2VXSH

Structure of il-17a in complex with a potent, fully human neutralising antibody
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
221
structure length
216
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYAMSWVRQAPGKGLEWVSAISGSGGSTYYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARDLIHGVTRNWGQGTLVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPQPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Il-17A in Complex with a Potent, Fully Human Neutralising Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cytokine
molecule keywords INTERLEUKIN-17A
total genus 43
structure length 216
sequence length 221
chains with identical sequence I, J, K
ec nomenclature
pdb deposition date 2008-07-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxsH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxsH01
2GHWB 3RZCD 5HGHA 1BFVH 1QTYT 3MBEA 2GCYA 4GSDH 3MV7D 3AAZB 3KPNA 4WHDA 3DV6B 4P23D 2FECL 4IDJH 3MMEB 2YOCA 2R2BB 3MACH 3O6FD 2OQJB 1PVHA 1WFUA 3PHQB 3WS3A 2DBLH 3WHE1 1HEZB 3S3JA 1CGSL 5I1LB 1JHKH 3ZDZE 1MPAH 1YN7A 4HBCH 2IQAA 3QUML 4P3CH 3QXWA 4BH7A 3QQ3A 2ARWA 5FHBH 2VQTA 4PGBA 3U7WH 2ZOKB 4LRIC 2Z8SA 4GBXD 1U93B 4ETYA 5GSVA 2NW3B 5E1AB 1RZ7L 5E00A 1G7JA 2OXHA 3EIFA 4JFEE 4UI2A 4I0PC 4LHUD 1R5VA 3V0WH 1EV2E 4U1NB 2GK0A 3IFNL 4JQXA 4X99A 2Q3ZA 3PWPA 2YS4A 4I77H 5FGCE 4LRNL 2AJSL 3KPQA 5HYFA 1OCWL 1MOEA 3RU8H 4Q9QH 2YA2A 43C9A 5DLML 1KEGL 1TPXB 1HXYA 4U1IB 4Z7VA 2AJUH 3KPMA 1XAUA 4LVOB 3QUZB 2PTTA 1EIBA 4QXUL 4EI5C 3QNXB 2AABH 2CIKB 3BPCA 3MO1B 3WXVH 3KDMA 4M9PA 4FQCL 3UDWA 2QKIA 1WICA 2Z31A 1RUQH 4P48A 4BFGA 4ODHH 3GUTB 3P73A 2E7BA 1SMAA 4HCRA 4EKXA 3QPQD 4HIEA 4YHKH 5CJXC 3FQTB 4TVPE 2C1OB 3ME0A 3AMKA 2RJMA 3F5WB 1IGJB 5J9PB 1G9NC 3HNVH 5IW1A 2DIBA 3CCHB 3VCLA 5DQDL 4X6BA 4M93C 4X6CF 2IANA 1DN0B 1WZMA 2DQJL 5I16B 4XPTL 4JQXC 1JZ8A 1FIGL 2ZSVB 5BRZA 4IHOB 3OG6B 1I8KA 1BVLB 1W0WA 4K8RD 1BP3B 5MEOB 1BD2A 1WSST 1FO0L 2XTJC 4IJ3C 1B88A 1AP2A 4N5UA 2YK1L 3IETA 1AY1L 2KQNA 2H6PB 4HFWB 5DK2A 2LFGA 3DVIA 12E8H 2QHRL 3HC0B 3BP6B 4XCFH 1MCDA 5KVMC 4YFLF 2DQTL 1CTNA 4XC1H 5F6HI 2WP3T 4GT7A 4P5KB 1WITA 3KJ4B 4NRZB 5ITBH 3KPNB 1Q9KB 4HJ0D 3OR6A 3GK8L 2NY0B 3BUYA 3AVEA 5DK0B 1IGYB 3T2OA 1FBIL 1QBML 4TUKH 2X4UB 3LZFL 4F7MA 3Q1SH 3IDXH 3NIDF 4M7ZC 4DKFL 3WYRA 3CX5J 3BVNA 1VESA 3U1SL 1OOAA 4PFEA 3HI6H 2IPUG 3RHWK 3RZCB 1BJ1J 4OZHA 1JZ7A 2JB5H 3RX8A 4UAOB 4BKLB 2MJWA 2AK1L 4S1SL 5F7MC 5CGMA 1AGDA 2QTEA 5IMKB 4XWGL 3UTTD 4APQB 3LHPH 5F72S 2NYYC 3KR3H 1V7NL 3H9SA 4OLXL 3OGOE 1JCKA 5DYOB 1JBJA 1I8KB 4ZTPH 4NC2B 1GGBH 5GZOC 2AEPL 1FC1A 4ZQKB 3H0TA 1G9NH 3BPNC 4GRLC 4LLAA 5DMGC 1LILA 1A1OB 1IGMH 5HGDA 3VI4E 1F3DJ 1FPTH 1P7QD 35C8H 4M8QB 1BFSA 3BKCL 4LVHB 1G0YR 3QA3B 1I3GH 1AHWC 4LVEA 2A9MH 2YEZB 1MRCH 1EK3A 2D7PA 3EZJB 3GUTA 5I1EL 4F58H 2OL3H 1U58B 5SWSB 1TETH 2GIYA 4MJIA 4KJYB 3CU1A 1T2QH 5J57B 1XGPA 3VDAA 1KEMH 3PGCB 1IAIL 1KB5A 3PWVB 4J7RA 3VXPB 4HMCA 3NPZB 2F19L 5IEKB 1NFDE 4F37F 1IE5A 4WU7A 1XEDA 1AH1A 3IKCA 2H32B 3LSOB 1CI5A 2WMPA 3I3BA 2QLVB 1EVTC 1Q9LA 5EZOL 5AZ2H 4XPHL 3KYAA 5FM5M 4UTAH 2CIIB 1GOGA 3L7FB 3DBXA 4OFPA 1LO5B 2MNUA 4F3FA 1FNAA 4UTBL 3G5XA 4XB7A 2BSRB 3CFBB 2VXSL 1ED3A 3MZGB 4X7TB 1XCQB 5KOMC 1ORQB 3FOLB 4WWKA 1CTOA 4I3SL 4YDJA 4R4BA 1N0XH 1X5AA 3VD4A 3VMOA 1U93A 1U8HB 3HE6D 1TCRA 5CLTA 5EUOB 1N5AA 2GSIA 2R0KL 4PJGE 1QSVA 1IGTB 4NQEA 4RWHA 1UVQB 2BVQA 3U7YL 1Q38A 3G9AB 3IDUA 2DI8A 3OKDB 5T5FL 1JV5A 1OB1A 4PV9A 4GQPH 1SEBA 3CSYB 4NHUA 4WW1A 4G6KH 5FCUL 5C0BB 1KOAA 5I1JH 2NY4B 3ARED 1C12A 3WS3B 4LLUA 2FX9L 2R2BA 1R3JA 1VEMA 5ALCH 1H3PH 2CXGA 5JMOC 2ZUYA 3RAJH 1QFPA 3FMGL 1H3WM 1YC8A 4EDXA 4HGWB 3HAEH 3R1GH 1YYLL 4I5BB 3REVA 3WNKA 4B0MM 1WC7A 2IPUK 3MGAA 2G60H 4ODVL 1TTUA 2EDDA 1YY8B 2W60B 3DROB 1NCDL 1TDQA 3CMGA 4JRXA 3LH2L 1KXQE 2F58H 2MCG1 1URLA 4ZFFA 2ADGB 1JRHL 3VW3H 5I1DB 1A6PA 1OGAA 3SDDC 5DTFA 3RI5F 1IEHA 2DL9A 1B90A 3U1SH 2Y5TB 3U0PA 2IWGA 1R3KA 4XZUB 1FNLA 5D2LB 5SWZD 3FRPG 2QSCH 4TOYH 4TRPH 5AYUL 4LPWA 4ODXA 1P4IL 4FZEL 5J11B 1AXSB 3KYMB 1K6QL 1N5YL 3RKPA 3LD8C 4L8DB 2BVTA 1U36A 2HTKC 4N0YL 3V4VH 4QT5B 4MQTB 5DRNB 3BPOC 2X4RA 4MD5B 4Z0BL 3RWEA 5FUOH 1NSNL 1YEGH 3PWLA 1Q94B 3QPXH 4RBPH 3GSVB 4HF5L 3LQAL 2H8PB 4U6HB 2V2XB 1FL6B 2DLHA 1OVZA 5DI8B 3EO0A 5C92A 2YMXH 2NX5E 4S11A 1BQHG 1NGYB 3VFNB 4QHUA 2WWKT 2B4CC 1BM3H 3QXAA 5TPWH 3SDDB 2ADIA 2MPAH 2IQ9H 4DN3H 1HHIA 4R97C 4JO1H 3VWJA 4ACPA 4Q97A 1MIML 5EU6E 4Z7WA 3H42H 3VXPA 1DQQA 2LU7A 1D5MB 1NLBL 3O8XD 2CH8A 3RVTC 5KOVC 3EYOB 5BVPL 4PD4K 1F90H 5BMFL 4ZO6A 2FYYB 4YO0B 1SYVB 5DHVB 3T65A 4G5ZL 2BOCB 3TIEB 4C83A 4CW1B 1W0VB 2VAAB 5MP6L 1NDMB 3MLUL 2APBA 3UBXA 4PJFB 4HIJA 3DIFA 2P1YA 1I7TA 4R2GB 3RY6C 3KLHD 3MJ8A 1H3UA 1QR1A 5JR1L 3DJ9A 1X44A 4P2QA 3FQUB 5JQ6L 2JJSA 5EU5B 1DUZA 4KKNA 1UKQA 1WLHA 4GMTH 1AXTL 3GO1H 1N6VA 5ENWB 3MRKB 1YNKL 4H1LA 1U3ZA 4MD0B 3FQWB 3LQMA 1YDPA 2LAAA 4XP9H 3VWKA 1S7RB 1A4KB 1LO3L 3IDXL 4FFVD 2Y36H 3D85D 3TBVB 1WT5A 3LQZA 1HWHB 1YA5A 4Z18A 2CKBL 3PWJA 5HDOA 5DD1H 2W65A 4GXUM 4ODUA 2Q8AL 5KJRL 3OJDB 1AI1L 1JHLL 4J12A 3NH7H 5ADOH 4N0FB 1L9NA 3UO1L 3QISA 1EGJH 1JGEB 1V7NH 1KTDA 1NPUA 5A2KH 3RL1A 4X6FB 4F57L 2D0HA 1ZLVH 4KGJA 4X8JA 4Y1AD 3VXSD 2W9DH 4LHUB 1QKZH 2CDFB 2RIKA 4UT7H 5T3XH 3WO4C 3QUYA 4KTYA 3D69B 4QHLB 1HOCA 4HUMB 1FAIL 3CAFA 3RWIB 3O9WC 3WLBA 1NL0H 4CU7A 2Q1EA 4N5ED 2HVKA 1CCZA 3VW3L 3N1MC 1QA9A 4KPHH 4ZO9A 3VRJA 4LNRA 4Y4HB 4WJ5A 3U4AA 5K93A 4F7EB 4P2CG 1Q9WB 4TUJB 5I30L 2MWCA 5TFSL 1VGEH 1R5WA 4CVXB 4ZUUB 4QTHA 5F7LB 3PV7A 1RV6X 4U1KA 4DOHB 1NAKL 3FFCE 5ACLA 1DQTA 4PJXF 5DQ9A 4MCZB 3WE6A 4FQ1L 2F19H 2F9BT 2WQRA 1J8HD 4ZUUA 3F7VB 4KRPB 4EOWL 4G7YL 4HKZB 5D7KD 4I0PD 1HHHA 3MLVL 2EYTA 4XHJC 3PUCA 2AK4B 1KJVA 3DVGB 2WZPD 1WEJH 2JIXD 5GS2D 3SJVD 4APQC 2QKIB 3WCYA 3VXRB 3FB8B 1CFTA 1UXWA 3B5TA 4AENB 1S7TA 3MV7A 2NY3B 3RY5A 4AEIL 2HKFL 5BCAA 1Z9MA 4PRHB 2H2PC 3QEQA 4U6YA 3U30C 3RNQA 4PJIA 2CR6A 3ULVF 5IFAL 1FHGA 4JM2F 1A1NB 2X4PA 5CGTA 4LCWE 5DUBA 4JZNA 4JO1L 2ITCB 3P4NA 2BY0A 5DRXA 1A3RH 4PJ9A 4GMSL 2NY0C 3RL1B 1SJXA 4FQHA 5BS0A 2X1OA 5ESVA 4OFIA 2HMIC 1GIGH 1S9VB 1E4KC 5GQBA 1NCAH 5JXAL 2DQUH 2VB5A 1T21A 4JO3H 4DW2L 4YFEA 5F7WC 5HDQH 1UM5L 5IIEA 4FQIH 1T5WB 4XP5L 4MDJA 2VXUL 1CDHA 3TZVA 2DYPB 2BFVH 3OKLA 3GI9L 1ZT4A 3ARFD 3P9LB 1JK8A 4PPTA 4BSWB 1UWXK 1LGVA 2R4SL 4WGWB 2D3VA 5KVDH 5TF1L 1JHTB 4MQ7A 4DOHE 5CLWA 4M93B 1XIWC 3OF6A 3QT2A 1ORSA 5GGUA 3P77A 3RUGA 3TFKD 3ULVH 3FO1A 1KSRA 4LFHG 1WFOA 1ZHNA 1YJDH 2NY5L 4YHLH 3U2SA 4PV8A 4L4JA 4I3RH 3O4LA 2X4OB 1TJHH 2F5BH 5TDPB 4S1DD 4KK9D 1XGYH 3VXQB 4FP8L 4AEHL 4PRNA 3NN8A 3GI8L 4D9RD 4L8CB 3S7GA 4QRRA 1AKJA 3LRSB 4Z5RA 1N7ML 1LO4L 1Z3GL 2UY7A 3VFRB 4HDIB 4XGZA 1T1WB 3DUUB 3OKNB 1U3HA 5JOPD 1SJEA 5I9QB 3O4OC 1D5BA 4OZIA 1J8KA 4I48B 2G2RB 4L4VB 5IK3A 1XR8B 1TPXC 4F8TA 4M5YH 4LLQB 4ZPTB 4GRWE 3ESUF 4F2MA 1N5YH 1Y0LB 4LL9A 4QOKE 4DZ8B 4HZAA 3OGCA 2PCPB 4L4TE 1K2DA 5H37G 3U48A 3ZKXC 1GGTA 1DBJH 1QLEH 4UUJB 4ZFGL 4Q6IB 4LLMA 1PSKH 3OB0K 3PJSA 4JG0L 1W72A 5IQ9A 5C09A 4LASH 3G5VB 3WUZA 3WO4B 4HCRH 1N64H 3EJZD 4JFED 2MFNA 2J6EL 3AU1A 3GMLA 3PWNA 2BDNL 5F1NA 1T1ZB 5J11C 4JM2B 1N6QH 3NCMA 3QDMA 2D7TL 2Q6WA 2KDGA 1B9ZA 3PDDA 2I07B 1KIQA 1KLGB 3AUVA 5FGCB 3SY0B 2B20A 4MJ5A 2V9TA 4U1MA 1V8HA 1VGKA 5C0AB 4A6YH 1JUFA 3SJVA 2VLRA 3MPCA 4XXDA 2A83B 4BQ9A 2R1XA 3CFCH 4GKZB 4Y16D 4J8RB 3ULVE 4GXUN 2JLLA 2E7LA 2X1WL 1YMME 3NABL 2E3VA 4YHPA 3K74B 4JFXB 4XRCB 5IM7B 4XNMA 1KPRA 3LKQA 3H9SE 1KFAH 1XIWD 4RZCB 3VXOA 3JUYA 5LAXB 2IC2A 4OSUL 3V6ZA 1CR9L 1ZMYA 2BNRA 4PB0H 4JZJC 3D39E 3OWEA 2AABL 1FZOB 3MV8D 5DVOA 3TT3H 1RUKL 3U46B 2VDRH 5TE6L 1N59A 4NFDA 2FD6L 1O0VA 1MCRA 3T09A 1IAMA 2VZSA 3D2UA 1DUYA 5EO9B 4ETQA 4J1UA 4P5TD 2VLRE 3QDMD 1A0QL 3C9NB 3I3DA 4LP5A 3ARXA 2R2HA 3TT1H 5ISZE 3D39D 1FH5L 5F3BA 5ANMB 2XPGB 2XWBB 3RGVA 5FDWB 1A6WL 2P47B 3GJFB 4JPWH 2FJGB 1MHEB 4M1DL 2UWEF 2QSQA 3TBSA 5I18L 1CLYH 3QZWB 1UM5H 4MNQA 4O58H 4X6DB 3KYKL 4X98A 2EIZA 4YWGH 1NUDA 4AMKL 1MHEA 1OP3H 4DAGH 2J8HA 5ADOL 4JFFD 1MCOH 5TF1H 3V5DA 2EDNA 4OUOA 4PRHD 2APTA 4IS6A 3L1OH 5D6CB 1FC2D 3O2WL 1BVKA 1DLFL 2XZAH 1BZ9B 4WEMB 4IRJA 1PD6A 2A1WH 4ZYKB 1NCWH 5C0GA 4Z0XB 4L4VE 1VFAB 4XNXH 1NMBH 1MI5D 3GI8H 4GKNB 1FSKB 1X5IA 1NC4D 4X4XB 1F8TH 4F7TB 1JIBA 3UTSB 1U3JA 4OT1H 3PHOB 1V3KA 1MFEL 1CFQA 2P8MA 1N26A 5SWZA 5I17A 5JW5B 2WIIA 1DR9A 4ENEC 5IKCA 1LVEA 3DHMA 4GG6E 5C3LD 3C5JB 4ZNCD 3MXVH 1YEIH 3I02A 4YAQA 2ILLA 1ZLUK 3DVNA 5IMOA 2I27N 1DBBH 4MS8D 4HIHA 5JIPA 5GZOD 2AERT 3JV5A 4OGYH 3WIHL 4JFDB 3FB7B 1HHJA 5FM8A 1REIA 1A64A 4GRWF 4DTGH 1NC2A 4KHXH 4GKSA 3PGFL 3S3SA 3ZTNH 4XBPA 5CZVL 1E4XI 4X4ZA 2GSGA 4Q9RH 1S5HB 1OARL 3MV9B 3HPJB 4OZGB 3WN5A 3BKCH 4WI4A 4D3CH 1RMFL 1MJ8L 5HHMD 3NZ8A 2D7NA 2C4XA 4YHZL 3MRIA 3G08B 4YZFF 4D0BB 1QSZA 4DVBA 5KZCB 4K7PY 1MNUH 2R0LL 1MJJB 3T77B 5DJ6A 1MRDL 1T2QL 2AVGA 2UWEB 3MNZB 4NO0A 1RZJC 5F1SA 4YH6A 1Q72H 5JW3L 4U6VL 4G8FB 4LF3B 3LN5A 1A7RH 3KJ4C 5DQJB 4IBLT 1WWWX 1ZXQA 4HIXH 4L4VA 4KI5C 4TNVF 3DV4A 1DFBL 2C1PA 3W5NA 3N9GH 2FDBP 4PJAB 3LIZH 4QTIH 4UTAL 2XI9A 1ZHBB 4I18A 5I8CA 1IC1A 4O5LH 3M8OL 1KC5L 3QXUA 4U1JB 1FO0H 2VMFA 3MRFB 5TDOB 3ES6A 5B21A 4JJHA 3SE9H 2JJWA 1A2YA 1WF5A 4KC3B 4YDIH 2VDMH 5DGQA 1ZA3A 3OR6B 1U42A 2IADA 3TV3L 5IUSA 1MCKA 3MXWH 5EBMA 5AZEL 4TVSa 1FYTA 5LBSH 2NY3C 4RGOL 2F5BL 4ZS7L 2ED9A 3ISWA 3V5KA 2GJ6A 2CR3A 2PW2A 5ESQB 4GJTB 1JHTA 2XWTA 4UV4L 2VDOH 1HINL 1WAAE 5D1QB 3ARDC 4LDOB 1KCSL 5CS7A 3WFHB 3KNBB 1AC0A 5FM4A 3IF1B 4IOSD 5C6PB 4KRPC 3OKLB 1MRFL 3OQ3B 2F5AH 3GJEA 3QWOB 4WTXA 2FCBA 2EH7L 1B4JH 4X5WB 3TWCH 1FE8L 2VLLB 1KELH 1MWAA 5HY9B 2XWJB 3BQUA 2VISB 1LWRA 2E27H 5CD3B 4U1LB 4K7PH 3LCYA 5BV7C 1RFDL 4ZD3L 1NJ9B 4WFFE 1MCOL 3IDMA 3O3DB 4PYHA 4GOSA 4YDLC 1YZZA 4XNMB 2KKQA 5IF0A 1KGCD 1DBKL 3O2WH 2M1KA 3HFML 3P73B 1GC1H 4X9FA 1J86A 1CS6A 3DARA 5DC0A 4UB0L 4KRPD 4MA3B 2CK0L 2A0LC 1Q1JL 5C0AA 4KROB 3VFTB 3UTPD 5FO7B 3MV7B 5D5MF 4WHTB 2IH1A 3K4ZA 2DLIA 2R1YB 4OCSL 4X4ME 1IFHL 4UOW0 5HHQB 43C9B 3BP5B 1E27B 3A0OA 1JYVA 3FQXB 2O5ZH 1UA6L 4WCYH 1PZ5A 4LLWB 5C0FB 3BDYH 4EI5A 1KIRB 1FZJA 3D9AL 2YD5A 2FX7H 4OLUH 4L5FL 4UILH 3KPPA 1SVCP 1MCPH 2FHBA 1NGWB 3QUXD 4MCZA 4AZ8A 1K6QH 1P6AB 4H1LG 3E0GA 3B83A 4HLJA 4OZGF 5T3ZD 1RJLA 5GGSY 5DSCA 4XPBL 5E6ZA 1FN4B 2MTPA 4E41E 4JQVC 4FZ8L 4Q6IA 3P40A 2X4NA 5LGHL 3UTZA 4L3CB 1PKQA 4Y5XC 2KBGA 3DWTA 4EBQL 1DTUA 4Q2ZA 4PGEB 1FVEA 4BH7B 2QHLA 3C6SA 3Q48A 4H88H 3D18A 4RAVA 5KN5A 1CLZL 5I75B 3HR5A 3GJFK 5EH1A 2QQLH 2VXSH 2EYSB 4IJ3B 1ZGLM 3KWWB 2BNQB 2FHCA 3ZT7A 2BMKB 5BRZE 5TQ2H 2HH0L 1WCBA 1HYRC 5IT2H 2F8XC 1KJ2A 5D5ME 3MRQA 4G8GA 4G6ML 3SGEI 1SMOA 2VXTL 1RI8A 4PJ5E 4KK5D 3HNSL 3CC5A 1WFNA 4BA8A 1HI6B 3RIAK 1NGXA 1XF5B 3G04B 4Z7UA 3GSNB 1UACH 3QG7L 4LOUD 4H25B 4NUJB 4YHOL 4HS6A 4PGDA 3T4YA 3BYTA 1Z6JT 4GRLA 2CRMA 3M8OH 4POYA 1QYGH 3RA7H 1YMHA 4F7PB 5K9QI 1TQBB 1A21A 2VDML 1AGCB 3VWKD 3TV3H 3MV9E 5E08H 2JCCB 5MENA 4W4OA 1S9VA 1XH3A 5CIPB 3BISA 1J7VR 5FKPA 4R7DB 4J4PC 3V9FA 1SEQL 2RAMA 3DPBA 3IS1X 2BNQE 4PB9H 3TO4C 4JFDE 2R69L 3CMOH 1GXEA 3O6KH 1MHHA 3Q5OA 4NQDA 4TSBL 2DI7A 1OD9A 5HJ3B 3W9DA 2CXKA 1KELL 1NCCL 5KN5B 3FN9A 3GBML 3LKPB 5EB9A 3SDAC 4Y5VA 5GGVH 3RNKA 2XNAB 4PJBE 2EE9A 4X6DF 1PDKA 1VHPA 2BCKA 1N3NA 2QQKL 1KPVA 3HAEG 3Q5YA 4WW2B 5HPOA 1DDHB 3SCMA 3SDXE 2W0PA 1FNEA 3NCBB 4HD9A 5E4EB 4PLKC 3HR6A 1QLFB 1BFOA 1DJSA 2D9CA 3JV6B 3RWGB 4OM1L 4OIIH 4HULB 5KVEH 2HLFD 3HPJA 2HLAB 1QVOB 5EUOF 4PJXB 1JWSA 1A6VL 1I85A 4B53A 4FN0A 2EC9T 4LCIH 4LLWA 5C0FA 3TZVC 3ARDD 2GAZB 3X11B 4LP4A 1NC2B 2ARJA 2XICA 1J10A 1X6NA 4OZFA 3C5ZA 4WCYL 1FGVL 5TPWL 3VGHA 1UGNA 3H9HA 4WJ5B 1R3HB 3GB7A 5I30H 3OB8A 3W11D 5ISZD 1Q94A 3V6OA 1VGEL 5GSRB 4KJQD 4ZFZB 5HHMB 5D2NC 4OLUL 4PJHA 1E6OL 4GLRI 1MCPL 4OLEA 1MQKL 3H8NA 1S7QA 2VSCA 2X89D 1IC7H 1F45A 3ALWA 1J1XH 2XQYK 3Q2CA 3TBYB 5C0NC 3SE3A 5JW3H 1EO5A 4FQ1H 3ZYJA 2W9LA 4FZ8H 2F74A 2Q8BH 1FNSL 1TTFA 1UZ8A 4P4KB 1HSBA 3EJZC 3W0WA 4C56A 5CEYB 1FG9C 4JFFE 1LO0H 3V7AE 2B1HH 3O3DA 5EO0B 3RWFB 1WK0A 4HC1H 4P46D 3QEHB 3UTSA 1F2XK 4CVWA 5J89A 1BECA 4JQIL 3PABA 1X5KA 5DEZA 1A8JH 2B7DT 5EO1A 1JYWA 4PGCA 4K8RC 4NN5B 4FQCH 1I1AD 1TZIB 4HG4J 2NNAB 9CGTA 4NWTL 4LCWA 3IF1A 3CDGB 3VXME 2VQ1B 4LCWD 5CSZA 5C0BD 4R90L 4WI8A 1S7RA 2Y07L 4HEME 5TH2A 4JFQA 3V4UH 4BQ8A 1BEYL 3L3IB 3ILPA 3MR9B 3QYCA 3VJ6A 3LDBB 3C5ZD 3F12A 3B9KA 3BZFB 3STZB 3QPQC 2CDEA 5J3HD 1GPOL 4PY7B 2HLAA 1DUZB 4L29B 2V2WB 5IEHA 3RRQA 4OD3L 2ZNWA 4JANB 1JMXA 1IZJA 3MRJB 3I2CH 5MEQB 3GGWB 1GOHA 4O51A 3RA7L 5ERWA 2FR4A 2X5PA 5FDWA 4JGMA 3RDTA 3V4PH 5F7HA 2YPKB 4X7CC 1AHWB 3N1PC 3QI9A 1VERA 4GSDL 5D5MA 4HXAH 4DWHA 3RNKB 3C9NA 2B1AH 5INDB 1IC4L 4CJ1A 1WV7T 1CWVA 3GDBA 1YECL 1P6FA 1TJHL 3NIGE 1Y6NR 3EJJX 4XCNB 3I75B 1CGSH 1ITCA 1DVFC 1MFCL 5C9JA 1J05A 1B2WL 3H7BA 2A77H 2R0WL 5KS9B 1Q1JH 1T20B 3V6ZB 5HVWA 3FKUS 5GHWH 5H37H 1F6AA 2WINA 5L0QB 1XF3B 4PJ9C 5FGBA 2O5ZL 2PW1A 2JELL 2Z91A 3JWDC 5BO1H 4JFXA 4PJFF 1NCCH 3AM8A 3OJVC 1MLBA 4UINH 3ZDYE 4W4OC 3VE0A 5FOBA 3LQAC 3RWCB 1QSFA 5JW4R 4Z7UF 3O45A 5J1SC 2HVJB 4PIRF 5DWUL 2HN7B 3HS0A 5K9KA 3GHBL 5C8JA 5DJCA 3B2VL 3EOYG 3BT2L 3O2DA 5A40E 4K8RL 5FGRA 5D1XA 5ADPH 5LJYH 4HXBL 4YK4B 1T04B 3REWA 5E0QA 4URTB 5EOCH 3C5SB 3I02B 4JAMA 5GRZA 2WBJD 4NQSA 3ZE0F 2VDPL 1KCKA 3KS0J 4MX7A 1FPTL 5F93C 2JE8A 2EE6A 4HK0B 3MODL 4ORZC 1OGAD 3LEVL 5KSVB 3VMPA 3FAXA 3IJSB 1FGVH 2A9ML 1HH9A 1WIOA 3FN3A 2IEPA 4GAFB 4BUHA 1BOGA 1Q9OB 1FNFA 4G6AD 4YHKL 4ZOAA 2P8PB 4K07A 2G5BA 1KCRL 4OF3A 2FL5A 3OGCB 3O3AA 5B8CC 4A6YA 1IQWL 3GIZH 3I75A 4XCFL 2V5TA 2FBOJ 2YPVL 2ICWI 5IBUB 1ZLVK 5I2IA 4QXTB 4JRXE 2V6HA 1FRGL 4JY5H 4K23H 5DJ8B 5DMKA 3U6RB 2CQVA 2EDJA 1JPFB 1LO0L 1CIUA 2J8UA 3WXWH 1KUMA 2NY2B 4QNPF 1T0PB 2FR4B 4UQ2A 4NM8L 2NXYC 4DKFH 4JQVA 1MFBL 5E2WL 3BEWA 1ERNA 3K80A 5FXCH 3EOAA 5M94B 1OAXH 2DTMH 1NC2D 4NPYA 4HQQH 5E2UH 4EZMA 3P0VL 5ILTH 2UY6A 4P5KA 3WD5L 4EI5B 3U2SB 1IAOB 2OZ4H 3TA3A 4M6OL 3P9WB 4RMWA 1S5IL 1EDQA 3W11C 4CNIB 4H8WC 3ULUH 4OLXH 2R56H 3BWAA 1OM3L 5T5FH 2AJXL 3P9MB 3MFFB 5EFIA 5MEOA 2H3NB 5BRZB 5I71C 1I7RB 5I1JL 5GIRA 2WNGA 4Z7UB 5F9OL 1QBLH 1T21B 2ENSA 2OMNA 1G7IA 4HMDA 4I0PB 1BJMA 2DQIL 2OSLB 3KPLB 2E7LC 5LQBH 5J9PA 2DWDA 4RCAA 2W9EL 3C6LD 3RY4A 1OP5H 2VR4A 3MRQB 4G8GB 3VI3F 2B1AL 1WBYA 4M43L 4YHPB 4TULL 3UJJL 1KTLA 5DJDB 1DP0A 1MWAB 3BD4A 2HJKA 5FB8B 2BNQA 1QSEE 2Z31B 5IB3A 1I7RA 1EAPB 5DFVD 4PJIB 1G9NL 5KVEL 4UNVA 2QQNH 4JY6B 1N64L 1U8PB 4NN6C 1I8MB 2FO4A 4M7JL 3U0TA 1BAFH 1VGKB 4OZHE 3I50L 1ACZA 1YEEH 4KKLC 1NLDL 5HD8D 4PRIA 3Q6FA 3WFZA 1MFEH 2L0DA 2YN3A 1CVSC 2MHAA 3BW9B 2AS5M 2ORBL 4MXVE 4MB3A 3MV7E 3O4OB 3UDWC 3HG1A 4NKIH 4ZOBA 1NAMB 4FZEH 3UEZA 4WO4D 4L9LA 5CILH 5F7YC 3FN0L 3IFPA 4LARH 4AY0A 4XNZB 4O2CB 1V05A 3P4LA 4HX1A 3KLHC 1CLCA 1UG9A 2EDKA 4NQXA 5GRJH 2VDQH 1YQVL 2XACC 4QRPE 5KSBF 1I8LC 1JPFA 3B2UC 1S9WB 3D0LB 4ZUTA 5JUEH 4OFDA 2OJEB 4HC1L 2CJUL 4PJXE 1IEBA 4GQ9H 1AGDB 5FYKE 1QA9B 2PKDA 1VEPA 1KB5H 3CLFL 3DX9A 1XIWB 5EOQL 4XCCL 2WW8A 1X5LA 2FHFA 2VZUA 2HMID 5HYJD 1DANU 3SE8H 5FDYA 2XTLA 3L3DB 4NHCH 1QFWI 3VFPA 5CSGA 3BYYA 3MMEA 3MNWA 1MH5B 2XY2A 3S97C 3PXHA 1CQYA 2ZUXA 4OGZA 3PP4H 3BRDA 4PP2A 3AAZA 4PJEE 1KTDB 2QADB 1NLBH 1XCTA 4IMLA 1U8KB 4LSVH 3L3JB 1EMTH 1HNGA 2EZ0C 1UCTA 5EU3A 4KQ4H 1ZTXH 3MRMB 4RGMB 4CADB 1T7VA 3O4LE 1HSAB 2MHAB 3BW9A 5HYSA 1T03H 1OAKH 1CLYL 3IXAB 1CLOL 4G9FD 4O58L 1D5XB 3QWOA 2P42B 2H6PA 4PRAA 3SHSA 1OT1A 3B9VA 1PY4A 5CBAB 4ELME 1FNGA 1IRAY 2XTJE 1CGWA 3HCVA 2HN7A 2GJ6D 4MS8C 4HIHB 2CD0A 3IU3A 5IMOB 2JCCE 2YBRB 3HLAA 2XV6B 3TJHC 1DE4A 4XNQA 5JQ6H 5JHDD 3R06A 5D7LE 4YNYA 1JYXA 4OBRA 5SV3A 1A6UH 3WKNA 5EU3B 4TRPL 3TM6A 3CC5B 5D6DC 1ACYL 1I85C 4XVJL 2DF3A 2IADB 2A1WL 1VA9A 2NY7L 1IGJA 5BS0B 1EJOL 1B2WH 5EUKB 1DL7H 4IRSA 1RIVH 4ORGB 1FDLL 1T1YA 5EU4B 1NBZA 4DZBB 3IDGB 3QB7C 4F15C 3DTXA 4ODTH 4NIKB 1MHCA 3X3GL 2HTLC 5GS1C 3KDMB 4OB5L 4XCNA 3O9WD 2I60L 4KAQL 5CFHA 4L8SA 3TN0A 4P2OA 5I1HL 2AV1B 4C4KT 3QXDA 2LU3A 3RVUC 4YO0A 2YXFA 2X44D 3KPMB 4OLVH 5D5MB 4Z7VF 2BVUA 5HYEA 1ZHLB 2ZCHL 1SY6H 4Y4HC 2D7MA 2XOTA 3NCYP 2XG4A 3WUWA 1H3VA 2UWEA 5L7XL 2VLKB 1OHQA 3B2UD 3CVHH 5GS0D 1RURL 5JXEA 4EI6B 3OKOB 4JZJA 4K3JH 5HPMA 4NQXB 4HLZG 3O9WB 1P4LB 3M17B 2N1KA 5F9WC 1MCHA 3P4MA 4HFUH 2P7TA 4PY7A 5C0RH 1NGYA 4HV8B 4GW4B 2WK2A 4EXKA 2CK0H 5D1ZC 3Q6GH 4NO2A 3RGVB 3LEXB 2XFXB 2VDLL 1YEEL 1LD9B 4LPCA 3CUPA 2C4FT 3QDGA 4E41B 2CLRB 1H9VA 4KKLD 4LNRB 3LRGA 1X4XA 4X6EA 4Y5YB 2F8VA 5HHPB 4NYLA 3GFUA 2O5YL 4YC2C 5DRNA 2ADFL 2IG2L 2BY1A 4P46B 4KXZI 4Z95L 2Y72A 5I1GL 4UIMB 5I8OH 1G7HA 4NZJA 4LPVA 3U0WH 4FFZL 2PYEA 2FJHB 4ZUSB 2WANA 1A7RL 3GBNH 5EA0H 1IL1A 4ONFH 1FRGH 4J4PA 1QG3A 4DQOL 1BMGA 1NDGB 3HZVA 3OTTA 4HWBA 4RFOH 1A7NH 1XF4B 4Z77A 1AGEA 2AEQL 2OSLA 4HWEL 5F6IC 4U1LA 4KI5D 1UH3A 4JAMB 2XWJA 4X4XA 2E8ZA 2WLZA 1U0QA 1YUHA 3R4DA 4KI5F 3ZSTA 3N1GC 5DD1L 5DJ0B 4XH2A 1VB9A 1JUFB 2XG5A 3SJVB 4JFPB 2VLJE 1INEH 5AZEH 3KLDA 1ADQH 5J06A 5AG9A 3D3VA 5HI3D 1T4KA 5EPMA 5KAQF 3QDGB 3ZKMD 4HG4K 1F4XH 1X4YA 1YDPB 2PW2B 2IALB 2D03H 1HINH 2AQ3A 4N9GA 1KJ3H 1P4BH 1QBBA 2W9DL 4KQ4L 4RA0C 4GW4A 3NAAL 5B8CB 1S9XA 1F4WH 1ZA3B 3TESA 5C71A 1FAIH 4R26H 4HZLB 4P2QB 4JN2B 2DAVA 1JPST 2NXYD 3UTSE 2DQCH 2PO6C 4Y4FC 3NH7L 4HH8A 1IJ9A 2ICEA 4I18B 4NN7B 2J8UB 2B4CL 5ANMA 3P0YL 5AD0A 1JN6B 2QHRH 4H0GA 4Y0GA 3HAEB 3MRDA 4FRWA 4C83B 2SEBA 5TGBB 1HE7A 3LKPA 3D2UB 4NZRL 5E08L 1MJ7H 3RGVC 4UT7L 5T3XL 4CRPA 1J1PL 1CZ8L 3BXNA 5J12C 4YK4C 5M7QA 1XGYL 2Z8WC 3WEXB 1CF8H 2BRQA 1AD0A 5HHOD 3NCYS 5JOEA 1Y6MR 4KJQC 3QIUB 3UAJD 5E6IC 25C8H 3GGWA 4O51B 4XPGH 5HVGB 3F6IA 3QEUB 1C1EL 4A2LA 5TE7H 3NN8B 1CT8B 3DLQR 3S98A 4P5TA 5J13C 1NLDH 2DQDL 4TSBH 1U8IB 3FT3A 4Y4KB 4RMRA 3PL6A 3JZ7A 5I1HH 3D3VE 3GBMH 4L5FH 2ZOLB 4UILL 2O26U 1FGNH 3QIUD 4MZ2A 1C5CL 5T1LD 1JPTL 3EO0B 3ROLB 2Y06H 1NAKH 5L0QC 3BIKA 1C08B 1CN4A 4N8VG 4UNTA 1R5IB 1KT2B 1DN2A 3HCVB 1SYSA 4UBDD 2VDQL 4G7YH 4L3EE 3SBWC 1FNGB 1ZGLA 5IJKC 2RGSA 5LGHH 4PJCE 2YEZA 3QEGL 2VOTA 1KLGA 3EYSH 1M7XA 4LCCC 3QRGH 1QSFB 3T3PF 2A9NL 1IGML 4LLVB 4DGIH 2BY3A 4ZNEE 1MCIA 2CLZB 3ESVF 4H88L 3VFSA 2V5RA 4RAUB 4X9BA 1XF4A 3RHWF 2UVEA 5HVHC 4LCIL 2J8UE 3MNVA 2P46B 4IMLB 1IEAA 4JREB 4XPTH 2J4WH 1PEWA 5GRVK 3ZL4L 3MRNA 1G84A 1M6OB 3VXMB 1WCBB 4J4PD 1VFBB 4YBQC 2IFGA 4GMSH 5F88B 4MB4A 3CFEA 5JTWA 1JP5A 3HMXH 3GMRA 4GBXC 4P46A 1XIWA 3QHTC 5B38A 4F2MB 4D8PB 1H3GA 4JVUA 4K2UL 4XC1L 4N8PA 3VG9C 1OAZL 2EDYA 2R15A 1A7PH 1IQDB 2Z93B 3KJ6H 3FQRA 2EYTB 2X4NB 4ZOEA 3G6JA 2BRRH 4LCUB 4Z78B 4H20H 4YHIA 1KACB 5MEQA 4OBSA 2P7TB 5IEHB 1FZMA 3O3EA 3K4DA 4OLYH 5TDPA 1KN2L 4KK5C 1W72H 2FH6A 3V7AG 1FZJB 1P7KA 4OCYH 3CSGA 2Y07H 3C5ZC 5GGTL 3T4AB 1EO8L 3NIDE 1RZIB 3FT2B 4XCYA 5I74B 3L3IA 4L9LC 4O2EB 1EXUB 1NGPH 1EH9A 5FYLE 1A6WH 3HTLX 4F8QA 2X4SA 1DBJL 1QLEL 4EUPB 1RZFL 4LU5H 5CSZB 4P2RE 3LB6C 4POZD 4YEEA 4JHWH 2B5IB 3R8BB 5FF6B 2AEPH 4X7TA 1F4WL 2YD6A 1OQXA 2ZCKL 2R2CA 3PNWB 4KRLB 1VDGA 2VZOA 1IVLA 1KTLB 5K9QG 4XMPH 3I9GL 4X7SL 4YPGA 4X7EC 1P5VA 4N1HB 4M7KH 4PREA 4R7DA 4CDGC 1Z9OA 1T66C 5EU6A 1MRCL 3DXAA 1WJ3A 2Q76A 2ZNXA 1EHAA 5DMIL 1E4KA 5JIIA 1G7IB 4HWBH 4RFEA 1CFVH 4QRRE 3R06B 4N90E 1NUGA 4QWWD 5IB5B 3N85H 43CAA 1IAIH 4XTRD 2G9HB 4N0UA 5GGQH 1RZJH 3GSOB 3BHBB 4NQUA 4YPJA 4ZFZA 3MLXH 2FLBT 5ALBH 3DYMA 4MJ5B 3NCFB 4NQCD 3STBA 4P59L 2X4TB 4XVTL 3U82B 2MKLC 5B39G 5EBMB 3ZMRA 5HGDB 1X5YA 3ARBD 1E6OH 3PWPB 4JKWA 3MLSH 3JWDH 5EU5A 3IGAA 4FFWD 5EBLA 2L4OA 1DBBL 1F4HA 5C09B 1PGRB 4LPTA 1K4DB 4FFZH 3IDIB 4DGYL 4WHYG 1RIHH 1MAMH 1DBAH 3QIBA 3FO9B 4LHJB 5J6HA 2Z93A 4NZTH 5I19H 4JG1H 2VAAA 5TDNB 1MLCB 3C8KB 4QXTA 4ZPTA 5SWQA 4JQIH 4PRPB 3IU4L 3J7HA 1RK0A 3QUKB 1R3IH 5EBWA 1B0WA 3DO3A 1RUKH 3QUYD 4G6JL 5C08B 1KENL 4NQDB 3LEYH 1RMFH 4LIQH 4BK5A 1X5ZA 1DQQB 2FD6H 2R4RL 3AXLA 4OF6A 3I6LE 4P2YA 3SGDI 4TPRL 4U2YA 5H94A 3ET9F 5B39A 3BOVA 4PRPD 3MV9A 4PLKD 5BMFH 1ZLSH 4AG4H 4WDIA 4U1SA 1G6RB 4G42B 5CINL 5F9DC 4K9EH 4OD2A 3WS6C 1B0RB 4LGSB 2ESVB 3Q6FB 3P77B 1RUAL 2FATH 3S36L 3N50A 4R26L 4D94A 1FLRL 1EHNA 1LO2H 1P2CB 4K3EL 3MV8E 15C8H 3SKMB 32C2B 4XP1L 5SX5H 2Y6SC 1PQZA 4J3WA 1I8MA 3ULUE 3U4BL 4HK3J 1MELA 3UTQA 4XMKL 4J3XA 1AJ7L 4PJ5A 1AXTH 1H15B 1WTGT 3DX8A 3T0ED 1HI6A 3OR7A 2MCPL 2YRLA 4X8XA 3V79C 4NZRH 3VCLB 4NQVA 5F96L 1FAKT 1PG7W 5JZ7C 2FWOB 5E4IA 1JZ2A 5GZND 4ZXBD 1XF3A 3ZE1E 2FJFB 3FQUA 3KLAB 2OZ4A 4BH8B 2WINB 4XP9L 5HYIA 3RWHB 3PE9A 3T0DA 3PWUA 2PXYD 2AV7A 5KS9A 5JHDB 1ZK9A 1AR2A 1C1EH 4F9LC 3QFJE 4JKLA 5AG8A 4PJAE 1AQKL 4U3XA 1HIMH 3SDCD 3LPWA 1E4WH 2H3NA 1E4XL 5KZCD 3KNBA 3SKJL 3MFFA 3ULVC 2DLFL 5H35B 1PKQE 2QSVA 4G7VH 3BKJL 2GTWB 4ZD3H 5ICYA 3X13B 3FT2A 4XCYB 2W9EH 4QRPD 5AD0B 3V7MA 1M7IB 5JPNB 5HDBF 5L2JA 1TJIL 4N90D 2YZ1A 5EC1A 4HKZA 3BT2H 1UWXH 4K8RH 4X99B 4X98B 3BH8B 1I3RB 3MLWH 1K5NA 2ZUSA 3L95A 5F97E 4JFDD 1S9XB 1DVFB 3CSYA 4OQ1A 3VXRE 1M4KA 3MUHL 1G7LB 2DBJA 3GSUA 3BZFA 4LRNH 1WWBX 5DF0A 4G5ZH 2IALA 3QIWC 5GZNC 4TSCL 2RCSL 5DI8A 4ODSL 1JVKA 3MCKA 2E7CA 3VJ6B 1FP5A 2R2HB 5MHSE 5JOPE 5JO5A 3TVMB 2ZOKA 5GRUH 3C60C 4JFOA 1ZS8A 4WUUD 4R4BB 1V3MA 1U3HC 3G6DL 3L3OA 4OM0L 4JO2L 4DN4H 2R1WA 4WFHD 1HOCB 5D9SB 3OAZH 3JWOC 3TGXA 2AQ1A 5GRJL 2YPVH 4HLZH 2IAND 3MX0A 5CJBA 1FQ9C 3D1MC 4H0HB 5DJZA 5DD5L 4U1HA 2P8LA 4MQXC 3LDBC 2CMRL 4RAUA 1WBZA 1TCMA 4CMHC 5E99L 5CJ8A 4OZFH 3WLWC 3FRPA 1OAQH 1LE9A 4XBPB 4PJ7E 1JTTA 4FXGB 4XCCH 3GSXB 5C0EA 1S7QB 4OLYL 3WO3B 5IFAH 4JFDA 3TBVA 3WD5H 3AM8C 2OK0L 4KDTA 3VWKB 3QCTL 5FGBC 1C08A 4ZUVA 1JPSH 2APFA 3D25B 3V8CA 2A73B 2QV2A 4UT9H 5MENE 5D8JL 5DS8A 3B9KD 4JDTL 5HI4C 5IMLA 2NY4D 2RR3A 2VZVA 3VXNB 3R0NA 4RDQG 2XY1A 2A6JB 5D1XC 4ZQKA 5K9OB 1OTTD 2NY6B 1B4JL 1UM4L 1YPZF 2VXUH 4P5TB 3QQ4A 3ARBB 1QBMH 3ES6B 3ZDXF 4XP6H 4U1JA 5CBEA 1T0MB 1U8MA 5FHBL 3SBWA 1MF2L 5I8CB 4HIJB 1D5IL 2UZIH 4CU8A 1YPZE 1CGVA 3EDDA 5HHXL 1KIPB 4H26A 3QXDB 1FCCA 3VMNA 5A3ID 3BKMH 1T22A 1BQUA 1T7XA 1SJEB 4POUB 4MCYA 3N85L 1JTPA 1FFNA 2JJVA 4M3KB 1DQDL 1U8MB 1TZHA 4K7FB 4XB8A 4Q74A 3NFSH 5I8KH 3TBWA 4G6AC 5T1KA 3MRJA 4MA8L 2Q86B 4XMLL 1AE6L 1OGAE 3D2UD 2X1QA 3RX5A 2OYPA 3VFOB 3IAQA 1EEUA 3TBSB 1AFVH 4M02A 5FA3A 1M05A 2JCCA 2P5EE 3LVEA 5KSBE 1ZHNB 3HZYB 5GS0H 3QG6B 4PJCB 1VPOH 1CICD 1FL6A 4LARL 2R8SH 3EYVA 5I6XC 5E94B 1DUYB 2M2DA 5EO9A 4J3TA 1UEYA 3ARYA 3TNNA 1G9MH 2V9RA 4JN1L 4LASL 1D5XA 5IIEB 1G6RL 4X5XA 5I16A 4K3DL 1KEML 3TO2B 2YWYA 1MSPA 5DMJB 2W59A 5BZDB 4Q9BA 3ZKND 5DJYB 1UXSB 4ENED 1UQSB 4Y2DA 5F1KC 1RZGA 3FQTA 3GIVB 3NCJL 4PP2B 5IB4A 4UDTB 4HKJA 3UPAA 1MI5A 2F74B 3ARPA 4UMGA 3LOWA 4WI5A 3L3KB 2WBJC 5IHLB 4F9PC 2BSTA 2EIBA 1I8IA 3P30L 4UZGA 2IG2H 4HH9A 5DYOA 2OL3B 5I1GH 5I8OL 4LIQE 2LVCA 1J1XL 5EN2B 4LK4A 4JPVL 2F54A 5GSRA 2DQEH 2ICWB 4X6EB 4Y5YA 3TJEL 4WI3A 4K9EL 4ZG1A 3PF2A 4KI5E 2H45A 2EDFA 1OP9A 5JXEC 4NKQB 3DX6A 3TYFB 3BVNB 5DR5H 1FBIH 1LNUB 2AEQH 4OQTH 1P9MC 3Q1SL 3DMMA 5JOFA 1MFDH 5JA9A 2FNBA 2AGJL 2EIZB 4FQQA 1I3RA 2XZZA 3O6KL 1W72B 5IQ9B 5F7FA 4GAJH 4NHUB 4ZO8A 1HK6A 3RWDA 2FX9H 4UUJA 5ALCL 1N0XL 3ARGD 3CFKA 4FNLL 5F96H 1Q9WA 2RBLA 4TUJA 4D0CB 5C0JA 3I85A 2AJZB 3AS0A 5F1IB 1JPSL 1E27A 1XGRA 3CXDH 3GSRB 3QIWD 4JPKL 2CPCA 2IH1B 4PBWD 4LLQA 4GG6A 1EFXB 4V2BA 1GGIH 4N0CC 5T5NF 3PGDB 5DJXA 1S7SB 2PYFB 4M1DH 4P2OB 4JG0H 4ODTL 2BVPB 1MHHB 2YC1A 1MHCB 1CXFA 4M6MH 1HIML 1FNHA 4YHYC 5F7DB 3O6FC 3G5XB 4Y5YC 3FB5A 4NFBA 2E9IA 1T1XA 3QDHA 3WUWG 5IHUH 5DZOA 4X6FA 1BIIB 4LLYB 4EEEA 3IFOA 2GCYB 4Y4KD 1KPRB 5BV7H 2EO9A 1AO7D 5CIPA 1J88A 4YXKH 5E2TL 4HHAA 1WFTA 3RVXD 5HHNB 3T8XB 2VISA 1GGCL 1MJ7L 1CICB 1IGIH 3GZKA 3VFUB 1ORSB 3PWJB 4UQ3B 5GGUB 1CF8L 2J8OA 5GGRA 3IU3B 4KHTL 1JYNA 3ZE2F 3A67L 1MCJA 1KPUB 3MRGB 3MRBB 5C0CA 3R0MA 4B7IA 4F7PA 3V4VL 3UROR 4LSTH 3FCTA 2DMKA 4HUNB 1D6VH 2XWTB 2VDLH 3SDYH 1B0GA 5AZ2L 3V6FA 3SEPA 5A1AA 1N2RA 1ZA6A 3DXAE 4OD2B 4TOYL 1H8OA 1WBXB 4N5EC 2OJZH 3IVKA 3UJTL 4JM2A 4NPYB 3OV6A 4S1QH 3CXHK 3NIFF 4WENB 2Y4SA 5IBUG 3MBEC 3LV3B 4KWUA 5INCB 3HZMA 5IBLD 4N0YH 1TLKA 4L9DA 5JDJA 1FORL 3MJ8B 3MNWB 4FFYL 3RDTC 3ZZ1A 2V5SA 2OTUA 1FFRA 5T5NG 2XZQH 4ONFL 1WIUA 1MIMH 5I1KH 5J56B 5JQHC 2EYSA 2XA8H 2JCCF 3JWNC 5E56A 3DVFA 2YUWA 4NP4L 2PCPA 4K3DH 3BZ4B 4APQA 3ARVA 1RK0B 3BESR 1MFAH 5MERB 3T0WA 4O9HH 3OKKB 5LXGH 3IDJA 1M71A 1OARH 2EDLA 2YN5A 1I1FB 5IVOA 2V9QA 3FZUD 3QNYB 1YN6B 3O6FA 3FO9A 5E2VH 4XHQA 1K8IA 5I76A 4KQ3H 2CKBA 2HA1A 3O3BB 4PTUB 4XT1C 1LE5A 3BDBA 4R90H 2FB4L 3DX7B 1ZOXA 4U3CA 3WDIA 3WN5B 4XP4L 3QDJE 5EOTB 4M5ZH 4MA1C 2PTUA 3FHQA 4O2FA 2DIAA 2CUIA 1A02N 3T0AA 3ILQC 2R29L 2G60L 2QADC 5DVLA 4KXZH 1P5UA 5AWNL 5FYKD 3TFKC 4G9DA 3BP5A 5B3JF 4WHTA 3FFDA 3C8HA 4OCWH 3IFLH 3TCLB 5K9KB 2GK2A 4NDMA 2HVKB 4QT5A 2IF7A 1TFHA 3WLBB 1MFBH 3DRQA 4FQLH 3DVNB 1J0IA 2P49B 2HJKB 5FB8A 3T2NL 4D0CA 5DVKA 2GITB 3W82A 4LLDB 1GH7A 2HFEB 1KLUA 3MCLH 3VD5A 3DXAB 4OCYL 1NCNA 4JFZL 1ZANH 1J1PH 4OFKA 1CFQB 3QP3A 2A38A 2DWDB 2H1PH 1JGEA 2C1OA 4LCCB 4NBYB 2B39A 4DFHA 3X14B 1T5XA 5IVZB 1ITBB 2Z31D 1KCSH 3B2VH 4WU5B 1LMKA 4PBXA 3O2VH 3H7BB 4MDIA 1JNNL 1MQ8A 4N0CD 5IQ7H 1VENA 2ZCKH 1FE8H 4HPYH 3FB6B 2Q8AH 4NQTA 2VLJA 4WWKC 3QNXA 4MNGB 4KMTH 4LBEA 3NTCL 5INDA 3WJLA 4AENA 1YJDC 1N6UA 5LQBL 4R4NC 4Q9RL 1BZ7B 3QI9B 3LEVH 1AO7E 3B4NA 4EXPX 5DA4A 4FXKA 2BNUB 1JF1A 2DLGA 3SGJA 1EHLH 2FZ3B 4OAWB 3Q3GB 4M1GH 5IB4B 2VKWA 4EN3C 2W91A 1RZGB 3VWJD 1HCFX 4LSQH 3WFDH 2QQNL 2X09A 3RJDA 1EBAA 5IW6B 1F90L 4WW2F 4I77L 5E9DD 3O8XA 3SDCB 1H3TA 1OY3B 4V1DA 1S8DB 2P5EA 1KBGL 4LKCB 4NQCE 4K23L 5E5RB 3RVWC 3S9DB 1N5AB 3DRTB 4XVTH 4KKCD 1CD1B 4AK1A 1IGCH 3AB0C 3CVHB 5I1AA 1SBSL 1KC5H 4XAWL 4HKBB 3HC3H 5K9JH 2GJZA 1KCRH 2DQHL 3KPOB 4RRPG 4XBGB 3HMXL 3CFEB 4YDIL 5EO1B 4RWYL 5DJ6B 1FL5B 4G43B 4JPVH 4M00A 3VFMA 2BNRB 3QAZC 2A6IA 4TUOA 2XZQL 4G8EB 4V2CB 4HGMA 7FABL 1OP5K 4PUBL 4NJ9H 2P44B 3WXWL 4EBQH 5E5MA 4N0FA 1UENA 3MOQA 5GJTH 2X4QB 4AEIH 4N1CA 1CU4H 4Y89A 5HDQL 1QQDA 5IG7A 1T2JA 1L7IL 4W68A 2R4RH 2NMSA 1LEKA 2VYRE 2NY2C 3BIBX 4RBPK 5CHNA 3QCUL 4KTEH 3HS0B 1KIPA 3BO8A 3H9HB 2EEDA 4G9FA 5KVDL 1X6LA 2QBWA 3QFDB 4KZEH 4Y7MA 1AKJD 2Q6WB 5MHSD 1ZGLP 3B8SA 4DVRH 2E7MA 4ODXB 2PUQT 1JL8A 4YZFE 1YJDL 2BVEA 1MLBB 1NCAL 5JXAH 4Y16A 4YDKL 1LDPL 4GAGH 4JDZB 1M7DA 1C8PA 1HH6A 1OAUL 1TVBB 2KL6A 5EDXA 3QEUA 2KZWA 1BAFL 3UTTA 3WIIL 4NKDA 3LZFH 5E8PA 1CDBA 2XKUA 1UWEL 2ATPA 4HAGA 4M7KL 3U7WL 5C0DA 1P84K 1SM3L 1T83A 3WBDA 1CDCA 2ZJSH 3RBGA 1UFUA 1BVKB 1L6XA 3HN3A 4W4NA 4GW1A 1T7WA 5TGBA 5J1AB 4PJ8B 4OGAD 4MXWH 4PYGA 2IFFH 2BXZA 4OZIB 3ALPA 3BGAA 1IM3B 4KHTH 1AR1C 2LTQB 2X05A 2NY3D 1RHHA 4F9PA 5E6IB 3P2TA 2QR0A 1QRND 2CKBB 2R69H 5E5MB 1UM6L 2HT2D 4JN2A 3DURB 5JW4N 3B9AA 4L29A 3VGAB 4YXHH 2P8LB 3GHEL 2YD3A 2ZCLH 5J12B 3G5ZB 1AQKH 4XVUC 3AS3A 3D39A 4ZAKC 3DHJA 3UJTH 2ESVE 2H32H 1BX2A 4FTVA 1K3ZA 4DUXA 3WS6A 5EPMB 2X1PA 1LP9B 4HS3A 3PQYA 7CGTA 4J1UB 4NCC2 3VD7A 1CDJA 4HKBA 2PO6D 4Y4FD 3E6FB 3HB3D 1TXKA 4NO5B 5IT2L 5I1CL 4BSWA 1XMWA 2YD4A 3ARDA 1XCQA 3ARTA 2XA8L 2GTZA 1N59B 1TJGH 5D1XD 3FQNA 4OM1H 3HZMB 5EZJA 4NZTL 4YGAB 1DN0A 5FKAB 1UJ3C 2P4AB 5C0RL 3EOTH 4X6BB 4V1DB 1A6AB 4LSVL 3LS5H 1T3FA 2RCSH 3LEYL 2DQJH 3HG1E 5BVJB 4XRCA 1TMCB 3U0PB 1T6WA 2H32A 3LSOA 4KMLB 3RX7A 2NTFB 1NEZA 3GMOB 1SVZA 4JZNB 2BMKA 1RHHB 5IHBA 4CU6A 5C2UB 3G6DH 3ULUD 5FYJD 5DHYB 3WFCH 5CJ5A 2VDRL 4EIGB 2VH5H 3ARGB 3KLSA 4OIAA 3B5GA 2P5WD 5C09E 3VFUA 1CK0H 1D7FA 3HRZA 4Z6AT 1CICA 4PRHE 2ZWLT 5EIQA 4NFCA 1L9MA 2F54E 1OAKL 4X6CB 4E41A 2H26B 1OT2A 3S36H 4LSSH 5KTEH 2GAZA 3X11A 5HDLA 2AK4A 3DVGA 1EJOH 4KMQA 1DL7L 5I1IL 5E95B 4PB9L 4XP1H 5GJTL 4PJ7A 3O81A 1P7QA 4M6NH 1QACA 3F7RA 1KJMA 4X9HA 3MLZH 2XQBL 1JGLH 3HI5L 5IVXA 1FNEB 5HBBA 2MCPH 4ZPVA 5DJXB 3OR7B 1JWMA 3OX8B 3EO1B 2B0SL 3S8WA 3WUWB 1FVCB 3E2HB 5EOCJ 4NGHL 1F3JB 1F58H 5ICZB 1NC4A 1QZ1A 1NBYA 3VRIA 2W0KA 1EA9C 5EIIB 1CGUA 3SDCC 3L1OL 1T80A 2FBJL 3MRRB 3KS0H 5D1ZB 5M95B 1OWRM 3EDEA 1CFBA 2AXJA 2DOCA 2H2PD 5IVXB 4RFNB 5F9WB 3UPRB 1JNHB 4G9DB 5IQ7L 5D71L 4X80L 3S37X 1EPFA 2W0LA 5CCKH 4QYOB 3KPSA 2EKSA 2VL5A 2MMXA 4OIBA 4F3FB 3Q6GL 4OZ4A 5IF0B 3SDXF 2OTPA 1DQLH 1EAJA 1UWEH 3AREC 4PS4L 5DEFA 2B4CH 2ZCHH 2W38A 4XCEB 3RTQC 1UB6A 2WP3O 3QUZD 4QOKD 3GMQB 5C3TA 3SGEH 4Z7VE 3F58L 2IFFL 2HJLA 2ZKHL 1K8IB 1NCWL 3ARWA 1AIFB 3VGGA 5EN2A 4HFUL 1MFCH 1BFTA 2NY5C 1XGUB 4RFNC 2YR3A 4LGPB 2C3GA 3ECBA 5IV2B 1A4KA 4U0QB 1AO7B 1NSNH 3V0VB 5CBAA 1K85A 4P2RD 2APXA 4RAHA 4Z7NF 5KANI 4HS6B 4Q9CA 4O00A 2J6EA 5FUCE 4BM7A 4ZSOB 5SWZE 3VD3A 1UEMA 3QIBB 4XNYH 2ADJA 3MRMA 4P5MB 3TCXA 3QFJD 3VG0L 4GW5A 4U0RB 1A5FL 2YSSA 1GZQA 3MLYL 1C5BL 3VH8B 3I6GA 5I71B 3Q3GA 4YR6B 4YE4L 1MUJA 1AO7A 3V0VA 2ADJB 4P5MA 1F3RB 1U91B 4YIQA 3H42L 2X42A 5BXFB 1N2RB 3DETD 3EYVB 3LKRA 1BEYH 3OL2A 3RWJA 3CH8A 1ZVHA 3QRGL 4QHKI 2HJLB 3LS5L 3BP7A 3GMPB 1UXWB 4B41A 3NBNA 3MODH 3P4OA 3U9PH 3S88H 2EDTA 1VKXA 2EXYC 4YHZH 2AKRB 1L7IH 4YWGL 4OF8A 1D9KB 4PJDE 1JGUH 3EOBB 3F7VA 4NBZB 2BK8A 1IKNA 3GMQA 2X4UA 5EU6B 4YUEL 2Y9RT 3P30H 5T1DL 1TZHB 5JR1H 1KCLA 1FFPB 3MV9D 4F80A 3IFOB 4KK9C 4OF5A 5HVHB 2DRUA 1LDPH 4GAGL 2Z8VC 3EJYC 1NFDF 5FIEA 5DD6B 1ETZA 4L8BA 4QRUB 5D7IA 1JNHA 5FF6A 3CSBA 4CBPA 5DR5L 2NR6C 1A14L 1S7SA 2PYFA 3SGKC 2MQ3A 2VDOL 2YD8A 5T1LB 5I1IH 2XKSA 3QXVA 5D7KE 3ROOB 2NY1C 1YNLL 3EJYD 4L8DA 4E9LA 4O2EA 4MAYC 2DQDH 3D69A 2EDOA 2DTML 3FT4B 4PJ5D 1KB9K 1W72L 1A9BB 4FNLH 1U2CA 4G8GE 1YMMD 2XXCB 3O6ML 1EO8H 2A6KA 4BSVB 4ZAKB 1RU9H 2HRPL 3OZ9H 3PHOA 3TIDA 4FQQB 2EXWD 1BQHB 1IC5L 2Z0BA 5DZNA 1KCUL 4YBLB 3CDYA 4HKXA 1OGAB 3D48R 2VN4A 4XMLH 3O11A 5HHOE 3CZFA 3LQAH 3MLTB 1VFAA 5CJOL 1QFOA 4OF0A 4P2QE 4IRJB 5BS0D 4KPHL 2O5XH 3BDXA 4PS4H 1QHOA 4KK8C 4LAJH 3IKKA 5IOPB 1UA6H 3BP4B 1HCVA 4K71B 3KPQB 4WFFD 4NC0B 5IBLC 1GGCH 5TFSH 2HJFB 5CEZD 5D9SA 5BVJA 1I9IH 1WT5C 2CK2A 4KRNA 4MJIE 3THMH 3U4EA 4LPUA 1P7HL 1Q72L 4DGIL 3MRFA 5TDOA 3UTTE 4O02H 3H3PL 4NCDA 2ITDB 1ES0B 2O93L 2XWBA 1OAZH 4IRSC 1WEJL 2VZ3A 4WV1B 5DLMH 2JK5B 4R4FH 2Z92B 5EUOE 1FZKB 1CD8A 2OJZL 1CE1H 3ARRA 3MOAL 4IRSD 3ETBF 3HI1A 2DI9A 4KJWD 2OR9H 3KPRB 1PX3A 2IMNA 5FYLD 5IW6A 2AJVL 2FGWL 5I66B 4LSUH 2MQ0A 4PJBF 4X6DE 1FORH 1U8OA 3L6FA 3TN0D 2YD1A 3UBXG 1NUFA 2BHYA 3MREA 3TJEH 3ZSSA 4S1RL 1HQ4B 1Q0XH 5FO9B 4HC1A 1IT9H 4LEXH 3JSSA 5GS1A 5FYLL 1BPVA 4JB9L 3L3HB 5ANME 3DURA 1KYOJ 4WU7B 2ZUUA 1C7TA 3STLB 4RGNC 1CBVL 1JZ5A 3BZEA 3FB5B 3W39A 3KXFA 4M6NL 5EOQH 2DMBA 1NFDB 2HFGL 3QAZB 3KHOA 5SWSA 1Y18A 1J87A 1PY9A 3GI9H 4NN5C 1QNZH 4TSAL 3C2AH 1JGUL 4NKDB 4P9ML 1MAJA 3QH3A 3QA3A 2HVJA 2F15A 4G6MH 3VWJC 5IJVA 1BQHA 4WO4A 4KGLA 4D9LL 4QRRD 2M8XA 2LVEA 1D5ZA 4YEFA 1IKFL 5D2NA 1TQCB 4HBQA 3SQOL 1JWMB 3OX8A 3MGOA 5DMIH 2R29H 1T03L 5E24E 1T6VN 3P0GB 1CFNA 2WV3A 1KULA 1FFOA 2ID5A 1DQJA 4PR5A 5DFWH 4YX2H 2CO6B 3ROOA 3H6JA 2YD9A 3QUMH 2F53A 1U8LA 4WFHE 1YMMA 2L7JA 5D2NB 3UYRL 2ADGA 1RZ8B 4RX4A 1D5ZB 3CMOL 5C9JB 4JZOA 2W60A 3DROA 3OAYK 3OJMB 1ZT1A 3V6OE 5BQ7B 2ESVA 2NZ9C 3OKEA 1WGOA 4LVHC 3VGDA 1H5BB 3D3VB 3BPLC 2EICA 3C6LB 3MRHA 2G2RA 3FAWA 4JFZH 3KYOB 1AQDB 3O6MH 4L3ED 3GRWL 1MWAH 4MA7L 4PJ9D 3H7LA 3FONB 4WY7H 4QRQA 3VU2A 4FQ2H 1FG2B 4ISVA 3ZDYF 1LE9B 3ZE1F 5JPMB 5KG9A 4F15B 1XF2A 1WBZB 5DFVC 1D9KA 4KDWA 1DCLA 3D3VD 1GGBL 4NM4L 1JNNH 3S5LG 2UVFA 3QZWA 2OCFD 4OB5H 4OI7A 1UWGH 1V7MH 4L4TB 1UXSA 2AJUL 3KGRA 1XR9A 5D2LE 4G7VL 5GGVL 4PJBA 4S1QL 2ZSWB 4B50A 1QUNA 5I66A 2DWEB 3WXVL 4MQ7B 3BGFB 1F11A 5HGAA 1TJIH 3O2DH 1QPPA 4MNQD 1IAKB 4MVBD 4KI1A 1EHLL 4K3JL 4G80A 4ELKB 1TZIA 3U4EB 3VH8A 4OF7A 4YXLL 5EIVA 2YSSB 5KSBA 4PJBB 4MQXD 5ESAA 1RVFL 1XR9B 4BFBD 1ZTXL 2KPNA 3OAZK 5EO0A 1E4JA 1UT9A 3BFOA 3M1BA 3U9PL 3BZDA 2AXGA 3VFOA 1K5NB 3JVGA 3T0EB 4DEPC 5KAQG 1BREA 3LAFA 5GRUL 3IB4A 1XF2B 4K3EH 4JR9L 2I9TB 5HHOA 4OFYA 3OKOA 5E6IA 5BRZD 4M48H 4ISVB 2WIMA 5C0BE 4F7CB 1WISA 3E6HA 3FTGB 1I8LA 2ERJC 3KPRE 2V5YA 4WNQA 3CPLB 3C60D 4TQEL 4MCYB 3VGBA 1FYTE 2GUOB 3U0WL 4BK4A 5C08E 1PG7X 1R24A 4PJ8A 4ZS6D 4RIRA 1Y6KR 5CINH 2AV1A 1ZLWK 5IVZA 3FB8A 5D6DA 5D72H 4PLNC 1A0QH 4HHAB 1O7VA 1U8QB 3CK0L 1KJVB 1GOFA 1A7OH 1U8LB 2EC8A 5E99H 4NRXA 5TQ0H 3PWNB 1KLUB 5E5UB 1I4FA 2NY6D 3HUJB 2GITA 3CH1B 3UCRA 2E6QA 5F7DA 3DOSA 1QOKA 2A6JA 3ZKQD 2A6KB 5FYJL 3SO3C 4BSVA 2DJUA 2BHZA 1KN4H 4NQVB 4JDVB 4AIXA 4EUPA 2BZDA 2AK1H 4S1SH 3EYFA 4OLVL 4PJ5B 3RAJL 1RUPL 3B3IA 3T2QA 4KZEL 5FUCC 5IMKA 4HJGB 5CJXA 2H9GA 3VRJB 4E42A 3SQOH 2A74A 3R1GL 4R8WL 3GSNL 2K3TA 4YDKH 1YEKH 3V52H 2HLFC 2XZAL 3VGFA 3PG2A 1HILA 5E8DL 2PXYC 3DUUA 1MEXH 1UKTA 1KJMB 2CUHA 3A6CL 5DD6A 4HDIA 2LU4A 4XGZB 4W81A 3WNMA 1JRHH 3I2CL 4KY1L 2X4QA 1ND0B 3BKJH 2QQQA 1WCQA 8FABB 2UZIL 3MV8A 5BJTA 1S3KH 2J12B 4KZDH 1JPGB 2VDKH 1CIDA 1R3LA 1AXIB 1XZ0A 1DLHA 2I24N 4FTVE 5I1EH 3O3BA 4PTUA 1LE5B 2O5YH 1BD2E 2F54B 4X6CE 2FO1A 4D8PA 4Z7OF 1I9IL 1YN6A 1P1ZA 3O6FB 1NMAH 4XAKD 3FTGA 5C08A 2COQA 4FQ2L 4YHYB 1DQDH 1JTOA 3MJ7B 5E8EB 4YBLC 5A2FA 3H3PH 2X89A 1W0WB 3HUJE 1PKOA 3DYPA 2GI7A 3BZ4A 5EZOH 1BQLH 3LKRB 2EZ0D 3T0VA 2BERA 3GSNA 4C4KO 2WUBH 3K2MC 3FL7A 5CZVH 4QO1A 4EIZC 1ES0A 5J7CC 5I9QC 4BUGA 4AEEA 5BV7B 1K4DA 5GRVL 1DEDA 1GL4B 3LKOB 2Y06L 3IFPB 2AJVH 3BGMB 3DUSB 1TQBC 3ARSA 3QQ9D 3L5XL 5FECA 1OPGH 5JHDE 3O2DL 1QR1B 5KVFL 3IDNA 4ZO7A 4WHCA 4OTXL 5DUPL 1EBPA 4QLRA 3C2SA 3E6FA 3P11L 3QUYC 4PRBA 4PJFA 4PRIB 4PUBH 5CWSA 2OI9C 3BIKB 3BPCB 4QHNB 2C5DC 2A9NH 2CGRH 2GTWA 4JHAH 4RQQA 4UT9L 3C6SB 4U4BA 4WI7A 4WTWA 1KJ3L 1P4BL 1HZHL 3HE7B 5D7JD 1CU4L 4YDVB 4KUZL 3KPSE 5D7SL 4CMMA 1UB6B 1D5MA 2P5WA 4PTTA 3MV8B 3ZL4H 4Z7WB 2NQCA 1S9YA 5C0CD 3NGBB 4PRID 3IJYB 3T8XA 4DAGL 3ILQD 3PWUB 4K3GA 2WBJB 2Z9TA 3KPSB 4U3HA 1RJLB 3QIUA 4KKAC 5FAAA 3NIGF 3QFJA 3P0YH 4QHUB 1BZQK 3T0EC 4DEPB 1OGTB 5FGSA 3HB3C 2BVPA 1T22B 1XT5A 3K2UL 3QI9D 4LLDA 1JJUA 4LHQB 3DX8B 1X3DA 1CZ8H 2XN9B 4ZSOE 1OF2B 1J12A 3FQXA 3HAEA 5ACZB 5HHVL 2EXYD 5C07E 3QQ3B 3P9MA 5EFIB 3VFWA 1EFXA 4QGTA 4NQDE 3UTOA 4X9IA 1RZKH 4YHML 1GGUA 1DQJB 1U95B 3HZKB 4XI5D 5HHXH 3VXSA 3SE4A 5F89B 2CDFA 3DGCR 2DD8L 4PY8I 4JDZA 5F70A 3BKML 2FSEA 4X8JB 4JGJA 1JF6A 4Y8DC 5EBGA 3B9EA 5DS8B 4ZOCA 4ONHB 5HD8C 1YEIL 3ULUL 3BEWB 1FZMB 3O0RH 4NNPL 1JRHI 3IDMB 5HGHB 3OXRA 4G9FB 2W07A 2VTFA 4KROC 4OCXL 4UQ2B 1YEGL 4OCRL 2EIDA 4ODUB 2Q3AA 2CO7B 4ZFFB 5IGXL 4L4VD 2Q20A 2C26A 5E8DH 1JHKL 3GSXA 3HE7A 2EDBA 1QD0A 4F7CA 3PDOB 1LK3L 4PRPA 4KVNH 3BZEB 2NLJB 1OTTC 4A6YB 4MSWA 2FL5B 3SDAD 4U1HB 2IBGA 4NJAH 2P24B 3BH9B 2DM4A 2BSTB 2MPAL 5I0ZA 1MJUH 1I9JL 1IM9B 1MNUL 1I7UA 2W92A 4YFLI 4RGNE 3TA3D 4OQTA 2IH3B 4Z76B 4ODBD 2VLMD 3TO2A 3L3OB 1T3FB 4R3SA 3EOTL 4NNXB 4MJ6B 3AY4A 4BZ1L 5IESH 1JGDB 4J6RL 4LSRL 4DGVH 4JLRA 5HYJE 1IAKA 4JY5L 4V1DD 4FQXD 1OCWH 2JK5A 3UBXB 3RU8L 3TH4T 4Q9QL 2FIKA 3N9GL 3QWQB 1RY7B 1NQBA 1YPZB 4NO5A 2NZ9D 4P3DB 3KYNB 3LKSB 1MCBA 5D7JB 3QEQD 4OLZL 3BD5A 3FOLA 3VWKC 1XGUA 5E8EA 1NMCB 1G7MA 3RBSA 1A5FH 4HV8A 3RQ3A 1P1ZB 4R2GD 3P4MB 1E28A 3LRHA 5IB5A 1NFKA 4EN3A 1OAXL 3HZYA 2ZUQC 3DBXB 3TBWB 1U8JA 1U9KA 4M6OH 3RUGE 1S5IH 4Y2OA 5FHAL 3FONA 8FABA 4IOFD 1S5HA 2KZ1B 2QR0B 4QXWA 1MCSA 2EKSB 5CIPH 2IJ0C 2WUCL 4GBXB 4LBEB 2RB8A 5DD0L 5HGGS 1KB5B 3PWVA 4L8SB 3TN0B 4XWOC 2X9YA 4K7PX 4YHOH 4MJIB 5LKNA 5F9OH 2JIXB 4R2GC 5ICXA 2YPLB 4YJZL 4U31A 4OCLC 2F53B 2VR5A 4LSPH 1KYOK 5A2IH 3TPUB 4OI8A 3HG1D 4JREC 2XKNB 4AIOA 5MI0C 2C3HA 3GSRA 3QUXA 1LEIA 3BN9C 5J8OA 3OSKA 2AJZA 4WWID 4ZAKA 5T3ZH 3T4AA 2PR4H 3KG5A 4QXGL 2HFFA 5DT1L 1T0MA 1EVUA 3CZJA 1EGJA 2J7LA 3SO5A 5CBEB 5IKCB 3GSNH 4R96A 2WWMD 3UJJH 5HYJB 3T2PA 5ITBL 3O6LH 5JW4M 4AQOA 1CLOH 4UB0H 3WNOA 2DQGL 2HT4C 2QL1A 4R4ND 3TYGL 2X70B 3UTQB 4R97B 5IJVB 3HUJA 3TPUA 2G5RA 5JOFB 1FDLH 4GRWH 2ICCA 4LCUA 3OXSB 4GXVH 5B4MC 2VAJA 5DVMA 1IFHH 4YHMH 1GGYA 2P45B 3FQRB 2DKSA 3ILPB 3MR9A 5BV7L 1DZBA 4M62H 4C56E 5F9JA 4FXGA 1A6UL 1NCBH 4GBXA 5JORA 1QSFE 4GG8B 4JM2C 4RDQF 4IIQB 3PV6A 3RKDD 4PLJD 4EDWL 4PJHE 1I1AA 2EECA 4G8EA 4JFYB 4EOWH 1Z0MA 3VFVA 3X3FL 1TZGH 5E1HB 3L3DA 1RIHL 3SOBH 3TA3C 1IKNC 4PRDA 4QGYA 2NCMA 5E9DB 3ZKNC 4OIIL 4LQ1A 5ISZA 2OLDA 5I19L 3GMNB 2Q87A 1HSBB 4JRWA 1G7MB 4N8VB 2FGZA 1FZKA 4DKDC 1YPZA 3QHFH 2R1WB 4X7FC 3RWJB 2PYED 1EZVX 5GS3A 1S9WA 4GH7B 5BXFA 1U91A 4NHCL 3SDXA 2C3WA 1E6JH 3W0WD 1ORQA 3NIFE 3KVQA 3PDGA 1BOYA 3NA9L 2IANB 4WEBL 4NUGL 1GIGL 4PG2C 1IAII 2E7HA 3HNSH 3NABH 1QFUL 1KB9J 5HYQB 4ZMAT 4HUUB 4JO3L 5MI0B 1ZA6B 4DW2H 3UZVB 1YEHL 3JV6A 2AJYL 2H2SD 1EZVY 3B9DA 4P2OD 5CUSH 5HPMB 3S35H 4TTGA 3LN4B 4XI5C 2Y7QB 1ONQB 2W0FA 2NY4C 3EKCA 1N4XL 3FO0H 4MNGA 2V7NB 2VLKA 3MRGA 3L5WB 2OXGA 3IT8D 2IGFH 3IDYC 4KV5F 4N8CH 3UYOD 4UQ3A 3MUY1 3D5OF 1BZ7A 3L9RB 1B4RA 3EUUA 3VXTB 1QLRB 3GBNL 4PJ7F 1ADQL 5JHDA 1A6ZB 3OKEB 1ZANL 4PD4J 1X5HA 2V7HA 1KIQB 5FHAH 1WWCA 3O4LD 5SWSD 4FP8H 4AEHH 2R0KH 1NGQL 1F4YL 3DTXB 3K81A 4Y5XB 3VFGL 4HWEH 1CXKA 2P43B 4Q0XH 4QRPB 1A9BA 3MRPA 1LDSA 1DQMH 1UZ6F 2MQCA 4Y2DD 1WAAF 2C4FU 3UXFA 2FWOA 3WJJC 5B8CA 3G9VA 5MENB 2WAHA 3OBAA 2HFEA 2X2YA 5D70L 3U79A 32C2A 2X4SB 1H15A 4XWGH 3BWAB 3KR3L 4E0RA 3O0RL 1SY6L 3M07A 4NNPH 3QDJB 1F3JA 1LQSR 1XF1A 4HUWB 4GRWB 1N0LA 5CMAA 3QH3B 4DVRL 2HWZL 2M26A 1U3HD 4YHNA 3K8MA 2VIRA 3K1DA 4OZHB 2C3XA 4JRYE 4ZTPL 1A7BA 1GRWA 2EIEA 1UCBH 3MOBL 3O3EB 4LSQL 4WFEE 1BD2D 5GGSB 1EUTA 2BDNH 4PJHF 2AK4D 3OAUL 1C16A 3ZKXB 5L6YL 5D4QA 5HI5D 1KTRL 4IOIB 4OKVA 5AAMA 1U8NB 3EDKA 2AK4E 5GS2H 1IL1B 1L0YA 5ID0B 3FOMA 1I9JH 3VFPB 3K0WA 5LWYH 1II4E 5B4MD 1N8ZA 3DMMD 3KWWA 1K3IA 4KK6D 1C5CH 4Z95H 1Z5LA 1YEJL 5DK2B 3UTPE 1IC7L 4NCC1 2DKUA 1M71B 4WI2A 4I3GA 3U83A 3NFSL 4Z0BH 5I8KL 4CN1A 1SY6A 3MRCB 2BOBB 5FUOL 4HJJL 1TZGL 3P9LA 1UM6H 4OGYL 1VEOA 3CVHA 4YR6A 1NEZB 1CD1A 5D1QC 4ZUTB 4OUUA 4DQOH 5INCA 3OPZH 5K33A 4GUPA 1R0AH 1YY9C 5DEGA 3BN9D 5CJQL 1SBSH 1A1MB 3VFSB 4MX7B 3MOAH 4X9GA 1K4CB 3H9SD 1H0DA 2VKXA 2Y25A 5FKAA 2X41A 4GAYB 3ALXA 2Q7NA 4NKOA 5C0CE 4D3CL 1A4JB 1JWUB 3PQYE 4M7ZB 3GMMB 1PLGH 4OAWA 3ULSA 4Z8FL 5DMYA 3KPSD 2IQ9L 3UYPA 4I3SH 4DN3L 2UWEE 2OK0H 5IV2A 3BP4A 3S34H 3PQYB 4PJIF 1KPUA 3MRBA 5C0CB 2J2ZA 1FYHB 3MUZ1 4WEBH 2R1YA 3CDFA 3GIZL 4FG6D 2PTTB 1BX2B 3VFTA 3JBG7 2HTLD 3BEVA 4IRZH 5GXBB 3EFFB 4HT1H 5H8DA 1YEHH 4J3VA 2R2EA 3LIZL 1DSFH 4OCNC 5DEFB 1KJ2H 4ELMB 3NGBC 4O5LL 1BGXL 1H3PL 2LABA 1CDUA 3WIIH 2EDQA 4OLWL 1OAYH 5IROC 4YLQT 5A43C 5GRWA 3WFCL 2XYCA 1FL3B 4GMTL 1YYMH 4I8DA 5E8NA 1QSEA 3PGDA 2LAGB 3ZDXE 4GG6B 2IPTL 5D72L 3QO0B 3KJ6L 4HJGA 3BIAX 3ZYOA 4JFFA 4TNWF 3GJEB 1G7QB 4XNXL 3JTTA 3W0WE 2GY5A 5JLZA 2A77L 4Y8AA 4UV4H 2BRRL 3RDTB 4JM4L 5DJAB 4XPGL 4RISL 2AJXH 3MV01 1YN7B 2QSTA 5C07A 1VACA 1LHZA 4JANA 2AQ2A 1MFNA 1A6TB 3QQ4B 1MCNA 3QO1A 4MVBC 2DM7A 2V2WA 3RWIA 1QFWL 2ZCLL 5FYJH 5DJ2A 2IBZX 4LVOC 2IAMB 1P7QB 3EYQD 4ZXBB 4YHIB 4OZIE 5GGTH 5FO8A 3WFBH 5IBTH 2KQMA 1UJTA 3CXDL 3QFDA 4JPKH 1D6EB 4ZUVB 5FYJU 4XPFL 1B6DA 5LCVL 1KG0A 1T4KB 1DBKH 2FBJH 2YRPA 1YEKL 1AGBB 3WIFA 2K1MA 4WGVB 5KW9H 3HPLB 3BPOB 3MLRH 1FIEA 1VKXB 3QNYA 4KROD 4C58B 1CDIA 3H2WA 3QUKA 1D3CA 4M7JH 1VFOA 5ITFB 3NZHL 5DD3H 5MERA 5ALBL 2OJEA 3HNTH 4JFHD 3MRNB 4OCSH 3RWFA 2YUVA 4LVNB 2G5BB 4HW6A 1UQSA 4Y2DB 5C6TL 3K1KC 1BOGB 5DZLA 2E8YA 1WZLA 2FX7L 4HWBL 5ESAB 2Z35B 5ELIA 5TJWK 1IARB 1HQRB 5DRWB 2EDXA 3EGSB 3JXAA 4U2ZA 3MNVB 3FQNB 1UH4A 1WTLA 1IQWH 3K3QA 4XPBH 5GGQL 3N1QC 3ARUA 4GG8A 4JRYD 3CFIC 1JZ4A 4Y1AB 4JFOB 1UKSA 5JO5B 5HGAB 1WAAA 5MEND 1C5DB 1CD9B 1KEGH 5DUML 2NTSP 3WLWD 1HN1A 2ZSWA 4KKCC 4BELD 1OTUD 1QR4A 2EYRA 3QDME 3SDCA 2AXHA 3U0TB 3VD9A 4QXUH 5K59F 3CLFH 1RPQA 3PL6B 1A9EB 3UC0H 1KENH 3QG6A 1HXMA 4PJCA 4TQEH 4LIQL 4JKPL 4XVSH 5DUPH 3P0VH 1YNKH 3TVMD 4JZJB 3QJFA 3EHBC 1PFCA 2EDWA 5F6IB 5JPNA 5L8JB 1NGQH 1I1YB 5ETUA 1EEYB 3QSKB 1BIIA 1NGPL 2CGRL 4JHAL 1MFAL 4LLYA 4M61A 4MD4A 2XN9D 2VL5B 4ONGL 1GGIL 4NQCB 5J1AA 3IU4H 4I0PA 4JFHE 2ERJB 2VWEC 2VLJB 4GG6F 2JIXA 1AD0B 4G6JH 4X4YB 1FYTD 5GIRB 4Z0XA 2H8PA 1RUAH 1DQML 2FATL 2EH7H 3HI5H 4F33B 2IPKB 2BFVL 2VXQL 1KN4L 4F9LA 3HE6B 1QYGL 2JKXA 2AJ3A 3I9GH 3OF6D 2FB4H 2R4SH 3DECA 2O61B 4MD4B 3U4BH 1UH2A 5ICZA 4I4WB 3D85A 6CGTA 4B7LA 3AB0B 4CNIA 2P5ED 5K9OA 5CD5D 4ZNEA 3EO1A 5C0JB 1IAOA 3RWDB 4I3RL 3DUHA 5AUMB 1TIUA 3SPVA 1QRNE 4RNRB 3MOBH 5I8EB 4X80H 4Z7NE 3IYLW 5GGVY 4PJ7B 4J3UA 3BO8B 5JA8B 2X6MA 4QRSA 4NQDD 4Q6IC 1QO3A 5KSAC 4IIQC 4WEUD 2CRIA 1PYWB 1RIUL 3BSZL 1YNTB 1HKLH 1BJ1H 2JB5L 3F58H 1G6RA 4G42A 3NFNB 4NRYB 1VADB 2HKHL 3K4AA 2NNAA 4MWFB 4UBDC 4ZXBC 1ZSDA 1ZLUH 4JFEA 4Z7QF 3RFZC 1S7XB 4ALAL 1XCTB 1EX0A 4HH9B 5JZ7D 2IH3A 4XPFH 5GS1B 3BKYH 5LCVH 3T3ME 1MAKA 1IM9A 1DBML 4OCRH 4QCIA 2BC4A 2NTFA 3MLVH 5KW9L 3TJHD 4NQEE 3LKQB 3CIQA 5CEYA 3QUMA 4D9RE 1G7HB 1E4WL 2Y6SD 1MHPH 3KXFE 3BPLB 1LK3H 4PV9B 3VG0H 3NTCH 3NFNA 2VXVL 2NLJA 3QNZB 2O5XL 4MNHA 4R6UA 4TN9A 3HNTL 3OG4B 3S88L 4LQFL 2A2QT 3INUL 4UV7H 1MVUB 3RZCC 2A6DA 3ZO0A 4KJPC 4L3EB 5GRXG 2GTZB 1I3GL 2HH0H 5CEZH 4OKDA 5DJCB 3P11H 1ZS8B 4NO2B 3SGKA 4FQXA 2NY6C 5T1DH 5D7LA 2DL2A 2ADFH 1X5GA 4OZFB 4NWUH 3RDTD 2NW2B 4M5ZL 3MA7B 4MHHG 3HNVL 1MY7A 5IESL 4CVZB 3CSPA 4WUKH 2JTDA 4PG9A 3VA2C 5LVEA 1U8IA 3QBTB 2APVA 1QRNA 2FLRT 3CLEL 1QLFA 1B0GB 4LNVA 4S0TD 1A7NL 4Y16C 5EULV 2VLJD 5IEKA 2YK1H 4RSVA 5C0IA 5JLZB 3RGVD 3UC0L 1G7QA 1ZHLA 5BZWA 1NMCC 5GJSL 4XTRC 2GQHA 4MDIB 5D7JC 3PP3H 1R6VA 3TZVD 1D5BB 1BBDL 1IGFH 1CDYA 4MHHI 3V4UL 1FL3A 2C7UB 3F7YA 1G0DA 1T1WA 1BWWA 2OI9B 4CL7A 1X5FA 1CBVH 1A1OA 5JIHA 1HYSD 3W2DH 5DD0H 3O2VL 4U6XA 4G6KL 1JF5A 4WFGE 1HXMB 1DE4B 4XNQB 4HWZB 4XNZC 3QQ9C 2VXQH 4KMTL 4IDLA 4LSPL 3E8UL 5L88L 5BS0E 2HRPH 3OZ9L 3MGTB 1YEFL 3KPRD 1RZIA 1ETZB 1PQZB 3CVHL 4X0KA 4LAQH 3TBTA 4JDTH 2YUZA 4DUWA 5DRZB 3O3UN 4CUCA 4WDIB 2EO1A 3V5HB 2VITA