2VXFA

Solution structure of the lsm-domain of zebrafish rap55
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
88
structure length
88
Chain Sequence
b'LEDPSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCEPPKPIM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LSM14A PROTEIN
molecule tags Transcription
source organism Danio rerio
publication title Similar modes of interaction enable Trailer Hitch and EDC3 to associate with DCP1 and Me31B in distinct protein complexes.
pubmed doi rcsb
total genus 10
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vxfA00
4MMKA 1D3BB 4J5YA 1JBMA 2E41A 4M78F 4XTVA 5LJ5g 5LJ5h 1LOJA 4M75C 5GANf 2QTXA 4A54A 1WQWA 2I2LA 1BIBA 5GAN4 4HT8A 3BW1A 3JB9J 1WPYA 5GANg 3SWNB 5LJ3h 2EJ9A 2CGHA 4M7DE 5LJ5e 4M7AC 2DKGA 4NOYA 3JCMb 4EMKB 4XTYA 4M77D 1JRIA 2E65A 2K57A 3L1AA 2DEQA 4M75F 4C92G 1LJOA 4QVDA 5I21A 2VXFA 2EJGA 3JB9F 5DY9A 4PJOB 5GAN7 5GANe 3EFRA 2RA2A 3INZA 5GAN8 4M75G 2RM4A 4M78D 3JB9G 1M5Q1 3BDUA 4HA8A 3SB2A 3JCMQ 4C8QB 2DTOA 1H641 1B34B 4M78A 3FIFA 3FB9A 2FB7A 4NL2A 4RCBA 5GAOp 3JCMJ 4JLIA 5GAOm 5GAMg 1WNLA 4M7DF 4C92B 3BY7A 4J6WA 5GAN5 3EFSA 4M77C 4V2SA 5GANh 3RUXA 1M8VA 4M7DA 4C8QF 4C8QE 4M7AA 1WQ7A 2DZCA 1BIAA 4M7DG 4X9CA 2VXEA 4M78B 2EAYA 4MMLA 4C92C 5LJ5d 4M77G 4C8QA 3JB9I 3HSBA 1KQ1A 5GAMj 4M7AB 4C8QG 4JRIA 5GAMe 3HFOA 4M75A 3V7SA 3QHSA 4J6YA 4XQ3A 2YLCA 4Y91A 4XU2A 2YHTA 4M77F 4M75D 3JCMc 4XU1A 3V8JA 4XTWA 5GAN3 4C8QC 5GAOl 4M78G 3JB9D 1LNXA 1X01A 5GMKi 4N0AC 2EWNA 3BFMA 5GAMh 5GMKe 4EMKA 5GMKl 1Y96A 1I81A 4M7DD 3GIBA 3V7RA 3JCMX 2FYKA 1MGQA 3RERA 2JN0A 4M77B 4PNOA 3SWNA 4XTUA 5GANd 1HXDA 3FJPA 4OP0A 5LJ3e 5LJ5j 4M7AG 3JB9H 1TH7A 2E10A 4EMKC 4EMGA 4M77A 2DXUA 2ZGWA 1I5LA 2DXTA 3SWNC 4M77E 2DVEA 2Y90A 4J6XA 2YLBA 4JRKA 4C8QD 3JCMg 5LJ3f 5GAN6 3QUIA 3JCMW 5GMKm 4RCCA 5GMKj 4M78C 1KQ2A 4A53A 3L2ZA 5LJ3g 3RESA 4C92E 4C92F 3RKWA 3QO3A 5LJ5f 4HT9A 2DZ9A 3AHUA 3HFNA 1D3BA 1Y96B 4N0AA 3JCMd 4XTZA 2DTIA 4XU3A 4JUVA 3V8KA 4F7UE 4M78E 1U1SA 4F7UB 4F7UG 5GAMd 4PJOD 2E64A 2E1HA 3V8LA 4M7AD 1I8FA 2RD1A 5GAMf 5GAOn 4WF2A 4DQ2A 5GAOr 2DJZA 2HNIA 4XTXA 4M7AE 4F7UF 4EMHA 3JCMf 4M75B 3PGGA 3RIRA 1U1TA 3JCMP 1N9SA 2EJFA 1B34A 4QVCA 5GAN2 4PJOC 3VU3C 3JCMh 4M7DB 1I4K1 4C92D 4XU0A 1N9RA 5LJ3d 3RKXA 4PJOG 1HK9A 4C92A 4M75E 3JCMV 2RB6A 1YCYA 3QSUA 4X9DA 4PJOA 3V7CA 5GMKh 3RKYA 4M7DC 5GAOq 5CAIA 4NL3A 4F7UA 4PJOE 4PJOF 2VC8A 3M4GA 3JCMe 5LJ3j 4M7AF 2DTHA 5GANj
chains in the Genus database with same CATH superfamily
1QMCA 3HTRA 2JTEA 1LOJA 2M0OA 3OYFA 4JJNK 1BIBA 2JS2A 2GNCA 1VQPQ 2EVRA 1C0MA 1E7OA 2ENMA 4EMKB 4XTYA 2LMJA 2K57A 1GL5A 2EJGA 3E9FA 3INZA 4C0GA 1GBQA 1JQQA 5FLXE 1H641 2E5QA 1VQ9T 4NL2A 3EFOA 3H41A 3VKIA 4GBQA 3RUXA 1D0XA 3M57A 5GJVB 4MMLA 2KI7A 3VUZA 4ESRA 1YHQT 2AZSA 1WFWA 1WJRA 1YJ9T 3OW2P 4KUDK 1WJQA 5GAN3 1D0ZA 5CO7A 3CMEA 1YJNT 1VYTA 3ME9A 1I81A 3QYGB 4DOWA 2D0NA 3MEAA 3O8VA 2OI3A 3FJPA 5EC7A 4EMKC 4EMGA 3A1PA 5C0MA 3CCSQ 1JJ2S 1KG1A 4JLGA 2EW3A 1G2BA 2K5FA 3QUIA 5GMKm 1VQ4T 5GMKj 1WHHA 4HCCA 5ECAA 6AT1B 1JXMA 3PFSA 4N4IA 5I22A 1WXBA 2DZ9A 3JCMd 3V8KA 2DTIA 2QEXT 1RAEB 3CCUQ 1I8FA 5GAOn 1X6GA 4DQ2A 5IH2A 2KXCA 5KYWA 1JB0E 1B34A 4FCYA 3NMZC 1JJ2A 1ABQA 1RL2A 3OS1A 1I4K1 3J81E 4CC3A 3OSVA 3GLXA 1Z9QA 3EFOB 4Z88A 2DO3A 3I55A 2QEXA 4OGEA 4NL3A 2KY9A 2DRMA 2WSFE 5KE2A 1D3BB 4LXCA 5KCHA 1UUEA 2E12A 3CPFA 3CCLT 1RABB 1EIFA 4TVRA 5M9OA 5CKDA 2F5TX 4M7AC 2GFAA 1W2BP 2K2VA 2DAQA 3VS4A 1VYUA 1VQ8A 1SKUB 1S72A 2XIDA 2FHDA 2AIRB 2QQSA 5GAN8 1HD3A 3MP8A 3ZFJA 5FROA 3M55A 3SB2A 3JCMQ 5FU6C 3O5ZA 3FIFA 2ZAEA 1SRMA 4KH0B 5EG2A 2W0ZA 4M7DF 2QI2A 2RQWA 1OOTA 1M8VA 4QKUA 2QG9B 1BIAA 2LQKA 7AT1B 4BE1A 4AT1B 1ZA1B 4M7AB 3TSZA 3CCLQ 4KH1B 1SRLA 1I0CA 3QZ9B 4F17A 4PLLA 4XTWA 3FC3A 3CMAQ 1X01A 2EWNA 4AMCA 4M7DD 1BI1A 2CREA 2DMOA 2L89A 3L2VA 4IUUA 1J3TA 2RK2A 2JXBA 2RQTA 3ZBDA 2K7AA 3QBYA 2R57A 2AKLA 2K3BA 4O5VA 1WXUA 1VQLT 2DE0X 1K0XA 1TU0B 2XU8A 2OAWA 1SHFA 1LVKA 2PU9B 3M4YA 4F7UG 3MPUB 2KROA 4FW1A 4WF2A 4F7UF 1T0JA 2BUDA 3TQ7P 3QWXX 1TWBA 2GBQA 2HEQA 2DXBA 5CQYA 1N9SA 1FWZA 4WCIA 2EGCA 1AVZC 4HXJA 2YSQA 1VQNA 1UGRB 4PJOG 1K76A 2O31A 4BI8B 1WX6A 2LT4A 1Q81C 4BD3A 2LQ8A 1U8RA 4PJOF 3CBOA 1UHCA 2V8JA 2CH4A 4M78F 2K9GA 2O01E 4ZGJB 1NZ9A 1AWWA 4NOYA 2KMTA 3GOXA 3UA7A 4LDYA 4F14A 2VXFA 3QJYA 3CPWS 3RR6A 2CP2A 5DY9A 4OB1B 4PJOB 3VRZA 3CD6A 4C8QB 1K73U 2DTOA 1BK2A 2HD0A 3M56A 4M78A 2JVVA 1WLPB 1RI0A 3EHQA 3H8ZA 4CC4B 2DD5A 4C92C 1M1GA 3M0SA 2SEMA 3OYEA 2YT6A 1UGQB 4ZGDB 1YI2Q 4M75D 1K0SA 2QAZA 1T0HA 3JB9D 1VA7A 4MZPA 1I5OB 1Q82C 1IGQA 2VVKA 4BACA 1M2VA 2RQVA 1S72T 3GBQA 1Q81U 2ZGWA 1FMKA 3KUFA 3SWNC 1K8AR 4M77E 5AT1B 2VGNA 1VQPA 4JRKA 4A4HA 4AFUC 3JCMW 3QDFA 1QWFA 1YJ9A 2C0OA 2RO0A 4Z8AA 5L23A 2MPXC 1UFFA 2RI2A 2I0NA 2DL5A 1KHIA 1ZSZA 1UJ0A 3CPWA 5CKBA 4E2FB 2KRNA 2XMFA 1YITA 1N8RC 2E6ZA 2LX9A 3GNFB 1D09B 3EGXB 3M9QA 2CYZB 1VQPT 3VYGA 1GBRA 1AWOA 3RIRA 2F2VA 2FPDA 3E2UA 4ZTJA 3KBGA 2B86A 1OX9A 1HK9A 1YN8A 2CZ0B 1YCYA 2LX7A 5KYXA 3RKYA 4ZN1A 5FU7C 3M4GA 3H0IA 4JDSA 2DTHA 4R55A 2W10A 3JAME 1M27C 1ZUKA 4PFPA 2BE7D 2E6NA 1WPYA 2SRCA 5LJ3h 1Q82R 2CGHA 2LC4A 3CCVQ 4VUBA 1QVPA 2GTOA 5IHNA 3UA6A 3OYHA 4DBQA 5FU6B 3R6NA 1WIEA 1QP2A 1PKSA 3L2WA 1M5Q1 5I11A 2DLPA 1B34B 1AEYA 1OPLA 5GAOp 4EDUA 2D6FA 4J6WA 1D0YA 3EFSA 4M77C 1VQ7T 2V26A 4PJLA 3FRNA 4ZGEB 2CUBA 4K11A 2LJ0A 2VXEA 3KXTA 2ROLA 1YIJA 4C8QA 3HFOA 1NBEB 1VQMQ 4XQ3A 4J6YA 3HKSA 1WHLA 3V8JA 4MZMA 5LL6S 1VQOQ 2CP5A 3MO8A 4A4FA 2XI9A 2MCNA 3UATA 1XJWB 2EYQA 5CK9A 2KT1A 4KULA 1RAHB 4CRIA 3RDVA 4DBRA 3JB9H 2KRSA 3M59A 3EG0A 5KYYB 1O9SA 2DVEA 1RLQC 1Q81R 4FT4A 1IREB 2ROTA 2DPPB 1UJYA 2ED1A 2JZ2A 4N4GA 2RHUA 5CIUA 1M90C 1AT1B 1YFNA 2CDTA 1MHNA 1X75C 1I07A 2ZPFB 3DKMA 3A5ZB 3G6EQ 3LH0A 2JS0A 3G4ST 5GAOr 2O9VA 4B9XA 2V1RA 2QYZA 1FMWA 1UDLA 4FIBA 5L8RE 2EYWA 2DK3A 1SEMA 5FRNA 4KGVB 4C92D 5LJ3d 1M3CA 4M75E 3QSUA 3EG3A 4X9DA 2JT4A 4BUGA 4PJOE 2EGEA 2KR3A 3G4SQ 2D8HA 3L42A 4XTVA 3OYMA 1X2QA 1ZSGA 1BI0A 3E19A 5GAN4 4D6WA 4IIOA 3CMAT 4PLIA 4HVWA 2EYYA 3OS2A 2DEQA 1LJOA 2P0PA 2RK1A 2K2MA 3EFRA 3G1JA 5DM7R 3BDUA 1QVFP 2LQWA 1PC0A 4RCBA 4D8KA 1ZA2B 2JW4A 4V2SA 5DLQE 4R0KA 2MMPA 3D7SB 3DB4A 4BI4A 3V7SA 4LE9A 3HRSA 2J05A 5GAOl 2X4XA 2KGTA 2CT3A 4PFZA 3GPLA 2OJ2A 2KSSA 2NUTA 4IKFA 5GANd 3MEVA 1W2BA 5LJ5j 3LWIA 1PHTA 4C5IA 1RLPC 3TREA 1B07A 4M4ZA 1KHCA 2RHZA 3CPWP 2F5KA 2KXDA 3REBB 3DLMA 2JM9A 2EPDA 3UF4A 2MWOA 5IT9E 2LZ6B 4YTLA 1KQSS 3CD6Q 4FSSA 2RD1A 2DJZA 2P4RA 3JCMf 2PVOB 1IHWA 2E3IA 2F2XA 1K4US 3BDLA 3CCLA 8AT1B 1NJIR 3QDRB 2X9HA 3HHTB 1N9RA 4C5EA 4Z02A 1XOVA 2D8JA 8ATCB 3ULRB 2O2OA 3QYHB 4RTWA 5KCOA 1KC8C 2HAXA 3QZ5B 4J83A 1MNEA 4RTVA 1NYFA 1LPLA 5A2QE 3JB9J 1CKAA 5GANg 1VQLQ 4L59A 5J26A 2DD4A 5CKHA 3OW2A 1YITT 1PCXA 3GP8A 4LD9K 4C92G 2C0TA 5CR2A 4HKEA 4HVUA 5GAN7 2V1QA 4LDXA 4RTTA 5KYUA 4FYWB 4R56A 1NPRA 2QQRA 2DYBA 3ZL7C 5IXFA 4OB3B 1VQKT 5GAN5 1K73C 1YITQ 4BDZA 4C8QE 1WQ7A 1N6AA 2LDMA 3TU4K 5D7UA 4B6MA 2BZXA 2D9TA 2FPFA 2EQUA 1NM7A 1VQ4A 4LUEA 3I5SA 1V29B 1VQLA 3RERA 1Q7YR 1TUDA 4ATOA 1ZLMA 1ARKA 3L2RA 1VQKQ 2YUNA 5KYYA 1QVGS 2XDPA 5J39A 1RI9A 1M2OA 4UC4A 1ZQ1A 3C94A 4C92E 2JMCA 2EQMA 3TVTA 2YXYA 4FU6A 1W6XA 2P0KA 1TUGB 1QLYA 3I55T 1KK7A 1M8MA 2E1HA 3M53A 4DEXA 2ESWA 4BB7A 1PSFA 1VQ4Q 3EH2A 4LNPA 5KYNA 2JJ9A 1VQ8T 1ZX6A 3JCMe 4M7AF 2O4XA 2QEXQ 1GCQA 1VQOA 4BDYA 3CC2T 1Q86U 2JTFA 3G4SA 3M0UA 1NEGA 4FYXB 1O75A 4B9WA 1AOJA 1M1KR 1WHKA 1H3ZA 4ZTFA 1TSFA 4AG1C 2RA2A 2FZKB 3X26B 1M1KC 4RKUE 1TXQA 1VQOT 4QQ6A 4II1A 4FT2A 2DYIA 1AHJB 1YNZA 2QTVA 2J06A 2MF2A 1WGSA 5KYXB 1GXIE 5I2SA 4C0DB 4M7AA 4GY5A 4EIKA 5IHKA 2GCXA 4BI3A 4BY6C 3EAEA 2BTTA 3N5BB 3EGXA 1N8RR 4XU1A 4C8QC 1UGSB 3MCAB 5GAMh 1B3QA 1VQ9Q 1QKXA 3JCMX 4D8DA 1RADB 3UPUA 2DERA 2JN0A 3KFVA 1Q95G 4OP0A 1OULA 4OB0B 2PUKB 3PE0A 3JRZA 4PJNA 3OS0A 4DBHA 4CI0C 2LNHB 2J6FA 2YLBA 4JZ4A 4JS4A 3G6ET 1FMVA 3FLGA 1BBZA 3HP9A 2EGAA 1VQ6A 1JO8A 4XU3A 2JNGA 2VYTA 4M78E 1KC8R 3A8OB 2GF7A 2FZCB 5KH6A 3I56T 3DLLA 2VUBA 3PVQA 1KD1C 1M4ZA 1TG0A 1KQSA 1OU9A 1OPKA 1U1TA 2EJFA 2CH4W 3X24B 4PJOC 5KYWB 1H3HA 1AWXA 1W4SA 5HY6A 4XU0A 3CXCP 2BIVA 1WA7A 2PZ1A 1QW1A 3M5AA 3WVEB 4C92A 3JCMV 2YUPA 3CC7T 3R6OA 3RMQA 4OB2B 2QA4Q 1G3YA 1SG5A 4JRQA 3M0QA 2EJ9A 1G83A 3CCRT 2ZZDA 1VQ5T 1WZOA 1UTIA 4M75F 3PTAA 3JB9F 1YJWQ 4OMQA 2QXFA 4N4HA 4QQDA 2KYBA 2RH2A 1QVGA 4HA8A 1C1AA 3MP1A 2L5QA 1TTHB 3HRUA 1U5SA 3SD4A 3CCRA 1WNLA 2E3HA 2EIFA 1KFZA 1ZSZC 3CCQA 2VB6A 2CP7A 2DZCA 4M7DG 2KE9A 2K5IA 3VS2A 1IXDA 5GAMj 3QHSA 1LCKA 2DXCA 1UB4A 2LRQA 2MAMA 2YUQA 2JMAA 2E70A 1Y96A 1P92A 4ELYC 4M77B 3CCQT 2L3PA 1CKBA 1VQ7Q 2XDDA 3CC4T 3TCJA 1BCMA 2DXTA 1S72Q 2D0QB 1F1BB 1OYXA 2B8AA 1VQKA 4A53A 9ATCB 3QO3A 3SHWA 1YWOA 4N0AA 1KD1U 4NS5A 2DETA 1NYGA 4JJBA 1CSKA 3CC4A 4OVAA 4M7AD 1OQKA 3G71Q 2RI5A 3M0RA 2MK5A 4EMHA 2A08A 2E5KA 2XDBA 3RBBB 3OY9A 2RN8A 5GAN2 1PRLC 1PD1A 4M7DB 4AFQC 3CMAA 1FX7A 3HPWA 1ZUUA 2FG0A 1YHQA 1U3OA 3A8GB 1M3BA 3G71T 2L3RA 1JBMA 4RTYA 4OGCA 2RJCA 2FEIA 3CCVA 1X6OA 2BZYA 2PVDB 4WTOB 4FYVB 3VS1A 2DA9A 3GF5A 2MYSA 1VQ7A 2HMAA 1D1CA 1G3TA 2P4TA 4A4EA 3I9QA 3Q1JA 1I1JA 5AYFA 3CCET 4OMPA 1PG5B 2M51A 3I35A 3X28B 3CCQQ 3JCMJ 4JLIA 1XQHA 1UEBA 2XG8D 1GFCA 5GJWB 2ECZA 2FPEA 3JB9I 1UE9A 1EX4A 2KT8A 4E7JA 3IQLA 1ZUYA 4JRIA 4M75A 3CEYA 2YLCA 3P8HA 2RF0A 2WSCE 4PJJA 2VV5A 1K9MR 1Y71A 3J7AF 2M16A 2ATCB 2QASA 2ZCFB 3NPFA 1WDXA 4ZN3A 2H3JA 3QJ6A 1QQJA 3V7RA 1WHGA 2OTLQ 4C0DC 2IPOB 2NYSA 2Y4XA 1V76A 4X1VA 1VUBA 2A37A 3SDZA 1YP5A 4C8QD 1AD5A 4LD6A 4RCCA 1JXOA 1KSWA 1X6BA 1KQ2A 1OZ2A 2JOYA 2DL8A 3OBYA 3MJXA 2DL3A 4FYYB 3H6ZA 1UHFA 2DEUA 3RNJA 4M75B 4XK8E 1EZZB 2KQWA 2RHXA 2X4YA 1AWJA 1M9SA 3V7CA 2HSEB 3I55Q 3OS5A 4QW2A 4M75C 3M0TA 4FW2A 4HT8A 3GNGA 1MV3A 4HCZA 3VS5A 2NUTB 3NGPA 5LJ5e 1N5ZA 4M77D 2K3XA 2QQBA 4QT7A 3I56A 3OMGA 2PNIA 3URGA 1B7TA 2IIMA 4AFSC 2DILA 3LW5E 3ZEHA 1WXTA 2R5AA 2G6FX 2J7IA 2JTMA 2RHIA 3BY7A 2CP3A 1SSHA 2QK0A 4M7DA 2ABLA 2JM8A 4RG2A 1BI2A 2V8KA 1YIJT 1ZSZB 2CZ1B 2J6OA 3U23A 1MMAA 3PVLA 2Y4YA 3DB3A 3NTHA 4A4GA 4EPCA 1MMGA 1WYXA 2HSPA 2M0YA 2HQXA 2CP0A 2EFIA 1M1FA 2X4JA 5GMKl 2KVQG 2HKNA 2FO0A 1H8KA 2NUPA 1HXDA 3PNWC 5LJ3e 3MEUA 4DA4A 1OEBA 4LN2A 3OYCA 3H9NA 3OSSC 2LJ3A 3EHRA 4IUVA 3OBWA 1SF9A 2MOXA 5LJ3g 1T3SA 4C92F 5LJ5f 1ABOA 2O4XB 1Y96B 2AK5A 2EKOA 2LCLA 1SHGA 3X20B 1T3LA 4RMOA 3EGDB 1QVFS 3CC2A 2ZPIB 1KD1R 3FDRA 5CCAA 1M30A 4DEYA 1MNDA 3CCEQ 2O9SA 4PJOA 3MKDA 4M7DC 2A28A 5HCKA 1SSFA 3CBMA 5GANj 2F2WA 2J6KA 3THKA 1U06A 1SPKA 5LJ5g 4A54A 1WQWA 2CUDA 4MZTA 2C0IA 3L2QA 3VRYA 1FXXA 4PFOA 2COYA 1BI3A 3I56Q 1M90U 1X43A 3LYIA 1RACB 2DBMA 2EQJA 2RM4A 3CCMA 3M0PA 2H3EB 4X34A 1NJIU 3H0FA 5CQXA 3PMTA 3EGUA 2DIQA 4J7FA 4BE2A 1NJIC 4C92B 3ASKA 2RJFA 3VS6A 4E7ZA 2XICA 4LUDA 1NE8A 2CP6A 3EG9A 2MIOA 5LJ5d 2PTKA 3G71A 1N27A 2QGGA 2R5MA 2KK4A 2RMOA 4LDVA 3CCMT 3CCVT 4P5NA 3WVDB 5GMKi 5D6YA 4Y28E 4PKCC 5HK0A 3CCEA 1BU1A 3F70A 2RNAA 3HL8A 4L5GA 3NHNA 5KYUB 2QA4A 4M7AG 2DXUA 3JV3A 4JJDA 1M3AA 4J6XA 3QWYA 1W70A 4PK4A 1MMDA 3QPHA 5IN1A 5A0LA 2CS7A 1K9AA 4C5GA 2X3XD 4F7UE 4F7UB 1R0BG 4J9FA 4RG8A 4JRPA 3S3MA 2CSIA 1ZHIA 2DL4A 5GAMf 2X3WD 1KC8U 2RJDA 3OW2S 3OB9A 3NTIA 4QVZA 3S6WA 4J9IA 4QVCA 5DLOA 1D1AA 1BYMA 3OYKA 1BB9A 2Z0WA 4MMKA 4J5YA 3M58A 4Z89A 3CXCS 1X69A 1PNJA 5GANf 1QVGP 1VQ5Q 5A0GA 3OYBA 2HBPA 2DKGA 2OAUA 2OTLT 2OX7A 5I21A 3QXEB 2WSEE 3CC7Q 1WI7A 1VYVA 4OMLA 1Y57A 3EG9B 3C4SA 1YJWT 3S3NA 1K9MU 4ORZA 1KIKA 1HSQA 1XNIA 1MV0B 4C8QF 2VASA 3CCRQ 1VQNQ 1HYOA 4M78B 2CSQA 3VS0A 2LCSA 2PQWA 4C8QG 2QQAA 5GAMe 4A4KA 3LH5A 2L8DA 4OMFB 1VQ9A 1RAAB 1VQMA 2K6DA 2ZPGB 3FEOA 5GMKe 3MHXA 1W1FA 4HCBA 1Q86C 2H8HA 2HQEA 4AG2C 1QP3A 2MI6A 3WXMB 3FJ5A 4E47A 2LT1A 4IUPA 2Y90A 5GAN6 1VQMT 1ZBJA 4HVVA 3RESA 2C06A 4HT9A 3CCUA 1Q7YC 4J9BA 3E9GA 2RPNA 5CKFA 3CC7A 1U1SA 3UT1A 4PJOD 4BE0A 4J9CA 1IZ6A 3LLRA 1NPPA 4LDUA 2RJEA 2KBTA 1DJ7B 2KRMA 3C95A 2CZ7B 5FWBA 3VU3C 4KGZB 4OMNA 2DVJA 5FU7B 2QA4T 2CZ6B 1GRIA 2GTJA 1IO6A 3CCJQ 1FYNA 1E6GA 3VJPA 2HKQB 1OI1A 2DFUA 3C12A 2MWPA 4PL6A 1YHQQ 2A7YA 1NLPC 1D1BA 1Q82U 4E7HA 2HL5C 2KNBB 3P8BB 1Q7YU 2FVUA 1ZBXA 1M90R 2EQIA 2EQKA 3E1SA 3JCMb 1C6VX 2O88A 3S3OA 2PUOB 2OTJT 2AKKA 3CCMQ 2LP5A 3OYJA 2EKHA 5GANe 2QDYB 2GGRA 2HCKA 3OYGA 1PWTA 4M78D 4FM4B 2AHJB 4KT0E 3FB9A 2GQVA 1G8XA 1PKTA 2XHCA 4JJCA 4GLMA 5CVIA 2COZA 2KEAA 2LNVA 1QWEA 1WHJA 3CC2Q 1R77A 3PMIA 1LNXA 3BFMA 1G3WA 4QQGA 2VKNA 3GIBA 2QQ9A 2YRDA 2FYKA 1R0CB 4XTUA 2CT4A 5A0DA 2E10A 1K8AC 1RAGB 4M77A 1VIEA 4RUGA 2K5LA 1R8OB 2LCCA 1YI2T 3EG2A 4C0FA 2KAFA 3CMET 1UGPB 2LJ1A 3EH1A 4Q5WA 1PM3A 3AHUA 3HFNA 3QKJA 4J9GA 5IHIA 5FRMA 4J8OA 3CC4Q 1K1ZA 2DRKA 3OQ5A 3OYDA 4MDXA 2P0QA 3CCJA 1QCFA 3CQTA 1IGUA 3LX7A 1YIJQ 2LQNA 3MP6A 1OZ3A 4J9HA 4F7UA 3VS7A 1MUZA 4ME7A 2E41A 2X4WA 1NG2A 1V1CA 4AFZC 3TSWA 3H0HA 1BCOA 1VQ5A 1VIFA 3L1AA 2PVGB 1WJSA 4M75G 2DBKA 3JB9G 3SEMA 4JZ3A 2GFUA 2RHYA 1YWPA 2FB7A 3X25B 1VQ6Q 1KQSP 5GAOm 1RAFB 1PD0A 2X51A 2HDAA 2AZVA 2YRVA 2RI3A 3ER0A 2D1XA 2EAYA 2A36A 2P84A 1JU5C 4E7KA 2K79A 2GQIA 2BE9B 2XD0A 3JCMc 1AZEA 3J80E 1OU8A 4M78G 2FZGB 4A63B 2L0AA 2IVWA 4EMKA 1UGVA 1GCPA 3TEEA 3OYNA 3HRTA 4PNOA 1WHMA 4C5HA 1QCNA 4HCKA 2QDLA 1M1KU 5D6XA 3LWHA 4JPBW 3A98A 1Y0MA 3QG1A 2FRWA 4M78C 5D6WA 4RTXA 4J7IA 3RKWA 2F1LA 3L2UA 1Q86R 1VQ8Q 2X35A 3LGFA 1MMNA 2WACA 5GAMd 3I5RA 1JEGA 1OX8A 3VUBA 1YJNQ 2HNIA 2JUFA 1XTDA 2A0FB 3PGGA 3A8MB 2FL7A 2M9UA 2VGMA 4PJMA 5FW9A 1UG1A 2M02A 5GMKh 5GAOq 3M54A 2VC8A 3CCUT 5LJ3j 1QKWA 1AZGB 2RQUA 2CKKA 2VWFA 5LJ5h 3MEWA 2QTXA 2R58A 1BKBA 1A0NB 5IXBA 2HQHA 2RQRA 2LTOA 3SWNB 4M7DE 4KGXB 4CC7A 2NWMA 1EFNA 2XKOC 2HBWA 4QVDA 3CCST 2BZ8A 2ED0A 2V8IA 1YBYA 1JJ2P 4IURA 2BKDN 1S1NA 3G6EA 3G7ZA 1YJNA 5J3BA 3A8HB 4XAXB 5GAMg 1H92A 1Y7XA 3OYIA 5GANh 3C0CA 2AT1B 3QIIA 4J9EA 4X9CA 3HSBA 4M77G 4RTZA 1KQ1A 3CD6T 2EYZA 4Y91A 4M77F 4E7LA 2ZPBB 4ELZC 2YWWA 1TUCA 1PRMC 4N0AC 2IG0A 3BE3A 1Y07A 1G3SA 3JSCA 2EBPA 1IRXA 3CMEQ 4JS5A 5KE3A 1TH7A 2F69A 4F16A 3PIPA 1UECA 4FSXA 4O6JA 4CC2A 4E7SA 1YJ9Q 3VV0A 2KYMA 5LJ3f 4DBFA 1QCOA 4J9DA 5C6SA 1M2VB 2DM1A 3AT1B 3CBPA 1D3BA 4JUVA 4DOVA 2YDLA 4XTXA 4FL6A 3JCMP 3OYAA 3JCMh 1KJWA 3PIOA 3VYHB 4BY6B 1YCSB 3VS3A 4OMOA 3A8LB 2OTLA 1K8AU 1YI2A 5CKEA 1NEBA 4ZNXA 3REAB 2QGFB 2DF6A 2OTJQ 2I2LA 3BW1A 2DL7A 3RMSA 4LDWA 1YJWA 4OMMA 2A3LA 1W2BS 1JRIA 2E65A 4C0ZA 1VQ6T 2ZPEB 4KBMB 2ZPHB 4KRTA 3EG1A 1G5VA 4F04B 1X2KA 3CCJT 3NFCA 1K9MC 1GCQC 1Z9ZA 1E6HA 1RUWA 2E4HA 5IAYA 1GFDA 4RTUA 3CXCA 2NUZA 1K73R 2L3SA 5HK3A 2G3RA 1VOMA 3P8DA 1TOVA 2L2PA 3EGDA 1RAIB 4XU2A 2YHTA 2K3YA 3OA6A 2LVMA 4E6RA 2YRCA 1X27A 4IUTA 3LGLA 4KUIA 2L3QA 1ACMB 1MGQA 2M1HA 3SWNA 3CCSA 4IIMA 1VQNT 2HZYA 2KDSA 1QVFA 4OF1A 3T9NA 3OMCA 1I5LA 2DNUA 1IHVA 3OYYA 3JCMg 2DX1A 2HL3A 3L2ZA 1TS9A 5HKCA 2YUOA 4ANJA 3UWNA 2NUPB 4IUQA 1OV3A 2DJQA 1NLOC 2NLUA 4XTZA 5FWCA 2FRYA 1N8RU 2E64A 3V8LA 3OYLA 3NTKA 4M7AE 4E7IA 2EYXA 5I2MA 3SFMA 2DIGA 3META 4MDWA 1IB8A 2XK0A 3RKXA 4GLKA 4Y92A 3PT9A 2K4YA 3UDCA 1PSEA 2RB6A 5CAIA 2COWA 1HJDA 2OTJA 4L6V5
chains in the Genus database with same CATH topology
3C12A 2MWPA 2L3RA 3G71T 3L42A 1JBMA 4XTVA 3OYMA 4PL6A 4OGCA 1LOJA 2A7YA 1BI0A 2RJCA 2M0OA 3E19A 3OYFA 5GAN4 4JJNK 1BIBA 4E7HA 1Q82U 3P8BB 3CCVA 4D6WA 1Q7YU 1X6OA 2PVDB 2FVUA 1ZBXA 3CMAT 4PLIA 2EQKA 3E1SA 3JCMb 3GF5A 4EMKB 4XTYA 3OS2A 2K57A 1VQ7A 2DEQA 3S3OA 1LJOA 2PUOB 2OTJT 2EJGA 1G3TA 2P0PA 2P4TA 2RK1A 4A4EA 3Q1JA 3OYJA 3E9FA 5GANe 3EFRA 2QDYB 3INZA 5AYFA 4C0GA 3OYGA 4M78D 5FLXE 3BDUA 5DM7R 3CCET 4FM4B 1H641 2AHJB 2E5QA 4KT0E 3FB9A 2GQVA 4RCBA 4NL2A 1VQ9T 3X28B 3JCMJ 4JLIA 2XHCA 3VKIA 1XQHA 4V2SA 1UEBA 2XG8D 3RUXA 3M57A 5DLQE 5CVIA 4MMLA 3JB9I 3VUZA 2LNVA 2MMPA 4E7JA 3DB4A 4JRIA 4M75A 4BI4A 3V7SA 3CEYA 1YHQT 2YLCA 3P8HA 3HRSA 1WJRA 2WSCE 3PMIA 1YJ9T 4KUDK 1WJQA 5GAN3 5GAOl 2VV5A 2X4XA 1LNXA 1Y71A 3J7AF 2M16A 5CO7A 3BFMA 2ZCFB 3CMEA 1G3WA 4QQGA 4ZN3A 2H3JA 3GPLA 1YJNT 3ME9A 1I81A 3QJ6A 3GIBA 2KSSA 2QQ9A 3QYGB 3V7RA 2FYKA 4DOWA 4IKFA 4C0DC 5GANd 3MEAA 3MEVA 3O8VA 4XTUA 5A0DA 3FJPA 5LJ5j 1W2BA 2Y4XA 2E10A 4EMKC 1K8AC 1VUBA 4EMGA 4M77A 3LWIA 3SDZA 1VIEA 5C0MA 2K5LA 1R8OB 4C5IA 1JJ2S 3TREA 1KG1A 2LCCA 4JLGA 1YI2T 4C8QD 2K5FA 4C0FA 2KAFA 4LD6A 3QUIA 3CMET 1UGPB 5GMKm 1VQ4T 4RCCA 5GMKj 4HCCA 1KHCA 2RHZA 1KQ2A 2F5KA 1OZ2A 3DLMA 2JOYA 3PFSA 3OBYA 4Q5WA 4N4IA 2DZ9A 3AHUA 3HFNA 3H6ZA 3JCMd 3V8KA 2DTIA 3QKJA 2QEXT 2MWOA 5IT9E 4YTLA 1KQSS 1I8FA 2RD1A 5GAOn 4DQ2A 2DJZA 5FRMA 4J8OA 3JCMf 4M75B 2PVOB 4XK8E 1JB0E 3BDLA 3OQ5A 3OYDA 3CCLA 1B34A 4MDXA 2KQWA 2P0QA 3QDRB 3CCJA 1JJ2A 1RL2A 3HHTB 3OS1A 1I4K1 3J81E 1N9RA 4C5EA 2RHXA 3OSVA 3LX7A 2X4YA 3GLXA 1M9SA 3I55A 2DO3A 3V7CA 4Z02A 1XOVA 1OZ3A 3MP6A 4OGEA 4NL3A 2QEXA 4F7UA 2KY9A 3QYHB 5KCOA 1KC8C 4ME7A 2HAXA 2WSFE 3QZ5B 4J83A 1D3BB 5KE2A 2E41A 3OS5A 2X4WA 4QW2A 4M75C 5KCHA 2E12A 3CPFA 3CCLT 4HT8A 3GNGA 5A2QE 3JB9J 5GANg 1EIFA 4TVRA 5M9OA 4HCZA 4L59A 5CKDA 5J26A 1VQ5A 2F5TX 5LJ5e 1VIFA 2DD4A 2GFAA 4M7AC 5CKHA 3OW2A 1YITT 2K2VA 4M77D 2DAQA 2PVGB 3L1AA 4C92G 3GP8A 4LD9K 1VQ8A 2K3XA 2QQBA 5CR2A 2XIDA 1WJSA 2FHDA 3OMGA 4HKEA 2QQSA 5GAN7 3I56A 1S72A 5GAN8 3URGA 4M75G 4LDXA 3MP8A 3ZFJA 3JB9G 5FROA 4R56A 3M55A 3LW5E 3SB2A 1NPRA 3JCMQ 5FU6C 2QQRA 3ZEHA 3FIFA 2GFUA 2R5AA 2RHYA 2FB7A 3X25B 4OB3B 2JTMA 2RHIA 5EG2A 5GAOm 1VQKT 4M7DF 2QI2A 3BY7A 5GAN5 1K73C 2YRVA 4BDZA 1M8VA 4M7DA 4C8QE 1WQ7A 4RG2A 1BI2A 2V8KA 1BIAA 2RI3A 3ER0A 1YIJT 1N6AA 2LQKA 2EAYA 2CZ1B 4BE1A 2LDMA 3TU4K 4M7AB 2Y4YA 3DB3A 3NTHA 4A4GA 4EPCA 4E7KA 2D9TA 2XD0A 3JCMc 3QZ9B 4PLLA 2EQUA 2HQXA 4XTWA 4M78G 3J80E 3FC3A 1X01A 2EWNA 2EFIA 2IVWA 1M1FA 1VQ4A 2X4JA 4EMKA 5GMKl 2KVQG 1BI1A 1V29B 4M7DD 3TEEA 1VQLA 2L89A 3OYNA 3HRTA 3L2VA 3RERA 4PNOA 4ATOA 1HXDA 3PNWC 5LJ3e 4IUUA 2RK2A 4C5HA 3MEUA 3ZBDA 4DA4A 3L2RA 1M1KU 3OYCA 5D6XA 3LWHA 3OSSC 3QBYA 2R57A 4IUVA 2XDPA 5J39A 1QVGS 3OBWA 4O5VA 3QG1A 4M78C 4UC4A 1ZQ1A 5D6WA 5LJ3g 3C94A 4C92E 4J7IA 3RKWA 4C92F 2EQMA 5LJ5f 3L2UA 4FU6A 2XU8A 2X35A 3LGFA 2P0KA 2O4XB 1Y96B 2PU9B 3M4YA 2EKOA 2WACA 3I55T 4F7UG 2LCLA 5GAMd 2E1HA 3M53A 3X20B 3VUBA 4WF2A 4RMOA 2HNIA 2JUFA 4F7UF 2BUDA 1XTDA 2DXBA 3PGGA 4BB7A 3A8MB 1QVFS 3CC2A 5CQYA 1N9SA 2ZPIB 1FWZA 2FL7A 1PSFA 3FDRA 5CCAA 2M9UA 1VQNA 1UGRB 4PJOG 4BI8B 4PJOA 2VGMA 2LT4A 5GMKh 4M7DC 5GAOq 1Q81C 1VQ8T 3M54A 2LQ8A 4BD3A 1U8RA 4PJOF 2VC8A 3CBOA 1SSFA 3JCMe 3CCUT 2V8JA 5LJ3j 4M7AF 3CBMA 5GANj 2O4XA 4M78F 1VQLT 1VQOA 2CKKA 5LJ5g 5LJ5h 3MEWA 4BDYA 2O01E 2QTXA 3CC2T 4A54A 2R58A 4ZGJB 1BKBA 1Q86U 1WQWA 2JTFA 4MZTA 3G4SA 1NZ9A 3L2QA 1FXXA 2LTOA 3SWNB 4M7DE 1BI3A 4NOYA 1M90U 2KMTA 3GOXA 2XKOC 1O75A 4LDYA 4B9WA 4QVDA 2VXFA 3QJYA 3CPWS 3LYIA 5DY9A 3CCST 4OB1B 4PJOB 1H3ZA 4ZTFA 2RA2A 2V8IA 2EQJA 3X26B 1M1KC 1YBYA 2RM4A 4RKUE 4IURA 1VQOT 3CCMA 2BKDN 4QQ6A 4II1A 3G6EA 4FT2A 3CD6A 4C8QB 3G7ZA 2DTOA 5J3BA 1YJNA 1K73U 2HD0A 3M56A 4M78A 1AHJB 4X34A 1NJIU 2JVVA 3A8HB 4XAXB 5CQXA 3PMTA 4J7FA 2DIQA 2MF2A 1WGSA 1GXIE 1RI0A 4BE2A 5GAMg 1NJIC 3H8ZA 4C92B 3ASKA 2RJFA 1Y7XA 2XICA 5I2SA 5GANh 3OYIA 1NE8A 3QIIA 4C0DB 4M7AA 4GY5A 2DD5A 4X9CA 4C92C 5LJ5d 1N27A 2R5MA 1M1GA 2GCXA 4M77G 4BI3A 4BY6C 3G71A 1KQ1A 2KK4A 3EAEA 3HSBA 3OYEA 4LDVA 1UGQB 3CD6T 4ZGDB 4Y91A 3CCMT 3CCVT 3N5BB 4M77F 4M75D 2ZPBB 4XU1A 4P5NA 3WVDB 4ELZC 4E7LA 4C8QC 3JB9D 5GMKi 1UGSB 4N0AC 2IG0A 3MCAB 4MZPA 4Y28E 1Y07A 4PKCC 5D6YA 5HK0A 5GAMh 3CCEA 1G3SA 3JSCA 1Q82C 3F70A 3HL8A 4L5GA 3JCMX 3UPUA 4BACA 2JN0A 1S72T 2QA4A 4JS5A 4OP0A 5KE3A 4M7AG 4OB0B 1TH7A 2F69A 2PUKB 3PIPA 2DXUA 2ZGWA 3JRZA 1Q81U 3OS0A 3KUFA 4CI0C 4FSXA 3SWNC 4O6JA 4M77E 2VGNA 3VV0A 4J6XA 2YLBA 4JRKA 4A4HA 1VQPA 5LJ3f 3JCMW 4JS4A 3G6ET 3QPHA 1YJ9A 3FLGA 2RO0A 5C6SA 5IN1A 3HP9A 5A0LA 2RI2A 1VQ6A 3CBPA 2CS7A 4C5GA 1KHIA 1D3BA 3CPWA 5CKBA 4XU3A 2JNGA 2VYTA 4JUVA 4M78E 4F7UE 1YITA 4F7UB 1N8RC 4RG8A 4DOVA 2E6ZA 2LX9A 3A8OB 3GNFB 4JRPA 1ZHIA 2GF7A 5GAMf 5KH6A 3S3MA 3M9QA 4XTXA 3I56T 2CYZB 2VUBA 3DLLA 1KC8U 2RJDA 3OW2S 3OB9A 1M4ZA 1VQPT 1KD1C 3NTIA 4FL6A 4QVZA 3VYGA 1KQSA 3S6WA 3RIRA 1U1TA 3JCMP 2EJFA 3X24B 4QVCA 3OYAA 4ZTJA 4PJOC 5DLOA 3KBGA 3JCMh 1W4SA 5HY6A 4XU0A 2BIVA 3PIOA 1HK9A 1BYMA 1QW1A 3M5AA 3VYHB 2CZ0B 3JCMV 3WVEB 4BY6B 1YCYA 4C92A 3OYKA 3R6OA 3CC7T 3RKYA 4ZN1A 5FU7C 3A8LB 2OTLA 3RMQA 3M4GA 1K8AU 4OB2B 1YI2A 5CKEA 4JDSA 2DTHA 4R55A 4MMKA 4J5YA 3M58A 3JAME 3CXCS 1G3YA 5GANf 2I2LA 5A0GA 3BW1A 2E6NA 1WPYA 4JRQA 3OYBA 3RMSA 4LDWA 5LJ3h 2EJ9A 2HBPA 3CCRT 2CGHA 2ZZDA 1YJWA 2LC4A 2DKGA 2OAUA 1VQ5T 2A3LA 4VUBA 1QVPA 1W2BS 1JRIA 2E65A 4M75F 4C0ZA 2OTLT 5I21A 3OYHA 3PTAA 2ZPEB 4KBMB 2ZPHB 1VQ6T 3JB9F 3QXEB 5FU6B 2WSEE 2QXFA 4N4HA 4QQDA 1QP2A 3L2WA 2RH2A 1QVGA 1M5Q1 4HA8A 3MP1A 1G5VA 2L5QA 1B34B 3CCJT 3NFCA 1K9MC 3HRUA 3SD4A 3C4SA 5GAOp 1YJWT 3S3NA 4EDUA 3CCRA 1WNLA 1K9MU 2D6FA 4J6WA 2EIFA 3EFSA 4M77C 1VQ7T 5IAYA 1XNIA 3FRNA 3CCQA 4C8QF 4ZGEB 3CXCA 2DZCA 4M7DG 2VXEA 4M78B 3KXTA 1YIJA 4C8QA 2K5IA 5HK3A 2G3RA 2PQWA 4C8QG 3P8DA 2QQAA 3HFOA 5GAMe 5GAMj 3QHSA 4J6YA 4XQ3A 4XU2A 2DXCA 2YHTA 3HKSA 1UB4A 2LRQA 4A4KA 2K3YA 2L8DA 2LVMA 4OMFB 3V8JA 2MAMA 3OA6A 1VQ9A 4MZMA 5LL6S 1VQMA 4IUTA 3MO8A 4A4FA 2XI9A 2ZPGB 2E70A 3FEOA 3LGLA 3MHXA 5GMKe 4KUIA 4HCBA 1Y96A 1Q86C 2HQEA 2EYQA 5CK9A 1P92A 4ELYC 1MGQA 1QP3A 4M77B 2M1HA 4KULA 3SWNA 2MI6A 3CCQT 3WXMB 4CRIA 3CCSA 1VQNT 2KDSA 1QVFA 3JB9H 4E47A 2XDDA 3CC4T 4OF1A 3T9NA 3M59A 3OMCA 2LT1A 4IUPA 3TCJA 1O9SA 1I5LA 2DXTA 2DVEA 2Y90A 2D0QB 4FT4A 1IREB 2DPPB 3OYYA 1OYXA 3JCMg 2JZ2A 5GAN6 4N4GA 2RHUA 2B8AA 1VQMT 5CIUA 1VQKA 4A53A 1M90C 3L2ZA 5HKCA 3RESA 3UWNA 1MHNA 2C06A 3QO3A 4HT9A 1X75C 4IUQA 3CCUA 4N0AA 1Q7YC 1KD1U 4NS5A 2NLUA 2ZPFB 3E9GA 4XTZA 3DKMA 5CKFA 3CC7A 1U1SA 3UT1A 3A5ZB 1N8RU 4BE0A 4PJOD 2E64A 1IZ6A 3LH0A 3LLRA 4OVAA 3NTKA 3V8LA 3OYLA 1NPPA 3CC4A 4M7AD 3G4ST 5GAOr 2RI5A 4M7AE 4LDUA 4B9XA 4EMHA 2RJEA 4E7IA 1DJ7B 3C95A 2XDBA 2CZ7B 5I2MA 3SFMA 2DIGA 3OY9A 3META 5GAN2 4FIBA 5L8RE 3VU3C 4MDWA 2DK3A 5FRNA 4M7DB 2XK0A 4C92D 3CMAA 5FU7B 1FX7A 3HPWA 5LJ3d 3RKXA 4GLKA 2QA4T 2CZ6B 3PT9A 2K4YA 4M75E 1PSEA 2RB6A 3UDCA 4X9DA 3QSUA 4L6V5 5CAIA 1YHQA 3VJPA 4BUGA 4PJOE 3A8GB 2OTJA 1OI1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MMK A;  1D3B B;  4J5Y A;  1JBM A;  2E41 A;  4M78 F;  4XTV A;  5LJ5 g;  5LJ5 h;  1LOJ A;  4M75 C;  5GAN f;  2QTX A;  4A54 A;  1WQW A;  2I2L A;  1BIB A;  5GAN 4;  4HT8 A;  3BW1 A;  3JB9 J;  1WPY A;  5GAN g;  3SWN B;  5LJ3 h;  2EJ9 A;  2CGH A;  4M7D E;  5LJ5 e;  4M7A C;  2DKG A;  4NOY A;  3JCM b;  4EMK B;  4XTY A;  4M77 D;  1JRI A;  2E65 A;  2K57 A;  3L1A A;  2DEQ A;  4M75 F;  4C92 G;  1LJO A;  4QVD A;  5I21 A;  2VXF A;  2EJG A;  3JB9 F;  5DY9 A;  4PJO B;  5GAN 7;  5GAN e;  3EFR A;  2RA2 A;  3INZ A;  5GAN 8;  4M75 G;  2RM4 A;  4M78 D;  3JB9 G;  1M5Q 1;  3BDU A;  4HA8 A;  3SB2 A;  3JCM Q;  4C8Q B;  2DTO A;  1H64 1;  1B34 B;  4M78 A;  3FIF A;  3FB9 A;  2FB7 A;  4NL2 A;  4RCB A;  5GAO p;  3JCM J;  4JLI A;  5GAO m;  5GAM g;  1WNL A;  4M7D F;  4C92 B;  3BY7 A;  4J6W A;  5GAN 5;  3EFS A;  4M77 C;  4V2S A;  5GAN h;  3RUX A;  1M8V A;  4M7D A;  4C8Q F;  4C8Q E;  4M7A A;  1WQ7 A;  2DZC A;  1BIA A;  4M7D G;  4X9C A;  2VXE A;  4M78 B;  2EAY A;  4MML A;  4C92 C;  5LJ5 d;  4M77 G;  4C8Q A;  3JB9 I;  3HSB A;  1KQ1 A;  5GAM j;  4M7A B;  4C8Q G;  4JRI A;  5GAM e;  3HFO A;  4M75 A;  3V7S A;  3QHS A;  4J6Y A;  4XQ3 A;  2YLC A;  4Y91 A;  4XU2 A;  2YHT A;  4M77 F;  4M75 D;  3JCM c;  4XU1 A;  3V8J A;  4XTW A;  5GAN 3;  4C8Q C;  5GAO l;  4M78 G;  3JB9 D;  1LNX A;  1X01 A;  5GMK i;  4N0A C;  2EWN A;  3BFM A;  5GAM h;  5GMK e;  4EMK A;  5GMK l;  1Y96 A;  1I81 A;  4M7D D;  3GIB A;  3V7R A;  3JCM X;  2FYK A;  1MGQ A;  3RER A;  2JN0 A;  4M77 B;  4PNO A;  3SWN A;  4XTU A;  5GAN d;  1HXD A;  3FJP A;  4OP0 A;  5LJ3 e;  5LJ5 j;  4M7A G;  3JB9 H;  1TH7 A;  2E10 A;  4EMK C;  4EMG A;  4M77 A;  2DXU A;  2ZGW A;  1I5L A;  2DXT A;  3SWN C;  4M77 E;  2DVE A;  2Y90 A;  4J6X A;  2YLB A;  4JRK A;  4C8Q D;  3JCM g;  5LJ3 f;  5GAN 6;  3QUI A;  3JCM W;  5GMK m;  4RCC A;  5GMK j;  4M78 C;  1KQ2 A;  4A53 A;  3L2Z A;  5LJ3 g;  3RES A;  4C92 E;  4C92 F;  3RKW A;  3QO3 A;  5LJ5 f;  4HT9 A;  2DZ9 A;  3AHU A;  3HFN A;  1D3B A;  1Y96 B;  4N0A A;  3JCM d;  4XTZ A;  2DTI A;  4XU3 A;  4JUV A;  3V8K A;  4F7U E;  4M78 E;  1U1S A;  4F7U B;  4F7U G;  5GAM d;  4PJO D;  2E64 A;  2E1H A;  3V8L A;  4M7A D;  1I8F A;  2RD1 A;  5GAM f;  5GAO n;  4WF2 A;  4DQ2 A;  5GAO r;  2DJZ A;  2HNI A;  4XTX A;  4M7A E;  4F7U F;  4EMH A;  3JCM f;  4M75 B;  3PGG A;  3RIR A;  1U1T A;  3JCM P;  1N9S A;  2EJF A;  1B34 A;  4QVC A;  5GAN 2;  4PJO C;  3VU3 C;  3JCM h;  4M7D B;  1I4K 1;  4C92 D;  4XU0 A;  1N9R A;  5LJ3 d;  3RKX A;  4PJO G;  1HK9 A;  4C92 A;  4M75 E;  3JCM V;  2RB6 A;  1YCY A;  3QSU A;  4X9D A;  4PJO A;  3V7C A;  5GMK h;  3RKY A;  4M7D C;  5GAO q;  5CAI A;  4NL3 A;  4F7U A;  4PJO E;  4PJO F;  2VC8 A;  3M4G A;  3JCM e;  5LJ3 j;  4M7A F;  2DTH A;  5GAN j; 
#chains in the Genus database with same CATH topology
 1QMC A;  3HTR A;  2JTE A;  1LOJ A;  2M0O A;  3OYF A;  4JJN K;  1BIB A;  2JS2 A;  2GNC A;  1VQP Q;  2EVR A;  1C0M A;  1E7O A;  2ENM A;  4EMK B;  4XTY A;  2LMJ A;  2K57 A;  1GL5 A;  2EJG A;  3E9F A;  3INZ A;  4C0G A;  1GBQ A;  1JQQ A;  5FLX E;  1H64 1;  2E5Q A;  1VQ9 T;  4NL2 A;  3EFO A;  3H41 A;  3VKI A;  4GBQ A;  3RUX A;  1D0X A;  3M57 A;  5GJV B;  4MML A;  2KI7 A;  3VUZ A;  4ESR A;  1YHQ T;  2AZS A;  1WFW A;  1WJR A;  1YJ9 T;  3OW2 P;  4KUD K;  1WJQ A;  5GAN 3;  1D0Z A;  5CO7 A;  3CME A;  1YJN T;  1VYT A;  3ME9 A;  1I81 A;  3QYG B;  4DOW A;  2D0N A;  3MEA A;  3O8V A;  2OI3 A;  3FJP A;  5EC7 A;  4EMK C;  4EMG A;  3A1P A;  5C0M A;  3CCS Q;  1JJ2 S;  1KG1 A;  4JLG A;  2EW3 A;  1G2B A;  2K5F A;  3QUI A;  5GMK m;  1VQ4 T;  5GMK j;  1WHH A;  4HCC A;  5ECA A;  6AT1 B;  1JXM A;  3PFS A;  4N4I A;  5I22 A;  1WXB A;  2DZ9 A;  3JCM d;  3V8K A;  2DTI A;  2QEX T;  1RAE B;  3CCU Q;  1I8F A;  5GAO n;  1X6G A;  4DQ2 A;  5IH2 A;  2KXC A;  5KYW A;  1JB0 E;  1B34 A;  4FCY A;  3NMZ C;  1JJ2 A;  1ABQ A;  1RL2 A;  3OS1 A;  1I4K 1;  3J81 E;  4CC3 A;  3OSV A;  3GLX A;  1Z9Q A;  3EFO B;  4Z88 A;  2DO3 A;  3I55 A;  2QEX A;  4OGE A;  4NL3 A;  2KY9 A;  2DRM A;  2WSF E;  5KE2 A;  1D3B B;  4LXC A;  5KCH A;  1UUE A;  2E12 A;  3CPF A;  3CCL T;  1RAB B;  1EIF A;  4TVR A;  5M9O A;  5CKD A;  2F5T X;  4M7A C;  2GFA A;  1W2B P;  2K2V A;  2DAQ A;  3VS4 A;  1VYU A;  1VQ8 A;  1SKU B;  1S72 A;  2XID A;  2FHD A;  2AIR B;  2QQS A;  5GAN 8;  1HD3 A;  3MP8 A;  3ZFJ A;  5FRO A;  3M55 A;  3SB2 A;  3JCM Q;  5FU6 C;  3O5Z A;  3FIF A;  2ZAE A;  1SRM A;  4KH0 B;  5EG2 A;  2W0Z A;  4M7D F;  2QI2 A;  2RQW A;  1OOT A;  1M8V A;  4QKU A;  2QG9 B;  1BIA A;  2LQK A;  7AT1 B;  4BE1 A;  4AT1 B;  1ZA1 B;  4M7A B;  3TSZ A;  3CCL Q;  4KH1 B;  1SRL A;  1I0C A;  3QZ9 B;  4F17 A;  4PLL A;  4XTW A;  3FC3 A;  3CMA Q;  1X01 A;  2EWN A;  4AMC A;  4M7D D;  1BI1 A;  2CRE A;  2DMO A;  2L89 A;  3L2V A;  4IUU A;  1J3T A;  2RK2 A;  2JXB A;  2RQT A;  3ZBD A;  2K7A A;  3QBY A;  2R57 A;  2AKL A;  2K3B A;  4O5V A;  1WXU A;  1VQL T;  2DE0 X;  1K0X A;  1TU0 B;  2XU8 A;  2OAW A;  1SHF A;  1LVK A;  2PU9 B;  3M4Y A;  4F7U G;  3MPU B;  2KRO A;  4FW1 A;  4WF2 A;  4F7U F;  1T0J A;  2BUD A;  3TQ7 P;  3QWX X;  1TWB A;  2GBQ A;  2HEQ A;  2DXB A;  5CQY A;  1N9S A;  1FWZ A;  4WCI A;  2EGC A;  1AVZ C;  4HXJ A;  2YSQ A;  1VQN A;  1UGR B;  4PJO G;  1K76 A;  2O31 A;  4BI8 B;  1WX6 A;  2LT4 A;  1Q81 C;  4BD3 A;  2LQ8 A;  1U8R A;  4PJO F;  3CBO A;  1UHC A;  2V8J A;  2CH4 A;  4M78 F;  2K9G A;  2O01 E;  4ZGJ B;  1NZ9 A;  1AWW A;  4NOY A;  2KMT A;  3GOX A;  3UA7 A;  4LDY A;  4F14 A;  2VXF A;  3QJY A;  3CPW S;  3RR6 A;  2CP2 A;  5DY9 A;  4OB1 B;  4PJO B;  3VRZ A;  3CD6 A;  4C8Q B;  1K73 U;  2DTO A;  1BK2 A;  2HD0 A;  3M56 A;  4M78 A;  2JVV A;  1WLP B;  1RI0 A;  3EHQ A;  3H8Z A;  4CC4 B;  2DD5 A;  4C92 C;  1M1G A;  3M0S A;  2SEM A;  3OYE A;  2YT6 A;  1UGQ B;  4ZGD B;  1YI2 Q;  4M75 D;  1K0S A;  2QAZ A;  1T0H A;  3JB9 D;  1VA7 A;  4MZP A;  1I5O B;  1Q82 C;  1IGQ A;  2VVK A;  4BAC A;  1M2V A;  2RQV A;  1S72 T;  3GBQ A;  1Q81 U;  2ZGW A;  1FMK A;  3KUF A;  3SWN C;  1K8A R;  4M77 E;  5AT1 B;  2VGN A;  1VQP A;  4JRK A;  4A4H A;  4AFU C;  3JCM W;  3QDF A;  1QWF A;  1YJ9 A;  2C0O A;  2RO0 A;  4Z8A A;  5L23 A;  2MPX C;  1UFF A;  2RI2 A;  2I0N A;  2DL5 A;  1KHI A;  1ZSZ A;  1UJ0 A;  3CPW A;  5CKB A;  4E2F B;  2KRN A;  2XMF A;  1YIT A;  1N8R C;  2E6Z A;  2LX9 A;  3GNF B;  1D09 B;  3EGX B;  3M9Q A;  2CYZ B;  1VQP T;  3VYG A;  1GBR A;  1AWO A;  3RIR A;  2F2V A;  2FPD A;  3E2U A;  4ZTJ A;  3KBG A;  2B86 A;  1OX9 A;  1HK9 A;  1YN8 A;  2CZ0 B;  1YCY A;  2LX7 A;  5KYX A;  3RKY A;  4ZN1 A;  5FU7 C;  3M4G A;  3H0I A;  4JDS A;  2DTH A;  4R55 A;  2W10 A;  3JAM E;  1M27 C;  1ZUK A;  4PFP A;  2BE7 D;  2E6N A;  1WPY A;  2SRC A;  5LJ3 h;  1Q82 R;  2CGH A;  2LC4 A;  3CCV Q;  4VUB A;  1QVP A;  2GTO A;  5IHN A;  3UA6 A;  3OYH A;  4DBQ A;  5FU6 B;  3R6N A;  1WIE A;  1QP2 A;  1PKS A;  3L2W A;  1M5Q 1;  5I11 A;  2DLP A;  1B34 B;  1AEY A;  1OPL A;  5GAO p;  4EDU A;  2D6F A;  4J6W A;  1D0Y A;  3EFS A;  4M77 C;  1VQ7 T;  2V26 A;  4PJL A;  3FRN A;  4ZGE B;  2CUB A;  4K11 A;  2LJ0 A;  2VXE A;  3KXT A;  2ROL A;  1YIJ A;  4C8Q A;  3HFO A;  1NBE B;  1VQM Q;  4XQ3 A;  4J6Y A;  3HKS A;  1WHL A;  3V8J A;  4MZM A;  5LL6 S;  1VQO Q;  2CP5 A;  3MO8 A;  4A4F A;  2XI9 A;  2MCN A;  3UAT A;  1XJW B;  2EYQ A;  5CK9 A;  2KT1 A;  4KUL A;  1RAH B;  4CRI A;  3RDV A;  4DBR A;  3JB9 H;  2KRS A;  3M59 A;  3EG0 A;  5KYY B;  1O9S A;  2DVE A;  1RLQ C;  1Q81 R;  4FT4 A;  1IRE B;  2ROT A;  2DPP B;  1UJY A;  2ED1 A;  2JZ2 A;  4N4G A;  2RHU A;  5CIU A;  1M90 C;  1AT1 B;  1YFN A;  2CDT A;  1MHN A;  1X75 C;  1I07 A;  2ZPF B;  3DKM A;  3A5Z B;  3G6E Q;  3LH0 A;  2JS0 A;  3G4S T;  5GAO r;  2O9V A;  4B9X A;  2V1R A;  2QYZ A;  1FMW A;  1UDL A;  4FIB A;  5L8R E;  2EYW A;  2DK3 A;  1SEM A;  5FRN A;  4KGV B;  4C92 D;  5LJ3 d;  1M3C A;  4M75 E;  3QSU A;  3EG3 A;  4X9D A;  2JT4 A;  4BUG A;  4PJO E;  2EGE A;  2KR3 A;  3G4S Q;  2D8H A;  3L42 A;  4XTV A;  3OYM A;  1X2Q A;  1ZSG A;  1BI0 A;  3E19 A;  5GAN 4;  4D6W A;  4IIO A;  3CMA T;  4PLI A;  4HVW A;  2EYY A;  3OS2 A;  2DEQ A;  1LJO A;  2P0P A;  2RK1 A;  2K2M A;  3EFR A;  3G1J A;  5DM7 R;  3BDU A;  1QVF P;  2LQW A;  1PC0 A;  4RCB A;  4D8K A;  1ZA2 B;  2JW4 A;  4V2S A;  5DLQ E;  4R0K A;  2MMP A;  3D7S B;  3DB4 A;  4BI4 A;  3V7S A;  4LE9 A;  3HRS A;  2J05 A;  5GAO l;  2X4X A;  2KGT A;  2CT3 A;  4PFZ A;  3GPL A;  2OJ2 A;  2KSS A;  2NUT A;  4IKF A;  5GAN d;  3MEV A;  1W2B A;  5LJ5 j;  3LWI A;  1PHT A;  4C5I A;  1RLP C;  3TRE A;  1B07 A;  4M4Z A;  1KHC A;  2RHZ A;  3CPW P;  2F5K A;  2KXD A;  3REB B;  3DLM A;  2JM9 A;  2EPD A;  3UF4 A;  2MWO A;  5IT9 E;  2LZ6 B;  4YTL A;  1KQS S;  3CD6 Q;  4FSS A;  2RD1 A;  2DJZ A;  2P4R A;  3JCM f;  2PVO B;  1IHW A;  2E3I A;  2F2X A;  1K4U S;  3BDL A;  3CCL A;  8AT1 B;  1NJI R;  3QDR B;  2X9H A;  3HHT B;  1N9R A;  4C5E A;  4Z02 A;  1XOV A;  2D8J A;  8ATC B;  3ULR B;  2O2O A;  3QYH B;  4RTW A;  5KCO A;  1KC8 C;  2HAX A;  3QZ5 B;  4J83 A;  1MNE A;  4RTV A;  1NYF A;  1LPL A;  5A2Q E;  3JB9 J;  1CKA A;  5GAN g;  1VQL Q;  4L59 A;  5J26 A;  2DD4 A;  5CKH A;  3OW2 A;  1YIT T;  1PCX A;  3GP8 A;  4LD9 K;  4C92 G;  2C0T A;  5CR2 A;  4HKE A;  4HVU A;  5GAN 7;  2V1Q A;  4LDX A;  4RTT A;  5KYU A;  4FYW B;  4R56 A;  1NPR A;  2QQR A;  2DYB A;  3ZL7 C;  5IXF A;  4OB3 B;  1VQK T;  5GAN 5;  1K73 C;  1YIT Q;  4BDZ A;  4C8Q E;  1WQ7 A;  1N6A A;  2LDM A;  3TU4 K;  5D7U A;  4B6M A;  2BZX A;  2D9T A;  2FPF A;  2EQU A;  1NM7 A;  1VQ4 A;  4LUE A;  3I5S A;  1V29 B;  1VQL A;  3RER A;  1Q7Y R;  1TUD A;  4ATO A;  1ZLM A;  1ARK A;  3L2R A;  1VQK Q;  2YUN A;  5KYY A;  1QVG S;  2XDP A;  5J39 A;  1RI9 A;  1M2O A;  4UC4 A;  1ZQ1 A;  3C94 A;  4C92 E;  2JMC A;  2EQM A;  3TVT A;  2YXY A;  4FU6 A;  1W6X A;  2P0K A;  1TUG B;  1QLY A;  3I55 T;  1KK7 A;  1M8M A;  2E1H A;  3M53 A;  4DEX A;  2ESW A;  4BB7 A;  1PSF A;  1VQ4 Q;  3EH2 A;  4LNP A;  5KYN A;  2JJ9 A;  1VQ8 T;  1ZX6 A;  3JCM e;  4M7A F;  2O4X A;  2QEX Q;  1GCQ A;  1VQO A;  4BDY A;  3CC2 T;  1Q86 U;  2JTF A;  3G4S A;  3M0U A;  1NEG A;  4FYX B;  1O75 A;  4B9W A;  1AOJ A;  1M1K R;  1WHK A;  1H3Z A;  4ZTF A;  1TSF A;  4AG1 C;  2RA2 A;  2FZK B;  3X26 B;  1M1K C;  4RKU E;  1TXQ A;  1VQO T;  4QQ6 A;  4II1 A;  4FT2 A;  2DYI A;  1AHJ B;  1YNZ A;  2QTV A;  2J06 A;  2MF2 A;  1WGS A;  5KYX B;  1GXI E;  5I2S A;  4C0D B;  4M7A A;  4GY5 A;  4EIK A;  5IHK A;  2GCX A;  4BI3 A;  4BY6 C;  3EAE A;  2BTT A;  3N5B B;  3EGX A;  1N8R R;  4XU1 A;  4C8Q C;  1UGS B;  3MCA B;  5GAM h;  1B3Q A;  1VQ9 Q;  1QKX A;  3JCM X;  4D8D A;  1RAD B;  3UPU A;  2DER A;  2JN0 A;  3KFV A;  1Q95 G;  4OP0 A;  1OUL A;  4OB0 B;  2PUK B;  3PE0 A;  3JRZ A;  4PJN A;  3OS0 A;  4DBH A;  4CI0 C;  2LNH B;  2J6F A;  2YLB A;  4JZ4 A;  4JS4 A;  3G6E T;  1FMV A;  3FLG A;  1BBZ A;  3HP9 A;  2EGA A;  1VQ6 A;  1JO8 A;  4XU3 A;  2JNG A;  2VYT A;  4M78 E;  1KC8 R;  3A8O B;  2GF7 A;  2FZC B;  5KH6 A;  3I56 T;  3DLL A;  2VUB A;  3PVQ A;  1KD1 C;  1M4Z A;  1TG0 A;  1KQS A;  1OU9 A;  1OPK A;  1U1T A;  2EJF A;  2CH4 W;  3X24 B;  4PJO C;  5KYW B;  1H3H A;  1AWX A;  1W4S A;  5HY6 A;  4XU0 A;  3CXC P;  2BIV A;  1WA7 A;  2PZ1 A;  1QW1 A;  3M5A A;  3WVE B;  4C92 A;  3JCM V;  2YUP A;  3CC7 T;  3R6O A;  3RMQ A;  4OB2 B;  2QA4 Q;  1G3Y A;  1SG5 A;  4JRQ A;  3M0Q A;  2EJ9 A;  1G83 A;  3CCR T;  2ZZD A;  1VQ5 T;  1WZO A;  1UTI A;  4M75 F;  3PTA A;  3JB9 F;  1YJW Q;  4OMQ A;  2QXF A;  4N4H A;  4QQD A;  2KYB A;  2RH2 A;  1QVG A;  4HA8 A;  1C1A A;  3MP1 A;  2L5Q A;  1TTH B;  3HRU A;  1U5S A;  3SD4 A;  3CCR A;  1WNL A;  2E3H A;  2EIF A;  1KFZ A;  1ZSZ C;  3CCQ A;  2VB6 A;  2CP7 A;  2DZC A;  4M7D G;  2KE9 A;  2K5I A;  3VS2 A;  1IXD A;  5GAM j;  3QHS A;  1LCK A;  2DXC A;  1UB4 A;  2LRQ A;  2MAM A;  2YUQ A;  2JMA A;  2E70 A;  1Y96 A;  1P92 A;  4ELY C;  4M77 B;  3CCQ T;  2L3P A;  1CKB A;  1VQ7 Q;  2XDD A;  3CC4 T;  3TCJ A;  1BCM A;  2DXT A;  1S72 Q;  2D0Q B;  1F1B B;  1OYX A;  2B8A A;  1VQK A;  4A53 A;  9ATC B;  3QO3 A;  3SHW A;  1YWO A;  4N0A A;  1KD1 U;  4NS5 A;  2DET A;  1NYG A;  4JJB A;  1CSK A;  3CC4 A;  4OVA A;  4M7A D;  1OQK A;  3G71 Q;  2RI5 A;  3M0R A;  2MK5 A;  4EMH A;  2A08 A;  2E5K A;  2XDB A;  3RBB B;  3OY9 A;  2RN8 A;  5GAN 2;  1PRL C;  1PD1 A;  4M7D B;  4AFQ C;  3CMA A;  1FX7 A;  3HPW A;  1ZUU A;  2FG0 A;  1YHQ A;  1U3O A;  3A8G B;  1M3B A;  3G71 T;  2L3R A;  1JBM A;  4RTY A;  4OGC A;  2RJC A;  2FEI A;  3CCV A;  1X6O A;  2BZY A;  2PVD B;  4WTO B;  4FYV B;  3VS1 A;  2DA9 A;  3GF5 A;  2MYS A;  1VQ7 A;  2HMA A;  1D1C A;  1G3T A;  2P4T A;  4A4E A;  3I9Q A;  3Q1J A;  1I1J A;  5AYF A;  3CCE T;  4OMP A;  1PG5 B;  2M51 A;  3I35 A;  3X28 B;  3CCQ Q;  3JCM J;  4JLI A;  1XQH A;  1UEB A;  2XG8 D;  1GFC A;  5GJW B;  2ECZ A;  2FPE A;  3JB9 I;  1UE9 A;  1EX4 A;  2KT8 A;  4E7J A;  3IQL A;  1ZUY A;  4JRI A;  4M75 A;  3CEY A;  2YLC A;  3P8H A;  2RF0 A;  2WSC E;  4PJJ A;  2VV5 A;  1K9M R;  1Y71 A;  3J7A F;  2M16 A;  2ATC B;  2QAS A;  2ZCF B;  3NPF A;  1WDX A;  4ZN3 A;  2H3J A;  3QJ6 A;  1QQJ A;  3V7R A;  1WHG A;  2OTL Q;  4C0D C;  2IPO B;  2NYS A;  2Y4X A;  1V76 A;  4X1V A;  1VUB A;  2A37 A;  3SDZ A;  1YP5 A;  4C8Q D;  1AD5 A;  4LD6 A;  4RCC A;  1JXO A;  1KSW A;  1X6B A;  1KQ2 A;  1OZ2 A;  2JOY A;  2DL8 A;  3OBY A;  3MJX A;  2DL3 A;  4FYY B;  3H6Z A;  1UHF A;  2DEU A;  3RNJ A;  4M75 B;  4XK8 E;  1EZZ B;  2KQW A;  2RHX A;  2X4Y A;  1AWJ A;  1M9S A;  3V7C A;  2HSE B;  3I55 Q;  3OS5 A;  4QW2 A;  4M75 C;  3M0T A;  4FW2 A;  4HT8 A;  3GNG A;  1MV3 A;  4HCZ A;  3VS5 A;  2NUT B;  3NGP A;  5LJ5 e;  1N5Z A;  4M77 D;  2K3X A;  2QQB A;  4QT7 A;  3I56 A;  3OMG A;  2PNI A;  3URG A;  1B7T A;  2IIM A;  4AFS C;  2DIL A;  3LW5 E;  3ZEH A;  1WXT A;  2R5A A;  2G6F X;  2J7I A;  2JTM A;  2RHI A;  3BY7 A;  2CP3 A;  1SSH A;  2QK0 A;  4M7D A;  2ABL A;  2JM8 A;  4RG2 A;  1BI2 A;  2V8K A;  1YIJ T;  1ZSZ B;  2CZ1 B;  2J6O A;  3U23 A;  1MMA A;  3PVL A;  2Y4Y A;  3DB3 A;  3NTH A;  4A4G A;  4EPC A;  1MMG A;  1WYX A;  2HSP A;  2M0Y A;  2HQX A;  2CP0 A;  2EFI A;  1M1F A;  2X4J A;  5GMK l;  2KVQ G;  2HKN A;  2FO0 A;  1H8K A;  2NUP A;  1HXD A;  3PNW C;  5LJ3 e;  3MEU A;  4DA4 A;  1OEB A;  4LN2 A;  3OYC A;  3H9N A;  3OSS C;  2LJ3 A;  3EHR A;  4IUV A;  3OBW A;  1SF9 A;  2MOX A;  5LJ3 g;  1T3S A;  4C92 F;  5LJ5 f;  1ABO A;  2O4X B;  1Y96 B;  2AK5 A;  2EKO A;  2LCL A;  1SHG A;  3X20 B;  1T3L A;  4RMO A;  3EGD B;  1QVF S;  3CC2 A;  2ZPI B;  1KD1 R;  3FDR A;  5CCA A;  1M30 A;  4DEY A;  1MND A;  3CCE Q;  2O9S A;  4PJO A;  3MKD A;  4M7D C;  2A28 A;  5HCK A;  1SSF A;  3CBM A;  5GAN j;  2F2W A;  2J6K A;  3THK A;  1U06 A;  1SPK A;  5LJ5 g;  4A54 A;  1WQW A;  2CUD A;  4MZT A;  2C0I A;  3L2Q A;  3VRY A;  1FXX A;  4PFO A;  2COY A;  1BI3 A;  3I56 Q;  1M90 U;  1X43 A;  3LYI A;  1RAC B;  2DBM A;  2EQJ A;  2RM4 A;  3CCM A;  3M0P A;  2H3E B;  4X34 A;  1NJI U;  3H0F A;  5CQX A;  3PMT A;  3EGU A;  2DIQ A;  4J7F A;  4BE2 A;  1NJI C;  4C92 B;  3ASK A;  2RJF A;  3VS6 A;  4E7Z A;  2XIC A;  4LUD A;  1NE8 A;  2CP6 A;  3EG9 A;  2MIO A;  5LJ5 d;  2PTK A;  3G71 A;  1N27 A;  2QGG A;  2R5M A;  2KK4 A;  2RMO A;  4LDV A;  3CCM T;  3CCV T;  4P5N A;  3WVD B;  5GMK i;  5D6Y A;  4Y28 E;  4PKC C;  5HK0 A;  3CCE A;  1BU1 A;  3F70 A;  2RNA A;  3HL8 A;  4L5G A;  3NHN A;  5KYU B;  2QA4 A;  4M7A G;  2DXU A;  3JV3 A;  4JJD A;  1M3A A;  4J6X A;  3QWY A;  1W70 A;  4PK4 A;  1MMD A;  3QPH A;  5IN1 A;  5A0L A;  2CS7 A;  1K9A A;  4C5G A;  2X3X D;  4F7U E;  4F7U B;  1R0B G;  4J9F A;  4RG8 A;  4JRP A;  3S3M A;  2CSI A;  1ZHI A;  2DL4 A;  5GAM f;  2X3W D;  1KC8 U;  2RJD A;  3OW2 S;  3OB9 A;  3NTI A;  4QVZ A;  3S6W A;  4J9I A;  4QVC A;  5DLO A;  1D1A A;  1BYM A;  3OYK A;  1BB9 A;  2Z0W A;  4MMK A;  4J5Y A;  3M58 A;  4Z89 A;  3CXC S;  1X69 A;  1PNJ A;  5GAN f;  1QVG P;  1VQ5 Q;  5A0G A;  3OYB A;  2HBP A;  2DKG A;  2OAU A;  2OTL T;  2OX7 A;  5I21 A;  3QXE B;  2WSE E;  3CC7 Q;  1WI7 A;  1VYV A;  4OML A;  1Y57 A;  3EG9 B;  3C4S A;  1YJW T;  3S3N A;  1K9M U;  4ORZ A;  1KIK A;  1HSQ A;  1XNI A;  1MV0 B;  4C8Q F;  2VAS A;  3CCR Q;  1VQN Q;  1HYO A;  4M78 B;  2CSQ A;  3VS0 A;  2LCS A;  2PQW A;  4C8Q G;  2QQA A;  5GAM e;  4A4K A;  3LH5 A;  2L8D A;  4OMF B;  1VQ9 A;  1RAA B;  1VQM A;  2K6D A;  2ZPG B;  3FEO A;  5GMK e;  3MHX A;  1W1F A;  4HCB A;  1Q86 C;  2H8H A;  2HQE A;  4AG2 C;  1QP3 A;  2MI6 A;  3WXM B;  3FJ5 A;  4E47 A;  2LT1 A;  4IUP A;  2Y90 A;  5GAN 6;  1VQM T;  1ZBJ A;  4HVV A;  3RES A;  2C06 A;  4HT9 A;  3CCU A;  1Q7Y C;  4J9B A;  3E9G A;  2RPN A;  5CKF A;  3CC7 A;  1U1S A;  3UT1 A;  4PJO D;  4BE0 A;  4J9C A;  1IZ6 A;  3LLR A;  1NPP A;  4LDU A;  2RJE A;  2KBT A;  1DJ7 B;  2KRM A;  3C95 A;  2CZ7 B;  5FWB A;  3VU3 C;  4KGZ B;  4OMN A;  2DVJ A;  5FU7 B;  2QA4 T;  2CZ6 B;  1GRI A;  2GTJ A;  1IO6 A;  3CCJ Q;  1FYN A;  1E6G A;  3VJP A;  2HKQ B;  1OI1 A;  2DFU A;  3C12 A;  2MWP A;  4PL6 A;  1YHQ Q;  2A7Y A;  1NLP C;  1D1B A;  1Q82 U;  4E7H A;  2HL5 C;  2KNB B;  3P8B B;  1Q7Y U;  2FVU A;  1ZBX A;  1M90 R;  2EQI A;  2EQK A;  3E1S A;  3JCM b;  1C6V X;  2O88 A;  3S3O A;  2PUO B;  2OTJ T;  2AKK A;  3CCM Q;  2LP5 A;  3OYJ A;  2EKH A;  5GAN e;  2QDY B;  2GGR A;  2HCK A;  3OYG A;  1PWT A;  4M78 D;  4FM4 B;  2AHJ B;  4KT0 E;  3FB9 A;  2GQV A;  1G8X A;  1PKT A;  2XHC A;  4JJC A;  4GLM A;  5CVI A;  2COZ A;  2KEA A;  2LNV A;  1QWE A;  1WHJ A;  3CC2 Q;  1R77 A;  3PMI A;  1LNX A;  3BFM A;  1G3W A;  4QQG A;  2VKN A;  3GIB A;  2QQ9 A;  2YRD A;  2FYK A;  1R0C B;  4XTU A;  2CT4 A;  5A0D A;  2E10 A;  1K8A C;  1RAG B;  4M77 A;  1VIE A;  4RUG A;  2K5L A;  1R8O B;  2LCC A;  1YI2 T;  3EG2 A;  4C0F A;  2KAF A;  3CME T;  1UGP B;  2LJ1 A;  3EH1 A;  4Q5W A;  1PM3 A;  3AHU A;  3HFN A;  3QKJ A;  4J9G A;  5IHI A;  5FRM A;  4J8O A;  3CC4 Q;  1K1Z A;  2DRK A;  3OQ5 A;  3OYD A;  4MDX A;  2P0Q A;  3CCJ A;  1QCF A;  3CQT A;  1IGU A;  3LX7 A;  1YIJ Q;  2LQN A;  3MP6 A;  1OZ3 A;  4J9H A;  4F7U A;  3VS7 A;  1MUZ A;  4ME7 A;  2E41 A;  2X4W A;  1NG2 A;  1V1C A;  4AFZ C;  3TSW A;  3H0H A;  1BCO A;  1VQ5 A;  1VIF A;  3L1A A;  2PVG B;  1WJS A;  4M75 G;  2DBK A;  3JB9 G;  3SEM A;  4JZ3 A;  2GFU A;  2RHY A;  1YWP A;  2FB7 A;  3X25 B;  1VQ6 Q;  1KQS P;  5GAO m;  1RAF B;  1PD0 A;  2X51 A;  2HDA A;  2AZV A;  2YRV A;  2RI3 A;  3ER0 A;  2D1X A;  2EAY A;  2A36 A;  2P84 A;  1JU5 C;  4E7K A;  2K79 A;  2GQI A;  2BE9 B;  2XD0 A;  3JCM c;  1AZE A;  3J80 E;  1OU8 A;  4M78 G;  2FZG B;  4A63 B;  2L0A A;  2IVW A;  4EMK A;  1UGV A;  1GCP A;  3TEE A;  3OYN A;  3HRT A;  4PNO A;  1WHM A;  4C5H A;  1QCN A;  4HCK A;  2QDL A;  1M1K U;  5D6X A;  3LWH A;  4JPB W;  3A98 A;  1Y0M A;  3QG1 A;  2FRW A;  4M78 C;  5D6W A;  4RTX A;  4J7I A;  3RKW A;  2F1L A;  3L2U A;  1Q86 R;  1VQ8 Q;  2X35 A;  3LGF A;  1MMN A;  2WAC A;  5GAM d;  3I5R A;  1JEG A;  1OX8 A;  3VUB A;  1YJN Q;  2HNI A;  2JUF A;  1XTD A;  2A0F B;  3PGG A;  3A8M B;  2FL7 A;  2M9U A;  2VGM A;  4PJM A;  5FW9 A;  1UG1 A;  2M02 A;  5GMK h;  5GAO q;  3M54 A;  2VC8 A;  3CCU T;  5LJ3 j;  1QKW A;  1AZG B;  2RQU A;  2CKK A;  2VWF A;  5LJ5 h;  3MEW A;  2QTX A;  2R58 A;  1BKB A;  1A0N B;  5IXB A;  2HQH A;  2RQR A;  2LTO A;  3SWN B;  4M7D E;  4KGX B;  4CC7 A;  2NWM A;  1EFN A;  2XKO C;  2HBW A;  4QVD A;  3CCS T;  2BZ8 A;  2ED0 A;  2V8I A;  1YBY A;  1JJ2 P;  4IUR A;  2BKD N;  1S1N A;  3G6E A;  3G7Z A;  1YJN A;  5J3B A;  3A8H B;  4XAX B;  5GAM g;  1H92 A;  1Y7X A;  3OYI A;  5GAN h;  3C0C A;  2AT1 B;  3QII A;  4J9E A;  4X9C A;  3HSB A;  4M77 G;  4RTZ A;  1KQ1 A;  3CD6 T;  2EYZ A;  4Y91 A;  4M77 F;  4E7L A;  2ZPB B;  4ELZ C;  2YWW A;  1TUC A;  1PRM C;  4N0A C;  2IG0 A;  3BE3 A;  1Y07 A;  1G3S A;  3JSC A;  2EBP A;  1IRX A;  3CME Q;  4JS5 A;  5KE3 A;  1TH7 A;  2F69 A;  4F16 A;  3PIP A;  1UEC A;  4FSX A;  4O6J A;  4CC2 A;  4E7S A;  1YJ9 Q;  3VV0 A;  2KYM A;  5LJ3 f;  4DBF A;  1QCO A;  4J9D A;  5C6S A;  1M2V B;  2DM1 A;  3AT1 B;  3CBP A;  1D3B A;  4JUV A;  4DOV A;  2YDL A;  4XTX A;  4FL6 A;  3JCM P;  3OYA A;  3JCM h;  1KJW A;  3PIO A;  3VYH B;  4BY6 B;  1YCS B;  3VS3 A;  4OMO A;  3A8L B;  2OTL A;  1K8A U;  1YI2 A;  5CKE A;  1NEB A;  4ZNX A;  3REA B;  2QGF B;  2DF6 A;  2OTJ Q;  2I2L A;  3BW1 A;  2DL7 A;  3RMS A;  4LDW A;  1YJW A;  4OMM A;  2A3L A;  1W2B S;  1JRI A;  2E65 A;  4C0Z A;  1VQ6 T;  2ZPE B;  4KBM B;  2ZPH B;  4KRT A;  3EG1 A;  1G5V A;  4F04 B;  1X2K A;  3CCJ T;  3NFC A;  1K9M C;  1GCQ C;  1Z9Z A;  1E6H A;  1RUW A;  2E4H A;  5IAY A;  1GFD A;  4RTU A;  3CXC A;  2NUZ A;  1K73 R;  2L3S A;  5HK3 A;  2G3R A;  1VOM A;  3P8D A;  1TOV A;  2L2P A;  3EGD A;  1RAI B;  4XU2 A;  2YHT A;  2K3Y A;  3OA6 A;  2LVM A;  4E6R A;  2YRC A;  1X27 A;  4IUT A;  3LGL A;  4KUI A;  2L3Q A;  1ACM B;  1MGQ A;  2M1H A;  3SWN A;  3CCS A;  4IIM A;  1VQN T;  2HZY A;  2KDS A;  1QVF A;  4OF1 A;  3T9N A;  3OMC A;  1I5L A;  2DNU A;  1IHV A;  3OYY A;  3JCM g;  2DX1 A;  2HL3 A;  3L2Z A;  1TS9 A;  5HKC A;  2YUO A;  4ANJ A;  3UWN A;  2NUP B;  4IUQ A;  1OV3 A;  2DJQ A;  1NLO C;  2NLU A;  4XTZ A;  5FWC A;  2FRY A;  1N8R U;  2E64 A;  3V8L A;  3OYL A;  3NTK A;  4M7A E;  4E7I A;  2EYX A;  5I2M A;  3SFM A;  2DIG A;  3MET A;  4MDW A;  1IB8 A;  2XK0 A;  3RKX A;  4GLK A;  4Y92 A;  3PT9 A;  2K4Y A;  3UDC A;  1PSE A;  2RB6 A;  5CAI A;  2COW A;  1HJD A;  2OTJ A;  4L6V 5; 
#chains in the Genus database with same CATH homology
 3C12 A;  2MWP A;  2L3R A;  3G71 T;  3L42 A;  1JBM A;  4XTV A;  3OYM A;  4PL6 A;  4OGC A;  1LOJ A;  2A7Y A;  1BI0 A;  2RJC A;  2M0O A;  3E19 A;  3OYF A;  5GAN 4;  4JJN K;  1BIB A;  4E7H A;  1Q82 U;  3P8B B;  3CCV A;  4D6W A;  1Q7Y U;  1X6O A;  2PVD B;  2FVU A;  1ZBX A;  3CMA T;  4PLI A;  2EQK A;  3E1S A;  3JCM b;  3GF5 A;  4EMK B;  4XTY A;  3OS2 A;  2K57 A;  1VQ7 A;  2DEQ A;  3S3O A;  1LJO A;  2PUO B;  2OTJ T;  2EJG A;  1G3T A;  2P0P A;  2P4T A;  2RK1 A;  4A4E A;  3Q1J A;  3OYJ A;  3E9F A;  5GAN e;  3EFR A;  2QDY B;  3INZ A;  5AYF A;  4C0G A;  3OYG A;  4M78 D;  5FLX E;  3BDU A;  5DM7 R;  3CCE T;  4FM4 B;  1H64 1;  2AHJ B;  2E5Q A;  4KT0 E;  3FB9 A;  2GQV A;  4RCB A;  4NL2 A;  1VQ9 T;  3X28 B;  3JCM J;  4JLI A;  2XHC A;  3VKI A;  1XQH A;  4V2S A;  1UEB A;  2XG8 D;  3RUX A;  3M57 A;  5DLQ E;  5CVI A;  4MML A;  3JB9 I;  3VUZ A;  2LNV A;  2MMP A;  4E7J A;  3DB4 A;  4JRI A;  4M75 A;  4BI4 A;  3V7S A;  3CEY A;  1YHQ T;  2YLC A;  3P8H A;  3HRS A;  1WJR A;  2WSC E;  3PMI A;  1YJ9 T;  4KUD K;  1WJQ A;  5GAN 3;  5GAO l;  2VV5 A;  2X4X A;  1LNX A;  1Y71 A;  3J7A F;  2M16 A;  5CO7 A;  3BFM A;  2ZCF B;  3CME A;  1G3W A;  4QQG A;  4ZN3 A;  2H3J A;  3GPL A;  1YJN T;  3ME9 A;  1I81 A;  3QJ6 A;  3GIB A;  2KSS A;  2QQ9 A;  3QYG B;  3V7R A;  2FYK A;  4DOW A;  4IKF A;  4C0D C;  5GAN d;  3MEA A;  3MEV A;  3O8V A;  4XTU A;  5A0D A;  3FJP A;  5LJ5 j;  1W2B A;  2Y4X A;  2E10 A;  4EMK C;  1K8A C;  1VUB A;  4EMG A;  4M77 A;  3LWI A;  3SDZ A;  1VIE A;  5C0M A;  2K5L A;  1R8O B;  4C5I A;  1JJ2 S;  3TRE A;  1KG1 A;  2LCC A;  4JLG A;  1YI2 T;  4C8Q D;  2K5F A;  4C0F A;  2KAF A;  4LD6 A;  3QUI A;  3CME T;  1UGP B;  5GMK m;  1VQ4 T;  4RCC A;  5GMK j;  4HCC A;  1KHC A;  2RHZ A;  1KQ2 A;  2F5K A;  1OZ2 A;  3DLM A;  2JOY A;  3PFS A;  3OBY A;  4Q5W A;  4N4I A;  2DZ9 A;  3AHU A;  3HFN A;  3H6Z A;  3JCM d;  3V8K A;  2DTI A;  3QKJ A;  2QEX T;  2MWO A;  5IT9 E;  4YTL A;  1KQS S;  1I8F A;  2RD1 A;  5GAO n;  4DQ2 A;  2DJZ A;  5FRM A;  4J8O A;  3JCM f;  4M75 B;  2PVO B;  4XK8 E;  1JB0 E;  3BDL A;  3OQ5 A;  3OYD A;  3CCL A;  1B34 A;  4MDX A;  2KQW A;  2P0Q A;  3QDR B;  3CCJ A;  1JJ2 A;  1RL2 A;  3HHT B;  3OS1 A;  1I4K 1;  3J81 E;  1N9R A;  4C5E A;  2RHX A;  3OSV A;  3LX7 A;  2X4Y A;  3GLX A;  1M9S A;  3I55 A;  2DO3 A;  3V7C A;  4Z02 A;  1XOV A;  1OZ3 A;  3MP6 A;  4OGE A;  4NL3 A;  2QEX A;  4F7U A;  2KY9 A;  3QYH B;  5KCO A;  1KC8 C;  4ME7 A;  2HAX A;  2WSF E;  3QZ5 B;  4J83 A;  1D3B B;  5KE2 A;  2E41 A;  3OS5 A;  2X4W A;  4QW2 A;  4M75 C;  5KCH A;  2E12 A;  3CPF A;  3CCL T;  4HT8 A;  3GNG A;  5A2Q E;  3JB9 J;  5GAN g;  1EIF A;  4TVR A;  5M9O A;  4HCZ A;  4L59 A;  5CKD A;  5J26 A;  1VQ5 A;  2F5T X;  5LJ5 e;  1VIF A;  2DD4 A;  2GFA A;  4M7A C;  5CKH A;  3OW2 A;  1YIT T;  2K2V A;  4M77 D;  2DAQ A;  2PVG B;  3L1A A;  4C92 G;  3GP8 A;  4LD9 K;  1VQ8 A;  2K3X A;  2QQB A;  5CR2 A;  2XID A;  1WJS A;  2FHD A;  3OMG A;  4HKE A;  2QQS A;  5GAN 7;  3I56 A;  1S72 A;  5GAN 8;  3URG A;  4M75 G;  4LDX A;  3MP8 A;  3ZFJ A;  3JB9 G;  5FRO A;  4R56 A;  3M55 A;  3LW5 E;  3SB2 A;  1NPR A;  3JCM Q;  5FU6 C;  2QQR A;  3ZEH A;  3FIF A;  2GFU A;  2R5A A;  2RHY A;  2FB7 A;  3X25 B;  4OB3 B;  2JTM A;  2RHI A;  5EG2 A;  5GAO m;  1VQK T;  4M7D F;  2QI2 A;  3BY7 A;  5GAN 5;  1K73 C;  2YRV A;  4BDZ A;  1M8V A;  4M7D A;  4C8Q E;  1WQ7 A;  4RG2 A;  1BI2 A;  2V8K A;  1BIA A;  2RI3 A;  3ER0 A;  1YIJ T;  1N6A A;  2LQK A;  2EAY A;  2CZ1 B;  4BE1 A;  2LDM A;  3TU4 K;  4M7A B;  2Y4Y A;  3DB3 A;  3NTH A;  4A4G A;  4EPC A;  4E7K A;  2D9T A;  2XD0 A;  3JCM c;  3QZ9 B;  4PLL A;  2EQU A;  2HQX A;  4XTW A;  4M78 G;  3J80 E;  3FC3 A;  1X01 A;  2EWN A;  2EFI A;  2IVW A;  1M1F A;  1VQ4 A;  2X4J A;  4EMK A;  5GMK l;  2KVQ G;  1BI1 A;  1V29 B;  4M7D D;  3TEE A;  1VQL A;  2L89 A;  3OYN A;  3HRT A;  3L2V A;  3RER A;  4PNO A;  4ATO A;  1HXD A;  3PNW C;  5LJ3 e;  4IUU A;  2RK2 A;  4C5H A;  3MEU A;  3ZBD A;  4DA4 A;  3L2R A;  1M1K U;  3OYC A;  5D6X A;  3LWH A;  3OSS C;  3QBY A;  2R57 A;  4IUV A;  2XDP A;  5J39 A;  1QVG S;  3OBW A;  4O5V A;  3QG1 A;  4M78 C;  4UC4 A;  1ZQ1 A;  5D6W A;  5LJ3 g;  3C94 A;  4C92 E;  4J7I A;  3RKW A;  4C92 F;  2EQM A;  5LJ5 f;  3L2U A;  4FU6 A;  2XU8 A;  2X35 A;  3LGF A;  2P0K A;  2O4X B;  1Y96 B;  2PU9 B;  3M4Y A;  2EKO A;  2WAC A;  3I55 T;  4F7U G;  2LCL A;  5GAM d;  2E1H A;  3M53 A;  3X20 B;  3VUB A;  4WF2 A;  4RMO A;  2HNI A;  2JUF A;  4F7U F;  2BUD A;  1XTD A;  2DXB A;  3PGG A;  4BB7 A;  3A8M B;  1QVF S;  3CC2 A;  5CQY A;  1N9S A;  2ZPI B;  1FWZ A;  2FL7 A;  1PSF A;  3FDR A;  5CCA A;  2M9U A;  1VQN A;  1UGR B;  4PJO G;  4BI8 B;  4PJO A;  2VGM A;  2LT4 A;  5GMK h;  4M7D C;  5GAO q;  1Q81 C;  1VQ8 T;  3M54 A;  2LQ8 A;  4BD3 A;  1U8R A;  4PJO F;  2VC8 A;  3CBO A;  1SSF A;  3JCM e;  3CCU T;  2V8J A;  5LJ3 j;  4M7A F;  3CBM A;  5GAN j;  2O4X A;  4M78 F;  1VQL T;  1VQO A;  2CKK A;  5LJ5 g;  5LJ5 h;  3MEW A;  4BDY A;  2O01 E;  2QTX A;  3CC2 T;  4A54 A;  2R58 A;  4ZGJ B;  1BKB A;  1Q86 U;  1WQW A;  2JTF A;  4MZT A;  3G4S A;  1NZ9 A;  3L2Q A;  1FXX A;  2LTO A;  3SWN B;  4M7D E;  1BI3 A;  4NOY A;  1M90 U;  2KMT A;  3GOX A;  2XKO C;  1O75 A;  4LDY A;  4B9W A;  4QVD A;  2VXF A;  3QJY A;  3CPW S;  3LYI A;  5DY9 A;  3CCS T;  4OB1 B;  4PJO B;  1H3Z A;  4ZTF A;  2RA2 A;  2V8I A;  2EQJ A;  3X26 B;  1M1K C;  1YBY A;  2RM4 A;  4RKU E;  4IUR A;  1VQO T;  3CCM A;  2BKD N;  4QQ6 A;  4II1 A;  3G6E A;  4FT2 A;  3CD6 A;  4C8Q B;  3G7Z A;  2DTO A;  5J3B A;  1YJN A;  1K73 U;  2HD0 A;  3M56 A;  4M78 A;  1AHJ B;  4X34 A;  1NJI U;  2JVV A;  3A8H B;  4XAX B;  5CQX A;  3PMT A;  4J7F A;  2DIQ A;  2MF2 A;  1WGS A;  1GXI E;  1RI0 A;  4BE2 A;  5GAM g;  1NJI C;  3H8Z A;  4C92 B;  3ASK A;  2RJF A;  1Y7X A;  2XIC A;  5I2S A;  5GAN h;  3OYI A;  1NE8 A;  3QII A;  4C0D B;  4M7A A;  4GY5 A;  2DD5 A;  4X9C A;  4C92 C;  5LJ5 d;  1N27 A;  2R5M A;  1M1G A;  2GCX A;  4M77 G;  4BI3 A;  4BY6 C;  3G71 A;  1KQ1 A;  2KK4 A;  3EAE A;  3HSB A;  3OYE A;  4LDV A;  1UGQ B;  3CD6 T;  4ZGD B;  4Y91 A;  3CCM T;  3CCV T;  3N5B B;  4M77 F;  4M75 D;  2ZPB B;  4XU1 A;  4P5N A;  3WVD B;  4ELZ C;  4E7L A;  4C8Q C;  3JB9 D;  5GMK i;  1UGS B;  4N0A C;  2IG0 A;  3MCA B;  4MZP A;  4Y28 E;  1Y07 A;  4PKC C;  5D6Y A;  5HK0 A;  5GAM h;  3CCE A;  1G3S A;  3JSC A;  1Q82 C;  3F70 A;  3HL8 A;  4L5G A;  3JCM X;  3UPU A;  4BAC A;  2JN0 A;  1S72 T;  2QA4 A;  4JS5 A;  4OP0 A;  5KE3 A;  4M7A G;  4OB0 B;  1TH7 A;  2F69 A;  2PUK B;  3PIP A;  2DXU A;  2ZGW A;  3JRZ A;  1Q81 U;  3OS0 A;  3KUF A;  4CI0 C;  4FSX A;  3SWN C;  4O6J A;  4M77 E;  2VGN A;  3VV0 A;  4J6X A;  2YLB A;  4JRK A;  4A4H A;  1VQP A;  5LJ3 f;  3JCM W;  4JS4 A;  3G6E T;  3QPH A;  1YJ9 A;  3FLG A;  2RO0 A;  5C6S A;  5IN1 A;  3HP9 A;  5A0L A;  2RI2 A;  1VQ6 A;  3CBP A;  2CS7 A;  4C5G A;  1KHI A;  1D3B A;  3CPW A;  5CKB A;  4XU3 A;  2JNG A;  2VYT A;  4JUV A;  4M78 E;  4F7U E;  1YIT A;  4F7U B;  1N8R C;  4RG8 A;  4DOV A;  2E6Z A;  2LX9 A;  3A8O B;  3GNF B;  4JRP A;  1ZHI A;  2GF7 A;  5GAM f;  5KH6 A;  3S3M A;  3M9Q A;  4XTX A;  3I56 T;  2CYZ B;  2VUB A;  3DLL A;  1KC8 U;  2RJD A;  3OW2 S;  3OB9 A;  1M4Z A;  1VQP T;  1KD1 C;  3NTI A;  4FL6 A;  4QVZ A;  3VYG A;  1KQS A;  3S6W A;  3RIR A;  1U1T A;  3JCM P;  2EJF A;  3X24 B;  4QVC A;  3OYA A;  4ZTJ A;  4PJO C;  5DLO A;  3KBG A;  3JCM h;  1W4S A;  5HY6 A;  4XU0 A;  2BIV A;  3PIO A;  1HK9 A;  1BYM A;  1QW1 A;  3M5A A;  3VYH B;  2CZ0 B;  3JCM V;  3WVE B;  4BY6 B;  1YCY A;  4C92 A;  3OYK A;  3R6O A;  3CC7 T;  3RKY A;  4ZN1 A;  5FU7 C;  3A8L B;  2OTL A;  3RMQ A;  3M4G A;  1K8A U;  4OB2 B;  1YI2 A;  5CKE A;  4JDS A;  2DTH A;  4R55 A;  4MMK A;  4J5Y A;  3M58 A;  3JAM E;  3CXC S;  1G3Y A;  5GAN f;  2I2L A;  5A0G A;  3BW1 A;  2E6N A;  1WPY A;  4JRQ A;  3OYB A;  3RMS A;  4LDW A;  5LJ3 h;  2EJ9 A;  2HBP A;  3CCR T;  2CGH A;  2ZZD A;  1YJW A;  2LC4 A;  2DKG A;  2OAU A;  1VQ5 T;  2A3L A;  4VUB A;  1QVP A;  1W2B S;  1JRI A;  2E65 A;  4M75 F;  4C0Z A;  2OTL T;  5I21 A;  3OYH A;  3PTA A;  2ZPE B;  4KBM B;  2ZPH B;  1VQ6 T;  3JB9 F;  3QXE B;  5FU6 B;  2WSE E;  2QXF A;  4N4H A;  4QQD A;  1QP2 A;  3L2W A;  2RH2 A;  1QVG A;  1M5Q 1;  4HA8 A;  3MP1 A;  1G5V A;  2L5Q A;  1B34 B;  3CCJ T;  3NFC A;  1K9M C;  3HRU A;  3SD4 A;  3C4S A;  5GAO p;  1YJW T;  3S3N A;  4EDU A;  3CCR A;  1WNL A;  1K9M U;  2D6F A;  4J6W A;  2EIF A;  3EFS A;  4M77 C;  1VQ7 T;  5IAY A;  1XNI A;  3FRN A;  3CCQ A;  4C8Q F;  4ZGE B;  3CXC A;  2DZC A;  4M7D G;  2VXE A;  4M78 B;  3KXT A;  1YIJ A;  4C8Q A;  2K5I A;  5HK3 A;  2G3R A;  2PQW A;  4C8Q G;  3P8D A;  2QQA A;  3HFO A;  5GAM e;  5GAM j;  3QHS A;  4J6Y A;  4XQ3 A;  4XU2 A;  2DXC A;  2YHT A;  3HKS A;  1UB4 A;  2LRQ A;  4A4K A;  2K3Y A;  2L8D A;  2LVM A;  4OMF B;  3V8J A;  2MAM A;  3OA6 A;  1VQ9 A;  4MZM A;  5LL6 S;  1VQM A;  4IUT A;  3MO8 A;  4A4F A;  2XI9 A;  2ZPG B;  2E70 A;  3FEO A;  3LGL A;  3MHX A;  5GMK e;  4KUI A;  4HCB A;  1Y96 A;  1Q86 C;  2HQE A;  2EYQ A;  5CK9 A;  1P92 A;  4ELY C;  1MGQ A;  1QP3 A;  4M77 B;  2M1H A;  4KUL A;  3SWN A;  2MI6 A;  3CCQ T;  3WXM B;  4CRI A;  3CCS A;  1VQN T;  2KDS A;  1QVF A;  3JB9 H;  4E47 A;  2XDD A;  3CC4 T;  4OF1 A;  3T9N A;  3M59 A;  3OMC A;  2LT1 A;  4IUP A;  3TCJ A;  1O9S A;  1I5L A;  2DXT A;  2DVE A;  2Y90 A;  2D0Q B;  4FT4 A;  1IRE B;  2DPP B;  3OYY A;  1OYX A;  3JCM g;  2JZ2 A;  5GAN 6;  4N4G A;  2RHU A;  2B8A A;  1VQM T;  5CIU A;  1VQK A;  4A53 A;  1M90 C;  3L2Z A;  5HKC A;  3RES A;  3UWN A;  1MHN A;  2C06 A;  3QO3 A;  4HT9 A;  1X75 C;  4IUQ A;  3CCU A;  4N0A A;  1Q7Y C;  1KD1 U;  4NS5 A;  2NLU A;  2ZPF B;  3E9G A;  4XTZ A;  3DKM A;  5CKF A;  3CC7 A;  1U1S A;  3UT1 A;  3A5Z B;  1N8R U;  4BE0 A;  4PJO D;  2E64 A;  1IZ6 A;  3LH0 A;  3LLR A;  4OVA A;  3NTK A;  3V8L A;  3OYL A;  1NPP A;  3CC4 A;  4M7A D;  3G4S T;  5GAO r;  2RI5 A;  4M7A E;  4LDU A;  4B9X A;  4EMH A;  2RJE A;  4E7I A;  1DJ7 B;  3C95 A;  2XDB A;  2CZ7 B;  5I2M A;  3SFM A;  2DIG A;  3OY9 A;  3MET A;  5GAN 2;  4FIB A;  5L8R E;  3VU3 C;  4MDW A;  2DK3 A;  5FRN A;  4M7D B;  2XK0 A;  4C92 D;  3CMA A;  5FU7 B;  1FX7 A;  3HPW A;  5LJ3 d;  3RKX A;  4GLK A;  2QA4 T;  2CZ6 B;  3PT9 A;  2K4Y A;  4M75 E;  1PSE A;  2RB6 A;  3UDC A;  4X9D A;  3QSU A;  4L6V 5;  5CAI A;  1YHQ A;  3VJP A;  4BUG A;  4PJO E;  3A8G B;  2OTJ A;  1OI1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...