2VXVH

Crystal structure of human igg abt-325 fab fragment
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
222
structure length
222
Chain Sequence
EVQLVQSGTEVKKPGESLKISCKGSGYTVTSYWIGWVRQMPGKGLEWMGFIYPGDSETRYSPTFQGQVTISADKSFNTAFLQWSSLKASDTAMYYCARVGSGWYPYTFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Unusual Water-Mediated Antigenic Recognition of the Proinflammatory Cytokine Interleukin-18.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords HUMAN IGG ABT-325
total genus 41
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2008-07-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxvH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vxvH01
3QDHA 3T4AA 1OTSC 2HWZH 3V0WL 4G8IB 2X5PA 2VLRA 5CMAA 5IBLC 4J1UB 5CSZB 3PE9A 5SWQA 5ADPL 4Q6YA 4KTDL 3O3BA 5C70A 5HYQA 5E2UL 1T2XA 2I5YH 1RZJH 4D9RD 2IQ9L 3R0MA 3GSNL 4WU5B 1F90L 1HSBB 1MH5B 3LY6A 3BQUD 3BE1H 3N1MC 4K3EH 1TJGL 2JLLA 3KNBA 2X7LB 3B2UD 4JE4B 3LD8B 4NFCA 4IJ3C 1JN6A 2DQHH 4R90L 4XC1L 1YN6A 4G7YL 3GSOB 1A9BB 2O5XH 1DN2A 1AC6A 4QHUB 2K7QA 4WU5A 3C2SA 3P4OA 4HWNA 2HH0H 4M5ZH 5EBMA 5DHYB 3TC9A 3MC0A 3O0RL 5JUEH 4PRDB 2HJFA 1W8NA 1ZA3B 4XPTL 2O61B 2QLVB 4R4NC 1WEJH 1MCOH 1RJZA 4MB5A 3BRDA 1NFDE 5JUEL 1RZGB 2Z92B 3CD4A 4NCC2 4PJAB 4D94A 5ACZA 2HP4A 2AJ3B 4GW1A 1G6RA 3ZT6A 3PGFH 4LKXB 4ODUA 2EC9U 3IJHB 5DR5L 1MIEL 5GS0L 2DI9A 2IH1A 4HUUA 1G7QA 5FKPA 4LRNH 3KPLB 3O3AA 3UZQA 4ISVA 3BIKA 4OQ1A 1NCNA 4U6YA 3RTQD 4XH2B 4R90H 4XC1H 4XP4L 2BSTA 1ZHKB 2VKXA 2GI7A 1J8HD 3A6CL 4H26A 4XRCA 2RCSH 1X5ZA 1SYSA 1QLFA 1GGTA 3IDMB 3LRSA 1MFBH 4EBQH 1L7TH 2YKLL 1R5VB 5DVNA 3VGBA 3MRLB 2W91A 1DBBH 1IE5A 3UXFA 4Q6IC 1G9NH 5A1AA 1KEML 4QRQA 3QHFH 4L8CA 5DJCA 1F6AA 4Z76B 3OR7B 3AVEA 4PJ5D 5HHMD 1S3KL 1Q9LA 1E4JA 2VH5L 2UWEF 3U7YL 3QH3B 2WWKT 3QDMA 1IM9D 4YHZL 4E0RA 1DLFL 1FZOB 2WLYA 1J0YA 3NCCB 4G8GE 5D4QA 2Q20A 1A1MB 4ORGB 3IKCB 4OZHE 1X4XA 1H5BA 3W2DH 4XBGA 4UNTA 3I6GB 1A3QA 3MOQA 4JFYB 4OBSA 3RVWC 2VKWA 1HINH 3GBNH 3OKLA 4EIGB 4JANB 4DFHA 1NGYB 3BGAA 3GSOA 2IANE 3CK0L 1OWRM 1YMMD 1AGEB 1EUTA 5DA4A 1OCWH 1P7KB 4FQXB 2AEPL 5CZVH 5CILL 3DTXB 5LG1A 1N6VA 2QKIA 3WUWG 4R8WH 2CK2A 5KSBA 3ZE2E 1INDH 4K3JH 3DIFB 4PRHA 1YEIH 1AFVL 5CBAB 1CGXA 5DD1H 4XI5D 1T5WA 3MV11 3VMPA 3RJQB 4Y4HA 3S37H 1QOKA 1YY8A 2NZIA 1RZ7L 2APXA 2BOCB 1H3GA 3BN9C 1WFTA 3MRBB 4HAFA 4UT9H 3P0VL 2NXYD 2LTQC 1C5BL 3OSKA 3BPOB 4IIQC 5FM5M 4F3FA 3IXTA 4YDVA 5TE6H 4BZ2L 4ODXA 1BIHA 4MNQD 1DEDA 4U05A 5IB5B 4HWBL 2F53B 2D03L 1XMWA 2AQ3A 1KBGH 1AD0B 4B53A 3OJDA 1HN1A 3OGOE 3U1SL 3LS4L 3LN4B 1TZHA 3BAEL 3QAZC 1MUJA 4XAKE 4LLUB 5DZLA 4OF6A 1AO7E 4OUOA 1U6AL 2OJEA 3QJFA 3MBXH 4OD1H 1NFKA 4J7RA 4OZFH 1ZOXA 4Z5RA 2R9HD 4QRPD 4MXQC 1SBSH 1X4ZA 1C8PA 4U6XA 1R5WB 3OKKA 4CW1B 2XZCH 3RA7H 5CS7A 3GDBA 2XKNA 4YBLC 3CFKB 3BESR 3T0EE 1H3PL 4JKPL 1ORSB 1D5BA 5KTEH 2FATH 1NDMA 4HUMB 2YUWA 4FXLA 4EIZC 4JY6A 3VRLF 4JFEB 4XMKL 1UQSA 5FM5O 4P46A 4FFVD 2IALA 1BFOA 2XTJE 2VXUL 3VI3E 4RISH 2QADC 4RX4A 3HPLA 1RZIB 3FFCE 2R4RL 1UACH 3QUML 4XVJL 2OMNA 4PJDB 1LO0H 2QL1A 1GZPA 3E1F1 4Q9RL 1H8OA 1A6WH 1I8KB 1TTFA 1PGRB 4JFPA 3HPJA 1DDHA 3ALXA 3TN0A 2LU3A 1UEYA 3T08A 3GSUB 3VMNA 4BUGA 2GFBB 1MHEB 3GSNA 5IQ7H 2BOBB 4Y5YA 4Z95L 5ETUB 1UC6A 5ADOH 5DUMH 2RFXB 3QR2A 1MEXH 4N1CA 4DKEL 5CD3B 2KDGA 1VFBA 4P46C 1DVFD 3S35H 1N64L 5E6ID 5JPMA 2CUIA 3L7FB 4EXPX 4UQ2A 1HHIB 4OCLC 3HMXL 4ODTL 3GSNB 1C1EL 4G6KL 4L9LA 3V5HB 1BGXL 4JB9H 3SGKC 4YIQB 2YPLD 5E8PB 5DMIL 4K07A 1XGPB 4QOKB 2QJDA 2FLRT 4I77L 1MCEA 1WISA 3S3SA 4Y19D 2EIZB 4EN3A 4WWKD 5BZDB 4RAVB 2AV1B 1Q72L 1FGNH 1J0JA 5C07B 2B2XH 3RZCB 1DSFH 2EDEA 1J10A 1T1ZA 3EGSA 1T1XB 3WEXA 3P11L 1ZA6B 1AGBA 2YOCA 5C2BL 3WS3B 2FZ3B 3GSQA 2DQEL 2NY0B 4ZDHA 1D5IL 1BVZA 3RI5K 1BAFH 1NGXA 3DX9B 4WI7A 2BVQA 4RAVA 1WWBX 3LEXB 1Z3GH 1VFAA 5ISZA 4WUKL 4XPAL 5ACMA 4ZUWA 2PR4H 3C9NA 5L2KD 4PJEF 3UJTH 3RAJL 3L6FA 5CJ8A 2IANB 3OAZH 3V95A 2ZKHL 1JFQH 4XPHL 1JNLH 1HNGA 4P4KB 1M4KA 1P4LB 4UDTB 1A4KB 2R2BA 4P49A 1ACZA 1LEGA 5F89A 1CGSL 3BGMB 3L1OL 3U30B 2PF6A 1FO0B 2GJ6B 1RPQA 2XG5A 1X5FA 4M02A 3V9FA 1JNLL 5KAQG 3MRDA 3QXDA 1PFCA 1RVFH 2ZG3A 2ARJQ 1GC1L 3VCLB 3VI4E 3ZDXE 3L5WA 3MJGX 5ITFB 4OIBA 1URLA 3KXFB 5CHNA 4YDJB 5KSBF 2EYRB 5D5MF 2F54B 5JOFB 4P4KA 2OI9B 3CH1B 3MNWA 5MEND 2D7TL 3LS4H 3BP6A 2V5SA 2Z9TA 2Z93B 3HMWL 4OF3A 5HHPA 2VJXA 4Y2OA 1P7QD 4LOUD 4EUPB 3EZJB 1CE1L 3LQAC 4AIZB 1BAFL 1OQXA 1FL3A 3L5HA 1ZKAA 5MEPB 3ULUE 1CR9L 4Z0XA 4ZNCD 3C2AH 3U9UA 1I3RA 5I6XC 1QR1A 5JXEC 5KVMC 3JWDL 2HJFB 4LCUA 1CBVH 4APQC 2AI0H 4HK0A 1IAII 5KSAB 1CLZH 4FZ8H 1AGCA 3ULVC 4QOKA 5GSVB 3BT2L 4XNYL 3BPCB 2OZ4A 5D2NA 2DOCA 4CU8A 1U95B 2BY1A 3BPLC 4NCDA 3RVVC 1YEEH 4FQ1H 1FNSH 4WI5A 3CDYA 2X4OB 4NPYB 5IMMA 4M1DH 2ZOLB 2HKFL 5J0BA 2CH8A 1DQLL 5C07D 4I0PB 2OJZH 2VZVA 3MRRB 2FB4H 4PBXA 3EYOB 4X6EA 4GRLC 1KG0B 3U2SA 3MYJB 1KULA 4P9ML 5CJBA 3SO5A 4K71C 2QHRL 2LAAA 5LGKA 2OTUB 2X4OA 1JNHA 3KJ4C 3OPZL 3T2NH 4P23A 2MHAA 3VWJA 5D7LA 3ARPA 3O3BB 1AO7D 4UZGA 4PJ9A 4X6DA 3ZE0F 4I0PA 3GB7A 3KLAA 5IB3B 3TN0C 3OHXA 3VXRA 4G8EA 4PJHA 3TZVA 1RSFA 4O2FB 3TBVA 2YC1A 1A3LH 1DBKL 1FYTA 2XQYK 2GTWA 1HQ4B 4N8CH 4BQBA 2W59A 3OXRB 4KKCD 2AK1L 1F6AB 4X6DF 4XPAH 5LQBL 1RFDH 4JZJC 3TF7C 3BVNA 4JM2C 3C6SA 3PUCA 4LHUD 2Q76B 2JJWA 2P8LB 3B2VL 1HH6B 4HGWA 1MFBL 4X98A 4F9PC 2WBJB 3BYTA 4UIKL 2WWMC 3ARWA 1G7MA 1N5AA 3PDOB 1QQDB 2D7NA 4IDJL 4HEME 1YEDB 5GRUL 4Y5XB 4NKMA 3QUYA 3QUKA 5TDPB 3V5KB 1DN0B 3FFCD 1I8MB 1WCBB 2HT3C 4G6JH 4XXDB 1RIUH 5K33A 3W82A 1P4BH 3W0WD 3ZZ1A 2HKHL 4ZNEE 5A43C 4PJHF 3GJFA 4JDVA 4P2RB 2KH2B 1A14L 5GS0H 5B3JE 4HGWB 4RNRB 4O4YH 2QKIB 1UB6A 4QTIH 4CVXB 1U8PA 4F7EA 5IJVA 4PRAB 1KIRB 3TNMB 1EGJH 4JM4L 3QWOA 4ZPTB 1KXTB 3ULUC 3GKZA 4MXVE 3D25B 3NZ8B 5ITBH 4U1NA 4TQEH 5DK0B 1GZQB 2A1WH 4XMPL 4RIRA 4GUPA 3BHBB 4D2NA 3V0AC 3X11B 2APVA 3WFCH 4CDGC 3VXQA 5GPRA 4OM0L 2NY3C 3V5DB 3DSNA 2P24B 4NO5B 2HH0L 2MKWA 4M5ZL 4NNXB 1P5UA 4RAUA 4F58H 5HVGB 3VRJA 3HZMB 2HJKA 2FX9L 2P48B 4L5FL 2YN3A 2F53D 4BKLB 1EFXA 2C7UB 2CQVA 5CEZD 1OTSD 4OSUH 3H3PL 1U8LB 5K9KB 3Q6GL 1ORQA 1JRHL 5GISL 1DQTA 1JGLL 2X4UA 1CFQB 3D69B 3FRUA 4KKLD 5GRYA 2NXYB 5EZOL 1KCVL 5HSFA 3AREA 5D7IF 1Y18B 4HHAB 3F8UB 5HGHB 4I4WB 4EDXB 1YPZE 2HWZL 1HQ4A 1JWMA 1K6QH 1XCTB 2VC2H 4K7PH 3FO9B 4O00A 5DC0A 1QNZL 2JIXD 3HS0A 3TYFB 3C6LA 3U36B 4MGXA 2C3VB 4ODWA 3IXAB 4G6AC 1HSAA 1T7WA 4G6MH 1YMHA 1UA6L 3SGDI 3ECBA 1I7UA 4YZFF 3SQOH 1J0KA 4DTGH 3HC4L 1MIML 5D6CB 2CIIA 2E6QA 2NXZD 4ODHL 4PV8A 4HKZA 2ENSA 3PP3H 3ALPA 4LPCA 1MI5B 4PRBB 1W0WB 5D2NC 1ZSDA 5JR1H 2BSRA 5HPMA 3MOBL 2XKUA 4G80A 1T80A 4XX1G 4P2OA 5FA4B 2NXYC 3EHBC 5C0FA 1U8PB 1NMAL 1UM6H 2C3XA 5HGDB 43CAB 3S9DB 4ELMF 2V7HB 3BH8A 1DSFL 4Q9BA 4P59H 3N85H 3H3BC 4L4VD 5J3HD 4P2RD 4LHJB 4S11A 5BV7L 4G8FA 2QTEA 4OF7A 2R1YB 5H35B 1MIEH 2FIKA 1GSMA 2Y36L 5FHAH 1EH9A 1IKNC 3RTQB 1ZLSL 4FFYL 1E6JH 1TCRB 3WFCL 2FBOJ 1NUDA 5L6YL 3MNZB 4DAGH 5EBWB 4JO1H 4RAUB 4JVWA 1NKRA 5JW4M 3O6KL 2ID5A 4XNQA 3N9GH 3OR6A 4KJYB 8FABB 3VRIB 3UTZB 5J12B 4NZJA 3CFCH 1H15A 1JWUA 5GGSA 5IOPA 2R1WA 1AXIB 1PX4A 3MQIA 4PP2B 2OS7A 2DQGH 1MFDH 1JJUA 4N9OB 4PTUB 3SBWA 4EI5D 3O9WB 4OCXL 5FOJA 2APWA 5TE7H 4KI5E 2CLZA 5T1KB 2GJZB 3GHBL 4JAMA 1IFHL 5FO9B 4FFVC 1RVFL 4MA7L 3B2UC 4QXGL 4QTIL 1I7ZB 3QUZD 4G42B 3LKQB 4KQ3L 5D1QD 2YS4A 1A14H 5J8OA 2I27N 4M43H 3V52L 1JWMB 2AXHA 1MFEL 3PDGA 4X4ZA 4XWOC 2DQHL 2E7LA 1J05A 3TJHC 3MRHA 3GK8H 3OJDB 3NMEA 5GGUA 3B9KA 4P2QB 3S36X 3SDDB 4WV1A 2NW3A 3O11A 4WCYL 2R2EB 3CFDB 4JO2L 3S8WA 1XZ0B 2A9NH 4JRXA 3KPMA 2FATL 2HT4C 5FOBA 1Q1JL 5L8JB 3HE7A 2Q7YA 1U8HB 2ITDA 4U1SA 5DEGB 4MLSA 5HI5D 3KPPB 5LGHL 3OG4B 4P46D 3B3IA 1FZJA 3QCTL 2ATPA 1ZANL 2YPKB 3C87A 5F9WC 1BX2A 5DFTA 3QQ4A 4G7VH 3CFKA 2EICA 3PABA 3CFCL 2KL6A 1GGYA 1UADC 5FOBB 2X4RB 2CK0H 1WEJL 4ZUSB 2AV1A 3RWGB 2GAZA 3QULB 4TOYL 3UPRA 3F7YB 4NQCB 1FNAA 3H9SA 4LF3B 4K8RD 4AG4L 4OLVL 3NACL 3BP4B 5I1CL 1DEEB 5DJZB 3FQWB 3KPSA 3W9EB 3BPLB 5FO8A 5B22A 5C0IB 5EBLA 5EC2A 2FHFA 3W5NA 5ID1A 3GIZL 5IQ9A 1OTTD 1YEFL 4GRWF 1A47A 5I0DA 3MRQA 5DEFB 3H9SB 2FLBT 3BT2H 4NUGH 4PJ8A 3M17B 3HA0A 1YQVH 2JB5L 3GMMA 1TJIH 3LQMA 3PHQB 5BRZB 4F37K 4D9LH 3VFPB 3VXOA 5IFJB 4LIQL 4Z7UB 2DYPD 4KI1A 4Y4KB 3VH8A 5C0JB 2D7MA 2F5AL 2BVPB 3FL7A 1T0NB 1H8SA 3HC3H 4EI5A 3RX8A 5DT1L 5JPNA 5BZDA 2F9BT 2OQJA 2IPUG 2I9TA 1EZVY 3C8KB 1RJYA 5IEHA 1A1OA 4DGYH 4PJ7A 3B9KB 4RMTA 4J8RA 5KSUA 4CRPA 4TNVF 2IQAB 2VR5A 4JR9L 4Z8FL 2OTPA 1WTLA 3ARZA 3O2DA 1XGQB 4Z7UE 2Q7YB 3K2MC 5JIHA 2O5ZH 2Q6WA 3GUTA 1WAAA 1R3LA 3T0XA 4KKNA 3FAWA 4GMSL 4PJ8D 2AJVH 1MCPH 2BCKA 1KCRH 5IJKC 5GJTL 3MV8A 2YD5A 4YHIB 4XCYB 2AS5M 1QFPA 4M7LT 1M7DA 5F9DC 1YPZA 3K3QA 4U6HB 4XVSH 2VR9A 1XR8A 5T3ZE 1P4LA 4UDTA 5SWSB 1FGVH 3DXAE 3QUMB 5JHDB 2VLKD 2BFVL 1B0WA 5F6IC 1T1WB 1D9KB 1KJ2B 1NBQA 3TVMD 3U0TA 4C54A 1UH3A 3SGJC 2Q6WB 3GUTB 2BNRD 4S1SL 1FFOB 2YUZA 4X9HA 3WIHH 1U8MB 3EOYG 1FORL 1AI1H 5IB2B 3TCXA 5C9KA 5FYLL 5TE4H 3MLYH 4MNGB 1ZT1A 5I1GH 4Y7MA 3UBXA 2P5ED 2UYLA 1B4JH 1GCFA 4GXVL 2YEZA 4X4XB 5EUKB 1Z6JT 2XFXA 5I1AB 5CZKA 2ZUUA 1HQRA 5I73B 1BJMA 3FB7A 1BVLA 3IS1X 3CH1A 4F37F 5L0QB 1BLNA 4FQHA 4M6OH 1XCQA 4FQQB 1HXMA 3EOBA 1BEYL 3EYFB 3GSWB 3QCUH 2C7UA 5CZVL 3I02B 4QCIB 3HMXH 4ODTH 5IBTH 5I1KL 1D6EB 3LB6D 5D71H 2H9GA 1MNUL 5E8EB 3MJ6A 4DOHE 3KPOB 3T0DA 1WT5C 4PJBA 1NGZB 4HKXA 4HJ0D 2Q76A 3HFML 3OXSA 3S97C 1G7HA 3HAEH 3L3JB 3HZYB 2W38A 2Y4SA 2IGFH 3MLPA 3MV7E 3MLVL 3B83A 4JN1H 3DMMB 2XN9B 4YHZH 2WWMD 1INEH 4OLXH 2AXFB 4HXBH 4M8VA 3SKNB 2NY4B 3LIZL 3L3GB 4UIMB 1D5MA 3MRPA 5E8DL 5D9SA 4WDIA 1BBDH 4BFEA 1LP9F 4Y2DD 3FT2B 3QDGD 4YXKL 2NX5B 4Z7VE 2FRGP 4OCSH 2A73B 3OWEA 3WFBH 1AQKL 2DWDA 2BC4A 1U8NB 5DMYA 4NDMA 4H5SA 4JPIB 5FECA 1U8OB 3O6FB 2J6EA 4UT6H 1VADA 5HYSG 1Q94A 3MUY1 5E6IA 3GJEB 4JFQA 1EZVX 4UAOB 4NQSB 2DF3A 1NAMH 4GXUN 2VLRB 4L3CB 4R2GB 3IVKB 3RWHA 4L3ED 3SDCB 1SBSL 1X5XA 4HK3N 2WBJA 1CLCA 1TNMA 3QO0B 4U3XA 3TIDA 4NRZA 5J13C 3I50L 3ALWA 1HKLL 3T4AB 3SQOL 5INDB 1DQLH 3RVXC 2FHCA 2VQ1B 2HVKA 3MUHL 1VPOH 3PGDB 4WW1B 1R24A 3MLRL 2DD8L 4KRNA 4GQ9H 4NRYA 1FFPA 4JFDB 4YX2L 5DK2B 2Y25A 2HT2C 4ZFZA 3ZYOA 4MMZC 1IGJA 1X44A 4L5FH 4TPRH 4IIQB 2R39A 1J1OH 1A7PH 1BMGA 3G04B 4RWYH 3MLTA 3HKFA 2GHWB 2X1PA 4BJLA 5MERA 5I8KH 4QHLB 4LLDA 3WN5C 1SJXA 4WUUE 2YBRB 1CDJA 2EC8A 4I0KA 3AS1A 5J1TC 4C55A 3GJFH 4XGZB 4GUPB 1FYTD 4BZ1L 2YN5A 5IB4A 4K94C 4N8VG 3ARDA 4HWBA 4PJBB 1HIML 5B38A 1WC7B 2A6KA 5CP3H 1YMMA 4FQXC 3OKMB 2FX9H 4ZUTA 5ID0A 2HN7A 4LASH 1BF8A 1E28B 3DETC 1NGPL 5KS9F 2NY1D 2X9YA 5LGJA 4G6KH 3QEQD 1R3IH 2AJZB 5ESAA 2WW8A 5I1IL 1JK8A 2PTTA 5HDQL 2AJ3A 1N59B 2IPKA 3ARGD 2QQLH 1FJ1B 5JNYA 2GSGA 1CFQA 4AH2A 1G7QB 1ZEAH 5B38B 2M26A 3X13A 1JYNA 2VDPH 1TVBB 4J1UA 5CSZA 3VXMD 2VIRB 3NFPA 1S7UB 4ZD3L 3RU8L 3CVHH 4HG4J 2A73A 3H42L 3QIUB 2XACC 4W6WB 3N1GC 2ZUQB 1YNKH 4PS4L 4M1GH 5HHNA 1HYRC 1PAMA 4FRWA 4LSTH 1HWHB 3BKCL 4E41A 5EPMA 3TPKA 2Z31C 4MXWH 1FL5B 2I60L 2J7LA 5F7UA 4UT6L 4M6NL 3OR7A 4JRYE 2BDNL 5ABDE 4NRXB 2VQ1A 1P2CA 2A83A 5E4EB 3IF1B 5AG8A 2BNQE 4D8PA 5CEXA 5T33H 4TSAH 2W92A 1T6WA 3WHXA 4E41E 2PYED 4E42A 3HLAB 4J3XA 5BXFB 4LSUH 5DVOA 1OW0C 4O51A 1JWUB 5GGSB 5C07E 2CIIB 2C1PA 3LIZH 1A6ZA 1PX3A 4QXGH 3G5VA 1INEL 4BFIB 3W81A 4R0LC 3GHBH 1RD6A 4HIJB 4I3GA 2A38A 4RFNC 1IL1B 2DAVA 1OAYH 3EFFB 4JVPA 4ZD3H 4U1HB 1YNLH 4G9DB 5DTFA 3VRJB 4S1RL 1BPVA 4LVEA 3ARXA 2YSSA 1S5HA 2MFNA 1I1YA 2YD3A 1NCBH 2YRZA 1FPTH 4OV6F 1DUZB 2PO6B 5ADOL 4Y16C 2UZXB 3HUJF 3O3DB 3RBSA 5F7LB 3MRNA 5HI4D 4PP1D 1OW0A 3UEZA 2AK4E 5DTFB 1KCLA 4WI3A 3R8BB 4EVNB 5DQ9B 4J3SA 1Q9OB 4KVCL 4JFHE 5E1AB 2DM2A 1BZ9B 1QBLH 4NFBA 4JZJA 1AJ7L 3RWIB 3QIBC 4JM2A 2N7AA 3PWUB 4HSQA 5LWYH 4J3OC 2DD8H 3MLRH 3OTTA 4HDIB 3T2PA 4L8BB 4GLRH 2HLFC 2P5WB 1HSAB 3UROR 5GRZA 2GJZA 3PQYA 2XRAL 5BOZG 5AZ2H 4HFUL 5D7JB 4S1DD 1KF9B 4TYUA 3CLFH 4ZS6D 3D0LA 4N8PA 2QR0A 4TPRL 1EEQA 4GKZA 2FX8H 3QFJE 1T2QH 3TFKC 2R29H 4JAMB 2OBGA 5FKPB 1JZ4A 3K81A 5HYFA 2PXYB 3ZTJG 4K8RL 3KLSA 2D0HA 3AB0B 4HQQL 4HH9B 3ZYZA 4K8RC 4H25B 4D0BB 4M61A 4MNHB 3WN5A 3HE7B 4JY6B 1NANH 3K80A 2AGJL 1FIGH 5CKGA 4ZXBD 2APBA 2DMBA 4WFGD 2XXMB 4PREB 3I2CH 4O02L 1DANU 1TJIL 4HPYL 2VDQH 4WGWB 1U41A 4YH6A 5DGQA 5EZOH 4P5TA 1T83C 1U8QB 4GMTH 2BHUA 3MPCA 4UV7L 5L88L 5C7XL 3HC3L 2ICCA 3UDWC 3ARRA 2DDQH 4WW2F 2VXTL 4GG8A 1FLTX 1A1MA 1BBDL 3B8SA 3GMNA 5D1XA 5GZOD 4YGAB 3DO7A 5BV7C 4ZSOB 5IESL 3NCJL 1EUUA 2Y7QA 4X7FC 2VLKE 4QRTB 3VWJD 2YA2A 5C2UB 5C6TL 5AZEL 1Q8MA 3I6KB 2NMSA 4KKAD 2XZQL 3IDYC 4NUGL 4ZS7H 3VXRD 1X6NA 3H9SE 1E6OL 2E9JA 3OXSB 3LKSA 5GGSY 2GYSA 4WUUA 4UT7L 4AEEA 1F4HA 3Q5TA 4JCMA 5BQ7A 3FZUD 1NC2A 5K9OB 5C0AA 4BSVA 4OCYH 4HJGB 5SWSE 3QIUD 4HAGA 4LGRB 4IMLA 4WW2A 1GC1H 1FV1A 3ILPB 4TUJB 1ZA6A 1I4FA 3OJVC 1U8IA 1J1PH 4G6JL 1JHTB 5L9DL 5EORH 4IRJB 1NGXB 4XCNA 4LCWA 3TVMC 5L88H 3VFPA 1LEIB 1BZ7A 2BFVH 2EO9A 3X14A 3DUSA 5IHUH 3ARGB 1A7NH 3VFNA 3N1FC 4HJGA 3QJHA 4BFGA 4NT6B 1RZJL 4FMKA 4YZFE 4OCSL 1U36A 2OXHA 1CGWA 5I30L 1ZLUH 4ZAKA 3KPSD 4U1KA 5FGBA 4ELMA 1F6LL 1X5LA 4LRIA 5CEYB 1IKNA 5I1EL 4JQIH 4NQED 3MRGB 1SYVB 3CIQA 3WCYA 2CLVB 3AY4C 4YK4C 1OY3B 1HHHA 2NNAA 4QF1A 3B5TA 1SY6L 1V7NL 1IGML 2EYRA 1FFRA 4WEBL 1QRKA 1QRNE 4G6ML 1GGUA 5CIPH 5TF0A 1MJJA 4EI5C 3WLWD 4I18C 4RA3A 2VDMH 4ELME 3AC0A 3QDAA 1RULH 2AK4B 2P4AB 3SKJH 1EEZA 3FOLB 3HFMH 2D7OA 3SBWC 4IIQA 5DJAB 1NBVL 5DQJB 3EJYD 5D1QC 5LKNA 1GH7A 4JFDD 5E9DA 4XWOD 2MOVA 1I3RB 3RVUD 4PTTA 2X6MA 4LNRA 2YD6A 3DNKA 3WS3A 1KOAA 4MD0A 4Z18A 5ESQA 2YEZB 1S7TB 2CXGA 3C60A 5CWSA 3S35X 4M6OL 4M7JL 4MJ4A 1BIIB 1NGWA 1MJ7L 4GAJH 1MCSA 1W0VA 3ARED 4L3EB 1HXMB 3EOBB 5HI5C 4U1LA 1YEHH 2VLRD 3OJMB 1DQQA 3STZA 3CMOL 4HUWB 2X41A 5F9OL 1UYWH 5GGRB 1ZLSH 3ZYJA 4OZ4A 5JIIA 1PBYA 4I3SL 3HZKA 1A1NA 1FHGA 3L3OA 2LV4A 5JOPE 2A6IB 3HE7C 4P23B 4HX1A 5T3ZD 4TQEL 5FDYA 4WJ5A 5F9JA 1JZ7A 4I13B 4HIXL 5DF0A 2CLRA 3MJ9A 2DQCH 3CUPB 4LVHC 1U3YA 4IBLT 5FUZH 1FGVL 1IILE 3RZWA 1OAUL 3LDBC 4HEPG 1G7HB 1OTUD 2OI9C 2FO1A 5M7QA 3ARQA 5DO2D 4OLVH 4PRIA 5BCAA 1ES0A 5J89A 3L7EB 4Z7VB 4OLYL 4OZFA 5TH2A 4ZFZB 4PR5B 3UDWA 4M9PA 1U95A 1XGYL 1FE8H 3LS5L 4FABL 5F88B 2Y5TB 1XGUB 4P2RE 4G8IA 1FL3B 4Y5XA 1V3LA 3GMOA 2X4SB 1VADB 1UT9A 4C4KT 2I60H 1QR1B 4ZNEA 3QP3A 1OGAD 4NZTH 1MCQA 1ES0B 3A6CH 4O9HL 1ZANH 1ZVSB 4QHNA 5ECJE 3WDIA 3QFJA 4XVUC 1QFUH 2EYSB 3C8DA 1OLZA 1BVLB 2VRAA 5DQJA 3UJJH 1PG7W 3KXFE 2A6KB 4G5ZL 2XOTA 1P84K 1OAZL 1X5YA 4Y16B 1MY5A 4D9LL 1VFOA 1R3KB 2K9UA 3BDYL 4R4FL 3DETD 3GEWB 4DVRL 2KBGA 4JN1L 4XNMB 4PJHB 3JWDC 1ADQA 4QNPE 4IOSD 1WFUA 1A7NL 2EDLA 5DK2A 3D3VB 1OP3H 1NCWH 2EDWA 3NZ8A 1QP1A 5DS8B 4I2XA 5D7LD 7FABL 2V2TA 1C08A 4X6DB 4RDQG 3TVMB 5C0DA 5D1ZC 4MA7H 3P30H 5F7DA 2YXMA 1EGJA 5JHDD 1G9MH 2VN7A 3QDGE 3TBSA 1KV3A 3LKNB 4LPTA 4IDLA 1Q9OA 1W8OA 1YUHB 1JPST 2P5WE 7FABH 1NCCH 2YWZA 4LCCC 1NLDL 3GSVA 3AU1A 3WIIL 1K5NA 4HS3B 2BP3A 4I2XE 5IEKA 4F57L 5E4EC 1HOCA 5HI3C 3KPLA 3S35L 2VQUA 43C9B 1ZAGA 3MRJB 3FQNB 1T03L 3IDIB 4UMGA 1ZMYA 2QSQA 2WMPA 3GJFB 3RDTA 3IFOA 5E8OA 1K3IA 3LN5B 2ARJA 2BC4B 1JK8B 1OAZH 2PTTB 3B9AA 2BSSB 3UJJL 1ED3B 3QEQE 3HNVL 5DHVB 4MD4B 1A6VL 5EH1A 4ZYKA 2AEQH 3TNNB 2R4RH 1S9KC 2B39A 3HCVA 1NFDA 3QEUB 1CXEA 4UUJB 5ERWA 4GBXD 1NBYB 1A6ZB 4POZD 2IBGA 4NJAL 3L5JA 1QFWM 3NH7H 4JDZB 3K2UH 2EZ0D 1NGQH 2UZIL 2L0DA 5EIIA 4FABH 5BRZD 1MJUH 2GTZA 4PJBF 2X1OA 2YD2A 5D7LB 1FNGA 4M8QA 5KVFL 3WNNA 2R0KL 1T66C 3OPZH 4QLRA 3DV6A 4MXWL 4E5XB 3OGCA 1CDCA 3VFUA 4ELKB 4Z77A 2ADGB 3D3VD 5DK0A 5LXGH 4X6CE 5FYKU 1JWSA 3H9SD 2VN4A 3LB6C 1JBJA 1MCJA 1YNKL 3CPLA 3CVHA 1FL5A 2LU4A 3FFDA 1EVUA 5IUSA 3VXQB 1W0WA 3MLTB 1C5CH 2VABB 3OX8B 1NGPH 4HS6A 4CNIB 1JPTH 4DN3H 5IB1B 1TZIB 4NKOB 5GS0C 2H2SD 2R0ZH 4LLDB 4W81A 1VHPA 2JE8A 2ESVB 5C3TA 1XEDA 4NQDA 5CJQL 5H94A 1ETZB 3VFSB 5HYJE 4WFFD 5BVJB 4OSUL 1MAML 4PJIB 1T5WB 1KBGL 3QEGL 1ITCA 3CLFL 3VG9C 2W9LA 3F6IA 5DUBB 4HWBH 3HRZA 4HBCL 4XP5H 1S9WA 1QLEH 2HLFD 2AJZA 4U7KA 2GJJA 3AS0A 2VB5A 5I17B 5I75C 1YY9C 3JTTB 1S5HB 3THMH 2IBZX 1FP5A 3QI9D 5A3IC 5BQ7B 4R26H 1RUKL 4XBGB 2CO6B 3TM6A 1KELH 3RHWF 1RUKH 1CGVA 3IFLL 3VXUB 4OZGE 2GSGB 3WIIH 4AH2B 5IW6A 4G7YH 1HOCB 4KRPD 1PQZA 3QIBB 3FQRB 4XXCA 1W72L 1RJZB 2HTKC 2JCCF 3WFDH 2EO1A 3PIQA 2NY5L 3L3HB 3GSNH 4P2QE 4PGBB 1JGEB 4M62H 2I9LA 3VI4F 1OVZA 3GO1L 3G08B 5JHDE 4HKZB 4MJID 1H8NA 1WUNT 2P24A 5FO9A 5ESVB 3O6FC 5DYOA 4WO4A 1HHJB 1EO5A 4H88L 4OF0A 5EU5B 4PJEE 2P5WA 3HC4H 4DGIL 4DVRH 2OR7A 1RIHL 4IDJH 2BVEA 4ZFOA 4N0CD 1FLRH 4NJAH 1DE4A 5C0GA 3QCTH 4QT5B 2MQ3A 4LSSH 4R4BB 1QBBA 4XHJC 5EOCL 2VH5H 1FNGB 4M8QB 4UQ3B 4MVBC 4R0LB 1LO0L 1P5VA 5DC9B 3WJLC 2CRMA 3BD4A 3QWQB 4G8FB 2AJXL 5LXGL 5CKAA 4X99A 3FT3A 1JYVA 2PXYA 4NZTL 5GZOC 3BOVA 3BEWA 3SDXB 5KVFH 1CZ8L 2GW5A 5F72S 1U2HA 3CSYA 1CZ8H 1KPVA 1YECL 4CNIA 1OGAA 2L4OA 4UQ3A 2WIIA 4YJZL 3BZFA 3QCVH 4LLYA 1MLBA 4KKAC 5D7SH 3RDTD 3JV0A 4D0BA 1MNUH 2XTLA 2AK4D 4OFYD 1WWCA 2Z31B 3H8NA 1Z3GL 3GO1H 1OPGH 3V0VA 1WFOA 2XQYG 5IGXH 2DQJH 3MJ9L 1CFBA 3EKCA 1A21A 4KK9C 2HVJA 3QFDA 5SV3A 1DBAH 5L0QC 4X6BB 1AGEA 2FIRT 1T7YA 4LU5H 3SDDA 1INQB 3GMPA 1XH3B 3FFCA 1SJEB 2E27H 1X4YA 2UV3A 3FQWA 4QRUA 4FZEH 5EU7C 3G5ZB 4EI6A 3THML 3B8YA 4LIQH 2QQLL 3KYMA 3LQZB 1MHCA 2E27L 1R3HA 3HPJB 2BMKB 4RA0C 4TTDD 2J8UA 4Y2DA 5GRJL 1CD1A 1AIFA 2FGZA 2LU7A 4KC3B 1IGCH 5JOEA 1A7PL 4KDTC 2GK2A 4HPOH 1AGBB 5FHAL 1CFSA 3IDXL 1OSZB 2RFXA 4LARL 4TSBH 1MJ8H 2RJMA 5F6IB 1CFTB 1CLOL 3TH3T 5T3XE 1L0YA 3U0WH 5DEGA 5I18H 5TQ2H 1SEBB 4PJ7E 2WBKA 5L2KE 2A2QT 3RQ3A 3VH8B 4K3JL 4AZ8A 3QFJD 2MCPL 2NY7H 2ED9A 4QEGA 3ZHKA 4N9GA 3V4PH 2XWBB 4Z0BL 5GZND 1KGCD 2EH7H 4IMLB 4Y4HD 1S9YA 3RL2A 3GRWL 1M7IA 2BVTA 5IV2A 4NFDA 5KTEL 4N8VB 2FH6A 1FG2A 3WN5B 4KZEH 5HY9B 4KK5C 3B2VH 3BEVB 2UZYB 2R8SH 5IROC 4CJ1A 2Y5TA 4XVJH 2G9HA 1A02N 2R2HA 4BQ9A 3D2UA 2VL4A 2DQUH 3KPTA 4LSSL 4HZLA 4Q2ZB 3NBNA 1S7QB 4XPBL 5DT1H 1S7XA 5C08A 3DSFL 3BAEH 4Y4KC 4YXKH 2V6HA 3SGEI 3NTCH 3KR3L 1F58L 3O11B 1FFOA 5J13B 3MJ7A 1C5DA 2SEBA 3VGAC 4CU7A 3D2UB 1R3KA 4EZMA 4F7PA 1F11B 3L5XL 4FXGA 3IYLW 3ZHDA 1I9JL 2LE9A 4POUB 4HG4K 5FA3B 1A1OB 4OT1H 4XPGH 3A6OA 5FUZL 2MCPH 2XY1A 4MMXC 3G6JA 1EBAA 2FECI 4MAUH 4NZRH 4PJCB 2IBBA 5JIKA 1XGQA 3H3PH 3W0WB 3MR9B 3T0BA 3PGCB 1A6TA 4N5ED 4Z7QE 2QQKH 5DJXA 4LNRB 4LCWD 3VE0A 3RX5A 4ALAL 4EXKA 1TDQA 1OAQL 2PXYD 2BVOB 4WFHE 1L7IH 5KSUB 3PWLB 4KJPC 1XCQB 1UZ8A 2WLZA 5MEQA 5GRJH 4JFEA 4RWYL 2DWEA 1N0XL 2ZOKA 5DMGD 5DD6A 2R9HC 4JQVA 5CJXC 3G6JB 4X9GA 3RFZC 3O6ML 1KB5A 2FSEB 4M48H 1KYOJ 4U1MA 1T1WA 3HG1E 4QHKI 1WGOA 2XN9E 1NCBL 4LHUB 5KZCB 5D7JD 2EIZA 4EN3B 2D7TH 4MX7B 4P5KA 4RQQA 4Z95H 2MWCA 1WZLA 3TT3L 4YHIA 5BO1H 2O26U 2FX7L 5CBEB 1H3UA 4PB0L 5T5NF 3WFHA 2F8VA 3QUMA 4DQOH 5FYJU 2X4QA 5DJ6B 1AO7B 5I74B 2DJ4A 2COQA 1JGDB 1RU9H 3DVNB 5M94B 4XWGH 4ZAKB 5AYUL 5CGTA 2YHGA 5HGBB 4UOJA 1WVZA 3B43A 4K2UL 3W5MA 2VDML 5EUOF 1CFNA 3MV01 4NN5B 4W68A 5EG6C 2EC9T 5TPWL 5KOVC 1L0QA 5FIEA 3VFUB 3NH7L 3NGBC 5HDBE 3GSWA 3PG2A 4X8JB 1Z0MA 3PL6C 1GOHA 3MLXH 3PWVB 2XFXB 4M43L 3V52H 4PJXE 1A6WL 3OG6B 3I6LD 5MENA 5IFHL 3NTCL 1CGTA 1J5OL 1IFHH 1OSPL 2V5TA 4NQSA 5D1XC 3FB5A 2FBJL 1FFNB 1BFSA 3FN3A 4MHHI 1K8DA 1J8HA 1ZGLA 2ESVA 4HQQH 5D93B 3TBVB 4MD0B 5IHLB 4PB9L 4X9IA 3OKDA 1V5JA 1KCRL 4L3AA 2DLEA 2HFGH 4KDTA 1OM3L 2CDFB 5CZXC 5SWZE 5C0AD 5DDHB 3WFZA 4U1NB 4KROC 2EH8H 4ZS7L 1VFUA 4YHMH 2W65B 3GRWH 3O4LB 1IAKB 1OTUC 2VLLB 4H1LG 3VD5A 2CPCA 4AL8H 2VZTA 2KZWA 4FQ2H 4XGZA 4M1DL 3NIGF 4ZUVA 5CP3A 4F7CA 4OZIA 5JW5B 3WD5H 1DP0A 1F2XK 2H8PA 3PQYD 3QSKB 5DDHA 1F3RB 1T04B 3MUGB 1WCBA 1JF6A 4Z7NF 4XPTH 5DJ2B 2FSEA 5EU6E 1KCUL 2XZQH 3NIFF 5KVGH 3VG9B 1B4JL 5E5MA 3RJDA 4PJIF 4DKFL 5H37G 4PGBA 2X4NA 4JREC 4NRZB 5EOCJ 1T3FB 2OMBA 4K9EH 3RIAF 4OZIE 1CFVL 3VXMB 5IBUB 5ADPH 3IDMA 4KI5F 2IC2A 2FWOA 1EJOL 3VXNA 4NO0A 2I07B 3QRGL 1KIQA 1XF1A 3WDJA 3HUJA 1U93A 2VAAA 1A2YB 3S37L 3D39B 3FO9A 1FJ1A 1U91B 1JPTL 5CJQH 1DE4B 1MCNA 5GGVY 5D7IB 3VI3F 5C0RH 1HKLH 1U9KA 1CFNB 5L2KA 3IDIA 3E3QC 2JCCE 4NQDB 4UTAH 3BXNA 3L1OH 2YC1B 3MRIA 1B90A 3CFIC 1EEYB 3IJYA 4LLWA 1XF5B 4AMKH 4HUNB 4HFUH 5T1DL 5A2LH 4E41B 4NRXA 1R5IB 4PGCA 1IGFH 2WZPD 1RZKC 1AQKH 4TUKH 3MRLA 3WXWL 3MYJA 3IETA 5EU3A 4APQD 3QNYA 2UVFA 1I1AC 1OSPH 1RURL 5F9WB 3U0WL 1A6AB 5IVZB 1ZLWH 3VFRB 1D5IH 1FN4B 4LRNL 4NHUA 2A0LC 3VFWB 4QYOA 4N8CL 2NPLX 4NM8L 3V2AR 3C6LB 6CGTA 1AKJD 1F4YH 2E9IA 2BZDA 5GRVL 5C08E 2H1PL 3CMOH 1B9ZA 4PRAA 3MXWH 3ZTNL 3JWNC 3RRQA 1ZT7A 2L7JA 4R2GD 4UNVA 3QIUA 1IL1A 4UT9L 4LCCB 3GJFK 1AJ7H 2W0KA 5D71L 5BW7A 2JJSC 4NC2B 4GRWE 3QNXB 5DSCA 1JHKL 3ARFD 5SWZD 4AYFA 2NR6C 2YZ1A 5JORA 4OCXH 4JFED 5IESH 1CXFA 1N5AB 1WBXB 1BBJA 1K8IA 3VFVB 4YE4L 4LKCA 3HRZB 1O0VA 4Y5XC 3C08H 1UB5B 5C0BA 3GSRB 3C5ZA 3RHWK 2GKIA 1BZ9A 3DMMD 4KHXL 3HZVA 4F7MB 2R0LH 3V6BR 3V8CA 2X9WA 4HLZG 4EOWL 1FZKB 4JDZA 3FO2B 1H9VA 4HDIA 2EXYD 1UKSA 4G6FB 4G5ZH 5B39A 4KUCF 1KB5H 2Y36H 2VERN 3E3QE 3LHPH 4XPFH 4O5LH 5LGHH 2XWTA 1RFDL 4WO4B 2DIJA 4AJ0A 4N1EA 3N06B 4PV9B 1JGEA 1G9NL 3OR6B 2IMNA 1DBBL 2E8YA 3G08A 4LLWB 1K4DB 1I1AB 1KLUB 4RISL 1YC8A 4J3VA 1F45A 3U36A 4TTGA 5FK9B 4MQXD 3MO1A 4OI8A 2X70B 3BFOA 4RDQF 2F58L 5IMKA 2OSLA 2EEAA 2JF1A 4K71B 1IAMA 2J6EL 2J6EH 2XKNB 1QVOB 2E7BA 3BEWB 5MP6L 1LQSR 1FC1A 2QQNH 4H26B 2AEWA 3MRHB 3LN9A 4FTVD 3MBXL 2DLIA 5L7XL 1A3RH 4LVHB 4OFIA 5D1ZA 3U46A 3DV4A 3S3JA 1DANT 3VGDA 1DVFA 25C8H 4KK6C 4YEEA 15C8H 1UKQA 2X42A 1ZE3C 2PR4L 1LO2L 1CE6A 5KN5B 4GG6F 4APQB 4QRRE 1D9KD 5CEZH 1P2CB 2A83B 3L3IB 1V3MA 4GKZB 3SQBA 2IEPA 3PP4L 4WI8A 3GIVB 1TVHA 2DJSA 2EIDA 3CFJA 4OV5B 4I9WE 4M62L 3S4SG 4BUHA 4N0CC 2JB5H 4GG8B 3LEVH 2FECL 3IFNL 4N0RA 4PD4J 4PJ8B 2IGFL 4WI9A 4FQLL 4JDTL 4JFPB 1Z2KA 3ROLB 2HRLA 4DWHA 5KVGL 4LHQB 4YHLL 2F53A 3BEVA 3K8KA 5GGQL 1NEZB 4RMSA 1OP5K 5HHMB 4ZUSA 1MHEA 5CSBA 4MS8D 3BW9A 2BNRA 3JV4B 3O45B 4DKDC 3CFJB 4U1JA 5DJYA 2VUOA 1MJ8L 2JJUA 3B9KD 4PJFA 1LK2A 3BD3A 4YQXL 1F4WH 3VRIA 2PN5A 1SQ2N 4M3KB 5EIVA 3WE6B 4DUWA 5I76B 3HC0B 3DJ9A 2VLME 2ARWA 4NN7B 1KFAH 1VEMA 4PTUA 4PJ7B 2DM7A 4JFFD 4IRJA 5AD0B 2XICA 2NY3B 1BWWA 4DK3A 4JPVH 1ZHLB 5C09D 2E7HA 3MNVA 2YR3A 3DUSB 4I18B 1FYHB 5I66B 5KJRH 1FV1B 3ILPA 1ZWIB 4YBHA 1CF8L 4WHTA 2D7QA 4HKJA 2VAJA 2R0ZL 1FNHA 4NO3B 1JZ3A 1K4DA 3QPQD 1JUFB 4M6NH 4UIKH 5FHBL 1L6ZA 3K1KC 4S1QH 3PXJA 1V7NH 5JQ6H 1KB9K 5IFAH 5FM8A 1Y6NR 5D93C 5IGXL 1ULVA 3KYNB 4FXKB 3PQYB 3ZLQC 1YY9D 3IAQA 3RL1A 3RY5A 2ZUSA 1CGSH 3GMNB 5D1XB 5TJWK 1G7LA 3ZDZE 3QWRA 4OLXL 4JRWA 4LLUA 1SYVA 2YUVA 4JCLA 4QXWA 4F9PA 3QI9A 2NY6D 4NQCD 1R6VA 1DUYB 2BOBA 5TQ0H 3SKUD 1IC5L 3JXAA 4NNPL 4HK3J 4QTHA 2IQAA 3HN3A 1S7RB 4U6VL 2P8PA 2Q3AA 4NN5C 2IFFH 4WTWA 5KANI 2BHZA 5TQ2L 4KAQH 1G7PB 2YD4A 5IBTL 5I1KH 4LGPB 1E0OB 1QO3B 3PNWB 4P5MA 4WIQA 2QQQA 1KB5L 4FA8A 4RGMB 1JTPA 3MCKB 5GGVH 2CRZA 4ZUUA 5E7FA 2CO7B 3QG6B 3BQUB 1GGBL 4C56A 4P46B 3DXAA 1EK3A 1KNOB 2OL3B 3ARBC 1RZ8B 3EYUL 1KXVC 3FB6B 3BZ4A 2ZNXA 2FD6H 5EWIL 2EDTA 3STZB 2XY2A 4CL7A 3GSXB 2APTA 3W39B 2BXYA 4YHYB 1FH5L 4YHNB 3ZHLA 2IADB 5T3ZH 1W0VB 4P9MH 3WDHA 3BGFC 4ALAH 1U8MA 1TPXB 2ZUTA 3ZDYE 2FB4L 2MMXA 3P73B 2HMID 5FCUL 4OI7A 1WZ1H 4ZAKD 1J7VR 4K3DL 5BRZA 1HHGA 3L3GA 1J12A 2HT3D 4MWFB 5T1KD 5D9SB 1UGNA 4Y4FB 4GXVH 1XGTB 3BX7C 4NNPH 5D70L 3CZFB 4X4MA 3L7FA 4JG0L 1AC0A 1LEKA 4HKBA 3T1FB 3BKML 2IQ9H 5DJDA 1T0PB 1F4YL 3BE1L 2EDOA 3CUPA 4K3EL 4PG2A 3I2CL 3BXNB 5KZCD 2RAMA 1JV5A 2VDQL 3SE9L 4M7ZC 5I6XB 1T0MB 4LMQI 4MQTB 2EH8L 1ZLUK 5F7EH 2DTML 1FIGL 4MWFA 3WFHB 4X5WB 4QRPA 4TUJA 1KG0A 3BO8B 4YHPB 3U2SB 2XI9A 3AB0C 3WL9A 4BK5A 1PG7H 5KVDL 2Y06H 1UXWA 3VD9A 3TBWA 5C09B 5DMGC 3GRWA 2NY3D 4P2YA 1KTLA 3T65A 1PG7L 1AXSB 2FL5A 1KJVA 1LO4L 1RHFA 2VL5A 1NGWB 1UKTA 4MDJB 2NY2B 3VFWA 5D7JC 3X17A 1MCCA 4X5WA 2A6DB 4JRYD 5B8CB 3PWJB 4PJCA 3JV6A 2BXZA 1OTTC 4K7PL 2R0WL 3UYRL 1X5IA 3TBYB 3BPOC 3FQTA 3OXRA 3B9VA 4KDWA 1J11A 1KTDA 5DJXB 2ORBL 3VE0B 5I8EA 2FO4A 4OD1L 4P4KC 4JG0H 4R4ND 5C09A 1Q9WA 1N4XH 1A0QL 3BP5B 2M1KA 3WFEH 2PCPA 1LO3L 5IB2A 3G6DH 1HH6A 3PF2A 3KJ6H 3GNML 4FQJH 4XWGL 3P4NA 4TSBL 4GRWH 1QBLL 5ICZB 4X7DC 1NUFA 4FZ8L 4MX7A 5DMIH 3ORJA 2FO4B 4G9FE 4F58L 3EO9H 2E7MA 3C2AL 3UTQB 3T4YB 5D2LE 5HHOE 3TVMA 3TT1L 5I1JL 2W65A 4OM0H 5JW5A 3ILQD 5B4MC 4ZODA 1DL7H 3TJEH 1C5BH 5JW3L 1A4JA 5INCA 1YC7A 2IG2L 5EWIH 5CUSL 5C8JB 4JN2A 5E9DD 1KIRA 3VFOB 1U58A 3VXSD 3PQYE 4M7LH 5FGSA 3WXVL 4Z7WA 3JSSA 3UYOD 3NIDE 4ZPTA 5JNYB 4JZNB 1IC4L 2FEDC 2C3VA 4ODWB 4DZBB 1TITA 4X5XB 3JZ7A 4JM4H 4EDWL 1BM3L 4Z0XB 3BWAB 4PJFE 2JIXA 5CZXD 2XA8H 4UINL 1WQVT 1BJ1J 4PJAA 3UBXB 1MVFA 3QG7L 2B1HH 5D7SL 1GGIH 1M6OB 3EJJX 4HJJL 3D39A 5FYLD 4QXUH 3VXPB 1IC5H 1NAML 4QKXB 1HQRB 5J9PA 5EOQL 2O93L 4TSAL 1K2DB 4ZQKB 1IM3B 1MPAH 4I0CC 4S0TD 3BIKB 1JFQL 2ZJSH 1AE6L 1BD2D 4JY4A 1M1SA 3GI8H 1JTTA 2P44B 2BDNH 3FB8A 3IDNA 4R4FH 5JDSB 3RY4A 3QZWG 4TN9A 5LVEA 4ONHA 2R23A 4ZOCA 5I9QB 1WICA 3BH8B 3ARBA 1U8OA 2ZUQC 3CPLB 3CVHB 4HFWA 5HPOA 3GSVB 4EQ3A 4L1DA 2H32A 5HGGS 4HW6A 5GHWH 4V1DB 1JGVL 1ERNA 4H1LA 4QXTB 1N5YL 1CU4H 3WXWH 4JO4L 4JY5H 4NWTH 1KIUA 3IJYB 4LPWA 3ECBB 4WWKA 1DCLA 3IETB 1P6AB 3C60D 5INDA 2P43B 3KHQA 2RQ8A 1NAMA 2IF7A 1S5IL 3GIVA 5DZNA 5K9JH 2YPLE 3O3EB 3QG7H 3VJ6B 5EULV 3O6LH 5AZEH 3HI1B 5EN2A 1S9WB 5ERWB 3G5XA 3SJVA 4IHOB 2AXGA 2XPGA 5E2VH 3V4PL 5AAWA 1C7SA 4UU9B 3JTTA 2DMCA 3MBED 4OCYL 1G6RB 5J11C 2EXYC 2IH1B 4HUUB 5C0CD 4IJ3B 3NPSB 3GIZH 1VACA 4NKDB 2Q86A 2DLTA 5D5MB 3P9WB 1KIQB 1U3HB 4U6YB 3CZJA 4PRHB 4XCFH 5GGQH 2QSTA 1AY1L 1ND0A 1T1YB 2AAVA 2AP2A 3O0RH 2E8ZA 4Q9CA 5LCVL 2E7LC 4HWEH 2CJUH 1UM6L 2VO5A 4IHOA 3QUYD 5I1JH 1YYLL 3MA7B 2IAMD 2E7CA 4GBXA 5C9JA 5I8CA 3INUL 4MNQA 2IH3A 2FH8A 5DVMA 1NCDH 3FMGH 3W11C 3I3EA 4NKIL 3QXTA 3TO4D 3DUHA 4PRDA 5LCVH 3CCHA 3R06A 4C83A 1U8JB 4MJIB 2A6JA 4FFZL 1FZOA 1JWSB 3LQAL 3QWRD 1I1FB 1DBMH 2A0LD 4E41D 3BHBA 4YX2H 1RMFH 3N85L 4LKCB 1FZKA 1JUFA 2DTSA 4KJQC 3MA7A 4I0PD 3J7HA 5C0BD 3T77A 5E95B 2QQNL 1QBAA 3ZKSD 5GJTH 5J11B 1B6UA 1HXYA 4R2GC 1LNUA 2E9BA 1A3RL 1MWAB 4NQDD 5E5RB 2C3WA 3QPXH 4WU7B 1I7UB 4JZOB 1OAXH 5SV4A 5DQ9A 4POYA 1AP2B 5JMRA 3J8F7 1TJHH 2JK5B 3RWGA 5DHVA 4XPHH 4N1HB 2CLZB 3NFSH 2QSVA 1BQHG 4WFGE 1KN2H 3KS0H 3F7YA 1Y6MR 4GAGL 4NNYB 3ZL4L 1P7KA 1N7ML 1T2JA 1Z0NA 5C92A 4A6YA 1AGFA 4HIHA 1MLBB 2FCBA 3ARFA 1ZHKA 2GJ6E 1CS6A 4WU7A 4H0GA 3PJSA 2FBJH 1IZKA 1XF3A 4OCWH 1KJMA 1J0ZA 3E8UL 1IAIL 3MUJA 1QO3A 3PNWA 4P5MB 3KPPA 4X6DE 3PWPD 4ZUUB 3AROA 5KS9E 4ETQA 3P11H 2R1XA 2R0LL 1KNOA 1QYGL 5EU7E 1DR9A 2VR4A 1R3JB 1JNNL 2GJ6D 5CIPB 4M9OA 1OP9A 5ILTL 3CNKA 1I9IL 2WP3T 4HUKB 5ITBL 4ONFH 4JJ5B 4O58H 1CLOH 4HUXA 4NJ9H 3ZE0E 4DAGL 5JZ7D 1J1PL 5MENE 5F3HA 3C5ZB 2ITCB 2H26A 1FDLL 3NIFE 4JG1L 1R3IL 4G80B 3BP4A 4ZO6A 3BRFA 4AL8L 3QCUL 4TUOA 4GBXB 2AKRB 1B88A 3UPRB 3O3DA 3Q6FB 4GRMB 4ACPA 3MZTA 1X7QA 3T1WA 3ZMRA 1CLYL 3QEQA 3S5LB 1A9EA 3QDMD 1I1FA 1CG9A 3WNKA 1UH2A 4LHUG 1H3TA 4GKNA 4Q97A 1RJCA 3VD7A 3MLYL 2DIBA 1YNLL 2AQ1A 5FKAB 4D9QD 1DLFH 3WIFA 2BNQB 1CQKA 3U4EB 5E2UH 3RZCA 4L1HA 3L3KA 5L2JB 3MNVB 1XZ0A 1A9EB 4Z7WF 3VDAA 1TCMA 4NO2B 4PS4H 5IM7B 2WQRA 4LLVB 3UBXI 4U2YA 3H9YA 1QFUL 4URTB 1Q1JH 2YPLB 5ALBL 3TIEB 1ZHLA 3N1PC 5DHXB 5FKAA 1RJLA 2Y6SD 2FYYB 1MCPL 3GHEH 3QG6A 3CX5K 4KVNL 2CXKA 5D8JH 1QSFE 2Q8AL 3V6ZB 3MLZH 1FL6B 4HIIB 1OP5H 3KPRA 4HWZB 3RKDD 3MOBH 4ZFOB 1XGPA 4ENEC 4ZTPH 4ODHH 3IU3B 3HUJE 2OZ4L 4EN3D 3MFGB 5EOCH 3ULVD 3TESA 1MVUA 2CUMA 3OBAA 4Y16D 3WNLA 4PREA 3CGTA 1QSEA 2WANA 2IPTL 5D2LB 5HHOB 2DQDH 4N8VA 1S8DB 5I1HH 4IRZL 4RRPG 1ZGLP 5ICXA 3GI9H 1E6OH 2ICEB 5I1LA 4ZTOH 2IALB 4UNUA 1N6UA 4KUZL 2VQTA 4Y5YC 4OIAA 4J3TA 5IHZB 4L3EA 1EJOH 3QPQC 1RZIA 4GFTB 3WO3B 5C2BH 5I1DB 5DLMH 4J4PD 1A6TB 1UYWL 3ARSA 4AIZA 3AGVA 3HAEB 2M8XA 4G8GD 5HHQA 1T03H 3PHOB 4L8DB 4OZGA 3PWLA 4XBEL 5JOPD 3P0VH 5I1AA 3FOLA 4GQ9L 3T3ME 1T22A 4QRPB 1RZ8A 4PPTA 4FQPA 4YHLH 4L9LC 4OAWA 3TYGH 1RK1A 3RNQB 1OHQA 4JM2D 4AG4H 4F7PB 3IRPX 4YIQA 4U2ZA 4U4BA 5DJZA 1AGDA 1YYML 2EECA 4JPIA 3STLB 1CICB 1FZMA 3ES6B 3ZT5A 3IS0X 5D2LF 1A7RL 2B4CC 4M5YH 4OBRA 5IR1A 4NZUL 1P4BL 3KYNA 4FXKA 1A4KA 2A9ML 2R2BB 3V5HA 4LPXA 2KQNA 5I1HL 1XIWA 2EDDA 1GJIA 1GAFH 3OHXB 4MAYD 4IRSD 1PY9A 3D85D 5IQ7L 1WLHA 1HH9A 1NFIB 1UA6H 4M1CC 4P3DA 3D6GA 1Y0LA 3ARBB 2Y7QB 2Y23A 1I9IH 3SY0A 1L0XA 1NL0L 1YPZB 3QHZH 5A2KH 5IR1B 3HZYA 4XP1L 3WO4C 5F9AC 5DD3L 1BD2E 3LEXA 5TDNA 5FYKE 1BJ1H 3P4NB 2DTMH 4OKVB 3P9MB 1EXUA 5LQBH 4YK4B 3QFJB 3SDDC 4ZDHB 1MHHB 3EBAA 3RGVB 3IDJA 4BH7A 1YA5A 3MLVH 3MLSL 4BFBD 3UBXG 4FQXD 2ZKHH 4Z0BH 5C0EB 2XTJD 4X0KB 1AXSA 2FL5B 2VWEC 3EDJA 3QUKB 4MB3A 1MF2L 2E3VA 4X98B 5JW4Q 2YMXH 3DYMA 4UDUA 1F4XH 5DQDH 1JGLH 1QACA 5C8JA 4XB7A 1AGCB 3TBWB 1QQDA 1TNNA 1I4FB 1EXUB 2EE3A 3Q6GH 4H5SB 3RWHB 1EAJA 3ARGC 4Z8FH 2IFGA 1YQ2A 4ODVH 4TVPH 5L9DH 5DGRA 1KJVB 4BSWA 1FO0H 4IRJC 5DS8A 3E0GA 3FZUC 2Q1EA 2VDRL 3DARA 1LE9B 1JTOA 3LVEA 4DGYL 4CVZA 3CSPA 2HN7B 3V7AE 5CBEA 3PGFL 1M7DB 3SCMA 1OT2A 1FO0A 2GJ6A 3D25A 4PJ5B 3GB7B 3KLAB 1DBJL 1GIGH 4H8WL 4CAGA 5DUPL 1AKJA 1E27B 3OAZK 4XTRD 2Z93A 4MJ2A 1CF8H 4FFWD 1CK0L 3LEYH 3TNMA 1LE5A 5E4IA 2FJGA 4OZIB 5FGCB 5HYIA 4U7SA 3KXFA 3KPOA 1OQOA 2CKBH 1XGTA 3HE6A 4JY4B 5EU4B 4OLZL 4XXCC 4Y1AA 4F33A 4I48B 5IROA 2B4CL 4MD5B 2KZ1B 4MJIA 4X8XA 2DM4A 1XAUA 4NN7C 5FV1L 5KSAA 3STLA 3NA9L 1RZ7H 1EAPA 4MCYB 3NABL 4Y8AA 1DJSA 5DURB 2YD7A 3JVGC 1UM4L 3VXRE 3RY6A 5ACLA 3VU2A 2HKHH 3OMZA 4ERSH 5HD8D 4NKMB 3FB7B 4MAUL 3TPUA 3MZGB 1S7WA 3BZEB 1LK3L 1NQBA 1EFXB 1Y18A 4HHAA 5I1GL 1PSKH 1E28A 3CAFA 3ULUL 3DURA 4YAQA 5I1CH 1J1XL 5TE4L 3V6FA 5D2NB 4XRCB 1UCBL 4PD4K 1BFVL 2X4UB 3ARDB 4FTVE 4KGLA 2B1AL 5HGAB 3G9AB 2EYTB 5JQHC 3EHBD 3AU1B 3EO1B 4NWUH 2VDOH 2H45A 4Z9KB 3RWCB 4C59B 4LCIH 4HV8B 3RVWD 4O9HH 2MHAB 3VWJB 3ULVF 3OAYK 3AS3A 4LLMB 2B20A 2CUHA 1YN7A 3ZKQD 2HJLB 4XVTH 5J1AA 1A6UH 3IFOB 5E8OB 5J3HC 4Z76A 5EC1A 3WLBA 3RVUC 2VTFA 5KS9B 1N3NA 1SY6H 3CC5B 5A16B 4HIJA 1WV7T 2VABA 1ZHNB 3NAAH 5D6CA 4YHOH 3IXAA 2BJML 1IRAY 3GGWB 4OZ4B 3ESVF 1UEMA 1YZZA 5JDSA 4V1DA 2EEBA 5E00B 2B7DT 2FX8L 1B2WH 4ORZC 3A6BL 3JTSB 4JFDA 4OGZA 5F9JB 3PWNA 2NQCA 3OKNA 4JQXC 3MFFB 4EQ2A 2BSTB 2VLJA 5CIPA 3UAJD 3UC0H 4MJ6A 4D9QE 4KY1H 2IAMC 4MJIE 5C08D 4DN4H 1EO8L 4YDKH 4G8GB 3UTTA 4OGYL 4KHTL 1FGNL 1QFWL 5CJOL 4LQFL 1IBGL 3SJVD 3HUJB 3OKDB 2FNBA 4PJGF 5CBAA 5EN2B 5H35A 2FJFB 1SEQH 4O5LL 4J23A 1D5ZB 1CTOA 3SEPA 4WO4C 1HZHL 1I3VA 3FRUB 1MPAL 4LARH 4JM2F 4KJQD 5ICYA 3QYCA 2BHYA 4HJJH 1EDQA 1P9MC 4YFEA 4G8GA 2OM5A 2GUOB 4JRXD 3RGVD 2WAHA 4JZOA 1PG7X 2A1WL 4XMPH 5EU3B 2PYFB 2PO6C 3JWOH 4ZXBC 4I1NB 1OT1A 3KDMB 3MJ9H 4RIRB 4JPKH 4LQ1A 3EJZC 3M07A 3D85B 3RVTD 2XWTB 4RFNB 1IM9A 4CDHA 2QADD 3LKQA 1B4RA 4P9HH 3LH2L 1IQDB 1KGCE 3W2DL 1OM3H 1DQDH 2OTWB 2YK1L 1NCUA 4G42A 3F6LA 1BVKB 4EVNA 3WNOA 1ACYL 4F9LC 4LPYA 3BISA 4MA1B 4LP4A 2WUBL 4AM0B 3WFBL 4JM2B 1S9XB 2QV2A 3D69A 4XNUH 3CX2A 3S88H 5BMFL 1U8QA 2BX5A 3W9DA 3C6LC 1N2RB 4LSTL 1T21B 2AK1H 1E4KC 3CH8A 3ZKNC 1IC7H 5FO7A 4A6YL 4ODSL 3HNVH 1AD9A 3GFUA 3A6BH 3G5XB 1HEZA 2FIKB 3KYKH 4Z7VF 4JFFE 3F65A 5HBBA 4UU9A 5I71C 3QO1B 4H88H 1TCRA 2YUXA 3Q6FA 4K2UH 4HXAL 3TEUA 3OX8A 5ICXB 1ZEAL 5BJTB 3I6KA 1FAIL 1J87A 3VXSE 4OUUA 4QY8B 5HDOA 1BQHA 5J6HB 1XF2A 5DVLA 3NCEB 4BQ6A 5DFVD 5ELIA 2QHRH 4JANA 4OLEA 5HI3D 3C5ZD 1CDIA 4M6ML 5K59E 1NCAL 2FR4A 3DTXA 5FA4A 2LQRA 2C1OB 1JPFA 3TBTB 3D3VE 3CFBA 2EDNA 3TT3H 3REVA 1NGYA 5C0NC 4NQCA 1Z9MA 5C0IA 4X83A 4M4PA 4UBDD 1DEEA 4E5XA 1ZT4B 4PJ9D 3N9GL 2WM0A 4PV9A 5FM4A 2Q87A 4RFEA 3WKMH 1YEEL 4FQ1L 5E2TL 5F3HB 5FO8B 4JHAH 1KACB 4OF5A 1YEIL 3PWPB 5T5FH 2JJTC 5D7LE 1U8KA 4R8WL 3SGDH 4LVOC 3VFNB 4X5LA 2EXWC 2Y6SC 1AI1L 4OJFH 1F2QA 4N0FA 3MODL 1YQVL 2CJUL 2DIAA 4JREB 4KUCD 4Y4KA 4WNQA 3CDGB 2OR8A 2VXTH 1OGTA 1BF2A 5BS0B 3ULVE 1YJDC 1T89A 2DDQL 3H9HB 5FGBC 5J4MA 4M3JA 2X4RA 1PKQA 3RWEA 4GAJL 3TH4T 1ODAA 3EJYC 4PRPB 3QEQB 1RJYB 3H6JA 4YPGB 3VMOA 1NEZG 4R9HA 1BVKA 2VZUA 2HA1A 2EE9A 1EPFA 3TH2T 5D2LA 5HHOA 3T8XB 3UYRH 1OCWL 4GSDL 5DUPH 3Q2CA 2P7TA 5C0GB 3OKKB 4CW1A 3ZO0A 3O6LL 5C71A 1TQBB 4EEEA 1HILA 4OQTH 5KG9A 1SEBA 1B0RA 1AXTH 4Y5VB 5T1KA 4YGVA 3BN9D 4KK8C 1A7BA 4JPWL 1FVDB 5I0ZA 2EDHA 2AW2A 4QNPF 4G9FB 5T3XH 1S7RA 5D6DC 4P99A 2X1XR 3VCLA 1CU4L 4G43A 4HIXH 3FJTA 2J4WL 2NY0C 3CXHJ 4RFOL 4AT6A 1OOAA 4M93B 4KRPC 2ATKA 4ETYA 3ME0A 4PJ5A 3PL6B 3RU8H 5FFLA 2FJHA 2OXGA 2AJSH 5CEYA 5ETUA 3FOMB 2NY4C 4NO3A 4H25A 4LSVL 4NZDA 4HIEB 1UZ8B 2YPKA 3K8MA 5DO2C 2XZZA 3RWFA 3U9UB 3DUUB 1MFEH 5DD6B 1MJ7H 2IADA 4HK0B 4KZDL 2UYLB 1RUAL 1MFNA 3O6FD 5ISZD 1WAAF 3TA3D 4PGEA 2XNAB 1KCSH 3IU4L 5I74C 1PEWA 4PB0H 4OM1H 4IRSC 2X4TB 4OQTL 1YDPA 2BNQA 3FTGB 4J2XA 1JPGB 1BLNB 4M1CD 5HHVH 4HIEA 1HCFX 3C60B 2CGRL 3HI6H 1Z9SA 4OF8A 4YHML 5CHNB 4ENED 1A8JH 1NUGA 4K7FB 4Y4FA 5C07A 5GIRA 4UT7H 1G0XA 2V5YA 5JW4N 4EN3C 5CP7A 4OZFB 2GCYA 1GGCL 4H0IA 4UILH 4WTXA 3P77B 2CDGA 4WEMB 5HYSB 2DS4A 2DMKA 4Q74A 3TYGL 4V1DD 4OTXH 5F8QC 5DMKB 2IPUK 5DRXB 3IFPB 4TULH 3WIHL 1MCWM 3KWWB 5A2IH 3BDXA 1FORH 3RWDB 4X6CB 5IB3A 2XTJC 4XP9H 4ODVL 2CIKB 5A2JH 4IRSA 2AJSL 4R96A 4D0DB 4WI4A 1SHMA 2HJLA 2J5LB 2AXFA 4M93C 3L6FB 3BH9B 2VSDA 1DVFC 3GNMH 2ZUVA 3O2DL 4TRPL 1B0RB 1N3NB 2D0FA 3MRGA 2V9TA 5DMKA 1IEBB 3HZKB 1CL7I 1DFBL 5F1KC 3NVQA 4DK6A 2ED7A 3BUYB 4IRJD 3TV3L 1A0QH 1NH6A 4JKKA 4KK9D 2HT2D 1G7JA 3BQUA 1F90H 4Q6IA 4QHMB 3T3MF 1K8DB 2XG4A 2HG5B 3MRRA 3GJEA 4JFQB 4KI5D 1LO2H 4LRIC 1GRWA 4GMSH 2XZCL 3KNBB 3GBML 5FECB 2GT9A 1U3HD 2O5ZL 3FHQA 3RA7L 3VGAB 2X1WL 2GITB 1EMTH 2ADFH 2P45B 1TQBC 4PRIB 3RNKA 3KLHC 1DZBA 4ZMAT 3PWJA 1OLLA 3P9MA 3AFLA 3NCYS 2LFGA 5E9DB 5F7DB 1G7JB 4HMEA 4YDJA 2AEIT 2R2CA 2W0LA 2DQCL 1A5FH 3EYQD 3VXRB 4QRRA 3CLEH 2NTFA 3DROB 2PTUA 3U1SH 3DVGB 3U0TB 3U83A 5F93C 2W60B 1JYXA 3O41A 2VLKB 5DRWA 1VKXB 2BY0A 2P1YA 3F5WB 1DUYA 4AEHL 1WIUA 3MV8E 4U6HA 1MFCH 4LAQH 5D2NE 3HG1B 5IT2H 4BQ8A 2LTQB 5FB8B 1CXIA 4LEXH 1E6JL 2JB6A 1E27A 3NCJH 4WFFE 2DI7A 4Y4HC 4MDIA 3SKNA 5BMFH 1HIMH 2FDBP 2W60A 3LPWA 1IGIL 1WWWX 1KELL 3DBXA 3QDJA 3V5KA 1A7OL 5I18L 5E5UB 5F3BA 1INDL 1BQUA 2V2TB 2BVUA 2AI0L 4X6CF 3QQ9C 5J1AB 5E94A 1GGCH 3BSZL 4UILL 5EO0B 3O4LA 1KJ2L 1U91A 1C1EH 3FQTB 1JVKA 2YD9A 5HTSA 3S6CA 1BFTA 3F12B 3CX5J 5EIIB 4GG6B 2Z35A 3G9VA 4B5EA 1PZ5B 1BD2B 1SYSB 3JUYA 5IBUG 1JZ2A 3BP5A 4XCCH 5CWSB 1NDGB 4FQQA 1QEWB 2R69H 3QEGH 4MCZB 4O2CA 2C4FU 3MRCB 2X89A 2P47B 2EE2A 4NQXB 1QPXA 2J88L 3I75A 4OQTA 3ZE2F 1JPSL 4YC2C 1P4IH 4LOUC 4LEOA 4MCYA 3DURB 4YAQB 2VDKH 3W0WA 4I3RH 4JRXE 4LIQE 1Z9OA 1FVEB 4XPBH 5T1MA 3R4DA 2ZPKL 3UAJC 5I71B 3KG5A 3OL2A 4Q6IB 4QHMA 5JXED 4W4NA 3LMJL 4H1LB 4QXTA 4O2FA 2H1PH 5INCB 1T2QL 4LLQB 2DL9A 5BVJA 1K6QL 3VW3H 3TO2A 3I6GA 4GOSA 1QR4A 4Y4FD 3QCVL 4XVSL 4WCYH 1FN4A 2XZAL 1UFUA 4NQEA 1MI5A 4PRBA 3BRGC 4KMLB 2AJVL 5GQBA 1BECA 1FBIH 3GGWA 4XNXH 4OIIL 3RWJB 3ZKXB 4X6EB 1EHLH 2BK8A 5MHSE 4JDVB 1M6OA 5DRWB 1VKXA 4ONGL 1A6VH 1MI5E 2PO6D 4IOIA 3F7VA 1YN6B 1P7HL 1XF5A 4P2OD 4JB9L 5J9PB 3Q1SL 3G5YB 1MFDL 2P49B 2G60L 4A2MA 3MROB 4XT1C 1MWAL 2R1YA 3OB8A 1IGTB 1UWGH 3NFPB 1VGKA 5I8OH 5FDWB 2B0SH 3EJZD 4UINH 4NKDA 5JORB 1KENH 4OGXH 5GRWA 3O9WC 4JPKL 1KN4H 3C08L 3MRMA 3ARYA 3QA3B 4L4VE 5GGRY 4JRYB 4RGOH 4OLUH 1U8KB 4IOIB 3ZE1E 1EERB 5F3BB 1IT9L 3MRJA 3DWTA 3G5YA 5DJ2A 2GY5A 3FB5B 1HHKA 1ETZA 3VFSA 1R0AH 3T2QA 1V7MH 1H5BB 5F97E 3C09C 4AM0A 5FF6B 1BEYH 4WNQB 5CLTA 5ACZB 4JFOA 5FYJD 3PV7A 5HGDA 5K93A 3VFGL 2O5XL 3V5DA 4GS7B 3G6JE 4FQXA 5HHXH 3D87B 5T33L 1TTGA 3ZKMC 2R15A 5EPMB 3O3EA 3HI5H 2WIMA 1MSPA 5T1LD 4CADB 5D1XD 1KCUH 2EDJA 3G6AA 3VGGA 2NZ9D 5FF6A 3IFNH 5IIEA 3EDDA 4DEPB 1ZHNA 1PLGL 3MGOB 2C26A 1HILB 4FQIL 2W0FB 1E4WL 3LRSB 3IB4A 5AUMA 1OAKL 1J18A 3O4LE 3N1QC 1WITA 4LNVA 3T0EB 1F4AA 3LKPB 2R0WH 2VMFA 4X7SL 1YMHB 1I8KA 5E2JA 3MV9E 3VXPA 4NO0D 4AEHH 4KMTH 4PGZA 3S4SB 2VXSL 4HCRA 2XKSA 3MA9L 2ZWLT 2GFBA 3NA4A 1BX2B 1ED3A 2C3GA 3DRQA 5ALCH 3IJHA 1AGFB 4CVWA 3TCLB 1S7UA 2I07A 1U3HA 3VWJC 3U6RA 1I1YB 2CKNA 5HD8C 2FJHB 3ULSB 5IG7B 5C0FB 4ONGH 1T21A 1JGVH 3P9LA 2V7HA 4UQ2B 5E6IC 2BSRB 3HTLX 3Q48A 4F15C 2PYEA 3GMLB 2HYMA 4P2OB 3VGEA 1LDPH 4UTBL 1UCBH 4ELKA 5LWYL 1H0DA 2EDQA 3BZDA 1PSKL 1YEGH 2YD1A 2P8MB 5DR5H 3BW9B 1JPFB 5TE7L 1G9MC 3Q5OA 1KEGH 5JXEA 5DMJB 4MZ2A 4HXBL 1RV6X 3SPVA 4XP5L 3V6OA 1Q9LB 3T77B 2CDEB 5F7FA 2AJYH 5EZLB 4EOWH 4ONOA 4X4YA 1GYAA 3D85A 4Z78A 1GZPB 4HS8H 1IJ9A 2XA8L 3TBTA 4ODXB 1CE6B 1XF3B 2ADIB 3DX9A 2OR9H 5CJXA 2VDNL 3WKNA 4U0RC 4S2SB 4PLOB 3F58L 2H6PA 1VFAB 1IQWH 3WIFB 4XB8A 5EBWA 1IQWL 1LILA 5L6YH 2DRUA 3BP7A 8CGTA 3SDCD 5D5MA 3X12B 3SDXE 3S98A 4GKNB 1W0YT 4R7DA 1BGXH 3O2WL 2HLAA 32C2B 1YJDH 2AERT 4NO2A 4YXHL 5IHBA 1OGTB 4MB4A 1M71B 1N0XH 4EKXA 43CAA 2Z8RA 1NBVH 2DQTH 2W0FA 3LZFL 4KWUA 4Q0XH 3SE8L 3DECA 3ULUF 4P2CG 2J12B 6FABL 4ZOBA 2Y07L 3TZVC 3CDGA 2E6PA 4WRLA 4JFFB 4RGNC 3S5LG 5GRUH 5IWLC 1T7ZA 2CMRL 3QQ3B 1WJ3A 2Z91A 1V05A 5FYLH 2JELL 3WE6A 4NN6B 5I76A 4KTDH 1J05B 4UBDC 3V4VH 2D4DA 2JKXA 1OF2A 4G6FD 2C3HA 1LO3H 5CFHA 4WV1B 4XC3H 4DN4L 4NOFA 3ROOA 4GKOA 1AD0A 3CXDH 4M1GL 5D7JA 1FCCA 1C16B 2R4SL 1HHJA 2JCCA 1MLCA 3FT4B 5T5NG 4BM7A 1LHZA 3VDCA 5J06A 5KG9B 5E2WH 2J4WH 3VWKB 1DDHB 3P2TA 4RFOH 3P9LB 3SOBH 2Z8SA 4YHOL 1X5HA 1G6VK 3HG1D 4YR6B 4G9FA 4XHQA 1XH3A 3FFCB 4HBQA 5EORL 3B9EA 2DQIH 3BZ4B 4U6TA 3OB0H 4B50A 3ARFB 3PABB 3BGMA 1H0DB 1P6FA 1MCDA 3KJ4B 4HJ0C 4LCYA 4YDLC 1JPSH 4IEFB 5GJSL 5KOMC 4XNZC 3SDXA 4ZTPL 1T83A 2Y07H 2H3NA 3BI9X 4YHNA 4CN6A 4Z7OF 1NKOA 4J6RH 5FYKH 1KCVH 4AY0A 1E4WH 4GRLB 1DQML 2NYYD 4PRID 3HNSH 4FTVB 4WW2B 1SMOA 4NQTA 1S9VB 4GRLD 2GSIB 3KPMB 3O6MH 3H9HA 5HDBF 1JHTA 3C6LD 5EBGA 1MCKA 1NEZA 4Y2DC 4DKEH 2ITDB 1CDGA 4U1SB 5BVPH 4GRWB 5HVWA 3QNZB 2BNRB 1CIUA 1HI6B 3CDCA 3JWDH 4Z6AT 3PHQA 3KS0J 4K9EL 1UJTA 4NQDE 3U7WH 1CR9H 1HHHB 5H37H 1UENA 5AWNL 3CSBA 3WEXB 3M17A 3GMPB 4MQXC 4JDTH 3B6SA 4P9HC 4GLRI 1G7IA 5C3LD 4TUOB 5EO9B 4OZHB 4I9WD 1MCHA 1FZMB 5E6YA 4LHUA 3LEVL 1I7RB 4L4TE 3KPRE 4YO0B 3VWKD 4Y5VA 4KKCC 3X3FH 3KYMB 3IFPA 5E08H 1AFVH 1KUMA 2VITA 3QULA 1QHPA 2F5BH 4WW2C 3I50H 5H2BA 2VDLL 1VPOL 3K7UA 5IVXA 2GCYB 3KYOB 3MV7B 2EDRA 1AHWB 4OLWH 3QIWC 3RBGA 1MCBA 2AQ2A 3LPGA 5DJ6A 2ZOLA 2V9RA 1RIUL 5GGTH 4MA3A 5CAYB 2DKUA 2ICWA 3MOAH 4XXDA 4BQCA 4F2MB 3B5GA 3D39D 3GMRA 3R8QA 5IM7A 4X0KA 4KAQL 5J1SC 3RUGF 3QUXA 2DYPB 5IJKA 1I8LA 3E6FB 3FOMA 4K8RH 4MSWB 4MQ7A 3RAJH 2G5BB 3V6OC 2WUCL 5ILTH 1IEBA 5F88A 1VGEL 5F70A 2X44D 3VFMA 2FZ3A 3S37X 5EZJB 5KSVB 4YUEL 5C0EA 4KVNH 1YECH 1G0YR 2HTLD 1WIOA 5ENWA 3MSPA 2BVQB 5MENB 2F54A 2ZCHL 2OLDA 3M8OH 4PJGA 4F2MA 3ULVL 4U1IB 5DZOA 3ULVH 1D9KA 4WV1C 5FCSH 2G2RA 4ZOEA 5EO0A 1QFWI 3WNPA 3PGCA 2EH7L 1C12B 4EBQL 4JKMA 4YXLL 4ODSH 3IU3A 5SX4I 4OCRL 2BSED 3U4AA 2VLKA 4NO5A 4RRPA 1QSZA 2A74A 2CMRH 3D18B 4MNQE 5GIRB 1RI8A 4HX1B 2EDKA 1FAKT 4KQ3H 3RZCC 3RL1B 3EFDH 3LV3B 2X7LA 2YK1H 5HYSA 4P2RA 2CLRB 2FJGB 3UTSD 3E6HA 4L8SA 5CGMA 4YWGL 3L95A 3QXDB 4LSQL 4XZUA 2VZ3A 1A7QL 2IJ0C 1OD7A 3WSQH 5IWLA 1I8MA 2PYEE 5L2KB 4KKLC 4GBXC 4JGUA 1QLRA 5SX5K 5HGHA 2PCPB 3SHSA 3PGDA 4Y19E 1FPTL 1O7SA 1JI1A 2ZZUT 4LSQH 4F7EB 3VA6A 1PJ9A 1ZVHA 4OZHA 1QRND 3O2WH 1EEYA 3RUGB 4L8DA 4OZGB 3V6FB 1D6EA 1W72H 2W0PA 5GS3A 2ARJB 3HB3D 4O58L 1B0GA 2DQFB 4ZQKA 1XGUA 5M95B 4N0YL 3U82B 3BZEA 5GGVL 3FQNA 3EZ8A 3IDGB 1FFQA 3L5IA 2DWEB 3MRCA 4PRPD 5LJYH 4FQLH 5HGAA 2Z35B 4P2QD 2BSSA 4M03A 1U58B 3U79A 2GITA 3QUMH 4YNYA 3M1BA 4P59L 4NHUB 4NO0B 1ZSDB 3S3PA 5CLWA 3TA3C 3GMRB 1Q9KA 1D5XB 4PJAF 1RK0A 1C08B 1SEQL 5IW3A 3QUZB 1A9BA 4NGHH 5E6IB 3OGCB 1U8LA 2I5YL 3QBTB 5GS1B 4P0DA 1O7VA 1T6VN 4QHUA 2IPTH 4Q9QH 25C8L 1HH9B 1NFIA 5A16A 4NDMB 4J6RL 1AO7A 3L3DA 4IS6A 1VB9A 1I1RA 1ZS8A 1QLFB 4L8CB 3F5WA 3MFFA 3T09A 5FYLE 1F58H 1JF5A 3QQ9D 5B3NA 4YNYB 5HGBA 3ET9F 5EU4A 1DQJB 5T1LB 5A3ID 3GMLA 3TBYA 1YNTB 1RIHH 4B41A 4L9DA 5HVFB 3NOIA 4UTAL 5MI0C 1D7FA 4HT1L 5HYJA 5I8EB 3O4LD 3ZDXF 2Z8VC 2F8OA 2GK0B 4ZFFB 1JNJA 1D6VH 3PV6A 2UWEA 4LDEB 3QAZB 1ZGLM 3SKMA 4PY8I 5FUOL 4ZYKB 2DBLH 4OD2A 3SDYH 3O3AB 4NRYB 5F1IA 1M7XA 3AM8A 3O2VL 5SX5H 3O8XA 5D96C 5EFIB 2RB8A 4OCNC 4DEPC 2V17L 1D5ZA 2OP4L 1F4WL 1DUZA 2QSCL 1J0IA 2X4NB 2AEQL 3OKLB 1OAKH 1U8NA 1PZ5A 2B2XL 5HDLA 2ICWI 3FMGL 3CVIH 3TN0D 4LCCA 5BV7H 4RZCA 5DUBA 2WUBH 4XCEB 4D8PB 1GPOH 5CEXB 3C5SB 1G6RH 3NCBB 1VESA 3ETBF 1P1ZB 4DUXA 2APFA 4OD3H 5KSBB 4BKLA 1QBMH 2ADJB 2C5DC 3MREA 1ONQB 3NPSC 1QBML 5EOQH 2V2XA 1MI5D 1MREH 5E2TH 5CILH 3PWNB 1IGCL 3T2OA 5HVHC 1G6RL 3QDME 3RVXD 3HE6B 1IQDA 5EBMB 3AM8C 1LP9A 2B4CH 2OTWA 2N1KA 4Z77B 4HH8A 1IKFL 1GZQA 1O5DT 3K0WA 4D9RE 3TO2B 3ULSA 2H32H 3G6AB 3BKYH 5T3XD 4PLNC 4M6AA 4IM8A 1IGJB 4JHWH 2EKSB 3IGAB 3KHOA 4Y19A 5H8DA 1IM3A 3U46B 1UB5A 1TVBA 1I8IB 1FAIH 1U92B 2V5RA 5MERB 3U7YH 1UWGL 1LP9B 5JW3H 3FB8B 3IDNB 5HHNB 5DHVH 1KENL 4OGXL 4C83B 5FO7B 1H15B 1IC1A 5IOPB 5LBSL 3UTSA 3FKUS 4PJIA 1MWAH 4MS8C 5GSRA 4LBEB 2A77L 4GKSA 2VLMD 2A9NL 1MY7A 1MCIA 1YMMB 2NY1C 2RCSL 3MROA 1OP3K 3DRQB 1OL0A 1LVEA 1H3PH 1MWAA 4JKPH 5FAAA 1WIPA 2ENYA 4LCYB 4WUKH 5JTWA 4XNXL 1J0HA 2BY2A 2ILLA 4KVCH 4PRNA 2D31A 2H6PB 3ZL4H 4NQCE 4JJ5A 1FSKB 3MGTB 3JVGA 1LK2B 1FLRL 5LAXA 1TZIA 3LKRB 4ZSOA 3QIUC 1H3VA 5EU6B 4W6XB 2VNCA 5MHSD 1LO4H 2DQGL 5DJCB 2AXJA 4P3CL 4FP8H 3FFDB 4QT5A 3V4UL 2ZNWA 3IKCA 1MCLA 1MCOL 4I3RL 1WZKA 1TVHB 4PJCE 1UZ6E 4H20L 5JPMB 4E0RB 1TVDA 3SPVB 4RFEB 4JFFA 4TSCL 2GEEA 2Z31D 1XFPA 4KJYA 4APQA 2X4PA 4CBPA 1FVCB 3E2HC 5IEHB 1WT5A 2NY6C 5I17A 3W9EA 4X6FB 3DIFA 4X80L 1ZLVH 4NQUA 2AJYL 5I19H 1NLBH 1KJ2H 1DLHA