2VXQA

Crystal structure of the major grass pollen allergen phl p 2 in complex with its specific ige-fab
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
92
structure length
92
Chain Sequence
b'KVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords POLLEN ALLERGEN PHL P 2
publication title High-Affinity Ige Recognition of a Conformational Epitope of the Major Respiratory Allergen Phl P 2 as Revealed by X-Ray Crystallography.
pubmed doi rcsb
source organism Phleum pratense
molecule tags Allergen
total genus 18
structure length 92
sequence length 92
ec nomenclature
pdb deposition date 2008-07-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01357 Pollen_allerg_1 Pollen allergen
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.760 Mainly Beta Sandwich Immunoglobulin-like Expansin, cellulose-binding-like domain 2vxqA00
3D30A 4L48A 1WHOA 1BMWA 4JS7A 4FG2A 4JJOA 2VXQA 4JCWA 2HCZX 3FT9A 3FT1A 1N10A 4FERA 2BH0A 4FG4A 4FFTA 2JNZA 1WHPA
chains in the Genus database with same CATH superfamily
4ODTH 1DEDA 1G7PA 3HNSL 5F70A 5E1GA 1UD4A 5JZ7D 3ELAT 5I19L 2GIYA 4PJEE 1Q9LB 4G42A 1U91B 1MW0A 3ULVF 4QXWA 4TYUA 1E4XL 4KJYA 4GKSA 1BPLB 1EFQA 4FRWA 4UILL 5BZWB 4D0BA 4OIIL 4P2RE 4PG9A 3APNA 2HVJB 5IB4B 2N1KA 3WJJC 5DC2A 4KFMA 3RAJH 2WBWB 4L5FL 3B2UC 3ORJA 3ARQA 3IDJB 3S3JA 1OY3B 2VXTH 1IGCH 1SN0A 3AUWB 3ML8A 2RIKA 1U3NA 3LQAL 4XPBH 4ZK8A 3W38A 1XF3A 2QL1A 1R4XA 3DSFL 3CSBA 5C7ZA 4DVBB 4YHOL 3VXNA 1WD9A 3CQQA 5BRZD 4DVRL 3GXTA 1HH6A 3MLYL 4DPRA 2AITA 3RRQA 1ZHLB 2IDFA 1NEZA 3QPXH 4XVJH 5DI8A 4QRFA 3HRZC 5IJCC 4PRPA 3TVMB 3QG6B 1QSEE 1FL3B 4WHDA 2NY6C 4QRBA 3BZDA 3W1ZA 3DC0A 4XO8A 3UTTA 1XGQA 2ZP0T 1JK8A 2APTA 4U1IA 3BVTA 3H42L 3UZVB 1NCDH 1FZKB 1Z9MA 1QVOA 2NMSA 5IWLA 2JJTC 2AEQL 1Q0EA 2PPAA 3APFA 1FUNA 1HH9B 2R8SH 4HIPA 1T1XB 3DTDA 6PAZA 3ULVE 4XO5A 4X5XB 3MRPA 1JV2A 1JI2A 4HGWB 3CFJB 4LQ1A 1Q4NX 2WIMA 3R4DA 5KYWB 1JDDA 3F6IA 1GR7A 1HHKB 1MCIA 5D70L 2PW2B 4KRNA 1OAXH 4KUZH 4OZGB 1RXLA 3IAQA 1KEML 4YSTA 4S1DD 1IBFA 2X4QA 1KACB 3GSWB 4WEEA 2PWEA 1VADA 3RP1A 4RDQG 2K7PA 5DJ2A 5CGYD 5JO5B 4FQXC 3S7GA 1DBBH 1HZHH 1WFTA 2GTZA 3VXUE 3T6VA 4Y4HB 4U1JA 1DDHB 3DETC 5L2KB 1BAWA 1HNGA 3RTQB 4NERA 3MR9B 3DRQB 3LPGA 3MACH 2R2HA 4Z95H 3SDXA 2AJXL 3J07A 4RMUA 4W9JC 5C0BB 4KPHH 2R59A 3QIBA 5EB9A 1U8QB 4YSPA 5BO1H 5M7QA 4KJWC 3FB6B 2B3RA 1E43A 2C4XA 1D5RA 2QSVA 2WAHA 3M17B 5HYFA 5ANHA 1MHEB 4UIKH 4D8OA 5C3IA 4Q14A 5F88A 3DJTA 2J4WL 2X9ZA 1TCMA 4KVNH 1KYUA 2YMTA 1GZQB 3L4YA 3IRZA 3I6KA 3BP4A 5HJDA 4DWHA 4MLSA 5INDA 2BSEA 5F7FA 2UX6A 3FHAA 3WUZA 4G6KH 4QDGA 2HH0L 4R0LC 3HE6D 1QNZL 2DMHA 4P23B 4AITA 4PVLA 3R7RA 4C56A 3QQDA 4WTZA 2GABA 2VXQL 4JPWL 4KI5D 3ZE1B 1G7HB 3GPSA 3ZX1A 1GA2A 1WTGT 3LN5B 1QPXA 2DMKA 4QHNB 5TE6L 3T2NL 1XAUA 4IBUA 1BG9A 3D3VE 4Z77A 4MQTB 1BEYL 4DGYL 1XIWA 4LLQB 3BVUA 1CL7H 5BVPH 3E2HB 4J5VA 1LO4L 5C09B 1U3JA 4RWYL 2P1YA 4IBYA 3VD1A 1CXKA 3REVB 2Z8RA 3VD7A 3ZY7A 3TF7C 3FU9A 4OH2A 4MJIE 3C5JB 4PJBF 3LZQA 4HJTA 1CFSB 1JTTA 4JFDB 4TVPL 3UAFA 1KLGB 4UV4L 4Y16D 4Y5XC 3C8DA 2VH5H 5CZVH 1ND0B 4HZLA 2ALAA 2R2EA 4HX1B 4HUKB 4KX9A 1PSKL 2GITA 3BRDA 4DKTA 5JQIB 1OSZA 4WV1A 5CWSB 4ZJ9A 4QRPD 1NGQH 4FL4C 3OBAA 4QR7A 5KYXA 2NCEA 3N40P 3Q8AA 5FDWA 2OYKA 1KB9K 5FYJE 4RDQF 4UBDD 3MNVA 2VITB 2VQUA 1NCAL 4NT6A 5LDSA 5CD3B 1G7JB 2ZNWA 4JY5H 1WS8A 1C5CL 4Z0BL 5IT2L 4A2FA 5IP4A 4CU7A 2VR9A 1A6TB 1SHSA 2D4FA 4QRQA 5KSAA 1L0YA 2IADA 3QHZH 5D4HA 3SGDI 2PPCA 2M8XA 2ADJB 4N86A 2IPKB 3UH8A 1I85C 5DA0B 3VRJB 1NKRA 4R4FH 3BPCA 2XQBH 7PCYA 1MG3C 1MFDL 2AK4E 4V2CB 4UQ2B 3FU0A 3EGDB 1TVBB 4FDWA 5FUOL 4JFOA 1MLBB 3PP3K 2Q76B 3W0WA 3U9PH 4LO9A 2BOBB 5KANI 4NCC1 4XZUA 3VRIA 3WV0A 5IK3B 1PL3A 4G6AC 1JDAA 4GIAA 2J5WA 3KBHE 4WFHE 4K94L 3G5XB 4H0IA 3B8YA 1CYXA 4OZIB 4KDVA 1K6QH 4XBPB 1ZT4A 1MOEA 1P84K 3GRBA 2IXQA 3LNFA 2CLRA 3NSJA 4HUXA 1NCIA 1A1NB 1KELH 4PWJA 4UYPA 3IDIA 5CCJA 5EIIB 1MCQA 1S7UB 4P2RD 3TFKD 2H32H 3BZFB 3P3SA 4AY0A 4AM0B 5AL8A 3BLBA 1FSKC 4ODSH 3PWUA 4JO2H 5DRWB 3CHXA 3DX8A 2VR5A 2ICWA 4ANKA 1AZCA 4YSQA 3LDBB 5EEYA 1PGRB 2CDEA 3SODB 1DQDL 4YSRA 4WO4C 2GK0B 4HCGA 1GC1C 1S7XA 1NQBA 3D34A 4OKVA 2XNAA 3BKML 2IGLA 5DK0A 2XQYG 1ZVHA 4NDMA 2D0FA 4HVBA 2BZ7A 1OVZA 4MKTA 4A7TA 5IOKA 3HRPA 3HFML 4Z3FA 4P4KA 1H5BA 4LRNH 2R1WA 2CIKA 2F8IA 4KHXH 1FZJB 2QR0A 9CGTA 4NQTA 1WIUA 3PFQA 2CUHA 2X4TB 1RZGB 3KCWA 3O8XA 1C9SA 3B3IB 1JHTA 1CI3M 3KPRA 5MENA 5KYNA 4X4ZA 3C6LD 4Q6YA 3ULVD 3NH7L 3NPSB 2YPKA 5E6UB 4AEIH 4W9HC 1MWAH 2HX8A 1G9EA 3Q2LA 3QXVA 1FLTX 1A0QH 4C4KT 5FK9B 5GRVK 3JWOH 2ZX8A 3VTAA 2HXAA 2CBPA 5ILTL 1AZVA 5LQBH 1O0VA 1U3HC 5EF1A 3FTSA 3MJ8A 4R97C 1SZNA 5TGBA 4M8UA 2E8YA 5D1ZB 2A9NH 4MMXA 1UASA 3DVGB 4PP2A 3BT2L 5DS1A 3ZN6A 5JHLH 5MEOA 4MJ2A 4JFQA 5MEQB 3K6OA 4JAMB 1NBZB 5LB1A 4G5ZL 1KEGH 1A9BA 2C9VA 2UWEA 4BQCA 4PGCB 3VXUD 4L4VB 4WDIA 4UTAL 1QQDB 5IM7A 4FXLA 1LQBC 2BZCA 4HPOL 5C0CE 1KCRH 1UT9A 1H6EA 2OXHA 3GSRA 5C86A 1ICTA 4F7MA 2KKQA 1K4CA 4NZ8A 3EYQC 3ZE0B 2TSAA 2VMCA 1DVYA 1F11A 5H35B 3BQUB 2YHGA 2CM5A 2QQLH 2HCZX 2WKOA 1M05A 4F37K 4H1LA 5GGSA 3V52H 1BQSA 3U46B 3GJFA 1IRAY 4WTQA 4Q74A 2AK1L 5HXMA 3AT8A 4WUUB 3N42F 2KQMA 3PCYA 5ALBL 3O3DA 1YMMB 2NY4B 2VKXA 1AR1B 4MZ3A 3P30H 2FEJA 5IVXF 2P45B 4LFHG 3VM7A 2HLFD 4YUEL 1KY7A 1A2YB 3GMQB 1XB8A 2ZXWB 2VL5B 3UTOA 2XG5A 2ZG1A 3O45A 3SQBB 5CJ5A 3GSQA 5CGMA 3SYOA 1RZJC 3GIZH 1NJ9B 3D3VD 1XH1A 2ZSVA 2R2BB 4MAUL 4M7KH 5AYTA 4ZPTB 5E2WH 3EHBD 4GY4A 2HWZL 1HQRB 1S7VA 4LCIL 5DJXA 1KBPA 2AS5M 1EO8L 3FCTB 1DL7L 4FN0A 1HCVA 4WHYH 4XO3A 3OKOB 1S78D 4I5BA 3HLAA 2DWDA 1TLKA 2H6OA 4AZ8A 3RVXC 2AXWA 2KH2B 1NBQA 4GP8B 4TUOA 5I9QB 2TRHA 2W0FA 4QNPF 1GYUA 4NBZB 2AJSH 4XCFH 4K7PL 1E27A 4R90L 5HGBA 1U8MA 2PF6A 4AH2A 2ICEA 2WINA 1SYSA 3GZOA 3NABH 4OQ1A 5INCA 5HY9B 3CH8A 1LP9F 3D0AA 1D5XB 4MRCA 1EJOH 5IKCA 3IDMA 3S36X 1MHCB 5I6XC 1ADQL 3DVIA 4C8XA 3FFDB 1IEAA 3FQUA 1T04B 2UUDK 2HX9A 3OXRB 5MP6L 1II4E 3KM2A 4Y0GA 4APQA 1ZWIA 1H8LA 4IRJA 4PCSA 2E6PA 2ZXQA 3QUZD 4MCYB 3N06B 3TT1L 2X0VA 1BQLL 1TVHA 2APBA 4Z0XB 5ID1A 2IWEA 1DFBH 1QLEB 2AK4D 2RBLA 2WXLA 3J27A 2UY7B 5EV7A 1QBLH 4Q6KA 1EJ6A 1E4KC 3L4ZA 1N59B 3MRQA 4P59L 1KB5B 2FJFA 3P73A 2IFFH 2D3NA 3IETA 3RVWC 1FGNH 4QNPE 1F2XK 4MD4B 7TAAA 3QDJA 5KVDL 5I8OL 3UAJA 1I7TB 2GEEA 4A6YH 4AQ1B 4LOEA 5AVZB 2XBZA 2BNUB 2VSDA 4QYAA 1PLGL 4XNXH 2VR4A 5ISZE 2FJGB 1LP9E 2DF3A 1MI5E 3V0VB 3QDGA 1JYVA 2CJTA 4F20A 4PJ7B 1WHPA 3N85H 4PWFA 5HHXH 1FHNA 2ED8A 3TEUA 4QHUB 4BFFA 3MBEA 3TA3B 4IRZH 1RIUH 3HHRB 2WLNA 3THML 1NGYA 1CGXA 4JR9H 5D1QB 5JHDE 4ZNEE 3WG7B 3N43F 2I5YH 1AQDA 1D6VL 4XOBA 4G9FA 1P5UA 2X6CA 4V1DA 1Y6KR 4EI5D 4KITB 4UM8B 3INOA 3HB3B 5F0PB 1A7OH 5BPPA 2Y3AA 3ARXA 3A4AA 4URTB 4AYDC 1DVFA 4EMZA 3VGBA 3QI9C 4G7RB 2MSPA 5B39G 4JZJB 3V4VL 2GJZA 5ECGA 1AHWA 3HE7B 3RKDC 4TSCL 4ZFOL 3O3EA 2GHWB 1KJ2H 5IFJA 3DA0A 2D3VA 2YBGA 1MLCB 2Y2WA 4M8QA 3P77A 2J1WA 1NPJA 4OAWB 2AXHA 2KDGA 2WO2B 3O9WA 4HUVB 4OSUH 1ZXKA 1AFVH 3M86A 1SVBA 1S5HA 4YXKH 1FYTA 4BFKA 3HKZA 3MLRL 1OD7A 1KLUB 3NSCA 2ZP9A 5F7NC 2VDQL 1R1CA 1V05A 1QBMH 1A21A 1QX1A 2B8OT 5ESVB 3T77B 2OQJA 3ETBF 1S5IH 3LS5H 3GM8A 1RK7A 3H9SB 1QASA 1J48A 2YA0A 4ZAKB 2Z1KA 1N6VA 4JO5A 3VVVA 4LF3B 2C9XA 1JPFA 3CSYA 4PLNC 1CICB 3VWKA 3S3SA 4UQCA 5IBTL 1A1OB 1S7RA 2QDVA 4HV8A 3NG5A 3UJIH 1KTLB 1UD3A 2BWIA 2DMGA 4Y2OB 1G5GA 5HP5A 1ZHKA 4X6DB 3UP6A 1AI1L 1VSCA 1AXTH 3MN8A 5E94A 2EO7A 5C08B 2Q3XA 2OTWA 4PJAE 1AQ8A 3EOBA 2NY1D 2FWOB 3VH8G 4HUUA 5C0CD 1EVTC 2JNZA 4RFEB 4MGXA 2ZUXA 1FZMA 1BXAA 2A1WH 2WV3A 1U3ZA 2YBRA 2BDNL 4Z7UF 1AR2A 5KJ4A 5EU4A 1WZAA 3K1KC 2YPLB 3L4UA 3PRZA 4ZS6C 3TNMB 4GG8B 1YEJH 1V7MH 4PJGB 4TN9A 4V2BA 2W91A 3K2UH 3L17A 4NO2A 3SN6N 4FQIL 3ULVH 4OFDA 2WN2A 2XFGB 4XP4H 1C8PA 4H0LC 1D6EA 5IESL 4RFNC 2ARJQ 2FSEB 2JXMB 4M5ZH 4PJXE 3B7YA 1KG0A 3IKCB 2B7DT 1Q9WA 3CZUB 4LSQL 4L1BA 5G55A 4KZEL 5T1LA 2YA2A 2EE2A 1FE8H 3I9AA 5JNYB 5AW6B 3T08A 4E9SA 1SBBA 3CQFA 3MOAH 3REWA 5C6WH 3BIAX 4FX5A 3BVWA 1LWJA 3ARGB 3J8F7 1ACYL 3P4MB 3MLVH 4M7ZB 4Q9RL 1CUOA 1OAZL 2IGFL 4NHUA 4LEOA 3O6LH 4HEME 5C1MB 4YFLI 2P26A 3MCLL 4KGLA 4XXDB 2V5YA 4GO9A 4L3FA 5DJZB 2F19H 4NO3A 3F01A 2P5EB 1GHFL 4Z7UE 2W07B 1CQYA 3TPKA 2FL5B 4MFHA 4NJAL 4P5TC 3JTTB 2AQQA 3AG4B 4IDJH 4OD1H 4ZNCD 5I76B 5DEZA 1YQVL 4HHAA 5DD0L 1Q94B 1HE7A 1DQQB 4FLRA 3AXHA 5C0AE 3L5JA 1MY7A 1QTYT 5EZIL 1ONQB 3UTZA 1AQMA 2PCFA 3QUMB 3TCTA 4YSDA 2C3XA 3SCMD 3VB8A 1AP2B 4LASL 1KNOB 1MNUH 3F62A 1NCJA 4TUJB 4YFDB 4RRPM 5BXFA 4UTCA 2FX8L 5CBAA 4OJEH 4NZUH 3MZTA 1OAYH 4UIMA 2VW4A 4HXBH 3G6JA 4HZAA 4AXWB 4C83B 2UZIH 3RX9A 4K07A 3FQTB 3WEOA 1WWAX 3JWDL 4KNTA 3EOTH 4WO0A 3WTUA 4YXLH 1S9XA 3LH8A 3MRJB 4QWWC 2A9CA 3TZVC 1E6JH 1XR9A 4HIQA 4NP4H 2EC8A 3UEZA 1HSBA 2CRIA 3KYOA 2XPGB 4HC1H 2BPBA 3ETBJ 2WBJA 1E5UI 4IIZA 4YBLC 3QS3A 1JWMB 1RJLA 5E08L 1CFVL 4MA3B 3UTPE 5IB2A 2JJSC 3C87A 3DXAD 4Z3EA 3IU3B 4KAQH 3PL6B 4E9LA 2ATKB 5JXEA 2FRGP 2VCOA 3DHUA 3QO1A 1NIEA 2A9ML 4FQCL 1QD0A 4GAAA 2F54A 3X1BA 1DSFL 3OF6A 1EO7A 5EBMA 3GBLA 1NM9A 2HRPH 3MRRA 5ISZD 4DTGH 3MLZH 2VXSL 2MOGA 3WHXA 3BUTA 1MI5D 3GBEA 5FYJH 1KPUA 1QFOA 1O6SA 4TQIA 3FCBA 1H3VA 5HHME 4XBEL 1UWGH 4L1HA 5GRXG 4UOZA 4KU1A 4DGIL 3AREB 2BX5A 1F4XL 1LO2L 1M2VA 3EYOA 3FO9A 4GBXA 5I8KL 2WP3T 3DVNA 5JQ6L 3GSNA 3TH3T 1JUFB 1P2CB 1Q90A 1Q1JL 2Z7WA 4ZMLA 1YMHA 3VGGA 5D8JL 1R3IL 5CO1A 3ZBMA 2K4AA 1SF3A 3VSVA 3B2UD 2I9LB 5GQBA 3S3BB 2COQA 4ZUSA 3KE0A 2RQEA 3OLIA 5EWIH 3OSVA 5E8OA 1J9QA 1U6AL 5ADPL 5CJXA 2H3NB 3QARA 1HINL 5C9JB 1OHQA 4KKNA 2VIRA 2VLJB 2PTUA 2VLME 4ENEC 1LQSR 4HFUH 2NUPA 2I9TA 4MAYC 4FG4A 3AROA 3T1WA 3OQ3B 5IROA 1L9NA 2PYEB 4IBZA 3PHOA 1QOKA 2NY6D 3TT3H 5EF3A 4U1NA 1J9SA 4LFHD 3F04A 4XNMB 5I1DA 1ILUA 4FQQB 1JDCA 1KFAL 2C7UA 2FE0A 4GSDL 4EN2A 4NUMA 5LNEA 2Z8SA 3PWLB 3N9GH 1UZGA 4HPYH 3FCUB 1W91A 3FKUS 1OT4A 1QI4A 4YHNA 4PBVC 3BZEA 1RAMA 3GTNA 4LLAA 1RK0B 5ID0A 4QO1B 4F91B 3M7OA 1BFVL 4AV4A 1O6TA 4FHBD 1IARB 4QPEA 1MCDA 4JO3L 4ZXBB 3D0LA 3RZCC 3O11A 2XY2A 4JQXC 3SGKC 1I7RB 4WK4B 2YQBA 1QEXA 3W9DB 2XDHA 2BCKA 3VD0A 2J20A 3O6KH 1RULL 1CXHA 3NCBB 2ZWSA 5JA9A 4QI3A 3G5ZB 4TM9A 4GXVL 5DRXA 2VC2H 3HAEA 2BP5M 2Y5QA 3AWFA 4M48L 4M93B 1WTLA 3WXWL 4PRPE 3QDHA 4N6RA 1NIFA 1WCQA 5GS1A 1L5GA 2BVQB 5DYOB 2A83A 3FN9A 1SYVA 1S9WA 4M1GL 3SDXF 2CJUH 1TQBC 4UUJA 3PREA 3DETD 3UO8B 5CMAA 3BOVA 2NNAA 3H9HA 2NLJA 4M00A 1NFIA 1IAIH 2P80A 3WKMH 5HDBF 5FV1L 1OF2B 5D6CB 2Z6FA 3MCKA 3O41A 1V7NH 3GT6A 2PO6B 1OCOB 2VDMH 4PU2A 3QHFL 4X6EB 3X1EA 2N59A 3KDMB 2GSGA 2Z3FA 4Y7OC 5D93B 1W8EA 3QIWD 3NPZB 5FW6A 4AZUA 3IDNA 2A4ZA 2V8MA 4NUQA 5IR1A 3N44F 4FQ2H 4ZX6A 1AH1A 5DK2A 2NUTA 3O4LA 2K3TA 1EAJA 4GW1A 4Y5VB 4F7TA 4D0DA 1I8IB 2WXRA 1JVKA 4MJ4A 1IBDA 3KEHA 4IOFC 5E56A 3EH2A 3GD1C 1OB1B 3BEVB 5DUMH 1RI8A 3TN0B 1KGCE 5E9NA 3BGMB 3KWTA 5TPWH 1NINA 2V7NA 1PDKB 2FX7L 1L7IH 1BCIA 3F5WB 5ALCH 3VXOB 3SKMA 5EU3A 4DO4A 3SDXE 4K94C 1MIEL 3HVDA 1IFRA 4XNQB 2VZ3A 1UJ3B 5TDNA 3T4AC 2V2XB 2X9WA 3H2QA 4FEMA 4RZKA 2G0KA 1B9KA 3ARSA 1RZ7L 3JV6B 5F0MB 3WFDH 4D7PA 4IMKA 1UXWA 4KZDL 3EGSB 2CKBB 4BSWB 5KBKA 3QZNA 3SDCD 4AJWA 3VX0A 2ZOTA 1CTMA 2Z7YA 5C0AD 3RJDA 3OPZH 3X1NA 4BQBA 1IM9A 3OPUA 4XB8A 3RBGA 5M95B 1BAFL 1TYRA 1MCJA 5ADOH 3HUJA 1HQ4B 1F6AB 4C56E 2EYSA 3FO1B 3TBBA 5T5NG 4B27A 5I0DA 2V9RA 1YEIH 1SDDA 2GG1A 3ROLB 1WYJA 2DBJA 4OCRH 4R3SA 3NA4A 4JQVA 4P46B 2H0EA 2IEPA 4NRZB 4JB9H 3KLHD 1WUZA 4IBVA 5A3IC 4IHBA 2EKSB 1G0YR 4NN6C 4RGNC 2VXVH 2A6DB 3ULUL 3MRFA 3G6DH 4FXKB 5IZ7A 2EUXA 5C6TH 3WUWG 3ZU8A 5IMKB 5GS0D 1OAUL 4H44C 2A6IB 2DQTH 2MCMA 2DL9A 2ZKXA 3KJ6L 2FBRA 3KJ4C 3ARVA 5I2IA 2E9BA 3RY6A 3QEHA 3WO4B 3L5HA 5F1NA 1MQKH 1H3PH 2NCMA 1U8IB 1RUAH 2IIJA 1RUQH 3GF8A 3T8MA 2WLJA 3CV5A 1BD2A 5LGYA 4CW1B 2XWBA 4ZT1A 5FB8B 2MOVA 4YDVB 3QJHB 1UM5L 3HMXL 3QPKA 5CJ8A 1EAPB 1MCWM 2B15A 4AWJC 1VFBA 3WNKA 1FO0B 4Y2DA 1FNEB 1BSIA 1ACZA 4OJCA 2BS9A 2VL4A 4A2HA 4OF3A 4B6ZA 4F33B 4FG2A 2DQMA 3KWWB 5FF6B 4B0MM 4FHKA 4AQAB 1NL0L 1WUNT 5I15L 4PCKA 1FNLA 3ARBC 3KL0A 1IBGH 4R8WL 1BBDH 1T1WB 1ZE3C 4Q56A 1FJ1A 2J21A 5LGHH 2L7UA 4J6IA 4QRUA 5HHMD 1JFQL 4H1LG 2RFXA 3GSVB 3RIAF 1X5GA 4G5AA 3FN0H 3WFEL 1KCBA 2G5BB 4NQDB 3DPBB 5T5FA 3MZGB 4A7SA 2FK9A 1UC6A 3LKPA 1SJEA 4JRLA 1NCCL 1R33A 5HJ3A 4ODVH 1D5IH 1KLFA 3MRMA 3WNMA 4D0CA 4NYLB 3S35L 3AB0B 3CN2A 1NMCB 4L8BA 2CDFA 2C8NA 5DUBA 3U0PB 5KZCD 5B7EA 4XP9H 3W0WE 1GGTA 2Y22A 4N1EA 2E27H 2VLMD 1IGML 4FKHA 2P8LB 4JN2B 1K8DB 1KJ3L 1W15A 3VGAC 2CHDA 4BSVB 4HWBL 1UD2A 3UYOD 5L4JA 1OQOA 2OX5A 1OKEA 1INDH 2XKNA 4HEPA 1NFDB 4M3JA 4OV6F 5CLXA 1JNNL 5J4MA 4PRAB 1JP5A 2FZ3A 4WSKA 4F93B 2B0SH 1FVEA 5KVGH 5HHPA 4BZ1H 3O0LA 1CLZH 5IHWA 4IKNA 5J9PB 2QZ5A 1SLWA 3VSTA 2MNJB 1JCVA 1RK1B 3WJJA 1UWXK 3FU7A 4LLUA 4HIXL 1KN2H 5IQ7H 3KLDA 4M43H 4B53A 1IJNA 3T6XA 1OLZA 3D39D 3HFFA 4BZ2A 3F2LA 4I3RL 1YYLH 4Q89A 2CGYA 2KZBA 3T71A 5B21A 2J56A 2Y7OA 5HHOE 1TKWB 2PPDA 1EBAA 4N2EA 1HZKA 2NYYC 4I89A 2L7QA 5E1HB 3VXTA 3HLKA 2UWEF 2ZOLB 1G9NL 1FG2A 2G9HB 3LN4A 3LRGA 2IQ9L 4TULH 1ZOXA 1X7QA 3O4OC 2OMZA 1JRHH 1E65A 3ME0B 2XV3A 3QEUA 3I02B 4WW2C 3L3DB 12E8L 3WAJA 3DOHA 2H6PA 1VRSA 3QDAA 2BHFA 4OLZH 5AWNL 5CFAA 2VISB 5ESAA 2GJPA 3L13A 2QSTA 2WKOF 4OD2A 4XXCA 1MRFL 1A6UH 4QHKI 4OGYH 4Y4KC 5MENE 3WLBA 1XZWA 4L3EE 3FZUD 1NUDA 3QPQC 2LLNA 5KJ7E 2UZPA 3OGCA 4X9YA 4KY1H 2PP9A 4XAWL 1G6RH 1KIPA 1P4BL 3BCDA 2J1ZA 4OZHA 5FA3A 2YC1A 4JKPL 5AVSB 1Y6MR 4GRLC 3BQVA 1UZ8B 5A7BA 4UMSA 1T83C 1HHGB 2UYLA 4P3WA 1TCRA 2Y25A 5EORL 2GT9B 3N91A 4OGAC 2HVBA 4LCWA 5CP7A 5SWSB 1MHHA 5CZKA 4TNFA 4N5ED 5K9KB 1KGCD 1HXMA 3FT4A 1UKTA 2F7OA 2XQYK 2ZX7A 2VERN 1M71B 2YK1L 5I1JL 4ZO7A 3FPXA 2ITDA 4CC1A 3BDYH 1I3RA 2AQPA 1OHZA 4FZ8L 1FQ9C 4PSRA 3T1FA 2CRYA 3UC0L 3QJTB 3QIBD 4HQQL 4HA1A 5IBLD 5GGUB 2VR7A 5HHQA 1NSNL 2Z92B 3FONB 4DOHE 2I60H 3NJHA 1BJ8A 2LE9A 2OMXB 4HETA 5CLYA 3TBYA 4DZBA 4PRBA 4J23A 4U1MB 2ICWJ 1JE6A 2H26A 4Z5RA 3S36H 3NFSH 1E3ZA 4UQIM 1AE6H 3T65A 5HI5C 1ZRUA 2FQEA 4UAOB 1J5OH 1LEIA 4NUJA 1WZ1H 1QLEL 3D2UA 4BH7B 1OOWA 2Q8BL 2ZWNA 3FSWA 3OX8A 4TPRH 4C56D 3CN4A 4CA4A 3P2DA 1OTTD 2X2JA 3IWUA 5I5MA 3HG2A 4ALAH 4ZSOB 2KC0A 4E9YA 2UZXA 2KMWA 2X2YA 5JPNB 4MZIA 1JN6B 1OZTG 4OZFG 5HGDA 1A7PL 4KV5F 1X3DA 3BWZA 4OY9A 2G3MA 3DLQR 2FYYB 3QJFB 5GZOC 2WC7A 3ECQA 1XGUA 3VXSB 4BGLA 2HJKB 4AVHA 5C6PB 5FECA 3KBPA 3VFRA 3L3KB 1X5YA 4XO9A 2AJZA 2ZPKH 4XP1H 2JJWA 2PTTA 1KENH 1WCBB 4OBSA 4DKEL 4LSPL 1BX2B 2F53B 3EOAA 4ODXA 5JW3H 4JFZL 4YHML 1HYSD 3FK3A 3NDYE 1N0LA 2D7NA 2HT4C 4KXZH 1J5CA 2H32B 2AANA 2O5XH 3B9DA 3PWVA 5EOTB 3BKCH 3RWGA 5LWYH 4MX7A 2P24B 1SJHA 1TU2A 2BCMA 3HCVA 3LIUA 4LMQI 1YG9A 4I48A 4AMXA 2LHAA 2IF7A 5KS9B 3QQ4B 4PB0H 1DR9A 4HCRL 3BPOB 4HIHA 1QSFD 2DQEH 2BVOB 1ERNA 5J3HD 1XSOA 3K2IA 2F5AL 4RRPA 4OF5A 1JSYA 5HDOA 3SE4A 1E9OB 2FWUA 4I1PA 4W9CC 4JPKL 5L0QB 2F58L 1CDJA 3B7RL 4XCNA 1JPST 3AVEA 4CADA 1KV3A 4BGDA 1M6UA 1TLMA 5GS0H 2IOOA 1CFQA 3LIZA 1T20B 2B5IB 3PUUA 3D52A 3MAWA 3TXAA 1VEPA 4PGBA 1URLA 1P4LA 1PD0A 2OSWA 3WD5L 3T4YA 4OI7A 1MWAB 1A3LL 1BIIB 1MW2A 3RUGB 1LILA 1FZOB 1ZXQA 3QDJE 5GRUL 1JGVL 3DTXB 4YQXH 3R8QA 3QDMB 5CIPB 5TF1H 1ET5A 3ZDZF 4FERA 3D2TA 4FABL 1CE6A 3MXVL 5DTFB 4FMVA 4JZNB 3M1CA 3N41F 3QDGE 1TQWA 4M29A 5BRZB 1D5ZA 3GMLB 4ANVA 3HI6L 2IANB 4Y1AA 3HG1B 4BRJA 3WSQH 5IVZB 3WFHB 4WU7B 2Z93A 4P3CL 3DX6A 3UBHA 3QA3B 5DHMC 2FEDC 2O6DA 2AP2A 3A6OA 3LEYH 4A2DA 4DUVA 5FR3A 3WMPA 1KUMA 2V0AA 3VAEA 1JWUB 4NQXA 5AFAA 5KAQG 3P4LA 3H0TB 4OUUA 4QJ4B 5HHOD 4G9FE 1UH2A 5LBGA 4PTUA 4V1DE 3OKKA 3DTUB 3HS0B 4U3HA 5TDOB 2QQQA 2WYIA 4BE5A 1U8KB 5EZJA 2QMKA 2LQRA 1UB5B 3LHPL 3HPLB 3W9EA 3P11H 4YK4B 4NKOB 3PAYA 4JDVA 4X9IA 2OMTA 2ZX9A 3EH5B 3QQNA 2F9BT 1NGXA 4Z7WA 3SSGA 1JPEA 3NT0A 1T89C 2I07B 1VHPA 5BS0A 3RWFA 5C0FA 1R0AL 4RETB 1DDTA 1XHHA 5FYLE 3HZ3A 4MBRA 4UM9D 4XT1C 3C60C 1RCYA 3G5VB 5JIQA 5T1JA 5FV2A 2EUZA 4N8VB 4M5YH 2VM9A 1YUHB 1HOCA 5MEND 4XH2A 4L3ED 2A74B 3FB8B 1BQ5A 1FYTE 1FFOB 4HIIA 1KXQA 5D1XA 3FL7A 2L04A 1BYNA 3DX9B 4ZS6D 2ENJA 5H4YA 2X0WA 1HVXA 5AOJA 1NA8A 2CK0H 3B6SA 2COVD 3VFNA 1Z9LA 3TF4A 1J8KA 5DS8B 3WFZA 2QELA 1A6WL 4LVNB 1ZT1A 2WQRA 3JWDC 2BP8B 2P7TB 4ISVA 4YBQD 4B9YA 1AD0A 3GBNH 3OG4B 3VI3B 5LNGA 3DKHA 4UQ3A 2E74C 2NW2A 5EUKA 3UYPA 4ELDA 3KWVA 2H0FA 3S37X 3S9DB 1ZJAA 5FYKE 1T3FB 3HI1B 3OKMB 2Z31B 1ORSB 3K81A 5E6ID 1FP5A 1F97A 2R39A 4P9HL 2X5PA 1I9JL 1CF1A 3QUML 1YNTA 2ZAIA 4DN3L 1QTSA 1SBSL 2C7FA 4ODUA 4UT9L 5GRWA 4JRYA 2HRLA 3H85A 1KDJA 2C26A 1TJXA 2WYTA 3CQPA 3ATEA 1B2WH 3HE6B 1T7YA 4KJQC 2D9CA 1RZIA 2Y23A 1ADWA 3D09A 4LOVA 1L7TL 5ITFB 5CR8A 5L6YH 4MQ7B 3DYMA 3UGEA 4KTEH 1CT8B 1OCRB 2Z35B 3S88L 3TVMC 3EXJA 3O6FC 3D48R 1MAML 5ICXB 4ABVA 1A1MA 1OGAA 3QZPA 4ZOAA 1XWVA 2MTAA 3ABZA 4HK0B 2IALA 2YD7A 3GLAA 2WBKA 3JWNC 1U95B 3NJMA 1BOGB 3G6JF 3NJFA 4P3DA 5DVNA 4CAGA 4Y16B 1YY8B 1KBBA 1R3KB 5I82A 3GSXB 3MODH 1JXKA 3QT2A 4MWFB 1NC4A 5JXAL 5J7CC 2MPAL 2BOCB 4A6YB 5I8CA 4FCHA 4IRSB 2JWYA 4QRPB 2H9GA 3U0WH 4W93A 2DQIH 3I6GB 5CBEA 1Y18A 3STZA 1VEMA 3EDKA 1EGJH 5DJDB 3L9YA 3AY2A 4RNRB 4UOW1 2R27A 3LMJH 5C07D 2FH6A 3HAEG 5FEBA 4WJ5A 3A4FA 3OKYA 1XGYH 1U8PB 1T7ZA 4Y4HC 2Y4SA 1B88A 1ZKAA 5D71H 4Q52A 4U4IA 3VI4A 3MMEA 3RTQC 4PP1C 2VLKA 4IJ3B 5TH2A 1ACXA 3RWCA 5DLML 3WENA 4X6CB 4PM1A 1K8IB 3FTUA 4FP8H 3CSGA 4GNKB 3L5XH 2VWEE 1KJMA 2OCFD 5CCHE 4Q0XL 2LU4A 1N2RB 1MVUA 3MI6A 2D0GA 3G6JE 4N9GA 3IJSB 2QGCA 3MRNB 5L88L 1EDHA 5HPOA 4MSWA 3DYPA 1SVCP 2JLPA 4IRJD 4KKCD 3L48A 1CBVH 3CDFA 4F9LC 2EO9A 3SYCA 1Q0YL 4LSUH 3QW9A 1KJ2B 2BMKA 2UXGA 3VD4A 3GMNA 1X5JA 3KNBA 1G7QB 5E9DA 4B9KC 3L5WA 2C4FU 5B1JC 4C4KO 4J8RA 4P23C 3UTSE 3D12B 1JGEB 1O7VA 2DV6A 4UINL 2VKWA 4TRPL 3VFGL 2IAMD 4HWEH 3L4TA 4WAFA 4IJTA 2ERJB 2PCYA 4ETQB 1G7MA 1BZ8A 4GKNA 2VLRD 4PJEB 2DQHH 4YDNA 4XVUD 1DTUA 3R0MA 3CBKB 4G1MB 1AC6A 2WZ6A 1XF5B 1B4RA 1AQKH 4P2RB 3QDJD 1OAKH 1E8YA 1N5AA 1KBGH 2F54E 1FIGH 2C3WA 4LU5L 4RAHA 4R7LA 5GISH 1DQLH 3RU8L 4JFFD 2OZ4A 1U2CA 5EH1A 5FW7A 4X7DC 3CZNA 1OK0A 2VO5A 5IUCA 2WB7A 5CF3A 4XCEA 2DTML 1XSIA 5IW6A 4L18A 3WBDA 1K5WA 3F7VA 4FQ1H 1JNLL 4IMLB 1JD7A 2NW3B 4FYRA 4X8JB 1JK9B 1TT6A 2WO3B 4N0UA 5EU5A 2I85A 4JZOB 3MNWA 4XB3A 1HESA 4NNXB 1QSEB 3I75A 4IKJA 5GGVL 5SV3A 4IU2B 4ZODA 5A16B 4WHCA 1SM3H 1LK3L 2HFEB 2ZXGA 5IHUL 4JM2A 3C9NB 3RG1C 4V1DD 4U05A 2XKSA 4IOIA 1QR1A 3KR3H 1DZBA 4TUKL 3RZCD 4OBRA 5PAZA 2HKHL 2EEDA 5DUPH 3PXLA 1AGEB 2KZWA 1BVNP 2I25N 4AE0A 1OALA 4HIEB 3HC0A 3C6LB 4JRXD 3X12B 1LK2A 1QZ1A 3MBXL 4EO5A 5L9DL 5FYLD 3OZ9H 1ZTXL 1MCRA 4H8WH 2J72A 2EE9A 1MJJB 3FT2B 4LQFH 4U1LA 1VKXB 4W70A 4W68A 5IFHH 4X6BB 3OB8A 4FNRA 1RVFL 4EKJA 1FYTD 1I8AA 1A6PA 3BUYA 1QPPA 3FO2A 4YDLB 4ZQTA 1QEWB 1A4KA 3EFOB 5GSRB 1C1EH 4KUCF 4YIQB 4XTRD 1A5FL 1ZSHA 3WIAA 3VXUB 2J1XA 5KSUB 3ULUC 2YUZA 3LKOA 4N85A 1B0RB 1D5MB 3NJGA 2XRAH 5EF2A 2C9AA 1A4BA 5K9JH 3VUAA 3G5YB 3VWKD 1KDIA 2DQUL 2CKBL 2XA8L 2ITEA 3UO1H 5DD1L 4NM4L 3RB5A 1RIHL 5FYKD 3LRSA 1WT5A 5A2LH 3E9UA 4QOKE 2Y6SC 1ZLUK 2YPVL 5GGTL 3FQ1A 4PB9L 1E4WH 1EHAA 1TJGL 2BWDA 3ESPA 5BMFL 4J39A 2OK0H 5J6GA 3IDGA 4Z78A 7PAZA 3GKWL 1TZIA 2Q7YA 5JOFB 3LDBC 1KTKE 2D9QB 3N1QC 3VXQB 1UYWL 4FE9A 5TE7L 1KN4H 4XMTA 4PVNA 4Z1PA 1WAEA 1LO3L 1MZYA 4ZMWA 4RFOL 3E8UL 2Z34A 5E8DH 3S5LG 1FAIH 4E9RA 2J6EL 2BHZA 1KXVA 2P8PA 3D3VB 3DX4A 3PWNA 4U6VH 2YUWA 3BSZL 1RLWA 1A14H 3AJ7A 4XWGL 5F97E 1TJHH 3D85A 5MEPA 3HUJF 2UY6B 5KTEH 3CPLA 1U93A 3BPNB 3CMOL 4X80H 35C8H 3CN0A 4HEPG 5T1LD 1X5IA 5JPMB 4MJIB 1PJWA 1N64H 2ORBH 3GIVA 15C8H 4OCYH 4G8EB 4R6UA 3UJJL 3H3PL 3BH9A 3BZ4A 3P3UA 3FJTA 3GSUB 3NPSC 3MREB 4NB7A 5TE4H 4ODHH 3RAJL 2MPVA 1IKOP 1FO0L 2GIXA 3TBTB 1EVUA 5HPMB 4X6FB 1B4JH 1CGUA 4XPBL 5B1CA 4WI6A 4RGND 5J5EA 3NFNB 1E0OB 4FKEA 4CGTA 1T0NB 3CK0L 3CZFB 4WZ9A 5D1ZC 4N28A 1JVOA 3W5MA 5FUZL 4Y2NA 2LAAA 3QPXL 4MDJA 2AI0H 5DU7A 3UFIA 5BQ7A 2ZJSH 4H1LH 2A77H 5CCKH 1V54B 2P5WA 4HF5H 3GJFH 5AL0A 5HTSA 4FGMA 1ZDQA 2W65A 4RQQA 4YOKA 4PGDA 2WLYA 5BUGA 1JNJA 3QE5A 1TTAA 3DROA 3ZMNA 1KULA 4JFSA 1RHHA 3HUJE 3QUZB 5EO9A 3FQRB 2GJ6A 1ID5I 4B9GA 4GG6E 1QRKA 3BQUC 5ICUA 1PG7L 3CVIH 4WNQA 2AK4B 1Q1PA 4BDVA 1DJSA 4X98A 4XBMA 1WFIA 4DP4X 5DHXB 4TOYL 4WI2A 4WI7A 1E9PA 4KQ0A 3S4SB 1T4KA 3QSKB 5F89A 5JW4R 1NFAA 1G9NC 2AXGA 2FO4B 1FC2D 3BVDB 5DJ6B 4PV8A 2B59A 4A63A 1OAXL 1DUZB 3PJNA 4KKZA 3TZVA 1HKFA 3BAYA 3MUUA 4XMUA 5D4IA 5KW9L 4JCLA 2M83A 2NY4C 1AR1C 3E6HB 1KCUL 2XG4A 3GEWB 3MRCB 5AAWC 4NNYB 5CEYB 1FORH 3S3CB 3UTSD 2E8ZA 5CKAA 2OTUB 3UABA 1H3TA 3PHQA 4B9JA 3O3AB 2ZYSA 4M56A 3UZEC 1F58H 1T1YB 4BFEA 1MJUH 1HZHL 1I8MB 1BD2E 4HH9A 2JJSA 3JWNG 3ARUA 1IC4H 1I9IH 3C6SB 3Q05A 2WAQA 5JXED 5FA4B 3DNKA 3HJ0A 3D07A 3KS0J 4KVPA 4F5CA 3MACL 2F54D 4N68A 1F3JA 2B08A 4QKTA 3G04A 4IGBB 4FFWD 5I23A 3QYMA 4ANXA 5BO1L 1KJVA 4JUTA 4XXWC 2YD0A 3CIQA 4XN1A 4EI5B 2YGPA 3OXSA 1DLHB 4XAKE 4BFIB 4ICXA 4ZW6A 3ZKXB 2V37A 1E4HA 2QEJA 1QHOA 5I9QC 2W9DH 1U58B 4MD5A 2EIJB 2C4FT 3DOSB 1LMIA 4LCUA 3HG4A 1CFTA 1D9KA 4G6KL 3BSGA 4G8FA 4X7SL 3PQYA 3SGJA 1RD6A 3MA9H 2R2CA 1BPVA 1DQVA 3SKOB 3QFGA 2ZE0A 3NJVA 2X4OA 2X4UB 4HZ1A 4NQVA 3C5ZA 3VXMA 2O1AA 4F8NA 3A24A 4JFVA 1H6UA 4PBDA 1DE4B 1DBAH 1WZMA 1U8OB 3K2MC 3GMOA 5HHNB 4AEHH 3K0YA 4P5MA 1W72A 1F6LL 5I5JA 1P7KB 2VABA 2VDMB 4PGZA 4PMFA 4MAYA 1RFDH 5BVPL 2VDLH 4FI6A 4IIQB 4XPFL 1AANA 2KDYA 5FKPB 3SE6A 3TIDA 5FO9B 4TLKA 3EAKA 4M61B 4PLKC 2BJMH 2VXQA 2EIKB 1CZ8L 3ABLB 2EIBA 3MBWA 5GRVL 4Y4KD 2XX1A 4OZHF 1IIKA 4M7LH 2OULB 5L4MA 2BSTA 1B3JA 3KPOA 4RGOH 1E9QB 2ZXAA 4TTDD 4N2IA 4NKIH 3JXAA 4JQXA 4RMTA 1ZA3B 2NY1B 3E6FB 5FKAA 3SPJA 4AQ1C 5C0CB 5F9JA 1M7DA 4Y5YA 3KPSE 1HILB 1HHIB 3D30A 3MGTB 1HE8A 4LOUD 1DBML 2LR4A 2QGEA 2F7PA 3EYFA 3IJHB 2VUKA 4JFWA 2D2CC 5DS2A 1SXCA 1INEH 5CN3A 3S8FB 2IPTL 4QOKD 3VFSA 3TA3C 3K8LA 3HC2A 1VERA 1D2OA 3DI3B 5D1QC 5FYLH 1JERA 3RGBA 3LNDA 4I1NB 4P2YA 4PTTB 4R4FL 1EEZA 2XQBL 5D6DA 5FYJU 2VDPH 2MEJB 4GKLA 1BVLA 3RFRA 4OLEA 2GPZA 2X1WL 2Y36L 4F57H 5DZJA 3HB3C 3U9PL 3U6RA 4X9FA 5EBLA 3N50A 4GRMB 3QEGH 1WBZA 5D2NE 4KUCD 5BZDB 4OZHE 4JZJC 4R7NB 3DIFA 3HE7C 4ZI8A 4P2OD 1XL6A 1K6QL 5E4IA 3EJPA 3QNXB 1KTDB 3DGGB 1UQSA 5FS5A 1AIFB 2Y7QA 3C5XA 4WTXA 3HNTH 2APFA 4DO6A 2GSIA 4LCWE 1AMYA 3QUKA 3MV7A 5FYKH 3TJEH 1F02I 3ETSA 4GT0A 3H7LA 3RY4A 5I17A 1NAMA 3DUUB 3QUXA 4JKLA 4FXGA 4NUGH 4AV0A 3CFIC 1L0XA 4LHUA 3K71B 2C3GA 2O6CA 4ZAKC 1A7BA 1YECH 1SEBB 1XZ0B 4HJIA 2WP3O 1KCLA 4L4TD 2DQFA 2VYRE 1VCBC 1DBJL 1Z2KA 2B77A 4YGAB 3SCMB 1CICC 4PFEA 1S8DA 4UYQA 2YZ1A 1AHKA 2WWKT 1C12B 4H26B 3B9KA 4ONGL 1FFTB 3UAAA 3TCXA 4AL8H 1E2VA 1NDGB 4AIZA 5D5MA 3D6GA 4YHYB 4WEBL 1IM9D 3EIFA 3SBRA 1KPVA 3F64A 4KHXL 1OAJA 2HJLA 4H8QA 3BAWA 3UG4A 1JI1A 3ARFB 2W60B 2J44A 1P5VA 3FSZA 1XGTA 5DC4B 1HKLH 1NGZB 5DVLA 3I9PA 4EBQH 1RP8A 2Z7UA 5L7XL 4AEIL 2BNRE 2X1PA 3AMLA 1L6PA 3AWEA 4BWUA 2FJHA 2J25A 3MRIA 4N2GA 4AKQA 2GBVA 2W95A 1YN6B 1HSAB 1ETZB 3LXCA 5EPMB 3RX7A 1PPIA 3PGDA 3DXAB 4GAGH 2AKRA 3IGLA 3GINA 5EZLB 4NZTH 4UT6A 3VXRA 1ZK5A 3NTCH 2A9NL 5JHLL 4XMPL 1JXGA 1SNRA 1LHZA 1TIUA 1Y7VA 4LBEA 5ISZB 3H55A 3UZQA 4RX4D 4OJAA 1LP9B 1V3JA 1BVKA 1MI5B 4B9ZA 4KTDH 3UTQA 1IC5L 1K4DB 2O4EA 2APSA 2WZ5A 4B96A 2GBUA 3K2KA 2RA1A 2A73A 1I3GH 2Z4QA 1WV7T 3ARGC 2G75A 1DBKH 1KCRL 3BIKA 4M7ZC 2R51A 4Y2DD 5BVJB 5SX4H 1P4UA 4U4BA 4BUQA 1QW8A 5JHDB 3AW5A 3AG2B 4MXQC 4AVKA 2ZCKH 1OSPL 3II1A 4TVSa 5I30L 1WWWX 3IS0X 2D7MA 2X2UA 2QQLL 3HOGA 4PGEB 1TMQA 1C5DB 4XAKD 4PRID 3U25A 2X53A 3WLWC 1ZV2A 4UTAA 4GKZA 2WXOA 3AS3A 4O51B 1EA9C 4P9HC 4I77L 1NCBH 2NT1A 3FMGH 2FEDD 4P2CG 4HOMA 4CN4A 5CJBA 2NY6B 4K3DH 1PNCA 4YVUA 4NLAA 3BW9B 4W4NA 3U36A 4WUKL 4PJ9A 5CSBA 5EC2A 3A3YB 4GAYA 4Z7WF 1UB6B 4YL4A 5HGHA 1KXTB 1X4ZA 4KWUA 2ITFA 2XZZA 3QQ9D 4KQ3L 2OYPA 1G6RB 1Q0XL 4MNHB 3ROOB 2QKIB 5F3BA 4QT5B 3BMVA 4HJSA 4OCXL 4OCMC 1HDMB 2CUMA 5EZOL 1E5ZA 1WAAA 3WY4A 2PYFB 4R7VA 3BVNA 2VSKB 3N43B 2HLAB 4NWTL 4AGLA 2HB0A 4XVSH 1JGLH 3WL9B 1BVOA 4NC1C 4FYQA 2Z4TA 2ZKHH 2VW7A 4TNWK 2OMYB 2VXUH 3P9LA 1YVLA 1UWEL 4KMLB 4IDLA 4Y9BA 3S8GB 3VFVA 5SWZA 1MCFA 1TQVA 3PL6C 2B9AA 3S37H 2DD8L 4LK4A 3GSNH 5A2AA 4PJAB 3VU2A 3JT0A 5FGCE 4JFED 1OV8A 4GI9A 1YDPB 5IOPB 2JKRM 3KPSD 1DQTA 1EJOL 4LHJB 1OE2A 5LJYH 5C0EB 4BRVA 2HG5B 4WI8A 1ZGLM 5I1IH 2K45A 4LKXA 1A4JB 2P8MB 3IJ7A 5IEKB 5DEGA 3C6EA 4EJ1C 3QWQB 1Y07A 4YE4H 1JPGB 4Z7WE 4K3JH 2IV9A 3AREC 3MYJA 4CRPA 2WNWA 2IBZY 5BS0E 2BHUA 1YNTF 1B0GA 5TK2A 3L7EB 4M1DH 5BOJA 4XHJC 3ALWA 1CYWA 4MJ5B 2PW1B 2YAEA 3M07A 1O5DT 4JCMA 3QIWB 3EG9A 4PJXB 4ZX4A 2XUWA 4M4RB 3FQXA 1QBLL 3R06B 3DRTB 1J8RA 3H2PA 3MXWH 4Q2ZA 1XF4B 3U7YH 3HZVB 1NOAA 2EACA 1MCBA 2VMFA 5D1XE 3V0WH 3UBFA 1Q9KB 4AGPA 2IQAA 5AKSA 1FGNL 1TPXB 5AZEH 2CO7B 3BAKA 3P4NA 3N2JA 5CSGA 3L3HA 3FF7A 4OR1A 5FO7B 4DP9X 2KL6A 4AT6A 4KNQA 3SDAD 4DK3A 3EJCA 2DEYX 3CU1A 1AGDB 4QXUH 3TVMD 3MJ9L 4PY8I 1HC1A 3O6FD 5ACLA 4XNXL 3D4GA 2YD3A 3PYCA 4BKLA 2ATPB 3VFUB 3GBML 5AUMA 1X7SA 4Z7UB 2JK5B 2YRPA 4LCWD 3RX5A 3BGAA 5C7XH 4JO4L 3Q2VA 1OARH 3HAEH 1BXUA 4IRZL 4NENB 4XMLH 4YR6B 4DGVL 1U92A 1M7XA 3SQRA 3HBPA 3SDCB 4JR9L 4DQAA 2FGWL 4N20A 5C0AB 2I5YL 2H8PB 3I9GL 3OVUB 4ZXBC 1AGCB 3CXHJ 1GSKA 4AG4H 1CFNA 3K0WA 4F2MA 1QFWI 3IGUA 2NY7L 3SOBH 3KPQA 2J8OA 3A5VA 3S96A 1G0DA 1WWBX 5BOZG 4YHKH 3FRUB 4M93C 3I3BA 3VI4F 3A67L 2Y5TB 3JTSB 3IWVA 5KSBA 2F8VA 3QCVL 5B39B 1KJ2L 1OB0A 2X6BA 2FWLB 1INQA 5A2IH 5AD0B 1NUFA 4JMXA 3D2UD 2D4DA 4NN7B 3CPUA 5KYUB 4XPHH 5EFIB 3GMRB 4OSUL 2B1OA 2XPZA 5DJAA 3APCA 3EO1B 1OAQH 3PNWB 5IB3A 1FH5H 3O2DA 3KS0H 3SHSA 4FI7A 2XWJB 2N0MA 3U0TB 3V55A 4PGJA 3BKJL 2BNRD 4GUPA 5C0BD 3F12A 4AQEA 2ETWA 1T2JA 1FYHB 1F1GA 1Q72L 1A9EA 1TTFA 2PO6C 2ARJA 4XNAA 2H2SC 4R9HA 4XGZA 2ZOUA 5D93C 2R1XA 1U8LB 1E28A 4ZFOA 5GZOA 5I75C 4UNVA 3HW7A 3MJ7A 3QB7C 5DRNB 1FL5B 4MCZB 3IF1A 43C9B 5E00A 5G5DA 1OP5H 4CVUA 2ID5A 3OLEA 4IBSA 3ZTJG 2L7EA 1GCFA 1F0LA 2F7IA 4Y5VC 3C12A 1RJYA 1Z32X 4ERSH 5IUSA 1HT6A 3WIFA 3G6AA 1AXTL 5C0JB 5EMYA 5HHMB 1VIWA 3TN0C 4WKXA 3L95B 4LCCA 4MD0A 2XPYA 4HOZA 2EICA 3VI4E 3IDXH 1U3YA 3SPVB 2VLKE 3VH8B 2XWEA 3S3DB 2A1WL 4F8OA 2G2PA 4P05A 1T1ZA 2B1AL 1SOSA 2AABH 5AVXB 4ZTEA 1UJ3C 3E1F1 2EIZA 2APWA 1YEJL 3JYBA 5FOBB 2FNWA 1KGXA 3K2UL 1YEEL 3ULVL 4K9EH 1QAWA 4GRWE 2R0LL 4JFDD 4XCYA 4LSSL 4ES9A 5AOMA 1E4XI 1L9TA 2UZYA 3IU4L 5AVTB 1TITA 1UUNA 5AOIA 4AKPA 1A4CA 4IBLT 2DWEA 5FFOA 4JM2F 1ET7A 4Q7DA 4KKBC 4U1KA 4U3SB 4QD2E 4QMEA 2FQGA 5F3HA 3AC0A 2PTVA 2FX9L 4ADIA 1G7PB 3HG0A 3ZSSA 1O75A 3P0YL 1AJ7H 3L5IA 4LSTH 2EE6A 2W0KA 3NK3A 5IIEB 4G42B 1UH3A 1Y0LA 4P46C 2OMNA 3MOAL 5J56B 1H3GA 3VD9A 3O2WL 4FNUA 5I8EB 2NY3D 4KJYB 4GKSB 4S11A 1I8LA 3DECA 3MLVL 1UENA 4PG9B 3JVFC 2E3VA 5SV4A 4DF9A 4FXKC 1J5DA 4CSSA 1OSYA 1ID2A 4Q6IA 3OHXB 1H9VA 2EH7H 1DVUA 1XF3B 4GI8A 4LSRH 1RZPA 1BZ7A 3V4UL 3QH3A 5IB5A 3C08L 2NT0A 3UBXA 3VXNB 1T66C 4X5PA 3QR2A 3WO4C 1HH6B 2E7LC 2GTQA 1HWHB 4OD1L 4U1SA 5AVRB 5J6HA 1NKOA 3PABA 1E5CA 4GSQA 1NEZB 4N0UE 3PAVA 1ULVA 4EUPA 4LLYB 4BINA 3PV6A 2Q8AH 5T5FH 1R5WB 5C0DB 3NFPA 3EGXB 1XGQB 2JJUA 1WGOA 4U1IB 4WFGE 3SBWA 5CILH 3EO9H 1WBXB 3TH2T 2KERA 3Q6GH 4HMEA 1CMOA 3ESOA 4NZUL 3BRGC 3PP4L 2VZOA 4CMHB 4HXBL 5G4NA 3U1PA 1JGUH 1KIQA 5T1MA 1P69B 1JV5A 3WELA 1T89A 4MB1A 3UYRL 5BS0D 3VNZA 3MRPB 1JV2B 4AYBA 4G43A 1CBJA 5BZXA 4X7CC 3BO8B 3P69A 4YC2B 2XVGA 2Y6SD 3ESNA 5LO7A 1E6JL 2NQ3A 4NP4L 5ICZB 4MBOA 3AB0C 2F08A 5HI4C 4GUQA 1NMCC 4N2DA 3WIIH 1BVZA 4HC1L 3FQ2A 3TV3H 2X4QB 2EEFA 4YBHA 5D1XD 1VADB 2X9YA 1QZNA 2PR9A 1L9QA 4OF6A 4CSZA 2P4AB 2I32A 4GKOA 3VYPA 4JDZA 1KB3A 1XBRA 2GTZB 3NSDA 1MFAL 3KYKH 1K3IA 4U1JB 1F41A 3IE9A 4G2AA 4BZ2H 2V5MA 3IT8D 2PXYA 2R15A 3V4PA 4YHLL 3MLZL 4L1TA 3SDXB 3P54A 1FFRA 1Q9LA 1SDAB 3DJ9A 3MU3A 1N68A 3QIBB 1U30A 5EEXA 5BZWA 1NH6A 2WUCL 1S3RA 4FNLH 4I3SH 1NBVH 1NC2A 2R56L 4ILDA 4H4NA 1AS7A 5F88B 4O2CA 5I0VA 2FR4B 3IDJA 1CURA 4DPCX 3WDHA 5DHEA 3WTXA 3MRKA 2X4PB 1N18A 3I6KB 3BP4B 3WJLA 3F05A 2FATH 4BFRA 4GSXA 5CJQL 1JG9A 5INDB 4DVBA 3M88A 4JW3A 1WA1X 4CL7A 4HUWA 4KK8C 1SEQH 4C56B 3MLXL 5BV7H 1FLRH 1ZHLA 2F68X 5D1ZD 1OTSC 3ETTA 3RPBA 1BECA 5CFHA 2AQSA 4HFUL 3QG6A 4NFDA 2WMPB 3MRLB 2MNWA 4BK5C 3AADB 5D4JA 3MA7B 4Z77B 1AY1L 1B9ZA 2X42A 4WW1A 4HFWB 4B50A 4URKA 1L3WA 2E7HA 1E5YA 4FJYA 4EZKA 3FQNB 2WHVA 3QULA 4QGTA 2CGRH 1YPZE 5GGSY 1FZKA 4GW4A 2DQDL 3HBGA 4I0PD 3KLLA 5FM5M 1OGSA 2WTRA 2VZTA 3AM8A 4KNSA 4PEEA 4X5XA 5KOMC 3RWJA 2QZQA 1SOQA 5AW7B 4WWOA 4AQZA 1BREA 1R17A 1LGVA 4HJ0D 4HMCA 2XVLA 1CQKA 1MFEH 4LGRB 1OSZB 5E1QA 1J5IA 3AQDA 3NRQA 2B1HH 3MYZA 3BJLA 2Z64C 1YY9D 1YLBB 4WUUD 5KYXB 4NNPH 5FDWB 2YD2A 4ZW8A 3T8VA 5LNDA 1GGCH 3FB5B 1FPTH 1MUJB 4WSJA 3MOBH 3MNVB 5KN5A 1IBHA 4L29A 2EDTA 5JO5A 2CUAA 5HDRA 5LUMA 1QWUA 1UOKA 5A2JH 1MN4A 2P5WE 4Y4HA 5IEHB 4A2GA 5L2KA 4QRQB 4FF9A 4LAQH 3VTMA 4AGMA 2CJUL 2IADB 3MR9A 4FNQA 2J88H 3DRQA 1MCSA 5DD3H 2VGLM 2J3SA 3IMRA 2CRMA 2H4EA 2GJ6E 3QZOA 2GI0A 1CS6A 2RCSH 1UG9A 3WKML 3QIUA 3BPCB 4ADGA 1AIZA 4JJ5B 5HDQH 3LSOB 4OM0L 1AG6A 1IB5A 1N19A 3AS1A 2VDML 5A1AA 3GRWL 1DZ0A 2IDCA 3UX9B 3W0WB 3CHSA 3CUPA 3TOPA 2EH8H 4L1SA 4XZUB 5KBDA 1VGEH 2X28A 4UAOC 3CZLA 1BBJB 1ACCA 1G7IA 2I7SA 1V55B 5AVVB 3DURA 1H19A 1DJIA 4JX0A 3QG7L 1YZZA 4P23A 4G70B 4YWGL 1BZEA 1ZT4B 3ESMA 4GAJH 1AZNA 2LU5A 1G7HA 2VJ8A 1W80A 8CGTA 3GI8H 4MMYB 2ZKWA 3OJVC 4TSAL 5DUML 4QHNA 5JDSA 3KYAA 3IDIB 3ZIYA 4L9DA 3RDTA 2Y7LA 5TPWL 5JPNC 5IFAL 2CWRA 2ZYHA 3V5KA 4FQLL 4BXVA 4LLQA 5JIHA 1L7IL 4LHUG 3II2A 5ALCL 5C09A 4OF7A 2J7LA 4M6MH 5C9KA 4K23H 1NANI 4N2NA 1QSZA 1F42A 2J73A 1R19A 3DX8B 3QO0B 3C5JA 3FTGB 3RPIA 5HHOB 1DQIA 3ZHNA 5H2BB 1WFJA 1VPOH 5T33H 1ND0A 1DEEB 2X4SB 1S7XB 2A6KB 4OKVB 4HX1A 3L3IB 2ZOOA 5TD4A 5DK0B 4XCCL 1DVSA 4FZEH 2BXZA 1NMAH 2IH1B 5CWSA 5AZUA 3PQYE 5ADOL 1XGZA 3Q0HA 4K5OA 4P4KB 4WFGD 2R1WB 2CIKB 3F84A 2OXGA 2CR0A 3NCFB 2FGZA 5DVOA 2E4FA 1YEIL 3LIZH 3BPOC 2NR6A 2FWSA 1I9RL 4HIJA 4I3GA 5MENB 4JB9L 4L3EB 2R69A 5SX5H 1ILSA 3V0HA 3B9VA 3M7FB 1NOFA 2YPKB 2B16A 2W94A 3G6DL 3US1A 1HIMH 5DLLA 3MNZB 2RALA 4WGKA 5L0QC 5E99L 5DMIH 4H20L 1SLXA 2Z8VC 1PTZA 2YKLH 3VRJA 2F5BL 5DGQA 4KK6C 1V3LA 4X9GA 4PWGA 3MJ8B 3D06A 5TGBB 1IC7H 2YLHA 5HJBA 1XH3A 4F9PA 4XPGH 2B5IC 4MMXB 4F3FA 3AGVA 1H3PL 5MEOB 2JB5H 4PP2B 5JZ7C 3ESUF 4RA3A 1E40A 1KPRA 2Q76A 2R0KH 3EDFA 4JFQB 2CIIA 2BOBA 5IK3A 1W0VA 1N6UA 4PUBH 4LL1A 4WDIB 1XMWA 5I16A 1MW1A 3G5XA 5E6IB 2NXYB 2V9UA 4D9QE 5LDUA 1BJ1J 1TMCB 3JWOC 1E2WA 2EUVA 3L2LA 1G0XA 2VZSA 4XBPA 1J8SA 2OXHB 3O0RL 1J1XH 2IFGA 5DZOA 4F7MB 1K4CB 3FU8A 2P47B 1BBDL 4CU6A 3VFTA 4Z7OE 3SJVE 5LGHL 1N8ZB 4TVPE 4XPTL 5T3XE 4DOHB 1S7UA 4JHVA 2R9HD 1I7UA 4H1LB 1XSKA 4BJLA 1ZGLA 3GUFA 4IKLA 4LZKA 2HT2C 5D2LA 3VG0L 3VRLF 1A3RL 1CK0L 3ZDXB 4XZ4A 3FHQA 1BLNB 3DO3A 1D5IL 4ODVL 5DRWA 4AKOA 4FAAB 1HCZA 3RWEB 5LBSA 4JHWH 4HOXA 1E7UA 3SDDC 2GK0A 3HS0C 3IRCA 3IFLH 5LHDA 3F85A 1VLXA 4XP9L 1JHKL 3HC4H 4YK4C 2A3TA 1ZT7A 1CICD 3IJEB 2XG5B 5D5MF 4PD4K 3GSQB 1R47A 2ZSVB 1U42A 4LESA 5LG6A 3FTVA 3OJDB 4YVNA 5GZNA 1INDL 1OCWL 1RZGA 3S98A 4LB8A 1LXMA 1S7VB 4QF1B 2B0SL 5DJXB 3B3IA 3RNKA 1KFGA 3I6SA 4BZ1L 2PPFA 3KPLB 4JFHE 2A74C 4TQHA 1FNGA 4S1DC 3UMNA 5F7AA 1UFUA 1ZPLA 1MW3A 3I3DA 4GINA 4AZ8B 1EMTH 4ETYA 4TUOB 1KN2L 3CFBA 4M43L 4PR5A 4RBPK 5CGYC 3DGDA 1AGFA 2LAGB 3VRLE 2DEXX 5DMKB 1J0KA 1YYLL 2EDRA 4EOWH 3DDGA 1E27B 4ELMF 5IJVB 3TP4A 3FQYA 4LVNC 4XP6L 5ANME 5HGBB 3UL4A 4NAQA 4AH2B 2VB5A 1SYSB 4MA1B 1WJ3A 3DVGA 2QFPA 2CNZA 2WOYA 4FNTA 4EZJA 1MCEA 3IDMB 1CJYA 2WPGA 1KGUA 4JAMA 1OK8A 4K7PX 5F1IA 5FGSA 2V17H 2Z31C 3CZGA 1IEAB 2W9EH 4L4VA 2JIXA 4TULL 5DA4A 4GMTH 3WEBA 5F7YC 5D5ME 5G4MA 4O4YL 3ISRA 3NCWA 3P9MA 4KQ4H 4XNZB 4W4OC 2OMVB 1ZWIB 1G1YA 4IRJB 2WCGA 3ZDYE 3CH1B 4OLZL 3RI5K 2GJ6D 3QQ3A 4AIEA 2BZDA 4ZMTA 3BQUA 1TVHB 2K7QA 5ID1B 3HE6C 1UXLA 1JXJA 2IAMB 4KY1L 4KI5C 2RACA 4PJCA 4UQ9A 3JUZA 2FJFB 3P73B 4FS0A 3DV6A 1JXDA 3A6CH 3IETB 2VDLB 1H3UA 3L8QA 3NN8A 3QDJB 3OMIB 1CR9L 3WLWD 3BWSA 2YWYA 4JY4A 3VXRE 4EAEA 4HJGA 1PS3A 4JCWA 2ENSA 2O61A 4WHTA 1JS4A 3OAYK 1N6QL 4J3UA 5JHBA 2OW7A 1N0XL 1A2YA 3GMQA 3U4KA 4DNLA 1S46A 2VL5A 3QDGB 3FQ4A 3ZJAA 2CNYA 3GBDA 5DXWA 5FX3A 3DO7A 4Y16C 3V4LA 2HG0A 5I1AA 3SE9H 4RH4A 1PZ5A 3BDYL 3V7AG 2F74B 5LAPA 1JYNA 2RMNA 1WAAF 1BMWA 1I75A 1NGYB 4AENA 1ZTMA 2BY0A 2WQVA 4IRSC 3PG2A 1AQDB 2XLLA 5T1DL 2NZ9D 4XXWA 1EQWA 3EYUH 3OKOA 4JKNA 3GXNA 3ET9F 4G9FB 4PCYA 2I60L 5DDHB 1IGFL 4V1DB 5E1AA 4OD3L 4W9FC 3RZCB 1CU4H 1UUSA 4UBDC 3QBTB 1C7TA 2PCPA 3PGFH 3HI5H 4X9BA 1BF8A 1MHPH 2HVKB 3NFSL 1QWHA 2CPUA 1AE6L 2BW5A 1X5MA 3K91A 5F1OB 4JG1L 1WZ1L 1E3XA 4IJ3C 3ABGA 3O3EB 3NRPA 1MCKA 5HY9A 5IFJB 3ARYA 3FOLB 5B3NA 3C5ZD 2VDPB 2ZUSA 1TENA 2X12A 1MHCA 4M8QB 3V9EA 1QSVA 1LEGA 4FFVD 4XPAL 5F9OH 5JW4M 4L3AA 3GTTA 2OA9A 1S5HB 1FYTB 3N41B 3DK0A 1UA6H 2J8HA 4E42B 3PLYA 3VX1A 5IG7A 2ZXBA 3U4EA 4OZFB 2WANA 3CDYA 4L8SA 5E2VH 2OQJB 4P8QA 3U7WH 1TZHA 4HUCA 1WAAE 1JZFA 5HJGA 5EO1B 1HN1A 3P4OB 3LZFL 5CUSH 2ZPKL 1SUJA 2UY7A 1KENL 3OG6B 1JPFB 5A2KH 3CSYB 3SKJL 3VWKB 2ERJC 5J1AA 1AO7A 1S7RB 4HV8B 4O02A 4FFYA 2O5XL 1ZHKB 5LWYL 4CC4C 4MD4A 3ZL4L 3FN3A 5E94B 3TFKC 2OL3B 1IFHH 1XMEB 2ZKYA 3DJRA 2OTWB 4D9QD 1I7TA 4J3OG 3PNRB 2EDFA 3DJSA 3WCYA 4PB0L 2FJGA 4OU3A 1FZMB 2DQEL 4RLDA 4HCFA 2VDRH 1J86A 2YBRB 1R3HA 3QNYA 1YEDA 1SY6L 5BNXD 2QJDA 1OL0A 2IJ0C 3SJVD 4ONHA 2QPDB 5T3XD 1RMFL 1XH0A 5K39B 3TA3A 4NO2B 4OGQC 2D03H 1UTDA 2VZ1A 3ZZQA 2QSCH 2YEZA 4A37A 1BGXL 2MMXA 4OFYA 1S3KL 2EVGA 3MGOA 2AGJL 2DMCA 4LL9A 5CKGA 5CJOH 3PXJA 5GS0L 2BSDA 4YNYA 4OVUA 3DPDA 1Q9WB 4RGMB 2DICA 4ZXBD 4UM8A 4JQIL 3B43A 4HCRA 4JJHA 5T1LB 2E59A 1ZAGA 2MQGA 1JZEA 1MCCA 4C4UA 1ET8A 1PZSA 4HKXB 3C6LC 1SXAA 3ULVC 5KSBF 1FGVH 3PJLA 4JZJA 1OGTA 3REWB 3HE7A 5ITBH 4YQXL 3E3QE 4N9OB 3NCMA 3WYRA 4HBQA 2FCBA 1ITBB 1F4YH 1A8ZA 4I2XA 1L6XA 4LEOB 3T0BA 4UB0H 1V8HA 1MREH 1M3IA 2BXYA 2OBGA 4LLDA 4JPIB 4QHMB 4NPYA 1AAJA 1TZGH 2KT6A 1JZ4A 1OLLA 1ZV9A 3B5TA 1R34A 4YDLC 3WSQL 2ZXDA 3KL5A 3RA7H 1UEYA 2WGXA 3QZLA 3EXLA 4FJ6A 3LEYL 2O72A 5ESVA 4LHUD 3V7AE 4HHAB 1KWKA 3CAFA 5SWQA 3VGHA 5GPRA 1WZKA 5KVDE 2ZAGA 4HS6A 2PO6D 1JTPA 2HKAA 3UTZB 4P5SA 4UDTA 4LF3A 1HEZA 2H2SD 1TR7A 4Y2LA 2XIIA 1DLFH 5F7KC 4F2ME 1QO3A 4KXBA 1A1OA 2V33A 4LLMA 4I4WB 3BLKA 5BXFB 2ILLA 4Y2OA 2B20A 1CC3A 1MNNA 3ILQD 4M8VA 4X6DA 3KH3A 5CBAB 3FB7A 3QP3A 4UIMB 1R24B 3G6JB 4N2MA 4UU9B 5KVEE 1A7RH 2H2PD 2Q6WA 1WH0A 5DC9B 2MQ3A 4J3OF 5AOZA 3SGEH 3WAKA 4Y89A 2CAKA 1LWHA 4HS3A 1KT2A 2DQJH 4J4PA 1Z1WA 3T04D 3A21A 5JR1L 2WXMA 4M5YL 3QWRA 4U1HA 5TQ2H 5F7WC 3AXLB 1PAZA 1XR9B 2R7EB 1BYPA 3TNMA 1G1OA 2WWMD 1T5XB 3UTSB 4PJGA 2WLKA 3KYOB 2JB6B 1UVQA 1OM3H 2HLFC 3E1ZA 2YUVA 3CDZA 3OKDB 2WBJB 4RIRA 3EFFA 3VE0A 1LLAA 2CK0L 2X4NB 1F4HA 5AW8B 2VZUA 5IB2B 2QQNH 1H6FA 1BVNT 2WYHA 3EZJB 1G1KA 5E2TH 3QO1B 3VXRD 4XP5H 4A2MA 5L2JB 3IAGC 3GBNL 2EDQA 2F54B 3KPPB 5K9QG 3BPNC 4CKQA 4OLVL 1BP3B 5EBMB 2MFNA 5GS2D 3L6FA 3MRRB 5I18H 3HNSH 5JPMC 5JNYA 4G9DA 3WHXB 4KKBD 2BO0A 3GFUA 1ZLWH 2MCPH 1KTBA 1S78C 1DQKA 3K6IA 1O6SB 1CGVA 3WFBH 3BRFA 4JGNA 3K6NA 1GIGL 2Q3AA 3ARGA 3ZKSD 3FO9B 1M2VB 3EYOB 3IKKA 3P0VH 4OLXL 1F86A 3DVNB 3GSNB 1OT1A 3LYRA 2QLVB 4XXDA 5KUMA 5C92A 3B2VL 3AQXA 3C75A 2I26N 1SMDA 4ZOBA 4DUWA 1JGDB 3LQAH 1EHNA 1JTOA 3DSFH 3HC3L 4G6FB 5FYKU 5D7JD 4YHOH 1B3IA 3FUNA 4IW4C 1HAUA 4LDEB 3MLYH 3DX3A 5E8OB 4DVRH 1RZFH 5I76A 4POUB 4ZOEA 5DQJB 5FXCH 1ML0A 1T66D 1DQQA 2LFGA 3MRHA 3B56A 2NUPB 1ONQA 2O5YL 4IM8A 1BG1A 3QUMA 2BERA 1QMUA 1J9CT 1FH2A 1TG8A 5AW9B 4E0RA 4GQRA 3QUZC 4UT9A 4LHQB 3PHOB 1OPOA 3C5SB 3H42H 4U1NB 4JN1H 5I1DB 4KVCL 3IFPB 4YX2L 1BJ1H 4JFYB 4LDOB 5DJCB 3MODL 3OC5A 4MJHA 4YHNB 3FUDA 3B1TA 4PJIA 5ID0B 3IVKA 1RZJL 2LW3A 5JIKA 4ZMYA 3MRJA 2XTSA 2A0LC 3D0LB 3U0WL 2WQWA 3BXNA 3O11B 3KYNA 2YJLA 5DRZA 1BQHA 1EGJL 1BFOA 3ZGIA 1L3NA 1WD8A 8PAZA 4NRYA 1VF5C 1GGBL 3WMQA 4KOCA 5HYSA 3WGUB 3MLUL 1UA3A 4MA3A 2G4EA 1J1PH 5DRXB 5DZVA 1XGYL 1XB3A 3HAEB 4KXCA 1DJYA 4IK6A 2WWKO 4QOKB 5HI3D 4G80A 4N6RB 2QHLA 4GUOA 4Y88A 3LKRA 4NM8H 2A83B 2OYLA 1T03H 4IGBC 1AOZA 1S9WB 5ES4B 4Q8BA 3ATFA 3A6BH 3N6YA 4JHZA 4KKAD 5LAXB 4FP8L 5C0GA 4UUJB 4Z76A 1CI5A 3GDCA 2NTSP 4K8RD 2NNAB 4EI5C 1NFIB 1LDPL 1RH8A 3EJZC 4FTDA 3ZKXC 2CLVA 1W72H 3MCKB 1CBVL 2L3BA 4EN3A 4LVEA 2J4WH 3KYMB 2XYCA 3HZYB 1LO0H 3MVSA 1T22A 5DHVA 4RISH 1WVZA 5FO2A 4ZQKB 3IDNB 4P2OB 1SFDA 5IR1B 1PZDA 3CLEL 3INUL 2HH0H 4DKFH 4HWEL 4GW1B 1QNZH 2H3NA 2VN6A 4D0DB 3UPRA 4HAGA 2WM0A 2VXQH 2YD6A 1PIFA 4JPWH 4POZD 5E6RB 5LN8A 2DYPA 1E5BA 4GSRA 4W9IC 2GFBA 3BWAB 1OAKL 5TE6H 3VU1A 4H40A 4G82A 3CC5B 3TC9A 4IIQC 1BEYH 5GISL 1DQLL 2PYEA 4ZMNA 1KC5H 2XV6B 4RWYH 5EU3B 2DPKA 2NOYA 3W5NA 1SHWA 3V8CA 4L4TB 4R26L 4UQAA 3PWLA 3G5WA 1TF4A 3RJQB 4TVPH 2GUYA 3WTWA 4NKMB 1UXWB 4TMPA 4Y19A 5T3XH 4UV4H 3TEXA 1MFNA 1IGIL 4PN6A 4Y9FA 4OZGF 3CX5J 1SM3L 1IM9B 4PJ5E 1PSKH 2BY1A 4YDKL 2NY1C 1ZLDA 1M4KA 3JTBA 3FSAA 3FTZA 3HUJB 4G59C 2EAEA 3GXMA 2EYSB 2WVSA 3EJYD 3BYYA 5A6IA 2J55A 3PJSA 4GG6B 3F00A 1SDDB 4HYTB 5I6PA 4JO1L 4R3SB 1NCAH 2GEQA 3UXFA 2NY5H 4Z3TA 1PLBA 5ABDE 2DZEA 1C5CH 4Z0BH 5IT2H 2BVQA 3OZ9L 3FXIC 3E0GA 4H8WL 3NP3A 3QK0A 1WEJH 2HFGL 5E7BA 4BKTC 4LQFL 2WLMA 2HJFA 4LLWB 2FHCA 1UCBL 4EVNA 5AW0B 4H0GA 5MERA 4AYGA 4X4XA 3VFOB 1RSYA 2JCCE 2J5LB 5F7BA 3ULAB 1MFDH 5B38G 2APXA 5I2IB 3QEHB 4XE5B 1PJ9A 5F1NB 1QATA 3HJEA 1CDBA 5FUOH 1X7TA 1Z3RA 1YJDH 2A5UA 1RQ5A 1BD2B 1NAMH 3KDMA 2O5ZH 3QXTA 2XWBB 2C1PA 4U3SA 1YEFH 2YRBA 4PJ8A 4ZYKA 2WCPA 3W39B 1VFBB 1MY5A 4P57B 4Y2DB 5JHMA 1XFPA 1L0QA 4ES8A 4M7LT 3DBXA 5A6LA 3IMSA 1GS8A 3ZE1F 3QFJE 1I8IA 3NIGE 3PDOA 3NJLA 3V6OA 1F4WL 4WFFE 3GJEB 1IBZA 1VFAB 3BEVA 4UNIA 1QFWL 1FJ1B 1J0ZA 4TSBL 1SDYA 4QRUB 2XCMC 3TN0A 1I1FB 1UGKA 1NCUA 1NDMB 1I4FA 2FUTA 2RFXB 4WEUD 1PY4A 2UX7A 1E4WL 3T6ZA 5A43C 1U4FA 1PDKA 3MDJA 3HZMB 1QLRA 1C5BH 4QJ3B 4J3OD 5E8EA 4MMZB 2NTFA 4MLIA 5GGRY 3LKPB 5HBBA 1SJEB 2KPWA 1UKQA 3IK2A 3R18A 3CZEA 4XNQA 4X2UA 2ZT9C 1T2QL 3H54A 1NZRA 5D1ZI 3SCMC 5LBVA 3GEFA 4L8BB 2CDFB 3T2LA 3VXSD 4BSWA 1ZSDA 4X42A 4YDJB 3UDWA 2YO3A 2ZIDA 3MV8A 3BKMH 3QCTL 4HCIA 2DLTA 4YHYC 1A14L 3S35X 4BA0A 2R29L 5AEAA 5GGTA 3ZE2F 5KTEL 3MCG1 1ZHBB 3E8VA 3VVWA 35C8L 4UT6H 3ARFC 1ZK9A 1AC0A 4L1DA 2JELL 4YHZH 2OX5B 5F8QC 2XKNB 3RNQB 5GS2H 1N64L 2ORBL 4OCYL 3ROLA 4E9VA 2IPUG 4BE6A 4WFEE 1FVEB 1SLVA 4KRPC 5TQ0L 4ODHL 3V8OA 3FT0A 3CFKA 4XX5A 4FXKA 3FU7B 2OMWB 3KW7A 4HT1H 1HXYB 4LLUB 3L4VA 1CE1L 1TQCB 1OPGL 3BSZA 1UM6H 3EKCA 2R4SL 3T6QC 1MDAA 3VJ6A 2D7TL 4KOBA 4L3CA 5AB9A 3KPSB 2GB2A 2E7LA 3RHWK 1R75A 4DEWA 5B8CB 1HL8A 3BT2H 3RL2A 1U8IA 1RUKH 1WRFA 3CLFH 4U3XA 5CCKL 3F7KA 1EZUA 1AS6A 1OE1A 5FB8A 4YDVA 3WHE1 1FG2B 2EZ0D 3LN4B 4HLJA 1Z9PA 3BH8A 3R19A 4G5ZH 4U6XA 5B1AB 5DQ9A 3OB0H 3BP5A 3SPCA 3OKEA 1FO0A 2XWTA 4DFIA 3TYGL 3QORA 5C2BH 1FNEA 3NCJL 2ICES 3FH8A 3ZE2E 4TLSA 1P9MA 4LRIA 4PW3A 2LTQB 4HPOH 3KWWA 2H6PB 2NX5E 1KCVL 1L9OA 4H88H 2G4GA 4K3HA 3QDMD 3VMNA 1ESOA 2Q1EA 4OGZA 5BV7B 3H9ZA 3WLBB 5EU6E 1Z5LA 2YQGA 1G43A 1Z0MA 5D2LF 3VMPA 3O3BA 1VACB 4R2GB 5AKVA 3U1QA 2ENQA 4NQDA 5CLTA 3H7BA 3ABKB 1KIPB 2IAND 5EEVA 2FUQA 5D2NB 3UJTL 3H3KA 3FAWA 3HG1D 4Y4FA 4NHCL 1PY0A 2AK1H 2HT2D 4OCWL 2IG2L 3MV9E 3RZWA 4NYLA 3SDAB 4E41A 5KEZA 1PZAA 1FORL 1FVCA 3TO4A 1BF2A 2HRHA 3O6FB 4CSTA 2YD4A 2YKKA 1TCRB 1IEHA 5DEFB 1F58L 1U8NA 4QLRA 1N5YH 5ERWA 4YUEH 3EDDA 2G2RB 4R4BA 1MXDA 2ZUUA 3SDDD 4LCWB 1I9IL 1IC4L 5CP7B 5FLVA 1WIOA 1MHHB 4A68A 4ABQA 3D25B 2P8LA 3OLGA 4KK9C 2EDXA 1HXMB 2L7JA 2XXGA 3SB3A 2XWRA 2QKIC 4MAUH 3HHSB 1N7ML 2AV7B 2ITDB 2DKMA 3S4SG 3D69B 4S0HA 4NLHA 2HWZH 3T1FB 5AB1A 4O2FA 1E67A 1GJUA 4JANB 4K8RH 5J9PA 2EXWC 2W9DL 4KTYA 3VA6A 5JLZA 2A7BA 5D2LE 1ZLSL 1QUNA 2NY0D 4Y1SA 2E7DA 2CXKA 4PJ5D 2CDGB 1LEKA 1IKNA 1UD8A 4K7PH 3T65B 4C54A 3N0PB 5FDYA 4JL2A 3DBSA 4NUJB 3CN3A 1TKWA 5D7IA 2IVFC 4OFQA 3D2UB 1GTFA 3OX8B 4HKZB 4U31A 1DBAL 32C2A 1OTUD 2FJSA 4YHIA 4AW7A 4AEHL 4FTVA 2EEAA 1MAKA 2ZOLA 3PV7A 4ZS7L 3DX2A 1FC1A 4FQJL 2BNRB 2H1PH 3BI9X 3D9AL 3ZGHA 1FF5A 3RX8A 2V2TA 2AQ2A 2VDLL 2UZXB 3CLWA 3ME0A 4APXB 4AYMC 5MP6H 1A9VA 3I02A 3LEXA 5HGDB 3EF7A 2Z31D 5KG9B 3BISA 3NK4A 3ATDA 2NSQA 5C97A 2TRYA 3EFDH 2FB4H 3ZE0F 1DP0A 1WE5A 2IDSA 1MEXL 2CMRL 3QIWC 4XRCA 1TTUA 4LKCA 1XGRB 3FYIB 3VMOA 3TT1H 1XH2A 2BJML 1BQLH 1YHPA 5FECB 3O2VL 3WNPA 2JKTM 3QGVA 1TJIL 2AJZB 2PTTB 4PJCF 4ODXB 3BUIA 3P02A 4ZUVB 1LNUB 4M7LL 4PIBA 4XI5D 1TPXC 1N0LB 3FULA 4RSYA 4RGOL 2LVEA 3DO4A 4NKIL 3PWVB 3RGVD 1SQ2N 2CG9X 2AMUA 4MX7B 1MF2H 5KVDH 2FLMA 3HCVB 2QVFB 3RL1A 4G6MH 5DFWH 3QFJD 1A7QL 3MTXA 1SMOA 1GYAA 4WFFD 4WVRA 4U2YA 3QXAA 6PCYA 4HUNB 3FT3B 4XMXA 3RVTD 5F6HJ 3V0GA 4S1RL 2CALA 5AAMC 5I1EH 1XCTB 1UZ6F 2Z7ZA 2OP4H 2YN5A 3DMMC 3P0GB 3SDCC 5FYLL 5A40E 5KVEH 1TVDA 3THMH 3LKQA 4M9OA 1QHQA 2VDPL 4NAMA 5FM8A 4XCNB 4CADB 3SO3B 1AHMA 3BT0A 3QIUD 5H37A 3WNIA 4F57L 4CNIA 4PY7A 2JMRA 1A22B 1CFQB 3O2DH 4IRSD 3BC9A 5DWUH 5HVGB 4DW2H 3R0NA 5JMOC 2JSFA 1ZLVH 2R23B 3QEGL 1H0DA 2B2XL 1P4LB 5CCGE 3Q5OA 2F7RA 2PETA 2WLLA 4PJCE 1GPOH 1JF1A 1Z3GL 3T4YB 3KLHC 1T2XA 2NY3B 4ZFGH 3PDGA 4B95C 4LSVL 4TSCH 4M62L 4NN7C 3RGHA 3LKSB 4L1LA 5E4OA 4JY6A 1ZIAA 2EJ1A 5GS0C 4DJMA 1MAJA 3HNTL 4S1QH 4G8AC 1CE6B 1M3JA 2Q5BA 1K2DA 3K4ZA 4NKQB 4BCXA 5FYKL 1CFBA 1GS7A 2F1AA 3TJEL 2JF1A 1D5ZB 5A2FA 2GVYA 3ECBA 4HSCX 1T0OA 5H8DA 4AOFA 1JN6A 5IREA 4R4NC 3RDTD 3MLRH 2OL3L 3WEAA 3VD2A 2BHYA 3FO0L 2Z93B 3AU1A 3DX6B 2DBLH 4OTXL 4GIPD 4PJBE 1UZ6E 2H5UA 1VB9A 2Z0UA 5F0JB 1YECL 4NO0A 3KMDA 4J3OH 2V5RA 2UVFA 4Z3HA 5FGCB 4NQXB 1OCZB 4OQTL 2YGNA 1UEMA 1DUYB 3L3KA 3T0EA 2P42B 3PWPA 2GTWA 3DOIA 4PTUB 4C59B 3OKKB 2F53A 3AY4C 2GIMA 3Q48A 5IBTH 5E23A 3NZ8B 4JRFA 5HDLA 3TU6A 4AL8L 5CINH 2P49B 4ZMAT 2H32A 4JDVB 3ZMEA 1NGXB 2F0CA 4WTWA 5C0FB 3QS2A 4H8PA