2VXSH

Structure of il-17a in complex with a potent, fully human neutralising antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
216
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDLIHGVTRNWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords INTERLEUKIN-17A
publication title Structure of Il-17A in Complex with a Potent, Fully Human Neutralising Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
total genus 43
structure length 216
sequence length 221
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2008-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxsH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxsH01
1XR9A 3K2UH 4QOKD 4PREA 3NAAL 5BMFL 3JVGA 4RWYL 4DW2L 1OAUH 3JSSA 1P84J 4LK4A 5KG9B 2W0KA 1T21A 4ODUA 5CINL 1KCRL 3IJHB 2ZCHL 1JIBA 5FYLE 3EFDH 4GMSH 5I8KL 2DBJA 1CQKA 1RHHA 1UZ6E 2A6DA 1IILE 2RB8A 4QKXB 5BS0A 1A6VL 1QFWM 1S9VA 2IH1A 2IQAA 1FAIL 4JPKL 4IS6B 1CFBA 4BFBD 1NSNL 1G7HA 2Y23A 1OAQL 1WWBX 1A6PA 5ID1A 4ZNEA 3Q5TA 1BJ1J 1NCAL 4UV4H 5CP7A 3MXWH 1HHGA 43CAA 4KHXH 4Z7NE 4PJBA 5EC2B 1I1YB 1Q0XL 2DB8A 4U6HB 4I18C 1NAMH 1P7QA 3AGVA 4L8BB 3MV8B 4LRIA 5T1DH 1CTOA 2UV3A 1KIRB 3MBEB 2UZIH 4FTVB 1RUQL 2XFXA 1TPXC 3QUMH 4Y16A 5MI0C 5EU3B 3LAFA 4IIQB 3PNWA 3BDBA 4P5KA 2Y07L 3GMNB 3EDKA 4MAUL 3O8XD 3SBWC 3QUYC 2P5WA 5CKGA 5IVXF 1Q9LA 1CLZH 4PLKD 1BAFH 1LO3L 4K8RH 2ZUYA 2R1WA 1MRFH 1X5KA 4O9HL 5EOTA 4GOSA 5T3XL 1GOHA 5JW3L 4XHQA 4N5UA 2DIAA 2EDEA 1MCBA 4Y5YB 1ES0B 1CBVH 2OR8A 1ZK9A 3C5JA 4FQQB 4ZUWB 2XTJC 3VGHA 1XGQA 1X5AA 1L0XA 3D5OF 3V7AE 5JIIA 4V2CB 3EZJB 4JM4H 3DOSA 4DWHA 3RY5A 4F37K 4GT7A 4QF1A 1J05B 1LK3L 4MJIE 5KJRH 1F4XH 3NFSH 2DWDA 3GUTA 3KYNA 2AI0H 2ITDA 4ZYKA 3QIWC 4NPYA 3LCYA 2P44B 1N6QL 5F7NC 1AC0A 3O4LA 3IFPB 5E8DH 2ZCLL 3RPIA 5I16B 2HVJB 4GKSB 3O6FC 2X89D 3LN4B 1TCMA 4WI3A 4YHZH 1P7KB 5EBWA 4Y4FD 4Z77A 5LWYL 3U0PA 4M48H 1SYVA 1MCDA 4WIQA 4X4YB 1TVBA 1RJLA 3PQYA 4YXKL 2VTFA 3MNZA 3QNZB 1HHHB 4MAYA 5IP4A 3GJEB 4OCXH 3BH9B 1UEMA 5TQ2H 3RFZC 2EXYC 4GQ9H 4LSTH 1A6TB 1QA9B 1QYGH 1G1YA 5TE6L 3BZDA 3GBLA 2VDRH 4Q2ZB 1MI5A 2BJML 1HEZB 4GH7B 3QQ4B 4J12A 7FABH 4PJ9B 3IGAB 2NZIA 4QRPA 3NCCB 5FYLH 1JPGB 3V4VL 4PV8B 3Q2CA 5I17B 5HYSB 1KTKE 3H8NA 1YJDH 5D1XA 2VLKA 5F1SA 4GKNB 1MJJB 3KHOA 4L5FL 4PJDB 2YD4A 3QG7L 2ENSA 2R2EA 5GSVA 2C3WA 1JZ8A 1M7IB 1J18A 3B6SA 1DQQA 2BERA 1QLFB 5DT1H 3TCLA 1DBMH 1A6WH 2CDGB 2VJXA 3D0VB 2DLTA 2XWBA 1VFAB 4Z78A 5I30H 3I85A 3UZEA 5ID0B 4GRMA 3TJHD 4NZJA 3IDUA 4YR6A 4PG2C 4G6JH 4XP9L 2W91A 3A6BL 4XI5C 5E70A 1QSFB 3TBVA 3CSPA 4JAMA 5BXFA 4I5BB 2V2XB 1IL1A 1Q0YL 2BVUA 4HSQA 5E8EA 2WWMD 4DKEH 1LEIA 1BQLH 1ZHNA 3TZVA 3AS1A 1A7OL 3U36B 4XCYA 4Z7UE 2FEEL 1D5BB 5IB1B 4WU7B 5I1KH 4G43A 5DVKA 3RY4A 3SJVB 1WEJH 3SGKC 1KJ3L 5IFHL 3CVHA 3B3IA 1IMHC 2HN7B 4OIBA 1PG7X 4EI6B 3KPSB 4YHOL 3MRBA 5EU7E 1NGQL 2JJTC 5ISZD 5LGHH 5KSAA 1IBGH 3S36X 2O93L 1M7DA 3MTRA 2MKLC 4RCAA 2DWEB 3IU3A 5F6HJ 1UH4A 3DUSA 4L29A 4OLVL 4ZFFA 2J88L 1U3ZA 4ZD3H 1MCCA 3VA6A 5C86A 5FKAA 2B8OT 5L8JB 3SDAC 1U8QB 4LL9A 3MRQA 3WDIA 4ODWA 3F7RA 4K7PH 3AMKA 2WANA 5IGXH 4QXUH 5ERWB 5EZOH 3PHOB 3T0DA 1T1YA 3QDJB 2BOBB 1S7VA 4YGAB 5FDYA 2ZPKH 2FLRT 4L9DA 1RJCA 3BQUA 5JOFB 5CHNA 3AS0A 4EXPX 4L3CA 5GGSA 3QJHB 2DOCA 1BFVL 1RULH 3CPLA 3FQRA 4PGZA 4WCYL 3MV11 5DJCA 5B39A 4XNUH 1WIUA 4DGVL 3UDWC 4GRWB 1XZ0B 4ZOAA 3HFML 3J8F7 4HT1L 1FZJA 4WUKL 3SKMB 1NGXB 1AR1C 4MB3A 1KCKA 4OZFG 4IM8A 3ZL4L 3OQ3B 5F1NB 3EGSB 3W5MA 4Z7VA 1KN4L 4K8RC 4OKVA 2ADJB 2W65A 1KNOB 4MWFA 1JK8A 4QO1A 3GNML 4KK6C 1N2RB 3UJTL 3FQNB 4PJFE 1ZV5A 2QLVB 2YBRB 1U91B 1NMAL 4QYOB 4WO4D 1BD2B 1AE6L 2V17H 4GKZB 5BVJA 2YPLE 2X7LA 2BY1A 4XPGH 4B7IA 1I8IA 4NZRH 5I1EH 3V5KB 2VUYA 3SE3A 1X4ZA 3CFKA 3UROR 3DROA 1F58H 4WWKC 5E2JA 3HC0A 1EERB 2AERT 4NN5C 5SWSB 4A2MA 3UMTA 1D9KA 4EQ3A 4F9PC 3IDNA 1HE7A 3RL1B 2E8YA 3HUJF 4NC2B 4AH2A 5L6YH 1JTPA 1UKSA 5A3ID 5F44A 3H6JA 3KPQB 4PJXB 3HCVA 4LLDB 1FORL 4Q9QH 1HCVA 3C6LA 2YD1A 4BQ6A 4LLVB 1YMHB 4GAGL 3GM0A 2HJFA 1CXKA 1I1FB 2XG5A 3DXAE 3PP4L 1YEKL 2CPCA 2HLFD 2VDKL 4HEPG 3R8QA 4ZO8A 1GGTA 4NQSA 1F4AA 4YJZL 2GJ6B 4NP4L 3LKNA 1RZFL 1M4KA 1OSPL 4NQCD 4WW2F 3SDDB 1FN4A 3T77B 4MJ4A 4F2MB 3S37X 1YJDC 2KL6A 1AIFB 2BVTA 3QCTH 5T33H 2FSEB 4I0CC 1BEYH 4FQ2L 2VC2L 5JW5A 2OI9B 1CF8L 2AK4A 2RFXA 5I8OH 3QIUC 3TNNB 3Q3GB 5CSZB 2B1AL 2VR5A 4WV1A 4ERSH 1W0VB 4XTRD 3FN9A 3O6KH 3SN6N 3H2WA 1QO3B 5BJTA 1H3WM 4JFQA 2G60H 3SHSA 5F8RC 2E27L 5JZ7C 1U0QA 1RZ8A 3I02A 3EW3B 3TBWA 2YRPA 3LKOA 1XCQA 1XGPB 4AK1A 4X7FC 2X1PA 2WUBH 1XIWA 1U3HA 4OFVA 3BE1H 1QHOA 4R7NB 2ARWA 3GSQA 1BFOB 4HG4K 1NBYB 1INEL 1MCLA 2GSGB 2BK8A 4XWOC 4OGXL 3QCUL 1YEHL 3RZCC 3GSOB 3X3GL 5F71A 1HYSC 3E8UH 2X4SB 3S35X 5HGDB 2NY7H 5KAQF 4ELME 3EFFB 1T2QH 1OTSD 4JB9H 3ARFD 3DBXA 2ICWI 3HI6L 3D69A 4G80B 3UJIL 1P84K 5AG9A 3K1DA 2CR6A 4YFLF 3RWEA 3VFMB 4G8FA 2FATL 2GIYA 3PP3K 1NCCL 3QI9D 5EIVA 4RGNB 5FECB 3EJJX 2NW3A 5KSBE 3QPQC 2R4SH 1KCUH 1F4YL 2X4RA 5T5FL 1CICB 4OZGF 5ADPL 1BOGB 1FBIH 2BFVL 3ARZA 3EO9L 1KTLA 4WI6A 3TN0C 1IEAA 4JKWA 2VL5B 4XC3L 5T3ZL 3D48R 3WS6C 4RQQB 5D5MA 4GUPB 2APWA 4P49A 1LP9A 4JHBA 3QIBA 4EZMA 3VFRB 3EUUA 2DM4A 4JDVB 5SX4H 1V7ML 2YSSA 1JF6A 2YUZA 3HPJA 2NW2B 5JLZB 1R0AH 3RWIA 3NBNA 4NRZB 4ONFL 4JG1L 1IC5H 4JM2D 3UTSA 2CLRB 3S97C 3EOTH 4MXWL 4XZUA 5EUOB 3L5WB 4TVSa 5DVOA 4Y4HA 2VO5A 2XPGA 2C3HA 2XZZA 1U9KA 4MNQA 3SDYL 4IHOB 1JYNA 3D39D 1CZ8H 4GLRH 4QLRA 1J0HA 3IXTA 5TE4H 3PL6A 4EN3D 5IROC 3E6FA 3EHBD 3DYOA 4IMLB 3FTGB 5EO1B 5F7LB 2H9GA 1SYSA 1N64H 1F2XK 5HJ3B 3BMWA 4QOKB 2MNUA 4HXAL 1C7SA 2JB6A 3HN3A 4R97B 5DC4B 4Y2DC 3FB8A 2FB4L 3PABB 4WDIA 2VDPH 2XA3A 3DX6A 4QHKI 2XZCH 1DVFD 1WZKA 2EECA 5J57B 3ARVA 3FFDB 3VDCA 2MSPA 4J3VA 1CGXA 1F00I 1WZ1H 5HYQB 4NQDA 3U83A 3DYMA 3MCKB 3L3OA 3UTTE 1BLNA 3BT2H 3L5HA 3VFPB 3U9UB 3OF6D 4U1HA 1WBZB 1WWAX 2VDQL 3GHEL 1FV1B 1TJHH 4LU5L 5BZWB 5C0EB 1UM4L 5K9QI 3KLDA 2IMMA 4UT6H 2IALA 1J8HE 5MEND 1B0RB 1W72B 4HWZA 3TPUA 3EYVA 1F3DH 2R29L 1NAKH 2EDNA 4ELMF 1HOCB 4JZOB 5E2VH 5F9WC 1NGYA 1KYOJ 3RWFA 1GPOL 3RBSA 5E5MA 2GHWB 4XB8A 5JO5A 3PIQA 3IDMB 5L8LB 5KSBF 3HC4H 5CLTA 3NCJH 1R5VA 1Q38A 1LDPL 5DJ0A 2JKXA 3D18B 3OJ2C 2VZ3A 5EU7C 1I3RA 4ZXBC 3SO3B 3O8XB 4NC0B 2H1PH 1KEMH 3VW3H 1JPSH 3QUYA 4N1EA 4KQ4H 2GJZB 2VAJA 2VQTA 3KPRE 5E95B 4UBDC 4LSUH 4TNVF 2M8XA 3S9DB 3X3FL 4PTTB 5DS8A 5B8CC 2BX5A 4JFEE 1N6UA 1MJUH 4M1DH 4AMKL 4J8RA 3HG1A 3DMMD 2DKUA 5JXAL 4WY7L 5DUPH 4KHTL 2PW1B 1EO8L 5C07D 6FABL 3PDGA 4NN7C 4KTEH 3PE9A 4MYWB 1GJIA 4KI5D 1KXQE 1GL4B 3K2UL 4YNYA 1AKJA 2NTFA 2E9JA 4X80L 4UIMA 4ZO7A 3AROA 4ZAKD 1OAUL 3T08A 3WIFA 3QIWA 3MO1B 1EEUA 2HFGH 1KCSL 5JW4M 1MCOL 1FFPB 4HIIB 4M61B 3G5XA 2D7NA 3VFGL 4BZYA 5C6PB 2YKLL 1HINL 3F58L 4GAYA 1FQ9C 5DK0B 4LGSB 5AYUH 2AS5M 3O6FA 4ODHH 1F4WH 4Y4FB 4U3CA 2HTKC 1QBLH 2BXYA 3WNMA 4JFFE 3RWJA 1JWSA 4C59B 5T3ZD 5C0JA 2WWKO 1HQ4A 1WVZA 2CLZA 3GJFK 4X5WA 2MWCA 2YD3A 2ZUVA 4XB7A 3MXWL 5T1LD 2BDNL 1H5BC 2ATPB 3FOMB 4KHXL 4NO5A 4C83A 1HKLL 4M5ZL 3BP5A 2VITA 3REVB 3NCEB 3DPBA 3LZFL 1NAML 1H3TA 4XPAH 1JFQH 3MLPA 1FG2B 5T1DL 5LBSH 2UZIL 1ZVSA 3IKCA 2NNAB 3BP6A 3VD3A 1IC4L 3AY4C 3X13B 2OZ4L 1GZPA 4NM4H 4P2QD 4LEOB 3LV3B 5CEXA 3ZTJG 1E27A 5BW7A 4YDJA 3MRPA 5HSFA 4MDJB 5DZOA 1KJ2A 4DVRH 4H1LH 1MRFL 3OKOA 1KBGL 1Q94A 4D2NA 2NPLX 1ERNA 3ZDXE 1A14L 1Q1JL 4ONHA 2ARJQ 2Z31C 5CSBA 2FX9L 3VE0B 3B2UD 2O5ZH 5ICXB 4QXTB 1K4DA 3MGTA 1N5AA 3R0MA 5DEGB 4HIEB 5F1IA 4ZPTA 5KJRL 1NGWB 2VXVL 4PG2A 3WFHB 3PXJA 1A1OA 5I8CA 2LE9A 2V2TB 4W81A 2CH8A 5EU6A 2ESVE 3FFCE 5D4QA 4MXQD 5E2WH 3WN5B 3DVGA 4MQXD 3VXRB 1ZLVK 3RRQA 3ZHLA 4YHZL 4EOWL 5IW6A 4YHIB 4KZDL 2WM0A 4HAFA 1S7RB 2O26U 4HWBL 4X6CF 2A9MH 5EG6C 1TTGA 5C0CE 3TA3D 1MRDH 4O2EA 1N0XL 5E9DE 3H7BA 1KJMA 3BEVA 4X98A 2QHRH 1F97A 3A6CL 4PJ8D 4XP4L 5ISZB 3BH8A 1MCQA 3MV7E 3BRFA 2EYSA 4NKQB 4GQ9L 1QYGL 4MB5A 4R9HA 4KTYA 5DRXB 3ARBD 1NJ9B 3DWTA 1NBVH 2D9CA 2NX5A 1A4KB 1XF4B 3NIGE 5DJXB 5ANME 1DQML 4OBRA 4HS8L 1T20A 1FLTX 5D8JH 1QSED 1WF5A 1IT9L 1S7TA 4WRLA 1EEZB 3WXVH 1LDSA 3SDAA 5SV3A 2H32H 5J3HC 4R7DB 4D8PB 2PTTA 1YJDL 2Y9RT 1JHKL 5FYJU 2NXYD 3CMOH 3RAJL 1OT1A 5C0IA 1ZHLA 3I9GH 3WNOA 15C8L 1CXIA 4MNGB 4D0BA 4OD1L 4ZOEA 3ZKMC 5ADOH 4OLXH 4DKAA 1DBML 1LEGB 5IM7A 4K7FB 4EI5C 1UEYA 1MQKL 1A47A 2R0WH 4G8IB 4XPTL 3UDWA 5CJOH 3RUGA 1WT5C 3QUMA 4M43L 1FNEA 3GJFB 2DQJH 2E9IA 3OL2A 4N90D 2YHGA 1X9QA 2LU3A 4YWGH 1EEYB 1FZMA 1Z6JT 1SM3H 4M1GH 5I1JH 3WXWH 4I13B 3L3IB 1N8ZB 1XF1A 5DGQA 1H8OA 4DZ8B 2YPVH 5IFJA 3T4YA 1IEBA 5DJZB 1JWMA 5IVXA 4KMLB 3ZDXF 2JCCE 1P2CA 2G2RA 4MQTB 4WO4B 3O45B 1T80A 3GGWB 1GGIH 5I1LB 2EXWD 4FQXC 2Q7YA 2CK0L 3KPMA 2BNUA 5I74B 1YY9C 2WINA 2P49B 3WHE1 1INQA 3KNBA 4LCWE 4J1UA 5GGTA 1YA5A 5FV2A 3OJDB 5GJTH 4WWKA 5LGHL 5GS2D 2YS4A 1IBGL 4FZEH 5FYKD 4LFHG 5IR1A 4KJQD 1DSFH 2DN7A 5MEPA 1H15A 2QSCL 4GAJL 1FVDB 4ZD3L 4F9PA 1ODAA 3BZFB 3BEWA 5J6GA 3HA0A 1YECH 3RKDD 4JANA 3U7AA 2NXZC 2FGZA 3QBTB 2IADA 4WFHD 5CMAA 5IGXL 4QXUL 2ED9A 1OF2A 3K1KC 3G5ZA 2LU7A 2X4TB 1I7ZA 4NOBA 2IPKA 1BF2A 1MFAL 1MCHA 5J06A 4GG8A 32C2B 1RJZA 2OR7A 4I9WD 2UUDH 3NCBB 3NIGF 4K23H 2IAMC 4OZIB 3V0WL 5FCUL 4NQCB 5F7UA 2EH7L 4C54A 4W4NA 1I3GH 3DV6A 1W0YT 3L7FB 3OGCA 4I0KA 4JPIA 4PJIF 5I0ZA 4Y7MA 1WQVT 4PLJD 1MVUB 1NEZB 3TBSB 1TENA 4TQEL 3ELAT 3SY0B 2E6JA 4LSVL 1NCUA 4XGZA 2IBGA 3VFVA 3QIUA 5IHUL 4FG6C 4G7YL 3IDXL 2ARJA 3LMJH 2HFFA 3QZWA 3RHWK 4F7MB 5GRUL 1T1WA 5L0QB 3QNYB 4GW4A 4UTAL 4A2LA 4JLRA 5D2NB 4OI7A 1MRCL 2VE6A 4NZRL 4F58H 5I1EL 4CVXA 3WCYA 3QWRA 4Y89A 3BKJL 1EBAA 3MREB 5EOQH 4OM1H 1F58L 1HHKA 3SE8H 2H8PB 5AWNL 2ZOLA 1FL3A 5GISH 5HD8D 5HYJD 1CT8A 4LAJH 1FYTD 2IPTL 4XCNA 3I75B 1VGEH 3WSQH 3RZCA 3OXRA 4XBPB 2JCCF 2F74B 3CFIC 4JREC 1X5YA 3LH2L 4OLEA 2C7UB 3ARFB 5EORL 3MRLB 4UV7H 3ULUF 3I50L 1T4KB 3OXSB 2Q7NA 2YR3A 4KJWC 4YGVB 1QPPA 2D2OA 2GCYB 4M9PA 5JIPA 5DZLA 4HGWB 4K94L 4ETQB 1KPRB 3QI9B 3WHE0 1ZT7B 4LOUC 2YK1H 2HT2D 4N5ED 4J3WA 4BSVB 4L4VA 4GW5B 1E4XL 2GFBB 5D1QD 3VXQA 1JGUH 1R3LB 1NANH 4XP1H 3OAZH 4IJ3B 3BPCB 3CLFL 3IFOB 1RURH 4RFNC 5C7XH 3WS6A 1T5WA 3SQOL 5FEBA 3QO1B 2DF3A 3FQUB 5IT2L 3LN9A 1YMME 2YD5A 5DO2C 3VRIB 5GZOD 1NBZA 4ORGA 1N59A 3QCTL 1KYOK 1VA9A 3CCHA 4LSDA 3M8OL 4CVZB 1QTYT 4PJAB 4UTBL 4LLYA 5AAMA 4HX1A 1TJIH 3KR3H 4JM2B 4ODTL 5ESVA 4TSCL 2CRMA 1AP2B 4ERSL 1FZOB 3ROOA 4JRXE 3O6KL 2IPUG 3O0RL 1LILA 3LPFA 1YEDA 1AXSB 4YDVB 3D39B 3SDCC 5ALCH 3FOLA 3W11C 3ZT6A 2ADFH 2WUBL 5EWIH 4PUBH 4EN3B 2X2YA 3L5IA 1MIEL 5IROA 1RJYB 1RUPL 2NCMA 1A7QH 3I2CL 1A7PL 1QRNA 1FNFA 1U8MB 5DRNB 1DJSA 3QEUB 1P4LA 3S5LA 1HQRA 3E8UL 2RAMA 4WTZA 3DGGA 1IKNC 2CMRH 1KUMA 1DVFB 4R2GD 1TZHB 4JB9L 2BHUA 3Q1SH 4KRNA 2GUOB 2XV6B 3CFCH 4IOFC 1CFQA 4UOJA 5FO8A 2D0FA 5DYOB 3DARA 4BUGA 1F6FB 3WHXA 1F3RB 1YPZA 5AYQA 3MGOA 5BZDB 2Y25A 2F8XC 1EDQA 4N0UB 5HHOE 5JORB 1KCUL 1UXSB 3U4EB 3BUYA 3LIZH 4WNQA 5HDQH 3O3BA 3BJLA 4KFZC 4Z0BH 1B0GA 2P8PA 5MENB 3JWDL 3KLAA 3RTQC 4JGMA 3G6AA 4FQ1H 4OZFB 4WJ5A 1DBBL 3P0YL 3V6ZB 1EGJH 2GITB 2EEBA 4Z7UA 2QSQA 3T0ED 1U93A 5CZVL 3QEHB 3KHQA 5FGRA 4UILH 4MMXC 4RA3A 4NO3B 2WAHA 3CFBB 5DF0A 3M1BB 4AEHL 3MA7A 5DEZA 1Z9MA 3TV3L 3VFOB 4ZUTB 2X41A 4OM0L 4ZXBA 1YQVH 2XWJA 1DEDA 2AABL 5DD6A 3U9PL 3BAEL 5EU5B 5DHVA 2EZ0D 2WSKA 4GQPH 1N6VA 3PGCA 5ICZB 4Y4KC 1I3UA 2WIMA 3NIDE 1CZ8L 5B8CA 2Z92B 2AXGA 3E6HB 3DMMB 2BSSB 1G9NH 4LFHD 3H3PL 4KKAC 3QXAB 1XMWA 5CJ8A 5F21B 5B21A 5C07B 4NZTH 5KS9A 3B43A 5L2JA 4GXVH 1SEBB 3IDJB 2XKNA 3TBTA 4X7EC 2VLRE 4ZAKB 4NKOA 4JG0L 2XZCL 3IF1A 4GBXC 3DVNA 4OCMC 2YA0A 3BKYH 4CW1B 1VACA 5IB3A 1WZ1L 5EPMB 3OKEB 4H0HB 2EDDA 1XR8B 4O4YL 2MQ3A 4G6KH 5I9QC 3SCMC 1DEEA 5IJVA 1BWMA 2W38A 4L4TE 5GGRA 2VDNL 3HS0B 4Y8AA 5D7LA 1TJHL 5MERB 1QLRB 2HTLD 1NDMA 4YHKH 1QSZA 3H7LA 2AJZA 4JFOA 3LEYL 4MS8C 4HDIB 1TZGH 5EOCH 5ESQB 1T7WA 2X5PA 3Q6FB 5LGKA 2B1HL 3ES6A 5T1LB 4FABH 4WTXA 1OD9A 2BVQB 4KY1H 3ZKXC 5TPWH 4S1RL 2A6IA 4PJFA 5CUSL 2VQ1B 4M3JA 5DXWA 4MD5B 3VGAC 3W39A 2MHAA 4FMKA 1M05B 3RJDA 2YPLA 4P99A 1NMBL 3GIVA 3M45A 1CDCA 1GH7A 4P4KC 5B39G 5ALBL 4P2QB 2H1PL 5CSGA 1KV3A 2DTMH 3DSNA 3SDXE 3VW3L 1JPSL 1DL7H 1J5OL 2FH6A 4KQ4L 2NY1D 4HW6A 3IFLH 4LVOB 5IESH 2D3VA 1X4XA 3GMMB 4L8SB 1MJUL 3EYUH 5HGGS 3LDBC 1PX3A 4J2XA 2Z31A 3L3KA 1DQDH 2X10A 2R0KH 3ZE2F 2EE3A 4PTUB 5DUPL 2EIZA 5I6XB 5BS0D 2DIJA 1ZHBA 5JHDD 5FIEA 3UZVB 4OI9A 3VFTB 1EK3A 5F1OB 4LHUA 4XVSL 3T1WA 1UA6H 2IFGA 3HRZB 3KPLA 3MLWH 4HKJB 3U46B 5FYJE 2IEPA 2HFGL 35C8L 1MCIA 3NIDF 4AIOA 5C0AA 4JY6B 2VIRA 2Q3AA 5DWUL 1NCBH 3NACL 4ZTPH 5IK3B 1UKTA 1P7QD 5EZLA 1XF3A 2CKBH 2H2SC 2C4FU 2JK5A 3OB0K 4H25B 3W0WA 4K71C 2VISB 3TA3B 1EHAA 4N8CL 4DTGL 4HJ0D 4PJ8B 1LO4H 1DLFL 1MEXH 2P5WD 3QHFL 4UMGA 4CUCA 4HKBA 2FYYA 5TGBB 1BP3B 4O58H 4OV5A 2HKHL 3ARBB 3K0WA 3NZ8B 3LQMA 1X4YA 4Q6YA 4AYFA 4FA8A 3SKJH 5ICYA 1UVQB 1QSEB 1JFQL 1WZMA 1HZHH 4CVWA 5LBSL 3RNKA 5T5NG 1Z2KA 5ECJE 4I0PD 3IXAA 1S9YA 5F3HA 4CVUA 2NXYB 3TWCL 2Q3ZA 1ZHKA 3MMEA 2H26A 3MRNB 4KVCL 2J6EH 3I6KA 5CZXC 2R39A 4M8QB 3ULSA 4DN4H 3O4LD 1SHMA 3S3PA 2O5ZL 5DA4A 3FB6A 1P4IL 1SY6H 1LWRA 5TDPB 1QFWI 4NO2A 3F7VB 1A7NL 1WT5A 4YQXH 2NTSP 3PQYD 5KSBA 3QG6B 4OLZH 3FN0H 1PYWA 1SMAA 4MAYD 2YRLA 3SDXF 1WCBB 1OGAE 3PGFH 1G7QA 3GSXB 3HLAB 4FHBD 1BZ7B 1ZA3A 5GGVY 4HJJH 1MHCA 5J89A 4PRID 3IT8D 1MI5D 1G9NC 2CD0A 4F3FA 1KTDA 4P23B 4PJ5D 1JYWA 1EUUA 4KDTA 3GKZA 3DRTB 3WS3A 5LGJA 1MRDL 5J1AA 2VLKD 1TJGH 4LHQB 5HBBA 1N26A 5E6ID 3FZUD 1IC1A 1YZZA 3RGVC 4TUJA 4BSWA 2D0HA 3EYOB 5FCSH 3RL2A 5F7DB 2ICWA 1MWAA 3C6SA 1U8LA 2DQIL 5KANG 4XWGH 2QJDA 1U8PB 2HH0L 3MR9A 5L88L 4TOYL 4UU9B 1EXUA 5FYJH 4ZO6A 1I1RA 4PRDA 1U8HB 1FFOB 4HIHA 3L1OL 3D9AL 1BM3L 5E8OB 5CJXC 1A3LL 5I1IH 1KCLA 3FO1B 5FV1L 3HR5B 5H37H 1PW3A 3K2MC 3KYMB 3I9GL 4EBQH 1ZT4B 3TT3L 3VH8G 1KULA 3SPVB 1XFPA 2P7TA 1TZIB 2CO7B 4OLXL 4PFEA 4YK4C 5DSCA 3TZVD 2I5YH 1AD0B 4C56B 2R0WL 4O00A 5E94A 4XVUC 4M7ZB 4NFDA 1NFIB 2DBLL 1JYXA 2CXGA 2FX8H 4HLZG 2OM5A 4R4ND 2FIRT 2ED7A 1Y6NR 4ODSH 1EZVY 2OL3B 2WNGA 3NFPA 4F7TA 4YWGL 5HHME 5I1JL 3ARUA 5DMKA 5KSAD 3WXWL 4YEFA 4H1LA 4RDQF 2ZSVB 1FLRH 1QR1B 5CJQH 3C08L 1NPUA 4PGJA 2R56H 3BW9A 2WLZA 1PEWA 1JGEB 4KPHL 3QQ3B 1RFDH 5FA4B 4I2XE 5IB5A 4R26H 5JDJA 4NKIL 1MH5A 4UIKL 2BNRE 5IQ9A 4S10A 4UDTA 5KSUB 3WL9B 4HH9A 4K3GA 3T1FB 3BQUD 3BYYA 5HYJB 1U8KB 1FYTB 2DQCH 4AG4H 3THMH 2DQDH 1TNMA 2P47B 3QO0A 2ZOKB 3P73A 4O2CA 1YECL 5FF6B 5DDHB 4DUWA 2V5YA 4XP6H 4ZFOL 1IGTA 4B5EA 4JFEA 1XGYL 4QNPE 1DE4A 5DC0A 5TH2A 1CFSA 1Z5LA 4Q9RL 4OQTA 4X7TB 4OB5L 1IGYB 1F2QA 5D1QB 4QCIB 1HH6B 5E8NB 4DN3H 1OAZL 3GHBL 3VXTB 2AV7B 4MA7H 4HQQH 3T4AA 5C6WH 2Y5TB 4NNXA 1KLUB 1C1EL 4TSAL 4HJGA 3MV8E 2ZUTA 2EYRB 4FTVE 2A6KB 1INDH 2R1YB 1A02N 4LRNH 1KCVL 3B9VA 3EDDA 1ZGLP 4LDOB 5FHBL 1I8MA 1A0QH 3QWOB 4ORZC 4KKLC 3LMJL 3GMLB 3C60D 2C1OB 4QTIL 3U30C 2BSTB 1G9MH 5JQHC 2YD7A 5DJ2A 1TETH 3U6RB 5DUBA 4U6XA 1MCFA 3DNKA 3CX5J 4DFIA 2W0FA 3ALPA 1QSVA 1J1PH 4PP1C 5EOQL 4X6EA 4M5YL 2HT3D 3P3YA 2VOTA 4XCCL 4IRZL 4YBLB 4Q7DA 3X12B 3SE8L 1NC4A 5JXEA 3HMXL 4UUJA 2HKFH 3LKQB 5KZCD 5DJ8A 1AGDB 5GISL 1RMFH 1Y18A 4OFDA 5C8JA 1IQDB 2PNDA 2BC4B 4BA8A 1IQWH 1OCWH 2APBA 4Z95H 1HI6A 4J3XA 2DL2A 3BPLB 5CEYB 3MRRB 2PTUA 3W2DH 5C0RH 1IKNA 1I1AC 3HMWH 4R2GB 5FK9B 2D7PA 4UV7L 1G7LA 3FRUB 4DEPB 4ZOCA 1YUHB 4APQC 4KKNA 5FUCE 1T04A 4FXGA 3QYCA 3ULUL 2W60B 2EDQA 2CDEB 1K5NB 4WGVB 2AK4D 1F11B 3TT1H 4KXZH 2VMFA 1RUKH 2AJUH 3BPOC 4QGTA 1I8KA 1LEKA 2WQRA 1WAAA 1SVZA 3RTQA 3DLQR 4UINL 5CBEA 1QG3A 2ESVA 3FFCA 4KQ3H 1LD9A 2APVA 5A40E 1YYLH 5HI5D 4QNPF 4JZNB 5ENWA 5J9PA 3FO0H 3T0EB 3P77B 2FHFA 1DQJA 1GSMA 3P9WB 1XIWD 4U2ZA 4HHAA 1LE9A 3BP7B 5FM8A 4OUUB 3O3AA 4PJDE 5E9DA 3DSFH 1TJIL 3FB5A 3KYKL 5C0CA 3VRLF 2AJSH 3RIFF 3DUUA 3E2HC 4POZC 1FO0L 3I6GA 2DI7A 3MV7A 1AGEB 1Z9OA 1UB6B 1T1ZA 4HK3N 3IAGC 1N3NB 4Y4KA 1E6OL 2XOTA 4OBSA 3S34H 1PQZB 5F9DC 4Z18A 2R0ZH 1QBMH 3NH7H 4K55A 2EC9U 5F9JA 3RWHB 1T22A 3QHZL 3H0TB 5F1KC 5DVMA 1GHFH 3HTLX 5TQ0H 4NGHL 1WBXA 4S0TD 2IPUK 3HUJB 1I7RA 2O61A 5IHZA 5GRZA 1H3GA 1KELH 4X6FA 4GBXA 1UYWL 2VXQL 3HZYA 4JHAH 3WJJC 4TRPH 1T66D 3EJYD 3MNWA 1CN4A 3MRFA 5EIQA 3ULVD 3QIBD 5BV7L 1RUMH 3AU1A 4RRPA 3G04B 3MACH 5JOEA 2LV4A 3HI5H 1MPAL 1X5JA 3SJVE 5E08L 2NMSA 3HZKA 4F9LA 4F7CA 1P6FA 5IW3A 1AXTH 1RUAH 1BZ9B 3TPKA 3SCMA 4FFWC 5TDNA 2EDKA 4MGXA 4AL8H 3IVKB 1GYAA 3UTSD 3K8MA 3LN5A 4PD4J 2FJGA 2Z4QB 5HDQL 4LEXL 2F9BT 5CIPH 1QFUL 1FRGL 4JFHD 1RZIB 2VXTH 3K74B 4MD0B 4MA1C 2EKJA 2JCCA 4MVBD 3DX9A 4NDMA 2E9WA 3CGTA 3H9YA 3R06B 4FQHB 3E0GA 2OQJB 3WLWC 1NGZA 3ESUF 4CNIB 1JPST 1UB5B 2KQNA 5IIEA 3STLB 3VXOB 4WFEE 3PJSA 3QDJE 1GGCL 1EIBA 4PREB 1YQVL 3PWLB 4RGOH 5LJYH 4M6OL 1JRHL 5IB2A 2NY1B 4DAGH 2FCBA 1FL5A 2BSRA 2LAGB 1IM9A 4NCC1 4RIRA 4ODUB 1GOGA 3IFNH 5IF0B 4GRWE 4NQDD 4K2UL 5I2IB 1RHHB 1ZS8A 4HCRA 2A6DB 4NZTL 5BS0B 5JHDB 4GXVL 4BZ1H 2IH1B 1RZ7H 3ETBF 4DKFH 3O2DL 3L5JA 2JTDA 1G7HB 12E8L 1SJHA 5ID1B 3UPAA 4HFUH 3RI5K 4NKDB 1G9MC 1T0MA 5CP7B 3W82A 4ELKB 2EEDA 3TH2T 5CGTA 1BF8A 1HHGB 5AEAA 3QXDA 1BD2E 2ZJSH 1ACZA 4BSJA 2FO4B 2YC1A 5EH1A 1YNLH 1D5IL 1WC7A 4QHUB 5IVOA 4G6KL 1P7QB 1ADQL 2KDGA 2C1PB 1JPTH 3LKRA 4F15B 2BSED 5SWZD 4OZGB 1DTUA 4OTXH 3AS3A 4BH8B 3AREB 4OKDA 3MFFA 3PNWB 4D0DA 4YHKL 2AJVH 3VXNB 3T0WA 4D9QE 5GZND 5F9OH 5SWSE 5EOCL 2P5WB 1HHJA 1TZGL 5TE7L 3QUYD 2W9LA 4POUB 4DVBA 2R1WB 5EOTB 3V6FA 4FABL 5IMMB 1C12A 4BELD 4RZCA 2HVKA 2XXMB 4PJXE 3C5JB 3HG1D 3MODL 1D6VL 4WEBH 4M4RA 1G0YR 4V1DB 3DI2B 1G6RL 3DX8A 3TLRA 4I0PB 5D7JD 3KAAA 2XQBH 1S5HA 3UC0H 4D9RE 5D2LA 3V5DA 1F90H 2DTML 3C8DA 3GUTB 3KYNB 1DL7L 4ZYKB 5FM5O 5AUMA 3QIWD 2GJ6E 3IFLL 3NCMA 1YC8A 5HHVL 1MREH 3EYUL 3O4LB 1EGJA 3O81A 3P4OA 4F37F 2VLJD 1Q9WB 1A7BA 5F7KC 4CN4A 2Z91B 4ZFZA 5D9SA 4P59L 2GYSA 3U0PB 1SYVB 5LAXB 3OKNA 1TVBB 3PQYB 4MQSB 3DX7A 2R4RL 4R4FH 3MNZB 5EN2B 4MAYB 3ZKND 1FPTH 3DTXA 1DBKL 4RSVA 1FCCA 5KSVB 4PRIB 2G75B 1RHFA 1MI5B 3T3PF 1W0WB 1NCBL 4TTDC 3HPLA 4PJ5B 5D1ZD 1EH9A 1U8JB 1YMMA 3ARDD 2CXKA 4ZS7L 3MLZH 4GRWH 1KXTB 3MBEC 1K2DA 3O6MH 1PSKL 1PZ5A 1JVKA 4QRTA 2VLKB 4IIQC 2HJKA 2AQ2A 4PRAA 2DI8A 5E6IB 4HMEA 4UQ2B 1ZLUK 1WIOA 2R2EB 4M7LL 1A5FH 4NQED 3RGVA 5GSVB 4PJHA 5DJ6B 4O58L 5CD5C 3B6SB 1DQQB 4Y5YC 3H9SE 1SVCP 1A64A 3IJSA 4H5SA 1BBDH 4JO3L 3QA3A 3SKUD 2XWBB 3ZMRA 1HZHL 2GAZA 4Z78B 4MD4A 3V6BR 1B2WL 4GRMB 1RU9H 5CJXA 4RGNE 4HPYH 4YO0A 3UYRL 2IC2A 1ZGLA 1AGFA 3JV4B 5DR5H 5E5RB 5H2BA 1OQXA 3TBVB 3BD3A 2ZCKH 3LPGA 1TVHA 5BXFB 2NLJA 5FHAH 1IL1B 1FVCB 1OARH 3O3DA 4U1SA 5EU6D 1LEIB 4QHNB 5F9AC 3B5TA 3TZVB 2A9NL 4PJXF 4OV6F 4G43B 5C92A 3GSNL 4PGDB 4ZPVA 3KXFA 5HHXH 4NWUH 2P45B 5FUCC 3N0PB 3X17A 1PLGH 3QUZA 2R2HA 3CVHB 3O41A 3B3IB 4MNHA 5GGQL 4OLZL 3FN0L 3ZT7A 5HHOA 3MRBB 2X05A 3C8KA 1FC2D 5KSAB 4WUUA 4LARL 3VGBA 5EUOE 5E2TL 4LCCC 4L29B 1FYHB 3WLBA 4ZFFB 2C5DC 4N0CC 2H41A 2Y7QA 4LLWA 4XNMA 3QFJA 2NX5D 1FZKB 5HDLA 3A6OA 4QXGH 4KK9C 1O0VA 4LSRH 2PYEA 1F45A 4OGYL 4PJ9C 3MRQB 5D6CA 2WMPA 3S5LG 3ZTNH 4ODWB 4ZUVA 3NA4A 4Y5XA 3P4NA 3FRPA 2OMNA 3LPWA 2CRYA 4QOKE 3HAEH 1T1YB 1MUJA 1S7VB 3MLSH 4YHPB 4Q97A 2PO6D 3BQUB 2IANA 5CHNB 2HRPL 4S2SA 1RK0A 1X5XA 4XWGL 4RFEA 3CPLB 4NJ9H 4G9FA 4DZBB 3FQRB 4TULH 3FQXA 4JPWL 5B39B 2FR4A 3T2NH 5L2KA 5I19H 4M1CD 1UT9A 2CKBA 1CE6A 4OCRL 4KROD 3TYFA 4ISVA 2JELH 1FZJB 2HLAA 4X6DF 3U7WH 3GO1L 1ZMYA 5I1IL 2Q8BL 2BOCA 4NOFA 5EA0H 3WO4B 5JA9A 4I4WA 4Z7VB 1YNTA 1T6WA 4U6VH 1U92A 4K9EH 4K8RD 2FEDC 1QHPA 3EDEA 3QDGA 4KRMB 5HY9B 4RMRA 1JK8B 1LQSR 1N4XH 4N1HB 4KRLB 1VKXA 1MAML 5BVJB 2WIIA 4M3KB 3VFUA 3WIHH 2W0PA 1VEMA 2B0SL 3CFKB 3LKSB 4JRWA 4HULB 1XT5A 2CUIA 3BRGC 1I9IL 1MAJA 1ZA6A 2FWOA 1KN2L 2J6EA 3PV6A 1A6ZA 3CH1B 4XRCB 2X4NA 3L7EB 4M6ML 1WV7T 5CJQL 4WTWA 3IDNB 2LVCA 3C60B 4Z76A 5DC9B 5C2BL 4KJYA 1S9XA 5E0QA 1F3JA 1WBYA 3RNQA 4NQUA 3RGHA 1A3RH 1C16A 3S7GA 1SY6A 1CDGA 4X6CB 4K3DH 2PETA 1Q9OA 1FAKT 1JHTB 1DLHB 2BVPB 3GMRB 3PHQB 4LASH 4LCIL 1UWGH 3KLHD 2JJVA 3L3HA 3I6LD 2GW5A 3UPCA 4XAKD 4YE4H 3WIIL 3NTCH 5D70H 5MP6H 5KZCB 5EUOF 1HXYA 4NQSB 3PGDA 4AG4L 3THML 2D9QB 2DQDL 3CZFA 5ILTL 3JZ7A 4HUWB 2PYFA 4EDWH 1BHGA 4FNLH 1IAIH 2QSVA 5DURD 1I1AA 5T1KA 5DFVC 1LK2A 3IYLW 5GGSY 5FYLD 3BESR 1CDHA 2YD6A 4U0RB 4APQA 4FQCL 4G6AC 1JZ3A 3TIDA 3LRSB 4W70A 5I18L 2AK4B 3LEXA 2ZG1A 1MLBB 4JJ5A 4X5LA 5DQJA 4WV1B 5BRZE 3GKWL 5DRZA 4NUGH 4OLYH 4MA7L 3OX8A 5EBGA 4JFQB 1JHLH 2OX5A 4NT6A 1JTOA 2QQLH 3TBWB 2IGFL 1XCQB 1MCEA 2NZ9C 2XG4A 1XIWB 4LRNL 4KK5D 1A0QL 3DETC 4ZUUB 5JDSA 2FGWL 5E2UL 1G9ML 1SJEB 4JFYA 1EHLL 1CVSC 2CJUH 4I48B 5GJSH 3RJQB 4LVNB 1W72H 1MCJA 4LHUG 4JKMA 1J1OH 4GXUN 3DBXB 3UJJL 3D69B 3EDJA 3UTQB 3RWEB 4G8FB 3RWDA 2B2XH 3QPQD 1EPFA 2X4RB 4L4VD 2HKFL 3L6FA 3U0WH 2F5AL 2EDJA 3AMLA 1MCKA 1HK6A 1KTLB 2OR9H 1IEAB 3MRMA 3IDYB 4TVPD 4HFWA 1GAFL 2HWZH 3C9NB 1BFSA 3TCXA 1RSFA 3VXRE 3SDDC 1T3FA 1LP9B 1T0NB 3QIBB 3L3DA 1G7JB 5E8PA 3MNVA 3PP3H 1G9EA 3B8SA 3JWOL 3FO9A 3WFDL 1XCTA 2YSSB 3VH8B 4XMKL 4YH6A 2Y06L 4F33A 3EJZD 3I3BA 1AFVL 4LDEB 3RWIB 1VPOH 2OI9C 1VENA 1BVZA 4G5ZH 3UTSB 1Z3GH 2DJSA 3KJ6H 1RUKL 4P3CH 2AJUL 4PB9L 3SOBH 1BJ1H 2Q76B 2BVEA 1OGAA 4XZUB 1VDGA 3PWJB 4FFVC 2Z35A 3TF7C 2XPGB 2A38A 2C26A 1VFMA 2C3VA 4HK3J 3D0LB 5F6HI 4PJIB 4FRWA 3HNVH 3FO0L 4XNXH 1UXWA 1T03L 3IXTB 5M7QA 1HSBB 5KBNC 2DAVA 3E6FB 2ZUSA 2XY1A 4LVHB 2H9GB 5T3XE 5K59E 3V4UH 2CGRH 2CKNA 5HGAA 1QRND 1QFHA 4K9EC 5FOBA 1OSZB 4MNGE 2JB6B 3JV0A 5DHYA 1RVFH 1ETZA 4WDIB 5JOPD 5KVMC 1HXMA 4AEEA 4IOIB 4NJAL 2E6QA 4NQDB 1QBML 4X9IA 1J8KA 3L3OB 5D72H 1BLNB 5JIHA 2QR0B 2R23B 4RGNC 4U1HB 1AD9B 5TQ0L 1S3KH 5DZNA 2E7BA 4CRPA 2D4FA 2DLEA 1ZANH 1LO5A 4K3EH 5J1SC 3K4AA 3WNLA 4U1GC 2ADGA 2XICA 3FN3A 4HWZB 4JHAL 3EYVB 3TPUB 3DYPA 1XGRA 1RUML 3RVUC 5J0BA 1NGYB 3O9WD 1ED3A 4E42A 1A22B 3FAXA 4YDIH 1ZAGA 2EKSA 3ZE0E 1JUFB 3PDOB 4P2OD 3PIQB 1OAKH 1CFNA 1LE5A 1S9WA 5SWZB 3NAAH 2GTZA 1R5VB 4AL8L 3KDMA 4RWYH 3Q5YA 5TDOA 4DW2H 1JGVL 5F7WC 4L3AA 1DBJL 4NFCA 1NMCB 1JNJA 4LMQE 1FIEA 3QUYB 2VXTL 5CINH 2KZ1B 5C0GB 5DMYA 3CSYA 4NQTA 4R0LB 5I8KH 3QFDA 5LQBL 5IHLB 4LQ1A 4XBGA 1OB1A 1A6VH 4QRQA 1CD1B 1KT2A 5I71B 1FAIH 3GSWA 4JPKH 2CIIA 1NSNH 1ZXQA 1OAQH 5D7JB 1R3IH 2BNRA 2GTWB 3B4NA 1NCAH 4YNYB 4I77L 2CR3A 4RGOL 4R97C 4OT1L 4UIMB 4U1LB 3QIWB 3WIFB 5J1TC 3NZHL 4OZIE 3BIKB 4NQCE 2EIEA 2YOCA 2NYYD 3G5XB 4YIQB 2VLJB 1BQUA 1ORQA 3MJGX 4H1LG 4TSBL 3WFBH 1RIVL 1RUQH 3BSZL 5FYKU 5DVLA 5HHQA 4MAUH 4DCQB 2B20A 4PRPA 4OFYA 5D7LD 4I1NB 2VDLL 1LO3H 5F96L 5C0JB 4O9HH 2EDBA 5T3XH 1YEJL 1MNUH 2JJSC 5JW3H 1X5HA 3ARRA 5BV7B 1YDPA 4WFGE 3ZZ1A 2DL9A 5KVDL 1VESA 1P9MC 3MV01 1MCWW 2F53A 4UB0H 4NO5B 4C83B 4OD2B 3GRWA 3BP5B 5D2NE 5D1ZB 5EC2A 1U95A 4R4BB 3EYSH 3ARDB 1LK3H 1JPTL 4P4RA 4L8BA 4NKMB 1ZVSB 3IKCB 2COQA 3BP6B 4FTVA 1GZPB 3GJFH 1LGVA 4HC1H 4LCYA 4XMPH 2J2ZA 1N6QH 3IDIB 1E27B 2WQ8A 3O8XC 4HMDA 3SO3C 4YDJB 3MRPB 5I1DA 2Y36L 1KJ2B 4NQEB 4PLKC 2ZCLH 5K9QG 1Q94B 3B5GA 1KXVC 4ONHB 4Y5YA 1ES0A 5SX5K 1OT2A 4R90L 3JV6A 5HGHB 3ZE0F 4ZUWA 4U2YA 4MZ3A 5A2FA 5C0FA 1E4KC 1K4DB 5CZKA 4YXKH 1CGTA 2W1NA 4JY4A 1PKOA 2XQBL 4KTDL 3RA7L 4LHUD 5IBLD 3AXLA 1CFVL 5EIIA 1A1OB 5I8CB 1I3VA 5CIPA 2DDQL 5IMKA 1BJMA 2BJMH 3LEVL 5EU6B 1WFUA 2ADIA 1MJ8H 1V3LA 1JF1A 3DVGB 3C8HA 4HUNB 5C0AD 2DYPA 3V4VH 5CGMA 5JPNB 2HVJA 3CK0L 4GKSA 1NL0L 4PBWD 4RX4A 2VDML 3LN4A 3HZVA 4Y4FC 4Q0XL 1P7KA 4MJ6A 2PCPB 1FGNL 4XCEB 5K93A 3W0WD 5JHLH 3BRDA 1D6EA 4H88H 3QG7H 4BH7A 4O2EB 4PJAE 1H3PH 2ZUQB 4R4FL 3BEVB 1FPTL 1HHHA 3GJEA 3BH9A 3SGDI 1ZLVH 2CRIA 3WJLC 1A6TA 1QA9A 4LCCA 5I66B 2NX5B 2ZP0T 3ISWA 2FJHB 5DRWA 3D39E 4ZSOB 2AW2A 2XNAA 3MJ9A 4RNRA 3N1PC 1S7TB 4ZUSA 3MLZL 4XP9H 3A6BH 4MCZB 3TJEL 3ALXA 4PV8A 5HYSA 5I17A 4RAUB 3QDMA 1Q0YH 5C0IB 3SEPA 1ZHLB 1A5FL 2UYLB 4PJDA 3VD9A 2PO6B 1A7OH 4D0BB 5J8OA 2DLFL 2ICWJ 1G6RB 3G08B 3TH4T 1QLFA 1IZKA 3ZYZA 3V7MA 3D0VA 1NLDH 4P5MA 5AD0A 2A73B 4PJCA 4KROB 4YHOH 4YHNA 4FS0A 1NGQH 5F72S 3TJHC 4N0UE 3IDGB 2JJWA 1CTNA 3WE6B 4DGIH 1B88A 1FZMB 5B22A 4JPVL 4OLVH 3QUKA 1OOAA 1CU4L 5MENE 1HHIA 4I5BA 2E7MA 5IFJB 2V2XA 3VFNA 2WWMC 1JWMB 1JZ6A 5E5UB 3WN5C 3WNKA 2V7NA 5C3LD 2G2RB 3U36A 5ACLA 3VXMA 1CR9L 4P46A 1JNNL 1MELA 5IB1A 4WU7A 2Q7YB 2V7HA 4DGYH 1KC5H 1T7VA 3SJVA 2BNUB 3TFKD 3BFOA 5DJYB 1INQB 4TTGA 2B7DT 1WFTA 4EI6A 5IVNA 4XXDA 3G6JF 1JZ5A 1EAJA 5IR1B 2CLVB 1KLGB 4WCYH 4YPGB 4KH2A 4AEFA 4HZLA 2FLBT 5MEPB 4DGVH 3UYPA 4AENB 2D31A 1X6NA 2GY7B 3N50A 3HFMH 4HT1H 4WUKH 4K3HA 3GI8L 2IADB 3ZTNL 1OTTD 3ZL4H 4HV8A 3RVTD 5C07E 4OLUH 5C6TL 2MCG1 4DJMA 4PJAF 1OF2B 4KI5E 3G5ZB 1ZGLM 3PHOA 4RRPG 1REIA 3GNMH 3MLSL 2BOBA 3QDJA 4QHKJ 2BZDA 3KLSA 5GHWL 1JN6B 4JCLA 3MZTA 1RJZB 1AE6H 3D85D 4OCSL 3QJHA 3VXPA 3T2NL 5DURB 5C0DA 2ICCA 2ATKA 5IBTL 5INDA 4HUVB 5D71L 3OGCB 4JPIB 3N1FC 4ETYA 4RMWA 3NN8A 1TIUA 5T3ZE 3NA9H 3BZEA 5D7IA 4XGZB 2R1XB 4U6VL 3GMOA 4NBXB 3VFVB 4J3SA 5JW4Q 4G7VH 1X7QB 4WI4A 2ARJB 2QQKH 1U8IB 2IMNA 2HFFB 5LCVL 3FQNA 4TNWF 1T1WB 4WO4C 3OPZL 5KVFL 4JRYA 2H6PB 4GW4B 4JLRB 4OF6A 4GAGH 4R8WH 3WIHL 4CVXB 5I74C 2EDYA 2DI9A 1QQDB 3PP4H 2VDKH 1HHKB 3DECA 3RHWF 3V0AC 2LFGA 4JY5L 4P2QE 2ZOLB 1DP0A 2MCPL 1FL3B 5F70A 1RZFH 2FJFA 4F8QA 5SWSA 1CT8B 6CGTA 2X4PB 1AGCA 4V2BA 4YZFE 1IAOB 5A2IH 1JV5A 3RL1A 5IMOA 4ZFGL 5A3IC 2AEIT 1FGVL 4OZFH 1T83C 1EO7A 3KPQA 4PJXA 2OCFD 4FQ2H 1HDMB 1UACL 2VC2H 1CF8H 4LLDA 3RQ3A 4NIKB 2O5XL 4POYA 4WHTB 4LBEA 4PJGA 4XMLL 1YMHA 2D7MA 2B1AH 1QR4A 3NTCL 4L4VB 4OCYH 1I1FA 4UNTA 5B3NA 2OP4L 2HLFC 3VXQB 2FL5B 2V5SA 4AT6B 4PRHE 1CGYA 1I9EA 3ZDZE 1PY4A 2E27H 4FNLL 2X4UB 4R3SA 5EU4B 3T77A 2DQEH 4R6UA 4F2MA 1NBZB 5DO2D 5M95B 1G7IA 2YZ1A 4ORGB 1N59B 4R96B 3BP4A 1AIFA 1MCPL 4KV5E 3O3EB 5EDXA 5MEOA 4KI5F 3HAEA 3IAQA 4OGXH 3QCUH 1YEHH 4Y88A 2A74A 4LLYB 3X3GH 4HX1B 4Q6IB 1A4JB 5ESVB 3WO3B 2YUVA 3TNNA 4GG6A 3Q3GA 3PWUB 4NUGL 4OLYL 3ROOB 3H42L 1W0VA 3HI6H 3VGDA 1K85A 2AQ1A 4LLAA 5L0QC 1QSEE 1YEDB 2FATH 1NCCH 5D2NC 4JQVA 2QQLL 3FOLB 5E56A 2NY5H 3UX9B 3AAZA 1KSRA 2FHBA 1F4YH 1FNAA 5T5FH 2Y72A 5EO9B 1NGPL 2BFVH 2A0LC 3EO9H 3MLRL 4XX1G 1NC4D 4A6YL 2WLYA 5JXED 1QRNB 4LP5A 3MJ8A 1EJOL 4XC3H 4R7NA 4NRYA 4HCRL 4HKXB 5T3ZH 1NBYA 1ITCA 2GSGA 3S5LB 1NCWH 1HQRB 2CJUL 5GJSL 1BECA 1J1OL 3QPXL 3EO0B 1OTSC 3H9SA 3ARFC 4G8EB 4JCMA 2HG5A 1CFQB 3F7YA 1RIHL 4G80A 3D2UD 4JG1H 1DQTA 1KPUB 1IVLA 1YPZB 2BP3A 4PLOB 1NDGA 3MGOB 4N90E 3QI9C 4MSWA 2B2XL 5FUZH 5FECA 1OW0A 4EQ2A 2FZ3B 3U0WL 1D5MB 4X4XA 1GIGH 3WNPA 1E4JA 1BOGA 3QHTC 2OR9L 3FO2A 8FABA 4WNQB 3O3BB 4IJ3C 2W07A 2VL5A 3OKMB 3RIFK 1B0GB 2P8PB 3EYQD 2XIDA 4F8TA 4YZFF 3RTQD 3G6AB 4WJ5B 4RQQA 3PV7A 4FQJH 1IEHA 1HSAA 2ZG2A 3O9WB 3U82B 2OJEB 1NUDA 4U7SA 3G5VB 3QUXD 4N9OB 1UM6H 2BCKA 2NY4C 4P2OB 1L6ZA 4WHYG 4HXAH 3MOQA 4G5ZL 4NRZA 2FB4H 4K7PY 3MA7B 1Z3GL 3KJ6L 5HVHC 4JM2C 4P3CL 4ZDHA 3SOBL 4U3HA 5FYKE 2A83B 2CLRA 2XWJB 2HT4D 3BD4A 5B38A 5DD6B 5IVZA 3W9DA 3L5WA 1S78D 5FUOL 5DHVB 1RZJL 2DQTL 4Y4KD 2XI9A 2BVOB 2YPKB 4IHOA 4XNXL 4IRSD 1C08A 4WFHE 2VDQH 1S7WB 4KV5F 4LU5H 4EN3C 3BO8B 3EHBC 2OSLB 5KS9B 5L2JB 3CIQA 3V4UL 5EO1A 3BI9X 3QEGL 3KVQA 2J12B 4LSQL 2XKNB 4YPJA 4H20L 1JWUA 4LVEA 4OCLC 3VGFA 5HJ3A 2R15A 4QOKA 2J8UF 4HH8A 2R29H 2C4XA 4NKOB 1OQOA 1X5LA 2OXGA 3HZMB 1U8NB 1GPOH 4C56E 1DVFC 5MEQA 5J4MA 2F54A 1VACB 2BY3A 1KIQB 5HYQA 2V5MA 1LDPH 2DKMA 2X1WL 3GMQA 4PY7B 5D72L 4C57C 3C5ZA 1DEEB 5GGRB 5D7LB 1S3KL 3MLUL 3S4SA 4BFEA 1CXHA 1FV1A 2QV2A 5C0EA 3UEZA 2AJZB 1UCBL 2JJSA 3RWCA 5KN5B 3FRPG 4AMKH 1S9KC 3PWNA 1OGTB 1W72A 3ES6B 5JXAH 1YYMH 2PKDA 2A6IB 2YA1A 4PJFB 4KHTH 4JZOA 1EO8H 3CMGA 6FABH 2XA8L 3W39B 4HG4J 2MHAB 1WISA 3RDTA 2ZG3A 2B4CL 1OAKL 3MJ6A 2YD2A 1D5ZA 4AM0B 3GIVB 1H3VA 4X80H 2X70B 2APFA 4EUPB 1KCSH 3O8XA 1MCOH 4YFDB 1FYTE 1JI2A 3VFGH 4JFDA 2YKLH 1HINH 1R3JB 1QUNA 1ZT1A 3F58H 4H8WL 1HN1A 4NZUL 2AJYL 1KIUA 4PTTA 1RK1B 1BQHG 3L3KB 4WI9A 3DMMC 5CBAA 2EIZB 2RBLA 1U2CA 1AQKL 1BIIA 2ORBL 4PB0H 4GRLA 2PW1A 1CI5A 4J4PD 1DN2A 3BN3B 3KPOA 1R3IL 3O2WL 4KI5C 1J11A 4LHUB 4M00A 1V3MA 3H3BC 3KPLB 2BDNH 3L3GB 5GS2H 4HBQA 3B83A 2LTQB 1HH9A 1HKLH 4M5ZH 3MXVH 5FYKH 5IOPA 3KG5A 3LZFH 5D7KD 2WBJD 4M61A 2NY5C 2R69L 5C0AB 2VIRB 3NPSB 4ONGL 3WFBL 3OR6A 2P24A 4OGZA 1PGRB 1IC4H 4LLMA 2CK2A 5DK0A 2OZ4H 4NHCL 3DHMA 3WFEH 1A6UL 3W0WB 2V9TA 3I84A 1MNUL 4RMVA 1KBGH 2BNQD 3D25B 4HKBB 1A14H 1Q1JH 5GGRY 3BGFB 2FYYB 2FX9H 3V8OA 3WJLA 4OV5B 5BRZA 4XH2B 1PAMA 5F89B 3WEXB 4UB0L 4HIJA 4YBHA 3FOMA 4MHHI 3OB0H 3BYTA 5ICYB 1YEFL 3EYSL 1G7MA 2VXVH 3RNKB 1R3KB 5DEFB 3V6OE 1S9YB 4HC1L 4XMPL 2OTUA 4XNZB 2OL3H 3S35L 2C3GA 4F7PB 1EUTA 2Z8WC 5I15L 5IJKC 2X1XR 1ZKAA 1P4BH 4RISH 1TTUA 4E41D 5DMIL 4Y5VB 3LD8B 4L8SC 3GEWB 5IV2B 2XN9D 4EOWH 1K6QH 3FQWB 4KZDH 4HWBH 3B2UC 5SWQA 3OZ9L 1N0XH 3V52H 4AIZB 5I6XC 2FH8A 1BGXL 4OFKA 1BQSA 3A6CH 4XP4H 4NO2B 5DEGA 4HIEA 4KK8D 3L9RB 5INCA 1H3XA 1FC1A 1PYWB 3NCYP 1TCRB 3R1GH 3RWGA 1G7QB 1DQMH 3BWAA 4HS8H 2Q86A 1ZA3B 5ITFA 1MJ8L 1U3YA 1IT9H 4DUVA 4MXQC 3AM8C 4MQXC 4F3FB 1ZSDA 3VXRA 1PBYA 3T0EE 4CGTA 2IWGA 1JHKH 3MRJA 1NCDH 3ZTJH 3RAJH 5JHLL 4H88L 3WS3B 1S7RA 1H3PL 3TA3C 15C8H 1C5CL 4OD1H 4PJ8C 3VG9B 4TUJB 1A6AA 3DIFA 5HVWA 5FO9A 3RL2B 2ICWB 1MWAB 3C6SB 3WDJA 1U8LB 1MQKH 2YUXA 3ARBC 2PXYA 4XPTH 4PJ7F 4CKVX 1KEGH 1EXUB 3F12B 4PRDB 4M43H 4Y19A 5DA0B 2JIXD 2I9LA 3K4ZA 4XPFH 3BKCL 4R7DA 5E6YA 4D8PA 4OQ1A 2NXYC 3MFGB 4HUKB 4Z7WF 1MHHB 1EV2E 4OZHA 4XXCA 1W8NA 3IETA 3E1F1 3HUJE 2UWEA 2P7TB 4MNGA 1L7TL 3D85B 5FM4A 5DSCB 1BVLB 2P43B 5CP3H 4MQ7A 2CK0H 1LEGA 5E94B 4K7FA 3MLVH 5FO7B 1NLDL 5HYEA 3KXFD 4LLQA 2A1WL 4J6RL 3HE6A 3VFWA 2FDBP 1XF2B 3QUZD 2IH3A 4AJ0A 4MJ5B 3GJFA 4F7TB 4DGIL 4LPWA 2G5BA 2QSCH 4LCUB 1M71B 4GAJH 4H1LB 4WUUD 5DGRA 1N8ZA 5A16A 5EFIB 5DJZA 2NY0D 3QFJD 3ZHKA 3BW9B 3LS4H 2R8SL 3KS0H 4P23C 2PYED 1DDHB 3O45A 2EXWC 3GGWA 3QEQA 3QSKB 4DGYL 5I1LA 1KC5L 5IB5B 3TVMC 3VWKA 4X8JA 1K9TA 3RPKA 5IQ9B 4XBEH 1MFAH 5DK2B 1J9CT 4YHML 4UDTB 3OJDA 3AVEA 2Z0BA 3UBXI 4HH9B 3HE7A 2IAND 3V0WH 5FCUH 4KJQC 4O51A 5E99H 2EH7H 1UJ3A 4S1QL 3QO0B 4JFPA 3P73B 4G9FD 4O2CB 4HBCL 5L2KD 3RY6A 3R0NA 5SX4I 3T2OA 1T83A 2NY3D 1DE4B 3BIAX 5TH2B 4ZTOL 2LVEA 1CFSB 4TQEH 5C09D 4OLUL 1YQ2A 4LSVH 1Z5LB 5BS0E 5JHDE 1M6OA 4X5XA 5IHUH 4G7YH 1GGBL 1AQDA 3IDXH 2VR9A 9CGTA 3QDGD 4JFZL 5GRUH 2FBOJ 2R2CA 3CD4A 3TO2B 4UTAH 4CN1A 1MRCH 4OSUH 3T4AB 4OZIA 4M7ZC 3BKJH 2E9BA 2MJWA 4QTHB 4GLRI 4NNXB 1IFHL 3L7FA 4P5TB 4OZGE 1OD7A 5D7SH 5AWNH 1NQBA 4PLJC 3NA9L 1NEZA 2PUQT 2IPTH 4G7VL 4GJTB 1CFTA 2QQKL 3LH2H 3VXSE 1O5DT 5EORH 3I50H 3QH3A 5DUBB 2I9TA 1NCTA 3TBYA 5D93B 4K94H 3K8KA 5E1AA 3QNYA 4R8WL 4KUZL 4V1DE 2W0FB 3FCTA 5H35A 4PS4L 2KH2B 4X6EB 5I76A 3N06B 1E4XH 3O4OB 4OFPA 3MREA 4QT5B 1ONQA 1NC4B 3CLFH 2H8PA 4BK4A 5DJ8B 2QADC 4ENED 5HD8C 4RAVA 3SQOH 1CDUA 5IT2H 4XC1L 4O2FB 3O4LE 4XBPA 2IBZY 5T1KD 3PWPE 5HYIA 2P8MA 1U36A 3M8OH 2I26N 3J7HA 2V9QA 5ACZA 2IG2H 1G7LB 3UPRA 1F6AB 3MOBL 2NY6D 1T4KA 3OXSA 4UTBH 1T04B 1YN6B 3D2UB 4APQD 4FXGB 2GCYA 4HGWA 1A7RL 4ODTH 3EIFA 3O3UN 4TSCH 1ZT7A 3IU4L 2HT2C 4N5EC 4OCYL 4X99B 4GW5A 5D1QC 3VWJD 1QZ1A 2GFBA 4QRRD 3O0RH 4ACPA 2O5YL 1R3LA 1RY7B 3EOAB 1DFBL 1I8KB 1LEKB 1Q9KB 1K8DA 1KFAL 4PRIE 5JMRA 3RTQB 1MI5E 5CBEB 4N8VA 2YA2A 1LD9B 3QP3A 3GMPA 4PJ5E 3QO1A 2DQEL 3FQUA 3ARWA 1MIEH 4X6DB 5ENWB 5J9PB 1RUPH 4LHJB 3OJVC 3VRIA 3I2CH 1JGLL 4JE4B 1A7PH 3QUXB 5JPMB 2LU4A 1SQ2N 2VLKE 4HHAB 2PTVA 4CVZA 3N9GL 2DKSA 4C55A 3O3AB 4PJAA 2OXHA 3FB5B 4W4OC 3BN9C 4J7RA 3DUUB 2XZQL 4JM2A 3CDGA 4YHYB 3TH3T 1AP2A 4URTB 1FZOA 3FT4B 2VKXA 3K3QA 4Z5RB 4D94A 4PJBF 4W6YB 3LSOA 5SV4A 1DANU 5GS0L 2NY5L 1JGDB 3D39A 3OWEA 4IRSB 4K3JL 4YBLC 4KVNL 4YDKL 3IS1X 4EN3A 1KJVB 5IBUG 3V6OC 4QWWC 3B9EA 1T22B 2EC9T 2F58H 4HZAA 3JWDH 1U8MA 5GGUB 1WBXB 5AZ2H 4JN2A 1NCWL 3QEUA 1DBBH 3P0YH 3W81A 1I7RB 2W9DL 2O61B 3ZSSA 5IHZB 3BPLC 4X6FB 5CZVH 1GZQB 3DGCR 4R2GC 3MRFB 1DVFA 1TZHA 2J8HA 3AU1B 5HHNB 2GUOA 4DEPC 3L3JA 4AEHH 2EIDA 4F7CB 1EFXA 4NNPL 5FUZL 3TV3H 5C0BE 5IWLC 3MQIA 4OM0H 5TDNB 1T1XA 3OF6A 1D3CA 4N0UA 2AABH 5JORA 4YDLB 3U4EA 1GIGL 5F88A 4YLQT 3U9PH 1TLKA 3BAEH 3LN5B 2YWYA 3V5HA 4PP2A 5JW4N 2EIBA 4JO1L 1IRAY 2JJUA 5HYSG 4M93B 4QRSB 2UZYB 4FQJL 4ZQKA 1UGNA 4OZFA 3H3PH 4L4JA 1KB5L 4LF3B 4MB4A 3DX9B 5EUKB 1K8IB 1J0KA 2IJ0C 3T0EC 3ROLA 3L5XH 4JO2H 1UM6L 2AJ3B 3QEHA 1NGZB 5GRJL 3WLWD 3V0VB 2DQHL 5H8DA 5EULV 5IIEB 3QXWA 4JG0H 2MTPA 5GGVL 1G6VK 1GC1L 3VFOA 4ZUTA 7CGTA 3IB4A 4JHWL 3ARGD 5IB2B 1FL5B 2BSRB 5DMGD 5EU5A 2EZ0C 4O4YH 4WW1A 1ZOXA 3CX2A 3MRDB 5ICZA 3JBG7 4BM7A 1JYVA 1C5BL 2Z92A 4PRBB 1B4JL 4A6YB 3DMMA 5C08A 2VDNH 2MPAH 1UH2A 5EO0A 4JQXC 1EVTC 3LEYH 4Z7VE 2MMXA 1SJHB 1L9MA 3N1GC 1JZ2A 2B1HH 4Y1AE 1S5IL 3G6DL 4S1RH 1T0MB 5CUSH 3CXHJ 1DBAH 4JZJB 4K94C 2WP3O 1KGCE 3QXDB 4I18A 2WBJB 2VXSL 1NMBH 1WC7B 3OKKA 4JKKA 4D9LL 5EPMA 3OKEA 3RI5F 1BREA 5J6HB 5ALBH 3LKRB 3SBWA 4YBQD 1J5OH 3EO1A 4XPHH 3HS0A 5ESAB 1FE8L 1E6JL 2HTLC 1QLRA 4G6ML 4P2RD 3MV9D 2VLLB 2BNQB 1J12A 1HHJB 3SKNA 5I73B 4DVBB 4HDIA 1KIPB 4JQIH 1XF5B 4L9LB 4WW2C 3V6FB 1YYML 1C12B 3KPPA 1IAIM 4MMZC 43C9A 3RX7A 3MUY1 3VXUA 1R3HA 2L7JA 2AXFA 4X6CE 2VQ1A 4OGAD 5GRWA 2WWKT 1Z9SA 3DX8B 3NGBB 2VZVA 4XVSH 3K8LA 4FZ8L 4ODXB 3CVHH 1S5HB 5D2LB 1UCTA 3GSRB 35C8H 1CE1L 5GS0D 3ZYOA 2NY1C 3MCG1 4H0IA 5IJKA 1SMOA 5DWUH 4E41B 3NACH 1SBSL 3VGGA 5GS3A 3P4OB 2XN9B 3IKKA 4ZFZB 5D9SB 5BQ7B 4N8CH 4PB0L 4DTGH 1UWEL 1RZKL 2OLDA 4PRPD 2PR4L 1DLFH 1K4CB 3QHFH 2AK4E 1NC2D 4JKPL 3DTXB 2HKHH 3B9KC 3HRZA 1TNNA 4MJ2A 3U46A 4HKJA 3MXVL 5FYKL 3DVFA 3VJ6A 3JUZA 1AJ7L 4PRHA 1MFEL 1AR2A 2F53D 3AM8A 4E9LA 3HPLB 4KMQA 2WK2A 4AEIL 4OCWH 5IK3A 3WFEL 2VZSA 1FH5L 2CDFB 3TWCH 3ME0A 5FA3B 3RU8H 5CWSA 1K2DB 4H25A 3V95A 4KVCH 3JWDC 4PG9B 3TO4D 3AREC 4Z7VF 2HJKB 4HJ0C 5B3JE 5KVGL 1JZ7A 2R0LL 3EOYG 4PJHB 4OD3L 3CFJA 3ARBA 1P4IH 2ZUUA 3NZ8A 3S98A 3QA3B 2Y6SD 1A7NH 1UVQA 2HP4A 3DJ9A 2JIXB 5C70A 1J1XH 1NCNA 2XQYG 3LQAL 4I0PC 1ZLUH 2I07A 2Y1VA 2OL3L 4LIQL 1OAXL 2G5RA 1FCGA 1JNHA 1MF2L 1YC7A 1TVHB 3MRNA 4RFOL 1P4BL 4RISL 2FX7H 3P30L 3O3DB 4M8QA 4U1SB 1J86A 3HAEG 1K6QL 4PY8I 1A8JH 2DYPD 4FP8L 3SGKA 4HLJA 4XVTH 3KXFB 3V52L 2X44D 1UM5L 1LHZA 3EBAA 2JJTA 3QUZB 2R2HB 3MGAA 4MNHB 4MDIA 4U1KA 3C8KB 3QG6A 4MAYC 2DQIH 3R1GL 2AGJL 1FIGL 3R8BB 4WUUB 5GIRB 3A67L 5T5NF 2HH0H 3GBML 5L88H 4TOYH 4L3EA 4LGRB 3GSXA 3VRJB 3HLAA 2OJZL 3WLBB 3AUVA 1BZ7A 4KDVA 4XNMB 4HUUB 2NY0B 3OAUL 3QFJB 4UT7H 3L1OH 5I1GL 3D9AH 1U3JA 1BM3H 4PJIE 3LB6C 1OLZA 4P23A 1A3LH 2PYEB 1NCDL 3TYGH 3D3VE 3TVMA 2VZ1A 3OKYA 4Y5XB 3P4NB 3F62A 3DRTA 5LG1A 4DUXA 3VI4E 4TUKL 2ZKHL 3TT3H 3KYOB 3QDMD 5E6IC 4H0GA 3FZUC 1MUJB 3FT3B 4HS3A 5F93C 2P5EA 1NANI 4BJLA 2IANB 3EYOA 4WFFE 3BXNA 5F7DA 4B7LA 1NAMA 4RFEB 2DBLH 1KEGL 4G9FB 1PKQE 4UU9A 1LO0L 2FR4B 5L2KB 3QQ9D 1GCFA 2OZ4A 4NQDE 3RVVD 2NY3B 4NCC2 3TYFB 5C09B 4XPFL 2HLAB 5E8OA 3HNTH 1EAPB 2BOCB 1CL7L 1DQLH 3REWA 3FO1A 5B3JF 5JNYA 3U1SH 5F7HA 2HRLA 2C9AA 3C08H 5GRVL 1YNTB 1BQHB 1MFBH 5ETUA 1CLOL 1ZT4A 3QDGB 4KPHH 3UP1A 1A2YB 5FDWA 1K3IA 4Z7QF 3TZVC 3ULUE 3JTSA 3GK8H 3MLVL 1AD0A 5I8EA 3VXMD 4P46D 4C56A 5DQ9B 4NKIH 1L7IL 4UIKH 5CEZL 5J11C 1NFIA 4KAQH 5B38G 1MHEB 2I27N 4BK5A 5SWZE 4CMHB 2GK2A 4HUMB 1S7UB 1AGBA 5C9JB 1A6ZB 1IGJB 2ZSVA 1IGML 3LS4L 4Z76B 1XGYH 3ULVF 1LP9F 1OM3H 1S9XB 1F3JB 1HIMH 4HWBA 3RNQB 1JGEA 4Q9RH 3QQ3A 4U1IB 2QQNH 4P57B 2BRQA 1AHWC 4OB5H 4N9GB 3K46A 4XBEL 1OAZH 4HPOL 2OTWA 4O02L 4WFED 3GHBH 2VABA 3T1FA 3PGDB 2D7QA 5E99L 5DQDH 3CZFB 1R5WA 1FYTA 3MYJA 1C1EH 2PYFB 4XVJL 4HLZH 4TSAH 2VLJE 4QEGA 3S4SG 5T1KB 1LK2B 1FFNA 4TNWK 2NY6B 4PYHA 1KCVH 1BJ8A 4APQB 3TIDB 5FHBH 3VI4F 4LPXA 2L0DA 3WO4C 4YFEA 4J3UA 5GQBA 4QTIH 2Z8VC 1IGYA 3VWJB 2EDOA 4QRRB 1HH6A 5E8NA 4JJ5B 1JRHI 5DQJB 1NUFA 3BPOB 1IGFL 5DRZB 3VXTA 2AV7A 4GO6B 4OSUL 3OX8B 2JB5H 4YXLH 4OJFL 2D7TL 2D0GA 4JRYD 4M5YH 4XCCH 4NT6B 4IRZH 3N1MC 4F57L 3SKOA 1EFQA 3P4MA 1Q72L 5D7SL 3HMXH 1I1CA 3QAZB 3SE3C 1FDLH 4HK0A 3ABZA 2A6KA 3B2VL 5D6DC 1MFDL 4PGBB 5JUEL 4WI5A 4NQEE 1WFOA 1WITA 4IRJD 4D9QD 5JDSB 5SWSD 1AY1H 2ITCA 3C60C 5CP3A 25C8L 4JFYB 3GMLA 1MLCB 3U6RA 4LP4A 3P0VL 3ULUH 4M02A 3NCYS 2FD6L 4MJIA 2HT3C 4NQVA 4S1DC 4X6BB 3GM8A 4CMMB 3TN0A 1HILA 3G6JB 3V6OA 3X11A 4UOW1 2R9HC 1IAKB 2ENYA 1S7XA 1CXEA 1VFUA 3CSGA 3LKQA 4WU5B 1AGDA 4G9DB 4UINH 2F5BL 3KS0J 3MRMB 4FOMA 4NO0D 1IQDA 1UZ8B 4GKOA 2BC4A 1IGIL 2GY5A 4HFWB 4LQFL 5EBLB 4QRUA 1T3FB 5KOMC 4Q9BA 2IG2L 3CXHK 5E8PB 5B4MD 3FRUA 1XCTB 4M03A 1WICA 3KWWB 4U0RC 2MQ0A 3KYKH 3U0TA 4X0KA 2CDEA 1RQ5A 5IWLA 1FO0H 1LNUA 3NFNB 1FNGB 4EDXA 1J0JA 3P2TA 4WV1C 5CEZD 5HVFB 5DVNA 1IM3B 2NX5E 3FKUS 2Z35B 1E6OH 3MUZ1 4ZSOE 3G9VA 1TQCB 5HI5C 1XGUA 4HUXA 4OAWB 4JZNA 4QY8B 3T8XB 1UXWB 4EVNB 1ZEAH 3P77A 2BMKB 3QHZH 1JBJA 1A1MA 1XIWC 4NGHH 1EMTL 2SEBA 2GT9A 4B53A 3BP7A 4Y2DA 5HGBA 3T0AA 5FOBB 3CUPB 4OUUA 2K9UA 2W0LA 1UYWH 2VXQH 4U6TA 1AC6A 4KJPD 3IJYA 3ARGB 5BV7H 1AGEA 1A1NB 1MPAH 4G8GD 4LVNC 1HXMB 5E08H 4P9ML 3H9SD 1QACA 5AZEH 4PR5B 4CU6A 3C87A 1N3NA 5IW1B 1FL6B 1AO7E 1R5IB 2R2BA 2YN5A 3RVXD 1URLA 1X6LA 4LEXH 4JQXA 4GSDL 2F58L 5TFSL 1QFUH 2OYPA 1FRGH 3ILQD 3O6LL 5AZ2L 3C5SB 4GAFB 4QXWA 1FJ1A 1LO5B 4LKXA 3IDYC 3HUJA 3FONB 3QRGL 2VRAA 2PW2B 1JNLL 3ZE2E 4P3WA 1T66C 1XGRB 3EJYC 3TP4A 1J7VR 4JR9L 3QIBC 1ED3B 2Q1EA 4E42B 4XT1C 2EKSB 4NQXB 2HAZA 1GGCH 1CFNB 1LE5B 1S9WB 4BKLA 3KDMB 1MVFA 4M6OH 1JRHH 5TDOB 4CU7A 3STZB 1MIML 4WEMB 2AXHA 4WI2A 1MHPH 1U41A 4UOW0 2Z4QA 2Q6WA 4P2RB 3CVIL 3MV9B 4WENB 4G42B 4D3CH 1RZIA 4WW2A 4MD0A 3SGJC 4K2UH 4MVBC 2QKIB 4HKZB 3L5XL 1OB1B 2WBWB 4H26A 4JO2L 4BQ9A 3R06A 5C0NC 4LSPH 2OQJA 3O2DH 1UQSA 1A9BB 3GSWB 1X5FA 4MX7B 4CNIA 12E8H 4GS7B 4LVHC 3I6LE 3MA9H 5FGBC 3STLA 3VXOA 3P9MA 1IAMA 2F19H 4XAKE 2XY2A 5L7XL 3DO7A 2DRUA 2HFTA 4P0DA 5HI3C 4WGWB 3PWLA 4UQ3A 1OTUD 2Y4SA 3WKMH 1D5IH 2F54D 2NQCA 1KLFA 1ADQH 1ORQB 5IF0A 4OIIL 3RVWD 5CD3A 3CC5B 2MPAL 5I2IA 5K9OA 5HHQB 2DQFB 3C5ZD 1WSST 4PRPB 2CRZA 5JHDA 5TE7H 4WI7A 1NC2B 3MCLL 1S7QA 1G1CA 3UO1H 1YDPB 3B9KA 4NKDA 5HPMA 1H5BA 4L8CB 1DBAL 4ELKA 3MODH 3ZHDA 3BMVA 1D6VH 4ZO9A 1MSPA 4S1SL 3WNNA 3ULUC 1VFOA 4UT9H 1N7MH 2F53B 5IFAH 1G6RH 1VGKA 2FO4A 4KZEH 2VZOA 3RDTD 1U95B 3RUGF 4QHUA 3AY4A 1KENL 3S88H 4P4RB 3UBXA 4BZ2L 2C1PA 4OZGA 2VAAB 4XPHL 3TO4B 4LCYB 4BH8A 2P48B 3AREA 3MRHB 3ZDYE 1NMCC 3BKMH 5HHVH 3VXNA 5GZNC 5CILL 5I1DB 1KB5B 1VEOA 1E0OB 4JQIL 2B5IB 4JFDD 4C4KT 5IMMA 4R0LC 3VXSA 2XRAH 4P59H 4X83A 5F3BA 3JV6B 3P9LA 2P8LB 2WUCL 5C0FB 2HJLA 5I71C 2R4RH 4NNYA 5HI4D 4GRLD 5DD1H 4V1DA 3RZWA 2PN5A 5IKCA 4OUOA 3DXAA 4JY4B 1OP3K 5D7JC 1OY3B 1DBKH 3CVHL 4I0PA 5BVPL 4L4VE 3AXLB 3H9HB 5EIIB 5GGTH 5C3TA 4WEUD 1T5XB 5CIPB 5IMKB 4PJEB 4TVPE 5SX5H 3VA2C 1NBQA 1NEZG 2ADIB 5IBUB 1JF1B 3GI9H 3BDXA 4N0YL 4ZS7H 1Q9WA 2DYPB 3LVEA 4Y16D 4X7SH 2Z91A 3PWPA 1PSKH 3V2AR 3HZVB 2DQGL 4MJ6B 2AEPH 3Q6GH 4Z0XA 1D6EB 4BH7B 4M7LH 4ODVL 5J7CC 1H3UA 5E03A 2J8UB 5LAXA 5K9JL 5EN2A 3ZKNC 4DQOL 5BV7C 3RIAF 3OMZA 1NKOA 4JO3H 4LCCB 3SE4C 3VMNA 4OZ4B 5BRZD 5KSVA 3EYFB 4PRIA 5DRWB 2G75A 3NCFB 3GSVB 1B2WH 2XNAB 5D1ZC 1W0WA 3UYRH 4RNRB 4PJ5A 4OCWL 1O7VA 1JE6A 4ZUSB 2EDLA 1U8JA 3ARDC 3KPNB 1UZ6F 3N1QC 3RU8L 3DV4B 3T09A 3MUGA 1QRNE 1IARB 3QDMB 4O5LL 5E6IA 5BW7C 4UQ2A 1OP5K 5E00B 5JOPE 2A9NH 2RGSA 4EI5A 1Z0MA 4ELMA 5DJ6A 4NSKB 3GSNH 1HNGA 2AKRB 3T65B 4Z7NF 3LQZB 3W9EB 4P5MB 5AD0B 4ONOA 1J1XL 3BISA 4PJCB 5GGQH 4FN0A 1YPZE 1QNZL 4YHNB 3WKNA 3MJ7A 4LARH 4N8VG 3TC9A 3G5YA 1F42A 3JV4A 4HAGA 5E2TH 2ICEA 2DJUA 3ZDYF 1B4RA 3QUKB 1U58B 2FX7L 3CDFA 1HHIB 3QJFB 3FQTB 3VFNB 2H3NB 4NM8H 1FVCA 4CADA 4QHNA 4FQXA 4NHUA 4OGYH 5EZIH 1H0DA 4QRPD 2V7NB 3VXRD 3VXMB 4P46B 2M2DA 2NY2D 4XVTL 5D1XD 2XQYK 2V7HB 4PGDA 3HRPA 2V2WA 1JPFA 5ELIA 4PV9A 2ZUQC 3F6IA 3JWNC 3OHXA 5C0BA 3S8WA 4S11A 2HRPH 5GRVK 4XXDB 3U4BL 1JMZA 4Q74A 4JPWH 3OG4B 4HZLB 1QEWB 4UT7L 3OR7B 2PXYD 4P3DB 3H9ZA 4KRPD 4OCRH 2D31B 5LKNA 1FZKA 4TVPH 3PWVB 4BQ8A 4Y19D 3GO1H 3TYGL 2Q8BH 4QHMA 2L4OA 3OKLA 4HV8B 4JO4L 1AHWA 3CXDH 5KS9E 1N5YL 4HF5H 3P4LA 3O11B 4JDZA 3TGXA 1V5JA 1F8TL 2GEEA 4LGPB 5T3XD 3DRQA 1YEIH 1UG9A 4KXZI 3TM6A 1T89C 2ZUWA 2PO6C 4YHPA 2IAMA 4E5XB 1MAMH 5E6ZA 2AEWA 4M7KL 3VXPB 1J88A 3NABL 4DZBA 5C0DB 3F6LA 4JVWA 2B0SH 1SBBA 4M1CC 3UTTA 2ATKB 3FMGL 5INDB 3HE6D 4KKCD 4KROC 1I9IH 3HNTL 4KKBD 1KN2H 3JV5A 2EYTA 4FXKB 2EE9A 3NN8B 2BY0A 1TMCB 4OCNC 1DQLL 5D7LE 3U1SL 3GIZL 4M6MH 3BZEB 5FKPA 1BBJA 5D7IB 1J8HA 1MFBL 4TPRL 3GMOB 4UNUA 5C2BH 3ILPA 4Y1AA 2F8VA 3WD5L 4F7EA 1BX2A 3CFEA 5DD0H 5HY9A 1XH3A 4GW1A 5CCKH 3GK8L 5I75B 4LCIH 4JRYB 3QEQD 4KAQL 4EIGB 4NN6B 3P0GB 1X5GA 1YPZF 3VWKD 3Q5OA 3OV6A 1FHGA 5I1HL 1YEEL 4I3GA 3WIIH 5BO1L 3LKSA 3BX7C 1YNKL 4XHJD 4M9OA 5D6DA 4DOHB 5J13B 3CFDA 4MCYA 3KPRA 3AB0B 3SGEI 3LOWA 5ILTH 3GSUB 4N0FA 3HE7D 3CH1A 4XRCA 2CIKA 1HWHB 1DN0B 2FJFB 3HNSL 4IRJB 3L7EA 1AGCB 1E28A 5IEHA 1OM3L 3C60A 1JV5B 1HIML 5IMOB 4Z7UF 3QULB 5LVEA 2CO6B 2QQNL 4FQCH 3ULVL 4X6CA 5I18H 5IQ7L 2QL1A 3KLHC 1JHTA 5GS1B 1DLHA 2BVPA 3GMRA 3PHQA 3VRLE 3KPTA 4LBEB 4PJGB 3PUCA 2VH5L 5ACMA 5L9DL 2DQUL 3U2SA 3GKWH 2ERJB 2L7UA 2FHCA 1FNSL 5DQDL 4PJ7B 4Z9KB 5GRXG 4NO0B 3M17A 2H32A 4L8DB 5JR1H 2D7OA 4HUWA 4U7MA 5GSRB 3LKPB 3FT2A 5C0AE 4R3SB 5DHVH 2IGFH 1S7SA 5DLML 4F80A 1G7IB 2ZSWB 3PG2A 5KS9F 4JFFA 4RGMB 3W0WE 3BP4B 4M62L 4Z7WB 5MEOB 2FBJL 3LRSA 2E6PA 3HAEB 1D9KD 2FGWH 5E2UH 2A74B 3FJTA 3BIBX 1YN7B 1EHLH 1MLBA 4GG6B 3HI1A 4WFGD 1BVKB 3UJJH 2N7BA 5IB4A 3SDCA 2JB5L 4YXLL 5MHSD 2H2PD 3WMSA 3C6LD 4CAGA 3AAZB 1G84A 4BYHA 5EZJA 1FDLL 2F5AH 2A0LD 4KK5C 3ARXA 3L95A 3MJ8B 3BGMB 3PHSA