2VXFA

Solution structure of the lsm-domain of zebrafish rap55
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
88
structure length
88
Chain Sequence
b'LEDPSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCEPPKPIM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LSM14A PROTEIN
publication title Similar modes of interaction enable Trailer Hitch and EDC3 to associate with DCP1 and Me31B in distinct protein complexes.
pubmed doi rcsb
source organism Danio rerio
molecule tags Transcription
total genus 10
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2008-07-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF12701 LSM14 Scd6-like Sm domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.100 Mainly Beta Roll SH3 type barrels. SH3 type barrels. 2vxfA00
3INZA 5CAIA 4M7AD 4M7DB 3V7SA 4M7DA 4M77D 1WQ7A 1BIAA 4J6YA 3RKWA 5GAOq 3GIBA 4M75E 5GMKi 5LJ3e 2DJZA 2EAYA 4F7UG 1Y96B 3SB2A 4QVDA 5LJ3d 1Y96A 2DVEA 5LJ3g 5GAN7 5GAN3 4M78E 4M75G 4OP0A 4NL2A 4M7AB 4M7AA 3EFRA 4M77B 4M7DG 4C8QC 4M77A 4V2SA 2VC8A 3QHSA 4XU1A 3JCMV 3JB9J 1N9SA 5GANf 5GANh 4PJOE 4X9CA 3M4GA 4MMKA 5GANj 2ZGWA 4C8QF 1X01A 4XQ3A 3JCMQ 3JB9F 3JCMW 2EJGA 4PJOG 2DEQA 4M77G 1MGQA 2RB6A 4C8QD 4N0AC 3FIFA 3JB9D 1YCYA 5GANe 1LNXA 4F7UE 5GAOr 2VXFA 5GANg 1B34B 4C8QB 4RCBA 1B34A 4A53A 4C8QA 4M7DE 3L2ZA 2I2LA 2E64A 1JRIA 3L1AA 4J6XA 4XU0A 1M8VA 4J5YA 2HNIA 4C92F 3JB9H 3JCMf 3JCMh 3RKXA 3JCMc 5GMKl 2EJ9A 4EMHA 1LJOA 1WNLA 4M7AE 4C8QG 4NL3A 3JB9G 3SWNB 1HK9A 1WQWA 4M77E 3HSBA 3SWNA 3JCMX 4N0AA 3EFSA 3FJPA 4M7AG 1TH7A 3BFMA 4X9DA 4XTXA 4EMKC 1U1TA 2DZCA 3RERA 3QSUA 2CGHA 4RCCA 3SWNC 3V7CA 2E10A 4C92B 3JCMe 2YHTA 3JB9I 3FB9A 1H641 4XTYA 4C92A 5GAMj 3JCMg 3VU3C 3V8LA 2DTHA 5GANd 5GAOm 1BIBA 4WF2A 4C92C 4M78C 5GMKh 4Y91A 4XTVA 5LJ5h 4MMLA 3BDUA 4M75F 2YLBA 5GMKj 5GAOp 1M5Q1 4PNOA 4JRKA 3V8KA 5LJ5j 2DZ9A 2DKGA 3JCMb 2RA2A 3V7RA 4C8QE 4PJOC 3HFOA 4M78F 4M75D 4EMGA 5GAOn 2E41A 3RUXA 2RD1A 2DTOA 4EMKB 5LJ3h 4C92D 2RM4A 4EMKA 4M78D 5GAN6 1D3BB 4HA8A 4PJOF 5LJ3j 5GAN8 3RESA 1D3BA 3RIRA 3PGGA 4M75B 5LJ5g 3JCMP 3QO3A 1I81A 2EWNA 4M75A 4XU2A 4J6WA 1I4K1 4JLIA 5GAMf 5GAMh 4PJOD 1JBMA 2DXUA 3AHUA 1KQ1A 4M78B 1HXDA 2DTIA 4XU3A 3JCMd 3HFNA 4M78A 2VXEA 4M75C 3RKYA 2FB7A 4HT9A 3V8JA 1U1SA 4C92E 4M7DC 5GAN4 3JCMJ 5I21A 1KQ2A 4A54A 4F7UF 4PJOB 5GAN5 5DY9A 4NOYA 5LJ5f 1I5LA 4PJOA 1LOJA 4JUVA 4XTZA 5GAMe 4C92G 4M78G 1N9RA 2EJFA 5GAMd 2E1HA 2DXTA 4DQ2A 4M7DF 5GAMg 4M7AC 3BY7A 4HT8A 2E65A 2JN0A 2Y90A 4M77C 4XTUA 2YLCA 5GAN2 2FYKA 5GAOl 4M7DD 3QUIA 2K57A 5LJ3f 1WPYA 4XTWA 4QVCA 5GMKe 4JRIA 3BW1A 4F7UB 5LJ5e 1I8FA 4M7AF 4F7UA 4M77F 5LJ5d 2QTXA 5GMKm
chains in the Genus database with same CATH superfamily
4KGZB 1I1JA 1KIKA 1SSHA 1OPLA 4M77D 3G6ET 1YITQ 1BCMA 3QG1A 1QVGA 4KT0E 1RAEB 4OGCA 3H0IA 4OVAA 1QMCA 2XDPA 3M55A 4F17A 2DAQA 1G83A 1M1FA 1IXDA 4C8QD 4RG2A 1LNXA 1KG1A 2A0FB 1KSWA 2A08A 1K76A 1VYTA 2XK0A 4BD3A 3JB9H 1WHHA 2RQRA 2CP3A 4HCZA 1LPLA 1JEGA 3CCJT 4ZGJB 3CMAQ 4GBQA 1VQ6Q 2DTHA 1MMAA 1YIJA 5C6SA 3X28B 1M5Q1 5LJ5j 1VQKT 1JU5C 1JXMA 4TVRA 2OTJT 1M9SA 2V8IA 1SF9A 3WXMB 2K7AA 4M78D 2FHDA 1D3BB 3C94A 2JS2A 2F2WA 4QQGA 3PMTA 1MV0B 5KYYB 5IH2A 2DTIA 3EG2A 3MEUA 2HQHA 3TSZA 3RKYA 2EYYA 3QJYA 1KQ2A 3OYLA 4PJOB 5HK3A 5GAN5 5HKCA 5CKDA 1YITA 4FSXA 1N9RA 2EJFA 3QZ9B 3M0PA 1K9MU 3MJXA 2WACA 1FWZA 1VIFA 2DX1A 2EYXA 1CKBA 5KYNA 3UT1A 3JB9I 3NMZC 3L2VA 1FXXA 2RHZA 5D6YA 3CCUT 4C0DC 2CKKA 2IIMA 5GAN3 2DM1A 3DB4A 2EYZA 1WYXA 1QP2A 2KVQG 4JS5A 3CPFA 4IURA 3JB9D 2OAWA 2OX7A 3OYKA 4HVVA 3KXTA 3CMAA 4Z8AA 1VQ6A 1BYMA 3CCST 2LCLA 4IIOA 3A8GB 1YI2Q 1O9SA 3CC7Q 3A98A 1B7TA 4BDYA 2EQKA 1G3WA 3OS0A 2FPEA 1N6AA 5GMKh 5GAOp 1QCOA 1M8MA 3V7RA 1KK7A 3CMEQ 4DBFA 2ZPEB 3RESA 5CCAA 4XU2A 2KYBA 2E6NA 4PJOD 3ZFJA 1QW1A 4C92E 2LMJA 2NWMA 2KSSA 2DD5A 2ZPFB 3QKJA 1LOJA 4DEYA 1M1KU 3NFCA 1Z9QA 3OQ5A 2QQBA 1PRMC 2ZAEA 2LJ3A 2Y4YA 3ME9A 4QKUA 3L2RA 4NS5A 1NLPC 2KRMA 2L8DA 2GCXA 1QLYA 1UG1A 1RL2A 1PNJA 2CSIA 4M75E 3OBWA 1BU1A 3OYHA 2NUTA 5LJ3d 3CC2Q 2KAFA 1M3BA 3RMQA 4M7AB 4FT4A 3E2UA 5KE2A 3MPUB 1N9SA 2HCKA 5HK0A 3CPWS 4X9CA 4LDUA 2KQWA 1HD3A 2EJGA 4PJOG 2X4YA 4EIKA 2QGGA 3CCVQ 1YI2A 3CC7A 2CZ0B 1PD0A 4FYXB 1KC8U 4N4HA 2VXFA 4HKEA 2DVJA 5D6WA 4J6XA 3OYMA 3P8DA 3RKXA 3M59A 2XMFA 2LQ8A 2HZYA 3CCEQ 4PKCC 1D1CA 2PVOB 4EDUA 1VQ7Q 4O5VA 1M3AA 4FM4B 3CMEA 1AWXA 1YNZA 3BFMA 3EFOA 4X9DA 1GFDA 2VGNA 1KHIA 3OSSC 3OYEA 2GNCA 5GJWB 2L89A 1QWEA 3JCMg 2F69A 5GAOm 1ZSGA 2L5QA 2EYWA 2RI2A 2YUNA 2VGMA 1WXTA 1KD1U 3FLGA 2RQVA 1UE9A 1S1NA 1YWOA 4KH1B 4HCBA 1X43A 3OS1A 5FROA 2O88A 5FW9A 1ZBJA 3T9NA 4XK8E 3PIOA 2P0KA 3I55T 1BBZA 3MEVA 5CQXA 4FYVB 4IUPA 1KHCA 2CT4A 4LE9A 4E7SA 1ZQ1A 4RTYA 3JCMJ 3M4YA 3NTIA 4NOYA 4JUVA 2SEMA 2KEAA 3AT1B 3CC2A 3ZL7C 2KMTA 4HT8A 1YJWT 5GAOl 2V1RA 4J9IA 4GLMA 2QTVA 2KT1A 4HXJA 2EAYA 3I9QA 4M7AD 1YCSB 2HQXA 1BIAA 3NPFA 3CCVA 1SRMA 5GMKi 2DJZA 4Z89A 4CC4B 4BI8B 4ELYC 4ZNXA 3TREA 4E7HA 3OA6A 4ORZA 4A4KA 1FMVA 2DE0X 4C5EA 2E5KA 4ELZC 1KQSS 5CKFA 3CCEA 3VKIA 2J6KA 1RAAB 4OB2B 1VQ7A 1K9MR 3TQ7P 5IHNA 3EG9A 2RNAA 4KGVB 1MUZA 1VQMT 4RCBA 4X1VA 3EHQA 4CI0C 4LD6A 5CO7A 4AFSC 4C92F 2BE9B 2QASA 4JJBA 3JCMc 2LC4A 3REBB 1G3SA 3ULRB 2XICA 1TOVA 4J9GA 3JCMX 2VYTA 4J83A 3M0UA 4M7AG 2CGHA 4XTYA 2DA9A 1ABQA 3X25B 3V8LA 4J9EA 3OYNA 3PMIA 4BE2A 4E7ZA 3DLLA 1SHFA 4MZMA 4M75F 3OYJA 2D8HA 2KDSA 4BY6C 1AOJA 2RD1A 1WZOA 2RH2A 4EMKA 3F70A 3RIRA 2O31A 2VB6A 5I22A 2LX7A 2VXEA 3M56A 4E7JA 1VQ8Q 1AD5A 2PZ1A 2BZXA 3HKSA 1XOVA 1FYNA 4BE0A 1PSEA 1TUGB 4AG2C 5GAMd 1H8KA 3BY7A 3CC4T 1RI9A 5KCOA 3CCQT 2FO0A 4E7LA 3CCMQ 4M7DA 4BI4A 2DETA 4RTTA 2WSFE 2YWWA 1Y96B 4D8DA 3EG0A 3L42A 4NL2A 4C0FA 2ZPBB 4M77A 1WIEA 5GANf 2COWA 5GANh 3EH1A 4GLKA 2M16A 3EGXA 4M4ZA 2YSQA 4JZ3A 2QQRA 1MMNA 2DEQA 2JNGA 5A0DA 1IGQA 2RB6A 3X26B 3FIFA 2EQJA 2DILA 5FRNA 1K9AA 3WVEB 4C0DB 5KCHA 2GTJA 2DIGA 3L2QA 4KH0B 1NYFA 1S72T 1QCNA 4A53A 4C8QA 1PHTA 3VS6A 2PU9B 4YTLA 2XI9A 3OB9A 4DOWA 5KYWB 3Q1JA 1OPKA 4JRQA 5KYUA 2VUBA 1IHWA 1RACB 3CD6Q 2J05A 3EG3A 1N8RU 3NHNA 7AT1B 2EQIA 2MWPA 2DO3A 1K73U 2DERA 5J26A 3OYCA 2XIDA 2NUPB 2E3HA 1VQNT 2QQAA 4Y91A 4MMLA 3OS2A 3E9FA 2R5AA 3RR6A 1VQ8A 1WJSA 3HTRA 2D0NA 2MIOA 1X2QA 1UEBA 1AEYA 3KFVA 2ATCB 3LH5A 2HDAA 3FJ5A 4IUTA 4PFPA 2KI7A 1WHLA 2BZ8A 3M0SA 2YRDA 1M1GA 4FW2A 2CREA 3J7AF 1GXIE 3PGGA 1GL5A 1WX6A 2EWNA 2IPOB 3OMGA 2DXUA 3AHUA 4M78A 2L3SA 5KH6A 3V8JA 2DPPB 3CCMA 5DY9A 1TUCA 1VQPQ 1G2BA 5I2MA 4OMFB 4KRTA 5HY6A 2O4XA 4XTUA 4ZN3A 5L23A 3G1JA 1H92A 4IUVA 5LJ3f 3A8LB 2K3YA 4QVCA 1CSKA 1KD1R 3OW2S 1UHCA 5GMKm 2Y4XA 2K3XA 2QG9B 4OP0A 1Q81C 4QQDA 2E5QA 1W1FA 1YBYA 1K8AR 2K9GA 1Q86U 3VJPA 2JVVA 1MGQA 2X4XA 2J6OA 3CD6A 3S3OA 4Y92A 2X9HA 5GANe 3R6NA 2BE7D 4J9BA 1YJNQ 3I56Q 1WXBA 1BI0A 2YRCA 4K11A 5GMKl 2MK5A 1M2VB 3QWYA 1BK2A 3OYFA 3PVQA 1B07A 1U1TA 3VS3A 4C92B 2YHTA 3M54A 4RTXA 1T3SA 3C4SA 4R55A 3CCRT 1ZUKA 3A8HB 2X4JA 1QQJA 4RTVA 1VQPA 2K79A 3J81E 1D3BA 4M75B 3FDRA 3GLXA 1I4K1 2DNUA 1JBMA 4ZGDB 1AVZC 4A63B 3HHTB 3OYAA 1Q82U 5KYYA 2GFAA 4ZGEB 2DMOA 2RJFA 1IRXA 3MP8A 4IUUA 4PJOA 2G6FX 1Q95G 2JW4A 2P84A 1VQ4Q 4PJJA 2BIVA 3C0CA 2XDBA 4OMNA 1OZ2A 4RMOA 3BW1A 1VQ5Q 2EKOA 2ZZDA 3H9NA 2JT4A 4MZTA 3V7SA 5EG2A 2VV5A 5LJ3e 4F7UG 2HL3A 5GAN7 5CKEA 1YJNA 3I56A 2A36A 3GPLA 3S6WA 3EG1A 4ANJA 3JRZA 2DL8A 2J06A 2DF6A 2GQVA 2FEIA 4PFOA 3VS1A 1OU9A 2BZYA 3MO8A 3VYGA 2KY9A 2KXCA 1VQ9T 4F7UE 1PC0A 5FU7C 4PLIA 1NG2A 4OMOA 3CCLT 3RNJA 4B9XA 4AFQC 3GOXA 2EJ9A 1GCPA 2GFUA 2V26A 3QDRB 3SWNB 4C5GA 5FU6B 3HSBA 4N0AA 3EFSA 1RI0A 2QA4Q 2CZ7B 3A5ZB 1H641 1UGQB 5GANd 1C6VX 3ZEHA 1PD1A 4BDZA 5LJ5h 3O5ZA 1U5SA 2DKGA 2F1LA 3JCMb 1B3QA 3HFOA 4M75D 4RTUA 1X27A 2RN8A 1NLOC 2X51A 1EIFA 4EPCA 1VQ4A 3VYHB 1UGRB 3EH2A 2KBTA 2LTOA 4J6WA 5GAMf 5GAMh 3HL8A 1D1BA 1YWPA 1TUDA 3HFNA 1VQ5A 5A0GA 3ZBDA 3LGLA 1BB9A 3ER0A 3CXCS 1U1SA 2MMPA 4BY6B 2LCCA 1UTIA 1N8RR 4C92G 3S3NA 3EHRA 1K73R 1M90U 2GGRA 4ZN1A 3RDVA 2XD0A 4CC3A 1ZX6A 1VQOQ 1PWTA 2MAMA 2PTKA 1X69A 3INZA 1QVFA 1TXQA 3GIBA 2CP6A 5FWBA 2OTLQ 3G7ZA 5KYXB 2DVEA 4M75G 5IHIA 1KFZA 4M7AA 2HKNA 2VC8A 2EFIA 4FT2A 1SG5A 3QHSA 1NYGA 2KT8A 2CUBA 4JRPA 3M0TA 2PVDB 2RQTA 2KRNA 2QA4A 5GAOr 4IIMA 1YN8A 1LCKA 3MP1A 1M27C 1YIJT 4F14A 2D6FA 5CVIA 1QVPA 1O75A 3SFMA 3KBGA 1RAHB 3CBOA 5I2SA 2RHUA 2H8HA 5IHKA 3QSUA 3PFSA 1JJ2S 3QPHA 2C0TA 3RMSA 3FB9A 5AYFA 1G3TA 4C0ZA 4II1A 1Q86R 1QKXA 2FZCB 4PLLA 3LWHA 4C92C 2YT6A 1YJ9Q 2QEXQ 1Q7YC 1YITT 3E9GA 2LJ1A 3G71Q 1X6BA 5GAOn 3QZ5B 2DL3A 2X4WA 1GCQC 4PJNA 5CR2A 5GAN8 4F16A 2DLPA 3HPWA 1IO6A 3UF4A 2A3LA 2QYZA 2V8JA 1NJIU 2P0PA 1VQOA 1AZEA 1UUEA 4M75C 1R77A 2K5IA 4F7UF 3UA7A 2NUZA 2OTLA 5GAMe 2LP5A 3G4SQ 2K4YA 2DXTA 3MEAA 1ARKA 1YHQQ 1E6HA 1IREB 2QAZA 4L5GA 2AK5A 1N27A 1AWOA 5GMKe 4ZTJA 2AHJB 4J8OA 3EGDB 2K5LA 2RQWA 5CAIA 3RKWA 5GAOq 2CZ1B 1K8AU 3OYGA 1G5VA 3FEOA 2BKDN 3CMAT 1VQ6T 5IXBA 1Q82R 3H0FA 3JCMV 1Y0MA 3CBPA 1QWFA 3OYYA 2KROA 4XQ3A 2W10A 2CT3A 4PFZA 3I5SA 2RF0A 3GBQA 4KBMB 3CXCP 1VYVA 1V76A 2DXCA 2L3RA 2X3XD 2M02A 1AWWA 2LNHB 3PE0A 2LQKA 2JTEA 3L2ZA 2FPFA 1VQLQ 2ABLA 2HNIA 3PTAA 3NTHA 3H41A 2KE9A 4NL3A 1YJ9A 1HK9A 3MCAB 2CP7A 2QEXA 1W2BS 3GF5A 4N4IA 5IT9E 3G6EQ 1T3LA 3G71A 1WGSA 2DZCA 3SWNC 1BCOA 5FU6C 1HSQA 3M57A 2DIQA 3H8ZA 1GRIA 2DRMA 2WSEE 1W70A 2W0ZA 3V8KA 4WCIA 2QK0A 1K9MC 2M0OA 1LVKA 1NPRA 3G4SA 2CZ6B 4RKUE 4XAXB 2C0OA 4O6JA 5L8RE 2EGAA 1YHQA 1ZBXA 1QCFA 3OBYA 2RK1A 3QO3A 2HBPA 3PT9A 2CSQA 1YP5A 3RBBB 1R0BG 1AWJA 2RJCA 1V29B 3DLMA 2A28A 1VA7A 4A54A 4XTZA 4DBHA 3CPWP 1WJRA 2B86A 1K0XA 1WXUA 2K3BA 2X3WD 3CCJQ 3M53A 2PNIA 2K57A 1JJ2P 4ESRA 1VYUA 5LJ5d 3VUZA 1YI2T 4QW2A 4KUDK 4OMQA 3CC7T 2MI6A 2O01E 1VQKQ 1OULA 2OTJQ 1Y96A 1RAGB 1G3YA 1HYOA 4V2SA 1PG5B 3JB9J 1VQLA 4DBRA 3M4GA 5I11A 3SHWA 3TU4K 2P4RA 2ZGWA 2D1XA 1ZSZB 3CMET 3MP6A 2CP0A 1NBEB 1M90R 4LUEA 3G6EA 3E1SA 3REAB 5GANg 1JXOA 4B9WA 3FC3A 1WA7A 4OF1A 4AT1B 1M8VA 5HCKA 2DRKA 5KYWA 1QKWA 4OB0B 1R8OB 2JS0A 5GJVB 3CCUQ 2ZCFB 2P0QA 5FU7B 3UWNA 2WSCE 3C12A 1D09B 2LDMA 2NUPA 2DJQA 4FW1A 3TSWA 2K2VA 1M1KC 4MDXA 2LT1A 4LN2A 4AFUC 4EMGA 3CC2T 2K6DA 2I0NA 1MMDA 2D9TA 2FRWA 3CBMA 4KUIA 3TEEA 4FYWB 5LJ3j 4LNPA 4DOVA 3CCJA 2PQWA 2JXBA 2SRCA 4ZTFA 3CCSQ 2KRSA 1HXDA 4IUQA 1EX4A 3CCVT 5LL6S 4B6MA 1UGSB 5I21A 2O2OA 1VQKA 1W2BP 2OTJA 3M0RA 4E7KA 2JN0A 3SEMA 1KQSP 2FPDA 1WPYA 2F2VA 2R5MA 1OQKA 1G8XA 3PIPA 3VS4A 4F7UB 1I8FA 1OV3A 1UJYA 3CCET 2CH4A 2DL4A 1VQ7T 2DK3A 2JUFA 4Z88A 1SRLA 1KC8C 2HEQA 2JM9A 2JMCA 2ED0A 1C0MA 2AKLA 5M9OA 5LJ3g 4LUDA 2GTOA 1NJIR 1XTDA 4Q5WA 2D8JA 5ECAA 3HP9A 2LNVA 2RK2A 2CH4W 4BUGA 4L59A 2JJ9A 1FX7A 5D6XA 3QJ6A 2HD0A 4HCKA 1Z9ZA 3CCUA 2VKNA 1B34B 2E3IA 2RO0A 2EQUA 1KD1C 2DEUA 4HCCA 3NTKA 1TWBA 1M2VA 1Q81R 2RHXA 1TSFA 2L3QA 1PKSA 4P5NA 1UHFA 1RLPC 2RQUA 3QXEB 4C92A 1SPKA 3CXCA 3H6ZA 2VASA 3LH0A 4WF2A 1Y7XA 1OYXA 3CCSA 2M9UA 3OYDA 1RADB 4PNOA 1SEMA 2RA2A 1NEBA 1X2KA 5IN1A 2F2XA 2H3EB 5GAN6 2EW3A 2QQSA 3ASKA 4M75A 2XHCA 1WHGA 4XU3A 5FWCA 2EIFA 3BDLA 1UGVA 2MOXA 3QWXX 6AT1B 1GFCA 4A4HA 2YUPA 2A37A 4XTWA 1EFNA 2L2PA 3UDCA 3VRZA 1J3TA 4AMCA 4CC2A 4OMMA 1UB4A 1WQ7A 4A4EA 5IXFA 4J9CA 1T0HA 3SB2A 4QVDA 2DYBA 3LW5E 2RHIA 1H3ZA 2V1QA 4M7DG 4Z02A 4JZ4A 9ATCB 2DD4A 3CPWA 3I55Q 4FL6A 4BACA 4MZPA 4M77G 1JJ2A 2D0QB 3D7SB 4J9FA 2M0YA 1ZSZC 1ZUYA 2ROTA 2KR3A 1X75C 1CKAA 1OX9A 3E19A 4M7DE 1YJWQ 1M30A 2E64A 3QIIA 3L1AA 4J5YA 1ZA1B 1VQ8T 2ZPIB 4HVWA 1RAFB 1WNLA 1A0NB 1MHNA 4C8QG 4M77E 1OI1A 2ZPGB 3SWNA 2DYIA 3VS0A 4EMKC 5C0MA 5CK9A 4RTZA 5GAMj 2PVGB 4F04B 3OS5A 3L2WA 2KK4A 4R0KA 1UDLA 1W6XA 2CS7A 4E2FB 3UATA 2K5FA 3HRSA 1PM3A 1VUBA 2FZGB 2JOYA 2MPXC 3CCMT 5GMKj 2DZ9A 4C8QE 2ZPHB 5A0LA 2E41A 2LT4A 2C0IA 2DTOA 4C92D 3OW2P 5LJ5g 1VQMQ 4UC4A 2HAXA 2X35A 2ESWA 4C5HA 2ROLA 4HT9A 4M7DC 2RHYA 2LCSA 4LDYA 5LJ5f 1I5LA 2HKQB 1HJDA 2BTTA 2BUDA 2YDLA 4M78G 2H3JA 4A4FA 4DQ2A 2J7IA 5GAMg 2LZ6B 1OU8A 2Y90A 4M77C 5EC7A 3I55A 2AIRB 4PL6A 2B8AA 2DFUA 5FRMA 2JTMA 1D1AA 3META 3CD6T 2CP5A 3I35A 3M5AA 4JJCA 5KYXA 2CYZB 4M78E 2MCNA 2RMOA 4AG1C 1UFFA 3WVDB 1FMKA 1MV3A 4C8QC 2DL5A 4XU1A 1YJWA 1W2BA 1SHGA 4BI3A 4ATOA 3JAME 2MF2A 1UGPB 1KQSA 1KJWA 4CC7A 2L0AA 4VUBA 8ATCB 2QGFB 1N8RC 3EAEA 1V1CA 4LDWA 1K73C 1JB0E 3CC4Q 1X6GA 2LX9A 1QVGS 2AZSA 2RI5A 1JRIA 3LLRA 3CCQQ 5CIUA 4EMHA 2EGCA 3P8BB 3JB9G 3SDZA 1WQWA 1VQPT 4DA4A 1IZ6A 1OEBA 3V7CA 3SD4A 4PJMA 1VQMA 2XKOC 3HRUA 3NGPA 4M78C 4JJDA 3BDUA 4L6V5 1RABB 1ZUUA 3MKDA 4E7IA 1MNEA 4OGEA 4KULA 2FG0A 2HSEB 2NYSA 1S72Q 3JCMP 1I81A 3U23A 2LQWA 1I07A 1WHKA 1KQ1A 4J9HA 2E6ZA 1WJQA 4JS4A 2RI3A 1YJNT 4E6RA 3I56T 4M7DF 1D0ZA 2AT1B 2E65A 1Q86C 3QUIA 4AFZC 4PJLA 3MHXA 1Q7YR 4JRIA 5LJ5e 3I5RA 3QBYA 4M77F 3EGDA 4LD9K 4PK4A 1VQNQ 2QTXA 1W4SA 2O9VA 4FIBA 4OMPA 2QDLA 2R58A 1K0SA 2EQMA 3QYHB 1P92A 2NUTB 2JTFA 2E70A 2KXDA 4ME7A 1U06A 3EFRA 1RUWA 3CC4A 4PJOE 3KUFA 2VWFA 2Z0WA 1H3HA 3CCQA 4C8QF 4QQ6A 2DL7A 3THKA 1U8RA 2P4TA 3TVTA 3VUBA 1PSFA 2JMAA 5J39A 3DB3A 1FMWA 3CEYA 1OX8A 3A8OB 1I5OB 2V8KA 2EBPA 2I2LA 1Q81U 1C1AA 3L2UA 3JCMf 3JCMh 2CDTA 4D6WA 1LJOA 2ECZA 3CQTA 3TCJA 2CP2A 2O9SA 5DM7R 3VS5A 3EFOB 2QXFA 1VQ4T 1M3CA 1TH7A 4XTXA 3RERA 3HRTA 4LDVA 1BI3A 3M58A 1Q82C 1D0YA 1S72A 2NLUA 1NM7A 1VQ5T 3LX7A 1BIBA 3LYIA 2COYA 1EZZB 2DBKA 4PJOC 4M78F 4FYYB 1K1ZA 1Y71A 1GBQA 2QI2A 2QQ9A 2LRQA 2MWOA 2YUQA 5J3BA 4HA8A 5A2QE 1JQQA 1X6OA 1WHMA 2K2MA 4BB7A 1BI2A 2HSPA 4OB3B 3A1PA 2PUKB 2AZVA 4D8KA 4DBQA 1QVGP 2YRVA 2RJEA 3MEWA 3R6OA 4FCYA 2ENMA 1VQNA 1SKUB 2FRYA 1WDXA 4GY5A 2GQIA 2HQEA 4OMLA 2XG8D 4R56A 1PKTA 1ABOA 3OW2A 2IVWA 3M0QA 2RPNA 1RLQC 3CCRQ 1QVFS 4J6YA 1DJ7B 4BE1A 2QA4T 2E12A 4LDXA 2EYQA 2DBMA 1OZ3A 1OOTA 2MYSA 3S3MA 2HBWA 5GANj 3JB9F 3JCMQ 2GF7A 2PUOB 4RG8A 3GNGA 1ZSZA 4WTOB 2OAUA 4N0AC 3X24B 3VS2A 3EG9B 3UA6A 4E47A 4C0GA 4OB1B 2M51A 1I0CA 2IG0A 4XU0A 1XNIA 1TG0A 2GBQA 1ACMB 4QT7A 4FU6A 3PVLA 4M7AE 2YXYA 3FJPA 1QP3A 3JV3A 4RCCA 3JCMe 8AT1B 2HMAA 3VU3C 5IAYA 3DKMA 5CKBA 3A8MB 2HL5C 1VQOT 1WHJA 1UJ0A 3QYGB 4XTVA 3OMCA 1M2OA 5FLXE 4JJNK 4MDWA 2OTLT 1T0JA 4JLGA 1IB8A 1M90C 3RUXA 3VRYA 4EMKB 2RM4A 2QDYB 1VQ9Q 4DEXA 2OI3A 2EPDA 4PJOF 1NZ9A 2KNBB 4X34A 1UECA 3CCLQ 5DLOA 1WLPB 4FSSA 2M1HA 2JZ2A 2FB7A 3X20B 4RUGA 3CCRA 1TTHB 4IKFA 2EVRA 1TU0B 1GBRA 2E1HA 2ED1A 4M7AC 2EKHA 1TS9A 1PRLC 1E6GA 2FYKA 1M1KR 4C5IA 1XJWB 1NE8A 4J7FA 3LWIA 4F7UA 3PNWC 2YUOA 4M7DB 3OYIA 2F5TX 3P8HA 2LJ0A 2LQNA 1PCXA 2F5KA 3GNFB 1IHVA 2RJDA 1YFNA 4M77B 4CRIA 4N4GA 2KYMA 1AT1B 2AKKA 3EGXB 1ZA2B 5AT1B 1E7OA 1F1BB 1MNDA 4MMKA 3UPUA 1X01A 1YJ9T 2EGEA 2QEXT 3JCMW 1NPPA 1NEGA 3G71T 3M9QA 2E4HA 4JDSA 1M4ZA 2A7YA 2VVKA 3H0HA 1JO8A 1YCYA 4J9DA 4LXCA 5CKHA 1R0CB 1D0XA 1ZHIA 1WI7A 4A4GA 1U3OA 3VS7A 3OY9A 4C8QB 2FL7A 2JM8A 1B34A 1IGUA 2L3PA 1KC8R 2OJ2A 2FZKB 1Y07A 2FVUA 3GP8A 5KYUB 3OYBA 3G4ST 1YHQT 1QVFP 2J6FA 5CQYA 5D7UA 4J7IA 2E10A 1VQ9A 1BKBA 3OSVA 1SSFA 2LVMA 1NJIC 1K4US 3JSCA 1WFWA 1N5ZA 1VOMA 3URGA 3CCLA 2YLBA 1MMGA 5KE3A 4JRKA 3IQLA 5LJ3h 1RAIB 3LGFA 2XU8A 1XQHA 3N5BB 1Y57A 1YIJQ 4QVZA 2DXBA 4JLIA 3C95A 3EGUA 2C06A 4M78B 2COZA 5DLQE 3JCMd 4RTWA 1ZLMA 3J80E 3FRNA 1K8AC 2CUDA 5GAN4 2R57A 2G3RA 4Y28E 1BI1A 2KGTA 1Q7YU 4KGXB 3VV0A 2O4XB 2XDDA 1GCQA 3O8VA 2YLCA 5GAN2 1VQLT 1VIEA 3QDFA 4M7DD 4JPBW 1AZGB 4M7AF 4HVUA 1AHJB 3BE3A
chains in the Genus database with same CATH topology
5CAIA 4E7LA 2JTMA 3META 3CD6T 4M77D 4M7DA 3RKWA 5GAOq 2CZ1B 3G6ET 4BI4A 1K8AU 3OYGA 1G5VA 3M5AA 2WSFE 3FEOA 2BKDN 3QG1A 1Y96B 4KT0E 1QVGA 4OGCA 3CMAT 2CYZB 3L42A 4M78E 1VQ6T 4NL2A 4C0FA 4OVAA 3WVDB 4C8QC 2ZPBB 2XDPA 4M77A 4XU1A 3M55A 3JCMV 1YJWA 5GANf 5GANh 1W2BA 4GLKA 2M16A 3CBPA 4BI3A 4ATOA 3OYYA 2MF2A 3JAME 4XQ3A 2DAQA 2QQRA 1UGPB 1KQSA 2DEQA 2JNGA 4VUBA 5A0DA 1M1FA 2RB6A 3X26B 4C8QD 1N8RC 3FIFA 2EQJA 3EAEA 4KBMB 5FRNA 3WVEB 4C0DB 5KCHA 4RG2A 4LDWA 1LNXA 2DIGA 2DXCA 2L3RA 3L2QA 1K73C 1S72T 1JB0E 2LQKA 1KG1A 4A53A 4C8QA 2LX9A 3L2ZA 1QVGS 2PU9B 2RI5A 4YTLA 1JRIA 3LLRA 2XI9A 2HNIA 3PTAA 2XK0A 3OB9A 5CIUA 4BD3A 4DOWA 3Q1JA 3JB9H 4EMHA 3P8BB 3NTHA 1JJ2A 4JRQA 4HCZA 3SDZA 4NL3A 3JB9G 1YJ9A 1HK9A 1WQWA 3MCAB 2QEXA 2VUBA 1W2BS 3GF5A 4N4IA 1VQPT 5IT9E 3G71A 1WGSA 4DA4A 1IZ6A 1N8RU 2DZCA 3CCJT 3V7CA 4ZGJB 3SWNC 3SD4A 5FU6C 2MWPA 3M57A 2DO3A 1K73U 2DTHA 5J26A 3OYCA 2XIDA 1VQMA 1YIJA 2XKOC 3HRUA 2DIQA 1VQNT 2QQAA 4M78C 3H8ZA 4Y91A 4MMLA 3X28B 5C6SA 3BDUA 4L6V5 3OS2A 3E9FA 2WSEE 2R5AA 1M5Q1 5LJ5j 3V8KA 1WJSA 1VQ8A 1VQKT 4E7IA 1UEBA 4TVRA 1K9MC 2OTJT 1M9SA 2M0OA 4IUTA 4OGEA 2V8IA 1NPRA 3WXMB 3G4SA 2CZ6B 4M78D 2FHDA 4RKUE 1M1GA 4KULA 4O6JA 1D3BB 4XAXB 5L8RE 1YHQA 1ZBXA 3J7AF 3C94A 3OBYA 1GXIE 2RK1A 3PGGA 3JCMP 3QO3A 1I81A 2EWNA 2HBPA 3PT9A 4QQGA 3OMGA 3PMTA 2DXUA 3AHUA 1KQ1A 2DTIA 3MEUA 4M78A 2E6ZA 2RJCA 1V29B 3RKYA 5KH6A 1WJQA 3DLMA 3V8JA 4JS4A 2RI3A 3QJYA 1KQ2A 4A54A 2DPPB 3OYLA 3CCMA 5HK3A 5GAN5 4PJOB 5DY9A 5HKCA 4XTZA 1YJNT 5CKDA 1YITA 4FSXA 3I56T 1N9RA 5I2MA 1WJRA 2EJFA 3QZ9B 4OMFB 5HY6A 1K9MU 4M7DF 2O4XA 2E65A 2WACA 4XTUA 3M53A 4ZN3A 1Q86C 3QUIA 2K57A 1FWZA 1VIFA 4IUVA 3A8LB 2K3YA 5LJ3f 4QVCA 3MHXA 4JRIA 5LJ5e 3QBYA 4M77F 5LJ5d 4LD9K 3OW2S 3VUZA 3UT1A 1YI2T 4QW2A 2QTXA 1W4SA 5GMKm 3JB9I 4KUDK 3CC7T 2Y4XA 4FIBA 3L2VA 2MI6A 2O01E 2R58A 1FXXA 2EQMA 3QYHB 2RHZA 1P92A 5D6YA 3CCUT 2JTFA 4C0DC 2CKKA 2E70A 2K3XA 1Y96A 5GAN3 1G3YA 4OP0A 4ME7A 3EFRA 1Q81C 4QQDA 2E5QA 4V2SA 1YBYA 3CC4A 3JB9J 4PJOE 3KUFA 3DB4A 1VQLA 3M4GA 1Q86U 3CCQA 3TU4K 2ZGWA 4C8QF 1QP2A 2KVQG 3VJPA 4JS5A 2JVVA 4QQ6A 1U8RA 3CPFA 1MGQA 2X4XA 2P4TA 4IURA 3CMET 3VUBA 3JB9D 3MP6A 1PSFA 3OYKA 5J39A 3DB3A 3CEYA 3CD6A 3S3OA 5GANe 3G6EA 3E1SA 5GANg 3A8OB 3KXTA 3CMAA 4B9WA 2V8KA 3FC3A 1VQ6A 2I2LA 4OF1A 1BYMA 3CCST 1Q81U 1BI0A 2LCLA 1M8VA 3L2UA 3JCMf 3JCMh 5GMKl 4D6WA 1LJOA 3A8GB 4OB0B 5GAMj 1R8OB 3TCJA 1O9SA 5DM7R 3OYFA 4BDYA 2EQKA 2QXFA 1G3WA 1VQ4T 1TH7A 4XTXA 3RERA 1U1TA 2ZCFB 2P0QA 5FU7B 3OS0A 3HRTA 4LDVA 3UWNA 2YHTA 4C92B 3M54A 2WSCE 3C12A 1BI3A 1N6AA 3M58A 1Q82C 2LDMA 3C4SA 1S72A 2NLUA 1VQ5T 3LX7A 1BIBA 3LYIA 4R55A 5GMKh 3CCRT 2K2VA 5GAOp 1M1KC 4MDXA 2LT1A 3A8HB 2X4JA 3V7RA 4PJOC 4M78F 4EMGA 3CC2T 1Y71A 2QI2A 2D9TA 2QQ9A 2LRQA 1VQPA 3CBMA 2MWOA 4KUIA 2ZPEB 5J3BA 3TEEA 4HA8A 5LJ3j 5A2QE 3J81E 3RESA 1D3BA 1X6OA 4DOVA 3CCJA 2PQWA 4M75B 1BI2A 4BB7A 5CCAA 3FDRA 4OB3B 4XU2A 3GLXA 1I4K1 2E6NA 4PJOD 4ZTFA 1JBMA 4ZGDB 2PUKB 3HHTB 4IUQA 1HXDA 3ZFJA 2GFAA 4ZGEB 3OYAA 1Q82U 1QW1A 2RJEA 2YRVA 3MEWA 3R6OA 1VQNA 3CCVT 2RJFA 5LL6S 4C92E 1UGSB 3MP8A 5I21A 2KSSA 2DD5A 2ZPFB 4IUUA 4PJOA 3QKJA 1VQKA 1LOJA 1M1KU 4GY5A 3NFCA 2OTJA 2BIVA 3OQ5A 4E7KA 2JN0A 2QQBA 2XDBA 2HQEA 2XG8D 3ME9A 2Y4YA 1WPYA 2R5MA 1OZ2A 4RMOA 4NS5A 3L2RA 3PIPA 4R56A 3BW1A 4F7UB 1I8FA 3OW2A 2IVWA 2EKOA 2ZZDA 3CCET 2L8DA 2GCXA 1VQ7T 2DK3A 2JUFA 1RL2A 4MZTA 3V7SA 1QVFS 4J6YA 1DJ7B 4BE1A 5EG2A 1KC8C 2QA4T 4M75E 2VV5A 3OBWA 5LJ3e 2E12A 4LDXA 4F7UG 5M9OA 3OYHA 5LJ3d 2KAFA 5LJ3g 5GAN7 3RMQA 5CKEA 4M7AB 1YJNA 2EYQA 3I56A 4FT4A 3GPLA 1OZ3A 3S6WA 1XTDA 5KE2A 4Q5WA 1N9SA 3HP9A 2LNVA 2RK2A 5HK0A 3CPWS 4X9CA 4LDUA 3S3MA 2KQWA 3JRZA 5GANj 3JB9F 3JCMQ 2GF7A 2EJGA 4PJOG 2GQVA 4BUGA 2PUOB 4L59A 2X4YA 4RG8A 3GNGA 2OAUA 1YI2A 4N0AC 3MO8A 2CZ0B 3VYGA 3X24B 2KY9A 1FX7A 5D6XA 3CC7A 4E47A 3QJ6A 1VQ9T 2HD0A 1KC8U 4C0GA 4F7UE 4N4HA 3CCUA 5FU7C 2VXFA 4PLIA 4OB1B 1B34B 4HKEA 3CCLT 2RO0A 5D6WA 2IG0A 4B9XA 4J6XA 4XU0A 3OYMA 3P8DA 1XNIA 2EQUA 1KD1C 3RKXA 3GOXA 3M59A 2EJ9A 2GFUA 2LQ8A 4PKCC 4FU6A 4M7AE 2PVOB 3QDRB 4EDUA 3SWNB 4O5VA 4C5GA 5FU6B 4HCCA 3NTKA 3HSBA 4FM4B 4N0AA 3EFSA 1RI0A 1VQ9A 3FJPA 2RHXA 3CMEA 3BFMA 4P5NA 4X9DA 2CZ7B 1QP3A 2VGNA 4RCCA 3JCMe 1KHIA 3A5ZB 3OSSC 3OYEA 1H641 1UGQB 2L89A 3QXEB 4C92A 3JCMg 3VU3C 5IAYA 3CXCA 3DKMA 5CKBA 2F69A 3H6ZA 3A8MB 5GANd 5GAOm 3LH0A 4WF2A 1VQOT 3ZEHA 1Y7XA 1NJIC 2L5QA 3QYGB 1OYXA 4BDZA 4XTVA 5LJ5h 3OMCA 5FLXE 3CCSA 4JJNK 2M9UA 4MDWA 2RI2A 3OYDA 4PNOA 2VGMA 2DKGA 1KD1U 4JLGA 3JCMb 2OTLT 2RA2A 3FLGA 3HFOA 4M75D 1M90C 3OS1A 4HCBA 3RUXA 5IN1A 5FROA 4EMKB 2RM4A 2QDYB 1EIFA 3T9NA 2QQSA 4XK8E 4PJOF 4EPCA 5GAN6 1NZ9A 3PIOA 3VYHB 1VQ4A 3ASKA 1UGRB 2P0KA 4X34A 3I55T 4M75A 2LTOA 3MEVA 4J6WA 5GAMf 5GAMh 3HL8A 2XHCA 5CQXA 5DLOA 4XU3A 3HFNA 4IUPA 2M1HA 1VQ5A 5A0GA 2JZ2A 3ZBDA 2FB7A 1KHCA 3LGLA 3ER0A 3X20B 1U1SA 2MMPA 4BY6B 3CXCS 1ZQ1A 2EIFA 2LCCA 3BDLA 3CCRA 3M4YA 3JCMJ 3NTIA 4NOYA 4IKFA 4JUVA 4C92G 3S3NA 2E1HA 3CC2A 2KMTA 1M90U 4M7AC 4HT8A 4A4HA 1YJWT 2FYKA 4ZN1A 5GAOl 4XTWA 4C5IA 2XD0A 3UDCA 1NE8A 4J7FA 3LWIA 4F7UA 3PNWC 2MAMA 2EAYA 3INZA 4M7AD 1QVFA 3OYIA 4M7DB 1UB4A 2HQXA 2F5TX 1WQ7A 1BIAA 3P8HA 4A4EA 3GIBA 3CCVA 5GMKi 2DJZA 2F5KA 3G7ZA 3GNFB 4QVDA 3SB2A 2RJDA 2DVEA 3LW5E 2RHIA 4BI8B 1H3ZA 4M75G 4ELYC 4M7AA 4M77B 4M7DG 4Z02A 3TREA 4N4GA 4CRIA 3OA6A 2VC8A 2EFIA 4E7HA 4FT2A 2DD4A 3QHSA 4A4KA 3CPWA 4FL6A 4C5EA 4MMKA 3UPUA 4ELZC 4BACA 1X01A 4MZPA 1YJ9T 2QEXT 3JCMW 1NPPA 4M77G 1KQSS 5CKFA 2D0QB 3VKIA 3M9QA 4JDSA 3G71T 1M4ZA 2A7YA 3CCEA 4JRPA 4OB2B 1VQ7A 1YCYA 5CKHA 2PVDB 2QA4A 5GAOr 1ZHIA 4A4GA 3MP1A 1X75C 4C8QB 3OY9A 4RCBA 2FL7A 1VQMT 1YIJT 1B34A 3E19A 2D6FA 4M7DE 4CI0C 2E64A 3QIIA 1QVPA 3L1AA 4LD6A 5CO7A 5CVIA 4J5YA 4C92F 1O75A 3JCMc 1VQ8T 2ZPIB 3SFMA 2LC4A 1G3SA 1WNLA 1Y07A 3KBGA 1MHNA 2FVUA 2XICA 3CBOA 4C8QG 5I2SA 3GP8A 4M77E 1OI1A 2ZPGB 3SWNA 3JCMX 2RHUA 2VYTA 4J83A 3OYBA 3G4ST 4M7AG 1YHQT 4EMKC 3QSUA 3PFSA 5CQYA 2CGHA 4J7IA 2E10A 3QPHA 5C0MA 3RMSA 1JJ2S 3FB9A 1BKBA 3OSVA 1G3TA 4XTYA 5AYFA 4C0ZA 5CK9A 1SSFA 2LVMA 2PVGB 3OS5A 4II1A 4PLLA 3X25B 3L2WA 2KK4A 3JSCA 3V8LA 3OYNA 3PMIA 4BE2A 2CS7A 3URGA 4C92C 3LWHA 3DLLA 2K5FA 3HRSA 3CCLA 1VUBA 2JOYA 4MZMA 4M75F 3OYJA 2YLBA 3CCMT 5GMKj 5KE3A 4JRKA 2DZ9A 1Q7YC 2KDSA 4BY6C 1YITT 3E9GA 4C8QE 2ZPHB 5A0LA 5GAOn 3QZ5B 2E41A 2LT4A 2RD1A 2DTOA 5LJ3h 4C92D 2RH2A 4EMKA 2X4WA 3F70A 3LGFA 2XU8A 5CR2A 5GAN8 3HPWA 3RIRA 1XQHA 3N5BB 5LJ5g 2A3LA 4UC4A 4QVZA 2DXBA 4JLIA 3C95A 2V8JA 1NJIU 2HAXA 2X35A 4M78B 5DLQE 2P0PA 3JCMd 2C06A 1VQOA 4C5HA 2VXEA 4M75C 3FRNA 3M56A 3J80E 4E7JA 1K8AC 4HT9A 4M7DC 2K5IA 2RHYA 5GAN4 2R57A 2G3RA 4LDYA 4Y28E 4F7UF 5LJ5f 1I5LA 1BI1A 2OTLA 3HKSA 1XOVA 2BUDA 5GAMe 1Q7YU 4M78G 2K4YA 4BE0A 1PSEA 2H3JA 3VV0A 2DXTA 3MEAA 2O4XB 4A4FA 4DQ2A 3BY7A 5GAMd 5GAMg 3O8VA 2XDDA 3CC4T 2Y90A 4M77C 1IREB 2YLCA 4L5GA 5KCOA 5GAN2 1VQLT 1VIEA 4M7DD 3CCQT 1N27A 5GMKe 4ZTJA 3I55A 2AHJB 4M7AF 4J8OA 2K5LA 4PL6A 2B8AA 5FRMA 1AHJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3INZ A;  5CAI A;  4M7A D;  4M7D B;  3V7S A;  4M7D A;  4M77 D;  1WQ7 A;  1BIA A;  4J6Y A;  3RKW A;  5GAO q;  3GIB A;  4M75 E;  5GMK i;  5LJ3 e;  2DJZ A;  2EAY A;  4F7U G;  1Y96 B;  3SB2 A;  4QVD A;  5LJ3 d;  1Y96 A;  2DVE A;  5LJ3 g;  5GAN 7;  5GAN 3;  4M78 E;  4M75 G;  4OP0 A;  4NL2 A;  4M7A B;  4M7A A;  3EFR A;  4M77 B;  4M7D G;  4C8Q C;  4M77 A;  4V2S A;  2VC8 A;  3QHS A;  4XU1 A;  3JCM V;  3JB9 J;  1N9S A;  5GAN f;  5GAN h;  4PJO E;  4X9C A;  3M4G A;  4MMK A;  5GAN j;  2ZGW A;  4C8Q F;  1X01 A;  4XQ3 A;  3JCM Q;  3JB9 F;  3JCM W;  2EJG A;  4PJO G;  2DEQ A;  4M77 G;  1MGQ A;  2RB6 A;  4C8Q D;  4N0A C;  3FIF A;  3JB9 D;  1YCY A;  5GAN e;  1LNX A;  4F7U E;  5GAO r;  2VXF A;  5GAN g;  1B34 B;  4C8Q B;  4RCB A;  1B34 A;  4A53 A;  4C8Q A;  4M7D E;  3L2Z A;  2I2L A;  2E64 A;  1JRI A;  3L1A A;  4J6X A;  4XU0 A;  1M8V A;  4J5Y A;  2HNI A;  4C92 F;  3JB9 H;  3JCM f;  3JCM h;  3RKX A;  3JCM c;  5GMK l;  2EJ9 A;  4EMH A;  1LJO A;  1WNL A;  4M7A E;  4C8Q G;  4NL3 A;  3JB9 G;  3SWN B;  1HK9 A;  1WQW A;  4M77 E;  3HSB A;  3SWN A;  3JCM X;  4N0A A;  3EFS A;  3FJP A;  4M7A G;  1TH7 A;  3BFM A;  4X9D A;  4XTX A;  4EMK C;  1U1T A;  2DZC A;  3RER A;  3QSU A;  2CGH A;  4RCC A;  3SWN C;  3V7C A;  2E10 A;  4C92 B;  3JCM e;  2YHT A;  3JB9 I;  3FB9 A;  1H64 1;  4XTY A;  4C92 A;  5GAM j;  3JCM g;  3VU3 C;  3V8L A;  2DTH A;  5GAN d;  5GAO m;  1BIB A;  4WF2 A;  4C92 C;  4M78 C;  5GMK h;  4Y91 A;  4XTV A;  5LJ5 h;  4MML A;  3BDU A;  4M75 F;  2YLB A;  5GMK j;  5GAO p;  1M5Q 1;  4PNO A;  4JRK A;  3V8K A;  5LJ5 j;  2DZ9 A;  2DKG A;  3JCM b;  2RA2 A;  3V7R A;  4C8Q E;  4PJO C;  3HFO A;  4M78 F;  4M75 D;  4EMG A;  5GAO n;  2E41 A;  3RUX A;  2RD1 A;  2DTO A;  4EMK B;  5LJ3 h;  4C92 D;  2RM4 A;  4EMK A;  4M78 D;  5GAN 6;  1D3B B;  4HA8 A;  4PJO F;  5LJ3 j;  5GAN 8;  3RES A;  1D3B A;  3RIR A;  3PGG A;  4M75 B;  5LJ5 g;  3JCM P;  3QO3 A;  1I81 A;  2EWN A;  4M75 A;  4XU2 A;  4J6W A;  1I4K 1;  4JLI A;  5GAM f;  5GAM h;  4PJO D;  1JBM A;  2DXU A;  3AHU A;  1KQ1 A;  4M78 B;  1HXD A;  2DTI A;  4XU3 A;  3JCM d;  3HFN A;  4M78 A;  2VXE A;  4M75 C;  3RKY A;  2FB7 A;  4HT9 A;  3V8J A;  1U1S A;  4C92 E;  4M7D C;  5GAN 4;  3JCM J;  5I21 A;  1KQ2 A;  4A54 A;  4F7U F;  4PJO B;  5GAN 5;  5DY9 A;  4NOY A;  5LJ5 f;  1I5L A;  4PJO A;  1LOJ A;  4JUV A;  4XTZ A;  5GAM e;  4C92 G;  4M78 G;  1N9R A;  2EJF A;  5GAM d;  2E1H A;  2DXT A;  4DQ2 A;  4M7D F;  5GAM g;  4M7A C;  3BY7 A;  4HT8 A;  2E65 A;  2JN0 A;  2Y90 A;  4M77 C;  4XTU A;  2YLC A;  5GAN 2;  2FYK A;  5GAO l;  4M7D D;  3QUI A;  2K57 A;  5LJ3 f;  1WPY A;  4XTW A;  4QVC A;  5GMK e;  4JRI A;  3BW1 A;  4F7U B;  5LJ5 e;  1I8F A;  4M7A F;  4F7U A;  4M77 F;  5LJ5 d;  2QTX A;  5GMK m; 
#chains in the Genus database with same CATH topology
 4KGZ B;  1I1J A;  1KIK A;  1SSH A;  1OPL A;  4M77 D;  3G6E T;  1YIT Q;  1BCM A;  3QG1 A;  1QVG A;  4KT0 E;  1RAE B;  4OGC A;  3H0I A;  4OVA A;  1QMC A;  2XDP A;  3M55 A;  4F17 A;  2DAQ A;  1G83 A;  1M1F A;  1IXD A;  4C8Q D;  4RG2 A;  1LNX A;  1KG1 A;  2A0F B;  1KSW A;  2A08 A;  1K76 A;  1VYT A;  2XK0 A;  4BD3 A;  3JB9 H;  1WHH A;  2RQR A;  2CP3 A;  4HCZ A;  1LPL A;  1JEG A;  3CCJ T;  4ZGJ B;  3CMA Q;  4GBQ A;  1VQ6 Q;  2DTH A;  1MMA A;  1YIJ A;  5C6S A;  3X28 B;  1M5Q 1;  5LJ5 j;  1VQK T;  1JU5 C;  1JXM A;  4TVR A;  2OTJ T;  1M9S A;  2V8I A;  1SF9 A;  3WXM B;  2K7A A;  4M78 D;  2FHD A;  1D3B B;  3C94 A;  2JS2 A;  2F2W A;  4QQG A;  3PMT A;  1MV0 B;  5KYY B;  5IH2 A;  2DTI A;  3EG2 A;  3MEU A;  2HQH A;  3TSZ A;  3RKY A;  2EYY A;  3QJY A;  1KQ2 A;  3OYL A;  4PJO B;  5HK3 A;  5GAN 5;  5HKC A;  5CKD A;  1YIT A;  4FSX A;  1N9R A;  2EJF A;  3QZ9 B;  3M0P A;  1K9M U;  3MJX A;  2WAC A;  1FWZ A;  1VIF A;  2DX1 A;  2EYX A;  1CKB A;  5KYN A;  3UT1 A;  3JB9 I;  3NMZ C;  3L2V A;  1FXX A;  2RHZ A;  5D6Y A;  3CCU T;  4C0D C;  2CKK A;  2IIM A;  5GAN 3;  2DM1 A;  3DB4 A;  2EYZ A;  1WYX A;  1QP2 A;  2KVQ G;  4JS5 A;  3CPF A;  4IUR A;  3JB9 D;  2OAW A;  2OX7 A;  3OYK A;  4HVV A;  3KXT A;  3CMA A;  4Z8A A;  1VQ6 A;  1BYM A;  3CCS T;  2LCL A;  4IIO A;  3A8G B;  1YI2 Q;  1O9S A;  3CC7 Q;  3A98 A;  1B7T A;  4BDY A;  2EQK A;  1G3W A;  3OS0 A;  2FPE A;  1N6A A;  5GMK h;  5GAO p;  1QCO A;  1M8M A;  3V7R A;  1KK7 A;  3CME Q;  4DBF A;  2ZPE B;  3RES A;  5CCA A;  4XU2 A;  2KYB A;  2E6N A;  4PJO D;  3ZFJ A;  1QW1 A;  4C92 E;  2LMJ A;  2NWM A;  2KSS A;  2DD5 A;  2ZPF B;  3QKJ A;  1LOJ A;  4DEY A;  1M1K U;  3NFC A;  1Z9Q A;  3OQ5 A;  2QQB A;  1PRM C;  2ZAE A;  2LJ3 A;  2Y4Y A;  3ME9 A;  4QKU A;  3L2R A;  4NS5 A;  1NLP C;  2KRM A;  2L8D A;  2GCX A;  1QLY A;  1UG1 A;  1RL2 A;  1PNJ A;  2CSI A;  4M75 E;  3OBW A;  1BU1 A;  3OYH A;  2NUT A;  5LJ3 d;  3CC2 Q;  2KAF A;  1M3B A;  3RMQ A;  4M7A B;  4FT4 A;  3E2U A;  5KE2 A;  3MPU B;  1N9S A;  2HCK A;  5HK0 A;  3CPW S;  4X9C A;  4LDU A;  2KQW A;  1HD3 A;  2EJG A;  4PJO G;  2X4Y A;  4EIK A;  2QGG A;  3CCV Q;  1YI2 A;  3CC7 A;  2CZ0 B;  1PD0 A;  4FYX B;  1KC8 U;  4N4H A;  2VXF A;  4HKE A;  2DVJ A;  5D6W A;  4J6X A;  3OYM A;  3P8D A;  3RKX A;  3M59 A;  2XMF A;  2LQ8 A;  2HZY A;  3CCE Q;  4PKC C;  1D1C A;  2PVO B;  4EDU A;  1VQ7 Q;  4O5V A;  1M3A A;  4FM4 B;  3CME A;  1AWX A;  1YNZ A;  3BFM A;  3EFO A;  4X9D A;  1GFD A;  2VGN A;  1KHI A;  3OSS C;  3OYE A;  2GNC A;  5GJW B;  2L89 A;  1QWE A;  3JCM g;  2F69 A;  5GAO m;  1ZSG A;  2L5Q A;  2EYW A;  2RI2 A;  2YUN A;  2VGM A;  1WXT A;  1KD1 U;  3FLG A;  2RQV A;  1UE9 A;  1S1N A;  1YWO A;  4KH1 B;  4HCB A;  1X43 A;  3OS1 A;  5FRO A;  2O88 A;  5FW9 A;  1ZBJ A;  3T9N A;  4XK8 E;  3PIO A;  2P0K A;  3I55 T;  1BBZ A;  3MEV A;  5CQX A;  4FYV B;  4IUP A;  1KHC A;  2CT4 A;  4LE9 A;  4E7S A;  1ZQ1 A;  4RTY A;  3JCM J;  3M4Y A;  3NTI A;  4NOY A;  4JUV A;  2SEM A;  2KEA A;  3AT1 B;  3CC2 A;  3ZL7 C;  2KMT A;  4HT8 A;  1YJW T;  5GAO l;  2V1R A;  4J9I A;  4GLM A;  2QTV A;  2KT1 A;  4HXJ A;  2EAY A;  3I9Q A;  4M7A D;  1YCS B;  2HQX A;  1BIA A;  3NPF A;  3CCV A;  1SRM A;  5GMK i;  2DJZ A;  4Z89 A;  4CC4 B;  4BI8 B;  4ELY C;  4ZNX A;  3TRE A;  4E7H A;  3OA6 A;  4ORZ A;  4A4K A;  1FMV A;  2DE0 X;  4C5E A;  2E5K A;  4ELZ C;  1KQS S;  5CKF A;  3CCE A;  3VKI A;  2J6K A;  1RAA B;  4OB2 B;  1VQ7 A;  1K9M R;  3TQ7 P;  5IHN A;  3EG9 A;  2RNA A;  4KGV B;  1MUZ A;  1VQM T;  4RCB A;  4X1V A;  3EHQ A;  4CI0 C;  4LD6 A;  5CO7 A;  4AFS C;  4C92 F;  2BE9 B;  2QAS A;  4JJB A;  3JCM c;  2LC4 A;  3REB B;  1G3S A;  3ULR B;  2XIC A;  1TOV A;  4J9G A;  3JCM X;  2VYT A;  4J83 A;  3M0U A;  4M7A G;  2CGH A;  4XTY A;  2DA9 A;  1ABQ A;  3X25 B;  3V8L A;  4J9E A;  3OYN A;  3PMI A;  4BE2 A;  4E7Z A;  3DLL A;  1SHF A;  4MZM A;  4M75 F;  3OYJ A;  2D8H A;  2KDS A;  4BY6 C;  1AOJ A;  2RD1 A;  1WZO A;  2RH2 A;  4EMK A;  3F70 A;  3RIR A;  2O31 A;  2VB6 A;  5I22 A;  2LX7 A;  2VXE A;  3M56 A;  4E7J A;  1VQ8 Q;  1AD5 A;  2PZ1 A;  2BZX A;  3HKS A;  1XOV A;  1FYN A;  4BE0 A;  1PSE A;  1TUG B;  4AG2 C;  5GAM d;  1H8K A;  3BY7 A;  3CC4 T;  1RI9 A;  5KCO A;  3CCQ T;  2FO0 A;  4E7L A;  3CCM Q;  4M7D A;  4BI4 A;  2DET A;  4RTT A;  2WSF E;  2YWW A;  1Y96 B;  4D8D A;  3EG0 A;  3L42 A;  4NL2 A;  4C0F A;  2ZPB B;  4M77 A;  1WIE A;  5GAN f;  2COW A;  5GAN h;  3EH1 A;  4GLK A;  2M16 A;  3EGX A;  4M4Z A;  2YSQ A;  4JZ3 A;  2QQR A;  1MMN A;  2DEQ A;  2JNG A;  5A0D A;  1IGQ A;  2RB6 A;  3X26 B;  3FIF A;  2EQJ A;  2DIL A;  5FRN A;  1K9A A;  3WVE B;  4C0D B;  5KCH A;  2GTJ A;  2DIG A;  3L2Q A;  4KH0 B;  1NYF A;  1S72 T;  1QCN A;  4A53 A;  4C8Q A;  1PHT A;  3VS6 A;  2PU9 B;  4YTL A;  2XI9 A;  3OB9 A;  4DOW A;  5KYW B;  3Q1J A;  1OPK A;  4JRQ A;  5KYU A;  2VUB A;  1IHW A;  1RAC B;  3CD6 Q;  2J05 A;  3EG3 A;  1N8R U;  3NHN A;  7AT1 B;  2EQI A;  2MWP A;  2DO3 A;  1K73 U;  2DER A;  5J26 A;  3OYC A;  2XID A;  2NUP B;  2E3H A;  1VQN T;  2QQA A;  4Y91 A;  4MML A;  3OS2 A;  3E9F A;  2R5A A;  3RR6 A;  1VQ8 A;  1WJS A;  3HTR A;  2D0N A;  2MIO A;  1X2Q A;  1UEB A;  1AEY A;  3KFV A;  2ATC B;  3LH5 A;  2HDA A;  3FJ5 A;  4IUT A;  4PFP A;  2KI7 A;  1WHL A;  2BZ8 A;  3M0S A;  2YRD A;  1M1G A;  4FW2 A;  2CRE A;  3J7A F;  1GXI E;  3PGG A;  1GL5 A;  1WX6 A;  2EWN A;  2IPO B;  3OMG A;  2DXU A;  3AHU A;  4M78 A;  2L3S A;  5KH6 A;  3V8J A;  2DPP B;  3CCM A;  5DY9 A;  1TUC A;  1VQP Q;  1G2B A;  5I2M A;  4OMF B;  4KRT A;  5HY6 A;  2O4X A;  4XTU A;  4ZN3 A;  5L23 A;  3G1J A;  1H92 A;  4IUV A;  5LJ3 f;  3A8L B;  2K3Y A;  4QVC A;  1CSK A;  1KD1 R;  3OW2 S;  1UHC A;  5GMK m;  2Y4X A;  2K3X A;  2QG9 B;  4OP0 A;  1Q81 C;  4QQD A;  2E5Q A;  1W1F A;  1YBY A;  1K8A R;  2K9G A;  1Q86 U;  3VJP A;  2JVV A;  1MGQ A;  2X4X A;  2J6O A;  3CD6 A;  3S3O A;  4Y92 A;  2X9H A;  5GAN e;  3R6N A;  2BE7 D;  4J9B A;  1YJN Q;  3I56 Q;  1WXB A;  1BI0 A;  2YRC A;  4K11 A;  5GMK l;  2MK5 A;  1M2V B;  3QWY A;  1BK2 A;  3OYF A;  3PVQ A;  1B07 A;  1U1T A;  3VS3 A;  4C92 B;  2YHT A;  3M54 A;  4RTX A;  1T3S A;  3C4S A;  4R55 A;  3CCR T;  1ZUK A;  3A8H B;  2X4J A;  1QQJ A;  4RTV A;  1VQP A;  2K79 A;  3J81 E;  1D3B A;  4M75 B;  3FDR A;  3GLX A;  1I4K 1;  2DNU A;  1JBM A;  4ZGD B;  1AVZ C;  4A63 B;  3HHT B;  3OYA A;  1Q82 U;  5KYY A;  2GFA A;  4ZGE B;  2DMO A;  2RJF A;  1IRX A;  3MP8 A;  4IUU A;  4PJO A;  2G6F X;  1Q95 G;  2JW4 A;  2P84 A;  1VQ4 Q;  4PJJ A;  2BIV A;  3C0C A;  2XDB A;  4OMN A;  1OZ2 A;  4RMO A;  3BW1 A;  1VQ5 Q;  2EKO A;  2ZZD A;  3H9N A;  2JT4 A;  4MZT A;  3V7S A;  5EG2 A;  2VV5 A;  5LJ3 e;  4F7U G;  2HL3 A;  5GAN 7;  5CKE A;  1YJN A;  3I56 A;  2A36 A;  3GPL A;  3S6W A;  3EG1 A;  4ANJ A;  3JRZ A;  2DL8 A;  2J06 A;  2DF6 A;  2GQV A;  2FEI A;  4PFO A;  3VS1 A;  1OU9 A;  2BZY A;  3MO8 A;  3VYG A;  2KY9 A;  2KXC A;  1VQ9 T;  4F7U E;  1PC0 A;  5FU7 C;  4PLI A;  1NG2 A;  4OMO A;  3CCL T;  3RNJ A;  4B9X A;  4AFQ C;  3GOX A;  2EJ9 A;  1GCP A;  2GFU A;  2V26 A;  3QDR B;  3SWN B;  4C5G A;  5FU6 B;  3HSB A;  4N0A A;  3EFS A;  1RI0 A;  2QA4 Q;  2CZ7 B;  3A5Z B;  1H64 1;  1UGQ B;  5GAN d;  1C6V X;  3ZEH A;  1PD1 A;  4BDZ A;  5LJ5 h;  3O5Z A;  1U5S A;  2DKG A;  2F1L A;  3JCM b;  1B3Q A;  3HFO A;  4M75 D;  4RTU A;  1X27 A;  2RN8 A;  1NLO C;  2X51 A;  1EIF A;  4EPC A;  1VQ4 A;  3VYH B;  1UGR B;  3EH2 A;  2KBT A;  2LTO A;  4J6W A;  5GAM f;  5GAM h;  3HL8 A;  1D1B A;  1YWP A;  1TUD A;  3HFN A;  1VQ5 A;  5A0G A;  3ZBD A;  3LGL A;  1BB9 A;  3ER0 A;  3CXC S;  1U1S A;  2MMP A;  4BY6 B;  2LCC A;  1UTI A;  1N8R R;  4C92 G;  3S3N A;  3EHR A;  1K73 R;  1M90 U;  2GGR A;  4ZN1 A;  3RDV A;  2XD0 A;  4CC3 A;  1ZX6 A;  1VQO Q;  1PWT A;  2MAM A;  2PTK A;  1X69 A;  3INZ A;  1QVF A;  1TXQ A;  3GIB A;  2CP6 A;  5FWB A;  2OTL Q;  3G7Z A;  5KYX B;  2DVE A;  4M75 G;  5IHI A;  1KFZ A;  4M7A A;  2HKN A;  2VC8 A;  2EFI A;  4FT2 A;  1SG5 A;  3QHS A;  1NYG A;  2KT8 A;  2CUB A;  4JRP A;  3M0T A;  2PVD B;  2RQT A;  2KRN A;  2QA4 A;  5GAO r;  4IIM A;  1YN8 A;  1LCK A;  3MP1 A;  1M27 C;  1YIJ T;  4F14 A;  2D6F A;  5CVI A;  1QVP A;  1O75 A;  3SFM A;  3KBG A;  1RAH B;  3CBO A;  5I2S A;  2RHU A;  2H8H A;  5IHK A;  3QSU A;  3PFS A;  1JJ2 S;  3QPH A;  2C0T A;  3RMS A;  3FB9 A;  5AYF A;  1G3T A;  4C0Z A;  4II1 A;  1Q86 R;  1QKX A;  2FZC B;  4PLL A;  3LWH A;  4C92 C;  2YT6 A;  1YJ9 Q;  2QEX Q;  1Q7Y C;  1YIT T;  3E9G A;  2LJ1 A;  3G71 Q;  1X6B A;  5GAO n;  3QZ5 B;  2DL3 A;  2X4W A;  1GCQ C;  4PJN A;  5CR2 A;  5GAN 8;  4F16 A;  2DLP A;  3HPW A;  1IO6 A;  3UF4 A;  2A3L A;  2QYZ A;  2V8J A;  1NJI U;  2P0P A;  1VQO A;  1AZE A;  1UUE A;  4M75 C;  1R77 A;  2K5I A;  4F7U F;  3UA7 A;  2NUZ A;  2OTL A;  5GAM e;  2LP5 A;  3G4S Q;  2K4Y A;  2DXT A;  3MEA A;  1ARK A;  1YHQ Q;  1E6H A;  1IRE B;  2QAZ A;  4L5G A;  2AK5 A;  1N27 A;  1AWO A;  5GMK e;  4ZTJ A;  2AHJ B;  4J8O A;  3EGD B;  2K5L A;  2RQW A;  5CAI A;  3RKW A;  5GAO q;  2CZ1 B;  1K8A U;  3OYG A;  1G5V A;  3FEO A;  2BKD N;  3CMA T;  1VQ6 T;  5IXB A;  1Q82 R;  3H0F A;  3JCM V;  1Y0M A;  3CBP A;  1QWF A;  3OYY A;  2KRO A;  4XQ3 A;  2W10 A;  2CT3 A;  4PFZ A;  3I5S A;  2RF0 A;  3GBQ A;  4KBM B;  3CXC P;  1VYV A;  1V76 A;  2DXC A;  2L3R A;  2X3X D;  2M02 A;  1AWW A;  2LNH B;  3PE0 A;  2LQK A;  2JTE A;  3L2Z A;  2FPF A;  1VQL Q;  2ABL A;  2HNI A;  3PTA A;  3NTH A;  3H41 A;  2KE9 A;  4NL3 A;  1YJ9 A;  1HK9 A;  3MCA B;  2CP7 A;  2QEX A;  1W2B S;  3GF5 A;  4N4I A;  5IT9 E;  3G6E Q;  1T3L A;  3G71 A;  1WGS A;  2DZC A;  3SWN C;  1BCO A;  5FU6 C;  1HSQ A;  3M57 A;  2DIQ A;  3H8Z A;  1GRI A;  2DRM A;  2WSE E;  1W70 A;  2W0Z A;  3V8K A;  4WCI A;  2QK0 A;  1K9M C;  2M0O A;  1LVK A;  1NPR A;  3G4S A;  2CZ6 B;  4RKU E;  4XAX B;  2C0O A;  4O6J A;  5L8R E;  2EGA A;  1YHQ A;  1ZBX A;  1QCF A;  3OBY A;  2RK1 A;  3QO3 A;  2HBP A;  3PT9 A;  2CSQ A;  1YP5 A;  3RBB B;  1R0B G;  1AWJ A;  2RJC A;  1V29 B;  3DLM A;  2A28 A;  1VA7 A;  4A54 A;  4XTZ A;  4DBH A;  3CPW P;  1WJR A;  2B86 A;  1K0X A;  1WXU A;  2K3B A;  2X3W D;  3CCJ Q;  3M53 A;  2PNI A;  2K57 A;  1JJ2 P;  4ESR A;  1VYU A;  5LJ5 d;  3VUZ A;  1YI2 T;  4QW2 A;  4KUD K;  4OMQ A;  3CC7 T;  2MI6 A;  2O01 E;  1VQK Q;  1OUL A;  2OTJ Q;  1Y96 A;  1RAG B;  1G3Y A;  1HYO A;  4V2S A;  1PG5 B;  3JB9 J;  1VQL A;  4DBR A;  3M4G A;  5I11 A;  3SHW A;  3TU4 K;  2P4R A;  2ZGW A;  2D1X A;  1ZSZ B;  3CME T;  3MP6 A;  2CP0 A;  1NBE B;  1M90 R;  4LUE A;  3G6E A;  3E1S A;  3REA B;  5GAN g;  1JXO A;  4B9W A;  3FC3 A;  1WA7 A;  4OF1 A;  4AT1 B;  1M8V A;  5HCK A;  2DRK A;  5KYW A;  1QKW A;  4OB0 B;  1R8O B;  2JS0 A;  5GJV B;  3CCU Q;  2ZCF B;  2P0Q A;  5FU7 B;  3UWN A;  2WSC E;  3C12 A;  1D09 B;  2LDM A;  2NUP A;  2DJQ A;  4FW1 A;  3TSW A;  2K2V A;  1M1K C;  4MDX A;  2LT1 A;  4LN2 A;  4AFU C;  4EMG A;  3CC2 T;  2K6D A;  2I0N A;  1MMD A;  2D9T A;  2FRW A;  3CBM A;  4KUI A;  3TEE A;  4FYW B;  5LJ3 j;  4LNP A;  4DOV A;  3CCJ A;  2PQW A;  2JXB A;  2SRC A;  4ZTF A;  3CCS Q;  2KRS A;  1HXD A;  4IUQ A;  1EX4 A;  3CCV T;  5LL6 S;  4B6M A;  1UGS B;  5I21 A;  2O2O A;  1VQK A;  1W2B P;  2OTJ A;  3M0R A;  4E7K A;  2JN0 A;  3SEM A;  1KQS P;  2FPD A;  1WPY A;  2F2V A;  2R5M A;  1OQK A;  1G8X A;  3PIP A;  3VS4 A;  4F7U B;  1I8F A;  1OV3 A;  1UJY A;  3CCE T;  2CH4 A;  2DL4 A;  1VQ7 T;  2DK3 A;  2JUF A;  4Z88 A;  1SRL A;  1KC8 C;  2HEQ A;  2JM9 A;  2JMC A;  2ED0 A;  1C0M A;  2AKL A;  5M9O A;  5LJ3 g;  4LUD A;  2GTO A;  1NJI R;  1XTD A;  4Q5W A;  2D8J A;  5ECA A;  3HP9 A;  2LNV A;  2RK2 A;  2CH4 W;  4BUG A;  4L59 A;  2JJ9 A;  1FX7 A;  5D6X A;  3QJ6 A;  2HD0 A;  4HCK A;  1Z9Z A;  3CCU A;  2VKN A;  1B34 B;  2E3I A;  2RO0 A;  2EQU A;  1KD1 C;  2DEU A;  4HCC A;  3NTK A;  1TWB A;  1M2V A;  1Q81 R;  2RHX A;  1TSF A;  2L3Q A;  1PKS A;  4P5N A;  1UHF A;  1RLP C;  2RQU A;  3QXE B;  4C92 A;  1SPK A;  3CXC A;  3H6Z A;  2VAS A;  3LH0 A;  4WF2 A;  1Y7X A;  1OYX A;  3CCS A;  2M9U A;  3OYD A;  1RAD B;  4PNO A;  1SEM A;  2RA2 A;  1NEB A;  1X2K A;  5IN1 A;  2F2X A;  2H3E B;  5GAN 6;  2EW3 A;  2QQS A;  3ASK A;  4M75 A;  2XHC A;  1WHG A;  4XU3 A;  5FWC A;  2EIF A;  3BDL A;  1UGV A;  2MOX A;  3QWX X;  6AT1 B;  1GFC A;  4A4H A;  2YUP A;  2A37 A;  4XTW A;  1EFN A;  2L2P A;  3UDC A;  3VRZ A;  1J3T A;  4AMC A;  4CC2 A;  4OMM A;  1UB4 A;  1WQ7 A;  4A4E A;  5IXF A;  4J9C A;  1T0H A;  3SB2 A;  4QVD A;  2DYB A;  3LW5 E;  2RHI A;  1H3Z A;  2V1Q A;  4M7D G;  4Z02 A;  4JZ4 A;  9ATC B;  2DD4 A;  3CPW A;  3I55 Q;  4FL6 A;  4BAC A;  4MZP A;  4M77 G;  1JJ2 A;  2D0Q B;  3D7S B;  4J9F A;  2M0Y A;  1ZSZ C;  1ZUY A;  2ROT A;  2KR3 A;  1X75 C;  1CKA A;  1OX9 A;  3E19 A;  4M7D E;  1YJW Q;  1M30 A;  2E64 A;  3QII A;  3L1A A;  4J5Y A;  1ZA1 B;  1VQ8 T;  2ZPI B;  4HVW A;  1RAF B;  1WNL A;  1A0N B;  1MHN A;  4C8Q G;  4M77 E;  1OI1 A;  2ZPG B;  3SWN A;  2DYI A;  3VS0 A;  4EMK C;  5C0M A;  5CK9 A;  4RTZ A;  5GAM j;  2PVG B;  4F04 B;  3OS5 A;  3L2W A;  2KK4 A;  4R0K A;  1UDL A;  1W6X A;  2CS7 A;  4E2F B;  3UAT A;  2K5F A;  3HRS A;  1PM3 A;  1VUB A;  2FZG B;  2JOY A;  2MPX C;  3CCM T;  5GMK j;  2DZ9 A;  4C8Q E;  2ZPH B;  5A0L A;  2E41 A;  2LT4 A;  2C0I A;  2DTO A;  4C92 D;  3OW2 P;  5LJ5 g;  1VQM Q;  4UC4 A;  2HAX A;  2X35 A;  2ESW A;  4C5H A;  2ROL A;  4HT9 A;  4M7D C;  2RHY A;  2LCS A;  4LDY A;  5LJ5 f;  1I5L A;  2HKQ B;  1HJD A;  2BTT A;  2BUD A;  2YDL A;  4M78 G;  2H3J A;  4A4F A;  4DQ2 A;  2J7I A;  5GAM g;  2LZ6 B;  1OU8 A;  2Y90 A;  4M77 C;  5EC7 A;  3I55 A;  2AIR B;  4PL6 A;  2B8A A;  2DFU A;  5FRM A;  2JTM A;  1D1A A;  3MET A;  3CD6 T;  2CP5 A;  3I35 A;  3M5A A;  4JJC A;  5KYX A;  2CYZ B;  4M78 E;  2MCN A;  2RMO A;  4AG1 C;  1UFF A;  3WVD B;  1FMK A;  1MV3 A;  4C8Q C;  2DL5 A;  4XU1 A;  1YJW A;  1W2B A;  1SHG A;  4BI3 A;  4ATO A;  3JAM E;  2MF2 A;  1UGP B;  1KQS A;  1KJW A;  4CC7 A;  2L0A A;  4VUB A;  8ATC B;  2QGF B;  1N8R C;  3EAE A;  1V1C A;  4LDW A;  1K73 C;  1JB0 E;  3CC4 Q;  1X6G A;  2LX9 A;  1QVG S;  2AZS A;  2RI5 A;  1JRI A;  3LLR A;  3CCQ Q;  5CIU A;  4EMH A;  2EGC A;  3P8B B;  3JB9 G;  3SDZ A;  1WQW A;  1VQP T;  4DA4 A;  1IZ6 A;  1OEB A;  3V7C A;  3SD4 A;  4PJM A;  1VQM A;  2XKO C;  3HRU A;  3NGP A;  4M78 C;  4JJD A;  3BDU A;  4L6V 5;  1RAB B;  1ZUU A;  3MKD A;  4E7I A;  1MNE A;  4OGE A;  4KUL A;  2FG0 A;  2HSE B;  2NYS A;  1S72 Q;  3JCM P;  1I81 A;  3U23 A;  2LQW A;  1I07 A;  1WHK A;  1KQ1 A;  4J9H A;  2E6Z A;  1WJQ A;  4JS4 A;  2RI3 A;  1YJN T;  4E6R A;  3I56 T;  4M7D F;  1D0Z A;  2AT1 B;  2E65 A;  1Q86 C;  3QUI A;  4AFZ C;  4PJL A;  3MHX A;  1Q7Y R;  4JRI A;  5LJ5 e;  3I5R A;  3QBY A;  4M77 F;  3EGD A;  4LD9 K;  4PK4 A;  1VQN Q;  2QTX A;  1W4S A;  2O9V A;  4FIB A;  4OMP A;  2QDL A;  2R58 A;  1K0S A;  2EQM A;  3QYH B;  1P92 A;  2NUT B;  2JTF A;  2E70 A;  2KXD A;  4ME7 A;  1U06 A;  3EFR A;  1RUW A;  3CC4 A;  4PJO E;  3KUF A;  2VWF A;  2Z0W A;  1H3H A;  3CCQ A;  4C8Q F;  4QQ6 A;  2DL7 A;  3THK A;  1U8R A;  2P4T A;  3TVT A;  3VUB A;  1PSF A;  2JMA A;  5J39 A;  3DB3 A;  1FMW A;  3CEY A;  1OX8 A;  3A8O B;  1I5O B;  2V8K A;  2EBP A;  2I2L A;  1Q81 U;  1C1A A;  3L2U A;  3JCM f;  3JCM h;  2CDT A;  4D6W A;  1LJO A;  2ECZ A;  3CQT A;  3TCJ A;  2CP2 A;  2O9S A;  5DM7 R;  3VS5 A;  3EFO B;  2QXF A;  1VQ4 T;  1M3C A;  1TH7 A;  4XTX A;  3RER A;  3HRT A;  4LDV A;  1BI3 A;  3M58 A;  1Q82 C;  1D0Y A;  1S72 A;  2NLU A;  1NM7 A;  1VQ5 T;  3LX7 A;  1BIB A;  3LYI A;  2COY A;  1EZZ B;  2DBK A;  4PJO C;  4M78 F;  4FYY B;  1K1Z A;  1Y71 A;  1GBQ A;  2QI2 A;  2QQ9 A;  2LRQ A;  2MWO A;  2YUQ A;  5J3B A;  4HA8 A;  5A2Q E;  1JQQ A;  1X6O A;  1WHM A;  2K2M A;  4BB7 A;  1BI2 A;  2HSP A;  4OB3 B;  3A1P A;  2PUK B;  2AZV A;  4D8K A;  4DBQ A;  1QVG P;  2YRV A;  2RJE A;  3MEW A;  3R6O A;  4FCY A;  2ENM A;  1VQN A;  1SKU B;  2FRY A;  1WDX A;  4GY5 A;  2GQI A;  2HQE A;  4OML A;  2XG8 D;  4R56 A;  1PKT A;  1ABO A;  3OW2 A;  2IVW A;  3M0Q A;  2RPN A;  1RLQ C;  3CCR Q;  1QVF S;  4J6Y A;  1DJ7 B;  4BE1 A;  2QA4 T;  2E12 A;  4LDX A;  2EYQ A;  2DBM A;  1OZ3 A;  1OOT A;  2MYS A;  3S3M A;  2HBW A;  5GAN j;  3JB9 F;  3JCM Q;  2GF7 A;  2PUO B;  4RG8 A;  3GNG A;  1ZSZ A;  4WTO B;  2OAU A;  4N0A C;  3X24 B;  3VS2 A;  3EG9 B;  3UA6 A;  4E47 A;  4C0G A;  4OB1 B;  2M51 A;  1I0C A;  2IG0 A;  4XU0 A;  1XNI A;  1TG0 A;  2GBQ A;  1ACM B;  4QT7 A;  4FU6 A;  3PVL A;  4M7A E;  2YXY A;  3FJP A;  1QP3 A;  3JV3 A;  4RCC A;  3JCM e;  8AT1 B;  2HMA A;  3VU3 C;  5IAY A;  3DKM A;  5CKB A;  3A8M B;  2HL5 C;  1VQO T;  1WHJ A;  1UJ0 A;  3QYG B;  4XTV A;  3OMC A;  1M2O A;  5FLX E;  4JJN K;  4MDW A;  2OTL T;  1T0J A;  4JLG A;  1IB8 A;  1M90 C;  3RUX A;  3VRY A;  4EMK B;  2RM4 A;  2QDY B;  1VQ9 Q;  4DEX A;  2OI3 A;  2EPD A;  4PJO F;  1NZ9 A;  2KNB B;  4X34 A;  1UEC A;  3CCL Q;  5DLO A;  1WLP B;  4FSS A;  2M1H A;  2JZ2 A;  2FB7 A;  3X20 B;  4RUG A;  3CCR A;  1TTH B;  4IKF A;  2EVR A;  1TU0 B;  1GBR A;  2E1H A;  2ED1 A;  4M7A C;  2EKH A;  1TS9 A;  1PRL C;  1E6G A;  2FYK A;  1M1K R;  4C5I A;  1XJW B;  1NE8 A;  4J7F A;  3LWI A;  4F7U A;  3PNW C;  2YUO A;  4M7D B;  3OYI A;  2F5T X;  3P8H A;  2LJ0 A;  2LQN A;  1PCX A;  2F5K A;  3GNF B;  1IHV A;  2RJD A;  1YFN A;  4M77 B;  4CRI A;  4N4G A;  2KYM A;  1AT1 B;  2AKK A;  3EGX B;  1ZA2 B;  5AT1 B;  1E7O A;  1F1B B;  1MND A;  4MMK A;  3UPU A;  1X01 A;  1YJ9 T;  2EGE A;  2QEX T;  3JCM W;  1NPP A;  1NEG A;  3G71 T;  3M9Q A;  2E4H A;  4JDS A;  1M4Z A;  2A7Y A;  2VVK A;  3H0H A;  1JO8 A;  1YCY A;  4J9D A;  4LXC A;  5CKH A;  1R0C B;  1D0X A;  1ZHI A;  1WI7 A;  4A4G A;  1U3O A;  3VS7 A;  3OY9 A;  4C8Q B;  2FL7 A;  2JM8 A;  1B34 A;  1IGU A;  2L3P A;  1KC8 R;  2OJ2 A;  2FZK B;  1Y07 A;  2FVU A;  3GP8 A;  5KYU B;  3OYB A;  3G4S T;  1YHQ T;  1QVF P;  2J6F A;  5CQY A;  5D7U A;  4J7I A;  2E10 A;  1VQ9 A;  1BKB A;  3OSV A;  1SSF A;  2LVM A;  1NJI C;  1K4U S;  3JSC A;  1WFW A;  1N5Z A;  1VOM A;  3URG A;  3CCL A;  2YLB A;  1MMG A;  5KE3 A;  4JRK A;  3IQL A;  5LJ3 h;  1RAI B;  3LGF A;  2XU8 A;  1XQH A;  3N5B B;  1Y57 A;  1YIJ Q;  4QVZ A;  2DXB A;  4JLI A;  3C95 A;  3EGU A;  2C06 A;  4M78 B;  2COZ A;  5DLQ E;  3JCM d;  4RTW A;  1ZLM A;  3J80 E;  3FRN A;  1K8A C;  2CUD A;  5GAN 4;  2R57 A;  2G3R A;  4Y28 E;  1BI1 A;  2KGT A;  1Q7Y U;  4KGX B;  3VV0 A;  2O4X B;  2XDD A;  1GCQ A;  3O8V A;  2YLC A;  5GAN 2;  1VQL T;  1VIE A;  3QDF A;  4M7D D;  4JPB W;  1AZG B;  4M7A F;  4HVU A;  1AHJ B;  3BE3 A; 
#chains in the Genus database with same CATH homology
 5CAI A;  4E7L A;  2JTM A;  3MET A;  3CD6 T;  4M77 D;  4M7D A;  3RKW A;  5GAO q;  2CZ1 B;  3G6E T;  4BI4 A;  1K8A U;  3OYG A;  1G5V A;  3M5A A;  2WSF E;  3FEO A;  2BKD N;  3QG1 A;  1Y96 B;  4KT0 E;  1QVG A;  4OGC A;  3CMA T;  2CYZ B;  3L42 A;  4M78 E;  1VQ6 T;  4NL2 A;  4C0F A;  4OVA A;  3WVD B;  4C8Q C;  2ZPB B;  2XDP A;  4M77 A;  4XU1 A;  3M55 A;  3JCM V;  1YJW A;  5GAN f;  5GAN h;  1W2B A;  4GLK A;  2M16 A;  3CBP A;  4BI3 A;  4ATO A;  3OYY A;  2MF2 A;  3JAM E;  4XQ3 A;  2DAQ A;  2QQR A;  1UGP B;  1KQS A;  2DEQ A;  2JNG A;  4VUB A;  5A0D A;  1M1F A;  2RB6 A;  3X26 B;  4C8Q D;  1N8R C;  3FIF A;  2EQJ A;  3EAE A;  4KBM B;  5FRN A;  3WVE B;  4C0D B;  5KCH A;  4RG2 A;  4LDW A;  1LNX A;  2DIG A;  2DXC A;  2L3R A;  3L2Q A;  1K73 C;  1S72 T;  1JB0 E;  2LQK A;  1KG1 A;  4A53 A;  4C8Q A;  2LX9 A;  3L2Z A;  1QVG S;  2PU9 B;  2RI5 A;  4YTL A;  1JRI A;  3LLR A;  2XI9 A;  2HNI A;  3PTA A;  2XK0 A;  3OB9 A;  5CIU A;  4BD3 A;  4DOW A;  3Q1J A;  3JB9 H;  4EMH A;  3P8B B;  3NTH A;  1JJ2 A;  4JRQ A;  4HCZ A;  3SDZ A;  4NL3 A;  3JB9 G;  1YJ9 A;  1HK9 A;  1WQW A;  3MCA B;  2QEX A;  2VUB A;  1W2B S;  3GF5 A;  4N4I A;  1VQP T;  5IT9 E;  3G71 A;  1WGS A;  4DA4 A;  1IZ6 A;  1N8R U;  2DZC A;  3CCJ T;  3V7C A;  4ZGJ B;  3SWN C;  3SD4 A;  5FU6 C;  2MWP A;  3M57 A;  2DO3 A;  1K73 U;  2DTH A;  5J26 A;  3OYC A;  2XID A;  1VQM A;  1YIJ A;  2XKO C;  3HRU A;  2DIQ A;  1VQN T;  2QQA A;  4M78 C;  3H8Z A;  4Y91 A;  4MML A;  3X28 B;  5C6S A;  3BDU A;  4L6V 5;  3OS2 A;  3E9F A;  2WSE E;  2R5A A;  1M5Q 1;  5LJ5 j;  3V8K A;  1WJS A;  1VQ8 A;  1VQK T;  4E7I A;  1UEB A;  4TVR A;  1K9M C;  2OTJ T;  1M9S A;  2M0O A;  4IUT A;  4OGE A;  2V8I A;  1NPR A;  3WXM B;  3G4S A;  2CZ6 B;  4M78 D;  2FHD A;  4RKU E;  1M1G A;  4KUL A;  4O6J A;  1D3B B;  4XAX B;  5L8R E;  1YHQ A;  1ZBX A;  3J7A F;  3C94 A;  3OBY A;  1GXI E;  2RK1 A;  3PGG A;  3JCM P;  3QO3 A;  1I81 A;  2EWN A;  2HBP A;  3PT9 A;  4QQG A;  3OMG A;  3PMT A;  2DXU A;  3AHU A;  1KQ1 A;  2DTI A;  3MEU A;  4M78 A;  2E6Z A;  2RJC A;  1V29 B;  3RKY A;  5KH6 A;  1WJQ A;  3DLM A;  3V8J A;  4JS4 A;  2RI3 A;  3QJY A;  1KQ2 A;  4A54 A;  2DPP B;  3OYL A;  3CCM A;  5HK3 A;  5GAN 5;  4PJO B;  5DY9 A;  5HKC A;  4XTZ A;  1YJN T;  5CKD A;  1YIT A;  4FSX A;  3I56 T;  1N9R A;  5I2M A;  1WJR A;  2EJF A;  3QZ9 B;  4OMF B;  5HY6 A;  1K9M U;  4M7D F;  2O4X A;  2E65 A;  2WAC A;  4XTU A;  3M53 A;  4ZN3 A;  1Q86 C;  3QUI A;  2K57 A;  1FWZ A;  1VIF A;  4IUV A;  3A8L B;  2K3Y A;  5LJ3 f;  4QVC A;  3MHX A;  4JRI A;  5LJ5 e;  3QBY A;  4M77 F;  5LJ5 d;  4LD9 K;  3OW2 S;  3VUZ A;  3UT1 A;  1YI2 T;  4QW2 A;  2QTX A;  1W4S A;  5GMK m;  3JB9 I;  4KUD K;  3CC7 T;  2Y4X A;  4FIB A;  3L2V A;  2MI6 A;  2O01 E;  2R58 A;  1FXX A;  2EQM A;  3QYH B;  2RHZ A;  1P92 A;  5D6Y A;  3CCU T;  2JTF A;  4C0D C;  2CKK A;  2E70 A;  2K3X A;  1Y96 A;  5GAN 3;  1G3Y A;  4OP0 A;  4ME7 A;  3EFR A;  1Q81 C;  4QQD A;  2E5Q A;  4V2S A;  1YBY A;  3CC4 A;  3JB9 J;  4PJO E;  3KUF A;  3DB4 A;  1VQL A;  3M4G A;  1Q86 U;  3CCQ A;  3TU4 K;  2ZGW A;  4C8Q F;  1QP2 A;  2KVQ G;  3VJP A;  4JS5 A;  2JVV A;  4QQ6 A;  1U8R A;  3CPF A;  1MGQ A;  2X4X A;  2P4T A;  4IUR A;  3CME T;  3VUB A;  3JB9 D;  3MP6 A;  1PSF A;  3OYK A;  5J39 A;  3DB3 A;  3CEY A;  3CD6 A;  3S3O A;  5GAN e;  3G6E A;  3E1S A;  5GAN g;  3A8O B;  3KXT A;  3CMA A;  4B9W A;  2V8K A;  3FC3 A;  1VQ6 A;  2I2L A;  4OF1 A;  1BYM A;  3CCS T;  1Q81 U;  1BI0 A;  2LCL A;  1M8V A;  3L2U A;  3JCM f;  3JCM h;  5GMK l;  4D6W A;  1LJO A;  3A8G B;  4OB0 B;  5GAM j;  1R8O B;  3TCJ A;  1O9S A;  5DM7 R;  3OYF A;  4BDY A;  2EQK A;  2QXF A;  1G3W A;  1VQ4 T;  1TH7 A;  4XTX A;  3RER A;  1U1T A;  2ZCF B;  2P0Q A;  5FU7 B;  3OS0 A;  3HRT A;  4LDV A;  3UWN A;  2YHT A;  4C92 B;  3M54 A;  2WSC E;  3C12 A;  1BI3 A;  1N6A A;  3M58 A;  1Q82 C;  2LDM A;  3C4S A;  1S72 A;  2NLU A;  1VQ5 T;  3LX7 A;  1BIB A;  3LYI A;  4R55 A;  5GMK h;  3CCR T;  2K2V A;  5GAO p;  1M1K C;  4MDX A;  2LT1 A;  3A8H B;  2X4J A;  3V7R A;  4PJO C;  4M78 F;  4EMG A;  3CC2 T;  1Y71 A;  2QI2 A;  2D9T A;  2QQ9 A;  2LRQ A;  1VQP A;  3CBM A;  2MWO A;  4KUI A;  2ZPE B;  5J3B A;  3TEE A;  4HA8 A;  5LJ3 j;  5A2Q E;  3J81 E;  3RES A;  1D3B A;  1X6O A;  4DOV A;  3CCJ A;  2PQW A;  4M75 B;  1BI2 A;  4BB7 A;  5CCA A;  3FDR A;  4OB3 B;  4XU2 A;  3GLX A;  1I4K 1;  2E6N A;  4PJO D;  4ZTF A;  1JBM A;  4ZGD B;  2PUK B;  3HHT B;  4IUQ A;  1HXD A;  3ZFJ A;  2GFA A;  4ZGE B;  3OYA A;  1Q82 U;  1QW1 A;  2RJE A;  2YRV A;  3MEW A;  3R6O A;  1VQN A;  3CCV T;  2RJF A;  5LL6 S;  4C92 E;  1UGS B;  3MP8 A;  5I21 A;  2KSS A;  2DD5 A;  2ZPF B;  4IUU A;  4PJO A;  3QKJ A;  1VQK A;  1LOJ A;  1M1K U;  4GY5 A;  3NFC A;  2OTJ A;  2BIV A;  3OQ5 A;  4E7K A;  2JN0 A;  2QQB A;  2XDB A;  2HQE A;  2XG8 D;  3ME9 A;  2Y4Y A;  1WPY A;  2R5M A;  1OZ2 A;  4RMO A;  4NS5 A;  3L2R A;  3PIP A;  4R56 A;  3BW1 A;  4F7U B;  1I8F A;  3OW2 A;  2IVW A;  2EKO A;  2ZZD A;  3CCE T;  2L8D A;  2GCX A;  1VQ7 T;  2DK3 A;  2JUF A;  1RL2 A;  4MZT A;  3V7S A;  1QVF S;  4J6Y A;  1DJ7 B;  4BE1 A;  5EG2 A;  1KC8 C;  2QA4 T;  4M75 E;  2VV5 A;  3OBW A;  5LJ3 e;  2E12 A;  4LDX A;  4F7U G;  5M9O A;  3OYH A;  5LJ3 d;  2KAF A;  5LJ3 g;  5GAN 7;  3RMQ A;  5CKE A;  4M7A B;  1YJN A;  2EYQ A;  3I56 A;  4FT4 A;  3GPL A;  1OZ3 A;  3S6W A;  1XTD A;  5KE2 A;  4Q5W A;  1N9S A;  3HP9 A;  2LNV A;  2RK2 A;  5HK0 A;  3CPW S;  4X9C A;  4LDU A;  3S3M A;  2KQW A;  3JRZ A;  5GAN j;  3JB9 F;  3JCM Q;  2GF7 A;  2EJG A;  4PJO G;  2GQV A;  4BUG A;  2PUO B;  4L59 A;  2X4Y A;  4RG8 A;  3GNG A;  2OAU A;  1YI2 A;  4N0A C;  3MO8 A;  2CZ0 B;  3VYG A;  3X24 B;  2KY9 A;  1FX7 A;  5D6X A;  3CC7 A;  4E47 A;  3QJ6 A;  1VQ9 T;  2HD0 A;  1KC8 U;  4C0G A;  4F7U E;  4N4H A;  3CCU A;  5FU7 C;  2VXF A;  4PLI A;  4OB1 B;  1B34 B;  4HKE A;  3CCL T;  2RO0 A;  5D6W A;  2IG0 A;  4B9X A;  4J6X A;  4XU0 A;  3OYM A;  3P8D A;  1XNI A;  2EQU A;  1KD1 C;  3RKX A;  3GOX A;  3M59 A;  2EJ9 A;  2GFU A;  2LQ8 A;  4PKC C;  4FU6 A;  4M7A E;  2PVO B;  3QDR B;  4EDU A;  3SWN B;  4O5V A;  4C5G A;  5FU6 B;  4HCC A;  3NTK A;  3HSB A;  4FM4 B;  4N0A A;  3EFS A;  1RI0 A;  1VQ9 A;  3FJP A;  2RHX A;  3CME A;  3BFM A;  4P5N A;  4X9D A;  2CZ7 B;  1QP3 A;  2VGN A;  4RCC A;  3JCM e;  1KHI A;  3A5Z B;  3OSS C;  3OYE A;  1H64 1;  1UGQ B;  2L89 A;  3QXE B;  4C92 A;  3JCM g;  3VU3 C;  5IAY A;  3CXC A;  3DKM A;  5CKB A;  2F69 A;  3H6Z A;  3A8M B;  5GAN d;  5GAO m;  3LH0 A;  4WF2 A;  1VQO T;  3ZEH A;  1Y7X A;  1NJI C;  2L5Q A;  3QYG B;  1OYX A;  4BDZ A;  4XTV A;  5LJ5 h;  3OMC A;  5FLX E;  3CCS A;  4JJN K;  2M9U A;  4MDW A;  2RI2 A;  3OYD A;  4PNO A;  2VGM A;  2DKG A;  1KD1 U;  4JLG A;  3JCM b;  2OTL T;  2RA2 A;  3FLG A;  3HFO A;  4M75 D;  1M90 C;  3OS1 A;  4HCB A;  3RUX A;  5IN1 A;  5FRO A;  4EMK B;  2RM4 A;  2QDY B;  1EIF A;  3T9N A;  2QQS A;  4XK8 E;  4PJO F;  4EPC A;  5GAN 6;  1NZ9 A;  3PIO A;  3VYH B;  1VQ4 A;  3ASK A;  1UGR B;  2P0K A;  4X34 A;  3I55 T;  4M75 A;  2LTO A;  3MEV A;  4J6W A;  5GAM f;  5GAM h;  3HL8 A;  2XHC A;  5CQX A;  5DLO A;  4XU3 A;  3HFN A;  4IUP A;  2M1H A;  1VQ5 A;  5A0G A;  2JZ2 A;  3ZBD A;  2FB7 A;  1KHC A;  3LGL A;  3ER0 A;  3X20 B;  1U1S A;  2MMP A;  4BY6 B;  3CXC S;  1ZQ1 A;  2EIF A;  2LCC A;  3BDL A;  3CCR A;  3M4Y A;  3JCM J;  3NTI A;  4NOY A;  4IKF A;  4JUV A;  4C92 G;  3S3N A;  2E1H A;  3CC2 A;  2KMT A;  1M90 U;  4M7A C;  4HT8 A;  4A4H A;  1YJW T;  2FYK A;  4ZN1 A;  5GAO l;  4XTW A;  4C5I A;  2XD0 A;  3UDC A;  1NE8 A;  4J7F A;  3LWI A;  4F7U A;  3PNW C;  2MAM A;  2EAY A;  3INZ A;  4M7A D;  1QVF A;  3OYI A;  4M7D B;  1UB4 A;  2HQX A;  2F5T X;  1WQ7 A;  1BIA A;  3P8H A;  4A4E A;  3GIB A;  3CCV A;  5GMK i;  2DJZ A;  2F5K A;  3G7Z A;  3GNF B;  4QVD A;  3SB2 A;  2RJD A;  2DVE A;  3LW5 E;  2RHI A;  4BI8 B;  1H3Z A;  4M75 G;  4ELY C;  4M7A A;  4M77 B;  4M7D G;  4Z02 A;  3TRE A;  4N4G A;  4CRI A;  3OA6 A;  2VC8 A;  2EFI A;  4E7H A;  4FT2 A;  2DD4 A;  3QHS A;  4A4K A;  3CPW A;  4FL6 A;  4C5E A;  4MMK A;  3UPU A;  4ELZ C;  4BAC A;  1X01 A;  4MZP A;  1YJ9 T;  2QEX T;  3JCM W;  1NPP A;  4M77 G;  1KQS S;  5CKF A;  2D0Q B;  3VKI A;  3M9Q A;  4JDS A;  3G71 T;  1M4Z A;  2A7Y A;  3CCE A;  4JRP A;  4OB2 B;  1VQ7 A;  1YCY A;  5CKH A;  2PVD B;  2QA4 A;  5GAO r;  1ZHI A;  4A4G A;  3MP1 A;  1X75 C;  4C8Q B;  3OY9 A;  4RCB A;  2FL7 A;  1VQM T;  1YIJ T;  1B34 A;  3E19 A;  2D6F A;  4M7D E;  4CI0 C;  2E64 A;  3QII A;  1QVP A;  3L1A A;  4LD6 A;  5CO7 A;  5CVI A;  4J5Y A;  4C92 F;  1O75 A;  3JCM c;  1VQ8 T;  2ZPI B;  3SFM A;  2LC4 A;  1G3S A;  1WNL A;  1Y07 A;  3KBG A;  1MHN A;  2FVU A;  2XIC A;  3CBO A;  4C8Q G;  5I2S A;  3GP8 A;  4M77 E;  1OI1 A;  2ZPG B;  3SWN A;  3JCM X;  2RHU A;  2VYT A;  4J83 A;  3OYB A;  3G4S T;  4M7A G;  1YHQ T;  4EMK C;  3QSU A;  3PFS A;  5CQY A;  2CGH A;  4J7I A;  2E10 A;  3QPH A;  5C0M A;  3RMS A;  1JJ2 S;  3FB9 A;  1BKB A;  3OSV A;  1G3T A;  4XTY A;  5AYF A;  4C0Z A;  5CK9 A;  1SSF A;  2LVM A;  2PVG B;  3OS5 A;  4II1 A;  4PLL A;  3X25 B;  3L2W A;  2KK4 A;  3JSC A;  3V8L A;  3OYN A;  3PMI A;  4BE2 A;  2CS7 A;  3URG A;  4C92 C;  3LWH A;  3DLL A;  2K5F A;  3HRS A;  3CCL A;  1VUB A;  2JOY A;  4MZM A;  4M75 F;  3OYJ A;  2YLB A;  3CCM T;  5GMK j;  5KE3 A;  4JRK A;  2DZ9 A;  1Q7Y C;  2KDS A;  4BY6 C;  1YIT T;  3E9G A;  4C8Q E;  2ZPH B;  5A0L A;  5GAO n;  3QZ5 B;  2E41 A;  2LT4 A;  2RD1 A;  2DTO A;  5LJ3 h;  4C92 D;  2RH2 A;  4EMK A;  2X4W A;  3F70 A;  3LGF A;  2XU8 A;  5CR2 A;  5GAN 8;  3HPW A;  3RIR A;  1XQH A;  3N5B B;  5LJ5 g;  2A3L A;  4UC4 A;  4QVZ A;  2DXB A;  4JLI A;  3C95 A;  2V8J A;  1NJI U;  2HAX A;  2X35 A;  4M78 B;  5DLQ E;  2P0P A;  3JCM d;  2C06 A;  1VQO A;  4C5H A;  2VXE A;  4M75 C;  3FRN A;  3M56 A;  3J80 E;  4E7J A;  1K8A C;  4HT9 A;  4M7D C;  2K5I A;  2RHY A;  5GAN 4;  2R57 A;  2G3R A;  4LDY A;  4Y28 E;  4F7U F;  5LJ5 f;  1I5L A;  1BI1 A;  2OTL A;  3HKS A;  1XOV A;  2BUD A;  5GAM e;  1Q7Y U;  4M78 G;  2K4Y A;  4BE0 A;  1PSE A;  2H3J A;  3VV0 A;  2DXT A;  3MEA A;  2O4X B;  4A4F A;  4DQ2 A;  3BY7 A;  5GAM d;  5GAM g;  3O8V A;  2XDD A;  3CC4 T;  2Y90 A;  4M77 C;  1IRE B;  2YLC A;  4L5G A;  5KCO A;  5GAN 2;  1VQL T;  1VIE A;  4M7D D;  3CCQ T;  1N27 A;  5GMK e;  4ZTJ A;  3I55 A;  2AHJ B;  4M7A F;  4J8O A;  2K5L A;  4PL6 A;  2B8A A;  5FRM A;  1AHJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...