5B 2MI6A 2XICA 4LDUA 1JJ2S 2R58A 3JCMg 4M7AB 1ZHIA 2WSCE 4YTLA 4M77A 5GMKj 1Q81U 5GAMe 3NFCA 3CCQA 2FVUA 1VQPT 2JN0A 4A4HA 4F7UE 3WVDB 2EYQA 3I56T 3CC7T 4F7UF 2VC8A 3HP9A 1I8FA 4L6V5 3MO8A 4PNOA 3G71T 4KUDK 1WQWA 2DXCA 1M9SA 3OYFA 4LDXA 3R6OA 1D3BA 2WSEE 4A4FA 4B9WA 3TREA 3KXTA 1M1GA 4RG2A 1M1KU 3OYIA 1QVPA 2RI3A 4L5GA 2QDYB 3LWIA 4JUVA 5LJ3f 2QEXA 1OI1A 2EJ9A 2M1HA 2ZCFB 1X75C 2X4JA 2VXEA 3M56A 2DIQA 3QPHA 3JCMe 1VIEA 3UPUA 5A0LA 1YHQA 1EIFA 3SFMA 1NJIC 4E7KA 5GMKm 2RB6A 3E9FA 4E7JA 4JRPA 1K73U 3HSBA 4JRQA 2MWPA 1N27A 5A0GA 1XQHA 2LC4A 3JB9G 4DOVA 1KQSA 3VUZA 5GANg 2JOYA 4OGEA 3LWHA 3BFMA 4BD3A 2LT4A 5GAOq 4BY6C 1NE8A 3MEVA 5GAN8 5GANd 1BIBA 3OQ5A 2HAXA 2L5QA 2QQBA 5DLOA 4C92D 3M5AA 1PSFA 4R56A 1YI2A 5LJ3d 5LJ5j 1VQLT 1VQ5A 1VQPA 1OYXA 3CBPA 4F7UB 3OS2A 1YHQT 5GAMj 3M4YA 3OYGA 1QVGS 4A54A 4II1A 2E5QA 4M78B 3CC4T 1RI0A 3OW2S 4FSXA 1KD1U 4M7DA 2V8IA 4Y28E 3SD4A 2PUOB 4C0ZA 1N9RA 3CXCA 3PFSA 2K3YA 5J3BA 2GF7A 3CEYA 4X9DA 1W2BS 1Y7XA 3FRNA 2EIFA 2K5FA 1QVGA 2LQKA 2P0PA 4ZGDB 2P0KA 3A8MB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XTZ A;  3SWN C;  3FIF A;  3JCM J;  4M78 A;  2K57 A;  2DVE A;  4X9C A;  4M75 D;  5LJ3 h;  5LJ5 g;  4EMK C;  5GAN f;  5GAN 4;  2EWN A;  1WPY A;  4C8Q A;  3JB9 I;  4M7D B;  1KQ2 A;  2DEQ A;  2EJG A;  3V8L A;  2E1H A;  5LJ3 e;  4NOY A;  4PJO A;  1U1S A;  3EFS A;  2DZ9 A;  3L1A A;  4HA8 A;  3HSB A;  3AHU A;  1WQ7 A;  4JLI A;  5GMK i;  5GAM h;  1Y96 B;  4XQ3 A;  3V7S A;  4PJO E;  2DJZ A;  1YCY A;  5GAN e;  4C8Q C;  2E10 A;  5GAN 2;  2EJF A;  3FJP A;  3V7R A;  5GAN 7;  2ZGW A;  4M78 G;  4M75 C;  4M7D E;  4M78 D;  2RM4 A;  1N9S A;  4XU3 A;  5GAM f;  4XTU A;  4PJO B;  4RCB A;  3L2Z A;  3JCM f;  4C8Q G;  5GAO p;  4PJO F;  3HFO A;  4M7A D;  2FYK A;  3RUX A;  5LJ5 e;  2CGH A;  1WNL A;  5DY9 A;  5GAN 5;  1B34 B;  3RKX A;  3V8J A;  3JCM Q;  2E64 A;  2DTO A;  3RIR A;  4M75 A;  4M75 B;  4MML A;  5LJ5 h;  1HK9 A;  2DZC A;  4C92 F;  5LJ3 g;  5I21 A;  5GAO r;  4NL2 A;  2E41 A;  4RCC A;  3V7C A;  4C92 C;  3VU3 C;  4QVC A;  5GAM d;  2YHT A;  2YLC A;  4J6W A;  2E65 A;  2HNI A;  4M77 C;  3RKW A;  1HXD A;  5LJ5 f;  3QSU A;  4XTX A;  3JCM X;  3SWN B;  4M75 F;  4M7D G;  1D3B B;  4EMH A;  3JCM P;  4M7D D;  3V8K A;  4C92 A;  4C8Q E;  1I5L A;  4NL3 A;  3JCM g;  4M7A B;  4HT8 A;  1JRI A;  4M78 E;  4M77 A;  5GMK j;  3QHS A;  1M8V A;  2QTX A;  4J6Y A;  5GAM e;  5GMK l;  1X01 A;  3JCM b;  1H64 1;  4XU0 A;  2DXU A;  2VXF A;  5GAO m;  3JB9 D;  2JN0 A;  5LJ5 d;  3QUI A;  4F7U E;  4XTY A;  1B34 A;  4OP0 A;  4F7U F;  2VC8 A;  4PNO A;  1I8F A;  1U1T A;  1LOJ A;  4JRK A;  1WQW A;  4MMK A;  4XU1 A;  4WF2 A;  4JRI A;  4M77 G;  4M77 B;  2FB7 A;  1D3B A;  3PGG A;  3QO3 A;  4M77 F;  3JB9 F;  1BIA A;  4J6X A;  4DQ2 A;  4F7U G;  2DKG A;  2RD1 A;  2RA2 A;  5CAI A;  4JUV A;  5LJ3 f;  3JB9 J;  5GAN 6;  2YLB A;  2EJ9 A;  4F7U A;  4Y91 A;  2DTH A;  2VXE A;  3JCM e;  1I81 A;  4XU2 A;  3JCM c;  4C92 B;  5GMK h;  1TH7 A;  5GAO n;  1Y96 A;  3JB9 H;  5GMK m;  4M7A E;  2RB6 A;  3JCM h;  1I4K 1;  4C8Q B;  4PJO G;  4C92 E;  4M7A F;  3JB9 G;  4M7A G;  2I2L A;  3JCM W;  5GAN g;  3INZ A;  2EAY A;  3BFM A;  4XTW A;  5GAO q;  5GAO l;  5GAN j;  1LJO A;  4M77 D;  3RER A;  5GAN 8;  5GAN d;  1M5Q 1;  1KQ1 A;  1BIB A;  4N0A C;  3RKY A;  4V2S A;  4M75 G;  4M77 E;  4C92 G;  4M7D F;  1MGQ A;  4M7A A;  1LNX A;  2Y90 A;  4C92 D;  4M7D C;  5GMK e;  4PJO C;  5LJ3 j;  5LJ3 d;  5GAN 3;  5LJ5 j;  4HT9 A;  3JCM V;  4F7U B;  4EMG A;  3JCM d;  5GAM g;  4N0A A;  5GAM j;  3EFR A;  3HFN A;  4A54 A;  4QVD A;  4M78 B;  4A53 A;  4M7A C;  3SWN A;  1JBM A;  4M7D A;  4M78 F;  1N9R A;  3RES A;  4PJO D;  3SB2 A;  4M78 C;  4X9D A;  2DTI A;  4XTV A;  4C8Q F;  4EMK A;  4EMK B;  3BY7 A;  3FB9 A;  3GIB A;  3M4G A;  4C8Q D;  2DXT A;  4M75 E;  5GAN h;  3BDU A;  4J5Y A;  3BW1 A; 
#chains in the Genus database with same CATH topology
 3BE3 A;  2E6N A;  3CXC S;  5KCO A;  4OB3 B;  4ELY C;  3THK A;  5GAN f;  3JRZ A;  2DET A;  2EYY A;  2KNB B;  3V8L A;  1WJQ A;  2E5K A;  4DBF A;  1E6G A;  2DZ9 A;  3VS3 A;  5GMK i;  2OAU A;  1Y96 B;  1R8O B;  2CSI A;  2O4X A;  3QJ6 A;  2LNH B;  1B3Q A;  4RCB A;  1OEB A;  1LVK A;  4ESR A;  3OYC A;  2YRV A;  1YFN A;  3G4S A;  1JJ2 A;  3VUB A;  5KCH A;  4QQD A;  3ER0 A;  5I21 A;  4HCC A;  1HJD A;  3GOX A;  5GAM d;  2CH4 A;  2O2O A;  3CPW S;  2E6Z A;  4DEY A;  1BI3 A;  4Z02 A;  2LVM A;  3CCR T;  4VUB A;  4DBR A;  4E6R A;  1VQN T;  3QDR B;  1PSE A;  2K2V A;  2P84 A;  3G4S T;  1M1K C;  1SKU B;  2V26 A;  1QCN A;  1VQN Q;  4XTY A;  1QWE A;  2OI3 A;  1NEB A;  1BB9 A;  1EZZ B;  2EKO A;  4M77 B;  2FB7 A;  2R57 A;  2CP0 A;  2XDP A;  4LDW A;  3FLG A;  1QVF A;  1MNE A;  1BKB A;  2HQE A;  4Y92 A;  2CP2 A;  5CAI A;  2MYS A;  2OJ2 A;  1YJN T;  2L3P A;  2QQR A;  3I35 A;  4BUG A;  2L2P A;  3X25 B;  1I4K 1;  4C8Q B;  1H3Z A;  3TCJ A;  4LE9 A;  2EAY A;  3CCE Q;  2MK5 A;  4HCK A;  5KE3 A;  2AK5 A;  3N5B B;  2YUP A;  4R0K A;  3MEA A;  3RKY A;  4IUV A;  3H6Z A;  1NYG A;  1QMC A;  1LNX A;  1K0X A;  5ECA A;  3G7Z A;  1OQK A;  1VQ5 Q;  1VUB A;  2HDA A;  1K1Z A;  4OB0 B;  5GAM g;  2DL5 A;  1VQO A;  3PIP A;  4AMC A;  1T0H A;  2KRS A;  3RES A;  2HSP A;  1BYM A;  1D0Y A;  1ZUK A;  2AZS A;  2H3E B;  3CME T;  2DXT A;  3M55 A;  4QQ6 A;  2A28 A;  1JB0 E;  5LJ5 g;  4X9C A;  1BI1 A;  2DRK A;  3JB9 I;  2GFA A;  2XD0 A;  1SRL A;  1KQ2 A;  1I1J A;  2DRM A;  3OYY A;  5LJ3 e;  2DYI A;  2HBW A;  1WQ7 A;  3QWX X;  2CT3 A;  3M57 A;  4C5H A;  3HFO A;  2QEX T;  5C6S A;  2L3Q A;  2HSE B;  1QKW A;  1X2Q A;  3E1S A;  2D8J A;  2QYZ A;  2CZ7 B;  5CCA A;  1VQ9 Q;  3OMC A;  4C92 C;  3EAE A;  4C0D C;  3NHN A;  1GXI E;  2PNI A;  5LJ5 f;  3QSU A;  3ZEH A;  2ZPI B;  1D3B B;  4C92 A;  3GPL A;  4RKU E;  5KYY A;  1XJW B;  1I5L A;  4HCB A;  4AFU C;  1O75 A;  2DL7 A;  3FC3 A;  1H64 1;  4E47 A;  4N4G A;  5I22 A;  2M02 A;  5J39 A;  2JM8 A;  1G2B A;  2NWM A;  3OYE A;  3PGG A;  3OY9 A;  3QBY A;  3ZFJ A;  2MIO A;  2AT1 B;  4FU6 A;  2NUP B;  4A4G A;  1G83 A;  3QDF A;  3CCJ T;  4C92 B;  5GMK h;  1KIK A;  5GAO n;  4M7A E;  4OMN A;  1GRI A;  1Q7Y R;  2JMA A;  2HBP A;  3OW2 P;  1WA7 A;  2M9U A;  4KGX B;  3A1P A;  2GTJ A;  1D0X A;  1U8R A;  1TS9 A;  2RHX A;  1M2O A;  3X26 B;  3VS4 A;  1WX6 A;  4C0G A;  3M0U A;  1VIF A;  3JSC A;  2X3W D;  2B86 A;  4M78 F;  3S3N A;  1RLP C;  3KFV A;  1OV3 A;  2KI7 A;  3NTH A;  4JPB W;  3OYA A;  4BB7 A;  1ZSZ A;  2OTL T;  3CCM Q;  2DMO A;  2CP7 A;  5I2M A;  2DIL A;  3RR6 A;  2DEQ A;  4PLL A;  4QVZ A;  4RUG A;  3M53 A;  1K4U S;  2LCL A;  1XOV A;  3HRT A;  1YI2 Q;  3V7S A;  4J9B A;  5HCK A;  1PNJ A;  1Q82 R;  1OZ2 A;  1B34 B;  2JZ2 A;  2DER A;  3MPU B;  1NLO C;  4MZM A;  4J9F A;  2FZC B;  2BIV A;  1WHL A;  5LJ5 h;  2OTL A;  2V8K A;  1T0J A;  1VQ4 Q;  3EG2 A;  3IQL A;  4BDY A;  2WSF E;  3TSW A;  1R0B G;  1QP3 A;  1B07 A;  1M8V A;  1YCS B;  2RJC A;  4J6Y A;  4XU0 A;  2DXU A;  5CR2 A;  4ZN3 A;  4HVW A;  2E12 A;  1D09 B;  1B34 A;  1K9M R;  3LLR A;  4P5N A;  1C6V X;  4XU1 A;  3G6E A;  4M77 G;  4HVU A;  2NUT A;  3CMA Q;  4J6X A;  3QG1 A;  5GAN 6;  2YLB A;  1S72 Q;  3G6E Q;  1VQ7 T;  4PFZ A;  2RQW A;  3REB B;  4PJO G;  1GFC A;  2KT1 A;  2YUN A;  4FL6 A;  3UAT A;  1J3T A;  4JZ4 A;  1NLP C;  1LJO A;  3I55 A;  1YIT A;  2PU9 B;  4N0A C;  2JTF A;  4M7D F;  1CKB A;  2Y90 A;  1SSF A;  3CCL Q;  1AWJ A;  2NLU A;  2DXB A;  1VQM T;  1WXT A;  4EMG A;  2HZY A;  2D0N A;  2MOX A;  1YBY A;  3CQT A;  3HRS A;  4QKU A;  1K9M U;  2DTI A;  4E7I A;  3FB9 A;  1C1A A;  1SSH A;  2KY9 A;  4KGZ B;  1VQ7 Q;  2YWW A;  1GCQ C;  5LJ3 h;  3EH2 A;  3CME A;  3CMA T;  4NS5 A;  1H3H A;  3A8O B;  3C94 A;  3HSB A;  1VQ6 T;  1UGV A;  1VOM A;  5IXB A;  4E7Z A;  5D6Y A;  4IKF A;  5GAN 2;  1WJR A;  1VQL A;  2R5A A;  3P8H A;  4ELZ C;  4D8D A;  4XU3 A;  4PJM A;  1M2V B;  4PJO F;  2FYK A;  3ZBD A;  1AVZ C;  2BE7 D;  3CCQ T;  1Q82 U;  4ATO A;  1HK9 A;  1W2B P;  1M90 U;  2BZX A;  3LH5 A;  3O5Z A;  1X2K A;  2FZG B;  3CC2 Q;  1WJS A;  2YHT A;  2CP5 A;  1OPL A;  4M77 C;  1RAA B;  1UE9 A;  3SWN B;  2K3B A;  3QZ5 B;  4LDU A;  1RAG B;  1ZHI A;  1Q81 U;  1TWB A;  2V1R A;  1VA7 A;  1UTI A;  2FVU A;  4DEX A;  1VQP T;  1ZX6 A;  4F7U E;  1KFZ A;  3CC7 T;  2ED1 A;  2DL3 A;  2GQI A;  2V1Q A;  1TSF A;  2L0A A;  2WSE E;  4A4F A;  1ARK A;  3TRE A;  1M1G A;  1M1K U;  2LQN A;  3OYI A;  3LWI A;  2DL4 A;  2EJ9 A;  3M56 A;  2ZCF B;  1X75 C;  2X4J A;  3JCM e;  1VIE A;  4E2F B;  1YHQ A;  1WZO A;  3SFM A;  5GMK m;  2RB6 A;  4JRQ A;  4ANJ A;  2LC4 A;  3JB9 G;  1KQS A;  2JOY A;  3LWH A;  3BFM A;  1WIE A;  1RLQ C;  3G71 Q;  1PSF A;  5LJ5 j;  1YHQ T;  5GAM j;  4J9G A;  1QVG S;  5IH2 A;  1KD1 U;  3SD4 A;  2EW3 A;  3CXC A;  2GF7 A;  1B7T A;  1MMG A;  1Y7X A;  2LJ3 A;  3FRN A;  1SF9 A;  3EG3 A;  2ED0 A;  4ZGD B;  1YJW A;  3F70 A;  4PFO A;  1D1C A;  2DYB A;  1X6G A;  1WPY A;  4C8Q A;  1EX4 A;  1TU0 B;  2JMC A;  2HQH A;  4J9H A;  4GBQ A;  4PJO E;  2EJF A;  2XKO C;  4FM4 B;  3D7S B;  2ZZD A;  1N9S A;  5L23 A;  5HK3 A;  3C12 A;  4RTY A;  4N4H A;  3I5S A;  4OF1 A;  5KYX A;  3DLM A;  3VU3 C;  2XK0 A;  1TXQ A;  1ZSG A;  3CCS Q;  3BDL A;  1BCO A;  3JCM X;  4GY5 A;  1UB4 A;  2FG0 A;  1S72 A;  2ROL A;  1KQS S;  1OOT A;  2DO3 A;  4RTX A;  4ZNX A;  2QEX Q;  1WHH A;  2EYX A;  2KDS A;  4AFQ C;  2O31 A;  2V8J A;  1W2B A;  3DB3 A;  2RI2 A;  1TUD A;  2DJQ A;  4M77 F;  3GP8 A;  2M16 A;  2YUO A;  4OVA A;  1BIA A;  4DQ2 A;  3EGU A;  1YNZ A;  1H8K A;  2JW4 A;  2MWO A;  1NG2 A;  1WDX A;  5IHI A;  3VS0 A;  2ZPF B;  4AG2 C;  3NPF A;  4C92 E;  2VB6 A;  3LYI A;  3JCM W;  3CC2 A;  1QQJ A;  2KXC A;  1RAH B;  3RDV A;  5CKH A;  3OB9 A;  2H3J A;  4BAC A;  3NMZ C;  3RMQ A;  5GAN 3;  1D0Z A;  3DKM A;  3JCM V;  1Z9Q A;  3JCM d;  3GBQ A;  3PNW C;  3REA B;  2E4H A;  2XID A;  3SWN A;  2OAW A;  1ZUU A;  3ASK A;  4GLK A;  1Q7Y C;  3QYH B;  5FWC A;  3GIB A;  4C8Q D;  3EGD A;  2P4T A;  5GAN h;  3QZ9 B;  4CRI A;  2RHU A;  4R55 A;  1VQ7 A;  2FPD A;  1VQ6 A;  6AT1 B;  4LUE A;  5AYF A;  1YHQ Q;  1E6H A;  2A36 A;  2RI5 A;  2RK2 A;  1U3O A;  2NUZ A;  3H8Z A;  2CT4 A;  4PJO A;  3CCV T;  5FRN A;  3M54 A;  2DJZ A;  3C0C A;  1ZA1 B;  2E3H A;  2ECZ A;  3L2Z A;  4PJJ A;  3TQ7 P;  1Q81 C;  2EFI A;  1K73 C;  2HD0 A;  8ATC B;  1MND A;  2SEM A;  3PMI A;  1FMW A;  1MUZ A;  2DPP B;  5AT1 B;  4QVC A;  5EC7 A;  2JXB A;  2QXF A;  2RPN A;  3V8K A;  1YJ9 Q;  4FYY B;  3CCV Q;  4HT8 A;  4M78 E;  4E7L A;  2RK1 A;  1HD3 A;  3TU4 K;  5CO7 A;  5EG2 A;  4ME7 A;  4JJN K;  1CKA A;  2DAQ A;  4X1V A;  1U1T A;  3EGX A;  2PQW A;  4KUL A;  2RN8 A;  4F17 A;  3CCM A;  2ZPG B;  4QW2 A;  2CZ1 B;  2MPX C;  3RMS A;  1PM3 A;  1TOV A;  2RA2 A;  3CCM T;  2W0Z A;  1PWT A;  2G3R A;  1UGR B;  1YI2 A;  1MMD A;  2KBT A;  2X9H A;  1TH7 A;  2XI9 A;  1QWF A;  5D7U A;  2I2L A;  3MHX A;  3LW5 E;  2HQX A;  5GAO l;  5GAN j;  4M77 D;  1KQ1 A;  4M75 G;  4M77 E;  4C92 G;  1ABO A;  3VJP A;  2AHJ B;  2LP5 A;  8AT1 B;  4Z88 A;  3GF5 A;  2RHY A;  1M90 R;  2QI2 A;  4PJO D;  1KHI A;  4EMK A;  2DEU A;  3CME Q;  3EGD B;  3M4G A;  1P92 A;  4L59 A;  1GBR A;  3BDU A;  3QWY A;  4A4K A;  3CCJ A;  4PFP A;  3I56 A;  4DOW A;  4JDS A;  2JT4 A;  4LDY A;  1VQM Q;  1V29 B;  1R77 A;  3CMA A;  3OW2 A;  2EBP A;  3CBM A;  1RAB B;  3QII A;  3P8B B;  4XQ3 A;  2OTJ T;  4KT0 E;  2QA4 T;  2CZ0 B;  2KMT A;  2VAS A;  5IN1 A;  3RUX A;  1ZBJ A;  2CGH A;  2FZK B;  2IG0 A;  1M1F A;  3HRU A;  1RAF B;  1VQ9 A;  1SHG A;  2EGE A;  1S72 T;  1IO6 A;  3A98 A;  1VQ9 T;  1AOJ A;  4M4Z A;  1UUE A;  1RL2 A;  3JCM P;  1RUW A;  2EQU A;  2JM9 A;  5GMK l;  3JB9 D;  3QUI A;  1KG1 A;  2FL7 A;  2W10 A;  3H0H A;  3I55 T;  5FU7 C;  1YIT T;  1M3C A;  3VRZ A;  4B9X A;  4MDX A;  1KQS P;  2DTH A;  4D8K A;  1WHG A;  3R6N A;  2F5T X;  3L2R A;  1I5O B;  2LX9 A;  1YJW T;  1KHC A;  1RAI B;  1D1B A;  2K5L A;  3RER A;  1VYU A;  2LJ1 A;  4V2S A;  1UGP B;  3NTI A;  3EG1 A;  3A8H B;  1NYF A;  2XHC A;  1YJN A;  2K79 A;  4N0A A;  1AT1 B;  4M7A C;  4OMF B;  2M0O A;  1WHM A;  3CCE T;  3BY7 A;  3JV3 A;  4BE2 A;  1UGS B;  3CCS T;  1JEG A;  1UDL A;  3G1J A;  4OMP A;  1ACM B;  1IRX A;  4TVR A;  4FYW B;  4BI4 A;  3OYH A;  3OYK A;  3PIO A;  1VQP Q;  3A8G B;  4J9C A;  1KJW A;  1U1S A;  1VQ8 T;  3CCR A;  3AHU A;  2O9V A;  4LD6 A;  1Q86 C;  4PJN A;  2ZGW A;  4C0D B;  3LGL A;  1V1C A;  5GAO p;  3CCV A;  1QVF P;  4JJB A;  1QVG P;  2L3R A;  1MV3 A;  3RKX A;  2JVV A;  3JCM Q;  4M75 A;  2AKK A;  2OTL Q;  3H9N A;  3PT9 A;  1XTD A;  2HNI A;  3HTR A;  3QKJ A;  1M1K R;  2MI6 A;  2XIC A;  1TG0 A;  4M7A B;  1QCF A;  3NFC A;  2A37 A;  2EYQ A;  4F7U F;  2VC8 A;  3G71 T;  2DX1 A;  3I9Q A;  1M9S A;  2HL3 A;  4LDX A;  1YWP A;  1SPK A;  3CCU Q;  2QDY B;  2VKN A;  2M1H A;  2QGF B;  1NJI C;  1M3A A;  3PE0 A;  2KR3 A;  3H0F A;  1N27 A;  1M3B A;  1XQH A;  1WHK A;  4RTV A;  1KD1 R;  1AZE A;  1BCM A;  1X6B A;  2LT4 A;  5GAN 8;  1BIB A;  3OQ5 A;  4CC2 A;  2QQB A;  3M5A A;  3H41 A;  4JZ3 A;  4CC4 B;  2DE0 X;  2EYZ A;  1SG5 A;  1MV0 B;  2DFU A;  5KYN A;  4M78 B;  1RI0 A;  1JU5 C;  2V8I A;  2PUO B;  2FO0 A;  4C0Z A;  1ZSZ C;  2K3Y A;  3PFS A;  9ATC B;  4X9D A;  2Z0W A;  2P0P A;  4PJL A;  3BW1 A;  1QP2 A;  4ZGJ B;  3PVL A;  3M0Q A;  2ROT A;  3MP8 A;  1UFF A;  3VS2 A;  3CCU T;  2ZPE B;  2AZV A;  1NJI R;  1ZBX A;  3EFS A;  2GCX A;  3LGF A;  2NUP A;  3FJP A;  4MDW A;  4M78 G;  2GTO A;  4M7D E;  4X34 A;  4C8Q G;  3HKS A;  4O6J A;  1AWO A;  1K73 R;  5GAN 5;  2IIM A;  2RH2 A;  2FPF A;  3RIR A;  4FSS A;  3OSS C;  2EGA A;  2PVO B;  1YJN Q;  3OBY A;  2DF6 A;  2PVG B;  4IUR A;  3SEM A;  4BI8 B;  3RKW A;  1TUG B;  1G3T A;  2KT8 A;  4AFZ C;  4IIO A;  4NL3 A;  3A8L B;  4OB1 B;  2EQI A;  2DBM A;  1NPP A;  1O9S A;  1QKX A;  4MZT A;  1GL5 A;  1M27 C;  4Q5W A;  1IHW A;  1RAC B;  3EG0 A;  3CCE A;  2L89 A;  2DKG A;  2K6D A;  2RD1 A;  1C0M A;  1BBZ A;  1N8R U;  4C0F A;  2CUD A;  3EG9 A;  3JCM h;  3FEO A;  3A5Z B;  4M7A F;  2P0Q A;  5J26 A;  1W6X A;  1UJ0 A;  5I11 A;  5CKB A;  2YXY A;  2CKK A;  1E7O A;  3U23 A;  2QA4 Q;  1RAE B;  2HL5 C;  1Y71 A;  2X51 A;  2DD4 A;  1MGQ A;  2ZAE A;  1K8A U;  1VYV A;  2CDT A;  4KGV B;  2ABL A;  1M4Z A;  3M59 A;  4OMM A;  4HXJ A;  3I5R A;  2QK0 A;  1NJI U;  2RHZ A;  3UA7 A;  1Q86 U;  1OZ3 A;  4JLG A;  3L2W A;  2QQ9 A;  4BDZ A;  3FIF A;  3HL8 A;  4M75 D;  3J81 E;  2QG9 B;  2LT1 A;  1VQO Q;  2E1H A;  3EHR A;  4RTZ A;  3CC2 T;  3CCL A;  1VYT A;  4CC3 A;  4AG1 C;  1OU8 A;  4FYV B;  2RM4 A;  3WVE B;  5GAM f;  2DLP A;  2YDL A;  1KC8 U;  2YT6 A;  1NM7 A;  4RMO A;  1MHN A;  1XNI A;  3NGP A;  1IXD A;  2JTM A;  2DZC A;  4C92 F;  3I56 Q;  2SRC A;  5KYU B;  2YLC A;  3GLX A;  3VS5 A;  2E65 A;  4MZP A;  2XDD A;  1QVF S;  4M75 F;  3OSV A;  1QW1 A;  1BI0 A;  2VV5 A;  2BZ8 A;  4IUP A;  2RO0 A;  3JB9 F;  1GCP A;  4PKC C;  2K7A A;  2X4X A;  1LOJ A;  5M9O A;  2HKN A;  1FXX A;  2J6K A;  4FT4 A;  3M0R A;  1PRM C;  2GQV A;  4QQG A;  5C0M A;  4LD9 K;  4XU2 A;  4WTO B;  3JAM E;  1Y96 A;  2ENM A;  2DM1 A;  1DJ7 B;  3OYD A;  1I07 A;  4ZGE B;  1N8R R;  3MEW A;  3INZ A;  3PVQ A;  3M0T A;  4FT2 A;  3AT1 B;  4JS4 A;  3CC4 Q;  1R0C B;  3C4S A;  5LJ3 j;  3FDR A;  1VQL Q;  1X6O A;  1YI2 T;  3VS6 A;  2GBQ A;  3QYG B;  4WCI A;  2IPO B;  2JTE A;  3GNF B;  4J5Y A;  2LX7 A;  2COW A;  3LH0 A;  1KD1 C;  1PKT A;  1WI7 A;  4EMK C;  4BE1 A;  2XG8 D;  5IAY A;  3LX7 A;  3J7A F;  1UEB A;  4B6M A;  2DVJ A;  1YJ9 A;  1VQ4 T;  4DBQ A;  4XTU A;  3JCM f;  3MP1 A;  1PD1 A;  4KUI A;  4BE0 A;  4M7A D;  3CXC P;  5HK0 A;  3UT1 A;  4XK8 E;  1PRL C;  2ATC B;  2A08 A;  2GFU A;  1YN8 A;  2F5K A;  2LQW A;  3CPF A;  5FU6 C;  2JS0 A;  4ZTJ A;  3FJ5 A;  2VUB A;  4FW1 A;  4M7D G;  1MMA A;  1TTH B;  3E9G A;  2X35 A;  3QHS A;  3DB4 A;  3MEU A;  2VXF A;  2RQR A;  4OP0 A;  2F2V A;  3GNG A;  2PVD B;  2QAZ A;  4WF2 A;  3CD6 Q;  2QA4 A;  1NPR A;  2R5M A;  2CYZ B;  1K9A A;  2KEA A;  3EFO B;  3KBG A;  1K8A R;  4BY6 B;  4F7U A;  1N6A A;  1UJY A;  2VGM A;  1Q82 C;  2OTJ A;  2KRN A;  1T3L A;  2RQU A;  1WXB A;  3OS0 A;  4OB2 B;  1JJ2 P;  4XTW A;  2QAS A;  2EYW A;  3CCJ Q;  3S3M A;  1WHJ A;  2RJE A;  4M7A A;  3S6W A;  2LCS A;  2LCC A;  2KSS A;  2RQV A;  4J83 A;  2K5I A;  3EFR A;  1AEY A;  4A53 A;  1H92 A;  2CSQ A;  3QXE B;  4F16 A;  2BKD N;  5CK9 A;  3UDC A;  5A0D A;  1ZSZ B;  3T9N A;  2K57 A;  3CD6 A;  5GAN 4;  1NZ9 A;  2EWN A;  4EPC A;  3CCU A;  3E19 A;  4N4I A;  1G3S A;  3CD6 T;  2EQK A;  4JLI A;  4KH0 B;  3TEE A;  2KK4 A;  4LXC A;  2QGG A;  2D1X A;  4DA4 A;  4M75 C;  1AZG B;  4PJO C;  2CP6 A;  5CKE A;  5LL6 S;  2DA9 A;  1PCX A;  3OYB A;  3M0P A;  3ME9 A;  5CVI A;  5L8R E;  2CZ6 B;  3P8D A;  1Q95 G;  5KYX B;  4QT7 A;  1GFD A;  3HPW A;  1K76 A;  1FMK A;  1VQ6 Q;  1YWO A;  3MJX A;  2J05 A;  5CQY A;  3WXM B;  1G5V A;  1K8A C;  1HXD A;  1JXM A;  4PL6 A;  2B8A A;  2F2X A;  4KRT A;  2DBK A;  2JS2 A;  1RI9 A;  1JJ2 S;  3EHQ A;  2WSC E;  5GMK j;  4M77 A;  5GAM e;  2JN0 A;  4FW2 A;  5IHK A;  1FYN A;  3WVD B;  1EFN A;  4PNO A;  4L6V 5;  5KYY B;  1OPK A;  1WQW A;  2DXC A;  2KRM A;  3R6O A;  1D3B A;  2DNU A;  1X69 A;  4B9W A;  2EGC A;  1UHC A;  3RBB B;  1QVP A;  2C0T A;  2RI3 A;  1OI1 A;  2VXE A;  2DIQ A;  2J06 A;  1WFW A;  4DBH A;  4JJC A;  3TVT A;  2YRD A;  5KYW A;  1NBE B;  1IGQ A;  4FCY A;  1NE8 A;  5GAN d;  2C0I A;  3ZL7 C;  1VQL T;  1VQ5 A;  1VQP A;  1YIJ Q;  1OU9 A;  3M4Y A;  4A54 A;  3CC4 T;  3OW2 S;  4FSX A;  4M7D A;  4Y28 E;  2KYB A;  3CEY A;  5GJW B;  1G8X A;  2EIF A;  2LJ0 A;  2LQK A;  2M51 A;  2P0K A;  3A8M B;  5DLQ E;  4XTZ A;  5GJV B;  5KH6 A;  1PG5 B;  5FLX E;  2K2M A;  3Q1J A;  3EGX B;  2KYM A;  3MCA B;  4IUU A;  1VQN A;  2JUF A;  2J6O A;  2VWF A;  3DLL A;  4AFS C;  5A2Q E;  3RNJ A;  1X27 A;  3O8V A;  4J9D A;  4C8Q C;  4IUT A;  4KBM B;  2QDL A;  4M78 D;  3MKD A;  4RTW A;  4CI0 C;  4CC7 A;  2QQA A;  5KYU A;  4C5E A;  5KE2 A;  1UG1 A;  3TSZ A;  4ORZ A;  1VQK T;  4J6W A;  1IGU A;  1PC0 A;  1VQM A;  5CQX A;  3L2U A;  1NEG A;  3OMG A;  4EMH A;  3OYM A;  2C0O A;  5FU7 B;  4J7F A;  4XAX B;  4C8Q E;  2O88 A;  2HCK A;  2K9G A;  1KSW A;  1JRI A;  1GBQ A;  3JCM b;  5CIU A;  1ZLM A;  1Q86 R;  1OX9 A;  4MMK A;  4OGC A;  4FYX B;  4ZTF A;  1VQK A;  1ZUY A;  1YP5 A;  1RAD B;  2LQ8 A;  4EIK A;  1T3S A;  4F7U G;  1WYX A;  3OA6 A;  1M8M A;  2G6F X;  2RNA A;  4Y91 A;  2QTV A;  1VQO T;  5FU6 B;  5HY6 A;  3CBO A;  3VYH B;  1JXO A;  5I2S A;  2CRE A;  3C95 A;  3SDZ A;  2FRW A;  3MET A;  4E7H A;  5FRM A;  4LDV A;  5KYW B;  1U06 A;  1M5Q 1;  3M58 A;  2COY A;  2LNV A;  3CPW A;  1TUC A;  5GMK e;  2KE9 A;  2RMO A;  4HT9 A;  4OMO A;  1WGS A;  2LDM A;  2DK3 A;  3OS1 A;  1YIJ T;  1KC8 C;  4M78 C;  2A0F B;  2CS7 A;  3PTA A;  1Z9Z A;  4EMK B;  2BUD A;  4E7S A;  1LPL A;  4RTU A;  3X28 B;  2MAM A;  1OX8 A;  2RJF A;  3JCM J;  1W70 A;  1VQK Q;  1QCO A;  1G3W A;  1V76 A;  1FWZ A;  4EDU A;  2HMA A;  3URG A;  3L1A A;  3OYL A;  2Y4X A;  2RJD A;  5GAM h;  2F1L A;  3OBW A;  2C06 A;  1G3Y A;  1YCY A;  5IXF A;  2E10 A;  1JQQ A;  1AWX A;  3VYG A;  2Y4Y A;  2L8D A;  5LJ5 e;  1YIJ A;  1UHF A;  5GAO r;  3HHT B;  2CH4 W;  4J9E A;  1VQ8 Q;  1YJW Q;  1M30 A;  2FRY A;  2ESW A;  3H0I A;  1SRM A;  3X24 B;  5FRO A;  1SEM A;  1WLP B;  4XTX A;  1A0N B;  2XMF A;  3L42 A;  4M7A G;  1X01 A;  2K3X A;  3X20 B;  5GAO m;  2D8H A;  4FIB A;  2AIR B;  2XDB A;  2E70 A;  3VKI A;  2XU8 A;  4JRK A;  4LNP A;  2EVR A;  4HCZ A;  3QO3 A;  3ULR B;  2KQW A;  3VRY A;  1FX7 A;  1UEC A;  3J80 E;  3MP6 A;  3JB9 H;  2RHI A;  3VV0 A;  3CCS A;  1S1N A;  1UGQ B;  2MCN A;  1IHV A;  1Q81 R;  1M90 C;  2FHD A;  2O9S A;  3S3O A;  1I0C A;  4D6W A;  2PUK B;  4C5G A;  3L2Q A;  4M7D C;  1AHJ B;  4A63 B;  3UWN A;  2F2W A;  2VVK A;  5HKC A;  2QQS A;  1JBM A;  1WXU A;  3SB2 A;  5D6W A;  4XTV A;  4C8Q F;  1VQ4 A;  2E3I A;  2DD5 A;  4M75 E;  1U5S A;  2EKH A;  3M9Q A;  1Y0M A;  2EQM A;  2RF0 A;  2F69 A;  4UC4 A;  2D0Q B;  2DVE A;  4PK4 A;  2BZY A;  2K4Y A;  1IZ6 A;  4M7D B;  2EJG A;  1ZQ1 A;  4NOY A;  3CCL T;  3PMT A;  2X3X D;  2KXD A;  4J7I A;  4BI3 A;  5CKD A;  4KH1 B;  5GAN 7;  3G6E T;  4GLM A;  1CSK A;  4HKE A;  2X4W A;  3CPW P;  2I0N A;  4LN2 A;  1AD5 A;  1OUL A;  4RTT A;  1Q7Y U;  1HSQ A;  3V8J A;  4OML A;  4M75 B;  4NL2 A;  2E41 A;  3V7C A;  1ABQ A;  3M0S A;  2O01 E;  4C5I A;  4IIM A;  4M7D D;  1MMN A;  4A4E A;  7AT1 B;  2WAC A;  2AKL A;  2D9T A;  2QTX A;  4ZN1 A;  4O5V A;  3G4S Q;  2JNG A;  5LJ5 d;  1BU1 A;  2CP3 A;  1PD0 A;  2J7I A;  2LRQ A;  4JRI A;  2L3S A;  4Z89 A;  1PKS A;  5IHN A;  1W4S A;  5DM7 R;  3QJY A;  3JB9 J;  3CC4 A;  2YUQ A;  3OYJ A;  1I81 A;  3SHW A;  3JCM c;  2D6F A;  2RQT A;  4OMQ A;  2X4Y A;  2LTO A;  3NTK A;  4K11 A;  3VS1 A;  3EH1 A;  2LMJ A;  1VQ8 A;  1N8R C;  5CKF A;  2A7Y A;  1X43 A;  5FWB A;  2HEQ A;  2VYT A;  1ZA2 B;  3G71 A;  2VGN A;  1VQ5 T;  2GGR A;  2KVQ G;  5IT9 E;  2KGT A;  3HFN A;  4QVD A;  4F04 B;  3KUF A;  2FPE A;  3OS5 A;  1GCQ A;  1D1A A;  2A3L A;  5FW9 A;  2P4R A;  1IB8 A;  2MMP A;  4PLI A;  2FEI A;  1Y57 A;  4F14 A;  3UF4 A;  3SWN C;  1W1F A;  2EQJ A;  1JO8 A;  4M78 A;  2J6F A;  2PTK A;  3CC7 Q;  2JJ9 A;  4Z8A A;  2PZ1 A;  1FMV A;  4LUD A;  1M2V A;  3OYN A;  1BI2 A;  4HA8 A;  4IUQ A;  2IVW A;  2ZPH B;  4J8O A;  2KAF A;  3CC7 A;  1LCK A;  5GAN e;  1YJ9 T;  2CUB A;  4JJD A;  3V7R A;  2O4X B;  4PJO B;  1K9M C;  1WNL A;  3E2U A;  5DY9 A;  2E64 A;  1SHF A;  2DTO A;  4JS5 A;  4MML A;  2DIG A;  5LJ3 g;  3CCR Q;  1Y07 A;  4RG8 A;  4RCC A;  1AWW A;  2OX7 A;  3L2V A;  2MF2 A;  2ZPB B;  1IRE B;  2M0Y A;  5D6X A;  1K0S A;  2BE9 B;  4AT1 B;  1PHT A;  2R58 A;  3JCM g;  4YTL A;  2COZ A;  3CCQ A;  4A4H A;  3I56 T;  2OTJ Q;  3HP9 A;  4KUD K;  1I8F A;  3MO8 A;  1KK7 A;  3OYF A;  2LZ6 B;  3CCQ Q;  2KRO A;  3KXT A;  1QLY A;  4RG2 A;  4L5G A;  2QEX A;  4JUV A;  5LJ3 f;  2NYS A;  3UA6 A;  4HVV A;  3QPH A;  3UPU A;  5A0L A;  1EIF A;  4J9I A;  1N5Z A;  4E7K A;  3E9F A;  4E7J A;  4JRP A;  1K73 U;  2MWP A;  5A0G A;  2NUT B;  2HKQ B;  4DOV A;  1F1B B;  3VUZ A;  5GAN g;  3VS7 A;  2YRC A;  4OGE A;  1BK2 A;  4BD3 A;  5GAO q;  4BY6 C;  3MEV A;  2HAX A;  2L5Q A;  3EG9 B;  5DLO A;  4C92 D;  2YSQ A;  3EFO A;  4R56 A;  2BTT A;  5LJ3 d;  1OYX A;  3CBP A;  4F7U B;  1HYO A;  3OS2 A;  2GNC A;  3I55 Q;  1YIT Q;  3OYG A;  4II1 A;  2E5Q A;  2H8H A;  2DL8 A;  1N9R A;  1KC8 R;  5J3B A;  1W2B S;  2EPD A;  1QVG A;  2K5F A; 
#chains in the Genus database with same CATH homology
 5DLQ E;  1YJW A;  4XTZ A;  3F70 A;  4ZGJ B;  5KH6 A;  2E6N A;  3CXC S;  5FLX E;  5KCO A;  4OB3 B;  4ELY C;  3Q1J A;  3MP8 A;  5GAN f;  3JRZ A;  1WPY A;  4C8Q A;  3CCU T;  3MCA B;  4IUU A;  3V8L A;  2ZPE B;  2JUF A;  1WJQ A;  3DLL A;  1ZBX A;  1VQN A;  5A2Q E;  3EFS A;  2DZ9 A;  5GMK i;  2OAU A;  1Y96 B;  2GCX A;  3O8V A;  1R8O B;  4PJO E;  3LGF A;  4C8Q C;  2EJF A;  2XKO C;  3FJP A;  4FM4 B;  4MDW A;  4IUT A;  4M78 G;  2O4X A;  4KBM B;  4M7D E;  2ZZD A;  3QJ6 A;  4M78 D;  1N9S A;  4X34 A;  4RCB A;  5HK3 A;  4C8Q G;  3C12 A;  3HKS A;  3OYC A;  4CI0 C;  2YRV A;  2QQA A;  4O6J A;  4N4H A;  4C5E A;  5KE2 A;  3G4S A;  5GAN 5;  1JJ2 A;  4OF1 A;  2RH2 A;  3VUB A;  3RIR A;  5KCH A;  3DLM A;  3ER0 A;  2PVO B;  3OSS C;  4QQD A;  1VQK T;  3OBY A;  5I21 A;  4HCC A;  2PVG B;  3VU3 C;  3GOX A;  5GAM d;  2XK0 A;  4J6W A;  4IUR A;  1VQM A;  4BI8 B;  5CQX A;  3RKW A;  3L2U A;  3CPW S;  3BDL A;  1G3T A;  2E6Z A;  3JCM X;  1BI3 A;  3OMG A;  1UB4 A;  4GY5 A;  4Z02 A;  4EMH A;  2LVM A;  5FU7 B;  3OYM A;  4J7F A;  4XAX B;  4C8Q E;  4VUB A;  3CCR T;  2DO3 A;  1KQS S;  4NL3 A;  3A8L B;  1JRI A;  2KDS A;  4OB1 B;  1VQN T;  3QDR B;  3JCM b;  1PSE A;  5CIU A;  2K2V A;  3G4S T;  1M1K C;  1NPP A;  1O9S A;  2V8J A;  4MZT A;  1W2B A;  4XTY A;  3DB3 A;  4Q5W A;  2RI2 A;  4MMK A;  4OGC A;  4ZTF A;  2EKO A;  4M77 B;  2FB7 A;  2R57 A;  4LDW A;  2XDP A;  1VQK A;  3FLG A;  4M77 F;  1QVF A;  3CCE A;  1BKB A;  2HQE A;  2L89 A;  2LQ8 A;  2M16 A;  3GP8 A;  4OVA A;  1BIA A;  4DQ2 A;  4F7U G;  2DKG A;  2RD1 A;  5CAI A;  3OA6 A;  4Y91 A;  2MWO A;  1VQO T;  5FU6 B;  1YJN T;  2QQR A;  5HY6 A;  4BUG A;  4C0F A;  1N8R U;  3CBO A;  3VYH B;  3X25 B;  3JCM h;  1I4K 1;  4C8Q B;  5I2S A;  2ZPF B;  3FEO A;  3A5Z B;  4C92 E;  4M7A F;  3C95 A;  3LYI A;  3SDZ A;  2P0Q A;  3MET A;  5J26 A;  4E7H A;  3JCM W;  3CC2 A;  5FRM A;  3TCJ A;  1H3Z A;  2EAY A;  5CKB A;  4LDV A;  1QP2 A;  2CKK A;  5KE3 A;  3N5B B;  1M5Q 1;  1Y71 A;  3M58 A;  2DD4 A;  3MEA A;  2LNV A;  3H6Z A;  4IUV A;  5CKH A;  3OB9 A;  3RKY A;  1MGQ A;  3CPW A;  1LNX A;  2H3J A;  4BAC A;  5GMK e;  1K8A U;  3RMQ A;  3G7Z A;  5GAN 3;  1VUB A;  3DKM A;  3JCM V;  4HT9 A;  1M4Z A;  3M59 A;  1WGS A;  4OB0 B;  3JCM d;  5GAM g;  1VQO A;  2LDM A;  2DK3 A;  3PNW C;  3PIP A;  2RHZ A;  3OS1 A;  1NJI U;  2XID A;  3SWN A;  1YIJ T;  1Q86 U;  3RES A;  3ASK A;  1KC8 C;  4GLK A;  4M78 C;  2CS7 A;  3PTA A;  1Q7Y C;  3QYH B;  1OZ3 A;  1BYM A;  4EMK B;  4JLG A;  3GIB A;  3CME T;  4C8Q D;  2BUD A;  2DXT A;  2P4T A;  5GAN h;  3L2W A;  3QZ9 B;  3M55 A;  4CRI A;  2RHU A;  2QQ9 A;  3X28 B;  2MAM A;  2RJF A;  4BDZ A;  4R55 A;  1VQ7 A;  1VQ6 A;  3FIF A;  4QQ6 A;  3JCM J;  5LJ5 g;  1JB0 E;  4X9C A;  3HL8 A;  4M75 D;  3J81 E;  5AYF A;  1BI1 A;  2LT1 A;  3JB9 I;  1G3W A;  2GFA A;  2XD0 A;  4EDU A;  1FWZ A;  2RI5 A;  1KQ2 A;  2RK2 A;  3OYY A;  2E1H A;  5LJ3 e;  3H8Z A;  4PJO A;  3URG A;  3L1A A;  3CC2 T;  3OYL A;  3CCL A;  2Y4X A;  3CCV T;  2RJD A;  1WQ7 A;  5GAM h;  3OBW A;  2C06 A;  1G3Y A;  5FRN A;  3M54 A;  2DJZ A;  1YCY A;  2E10 A;  3M57 A;  3VYG A;  4C5H A;  2RM4 A;  3WVE B;  5GAM f;  2Y4Y A;  3L2Z A;  2L8D A;  3HFO A;  2QEX T;  5C6S A;  1Q81 C;  5LJ5 e;  1KC8 U;  2EFI A;  1K73 C;  2HD0 A;  4RMO A;  1MHN A;  1XNI A;  3E1S A;  2JTM A;  3CCR A;  1YIJ A;  2DZC A;  3PMI A;  4C92 F;  2CZ7 B;  5CCA A;  3HHT B;  5GAO r;  2DPP B;  3OMC A;  4C92 C;  3EAE A;  4QVC A;  2YLC A;  4C0D C;  3GLX A;  3X24 B;  2E65 A;  4MZP A;  5FRO A;  1GXI E;  5LJ5 f;  3QSU A;  3ZEH A;  2XDD A;  4XTX A;  1QVF S;  2ZPI B;  4M75 F;  2QXF A;  3OSV A;  1D3B B;  1QW1 A;  1BI0 A;  3V8K A;  4C92 A;  3GPL A;  2VV5 A;  4RKU E;  4IUP A;  1I5L A;  2RO0 A;  4HCB A;  3L42 A;  4HT8 A;  4M78 E;  4E7L A;  2RK1 A;  1O75 A;  3JB9 F;  4M7A G;  1X01 A;  2K3X A;  1H64 1;  3X20 B;  5GAO m;  5CO7 A;  4E47 A;  3FC3 A;  4N4G A;  4FIB A;  5EG2 A;  3TU4 K;  4ME7 A;  2XDB A;  5J39 A;  2E70 A;  4JJN K;  3VKI A;  2DAQ A;  2XU8 A;  4PKC C;  1U1T A;  2X4X A;  1LOJ A;  2PQW A;  4JRK A;  4KUL A;  3OYE A;  4HCZ A;  3CCM A;  2ZPG B;  5M9O A;  3PGG A;  3QO3 A;  1FXX A;  3OY9 A;  4QW2 A;  2CZ1 B;  3QBY A;  3RMS A;  4FT4 A;  2KQW A;  3ZFJ A;  2GQV A;  4QQG A;  2RA2 A;  3CCM T;  1FX7 A;  4FU6 A;  2G3R A;  1UGR B;  4A4G A;  5C0M A;  3MP6 A;  4XU2 A;  3JAM E;  3J80 E;  4C92 B;  5GMK h;  3CCJ T;  4LD9 K;  1TH7 A;  5GAO n;  1Y96 A;  2RHI A;  3VV0 A;  3JB9 H;  4M7A E;  2XI9 A;  3CCS A;  1DJ7 B;  2HBP A;  3OYD A;  1UGQ B;  2I2L A;  4ZGE B;  3MHX A;  2M9U A;  3MEW A;  3INZ A;  3BW1 A;  3LW5 E;  2HQX A;  1M90 C;  4FT2 A;  2FHD A;  5GAO l;  4JS4 A;  5GAN j;  4M77 D;  1U8R A;  2RHX A;  3S3O A;  1KQ1 A;  4D6W A;  4M75 G;  4M77 E;  4C92 G;  3VJP A;  3X26 B;  2PUK B;  4C5G A;  3C4S A;  3L2Q A;  2AHJ B;  4C0G A;  4M7D C;  5LJ3 j;  3FDR A;  1AHJ B;  1VIF A;  3GF5 A;  3UWN A;  3JSC A;  1X6O A;  5HKC A;  2RHY A;  1YI2 T;  2QI2 A;  2QQS A;  1JBM A;  4M78 F;  3S3N A;  4PJO D;  3SB2 A;  3QYG B;  1KHI A;  5D6W A;  4XTV A;  4C8Q F;  4EMK A;  1VQ4 A;  2DD5 A;  3M4G A;  1P92 A;  4L59 A;  4M75 E;  3GNF B;  3BDU A;  3NTH A;  4J5Y A;  4A4K A;  3CCJ A;  3LH0 A;  3OYA A;  3M9Q A;  4BB7 A;  3I56 A;  4DOW A;  1KD1 C;  2EQM A;  4UC4 A;  2F69 A;  4JDS A;  2D0Q B;  2DVE A;  4LDY A;  2OTL T;  2K4Y A;  4EMK C;  4BE1 A;  1IZ6 A;  5I2M A;  4M7D B;  1V29 B;  3CMA A;  2DEQ A;  2XG8 D;  2EJG A;  4PLL A;  4QVZ A;  5IAY A;  1ZQ1 A;  4NOY A;  3CCL T;  3OW2 A;  3PMT A;  3LX7 A;  3CBM A;  3J7A F;  4J7I A;  1UEB A;  3M53 A;  2LCL A;  1XOV A;  3P8B B;  3QII A;  3HRT A;  4BI3 A;  5CKD A;  4XQ3 A;  2OTJ T;  4KT0 E;  3V7S A;  2QA4 T;  2CZ0 B;  5GAN 7;  3G6E T;  1YJ9 A;  2KMT A;  1VQ4 T;  4HKE A;  2X4W A;  4XTU A;  3JCM f;  3MP1 A;  4KUI A;  4BE0 A;  5IN1 A;  4M7A D;  5HK0 A;  3RUX A;  1OZ2 A;  2CGH A;  4XK8 E;  3UT1 A;  1Q7Y U;  1B34 B;  2JZ2 A;  3V8J A;  2IG0 A;  1VQ8 T;  1M1F A;  3HRU A;  4M75 B;  2BIV A;  2GFU A;  4MZM A;  5LJ5 h;  1VQ9 A;  2OTL A;  2F5K A;  4NL2 A;  1S72 T;  2E41 A;  3V7C A;  2V8K A;  3CPF A;  1VQ9 T;  5FU6 C;  4ZTJ A;  2O01 E;  4C5I A;  1RL2 A;  2VUB A;  4M7D G;  4BDY A;  3JCM P;  4M7D D;  2WSF E;  3E9G A;  4A4E A;  2EQU A;  2WAC A;  1QP3 A;  2D9T A;  1M8V A;  2RJC A;  2X35 A;  3QHS A;  2QTX A;  3DB4 A;  4J6Y A;  4ZN1 A;  5GMK l;  4O5V A;  4XU0 A;  3MEU A;  2DXU A;  2VXF A;  3JB9 D;  5CR2 A;  2JNG A;  3QUI A;  5LJ5 d;  1KG1 A;  4ZN3 A;  2E12 A;  1B34 A;  4OP0 A;  2FL7 A;  3GNG A;  3LLR A;  2PVD B;  4P5N A;  2LRQ A;  4XU1 A;  4WF2 A;  4JRI A;  4M77 G;  3G6E A;  2QA4 A;  3I55 T;  5FU7 C;  1YIT T;  1NPR A;  2R5M A;  2CYZ B;  1W4S A;  4J6X A;  4B9X A;  5DM7 R;  3KBG A;  3QJY A;  3JB9 J;  3CC4 A;  3QG1 A;  5GAN 6;  2YLB A;  4BY6 B;  4F7U A;  4MDX A;  1VQ7 T;  2DTH A;  3OYJ A;  3L2R A;  1I81 A;  2F5T X;  1N6A A;  3JCM c;  2D6F A;  2VGM A;  2X4Y A;  2LTO A;  3NTK A;  2LX9 A;  1Q82 C;  2OTJ A;  4PJO G;  4FL6 A;  1YJW T;  1KHC A;  1VQ8 A;  3OS0 A;  4OB2 B;  4XTW A;  2K5L A;  1N8R C;  5CKF A;  1LJO A;  2A7Y A;  3I55 A;  3S3M A;  1YIT A;  2PU9 B;  3RER A;  4N0A C;  2JTF A;  4V2S A;  2VYT A;  2RJE A;  4M7D F;  4M7A A;  2Y90 A;  3S6W A;  1UGP B;  3NTI A;  1SSF A;  3G71 A;  2VGN A;  2LCC A;  2KSS A;  3A8H B;  2NLU A;  1VQ5 T;  2XHC A;  2DXB A;  1VQM T;  4J83 A;  2KVQ G;  1YJN A;  4EMG A;  4N0A A;  2K5I A;  3EFR A;  5IT9 E;  3HFN A;  4QVD A;  4A53 A;  4M7A C;  4OMF B;  1YBY A;  3HRS A;  2M0O A;  1K9M U;  3KUF A;  3OS5 A;  2BKD N;  3QXE B;  5CK9 A;  2DTI A;  3CCE T;  2A3L A;  3BY7 A;  3FB9 A;  4E7I A;  4BE2 A;  1UGS B;  4PLI A;  3CCS T;  2MMP A;  3UDC A;  5A0D A;  2KY9 A;  3SWN C;  2EQJ A;  4M78 A;  2K57 A;  3T9N A;  5LJ3 h;  5GAN 4;  3CD6 A;  1NZ9 A;  2EWN A;  3CME A;  4EPC A;  4TVR A;  3OYH A;  4BI4 A;  3CCU A;  3OYK A;  3CMA T;  4NS5 A;  3PIO A;  3E19 A;  3OYN A;  4N4I A;  3A8G B;  3A8O B;  1G3S A;  1U1S A;  3CD6 T;  3C94 A;  1BI2 A;  2EQK A;  4HA8 A;  4IUQ A;  2IVW A;  2ZPH B;  4LD6 A;  4J8O A;  4JLI A;  2KAF A;  1S72 A;  1Q86 C;  1VQ6 T;  3AHU A;  3CC7 A;  3TEE A;  5D6Y A;  4IKF A;  5GAN e;  1YJ9 T;  2KK4 A;  5GAN 2;  1WJR A;  3V7R A;  1VQL A;  2R5A A;  2ZGW A;  3P8H A;  4M75 C;  4C0D B;  2O4X B;  4ELZ C;  4DA4 A;  4XU3 A;  4PJO C;  3LGL A;  4PJO B;  5CKE A;  5GAO p;  3CCV A;  4PJO F;  5LL6 S;  2FYK A;  3ZBD A;  1K9M C;  1WNL A;  2L3R A;  5DY9 A;  3CCQ T;  3OYB A;  1Q82 U;  3RKX A;  3ME9 A;  4ATO A;  2JVV A;  2E64 A;  5CVI A;  3JCM Q;  2DTO A;  5L8R E;  4M75 A;  4JS5 A;  2CZ6 B;  3P8D A;  4MML A;  2DIG A;  1HK9 A;  1M90 U;  5LJ3 g;  3HPW A;  1Y07 A;  4RG8 A;  4RCC A;  5CQY A;  1WJS A;  3L2V A;  3WXM B;  2YHT A;  1G5V A;  3PT9 A;  1XTD A;  2HNI A;  2MF2 A;  2ZPB B;  1HXD A;  4M77 C;  1K8A C;  4PL6 A;  1IRE B;  2B8A A;  3QKJ A;  5D6X A;  3SWN B;  3QZ5 B;  2MI6 A;  2XIC A;  4LDU A;  1JJ2 S;  2R58 A;  3JCM g;  4M7A B;  1ZHI A;  2WSC E;  4YTL A;  4M77 A;  5GMK j;  1Q81 U;  5GAM e;  3NFC A;  3CCQ A;  2FVU A;  1VQP T;  2JN0 A;  4A4H A;  4F7U E;  3WVD B;  2EYQ A;  3I56 T;  3CC7 T;  4F7U F;  2VC8 A;  3HP9 A;  1I8F A;  4L6V 5;  3MO8 A;  4PNO A;  3G71 T;  4KUD K;  1WQW A;  2DXC A;  1M9S A;  3OYF A;  4LDX A;  3R6O A;  1D3B A;  2WSE E;  4A4F A;  4B9W A;  3TRE A;  3KXT A;  1M1G A;  4RG2 A;  1M1K U;  3OYI A;  1QVP A;  2RI3 A;  4L5G A;  2QDY B;  3LWI A;  4JUV A;  5LJ3 f;  2QEX A;  1OI1 A;  2EJ9 A;  2M1H A;  2ZCF B;  1X75 C;  2X4J A;  2VXE A;  3M56 A;  2DIQ A;  3QPH A;  3JCM e;  1VIE A;  3UPU A;  5A0L A;  1YHQ A;  1EIF A;  3SFM A;  1NJI C;  4E7K A;  5GMK m;  2RB6 A;  3E9F A;  4E7J A;  4JRP A;  1K73 U;  3HSB A;  4JRQ A;  2MWP A;  1N27 A;  5A0G A;  1XQH A;  2LC4 A;  3JB9 G;  4DOV A;  1KQS A;  3VUZ A;  5GAN g;  2JOY A;  4OGE A;  3LWH A;  3BFM A;  4BD3 A;  2LT4 A;  5GAO q;  4BY6 C;  1NE8 A;  3MEV A;  5GAN 8;  5GAN d;  1BIB A;  3OQ5 A;  2HAX A;  2L5Q A;  2QQB A;  5DLO A;  4C92 D;  3M5A A;  1PSF A;  4R56 A;  1YI2 A;  5LJ3 d;  5LJ5 j;  1VQL T;  1VQ5 A;  1VQP A;  1OYX A;  3CBP A;  4F7U B;  3OS2 A;  1YHQ T;  5GAM j;  3M4Y A;  3OYG A;  1QVG S;  4A54 A;  4II1 A;  2E5Q A;  4M78 B;  3CC4 T;  1RI0 A;  3OW2 S;  4FSX A;  1KD1 U;  4M7D A;  2V8I A;  4Y28 E;  3SD4 A;  2PUO B;  4C0Z A;  1N9R A;  3CXC A;  3PFS A;  2K3Y A;  5J3B A;  2GF7 A;  3CEY A;  4X9D A;  1W2B S;  1Y7X A;  3FRN A;  2EIF A;  2K5F A;  1QVG A;  2LQK A;  2P0P A;  4ZGD B;  2P0K A;  3A8M B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...