2VXIA

The binding of heme and zinc in escherichia coli bacterioferritin
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
157
structure length
157
Chain Sequence
MKGDTKVINYLNKLLGNELVAINQYFLHARMFKNWGLKRLNDVEYHESIDEMKHADRYIERILFLEGLPNLQDLGKLNIGEDVEEMLRSDLALELDGAKNLREAIGYADSVHDYVSRDMMIEILRDEEGHIDWLETELDLIQKMGLQNYLQAQIREE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords BACTERIOFERRITIN
publication title The Binding of Haem and Zinc in the 1.9 A X-Ray Structure of Escherichia Coli Bacterioferritin.
pubmed doi rcsb
molecule tags Metal transport
total genus 77
structure length 157
sequence length 157
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L
ec nomenclature ec 1.16.3.1: Ferroxidase.
pdb deposition date 2008-07-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00210 Ferritin Ferritin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.1260.10 Mainly Alpha Up-down Bundle Ferritin Ferritin 2vxiA00
5GU1X 4DZ0A 4TODA 5D8YA 3AF8X 5FFAA 5J9VA 5JKLG 2PYBA 2XGWA 4CMYA 1NNQA 3PW8A 3UOIA 2C2JA 3QD8A 5GU2X 3PZAA 3EZUA 4ZMCA 3HIUA 2ZG8X 3PW1A 3A9QA 4EVEA 4LQNA 4TOFA 1LB3A 1KRQA 1VEIA 2GYDA 3R2MA 3F36A 2HR5A 4OYNA 2JD60 3QZ3A 3RBCA 1AEWA 1JKVA 2Y3QA 4RC6A 3R2LA 5K53A 5D8QA 4QUWA 3E1MA 2C2FA 4RC7B 4IWKA 4ZLWA 3WNWA 4CYBA 3E2CA 5IX6A 3E6SA 3QHBA 2VXIA 1N1QA 2CHPA 3BVKA 3BT5A 5LG2A 4EVDA 2JD70 3BVLA 3U90A 2FG8A 5GU3X 5FFCA 2OH3A 4ZKWA 4ETRA 1YUXA 2CLBA 3IQ1A 3EZ0A 2VZBA 5LG8A 3BVIA 1VLGA 4PGIA 3R2HA 2WLUA 4CVSA 4XKSA 5J8SA 2ZA6A 4CY9A 1RCDA 5I4JA 3UOFA 3WVVA 1DVBA 4XGSA 2XJNA 1H96A 4ML5A 5FEJA 3SHXA 1L8IA 1IESA 5GU0X 5GN8A 3F38A 3F35A 2WTLA 3PWQA 3PWQC 3FVBA 1OTKA 2D5KA 1UMNA 1L8HA 2V2MA 4ISPA 2FJCA 1EUMA 2V2JA 4PG0A 4II4A 3EGMA 4Z5SA 1O9IA 5CMRA 3E1QA 4ERUA 3AJPA 4ZKHA 2Z5QA 2UX1A 3GE4A 4TOBA 4TW3A 2FFXJ 3KA3A 4IWJA 1SQ3A 3QB9A 2CIHA 2VXXA 2ZG7X 3PVRB 4CMYV 4YKHA 1Z6OA 3HL1A 4ISMA 5E2DA 1LKPA 2C41A 2QQYA 3PW8C 4A25A 1S30A 5D8RA 1RCGA 1UVHA 2V2IA 5JKMA 3A68A 4R42A 4Z3BA 2YJKA 4RC5A 1DPSA 4DE6A 5J8WA 2ZA7A 4ZL6A 4DI0A 4LQVA 2FL0A 2HTNA 5FFDA 5ERKA 3Q4RA 4LPMA 3QHCA 3KWOA 3E1OA 2V2RA 3PWFA 3KXUA 1R03A 1RCCA 3Q4QA 5FFBA 1Z4AA 2Z90A 3SH6A 1RCEA 4M32A 4LQHA 1FHAA 2ITBA 1BCFA 3OGHA 4EVBA 1YUZA 1J30A 1LKMA 3BKNA 3OJ5A 4DASA 1F30A 2IB0A 3IS7A 5D8PA 5JKMG 3F37A 3WVWA 3PVYB 2BJYA 4KVSA 3R2OA 1MOJA 2XJOA 1ZS3A 3ES3A 1NFVA 4EVCA 2G4HA 3ISFA 2QF9A 1IERA 4MUDA 4AM2A 2ZURX 4M35A 4TO9A 4LYUA 1NF4A 4Y08A 3AF7X 3R2SA 5D8XA 4LPNA 2GYQA 2GS4A 3AJQA 3AK8A 2W0OA 1TKOA 3AJOA 3NP0X 3KA4A 2Z5RA 5C6FA 4ZL5A 1DATA 1JREA 3PVTB 4MN9A 4ITWA 3O7SA 1RYTA 2FZFA 3NP2X 2ZG9X 5E1UA 4TOGA 1Z6OM 3E1JA 4REUA 4U3GA 4RC7A 3GHQA 3BVEA 5J93A 4E6KA 3F39A 5AXSA 2CN7A 4TOEA 5JACA 1S3QA 4DYZA 3PW1B 1BG7A 4XKUA 1ZUJA 4ZKXA 1JIGA 2WLAA 1B71A 2CF7A 4TOAA 1TKPA 3O7RA 4CVTA 5JKLA 1GWGA 1JKUA 3TA8A 1O9RA 4CVPA 4DYUA 1F33A 2IY4A 3Q4NA 4RC6B 4DYXA 1NF6A 3RD0A 4M34A 4LQJA 2CHIA 1HRSA 1JYBA 3QVDA 1JTSA 3F32A 4MJYA 1QGHA 5CMQA 3T9JA 4PGKA 5D8OA 4ZTTA 2JD80 3KA6A 1JGCA 1VEQA 1RCIA 4AM5A 5K52A 1LKOA 2YW7A 3KX9A 1SOFA 4IXKA 3RGDA 4LPJA 1YV1A 3NOZX 2Z6MA 2ZA8A 4CYAA 4KVRA 4RC8A 3FSEA 3KA8A 1VJXA 3PVRA 3IS8A 2C2UA 4P18A 3VNXA 1VELA 3AF9X 2YJJA 5LS9A 2YW6A 4ITTA 2F7NA 2IU2A 3WVUA 5GN8B 2BK6A 2Z5PA 4TOHA 3AK9A 2C6RA 5LBHA 4II4B 2BW1A 3R2KA 3RE7A 5HJHA 3ISEA 5FFEA 4LYXA 2CEIA 3UNOA 1XZ3A 3E1LA 3ERZA 2RBDA 4M33A 4KVQA 3E1PA 1XZ1A 2FHAA 1MFRA 3E1NA 2V2NA 2FG4A 4TOCA 3Q4OA 3GVYA 1BFRA 2X170 1JI5A 2CLUA 3PVYA 1QYBA 3FI6A 3SE1A 2BKCA 5HQOA 4CVRA 5GOUA 2V2PA 1TJOA 2V15A 2XJMA 4RC5B 3E6RA 3SIDA 3H7GA 4AM4A 4DYYA 2V2LA 1JI4A 4PG1A 3F34A 5D8SA 3KA9A 2V2SA 5CZUA 1TK6A 2OC5A 3MPSA 2XKQA 3RAVA 4MKUA 5ERJA 4XKTA 4ZJKA 2V2OA 3BVFA 4MY7A 5HJFA 2CN6A 3PVTA 1S2ZA 3R2RA 2FKZA 3F33A
chains in the Genus database with same CATH superfamily
5GU1X 4DZ0A 3FRSA 4TODA 5D8YA 3AF8X 5FFAA 5J9VA 5JKLG 2PYBA 2XGWA 4CMYA 1NNQA 3PW8A 3UOIA 2C2JA 3QD8A 5GU2X 3PZAA 2N02A 3EZUA 4ZMCA 3HIUA 4X0JA 2ZG8X 3PW1A 3L0MA 3A9QA 4EVEA 4LQNA 4TOFA 1LB3A 1KRQA 3C21A 1VEIA 2GYDA 3R2MA 3F36A 2HR5A 4OYNA 2JD60 3QZ3A 3RBCA 1AEWA 1JKVA 2Y3QA 4RC6A 3R2LA 5K53A 5D8QA 4QUWA 3E1MA 2C2FA 4KXRB 4RC7B 4IWKA 4ZLWA 3WNWA 4CYBA 3E2CA 5IX6A 3E6SA 3QHBA 2VXIA 1N1QA 2CHPA 3BVKA 3BT5A 5LG2A 4EVDA 2JD70 3BVLA 4YXJA 3U90A 2FG8A 5GU3X 5FFCA 2OH3A 4ZKWA 3C1YA 4ETRA 1YUXA 2CLBA 3IQ1A 3EZ0A 2VZBA 2AR0A 5LG8A 3BVIA 2G38B 1VLGA 4PGIA 3R2HA 3GGYA 2WLUA 4CVSA 4XKSA 2V8TA 2ZA6A 5J8SA 4CY9A 1RCDA 5I4JA 3UOFA 3WVVA 1DVBA 4XGSA 2XJNA 1H96A 4ML5A 5FEJA 3SHXA 1L8IA 1IESA 5GU0X 5GN8A 3F38A 3V3KB 3F35A 2WTLA 3PWQA 3PWQC 3FVBA 1OTKA 2D5KA 1UMNA 1L8HA 2V2MA 4ISPA 2FJCA 1EUMA 2V2JA 2V8UA 4PG0A 4II4A 3EGMA 4Z5SA 1O9IA 5CMRA 3E1QA 4ERUA 3AJPA 3JZ9A 2Z5QA 4ZKHA 2UX1A 3GE4A 4TOBA 4TW3A 2FFXJ 3KA3A 4IWJA 1SQ3A 3QB9A 2CIHA 2VXXA 2ZG7X 3PVRB 4CMYV 4YKHA 1Z6OA 3HL1A 4ISMA 2WWXB 5E2DA 1LKPA 2C41A 2QQYA 2MGYA 3PW8C 4A25A 1S30A 5D8RA 1RCGA 1UVHA 2V2IA 5JKMA 3A68A 4R42A 4Z3BA 2YJKA 4RC5A 1DPSA 4DE6A 5J8WA 2ZA7A 4ZL6A 4DI0A 4LQVA 3KDQA 2FL0A 2HTNA 2OKCA 5FFDA 5ERKA 3Q4RA 4LPMA 3QHCA 3KWOA 3E1OA 2V2RA 3PWFA 3KXUA 1R03A 1RCCA 3Q4QA 4YVZA 5FFBA 1Z4AA 2Z90A 4W4LB 3SH6A 1RCEA 4M32A 4LQHA 1FHAA 2ITBA 1BCFA 3OGHA 4EVBA 1YUZA 1J30A 1LKMA 3BKNA 3OJ5A 4DASA 1F30A 2IB0A 3IS7A 5D8PA 5JKMG 3F37A 3WVWA 3PVYB 2BJYA 4KVSA 3R2OA 1MOJA 2XJOA 1ZS3A 3ES3A 1NFVA 4EVCA 2G4HA 3ISFA 2QF9A 1IERA 4MUDA 4AM2A 2ZURX 4M35A 4TO9A 4LYUA 3C1ZA 1NF4A 4Y08A 2Y44A 3AF7X 3R2SA 5D8XA 4LPNA 2GYQA 2GS4A 3AJQA 3C23A 3AK8A 2W0OA 1TKOA 3AJOA 3NP0X 3KA4A 2Z5RA 5C6FA 4ZL5A 1DATA 1JREA 3PVTB 4MN9A 4MXPA 4ITWA 3O7SA 1RYTA 2FZFA 3NP2X 2ZG9X 5E1UA 4TOGA 1Z6OM 3E1JA 4REUA 4U3GA 3W54A 4RC7A 3GHQA 3BVEA 5J93A 4E6KA 3F39A 5AXSA 2CN7A 4TOEA 5JACA 1S3QA 4DYZA 3PW1B 1BG7A 4XKUA 1ZUJA 4ZKXA 1JIGA 2WLAA 1B71A 2CF7A 4TOAA 1TKPA 3O7RA 4CVTA 5JKLA 1GWGA 1JKUA 3TA8A 1O9RA 3FRRA 4CVPA 4DYUA 1F33A 2IY4A 3Q4NA 4RC6B 4DYXA 1NF6A 3RD0A 4M34A 4YXMA 2CHIA 4LQJA 1HRSA 1JYBA 3QVDA 1JTSA 3F32A 4MJYA 1QGHA 5CMQA 5HU6D 3T9JA 3VVAA 4PGKA 5D8OA 4ZTTA 2JD80 3KA6A 3VV9A 3KHKA 1JGCA 5JDOA 1VEQA 1RCIA 4AM5A 5K52A 1LKOA 2YW7A 3KX9A 1SOFA 4IXKA 3RGDA 4LPJA 1YV1A 3NOZX 2Z6MA 2ZA8A 4CYAA 3JZAB 4KVRA 4RC8A 3FSEA 3KA8A 1VJXA 3PVRA 3IS8A 3M6JA 2C2UA 4P18A 3VNXA 1VELA 3AF9X 2YJJA 5LS9A 2YW6A 4ITTA 4WJG4 2F7NA 2IU2A 3WVUA 5GN8B 2BK6A 2Z5PA 4TOHA 3AK9A 2CWLA 2C6RA 5LBHA 4II4B 2BW1A 3R2KA 3RE7A 5HJHA 3ISEA 5FFEA 4LYXA 2CEIA 3UNOA 1XZ3A 3D19A 3E1LA 3ERZA 2RBDA 4M33A 4KVQA 3E1PA 1XZ1A 2FHAA 3DBYA 4E40A 1MFRA 3E1NA 2V2NA 2FG4A 4TOCA 3Q4OA 3GVYA 1BFRA 2X170 1JI5A 2CLUA 3PVYA 3UFBA 1QYBA 3FI6A 3SE1A 2BKCA 5HQOA 4CVRA 5GOUA 2V2PA 1TJOA 2V15A 2XJMA 4RC5B 3E6RA 3SIDA 3H7GA 4AM4A 4DYYA 3LKDA 2V2LA 1JI4A 4PG1A 3F34A 5D8SA 3KA9A 2V2SA 5CZUA 1TK6A 2OC5A 3MPSA 5JDOB 2XKQA 3GGZA 3RAVA 4MKUA 5ERJA 4XKTA 4ZJKA 2V2OA 3BVFA 4MY7A 3N6OA 5HJFA 2CN6A 3PVTA 1S2ZA 3R2RA 2FKZA 4W4KB 3F33A
chains in the Genus database with same CATH topology
5GU1X 4DZ0A 3FRSA 4TODA 5D8YA 3AF8X 5FFAA 5J9VA 5JKLG 2PYBA 2XGWA 4CMYA 1NNQA 3PW8A 3UOIA 2C2JA 3QD8A 5GU2X 3PZAA 2N02A 3EZUA 4ZMCA 3HIUA 4X0JA 2ZG8X 3PW1A 3L0MA 3A9QA 4EVEA 4LQNA 4TOFA 1LB3A 1KRQA 3C21A 1VEIA 2GYDA 3R2MA 3F36A 2HR5A 4OYNA 2JD60 3QZ3A 3RBCA 1AEWA 1JKVA 2Y3QA 4RC6A 3R2LA 5K53A 5D8QA 4QUWA 3E1MA 2C2FA 4KXRB 4RC7B 4IWKA 4ZLWA 3WNWA 4CYBA 3E2CA 5IX6A 3E6SA 3QHBA 2VXIA 1N1QA 2CHPA 3BVKA 3BT5A 5LG2A 4EVDA 2JD70 3BVLA 4YXJA 3U90A 2FG8A 5GU3X 5FFCA 2OH3A 4ZKWA 3C1YA 4ETRA 1YUXA 2CLBA 3IQ1A 3EZ0A 2VZBA 2AR0A 5LG8A 3BVIA 2G38B 1VLGA 4PGIA 3R2HA 3GGYA 2WLUA 4CVSA 4XKSA 2V8TA 2ZA6A 5J8SA 4CY9A 1RCDA 5I4JA 3UOFA 3WVVA 1DVBA 4XGSA 2XJNA 1H96A 4ML5A 5FEJA 3SHXA 1L8IA 1IESA 5GU0X 5GN8A 3F38A 3V3KB 3F35A 2WTLA 3PWQA 3PWQC 3FVBA 1OTKA 2D5KA 1UMNA 1L8HA 2V2MA 4ISPA 2FJCA 1EUMA 2V2JA 2V8UA 4PG0A 4II4A 3EGMA 4Z5SA 1O9IA 5CMRA 3E1QA 4ERUA 3AJPA 3JZ9A 2Z5QA 4ZKHA 2UX1A 3GE4A 4TOBA 4TW3A 2FFXJ 3KA3A 4IWJA 1SQ3A 3QB9A 2CIHA 2VXXA 2ZG7X 3PVRB 4CMYV 4YKHA 1Z6OA 3HL1A 4ISMA 2WWXB 5E2DA 1LKPA 2C41A 2QQYA 2MGYA 3PW8C 4A25A 1S30A 5D8RA 1RCGA 1UVHA 2V2IA 5JKMA 3A68A 4R42A 4Z3BA 2YJKA 4RC5A 1DPSA 4DE6A 5J8WA 2ZA7A 4ZL6A 4DI0A 4LQVA 3KDQA 2FL0A 2HTNA 2OKCA 5FFDA 5ERKA 3Q4RA 4LPMA 3QHCA 3KWOA 3E1OA 2V2RA 3PWFA 3KXUA 1R03A 1RCCA 3Q4QA 4YVZA 5FFBA 1Z4AA 2Z90A 4W4LB 3SH6A 1RCEA 4M32A 4LQHA 1FHAA 2ITBA 1BCFA 3OGHA 4EVBA 1YUZA 1J30A 1LKMA 3BKNA 3OJ5A 4DASA 1F30A 2IB0A 3IS7A 5D8PA 5JKMG 3F37A 3WVWA 3PVYB 2BJYA 4KVSA 3R2OA 1MOJA 2XJOA 1ZS3A 3ES3A 1NFVA 4EVCA 2G4HA 3ISFA 2QF9A 1IERA 4MUDA 4AM2A 2ZURX 4M35A 4TO9A 4LYUA 3C1ZA 1NF4A 4Y08A 2Y44A 3AF7X 3R2SA 5D8XA 4LPNA 2GYQA 2GS4A 3AJQA 3C23A 3AK8A 2W0OA 1TKOA 3AJOA 3NP0X 3KA4A 2Z5RA 5C6FA 4ZL5A 1DATA 1JREA 3PVTB 4MN9A 4MXPA 4ITWA 3O7SA 1RYTA 2FZFA 3NP2X 2ZG9X 5E1UA 4TOGA 1Z6OM 3E1JA 4REUA 4U3GA 3W54A 4RC7A 3GHQA 3BVEA 5J93A 4E6KA 3F39A 5AXSA 2CN7A 4TOEA 5JACA 1S3QA 4DYZA 3PW1B 1BG7A 4XKUA 1ZUJA 4ZKXA 1JIGA 2WLAA 1B71A 2CF7A 4TOAA 1TKPA 3O7RA 4CVTA 5JKLA 1GWGA 1JKUA 3TA8A 1O9RA 3FRRA 4CVPA 4DYUA 1F33A 2IY4A 3Q4NA 4RC6B 4DYXA 1NF6A 3RD0A 4M34A 4YXMA 2CHIA 4LQJA 1HRSA 1JYBA 3QVDA 1JTSA 3F32A 4MJYA 1QGHA 5CMQA 5HU6D 3T9JA 3VVAA 4PGKA 5D8OA 4ZTTA 2JD80 3KA6A 3VV9A 3KHKA 1JGCA 5JDOA 1VEQA 1RCIA 4AM5A 5K52A 1LKOA 2YW7A 3KX9A 1SOFA 4IXKA 3RGDA 4LPJA 1YV1A 3NOZX 2Z6MA 2ZA8A 4CYAA 3JZAB 4KVRA 4RC8A 3FSEA 3KA8A 1VJXA 3PVRA 3IS8A 3M6JA 2C2UA 4P18A 3VNXA 1VELA 3AF9X 2YJJA 5LS9A 2YW6A 4ITTA 4WJG4 2F7NA 2IU2A 3WVUA 5GN8B 2BK6A 2Z5PA 4TOHA 3AK9A 2CWLA 2C6RA 5LBHA 4II4B 2BW1A 3R2KA 3RE7A 5HJHA 3ISEA 5FFEA 4LYXA 2CEIA 3UNOA 1XZ3A 3D19A 3E1LA 3ERZA 2RBDA 4M33A 4KVQA 3E1PA 1XZ1A 2FHAA 3DBYA 4E40A 1MFRA 3E1NA 2V2NA 2FG4A 4TOCA 3Q4OA 3GVYA 1BFRA 2X170 1JI5A 2CLUA 3PVYA 3UFBA 1QYBA 3FI6A 3SE1A 2BKCA 5HQOA 4CVRA 5GOUA 2V2PA 1TJOA 2V15A 2XJMA 4RC5B 3E6RA 3SIDA 3H7GA 4AM4A 4DYYA 3LKDA 2V2LA 1JI4A 4PG1A 3F34A 5D8SA 3KA9A 2V2SA 5CZUA 1TK6A 2OC5A 3MPSA 5JDOB 2XKQA 3GGZA 3RAVA 4MKUA 5ERJA 4XKTA 4ZJKA 2V2OA 3BVFA 4MY7A 3N6OA 5HJFA 2CN6A 3PVTA 1S2ZA 3R2RA 2FKZA 4W4KB 3F33A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5GU1 X;  4DZ0 A;  4TOD A;  5D8Y A;  3AF8 X;  5FFA A;  5J9V A;  5JKL G;  2PYB A;  2XGW A;  4CMY A;  1NNQ A;  3PW8 A;  3UOI A;  2C2J A;  3QD8 A;  5GU2 X;  3PZA A;  3EZU A;  4ZMC A;  3HIU A;  2ZG8 X;  3PW1 A;  3A9Q A;  4EVE A;  4LQN A;  4TOF A;  1LB3 A;  1KRQ A;  1VEI A;  2GYD A;  3R2M A;  3F36 A;  2HR5 A;  4OYN A;  2JD6 0;  3QZ3 A;  3RBC A;  1AEW A;  1JKV A;  2Y3Q A;  4RC6 A;  3R2L A;  5K53 A;  5D8Q A;  4QUW A;  3E1M A;  2C2F A;  4RC7 B;  4IWK A;  4ZLW A;  3WNW A;  4CYB A;  3E2C A;  5IX6 A;  3E6S A;  3QHB A;  2VXI A;  1N1Q A;  2CHP A;  3BVK A;  3BT5 A;  5LG2 A;  4EVD A;  2JD7 0;  3BVL A;  3U90 A;  2FG8 A;  5GU3 X;  5FFC A;  2OH3 A;  4ZKW A;  4ETR A;  1YUX A;  2CLB A;  3IQ1 A;  3EZ0 A;  2VZB A;  5LG8 A;  3BVI A;  1VLG A;  4PGI A;  3R2H A;  2WLU A;  4CVS A;  4XKS A;  5J8S A;  2ZA6 A;  4CY9 A;  1RCD A;  5I4J A;  3UOF A;  3WVV A;  1DVB A;  4XGS A;  2XJN A;  1H96 A;  4ML5 A;  5FEJ A;  3SHX A;  1L8I A;  1IES A;  5GU0 X;  5GN8 A;  3F38 A;  3F35 A;  2WTL A;  3PWQ A;  3PWQ C;  3FVB A;  1OTK A;  2D5K A;  1UMN A;  1L8H A;  2V2M A;  4ISP A;  2FJC A;  1EUM A;  2V2J A;  4PG0 A;  4II4 A;  3EGM A;  4Z5S A;  1O9I A;  5CMR A;  3E1Q A;  4ERU A;  3AJP A;  4ZKH A;  2Z5Q A;  2UX1 A;  3GE4 A;  4TOB A;  4TW3 A;  2FFX J;  3KA3 A;  4IWJ A;  1SQ3 A;  3QB9 A;  2CIH A;  2VXX A;  2ZG7 X;  3PVR B;  4CMY V;  4YKH A;  1Z6O A;  3HL1 A;  4ISM A;  5E2D A;  1LKP A;  2C41 A;  2QQY A;  3PW8 C;  4A25 A;  1S30 A;  5D8R A;  1RCG A;  1UVH A;  2V2I A;  5JKM A;  3A68 A;  4R42 A;  4Z3B A;  2YJK A;  4RC5 A;  1DPS A;  4DE6 A;  5J8W A;  2ZA7 A;  4ZL6 A;  4DI0 A;  4LQV A;  2FL0 A;  2HTN A;  5FFD A;  5ERK A;  3Q4R A;  4LPM A;  3QHC A;  3KWO A;  3E1O A;  2V2R A;  3PWF A;  3KXU A;  1R03 A;  1RCC A;  3Q4Q A;  5FFB A;  1Z4A A;  2Z90 A;  3SH6 A;  1RCE A;  4M32 A;  4LQH A;  1FHA A;  2ITB A;  1BCF A;  3OGH A;  4EVB A;  1YUZ A;  1J30 A;  1LKM A;  3BKN A;  3OJ5 A;  4DAS A;  1F30 A;  2IB0 A;  3IS7 A;  5D8P A;  5JKM G;  3F37 A;  3WVW A;  3PVY B;  2BJY A;  4KVS A;  3R2O A;  1MOJ A;  2XJO A;  1ZS3 A;  3ES3 A;  1NFV A;  4EVC A;  2G4H A;  3ISF A;  2QF9 A;  1IER A;  4MUD A;  4AM2 A;  2ZUR X;  4M35 A;  4TO9 A;  4LYU A;  1NF4 A;  4Y08 A;  3AF7 X;  3R2S A;  5D8X A;  4LPN A;  2GYQ A;  2GS4 A;  3AJQ A;  3AK8 A;  2W0O A;  1TKO A;  3AJO A;  3NP0 X;  3KA4 A;  2Z5R A;  5C6F A;  4ZL5 A;  1DAT A;  1JRE A;  3PVT B;  4MN9 A;  4ITW A;  3O7S A;  1RYT A;  2FZF A;  3NP2 X;  2ZG9 X;  5E1U A;  4TOG A;  1Z6O M;  3E1J A;  4REU A;  4U3G A;  4RC7 A;  3GHQ A;  3BVE A;  5J93 A;  4E6K A;  3F39 A;  5AXS A;  2CN7 A;  4TOE A;  5JAC A;  1S3Q A;  4DYZ A;  3PW1 B;  1BG7 A;  4XKU A;  1ZUJ A;  4ZKX A;  1JIG A;  2WLA A;  1B71 A;  2CF7 A;  4TOA A;  1TKP A;  3O7R A;  4CVT A;  5JKL A;  1GWG A;  1JKU A;  3TA8 A;  1O9R A;  4CVP A;  4DYU A;  1F33 A;  2IY4 A;  3Q4N A;  4RC6 B;  4DYX A;  1NF6 A;  3RD0 A;  4M34 A;  4LQJ A;  2CHI A;  1HRS A;  1JYB A;  3QVD A;  1JTS A;  3F32 A;  4MJY A;  1QGH A;  5CMQ A;  3T9J A;  4PGK A;  5D8O A;  4ZTT A;  2JD8 0;  3KA6 A;  1JGC A;  1VEQ A;  1RCI A;  4AM5 A;  5K52 A;  1LKO A;  2YW7 A;  3KX9 A;  1SOF A;  4IXK A;  3RGD A;  4LPJ A;  1YV1 A;  3NOZ X;  2Z6M A;  2ZA8 A;  4CYA A;  4KVR A;  4RC8 A;  3FSE A;  3KA8 A;  1VJX A;  3PVR A;  3IS8 A;  2C2U A;  4P18 A;  3VNX A;  1VEL A;  3AF9 X;  2YJJ A;  5LS9 A;  2YW6 A;  4ITT A;  2F7N A;  2IU2 A;  3WVU A;  5GN8 B;  2BK6 A;  2Z5P A;  4TOH A;  3AK9 A;  2C6R A;  5LBH A;  4II4 B;  2BW1 A;  3R2K A;  3RE7 A;  5HJH A;  3ISE A;  5FFE A;  4LYX A;  2CEI A;  3UNO A;  1XZ3 A;  3E1L A;  3ERZ A;  2RBD A;  4M33 A;  4KVQ A;  3E1P A;  1XZ1 A;  2FHA A;  1MFR A;  3E1N A;  2V2N A;  2FG4 A;  4TOC A;  3Q4O A;  3GVY A;  1BFR A;  2X17 0;  1JI5 A;  2CLU A;  3PVY A;  1QYB A;  3FI6 A;  3SE1 A;  2BKC A;  5HQO A;  4CVR A;  5GOU A;  2V2P A;  1TJO A;  2V15 A;  2XJM A;  4RC5 B;  3E6R A;  3SID A;  3H7G A;  4AM4 A;  4DYY A;  2V2L A;  1JI4 A;  4PG1 A;  3F34 A;  5D8S A;  3KA9 A;  2V2S A;  5CZU A;  1TK6 A;  2OC5 A;  3MPS A;  2XKQ A;  3RAV A;  4MKU A;  5ERJ A;  4XKT A;  4ZJK A;  2V2O A;  3BVF A;  4MY7 A;  5HJF A;  2CN6 A;  3PVT A;  1S2Z A;  3R2R A;  2FKZ A;  3F33 A; 
#chains in the Genus database with same CATH topology
 5GU1 X;  4DZ0 A;  3FRS A;  4TOD A;  5D8Y A;  3AF8 X;  5FFA A;  5J9V A;  5JKL G;  2PYB A;  2XGW A;  4CMY A;  1NNQ A;  3PW8 A;  3UOI A;  2C2J A;  3QD8 A;  5GU2 X;  3PZA A;  2N02 A;  3EZU A;  4ZMC A;  3HIU A;  4X0J A;  2ZG8 X;  3PW1 A;  3L0M A;  3A9Q A;  4EVE A;  4LQN A;  4TOF A;  1LB3 A;  1KRQ A;  3C21 A;  1VEI A;  2GYD A;  3R2M A;  3F36 A;  2HR5 A;  4OYN A;  2JD6 0;  3QZ3 A;  3RBC A;  1AEW A;  1JKV A;  2Y3Q A;  4RC6 A;  3R2L A;  5K53 A;  5D8Q A;  4QUW A;  3E1M A;  2C2F A;  4KXR B;  4RC7 B;  4IWK A;  4ZLW A;  3WNW A;  4CYB A;  3E2C A;  5IX6 A;  3E6S A;  3QHB A;  2VXI A;  1N1Q A;  2CHP A;  3BVK A;  3BT5 A;  5LG2 A;  4EVD A;  2JD7 0;  3BVL A;  4YXJ A;  3U90 A;  2FG8 A;  5GU3 X;  5FFC A;  2OH3 A;  4ZKW A;  3C1Y A;  4ETR A;  1YUX A;  2CLB A;  3IQ1 A;  3EZ0 A;  2VZB A;  2AR0 A;  5LG8 A;  3BVI A;  2G38 B;  1VLG A;  4PGI A;  3R2H A;  3GGY A;  2WLU A;  4CVS A;  4XKS A;  2V8T A;  2ZA6 A;  5J8S A;  4CY9 A;  1RCD A;  5I4J A;  3UOF A;  3WVV A;  1DVB A;  4XGS A;  2XJN A;  1H96 A;  4ML5 A;  5FEJ A;  3SHX A;  1L8I A;  1IES A;  5GU0 X;  5GN8 A;  3F38 A;  3V3K B;  3F35 A;  2WTL A;  3PWQ A;  3PWQ C;  3FVB A;  1OTK A;  2D5K A;  1UMN A;  1L8H A;  2V2M A;  4ISP A;  2FJC A;  1EUM A;  2V2J A;  2V8U A;  4PG0 A;  4II4 A;  3EGM A;  4Z5S A;  1O9I A;  5CMR A;  3E1Q A;  4ERU A;  3AJP A;  3JZ9 A;  2Z5Q A;  4ZKH A;  2UX1 A;  3GE4 A;  4TOB A;  4TW3 A;  2FFX J;  3KA3 A;  4IWJ A;  1SQ3 A;  3QB9 A;  2CIH A;  2VXX A;  2ZG7 X;  3PVR B;  4CMY V;  4YKH A;  1Z6O A;  3HL1 A;  4ISM A;  2WWX B;  5E2D A;  1LKP A;  2C41 A;  2QQY A;  2MGY A;  3PW8 C;  4A25 A;  1S30 A;  5D8R A;  1RCG A;  1UVH A;  2V2I A;  5JKM A;  3A68 A;  4R42 A;  4Z3B A;  2YJK A;  4RC5 A;  1DPS A;  4DE6 A;  5J8W A;  2ZA7 A;  4ZL6 A;  4DI0 A;  4LQV A;  3KDQ A;  2FL0 A;  2HTN A;  2OKC A;  5FFD A;  5ERK A;  3Q4R A;  4LPM A;  3QHC A;  3KWO A;  3E1O A;  2V2R A;  3PWF A;  3KXU A;  1R03 A;  1RCC A;  3Q4Q A;  4YVZ A;  5FFB A;  1Z4A A;  2Z90 A;  4W4L B;  3SH6 A;  1RCE A;  4M32 A;  4LQH A;  1FHA A;  2ITB A;  1BCF A;  3OGH A;  4EVB A;  1YUZ A;  1J30 A;  1LKM A;  3BKN A;  3OJ5 A;  4DAS A;  1F30 A;  2IB0 A;  3IS7 A;  5D8P A;  5JKM G;  3F37 A;  3WVW A;  3PVY B;  2BJY A;  4KVS A;  3R2O A;  1MOJ A;  2XJO A;  1ZS3 A;  3ES3 A;  1NFV A;  4EVC A;  2G4H A;  3ISF A;  2QF9 A;  1IER A;  4MUD A;  4AM2 A;  2ZUR X;  4M35 A;  4TO9 A;  4LYU A;  3C1Z A;  1NF4 A;  4Y08 A;  2Y44 A;  3AF7 X;  3R2S A;  5D8X A;  4LPN A;  2GYQ A;  2GS4 A;  3AJQ A;  3C23 A;  3AK8 A;  2W0O A;  1TKO A;  3AJO A;  3NP0 X;  3KA4 A;  2Z5R A;  5C6F A;  4ZL5 A;  1DAT A;  1JRE A;  3PVT B;  4MN9 A;  4MXP A;  4ITW A;  3O7S A;  1RYT A;  2FZF A;  3NP2 X;  2ZG9 X;  5E1U A;  4TOG A;  1Z6O M;  3E1J A;  4REU A;  4U3G A;  3W54 A;  4RC7 A;  3GHQ A;  3BVE A;  5J93 A;  4E6K A;  3F39 A;  5AXS A;  2CN7 A;  4TOE A;  5JAC A;  1S3Q A;  4DYZ A;  3PW1 B;  1BG7 A;  4XKU A;  1ZUJ A;  4ZKX A;  1JIG A;  2WLA A;  1B71 A;  2CF7 A;  4TOA A;  1TKP A;  3O7R A;  4CVT A;  5JKL A;  1GWG A;  1JKU A;  3TA8 A;  1O9R A;  3FRR A;  4CVP A;  4DYU A;  1F33 A;  2IY4 A;  3Q4N A;  4RC6 B;  4DYX A;  1NF6 A;  3RD0 A;  4M34 A;  4YXM A;  2CHI A;  4LQJ A;  1HRS A;  1JYB A;  3QVD A;  1JTS A;  3F32 A;  4MJY A;  1QGH A;  5CMQ A;  5HU6 D;  3T9J A;  3VVA A;  4PGK A;  5D8O A;  4ZTT A;  2JD8 0;  3KA6 A;  3VV9 A;  3KHK A;  1JGC A;  5JDO A;  1VEQ A;  1RCI A;  4AM5 A;  5K52 A;  1LKO A;  2YW7 A;  3KX9 A;  1SOF A;  4IXK A;  3RGD A;  4LPJ A;  1YV1 A;  3NOZ X;  2Z6M A;  2ZA8 A;  4CYA A;  3JZA B;  4KVR A;  4RC8 A;  3FSE A;  3KA8 A;  1VJX A;  3PVR A;  3IS8 A;  3M6J A;  2C2U A;  4P18 A;  3VNX A;  1VEL A;  3AF9 X;  2YJJ A;  5LS9 A;  2YW6 A;  4ITT A;  4WJG 4;  2F7N A;  2IU2 A;  3WVU A;  5GN8 B;  2BK6 A;  2Z5P A;  4TOH A;  3AK9 A;  2CWL A;  2C6R A;  5LBH A;  4II4 B;  2BW1 A;  3R2K A;  3RE7 A;  5HJH A;  3ISE A;  5FFE A;  4LYX A;  2CEI A;  3UNO A;  1XZ3 A;  3D19 A;  3E1L A;  3ERZ A;  2RBD A;  4M33 A;  4KVQ A;  3E1P A;  1XZ1 A;  2FHA A;  3DBY A;  4E40 A;  1MFR A;  3E1N A;  2V2N A;  2FG4 A;  4TOC A;  3Q4O A;  3GVY A;  1BFR A;  2X17 0;  1JI5 A;  2CLU A;  3PVY A;  3UFB A;  1QYB A;  3FI6 A;  3SE1 A;  2BKC A;  5HQO A;  4CVR A;  5GOU A;  2V2P A;  1TJO A;  2V15 A;  2XJM A;  4RC5 B;  3E6R A;  3SID A;  3H7G A;  4AM4 A;  4DYY A;  3LKD A;  2V2L A;  1JI4 A;  4PG1 A;  3F34 A;  5D8S A;  3KA9 A;  2V2S A;  5CZU A;  1TK6 A;  2OC5 A;  3MPS A;  5JDO B;  2XKQ A;  3GGZ A;  3RAV A;  4MKU A;  5ERJ A;  4XKT A;  4ZJK A;  2V2O A;  3BVF A;  4MY7 A;  3N6O A;  5HJF A;  2CN6 A;  3PVT A;  1S2Z A;  3R2R A;  2FKZ A;  4W4K B;  3F33 A; 
#chains in the Genus database with same CATH homology
 5GU1 X;  4DZ0 A;  3FRS A;  4TOD A;  5D8Y A;  3AF8 X;  5FFA A;  5J9V A;  5JKL G;  2PYB A;  2XGW A;  4CMY A;  1NNQ A;  3PW8 A;  3UOI A;  2C2J A;  3QD8 A;  5GU2 X;  3PZA A;  2N02 A;  3EZU A;  4ZMC A;  3HIU A;  4X0J A;  2ZG8 X;  3PW1 A;  3L0M A;  3A9Q A;  4EVE A;  4LQN A;  4TOF A;  1LB3 A;  1KRQ A;  3C21 A;  1VEI A;  2GYD A;  3R2M A;  3F36 A;  2HR5 A;  4OYN A;  2JD6 0;  3QZ3 A;  3RBC A;  1AEW A;  1JKV A;  2Y3Q A;  4RC6 A;  3R2L A;  5K53 A;  5D8Q A;  4QUW A;  3E1M A;  2C2F A;  4KXR B;  4RC7 B;  4IWK A;  4ZLW A;  3WNW A;  4CYB A;  3E2C A;  5IX6 A;  3E6S A;  3QHB A;  2VXI A;  1N1Q A;  2CHP A;  3BVK A;  3BT5 A;  5LG2 A;  4EVD A;  2JD7 0;  3BVL A;  4YXJ A;  3U90 A;  2FG8 A;  5GU3 X;  5FFC A;  2OH3 A;  4ZKW A;  3C1Y A;  4ETR A;  1YUX A;  2CLB A;  3IQ1 A;  3EZ0 A;  2VZB A;  2AR0 A;  5LG8 A;  3BVI A;  2G38 B;  1VLG A;  4PGI A;  3R2H A;  3GGY A;  2WLU A;  4CVS A;  4XKS A;  2V8T A;  2ZA6 A;  5J8S A;  4CY9 A;  1RCD A;  5I4J A;  3UOF A;  3WVV A;  1DVB A;  4XGS A;  2XJN A;  1H96 A;  4ML5 A;  5FEJ A;  3SHX A;  1L8I A;  1IES A;  5GU0 X;  5GN8 A;  3F38 A;  3V3K B;  3F35 A;  2WTL A;  3PWQ A;  3PWQ C;  3FVB A;  1OTK A;  2D5K A;  1UMN A;  1L8H A;  2V2M A;  4ISP A;  2FJC A;  1EUM A;  2V2J A;  2V8U A;  4PG0 A;  4II4 A;  3EGM A;  4Z5S A;  1O9I A;  5CMR A;  3E1Q A;  4ERU A;  3AJP A;  3JZ9 A;  2Z5Q A;  4ZKH A;  2UX1 A;  3GE4 A;  4TOB A;  4TW3 A;  2FFX J;  3KA3 A;  4IWJ A;  1SQ3 A;  3QB9 A;  2CIH A;  2VXX A;  2ZG7 X;  3PVR B;  4CMY V;  4YKH A;  1Z6O A;  3HL1 A;  4ISM A;  2WWX B;  5E2D A;  1LKP A;  2C41 A;  2QQY A;  2MGY A;  3PW8 C;  4A25 A;  1S30 A;  5D8R A;  1RCG A;  1UVH A;  2V2I A;  5JKM A;  3A68 A;  4R42 A;  4Z3B A;  2YJK A;  4RC5 A;  1DPS A;  4DE6 A;  5J8W A;  2ZA7 A;  4ZL6 A;  4DI0 A;  4LQV A;  3KDQ A;  2FL0 A;  2HTN A;  2OKC A;  5FFD A;  5ERK A;  3Q4R A;  4LPM A;  3QHC A;  3KWO A;  3E1O A;  2V2R A;  3PWF A;  3KXU A;  1R03 A;  1RCC A;  3Q4Q A;  4YVZ A;  5FFB A;  1Z4A A;  2Z90 A;  4W4L B;  3SH6 A;  1RCE A;  4M32 A;  4LQH A;  1FHA A;  2ITB A;  1BCF A;  3OGH A;  4EVB A;  1YUZ A;  1J30 A;  1LKM A;  3BKN A;  3OJ5 A;  4DAS A;  1F30 A;  2IB0 A;  3IS7 A;  5D8P A;  5JKM G;  3F37 A;  3WVW A;  3PVY B;  2BJY A;  4KVS A;  3R2O A;  1MOJ A;  2XJO A;  1ZS3 A;  3ES3 A;  1NFV A;  4EVC A;  2G4H A;  3ISF A;  2QF9 A;  1IER A;  4MUD A;  4AM2 A;  2ZUR X;  4M35 A;  4TO9 A;  4LYU A;  3C1Z A;  1NF4 A;  4Y08 A;  2Y44 A;  3AF7 X;  3R2S A;  5D8X A;  4LPN A;  2GYQ A;  2GS4 A;  3AJQ A;  3C23 A;  3AK8 A;  2W0O A;  1TKO A;  3AJO A;  3NP0 X;  3KA4 A;  2Z5R A;  5C6F A;  4ZL5 A;  1DAT A;  1JRE A;  3PVT B;  4MN9 A;  4MXP A;  4ITW A;  3O7S A;  1RYT A;  2FZF A;  3NP2 X;  2ZG9 X;  5E1U A;  4TOG A;  1Z6O M;  3E1J A;  4REU A;  4U3G A;  3W54 A;  4RC7 A;  3GHQ A;  3BVE A;  5J93 A;  4E6K A;  3F39 A;  5AXS A;  2CN7 A;  4TOE A;  5JAC A;  1S3Q A;  4DYZ A;  3PW1 B;  1BG7 A;  4XKU A;  1ZUJ A;  4ZKX A;  1JIG A;  2WLA A;  1B71 A;  2CF7 A;  4TOA A;  1TKP A;  3O7R A;  4CVT A;  5JKL A;  1GWG A;  1JKU A;  3TA8 A;  1O9R A;  3FRR A;  4CVP A;  4DYU A;  1F33 A;  2IY4 A;  3Q4N A;  4RC6 B;  4DYX A;  1NF6 A;  3RD0 A;  4M34 A;  4YXM A;  2CHI A;  4LQJ A;  1HRS A;  1JYB A;  3QVD A;  1JTS A;  3F32 A;  4MJY A;  1QGH A;  5CMQ A;  5HU6 D;  3T9J A;  3VVA A;  4PGK A;  5D8O A;  4ZTT A;  2JD8 0;  3KA6 A;  3VV9 A;  3KHK A;  1JGC A;  5JDO A;  1VEQ A;  1RCI A;  4AM5 A;  5K52 A;  1LKO A;  2YW7 A;  3KX9 A;  1SOF A;  4IXK A;  3RGD A;  4LPJ A;  1YV1 A;  3NOZ X;  2Z6M A;  2ZA8 A;  4CYA A;  3JZA B;  4KVR A;  4RC8 A;  3FSE A;  3KA8 A;  1VJX A;  3PVR A;  3IS8 A;  3M6J A;  2C2U A;  4P18 A;  3VNX A;  1VEL A;  3AF9 X;  2YJJ A;  5LS9 A;  2YW6 A;  4ITT A;  4WJG 4;  2F7N A;  2IU2 A;  3WVU A;  5GN8 B;  2BK6 A;  2Z5P A;  4TOH A;  3AK9 A;  2CWL A;  2C6R A;  5LBH A;  4II4 B;  2BW1 A;  3R2K A;  3RE7 A;  5HJH A;  3ISE A;  5FFE A;  4LYX A;  2CEI A;  3UNO A;  1XZ3 A;  3D19 A;  3E1L A;  3ERZ A;  2RBD A;  4M33 A;  4KVQ A;  3E1P A;  1XZ1 A;  2FHA A;  3DBY A;  4E40 A;  1MFR A;  3E1N A;  2V2N A;  2FG4 A;  4TOC A;  3Q4O A;  3GVY A;  1BFR A;  2X17 0;  1JI5 A;  2CLU A;  3PVY A;  3UFB A;  1QYB A;  3FI6 A;  3SE1 A;  2BKC A;  5HQO A;  4CVR A;  5GOU A;  2V2P A;  1TJO A;  2V15 A;  2XJM A;  4RC5 B;  3E6R A;  3SID A;  3H7G A;  4AM4 A;  4DYY A;  3LKD A;  2V2L A;  1JI4 A;  4PG1 A;  3F34 A;  5D8S A;  3KA9 A;  2V2S A;  5CZU A;  1TK6 A;  2OC5 A;  3MPS A;  5JDO B;  2XKQ A;  3GGZ A;  3RAV A;  4MKU A;  5ERJ A;  4XKT A;  4ZJK A;  2V2O A;  3BVF A;  4MY7 A;  3N6O A;  5HJF A;  2CN6 A;  3PVT A;  1S2Z A;  3R2R A;  2FKZ A;  4W4K B;  3F33 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...