2VXQA

Crystal structure of the major grass pollen allergen phl p 2 in complex with its specific ige-fab
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
KVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Allergen
molecule keywords POLLEN ALLERGEN PHL P 2
publication title High-Affinity Ige Recognition of a Conformational Epitope of the Major Respiratory Allergen Phl P 2 as Revealed by X-Ray Crystallography.
pubmed doi rcsb
source organism Phleum pratense
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 2vxqA00
4L48A 4JS7A 3FT1A 3D30A 4JCWA 1WHPA 3FT9A 2HCZX 4FG4A 2BH0A 4JJOA 1BMWA 2JNZA 2VXQA 4FERA 1N10A 1WHOA 4FFTA 4FG2A
chains in the Genus database with same CATH superfamily
4AUYA 5CEZD 3KPRB 1FAIL 1Z3GL 2OCCB 1GZPB 4U4BA 4NUGH 1P4LA 1JZ7A 5EEZA 1NC4A 3HAEB 2J25A 1K85A 1YY8A 4JKNA 4G8IB 4ODSL 4N25A 1UD4A 4LHJB 1MOEA 3VX0A 3RURA 4NQDA 4X6CA 2XQYK 2EVFA 4KNUA 1OGPA 3BQUA 1N8ZA 2XWZA 4D9LH 1E9QA 3WE6A 5T5FH 1HYRC 5T1KD 5A2IH 3CXDH 1WC7A 2V3FA 1OAXH 1PYWA 5M95B 4PLNC 2YAMA 2LFGA 2R7EA 2VAAA 4X7SL 2D3JA 4O02H 2YPVA 3RWHB 3H9ZA 5JW4N 3IBEA 2CUHA 1E7UA 5FW6A 1NCHA 1XL6A 3B2UD 1DVFD 3SYOA 5T3XL 3B2PA 2MOVA 5TF1H 3GSWA 1QYGH 3MUGA 4KHXH 4ZFQA 3VXMD 2HJLA 3KBHE 4PJCB 5E9DB 3BD4A 2NQCA 4BUQA 1MQ8A 1MWAH 1UHVA 3QUYD 2V5SA 4UM9D 3ZPDA 3QULA 3FQWB 4HJGB 3UOAB 1AGEA 3I75A 1BQRA 3IDGB 5GGVY 4H13C 2K0RA 2CA3A 3FH5A 1TZOA 1KT2B 1JV5A 1AGFA 4PFEA 1AMXA 1HHHB 3VG0L 5I73C 2RGSA 5GRWA 3X17A 4LKXB 2PWDA 4LRIA 4NRZB 3MJ9H 4NI3A 2XRAH 4XXCA 4GSQA 1KYDA 5INDA 3OAYH 4IKNA 2WVTA 2FWLB 3KPSD 1BBJB 2CQVA 4JVUA 4OZGA 4P06A 1KCBA 2ZUVA 3ISRA 3L6FA 3QI9C 2WAHA 4CBZA 3FFCA 3QJFA 5FHBL 3UC0H 1II4E 4UIMA 4YSUA 4ACPA 3N06B 1MLBB 2HX7A 5EOQL 4P3DB 5FK9B 2G2RB 2VIRA 2NYKA 5J11C 3ULUC 4Y9EA 3M1BA 4N9GA 1XH2A 2YXWA 4N4YB 4C4KO 3WIIH 4ISVB 4PRHE 2WCPA 5ESQA 1D2OA 4HJ0D 1MI5B 2MOQA 1GZHC 5IF0A 3GS4A 2AJXL 3FTXA 1J88A 4I0PC 3MNVB 4BEIA 1IAOB 3MGOA 4KO7A 5TQ0H 5EF0A 4ELDA 1QNIA 2X6VA 3MLWH 5K9JL 2BNQB 2BCKA 4RAUB 2WJ7A 3SGKA 1JZDC 2J4WL 3F01A 2XYBA 3DV6A 4OFDA 1ZE3C 1AOZA 1SOXA 3PWPE 3O3DA 1BGXL 1EIBA 3N6YA 4LMQE 4P2QE 4JQXA 4Y5XB 1PCSA 4UTAA 4M1CD 3KYOB 1HL5A 3ARUA 1S9WB 2VLLB 2Z6FA 1S7VB 2FB4L 3MV7B 1HESA 2V5RA 5E6ID 1KDJA 4HV8A 1YECL 4RGOH 1EH9A 3TZVB 4HUNB 2J73A 2CXGA 4OD1H 4YGAB 5EO0A 3ZMRA 1N9PA 4FC3E 5I6NA 3P3RA 1KTDB 3PWLB 5CR1A 2XU9A 4PRAA 2VMFA 1ZWIB 3GXUB 1PKOA 3GSOA 2DTML 3EOTH 4OLYL 3W37A 1IT9H 3T2NL 2VLKE 5MEQA 2C4FT 5MENA 1NCDH 3OKYA 2OJ1A 3PRZA 4Y1AB 3P4LA 1NMCC 2Q9OA 5DZVA 1AGCB 4KTGA 1SMAA 2FJGA 5JPMB 4GI8A 3FH7A 3UPRB 2HWZH 3E9TA 5L6YL 1NPJA 2XPGB 1DQDL 1KJ2B 1BX2B 2C3HA 3ZMNA 3MJGX 1EHLL 1XGPA 2ARJQ 4DF9A 4X8CA 1SXCA 2VXUH 3K6FA 1S3KH 1KTCA 1RSYA 1X7SA 3ABZA 1HE7A 2DF3A 1I7ZB 5CGYD 3WBDA 1WT5C 1XT5A 4PW3A 4EF3A 5EU7C 4JRYD 1CURA 4OVUA 4F8QA 1DJGA 3PF2A 2WV3A 2DLEA 1KCRH 3EXJA 3N40P 2GTQA 2P1YA 3MI6A 1AIZA 3TOPA 4ZODA 4X4MA 4DKTA 3FKUS 3OKMA 1DANT 2HXAA 4A38A 1MCOH 2Z31A 3C6LA 3EIFA 3O3UN 4RH4A 4TSCH 4A2HA 1OE2A 2QMJA 1LK2A 3AXLB 1CDYA 1V10A 2CCVA 4G1MB 4G7VL 1LO3L 4GXUN 4WSKA 4X4XA 5FA3A 4K0OA 3EZJB 3VFGH 1JWSA 2NNAB 3O6LH 1NGZA 1S7UA 2APTA 1JNJA 5D7IF 3D0LB 1J1OL 2EVIA 2FH6A 3ZRFC 1A4BA 1AD0A 5GZOA 2BSCA 3KPNA 1KLUA 1AY1H 1F4WL 2PCXA 1OM3L 3WEXB 1UH4A 4MMYA 1H3XA 4H2AA 3HG4A 4AEHL 1E9PB 4KK9D 3U9PL 4F2EA 1A6AA 4XPBH 3RVWD 4Z3JA 4QHMB 1BZ7B 3MRFA 4JRFA 4LSDA 2WVUA 4NCC1 4OJFH 4W6YB 4A7GA 3WFCH 5AW1B 4LPVA 1D5MA 2OR9L 3MLZH 1KFAH 4MCMA 4XNMA 2DQMA 1H6UA 3FT2B 3FCTB 1X5ZA 1X5JA 1HKLL 3OKLA 5DUML 5IM7A 4TVPL 1IZJA 2CDGA 3QEHB 5IMOA 1IU1A 1MFCL 4NIYE 2Z8VC 4TLKA 1LO2L 4O2EB 4APQD 2B3IA 1X5KA 3CFBB 1X9RA 3SY6A 2BVPA 4UUJB 4Y9BA 5K1NA 4LSRL 4OJCA 4AZUA 5KANG 5A2FA 1CGWA 4MMXC 3ARED 3GHEL 3QCVL 3ZDZE 1XX9C 5DJ0A 1EVUA 4JFFE 3P9MB 2WTOA 4GO6B 1KBWA 3QZWG 3CVCA 1YA5A 3GMLA 4XC1H 5E94B 1FZMA 1PLBA 1AZZC 3IYLW 2VR3A 4DN4H 1XZ0B 3QUML 4KKRA 4KOBA 1QRND 1UGKA 3K81A 4TSBH 2WGNB 5DFAA 1C7SA 4K9EL 4GAYB 4MJIB 4QCIB 5H37H 1YEIH 1UT2A 2A6KB 5I73B 2HRPH 3IRZA 2WWOA 1PZUB 4B6ZA 3FO0L 1WS7A 4ZSOA 3EUUA 3L5WB 4PJHE 4PTTA 1OTTC 2VW4A 4Y2DC 4WW1A 4FXGC 1E40A 2YRLA 1IQWL 3QHZL 1GCYA 1G9NC 4XN4A 2YUZA 3QI9B 1FHGA 3C08L 4HKBB 4RA0C 4Y8DC 3VU2A 2FYYB 2G75B 2J7LA 3P2DA 5DZJA 5I0DA 5F70A 1IM3B 1PGRB 2F58H 4QRPB 3EGDB 3V0WL 5H2BA 5I6MA 3CG8A 5J11B 4Z76A 1F8TH 1KCUL 2QKIB 5EOCH 2JIXA 4ERSH 4N2EA 5D2LF 2ZE0A 3CFEB 4I9XA 4RESB 5HPMB 1N2RA 3EJJX 1H6TA 2ZWLT 4I0CC 2BMKA 2NW3B 1VESA 4ADJA 4M6ML 3Q43A 3JUYA 3BUTA 4RWYH 3BUDA 4KKZA 2P8MB 2B2XL 4PGZA 3A6CL 4X99A 2XACC 4I0PB 2EKSA 1RZKC 3IVKA 4U1LB 4L8CA 4XWOD 2E4FA 4LPXA 5BZDB 1M3JA 3GMPA 1MVYA 1E3FA 4HMEA 1RZJC 4NRYA 2F1EA 1ZLSL 5ANHA 3U4AA 4XWGL 1IQDA 3QIWC 4PJBF 1ADWA 2R39A 4PS4H 3X14B 2QR0A 5FFGA 1JD7A 3LPPA 5AW4B 4EI0A 5DTFA 4E42B 3JTSA 4XNYL 1T5WB 4N9OB 1VRSA 3OC8A 3UTOA 4BINA 5EBWA 1CFSA 3BGAA 4WHTA 2ZOOA 1JIBA 3HNSL 4C83A 2ZQKA 1R5IB 1WZ1H 4NNPL 5EEUA 4LQ1A 2BOBA 4G8AC 1MAJA 4PLJD 4U7KA 4X9BA 2OMWA 3P40A 5BRZE 3X13B 5EA0L 1V7NH 3HG1A 5BMFH 15C8H 1FZJA 1KYFA 1UB5A 3NSXA 4FTVA 3OJVC 3TJEL 1WFUA 2FJFA 4K3JH 4KH2A 4NBXB 4GKOA 1KY6A 2ERJC 2VDMH 2FAUA 2XCMC 3HPLA 4X4KA 1SFDA 4WDIA 3LH2L 3SKJH 3IDMB 1WP6A 1I85A 2CPUA 3B83A 1RZKL 2N4IA 3FCUB 4W9EC 4DJMA 2O93L 1NFIB 4PJ5A 3BUQA 1CDUA 3RY6C 5ECGA 3L3OA 2B77A 1RZJL 4NO5B 4PB0L 1CMOA 2KYIA 3GGWB 1AQ8A 5IB1B 5DHVB 3IETA 3Q8CA 1P6AB 3UGEA 2EABA 3KYNA 4MD0A 4HW6A 5T3ZE 1BAFH 1SVZA 3FZUC 5BPPA 3TVMC 2VERN 4AC4A 1NKRA 5F0MB 4IRSB 2OMNA 1MW2A 1G0YR 1ICTA 2OMVA 4YHPB 4AQEA 2VMJA 1IC1A 1F0LA 5GRYA 4PRID 1BQSA 3RGVD 1QW9A 2BNUA 1EJ8A 2BC4A 3NK4A 1HZLA 4OT1H 3SE9H 4XH2A 1OARH 2D8KA 2VJXA 1TTGA 4RFOH 2EINB 3SDDC 3KPPA 4JDEB 2NQ3A 2QBWA 3BGFC 3ARYA 4N3TA 1FL5A 3QDGD 4AV5A 1DJYA 1CTOA 2D4FA 4KJYB 1LM8V 4DCQA 3I50H 3MN8A 4HSQA 1A8JH 3VM5A 3L54A 3TIDA 5KYNA 4OZ4A 4IBLT 4R8WL 4HAGA 4LLYA 5EOTB 5E5UB 5HGAA 1PCXA 4NSKA 1OF2B 1BVKB 2NY6D 4CN4A 1GVIA 1ZHNB 3H9SA 3HZKB 1YC7A 4I85A 4NO3A 1F4AA 2QQQA 4PRDB 4A7VA 4MVBC 4UCFA 2W1NA 3B6SB 4YDZA 4JPWL 4D3CH 1G7JA 3MRQA 2DKSA 1AD9A 1WFOA 1U8LA 2PP9A 4HC1A 2H0JA 1K2DA 2AQ3A 1IEHA 4DW2L 3TCLB 4DVBB 2E7LC 4X6CF 2WWMC 2KZWA 4A67A 2FBJH 4WI0A 1BQ5A 1OK0A 5IROC 4H20H 4WFGE 2O72A 3VO0A 4G9DB 3E7JA 5C0EA 5BCAA 3GEWB 2FSEB 1QBLH 3BP5B 3LH9A 4H8WH 2Y07H 4M8VA 3V5HA 5EO1A 2NY3C 4JRXE 1RLBA 4K71C 4M03A 3B43A 1O6SB 1SVBA 3VSTA 3RFZA 4U1JA 4Z7UA 3QGVA 3NSJA 1GJIA 1AS6A 3VXUB 4S11A 1U30A 4C47A 4Z7NF 2IGTA 5AOJA 1G7LB 4A6YA 2VN5A 3HS0A 4FD0A 1ZIBA 4Z77B 3BDXA 3FQNB 1JK8B 3F58L 4OCWL 1FO0H 3N5AA 3VDAA 1MEXH 2FJHB 1N6UA 3O4LA 4A1RA 1WFTA 3ERXA 3MBEC 4JHWH 1SN2A 3O2DH 4JRLA 3ZT5A 4JGMA 3DUSB 4H2CA 5E1AB 3MBWA 3FULA 4XCEA 3G5VB 4LLMB 2ZP8A 3MRHB 1XTMA 4WI6A 4ZUWB 1NKOA 1YN6A 3VNZA 4AMKH 1G9EA 5CGBA 2X2YA 5FLVA 2ALAA 4IKIA 3MXVH 3IFPA 5E5LA 2AQ1A 3RAJH 3VXSD 4D8PB 5IBTL 2OFQA 4PY7A 3ARBA 1LK3L 4L3CB 1VGKB 1FE8L 4EI5C 2CG9X 1K3ZA 4E5XB 2UZYB 3QDAA 4IJTA 4LEXL 1FZOB 2BH0A 3D2UB 5C97A 2WYHA 1TTUA 2DQCL 4NLHA 3ESNA 4OZGF 3UAEA 3S5ZA 1BFTA 4OZFH 5FYJL 1UGNA 2AXGB 4I8DA 2BSBA 1GYWA 1E4WH 3MV9A 1L9QA 1DL7L 3MRBB 1CDBA 2EIBA 3QIWB 1B0GB 3L9BA 4A2GA 3QFJD 1E4XI 2ZX5A 2O6DA 3L3HB 3FHAA 4GEIA 5I6PA 2WIIB 3WXWH 4ODVL 1T3FA 1MHCA 1Y1UA 2IFGA 2E27L 2JI2A 1TEGA 5HD8D 3BN9D 5CJQH 3CZSA 2VDQL 4HZLA 3P1VA 4IGBD 4KY1H 2M8XA 2GBUA 3ATAA 1GC1H 4TLTA 1LJMA 2AP2A 1LNUA 4MA7H 1V7MH 4FFYA 3WTUA 4P46A 4MXQD 2DMBA 1OAUL 1SY6H 3D4CA 3AQYA 5C0AE 3WKNA 3QEUB 2J1WA 4RRPM 2QVKA 2C4FU 4N2MA 4DTGH 4DKFH 5EC1A 2ERJB 2BDNH 2Z65C 2XG4A 2DI7A 2HFGL 4FOMA 4FHJA 4C4UA 1F6LL 3MGTA 3HR5B 4JFPB 1CFTB 4JG5A 5B1JA 5J6SA 4CGTA 4BZ2H 3RP1A 4QIRA 2IAMD 2BSTB 4GW5A 4OKDA 1YEHH 1EK3A 3Q2WA 1JOIA 1IAKB 1MF2H 1PKQA 1AGDB 2HP4A 3Q1EA 5HI4D 3WLBB 1FG2A 3L1OH 1IGIL 1E6OL 4N0YL 2J5WA 2XI9A 3WD5H 2H45A 2IWEA 5EIIB 3ZY7A 3O9WD 2H2PD 1N59B 4LSSH 2WNWA 4OQTL 1JXGA 3DA0A 3D85D 4O4YL 2DKUA 2X10A 5DMIH 1ND0B 3BZEB 3AXHA 5EORH 1I82A 4LIQL 3ZZSA 1DLFL 1JZ2A 1Q94B 2X53A 2Y22A 2HTKD 4GAJL 5HHPB 2P5WB 4ELME 1EEYA 2IQ9L 1VKXB 3QDJA 3WNPA 3LB6C 4NKIL 3ROLB 5AWNL 2X0UA 4ONGL 1X9QA 3BKJH 1CXEA 1IFGA 3DRQA 3MUJA 3NIDF 3UL4A 2CBTA 3SDDB 2WNGA 3FOLB 4P4KD 1RULH 3ARDC 1QSEE 5DJ8B 3RDJA 3P4NB 1TJIH 3DGDA 1IEAA 4PY8J 3OTTA 1RZFH 1A4CA 5A2KH 5BO0D 4OF8A 1C1EH 1L5GB 1RUMH 2WTPA 1EJ6A 1VEOA 4WI7A 3HMXH 1BMZA 3E1ZA 3TPKA 3NEXA 4EKJA 3MLVH 3NG5A 3KEDA 1YNLH 4E9LA 4F15B 2BSEA 4QTHA 1PSKL 2KT6A 2OBGA 4WW2F 4YHKL 3BVNA 5D1ZB 3JV6B 1DBBH 2J21A 3QCUH 4EUPB 2V2XA 4IS6A 1CG9B 5HDWA 2ZD0A 3APMA 1RZPA 1MJUH 2D03L 1IGCH 1BD2B 5TFSL 1T1ZB 3DX7B 4J28A 1MCBA 2E7HA 3JQOB 4KZCA 1AXSA 1P7QA 2VLJA 3FQ1A 2Z8RA 3RWIA 3WMQA 3F64A 2R69L 2ZNWA 2XY1A 2XN0A 1SM3H 2Z4QA 4L18A 4WI8A 3LPGA 1YEEL 3JWDH 2CK0L 2WQRA 3VXRE 3KPOB 4B0MM 1LO4L 3NPZB 4IRSD 2BFGA 3RHWF 4ZTOH 2BJML 2WPGA 1HK6A 4R83A 1IC0A 4QF1B 3MLYL 5CSZB 3HE6B 1I7UB 2IGLA 1TG8A 3HE7D 1PF3A 1I9EA 1K4CB 5KVDL 3TWCH 2NY3B 4K71B 3KYAA 4TNVK 4P59L 3U2IA 3L7EA 4RGNE 4X8JB 3NIFF 3ARXA 4YNYA 4HCRH 5GJTL 5IQ7H 1YEKH 2CHXA 2FGZA 3DSNB 4HLEA 2BP3A 2XBDA 2CO1A 3I84A 4R5TA 5EPMA 2MNJB 1R19A 3VXME 1YPZB 2AANA 2E5EA 4L8SA 1IGFL 5E00B 3L1GA 1ONQB 5IJKC 1KBVA 4HZAA 2APBA 1DVQA 1GOFA 3FFOA 2CJUL 3ARTA 4F80A 5K9QG 1LO5A 1FZKA 2WZ0A 4GRWF 4J12A 4L4TB 4BWUA 3KVDD 1OW0C 4R4FH 3N43F 4FQXA 1RUAL 3IGKA 1ZXQA 4PWJA 4N3UA 3T4AA 2IADA 2PYEE 4X5WB 2PLTA 2YPLB 5JXED 5EUKA 2Z8SA 3QORB 5KVEL 1HCZA 2ZCZA 4AEIH 2A2QT 4TF4A 2PW1B 4PBDA 1H5BA 2DMKA 1JWUB 3CSYB 1D5XB 1QFWL 3QDMA 1BYNA 2XZAL 5D6DA 1D3CA 1WD9A 4Z7WE 3TPUB 5L8KB 2ZTBA 2PPDA 3KPSE 2FL5B 4MMZB 3GK8L 3NCJL 3I6KB 4EI5B 5C09B 2I24N 3FTUA 4O2FA 3GI9H 2WXMA 3AB0C 5AOMA 3K91A 2LOEA 4CNIB 1OOAA 5FCUH 32C2B 1D5IH 4NM8H 1EGJL 3SKMB 2AQQA 1JWMB 3WIHH 3T0WA 4XMUA 1MCQA 4JDTH 2OMYB 3C87A 4MS8D 3WO3B 2NZ9D 3VWJD 2FQEA 2H5UA 4ZXBD 4HVBA 3KAAA 3IPBA 4G80B 2G30A 1FJ1A 1I8MA 1G7PA 3U9WA 5LNDA 1JGUH 4XP6L 2VMDA 2AVGA 5JMOC 1Z5LB 1FH2A 1CUOA 2TRYA 3L5XH 2ZNXA 3CMGA 5C0NC 1CU4L 2PCYA 3MPCA 4F91B 1JZ3A 3ECBA 4M5ZL 1BQHA 2Y9RT 4WEBL 1KCSH 2FX8H 1NEZG 5FA4B 4ZD3H 5C7XL 5CD3B 3S5LG 1FNSL 4F37F 3HMWL 5ITBL 4JY6A 1BVNT 2R29H 2A77H 1K8DA 3K8LA 1HXMA 4ONHA 4X50A 2AQTA 1I8KB 2UX7A 5ANME 1KLGB 1XEUA 2EILB 5JDJA 1XVSA 1WYJA 2I9TA 2DEXX 4NFDA 3S35L 1DBKL 3DWTA 3EJZC 1YCSA 1ORSB 4OFIA 3FRPB 2Z0BA 3UC2A 3WFHA 1SMDA 4YK4C 2IPTL 1P1ZA 2W9DL 4WWKD 3SCMC 3BJ91 2CGRL 4XAWH 4HF5H 4AQ1A 2OR8A 1U8MB 3OZ9L 2XZZA 2ICWI 3D2UD 4GSRA 4UINH 4YHNB 5IJCC 3IMVA 3PGFL 3V0GA 5C07A 3C09C 3P77A 2IBGA 3MX0A 5KJRL 2NTSP 3BAEH 4S1DD 3LZFH 2X9YA 2B14A 3EO0A 4GXVL 2DQGH 3V2AR 3SIKA 3D2TA 4ENZA 1QBBA 3O6ML 4RMVA 1LYQA 3GSXA 1N64L 5AOIA 3TT3H 3D3VB 4TQHA 2QSQA 1J9RA 1FWXA 4GKNB 1DBML 5CU5A 3U0PB 3ARDB 5AKTA 1PQZA 3BDBA 2QLYA 3OKNB 1QNZL 1QABA 4YX2H 5AAWA 5I6KA 3FTGA 1XD0A 2W60A 4XTRC 4YBQC 4DSYA 3HI6L 3KLQA 3SKUD 4G7RB 5F6HJ 1BAGA 1VGEH 5LDUA 4IIZA 2FUQA 3KWUA 1OL0A 2VLKA 1LP9F 3V9CA 4QTIH 4L0ZA 4EO5A 3BT2H 1FN4A 1CFQB 4DVRH 1IVTA 3KGTA 4JG1H 4WSGA 4ZPTA 3SJVA 2PR4H 1WEJL 3QWQB 2C7FA 4DK3A 5DVMA 1C12A 2GUYA 4GKZB 5TQ2L 1AP2B 4P9HL 3KGUA 1PMYA 1Q38A 3NEEA 1QHOA 5HHXL 3BLPX 5KBNC 4CW1A 3MRGB 4AT6B 3LXCA 5BUPA 3N42B 4CSTA 4GOSA 3PWNB 4GMTL 1G6RH 1FFOA 2YPKB 5EB9A 4Q2ZB 4U2ZA 2RALA 1CQYA 2VR9A 5IHUL 3EHBB 5CN2A 5DS8B 2R2HA 3WI9A 4KDVA 3US1A 3UIYA 3KWWB 1XGTA 2JI1A 4G70B 1EDHA 1QSZA 4IBVA 3O3BB 5F7KC 2OS7A 4B5EA 2R8SH 5CZVL 4LOEA 4MJJA 1S7WB 3BSGA 4H8UA 1MREL 3GPEA 3MRDA 2XWEA 3OXSA 4NZFA 1CLZH 2VDRH 1KELH 5MERA 1XAKA 2F53B 5I0WA 1NCNA 3S3SA 3LAFA 4BK5A 5JA9A 2X1QA 4Y88A 1NLDL 3GUTB 2RA1A 3NRQA 3NSCA 2F68X 2CSPA 5E70A 1NJ9A 4NUJB 3DTXB 3LQMA 4JFEA 3B2MA 3EFFB 4QRTA 5CIPB 3D39A 1U91B 1L3NA 4FQCL 2EYSA 1T4WA 3HNTL 1ODUA 5BOPA 1XCXA 4RAHA 1FRGH 2IH8A 3C60C 2QHRL 1ZTMA 4LPUA 4LLUB 1QEWA 4MAUH 2X1OA 5K69A 4NQXB 1TYJA 4OUUA 1OZUA 1KIRA 3WHXB 1HSBA 1T7XA 5ENWB 1LWRA 1IAIH 4OGYH 1PJWA 3L16A 2J88H 3FUJA 3MTRA 4JJ5A 1XF3B 1T5KA 2ZX7A 3LQAH 1MFEL 2XA3A 2X4PB 3OKKB 5D71L 2PXYC 3ZGHA 1R3LB 1ZV9A 3QEGH 1AZNA 4ZO7A 1A3RL 5F44A 2HFFB 2GK0A 3NCYP 3OBAA 1PZ5A 4W68A 4Y16B 3VWKD 1EDYA 2OSYA 4R26L 3VTAA 2NSXA 3FF8A 5EF1A 3CN0A 6FABH 1FSKB 4I5BA 1BAWA 4PGCA 2BZ7A 5IHBA 3MRRB 4EDWL 2IAND 1FVCA 3KYKH 1TJHH 3BVUA 4HIEB 4PVNA 3UJTH 43CAA 2AV1B 5L2KD 1C16A 1X5MA 2VMEA 3EYVA 3LZPA 4MZRA 1A5FH 4L0YA 3MROA 4HUUB 1BFOB 1HHIA 1UWGL 4YHML 1S5HB 1ETA1 2K8QA 2EVJA 3RBSA 4YR6B 4FAAB 5GRUH 5DK0A 5E8DL 2KLSA 3EJTA 3L3JB 3PHSA 3EJPA 2EO1A 3FPXA 1DJXA 1AIFB 4YO0B 1N12A 3OAUH 2HKFL 4MXWL 2F15A 1M6OB 1NCWH 2IJ0C 3V6OE 5ISZD 1JZIA 3FMGH 4JCWA 3Q5YA 2ZKMX 4XMKH 2F19L 4XNZC 2DEWX 4FI8A 1EHXA 4Z7QB 1NDMA 2CALA 1CDIA 1HEZB 2DJSA 1A25A 4JFZL 4K8RD 2H1LM 4Y19B 4ZDHA 4AVIA 4XPTH 3BSHA 1CLOL 3SCMB 4XMPH 4K94C 5ABZA 2XYCA 4NKMB 2RJMA 5KSBB 1YMMB 4GW1A 5GZNA 1N10A 5HHNA 5KYWB 1L0QA 1QBMH 4HU2A 4TNWK 2X6UA 1U8JB 1T04A 4JM2D 1XR8A 5I1DA 3KS0J 1L9OA 2UZXB 3KLAA 4TULH 4JZOA 2ZWYA 3C6SA 3C09B 3QZLA 1WV7T 2Q87A 2OZ4L 4NRXA 3EUDA 3QNZA 1WAAF 1DQKA 2DMCA 1A6VL 3CMOH 5I2IB 3IAGC 5DC4B 5HDQH 3M7FB 1F56A 1ZHBA 3P3YA 1FDLH 3EDFA 2BIHA 3BP4B 4M48L 3K6NA 2R1WB 4XMZA 3RX5A 1OB1A 4YSOA 1FFNA 3G5ZB 3MACL 4GLRH 4L48A 3F00A 1AXTL 1E3ZA 1Z9NA 3VFRA 3BP7A 3DOSB 1I1AA 1HX0A 3R8BB 1P0SE 2AK4D 4FYTA 4Y89A 4JNXA 4HAFA 1PNDA 4B9CA 4K94L 3VI3B 1W9XA 6TAAA 1NCIA 2EEXA 3TBYA 1J8HB 3SDXB 3UTQB 3IAPA 3QDGE 4PV1C 2DLFH 2VXTL 3MV01 1TJXA 4QOKA 2VN4A 2UV3A 2R4RL 4JY5H 3O8XA 3WFEL 4OJAA 3G08A 3L4TA 2HX9A 4TVSa 3TASA 4D8OA 3FBKA 4JAMB 4DQOL 4JO1L 3Q01A 4PJDE 1FCCA 3TFKD 1QFHA 3BXNB 4Z3GA 4JQVA 2EDYA 4GKLA 4B96A 1GW0A 1B2WL 2WQWA 3LSOA 4WJKB 1W8EA 3O0RH 2VQ1A 1YQVH 3QXAB 1M2VA 1MZYA 4ZAKA 3WXVL 2OSWA 1UJ3A 2Y7MA 4HZ1A 4RNRB 5I1LB 1EUTA 4O58L 1MCIA 2JTYA 2UX6A 1I9RH 4QUOA 3FSWA 1UKSA 4GUPB 4KKAC 1A0QH 5C0CB 5FYLE 4O00A 1QLEH 2OI9C 4G8GB 3S37H 5MP6H 4YPGA 3RJDA 1CFVL 3IDYB 1I1YA 1L7TH 3ZLQC 4F7CB 3VXTA 1AQKH 1RD6A 1TEFA 4FKKA 2EDJA 2VE6B 2A7BA 3FSZA 1V3LA 3MNZA 3ECQA 2AVFA 3SDCA 4BJLA 2DL2A 3ARWA 4ZZFA 4M6OL 1CDGA 4Q52A 3Q9QA 5D5MB 5EFIA 2K4WA 1GYVA 2UWEB 3C60B 2Y1ZA 2Z92B 2NY1C 2OTUA 2ED6A 4FABL 3MNWA 4GT0A 4YDJA 5DUBA 3QUZA 5CLTA 3WS3B 3QZWA 2BXYA 4L3FA 3R8QA 2IPUK 1JHTA 3GHBL 1QA9A 2Q7YA 1NWPA 3FU7B 4WGKA 3UJIH 3GPSA 1TQCC 4XN9A 3UZVA 1CGVA 3G6AA 3T5WA 2PXYB 4LOFA 5CSBA 1NA8A 3B9KA 4AIXA 1SJVA 1T22A 3MMEA 1UVQB 4XN1A 2XVBA 1BJ1H 5IMKB 1JHKH 2XFXB 1PEWA 2XTSA 4CVXA 3OKEB 3KXFA 3KYMB 4KKCD 3V4PL 5EU3B 5IHZA 1KPUB 4QRUA 5F9WC 5FM8A 2QQKH 4JRXA 1GYAA 3TIEA 3C5ZA 3WL9A 2CRIA 2F54B 4JFOA 1MFNA 4IJ3C 4J3UA 4MX7A 1M71A 4N0FB 5BV7C 5JIMA 4LCWB 4F58L 2FEDC 5MI0C 4QXTA 3SKOA 1D9KD 2AF2A 3K1KC 1SLVA 4F7PB 2RR3A 2NY5C 3O11B 1UQSA 4BQ9A 4ZBJA 1L9NA 1LEGB 5AZEH 4XNQA 2IG2L 1DN0B 1MUJA 3I2CH 4XPHL 1FNEB 5DVOA 4ZW8A 4ODTL 1OP5H 4YHOL 3IXTB 2B1AH 3QFJE 4XCCH 4PJFE 5AL8A 1XGQA 1I4FB 3OHXC 2DPKA 5JLZB 5HDRA 3CVHH 4JDVB 1F4HA 3IE4A 4D0DB 2W9EL 3HEIB 3C8KB 5H37G 3LH8A 4HGMA 2FIKA 2QVMA 5C8JA 1DDHA 4ONFL 4QXGH 1MG2C 5I66B 2GBVA 5BRQA 3SN6N 1MRFH 3DRTB 2TSBA 3E9UA 3RIFF 4JFTA 1EAPB 1KBGH 4OLUH 4XNZB 4GUCA 4PGBA 4KK5D 1D6VH 4ODXA 1TT6A 1I75A 1O75A 3M8OL 3VFMB 2CA4A 3RNQB 2Y7NA 5ESVA 3L4CA 2BIMA 5G5DB 1MPAH 1K4DA 3ABMB 4MQXD 3WCYA 2FO4B 5IGXH 5JO5A 3ES6A 1I9IL 1Q9OA 1ZHLA 4WU7A 2X05A 1YDPB 4P3CH 5KTEL 2QL1A 4NM4H 1NCCH 1JNNL 2GTZB 4AYSA 1YEFL 4M7LL 4UNVA 1RMFL 2NY5L 2X6AA 3KCPB 4YSRA 4X7TB 3CQPA 4PIRF 2FNWA 1FAIH 1Z3GH 2BSDA 2EDXA 4LVHC 2W80C 4X8XA 5ADPL 1A6TA 3T65A 4R7NB 3K6OA 2VSDA 4UTBA 2FTAA 3BW9B 3V95A 4V2BA 4FXKA 1QLFA 5IEKA 1RXLA 5KWYC 5A6IA 2WHVA 3P0GB 3SD2A 5FPIA 1H0DA 3V0IA 2OJZH 5I28A 3MKKA 4QHUA 2HSIA 3OKDB 4Y4FA 5D6CA 4KQ3L 5C0AA 3DV4B 4FG6C 2XV3A 4H1LG 1ORQA 4I88A 2KZKA 3EOBB 3GMNA 3LNHA 4WRLA 4E9YA 2Q3ZA 1D7DA 3GXDA 3P11L 4EN3A 5I19L 5E23A 1NCJA 3Q2VA 4NZTL 2C9QA 1GAFL 1Z9PA 2GT9A 4X7FC 4X7SH 2VNCA 4KO9A 3QE5A 4L1HA 3CFMA 4HS3A 2EDHA 3KWTA 5T3XH 3U2SB 4KX9A 1YJDC 2FZ3A 1HQRB 4JE0A 1PX4A 2E74C 3S97C 3ME0B 4UT9A 3W9EA 3SY0B 4JS7A 1NIBA 5IR1A 3QJUB 4RIRB 2GJ6A 1SYVA 1F90L 4HWZA 4U1NB 4G8EA 3KLSA 1JPEA 4Z3TA 4TNEA 1GCFA 4L4VB 1OTUD 4DOHE 4GQQA 2WLMA 4F33B 5SWSD 3MUZ1 4B9KC 3PJLA 3DXAA 1DUZA 5E6RB 3OPZH 5C0JB 4OGXL 3VVVA 1A4AA 2P26A 4OIFA 1TTCA 4HKJA 3RUGE 3IFOB 3MRLA 3PQYD 1JZ4A 4MJ5B 3TBCA 1M4KA 1QSEA 3S37X 2FSDA 3FN9A 4FFVD 4XB3A 3LQZA 3E1F1 1KN2L 4UTCA 5DDHB 2CHZA 4KROD 3VGAC 1L9SA 2G9HA 3FUEA 4KMTL 5FHBH 2O61B 2NY7L 3F7QA 5EOQH 5F9JB 2A74A 4NQEB 1YJDL 2EIJB 2B8OT 4NUMA 2F7PA 2HPTA 5JHDA 3AG1B 1JCKA 3DX9B 1ERNA 2BOLA 2NY1B 5FF6B 3WTVA 2ZWZA 4WGVB 3NVQA 4PJEE 1BLNA 1S9XB 3NJHA 4W9IC 4BDVA 5FB8B 1T2XA 3BRFA 3HPJB 5D2NE 3P9WB 1Q9KB 1RZ8B 4ZO6A 2ADGA 1DQQA 4ORGA 4XX5A 5AVXB 3THML 1TQCB 3DX2A 3ZL4L 4APXA 2X4NB 5K9JH 5IQ9A 4I3RH 2Y5QA 1R17A 2J4WH 1WBZB 2XXGA 1ZA3B 2F08A 3STLA 3BUYB 1KGIA 5T1KA 2JJVA 2AJSH 3AY4C 4BK4A 3H6JA 2EIDA 1V3JA 3QUXB 2FB4H 2CHWA 5F9WB 1YECH 2Y0SA 5B7MA 1C5DA 3T0ED 2APSA 4IJ3B 1YAIA 1KXTA 4NXSA 5BV7B 1EXHA 5F93C 2DQTL 1P2CA 4NO0B 5I17A 1DVFA 2WCGA 2B7DT 3UP6A 1KN4L 3ULUH 5MI0B 3LXBA 1GIGL 2VLRB 4WJ5B 1Z7JA 3G5WA 3RTQC 2DTMH 4U7SA 4HD9A 2EDDA 3C2AH 3VXQA 4X0NA 1T1XA 3T2NH 3ZOAA 3V6BR 2EIMB 5F7MC 3ZDZF 2C1PA 3AAZB 3QUYA 3S98A 4BFBD 5CFHA 4LOUD 4LSVL 5LVEA 2VXQL 4UM9A 5CP3H 4J2XA 5L6YH 4ZMYA 2EVHA 1DQDH 1CGSL 3OHXB 3GSNL 1QUNB 3DARA 3QQ4B 3BQUC 3NESA 5TD4A 4BH8A 3SGDI 3DX1A 3R0NA 1EHLH 5AZ2L 2VDNL 1BIIB 2AJYL 1SJEB 4FJ6A 4KJWC 1ZE3H 2BVQB 2EYTA 5K39A 3NSYA 3FAWA 4RAVA 1ZXKA 3ZU8A 1DQML 2HFEA 3NIGB 4KPHL 2QADB 3V6FB 2GJZA 3LZNA 5I1KL 4FMFA 3TWYA 5J6GB 5F89B 3TO4A 3KPSA 4PJHF 1KIQB 4TVUA 4K23L 1LILA 3D18A 3GB7A 3QHTC 4M5YL 1F13A 4AY0A 1IJ9A 5J9PA 3HA0A 3QCTL 4Z3EA 3EGXB 3OVUB 1VFAB 3QQ3A 1ZT7B 2VR8A 1HH9B 2UVFA 1A3QA 1HQ4A 3N50A 4PG9A 3VI4A 4AMXA 4U6YA 2P9RA 1LO3H 4G7VH 1IO4C 3DX6A 1NAMA 2HVBA 4P2RA 1R3HA 5ELIA 5TK4A 2ZWSA 1GY2A 2V2WB 1NCAH 4TV3A 1J1OH 1MJJB 2NNRA 5LG6A 4AJYV 5KVGL 1MW0A 5ABDE 2A6DB 3NGBC 3V5KB 1F4WH 4MLIA 4GIPD 3CFUA 4RZCA 5D2LB 2YEVB 5FKPB 4LRIC 4AEHH 4CMMB 5DHVH 2JV6A 4N2KA 4P5SA 3KDMB 3MO1A 4LVOC 4XXCC 5L8LB 1PLCA 3R7RA 2QLVB 3OV6A 5KSUB 2OR9H 5GS1A 1WTGT 2IBBA 2JKJA 3LHPL 1EA9C 1XCQB 3PWVA 1HKLH 1J5DA 4TVPH 4E41B 2VC2L 2ZXWB 4KKNA 5E6IA 1MFCH 3CC5B 1LO2H 1IARB 2H8PA 4Q6KA 4UU9A 5ANMA 2HLFD 4PJBB 5AW6B 4EI6B 3O45A 4NQCD 4X9FA 5DQ9B 1X3DA 2KMWA 5ICXB 2E47A 2LABA 4WNQB 4YDKL 2YMOA 3GUFA 4U31A 3GHEH 4BWWA 2F7OA 5JHBA 4FFWD 3OX8B 3QAQA 3V10A 5EBMA 2X4OA 4BUHA 2WZ6A 1WISA 3S96A 4GRLB 4ANWA 3F5WB 2XWJA 4U1MA 2NRDA 4BM7A 3SGJA 4O2CB 3WG7B 5GGUB 1FV1A 3CZLA 3SGKC 4PLKC 3ROOB 3HVNA 3U7YH 2HLAA 4H8VA 4HXBL 4MKMA 4PJXA 1F3JB 1JGIA 2KDYA 3HBQA 3Q8FA 3RX7A 4Z5RB 4JQXC 5KBPA 1NANH 4YXKL 2K9UA 1ML0A 2H9GB 1E9OB 3E8UL 4QNPE 3T71A 3PV6B 3FO0H 5CBEA 4JRYA 1MQKL 4BFJA 3PNWA 3SBWA 3L3KB 4LLAA 4OLWH 1H8OA 4TL4A 1P5VA 4JPVL 5AAMC 3BPCA 1IQWH 1E5ZA 4QHLB 3UBXG 3QHZH 2ICWB 4FQHA 1E67A 4B3EA 4JK0D 1OD7A 1IFHL 5FO7A 5IV2B 1M1XA 4KU1A 4U3SB 5FO9B 1J05B 4OF3A 2YKLL 4JANB 3DX4A 5A7BA 2Q76B 1KGWA 4WZ9A 2G5BB 1ET7A 4P8QA 1EFXB 1KCUH 3NEOA 1N3NA 2AXFA 4HWBL 5CILL 4GFTB 4YDIL 4HJSA 3UAJD 2MHAB 4M6MH 3ULSB 3NJVA 2HT4C 4NJ9L 4AQAB 1HH6B 5BRPA 2HN7A 5TK2A 3SOTA 2P28B 2X4RA 2LAGB 4LVNC 4MHHI 4XXDB 2GCYB 1DQLH 4OJEH 2ZUTA 1RUKH 2A9NL 1UWXK 4KKQA 1BDYA 4QRRB 3SYQA 2PETA 4K07A 1ZLSH 5CM1A 3S4SG 3ZE2B 5FX3A 1D7FA 1LEIB 2V5TA 3BSZL 3HNVL 4IRZA 3BIAX 1A4KB 1XCTB 3HC4L 1S9YB 3MGAA 3KLLA 3C6LC 3QG6A 1G9NH 4CJ0A 2DQ6A 2X9XA 3HNSH 1E5UI 5GHWL 4L29A 4JZNA 4UYPA 2PCPA 5C7ZA 1JNLH 4NNPH 2GAZA 3BWAA 3ULVC 4UYQA 5DQJB 4OF6A 3GLDA 5EDSA 3AREA 5EA0H 3E6FB 4UMGA 5DS1A 1F11A 3Q2NA 1P4LB 5ALBL 3TJEH 1NC4B 1CWVA 2FLBT 4F2MA 3NDZE 2IQAA 3U0WL 4X9GA 4FMVA 3IDNA 5J89A 3BAJA 3CBJB 5DD1L 1QUPA 2R9HD 2XN1A 1XGRA 2JK5A 4RMBA 3DBSA 4NQDB 4X6CB 3SDAB 2E56A 3A3YB 1RZKH 1QRNA 1MDAA 2AABH 2YBGA 4NQED 4JQIL 5E2TL 1RSFA 5FUOL 5K9OA 3BQUB 1N8ZB 3H1ZA 4UBDC 1DJSA 1BW8A 3X3GH 4OM0L 1RZJH 3WE6B 4PB0H 1MCWM 2A83A 2V6HA 2VLMD 3DPBA 4EPSA 1RIHL 1M1SA 1BREA 2R7EB 3HBGA 2VAAB 2GTWA 5GGTH 5JZ7C 3SDYH 1U33A 4LK4A 1MY7A 3RL1A 4P07A 1A9BA 5HHME 5HJBA 2Y6SD 1A6WL 5E6YA 3GLAA 2L8AA 5TDPA 5GGRY 4JW3A 5ISZE 3EBAA 3H9HA 4NNYB 1EBPA 4B0MB 3GSWB 3PDDA 3MUGB 4EDXA 2HJLB 4Z8FL 3JBG7 1OK8A 2BRQA 2GPZA 1NEZA 4RMQA 4BSJA 3S5LA 3QUXD 1P7HL 1PL3A 3QULB 3ML9A 3QNYA 1AGEB 1Q0XL 5TDOA 3KGSA 3IMTA 3HFFA 1G7IB 1JV5B 1CS6A 3SE8L 3NSFA 1AGFB 4HJJH 1WK0A 3LIUA 4HHGA 5IFHH 1T03H 1EZSA 3QR1A 4KI5C 1L6ZA 4R8WH 4GRWH 1TNNA 4Z7VA 1E8YA 1UASA 2OYMA 4JO4L 1UWEL 4YXLL 3AU0A 1OGTA 5INDB 1WIPA 1P4IL 3FQWA 4D0CA 3WV0A 4BCXA 1WCQA 4OZGB 5AUMA 2VDKL 3FFCB 3QJFB 4UIMB 1OAQL 1OQXA 4ETYA 3V6OA 4JPWH 2ZUXA 1HHHA 1Z66A 1JPSH 2VIRB 2YZ8A 3IJ7A 4M1GH 3OF6D 4N9GB 1S3RA 5ID0A 1FYTD 4POZC 3OB0K 2GKIA 1IKNA 1UD5A 5ESQB 3RGBA 4LSPL 1DEDA 3BN3B 2AK4E 2EDLA 5IF0B 3HJEA 4QO1A 1EVTC 4F20A 4YC2C 4F3FA 4NBZB 1GTNA 5I5MA 3MGOB 1PZAA 1NQBA 5TE7L 5TE4L 3G6JE 2BCKB 5D7JD 3R4DA 1TQSA 3WAJA 4QJ3B 3DV6B 2VSMB 1BHGA 3OSVA 4FZ8L 3QR0A 3O3DB 4TTDC 4YMPA 1TZGL 3IDUA 5CR8A 4PG2A 1MI5A 5HI3D 1DDTA 1J8RA 3H4FA 5EEWA 2FR4A 1I7RA 2Q3XA 4A2DA 4OR1A 1MIML 1BVNP 1EMTH 2H26B 4J7RA 4PRIA 1UEMA 4RAUA 1TVBB 3ELQA 3RGVA 4Z7OE 3B4NA 3TYFA 3BPNC 4ZMNA 4PRAB 4QAWA 2DWXA 2BVUA 3GSOB 2VXVH 1WTLA 2ZKYA 5T3XD 4KK8C 1IMHC 3MLRL 3BZ4A 5MENB 3M86A 2VLLA 4ELMF 5CEXA 2FJGB 5DF0A 5IBTH 1LK3H 4Y8AA 4AYFA 2QTEA 1TSHA 3QDGA 4M9OA 3QS2A 1FE8H 3VFTA 3L3OC 1XGPB 4ZX5A 4GQPH 1KTDA 4M1DL 2Z93A 2YQ3A 1CN4A 2C9PA 4FGMA 5CS7A 4LVNB 3JV5A 4CU8A 3GJEA 4OCYL 4KJQC 4PJDA 5FYJH 3IXAA 2WQAA 1GGTA 3RFRA 4KBPA 4RDQF 1DL7H 3LS5L 2H4EA 2ZXDA 4U6HA 4F92B 3JV4A 2DQDH 2OK0L 4HMDA 5BNXD 1TOXA 3OKMB 1OSZB 4ODVH 1WZMA 2DIAA 2E27H 2Z31B 3C6LB 3NPSB 2I9LA 3MLSH 3EYUL 1KTJA 3HZMA 3NZ8A 2CKBB 2X0WA 1LK2B 2XT1B 2GIMA 3EDKA 1N0LB 4YZFF 4JN1H 1LQBC 4KJPC 2FWOB 1I7ZA 5FA3B 2QZ5A 4X4XB 4ZQTA 2BZDA 1XSOA 3GLEA 1WFNA 1JWSB 2WXIA 1NGZB 1S7UB 3LKNA 1QTPA 4KC3B 3NJKA 4N6RB 2X2UA 4I3GA 3S5YA 3D9AL 3V9FA 1AYRA 3T0AA 4N0UE 1AD0B 1INEL 3Q8BA 3KPNB 1KLUB 2ED7A 2HFGH 1WPCA 4WO0A 5LNEA 2LE9A 4MMYB 1ZEAL 3AXLA 1A7NH 3L17A 3UBFA 3UAFA 3RZCB 4G1MA 4DGYL 1KC5L 3MRFB 3GO1H 1NBVL 3ZUNC 2NNAA 2NDGA 5SWZE 4N0YH 1E6OH 3IWUA 4XNMB 4WI4A 2HZHA 3OKLB 4FYSA 5IM7B 5IMOB 2CDGB 4WUUD 4OQTH 1EAOA 3CHOA 1KGXA 2NX5D 4ZPVA 2ZYIA 2EE9A 3HZVB 2HMIC 2BVPB 4MQTB 1W80A 5I0XA 2DZEA 3TT1H 3OMNB 4MB5A 5L4MA 1PIFA 2EDOA 1DLFH 3UTSD 3D06A 4A55A 5JR1L 4GAJH 4XBEL 5DJ0B 2LLGA 5AL0A 3FCTA 4GG6A 2IQ9H 2UUDK 1UKQA 4EJ1C 3QEHA 4PJGE 5AWNH 1DFBL 3VXSA 1I53A 3GMLB 3PY9A 1FZMB 2YAEA 5LCVL 3N43B 4HK3N 1UATA 3ZE0E 3O3AA 3CFBA 5F1IA 4PV9B 3L45A 1DVTA 1FVEA 1ZT4A 4K3HA 2HJKA 5L9DL 4Z7WF 5CFAA 1LDPH 4OZIE 4RMRA 4JVWA 4GRMA 3D4GA 4OV6F 2VXSH 3HS0C 3II2A 3BAYA 2OZNA 4PRPD 4ZSOB 1RHFA 3MJ9A 1PSKH 4GNKB 4WW1B 3QFJA 3KPQA 4FFZH 1YNKL 2NY4D 1XSJA 2ZF9A 4PJFA 5FGCE 3STZA 1FGNH 4Q6IA 2D03H 5CINL 3H42L 3GSQA 3HJ0A 4GAYA 3ZIYA 1VDGA 3N0PB 4XPFL 2OV0A 4MWFB 2A6KA 4HSAC 2CBMA 3GSUB 5H2BB 4B95C 4Z3FA 4Z76B 1YEEH 2JIXB 3O81A 3ARBC 1VPOL 4X83A 2CK0H 3WUZA 1N2RB 3LCYA 1IBDA 2VZ1A 1BSIA 2BMKB 1WS8A 3RWEA 2XVKA 4KQ4H 1BQLL 4Y4HB 2BJMH 5FEBA 2G0LA 3BT0A 1OCWL 2X4TA 3EH5B 3MLYH 4W1TA 4GT7A 2IO5A 4X5PA 5DFVC 4DEPC 1JPGA 4YC2B 4X99B 4CDHA 2G75A 5KVDH 2EKSB 3IVKB 4L3ED 4L8CB 3MA9L 5DYFA 1IM3A 4A6YL 4PJIE 1VLXA 2ZICA 3V4UL 3UPCA 2IAMA 4P59H 3N1PC 4NRYB 1NGYA 2O30A 1GTFA 5H4YA 1OT1A 2WINA 2I60L 4JZJA 5GJTH 2CLVB 5LGJB 4LL4A 2NW3A 3O9WA 1GOGA 2MPAL 2QR0B 2VDPB 3JTSB 3BUIA 4UAOB 1IGFH 1CFSB 1H15A 5EBWB 4WHTB 3D85A 1W0YT 1EXGA 2WQXA 1NCBL 4TVPD 4C83B 1G9MC 2WLIA 1XF2B 5M7QA 4JFDE 2FT6A 2B9AA 2CJUH 2BOBB 1T83C 1BZEA 4P04A 4XVSL 2J44A 1AI1L 3CDZA 3CN2A 2OMWB 3GJFH 1RUAH 3BPNB 1Q1JL 2H0FA 3HG1B 5SWSE 4BQ8A 4F8TA 1FZJB 1UB5B 4FTVB 2IH3A 1ZLWK 2FJFB 3VCLA 3W38A 4WFHE 4FQLL 4BGDA 1JZ5A 3HPLB 2WZPD 4WDIB 5ETUB 2H1PH 3K0YA 1HT6A 4P4KA 3VGFA 1PNCA 1IB5A 2V33A 1RFDH 5BQDA 5JQHC 2EUVA 1IC7L 5B1JC 4IIQA 3L9RA 1QSFD 4ZNEA 3NCJH 5AB1A 4WU5A 4PJ5B 12E8H 1IFRA 3P4MA 4PJ8D 4Q7DA 5FYLL 3BRDA 1UWXH 1AZRA 1KIUA 4M6NL 4NUGL 1FGVL 3ESPA 3IETB 2FLRT 3NZHH 4I1PA 4GSUA 3KYNB 4MD0B 5IBLD 1EGJH 5CKAA 2P42B 1EDQA 5FDWB 1CK0L 5I8KL 2LQRA 3DHJA 5DJZA 4AQEB 2OMVB 1F00I 3ZDWA 4NAJA 2XWXA 4J27A 2OX5A 4DUVA 2BNUB 4XP6H 4BXVA 4NO5A 5E0FA 5KANI 5GGQL 2WN3A 5IB1A 5ABAA 3RB7A 3VW3L 2BY1A 3BC9A 4XH2B 1OAXL 1CU4H 3LEVL 3RKDD 2P45B 2GI0A 3KPPB 4WEBH 5C7XH 4JB9H 5IKCA 4IRSA 3LD8C 1AZCA 2QPDB 4G6FD 4POUB 1RJYA 1NSNL 4J2QA 2YFNA 1FL5B 4M9PA 3RL2B 1UOKA 4JKPH 5ITBH 1T2QL 3HE7A 3ARFD 4MNGB 3BAXA 4DCQB 2F2HA 3RG1C 4AVHA 3TIDB 2FX9L 4OZ4B 4UOW0 1QYGL 1VJSA 1PU0A 2W0FA 1GZQA 4V1DB 4LEOA 4LLYB 4TXVB 2DWYA 3ZYJA 2YZ1A 2ZZUT 1BG1A 3S35H 1DBKH 1MWAL 4NSKB 3ALPA 1MHEB 3D4YA 3H9SB 3AM8A 5ACMA 4NO3B 2W9DH 4FX5A 5DUJA 1U8NB 5D2NA 4AYBA 1XH3A 3P3UA 4OGQC 4I18A 1JCVA 1ADQA 1KBPA 3WEAA 1AD9B 4MZIA 3EF7A 3PGFH 3SSGA 1K2DB 1AVAA 5HYFA 1ID5I 1UENA 2GY7B 5A40E 2ATAA 3OD3A 5HXMA 1BVKA 5JXEA 2IWFA 1ODAA 4QXWA 3INUH 4WI0B 2WQ8A 1VSCA 3FCSA 4YL4A 4GXVH 5DC9B 4XP1L 3U25A 3A47A 1TNMA 3D09A 2JTDA 5B3JE 4QD2E 3CIQA 5C0EB 2I25N 3O6MH 3UC0L 1W15A 3PL6B 1N64H 4IBQA 1A64A 5EO1B 4L4JA 1DBMH 2UZIL 4OGAD 3RFZB 4U1JB 4Z7UB 1QNZH 3SPIA 1CXHA 3TCLA 5EBLA 2NLJA 1OIOA 1JPST 5LDSA 1YNTA 2XWTA 1D7BA 3HG2A 4I77L 8FABA 2F5AL 3HS0B 2HUEA 4G9DA 4L8SC 4R0LA 5EU5A 2D7PA 2FK9A 2XTLA 3VWJA 2EXYC 3BP5A 2GK2A 3E3QC 3JYBA 4MJ6A 4ZXBA 1L6PA 1VCAA 5I8CA 3C75A 1E2VA 5HYJB 1UH2A 2PPFA 1WEJH 4OQ1A 3RZCD 4FQXC 4TRPH 1HL9A 1UUSA 1IIKA 2GVYA 3MBWB 4LLQA 4LQFL 3T4AC 3ZVVA 2QSVA 2CRMA 2NY0C 3GXTA 3QJZA 1PX3A 3WFDL 1YN6B 4ILDA 1AANA 4Q9RL 4LOVA 4Z77A 3WUWG 5HHXH 5JW4M 1U2CA 3V9EA 4NN5C 1H5BC 3WDHA 1WGVA 3IFPB 3AWFA 2ICWJ 3KPMA 2AEPL 5FLUA 4D0BA 5I1GH 3OB0H 5D6DC 4PY7B 3ARBB 1A8ZA 1GGIH 4GMTH 1MJ7L 2RFXA 3PFUA 5IHUH 3OG6B 3JT0A 2BVYA 1OLZA 4U1HA 1JGLH 3WNJA 4LLMA 5FV1L 4TQEL 4C4BA 3OJMB 3I74A 4GS7B 5CZVH 1IT9L 4YSCA 4ZUUA 4NQCE 1MREH 3MV9B 4PP1D 1FFRA 2HWZL 4H1LA 1IM9D 4L3CA 4WWKA 3FZUD 1T3FB 1NLDH 2OL3A 3P2BA 2DH3A 5EV7A 1B4JL 2E46A 3QQ9C 4J4PD 3D2UA 2VITA 3EJYC 4HISA 2FNBA 4HZLB 1S3KL 2LLLA 5AVQB 3LOWA 4UNTA 4Y7OC 2DYPD 5DGRA 2Q6WA 3VYOA 4FQCH 1LNUB 3O6FD 4L1TA 4A37A 3HNTH 4P46B 1TYRA 1CI5A 2QHRH 1A7QH 4JFSA 3KVQA 1A7PH 2ADIA 2WIIA 5EC1B 1DUYA 3VM7A 3SQOH 3PABA 3DVGA 4OCXL 2A73B 4XRCA 3TH2T 5JQ6L 3MGTB 3FXIC 2VWEE 3A67L 2HT3C 4QRQA 3WY3A 3US0A 1ZVNA 5F88A 1HNYA 4GW5B 3HCVA 3ZDYE 1EJOH 1UOLA 1AS7A 3CHQA 3DVFA 1PKQB 4RDBA 3VFGL 1AKJD 4JMXA 3MUY1 2IDQA 2ARJA 1A3RH 4GAGL 4Y4HD 2WXOA 2CHNA 3QRGL 3EJRA 4IMLB 1EANA 4AQ1C 2C34A 2WXKA 1UJTA 1T7YA 1NMAH 3GBML 4L1BA 2P3YA 3FW6A 2EEAA 2X3CA 4JG0L 5KSAD 3TA3D 3FBQA 4P5TD 2PKDA 3WFCL 3UZEA 1G43A 1P84J 1CGYA 5LBVA 2HVJA 3O2VH 3QDJB 4GSDL 1N59A 5AENA 1UWGH 2DLHA 4BE5A 3DRQB 3AWEA 1A2YA 1BFSA 1UFUA 2WYTA 1XMEB 3SB3A 1E28A 5LN8A 5I71B 3LD8B 3QYCA 3BZEA 2ZF8A 1F1GA 1IEAB 3P4OA 3RVVC 3PAZA 3D30A 1YC8A 3Q05A 4MXWH 2HKFH 5IQNA 1U0QA 4QTHB 5FYJD 4G8FA 4PCSA 3S35X 2V5YA 5F1OB 2CM6A 3BVNB 1G1YA 2X1XR 4JJOA 4ABQA 2PR9A 2V2XB 3M45A 4PJCE 5E9DE 5AYTA 2N0KA 4IS6B 2E3VA 4DN4L 2EC9T 3KNBA 5EU6D 4EIZC 3LIZA 1ZHKA 1CLOH 1G5GA 2NUPA 3GIVA 5A2BA 1AR1C 1AXSB 4AEEA 4CBPA 1YEIL 3MBED 1P7QB 2VLJB 5DMKA 2DMGA 1TCRB 3RWIB 4NFBA 1F3RB 3U4KA 3NRPA 4L2YA 3BEVA 2Z4QB 3VRIA 1NGXA 3MRKB 4G59C 4DP6X 1CTNA 2FDBP 4PREA 2XY2A 2OZ4H 2UUDH 3NQIA 4JO8A 2VLME 5DUPH 2XWDA 1MVUA 1BD2A 1T66C 1PY0A 3B2XA 3DX7A 4GXUM 1A6VH 5B21A 4IRJC 1EAQA 2YUVA 1WAEA 2F58L 1AZBA 4FG2A 3VFOA 5CGMA 1GSMA 2J3SA 3L7EB 4R6UA 4ERSL 5AOLA 4M48H 4YNYB 4QLWA 1R24A 1MN4A 3MACH 2MQGA 4TSAH 4BK5C 1AXTH 4W9ZA 3VWKA 3QEQD 4QXUL 5CSZA 4L8SB 3HE6A 3SPCA 3ZO0A 4GUQA 4X4YA 5DI8A 1FO0A 2N1TE 4K94H 5BS0D 4HEMA 3BPLC 3PU7A 2JH2A 2WIMA 2IANA 3T0VA 1LO5B 1FZKB 5L2KA 2E8ZA 5C0IA 1CR9L 3PP3K 4FQXB 2VXTH 3O2DA 3T4AB 1SJXA 2MNWA 2BNQE 1GH7A 2IADB 3CSPA 3WFEH 1TO4A 2JKWA 4PWKA 1HXYA 4JO1H 4DQOH 3HKZA 4NN5B 1H5BB 3FCBA 4WTZG 4EKXA 1DP0A 1EBAA 1L6XA 3QDMB 4CVWA 1HNGA 3TEUA 1KB5B 3NCEB 4J3TA 3HN5A 4KAQL 1B2WH 4L4TA 4UAHA 3MV7E 5TE6L 4O2FB 1Y7VA 4H25A 3M1CA 3DROB 1V7NL 2ROYA 4OIBA 4X5WA 4PJFF 5ISZA 4JFQA 3WXVH 2WXJA 4QYOA 2YLHA 3GXIA 4O58H 3DHPA 3B7RL 2E86A 3QUKA 3PHOA 3PL6D 4A2LA 1N18A 4LHQB 4N90D 2ZONA 3IMSA 2RB8A 1FJ1B 4MCZA 4W4OA 1G7PB 1I8MB 1CFVH 2EIZA 1GGBH 3FK3A 2EXWD 2DTSA 2ATPA 3ZHKA 2ZWKA 3ULAB 3UPAA 3IGFA 1S2EA 5KJ4A 4JM2A 2X42A 3FFDA 5DLLA 2V2TB 5HJGA 4M6OH 4QWWD 3ECBB 1BQHB 1ZLWH 3NBNA 1NMBH 3EYFB 5HDBE 2ZXEB 3PAYA 1BMGA 1SY6A 5JOEA 3K8MA 5HYJD 2XC8A 4OH2A 3T77B 4LAQL 4WEEA 1K8DB 1HXMB 4UZUA 4Y1TA 4OLXL 1Z5LA 3GHBH 1N67A 4OT1L 1QFPA 4I48A 3IAQA 1KYUA 1RH8A 4P5MA 2I9TB 4RFOL 2QVIA 2BZCA 1BM7A 3WFHB 3SBRA 2XWCA 1P1ZB 4UT6A 4PRHB 5T3XE 4F27A 2AK4A 3GFUA 3VD4A 5JPNA 5F9DC 2OJEA 4O5LL 5GZNC 4AQ1B 3LRHA 1N68A 3D4ZA 1NM4A 5HGGS 1J86A 3V4PH 5KG9A 2XICA 4PI0A 4QHNB 4N2FA 2R0ZH 3G6JA 4KGJA 2NNXA 5C07B 3UBXA 5IUCA 2K4AA 1G5AA 3P77B 3MX0B 4HUXA 4F58H 1QWNA 1JD9A 3BMWA 3VFPA 3EO0B 2VDLL 3PXHA 4P2QB 3NSDA 1WWWX 4J5VA 5GXBB 5DHEA 1VZGA 4P49A 4JFVA 4JHBA 3GSXB 3MRJA 2K70A 1CICD 3D87B 1ZDSA 3H54A 4ODTH 1PQZB 1RZIA 2ESVD 4YHOH 4AKQA 1O7DC 1WWCA 3FTGB 4FG0A 3GKWL 2ZOUA 1ZLUK 2W9EH 3F3HA 4CN6A 3W56A 1I1AC 4ONFH 2QTVA 2VLKB 1HI6A 3AMLA 3WJLA 1RIVH 4FJZA 1QBLL 4H8WL 2CPCA 1FN4B 4OBSA 3S4SA 3N3EA 3CZKA 5DCCA 4IBUA 1JZHA 4ZPTB 3M8OH 3RUGF 1P7BA 2GJPA 4H0LC 5K9QI 4EZJA 1C12B 2APVA 3O8XC 2D31A 2IOIA 4LLDA 1AR1B 4DGIL 2P80D 5E2UL 4HOWA 2FRGP 2R0WL 2BSSA 3Q1SL 4CW1B 1JNNH 2QPFA 2WLJA 1YEFH 1FAKT 4JQVC 4M7LH 1RMFH 2NY5H 1FFOB 1N70A 2N7AA 3ZO9A 4DGWC 3D5OF 3A4AA 2R2HB 3T9WA 5ADPH 1XGTB 5KOVC 4WUUE 2K8MA 4PJEF 4ZAKC 2OPCA 1AP2A 3BVWA 2NX5E 1JGVH 1ZLDA 3IF1A 4NP4H 1ITCA 2GJRA 2H32A 3QFDB 1I7TA 1QWUA 2W38A 1NGQH 3MRDB 3MXVL 3MR9B 1QW8A 4FF9A 4FTDA 2ENSA 3SZKC 1WBXA 5MERB 4HCRA 4KQ3H 3EO9L 3ULUE 2YUXA 5DS8A 5EZIL 3V7MA 2WBJD 5I19H 4N0UA 3X1GA 1NJ9B 4NZTH 4JFEB 4U1SA 2WOBA 3BPLB 4LSTL 3D39B 3BH8A 4QRTB 2K3HA 1S7WA 2EYSB 1WITA 1E4WL 1Q8MA 2VZUA 5SV3A 4OLVH 5FYKL 3B2VL 2IVFC 3MYJA 5F7WC 3LNIA 2NXZC 1D9KA 4FNPA 4PBWD 2BS8A 3FB5B 1JYXA 4J3SA 4OUUB 4KHTL 3QO1A 2F8VA 2GITB 2V0AA 5KYYA 2ZAHA 1KIRB 1HSBB 1ID2A 1JXJA 1V8HA 2DBJA 5CWSB 4JJ5B 3TH3T 3BKCL 4JO5A 3B34A 1GC1L 3C5JA 3QPQD 1SJHA 1F90H 1V7ML 2E6JA 3FU8A 2JI3A 3OLIA 3TV8A 5GS0C 4PY8I 5TDNA 1T0MA 1IBGL 3VMPA 3ZDZB 4WWNA 2GK0B 4DKFL 5LGHH 2BDNL 4OGXH 3WHXA 3WIHA 3CFQA 3P0YL 2JKRM 4PGCB 1XF3A 2O6EA 2WCSA 3F83A 4KDWA 4HDIA 1YEWA 3SPJA 2ED8A 2G5UA 4Z7NE 1FVCB 2X4PA 4PJ9B 3WJMA 3TL5A 2AHIA 43CAB 1YEHL 1MF2L 1R3LA 2DAVA 1C16B 3RVUC 1B3IA 1KN2H 4H26B 2SEBA 1TMQA 4TUUA 3EYVB 4KMTH 1W72B 3MROB 1HHIB 1E90A 4FI7A 2HFFA 3MV11 5GS3A 5FYJU 1YJDH 1U2YA 3C5SA 2WK2A 2VDLB 1FNAA 3PUCA 5DMIL 1GKOA 3WNLA 5DK0B 1E8ZA 5EU7E 4JDZA 5FUZL 2E7MA 2NYYC 3UYRL 3OMAB 3V4VL 3R18A 4TVPE 4OZHA 2W0LA 1WZKA 4HUUA 1KV3A 3O2WL 3ZL4H 3IM1A 3N85H 1J48A 4X4ZA 4AUUA 1S5HA 3NAAL 4HYTB 3MNMA 1NDMB 4JM4H 2BOCA 3JXAA 3IDIA 3TCXA 4LGSB 4R4BA 1AGBB 5EU4B 2EDMA 4J6RL 2E7DA 4NQQA 2OXHA 4ZRGA 3GM8A 4YEFA 5FM5O 1PY9A 4WHYH 4S0TD 4GW1B 1AIFA 1RHHA 1WJ3A 4F7EB 1T04B 1QSFE 4XB7A 3W2DL 1KPVB 1XR8B 3MLVL 3OGCB 4HFWA 5I1DB 4JO3L 4KKLC 1ET8A 3C6SB 1YEGL 1URIA 2DQTH 2G60L 3WJJA 4XVOA 3QJHA 4HCFA 5EN2A 1YUHA 2X4QA 4NRXB 1E65A 2Y23A 2Y7QA 4RSYA 4ZFZA 2D0HA 4AG4L 4KXCA 1MJUL 2G4EA 1Q4NX 2B59B 5AB2A 5FFLA 3HIZA 4FXKC 3K4DA 1E4KA 3IJEA 3FJTA 4JPSA 4LSVH 2VXQH 4FCAA 1ZHBB 2UY6A 1U8JA 1ZJBA 1SM3L 4HX1A 1A47A 3MV8D 1U8CA 5KS9F 3JWDL 4NWTL 5C6TL 1OP9A 4KUZH 4Y4FC 3PP4L 5BRZB 5DLML 1OB1B 5SWSA 1FFNB 1P53A 5AZ2H 1U4EA 2VDNH 1MNUL 2I07A 4ZTOL 2YAOA 2WLZA 4BRJA 4EN3C 1I1AB 5D4HA 1DQMH 2W0PA 4KPHH 4AX3A 4DO4A 3TWCL 3PQYA 2H6UA 4QTFA 1NEUA 3TBYB 4QNPF 2EC9U 5I82A 1JP5A 3MCG1 2HUHA 3OG4B 5I1KH 1UFGA 4RX4D 2FYVA 4G3YH 4K23H 5IHLB 4QOKB 2MTPA 2H6OA 3VSUA 5T1LD 3O8XB 4M5YH 1TFHA 1YEKL 2FHFA 3UTTD 4HLJA 2XKSA 4PRHD 1EX0A 2FWSA 2DRUA 4XNDA 4X7EC 1DBJL 3HB3C 2X4SA 4UTBL 3J27A 4IK6A 1G6RA 2YJLA 1DCLA 2KI6A 5HTSA 4N1EA 3LSOB 2ZPKH 2XTJD 2GC7C 4Q9QH 4X9YA 3CBRA 4GPVA 1NIFA 2DM4A 4HS8L 1J10A 5KVGH 3PWPD 3TTSA 1UJ3B 2A0LD 2W94A 1WFJA 4AEIL 3NIDE 3EFOB 4KRMB 4P2QD 5DXWA 3L9EA 1IRAY 1SHXA 2WXHA 3P02A 5DEGB 1OZTG 3CU7A 5CCKH 3DK0A 2GG1A 4FNQA 4A7UA 1Q1PA 3F2LA 4R2GC 1ZANL 1L9MA 1JZ8A 1I1YB 3LHPH 5KZCD 1MJ8H 4UM8B 5FCUL 4MZ2A 2VC2H 1OPOA 5D7LE 4G6KH 3MNZB 5GGSA 1JN6A 2W9LA 2X44D 4NM8L 3PP3H 2L3BA 4YEEA 3SDCB 2A74C 3T0EA 1UURA 2O5XL 4RNRA 5I6OA 3RA7L 4JDTL 4OGZA 2J8HA 2VSKB 4MTMA 4LAJH 1VB9A 1TU2A 4X6FA 2OTUB 1PX8A 4G8GA 1VZHA 3JYCA 1QHQA 1WE5A 3MNWB 4P3WA 3F6LA 4B7IA 4YDJB 5DUBB 3QUZB 4OFVA 1AC6A 4LXFA 4F7CA 3QZWB 1FLRL 4GBXD 1CI3M 4IU2A 1JHTB 3IU4L 3TC9A 1QA9B 2Q7YB 1OXYA 1AO7D 3U6XA 4KX8A 3UZVB 3FCGA 2R23A 3G6AB 2A38A 1RP9A 3B9KB 3RVTD 1VADA 1T22B 4PWGA 4YOKA 4HXBH 3JSSA 5EZLA 5F6HI 2R29L 2A77L 4CVXB 1XB6A 4KVCL 5IHZB 4QRUB 1MQKH 4JRXB 1DQJA 1N4XH 3TIEB 3C5ZB 5E6UB 3I3EA 1AHMA 1D6EA 3WL9B 4D7PA 4JFOB 4JPVH 4MX7B 5C0RL 1NC2D 2OSXA 3BPOB 1KZQA 1SF3A 3HW7A 4QXTB 3SKOB 1FLTX 3OM3B 3CUPA 1MRDL 1SXAA 3BUPA 3FU5A 2DDQL 4U6VH 2YKLH 1CPUA 4WWPA 1UQSB 1T7ZA 1MCPL 2WKOF 2ZP0T 3OKEA 1UZGA 2EDWA 4FMKA 3D25A 3QUYC 1A9EA 4NPJA 1MUJB 2LT9A 4GRWE 4XNQB 5JW5B 2JJTA 4UINL 1KPUA 2FIRT 5F71A 3UTPE 3K6SA 2J55A 2IMNA 3D0VA 5CILH 3AWGA 4ZQKA 2VR5A 2HH0H 1XGQB 2YAPA 1MFAL 3OQRA 3VXNA 4NC1C 4LKCB 1JRHI 3GMMA 4PQXA 2WLLA 4LCIL 2FIKB 5C8JB 1O9WA 2UXVA 2LW3A 4WAFA 4U0RB 1H8SA 3FSVA 3P73B 4PGBB 1AACA 3S9DB 1C5CL 1UYWL 4JM2F 4ODXB 3CSTA 3VTTA 2V9QA 3QXDA 4FRWA 1BYPA 4TQIA 3TO4C 1N5YL 3VD5A 5ESVB 3BSZH 5D7SL 3J2PA 3Q2CA 3WKPA 3ZSSA 1QPXA 2Y1AA 3TP4A 4G1EA 3HC4H 1K4DB 5JO5B 2BNRE 3ES6B 1Q9OB 1ZHLB 4WU7B 2WN2A 1VGEL 3HC2A 4OLEA 4X6EA 2HT2D 2OXGA 2QHLA 2PO6D 1VACA 4JFFD 5GHWH 1D5BA 5L0QC 5I5JA 2ENPA 1OP3H 2PR4L 1ZCRA 3LN5A 3TO2A 2I7SA 3RNQA 1CJYA 1A6TB 3T65B 3UO8B 4CKVX 4PJ9D 1OHQA 5ALBH 4O9HH 4JCMA 3U0WH 3II1A 1O5PA 2DS4A 4J1UA 4QRBA 1QLFB 3FSOA 1NUFA 1PJ9A 3APDA 5DD1H 5GSVA 4HOZA 8CGTA 5IEKB 1YDPA 3I9GL 3UFIA 2WTRA 2GTZA 2VO8A 1ZLUH 1H3VA 2QV4A 4QHUB 4JQIH 5CBAA 4HIQA 2YR3A 2EE2A 4Y4FB 4DWHA 1FNGB 3G6JF 5C0AB 5GPRA 1ORQB 4OM0H 5GS1C 3GMNB 4YAQB 3W81A 2H3NA 4M1CC 3CH8A 2ZYRA 1IEBA 4XBPB 1CD1A 4LFHD 5G4NA 1E7VA 1RIHH 3T08A 5E6IC 2Q0ZX 2R0KL 4MDRA 1CB4A 1KCKA 2BHZA 2DJUA 2GT9B 2NXYB 3SPVA 5C2BH 1CFNA 4EMZA 4E0RA 2CRYA 3JWOC 2PP7A 3TNMA 2YA2A 4HS3B 3TX4A 1SDDA 3OKDA 4MCYA 5E4EC 3QA3B 3ECWA 5KYUA 6PCYA 3ULVH 2IDUA 2VISA 4S1SL 2FZ3B 4Z7OF 4M7ZC 3BKMH 5J1SC 1U8IA 1U93A 1S7SA 5EZOH 5FYJE 3W9EB 1LVEA 5AW9B 5F0LB 4JM0A 5IR1B 1YPZE 3U36A 4RETB 2GJ6B 1JPFA 1SYVB 2F74A 3LZOA 4HWZB 4IMKA 1R33A 5EZPA 3SGJC 4JFHD 3UAJA 5EU6E 1J18A 3TH4T 1EEQA 5E2JA 1H6FA 1PS3A 3A4DA 3B5HA 2YEZA 2IEPA 3A4EA 4LHUD 2YKKA 4N5UA 4NCDA 4OKVA 4MAUL 5F7DA 5LQBL 2KZ1B 2X9WA 1CBJA 1DSWA 5EIQA 5CLYA 5E1HB 3TBTA 3DXAB 1DUZB 4ELMB 3QIBD 5CGYC 3L95B 2YPLE 3HG0A 4HKJB 1ANUA 4OGYL 3SBWC 3MRLB 2J88L 1NOAA 4JO4H 1UWEH 2BWDA 3D08A 5I24A 4R2GB 3FT1A 1MFUA 1QSEB 3LQZB 5LKNA 3VGDA 3RJQB 1WLHA 3NFNA 1CLYH 3QEGL 1CD0A 2G9HB 4D2NA 4ZMTA 5C09E 4Q89A 3HLAA 1OAQH 4HA1A 1GMEA 2YMTA 4X5QA 5EIVA 2D9CA 2D3LA 5C0JA 2A74B 1TLKA 5D70L 3U4BL 4J39A 3VTMA 4W9KC 2UXTA 5HYQB 5DVLA 5HVWA 1TSRA 2A6JA 4NHCL 2W59A 1SBSL 1ZMYA 5FW7A 1BLNB 4BDVB 3QEQE 3T3ME 1O7SA 4LSPH 4OJYA 3TJHC 3J7HA 2CDEA 3OZKA 3G5XA 3D69A 4LBAA 4BV1A 4DGUA 2ADGB 5DDHA 3VD9A 1DQQB 2GSIA 4JR9L 1XEDA 3ZKXB 4ORGB 5BS0E 4LESA 4APXB 1N0XH 4BGLA 1G7HA 1NM9A 5F9JA 5TE7H 1LLAA 5TE4H 4J3VA 4NQEA 3RVWC 5I6LA 1RK7A 3REVA 5T3ZD 4F9LA 3KLHC 3UAAA 1KYAA 1CYXA 1FG9C 3B8YA 4FZ8H 1CF1A 2EDRA 2XWBA 4YFDB 3KPLA 5T1KB 4BCZA 2QMKA 3A22A 5CD5C 5IG7A 3OAUL 5ADOH 1JSYA 1JFHA 1HEHC 4WI9A 3L7FB 1MIMH 5CCHE 5E8OA 1C5DB 4AGOA 3MTXA 2LU3A 5D7IA 1P2CB 3HRPA 1DVFB 3H7LA 2NY2C 3EBHA 4HUWA 3AREC 4HULB 4XBMA 1J8SA 2CUMA 1MKFA 5FOBA 3BUYA 4YSPA 3VXQB 3WUWA 3VXMB 1T1XB 3ZKMD 3MLRH 2C1PB 3QUYB 5CN3A 3MLUH 2ITCA 1QBML 1UZ8A 3QUXA 4UM9B 5DHMC 4PJGF 3TLRA 4N90E 3RNKB 3LNDA 2WXPA 3ESMA 4GIAA 4TLUA 3DLQR 5T5NF 2YGPA 1F2QA 3ZE0F 2PYEB 4XNXL 5C1MB 3JTBA 3CH1A 2ZG2A 2EYTB 3E6HA 5K39B 3IB4A 4RAVB 3H2PA 3QWOB 2QDWA 4OZIF 2HFEB 2F9BT 4P05A 1AHWB 1FYHB 4FG6D 3B37A 4W6WB 1FF5A 3AAZA 5DGQA 4AH2A 1OAJA 5HDQL 4FKHA 1V3MA 3B7UX 3LS5H 3SPHA 3KPSB 4P99A 3D3VE 4PD4J 3RQ3A 1FDLL 1THCA 5EH1A 2ADFH 3RRQA 3D18B 3GB7B 3FRUB 3QQ4A 4X80L 3PE9A 4FDWA 5D1QD 1AG6A 4MBRA 1KSRA 4GAAA 3AZUA 3EYUH 3MHZA 5KVDE 1F3DJ 4WFGD 4PM1A 4C4KT 1HQ4B 4PG9B 3VI4B 3OF6A 1EPFA 2D2OA 4LDCA 4U6YB 3T2LA 3QYMA 5H8DA 5EZJA 1FYTA 3DX6B 3BJLA 2ZX8A 1NAMB 4LF3A 1R3HB 3LHAA 2WGXA 3DBXA 1MSPA 5F89A 1BFVL 1P4UA 3AQDA 1GGYA 4GQRA 3CCHB 2DLFL 2AJVL 5GGSY 5I9QC 4RMSA 4XWOC 5C3LD 1J5IA 4GYBA 1HINH 1VFAA 3FYEB 1BBDL 1EXUA 1ZEAH 3R06A 2N0MA 4RZCB 5D7JA 5DEJA 4A2MA 4TQPA 4PJIF 1OLLA 4MNQD 5ACZA 5C9KA 4AW4A 1NBVH 3CSBA 5ICYA 5GS1B 3BAKA 3BVXA 4ZTPH 3WAKA 1MCHA 3O0RL 3PWVB 3ARPA 2WBXA 4ALAC 1YQVL 2ZJSL 5E6IB 1HCVA 3UROR 4XCNA 3EO1A 4UU9B 2H8PB 5ANMB 3V6OC 2ESVE 5IHWA 1XGYL 1NICA 5GQBA 1SFHA 1N8OE 3BISA 3O45B 3UDWC 1EHNA 3F8UB 2J5LB 3T1FB 1ZV5A 2E6QA 1A0QL 5JQIB 5E4EB 2BS71 5JR1H 2JLLA 5MP6L 3SYPA 3WGVB 1IKNC 4PGEA 1S7TA 4XBEH 5BXFB 2XA8L 2E0PA 3UZQA 2F53E 5EBMB 2O6PA 4HK0A 1AQKL 1D7CA 4S1RH 3CVBA 1DFBH 5FM5M 5EF2A 5DD5L 1MHHA 2XWJB 4U1MB 1SLXA 1LDSA 3JUZA 3WNOA 1FV1B 5ICXA 5C08D 2XVLA 3KWVA 5L9DH 2EDKA 2HLAB 1X5YA 2OMBA 4F8PA 1AQDA 4N68A 5E4OA 1G4RA 4PG2C 1WGOA 3Q3GA 1HCYA 4NX0A 5E9AA 3OX8A 1V5JA 4TUOA 2Q8BH 5CBEB 5JORA 4JRYB 3PNWB 2NZ1A 3ZDXB 1O5DT 1RVFL 4ALAL 3COOA 2YSTA 5FV2A 5DJCA 3HHRB 1P5VB 5DS2A 2QVTA 3BPCB 3D7PA 2W07A 4GINA 1YNKH 4O2CA 5GGUA 3RGVC 2HG5A 1XBRA 4FQHB 5CINH 3OQ3B 3H42H 4NDMA 1JHKL 3WDIA 3ZE1B 1BP3B 1XH1A 1RZ7L 4XPFH 5D1ZI 3S7GA 2OTWB 3U6XS 2EEBA 5GRVK 3UX9B 5J5EA 5E99L 5E51A 5DJ6A 3MRNA 2R2BA 5AVZB 1Y07A 2CLZA 1N3NB 2AXFB 3RTQD 1M3IA 3WHE1 3TZVC 3L3KA 1VPOH 2NXYD 5D4QA 3S3JA 1RJLA 2V5MA 1PBYA 3RX8A 1BQLH 3TJPA 5HI5C 4CC1A 2XIIA 2LAAA 2C7UA 3ZTNL 1IGJA 2VYRE 2HN7B 3FQXA 1JYWA 2HTLC 4JANA 3JWNC 3MA9H 4A6YH 1R47A 1NKGA 3V4UH 5DMGD 2XVGA 4FN0A 4B50A 4XMXA 4YFLI 4AE0A 5JPMC 4WI5A 4XO4A 1M7IA 4XCCL 4ZMVA 2I60H 3AG3B 4W9CC 5T1JA 3MLTA 1NIAA 4RSVA 2MHAA 4NZJA 1CFBA 1SXSA 4WUUA 3QG6B 2DEYX 2HRHA 2KKQA 3CFDA 2EO7A 1BVLA 1HH6A 2NX5A 5F3HA 3R19A 2UY7A 1NCBH 5B4MD 4APQB 4L29B 4PYHA 2X09A 4QXGL 4HOMA 2GCYA 2J1XA 2GAZB 3V4LA 1UKTA 1NGWB 5DD3L 2CIIA 3UTSA 2A5UA 3AREB 1IC4L 1Q1JH 1LEIA 1F11B 1OT4A 2BIIA 4DO6A 1A4KA 4N28A 3VFVB 4F2MB 4JBSA 1XCTA 2IQAB 3U9UA 4FQLH 1S9YA 4WTZA 5AD0A 5IMMA 4OCSL 4Y19E 3IDNB 5BZXA 3D05A 1YUKB 1G0XA 2JK5B 3LZLA 1IC7H 4OM1L 1J0HA 5KSBE 5CP3A 1QRNB 4G7QB 3ALXA 3SYAA 3QPXH 2UVEA 4PJ7E 3SGDH 3BWUC 4X0KA 3AS2A 3E6FA 5BOJA 5K59E 3DX0A 2A83B 4M6NH 1FGVH 4JPKL 5LWYL 3DPBB 4PRPA 1KJ2L 1KCWA 2ICCA 2GTWB 4BFEA 4KK6C 1CK0H 1J7VR 5I8KH 2MNUA 3GTVA 3DJZA 1ZT1B 3SDAA 2P8PA 1G9MH 3RL1B 1A9BB 2OJZL 3KM2A 3QO0A 4OFQA 4FG4A 4FEMA 5TDPB 5DJXA 3VXRD 4FFYH 1ZK5A 5INCA 1QVOA 3H9HB 3OC5A 5GGQH 2O6FA 2VUOA 3ZKND 3WENA 3RILA 4EDXB 3VW3H 1LWJA 2DD8H 3BD5A 3LEVH 2WQSA 4CVUA 1NEZB 5CJOL 5DSCA 3S5LB 3QXTA 4HS6A 5DZOA 5KW9L 5JW4R 3QNYB 2NUTB 2LTQC 1B3JA 2D7OA 1NSNH 5ESAA 3FU9A 4RGND 3E8VA 5TDOB 1J8HE 4KZEL 1T2QH 2APXA 3SDXE 3CIAA 4IBTA 4L3EA 5I9QB 4ZS6C 4PLKD 2FX9H 4NNYA 3F12B 5KOMC 4QRSA 4Z7VB 2B1HH 3ISWA 4K2UH 1OGTB 4D0CB 3GIZL 2FWUA 3DC0A 5AUMB 4QT5B 5FDYA 5HD8C 1XIWD 1YYLL 1O9ZA 1PDKA 3NCMA 4NC2B 2FUTA 2GI7A 3UBXI 4BSWA 2CK2A 1G7IA 1HL8A 4JG9A 4JHVA 2PYED 1V55B 2JCCE 3KGRA 3JZYA 2D7QA 3OPZL 3MV8E 4OW6A 3FL7A 3MZTA 2Z64C 5CEYB 2Y36L 2JCWA 4MXQC 1KYOK 4IU3A 3MVSA 1H8NA 4KNQA 4ODHL 5ID0B 1TETH 3DMMD 4XCFL 2QPEB 4JFWA 4U1IA 2MKLC 3A21A 2D3VA 2O5YL 4XP1H 1FA4A 4QO1B 2WZPA 1GL4B 1IAMA 2JB5H 4F3FB 4KXBA 1UACL 4XP4L 3MODH 1QSFA 1A7RL 2UZIH 3C12A 2IAMC 2H47C 2JQZA 4OFPA 3A6BL 5PCYA 3U4EA 2NQDA 3HTLX 2QKIC 4PJ8A 5HI4C 3QUMA 4BKSC 1SLUA 1UM4L 5HGHA 1U8PA 3V0FA 4JZJC 5L7XL 4QPEA 1GY1A 3BX7C 3UTTE 1TR7A 3ZDYF 2H2PC 3JVGC 3QNFA 4I77H 2F5AH 3EZ8A 5IB2A 4N5ED 2AFNA 4ELKA 1Z0MA 2YRPA 3M7OA 1J9TA 4LFHG 4PVLA 5IJBC 1NBCA 4NYLA 3VFWB 1I7RB 2FR4B 3NFPA 4WQOA 2ZOKB 3NMEA 1LE5A 2XTJE 1IGTA 2CJ3A 4I3RL 4PRIB 3RGVB 4RFEA 3TYFB 2J1ZA 2XWRA 4LQFH 4KGLA 3WFDH 1Z6JT 4OSUL 3WIFA 4Q9RH 2AJSL 2E8YA 1S5IL 1BCIA 4MMXA 3BZ4B 4TNVF 2MCMA 1IIIA 4FQJH 2AEPH 5CEXB 3QARA 2BO0A 4WVRA 2J1KA 4IIQC 1AOHA 1YLBB 1MJ7H 2XV0A 4FYQA 4AYFB 2H26A 3QDGB 3OJ2C 1YQ2A 1TVBA 1G1OA 3R4RA 3ARFA 1JRHL 3VFTB 4LHUG 3ULUL 3BIKA 2XSKA 2Z93B 4PJAE 1NBYA 4TQEH 4LCWE 3GJEB 3C2AL 1RV6X 4PJDB 3IXAB 3KPTA 1FHNA 2WMPB 4LPCA 4NQVA 2ZUWA 1SN0A 2MQCA 2NY6B 3I3BA 4PI2A 1DLHA 3B3BA 4U6HB 3W39A 3JV4B 3TV3L 1SEBA 4DKDC 2O5NA 2FT8A 5LAXA 4PJCF 2I9LB 1B4JH 4GI6A 5FFOA 1IL1A 3HZMB 3NZ8B 1AFVH 1AO7E 4JHAL 1A14L 4NB7A 3J8F7 1A21A 1TEYA 4LLVA 3GMRA 4IRSC 3CSGA 1TITA 3LKNB 2QDVA 1OM9A 3NABL 1OSZA 3HE7C 5C0DA 2YO3A 4OCXH 4H40A 1JYNA 5JQ6H 2CKBA 2XG5A 1T1YA 5I8EA 4WW2A 1VA9A 2CGZA 2CO7B 3A67H 1FORL 1N0LA 4MJHA 5BVPH 2FEEI 2NTFA 1CD8A 3KDPB 2FWOA 3N44B 4XCYB 1V05A 5DURB 3ARSA 3T09A 2AXJA 4XP5L 1BVZA 2FE0A 4B97A 3AM8C 1NCAL 4N6RA 5E2WL