2VXWA

Structural and functional studies of the potent anti-hiv chemokine variant p2-rantes
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
FSPLSSQSSACCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords C-C MOTIF CHEMOKINE 5
publication title Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-Rantes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 14
structure length 69
sequence length 69
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2vxwA00
2NZ1D 2Q8RE 2N55A 3TN2A 2DY8A 2MPMA 3GV3A 5D65A 3HP3A 1DZ1A 2X69A 3N52A 4X3UA 1BBXC 1RJTA 2B2YA 2KOLA 4NW2A 2NWGA 4XT3B 1TVXA 1O7YA 5EKIA 4XDXA 5T1GA 1Q3LA 2RVLA 1IKMA 1WTRA 2N88A 1J8IA 1AZQA 2RSNA 3SVMA 1XYIA 4QUCA 4R8IA 4QUFA 1PFNA 3GV6A 5CORA 1B2TA 2DY7A 1SDFA 2B2VA 2FFKB 2X6LA 4OIJA 1WD0A 2R3ZA 3QO2A 2FJ2A 1PLFA 1RODA 1VMCA 2X6GA 3I91A 1CM9A 4X3SA 1BO0A 4DN4M 1MSHA 1PDQA 4IUUA 2B2VC 3KBXA 1EL0A 4IUQA 2K05A 1O80A 2KEEA 2EE1A 5CBEE 2L11A 1MGSA 2FINB 1LV9A 2K01A 2VXWA 1BNZA 2FMMA 3I3CA 1WTXA 5DNFA 4IUPA 4IURA 3DEOA 1ZXTA 3KUPA 2RA4A 1GUWA 1WTOA 1QE6A 1F9RA 4ZK9B 2Q8TA 2L9HA 1F9QA 1JICA 2KUMA 5E4WC 5CMDA 4CJ1B 4HSVA 1X32A 2B2YC 2K04A 1CA6A 1NCVA 4RA8A 1AZPA 4ZKBB 2EOTA 2B2TA 2M2LA 1G2SA 3MTSA 4RAUC 4ZLTF 4CJ0B 1DOMA 1WD1A 3R93A 1M8AA 3I90A 3P7JA 1S4ZA 1U4MA 2B2UA 2B2TC 1WTQA 1KNEA 1HUNA 5D14A 4HAEA 4HEDA 4MN3A 3DM1A 2B2UC 5T1IA 2L12A 3MWYW 1IKLA 1SAPA 3D6WA 4XT1B 2JP1A 1EQTA 1BF4A 1MSGA 1HRJA 1EOTA 1SSOA 1J9OA 2B2WA 3DEPA 1RHPA 2FHTA 2CVRA 3G7LA 4X3KA 1PFMA 3Q6SA 4IUVA 5EJWA 1QG7A 3I8ZA 5EPLA 1AP0A 1HA6A 1VMPA 3LWEA 2B2WC 1DOLA 1QNKA 5AFWA 5EPJA 2K28A 5JJZA 1X3PA 2EPBA 1XX8A 1WTWA 1C8CA 4MHEA 1E0BA 1NR2A 3F2UA 3IL8A 1HHVA 4OIKA 5E4XA 4U68A 1CA5A 1RTOA 2MGSA 2HUGA 1JE4A 1HUMA 2HCCA 5EPKA 1HFNA 2XIWA 1B50A 1NAPA 1B53A 1WTVA 1WVLA 2H1EA 2JYOA 4ZKCB 4HCSA 1G91A 1IL8A 1ML0D 1ESRA 2BDNA 3FPUB 2K1BA 5CBAE 5COYA 2L1BA 3IFDA 4O42A 4IUTA 4UAIA 2K03A 2HCIA 3ONAB 1EIHA 4RWSC 2MP1A 1A15A 2HDMA 1U4RA 2RSOA 2J7ZA 3H91A 1F9SA 1WTPA 1U4LA 2KEDA 2L4NA 2MJ8A 1EIGA 1B3AA 1DONA 1B4OA 1ILPA 1MI2A 1HFGA 5EQ0A 4R9WA 3UI2A 2NYZD 1ICWA 4LMQD 1F2LA 2IL8A 1ILQA 1F9PA 2HDLA 4X3TA 1G2TA 1U4PA 1DOKA 3TZDA 1G6ZA 1PFBA 3FDTA 1X3QA 4CJ2C 1O7ZA 1RTNA 1NR4A 2D9UA 4ZAIA 2KECA 1KNAA 2KVMA 2SDFA
chains in the Genus database with same CATH superfamily
2WAQG 5M3MH 1UEAB 3TN2A 3NUCA 5JVH3 2E76C 2X69A 2H4OA 1CHQD 4NW2A 1LTRD 4HSPA 4A75A 1XYIA 4A3CH 5I6WA 4ZUJA 4C2MB 1TWFB 5C4XG 2PCFB 4J8QA 3HOVG 5ELBA 2F0OA 3B6YA 1FR3A 2PYKA 3FRPB 1EIFA 1FNVA 4UPAA 3MEHA 1CM9A 4DN4M 4KI0A 3GP7A 1D5ZC 1QZHA 1D5MC 1KRTA 2QEXA 2K5DA 1ZXTA 4KD4A 2XRSD 3W3AA 4JK1C 3JC66 1F9QA 2O2LD 1FJGQ 1XMOQ 3HKZG 5A2QL 3VR2A 5HURA 4RA8A 4Y7NH 3NTIA 2B2TA 4A3JB 3BVGA 4CDEC 3KFUA 1DOMA 4BA1I 3Q0AA 4R4TA 4OO1H 2QF7A 2K5NA 1AE3A 4A3DB 2VW9A 4L5RC 4MN3A 1QCBD 1YBYA 1K8GA 4P71A 1YNJD 3PIPA 4K6DA 4YWMA 2B63G 1HZAA 1XPUA 2VUMH 4CJ1B 4HIOA 1PTOC 2L0CA 3FHWA 4I65A 1PYWD 4DFAA 3HOYH 3S16H 3ULLA 4UP7A 2JA7H 1FYCA 2K5VA 3AB9A 1KDBA 1Z47A 1HTPA 1E0BA 4K0KL 1RTOA 2MGSA 3Q22A 1VQ5A 2EYLA 3M7GA 4NKLA 2NZOA 1ENFA 4A3EG 2J4XA 1K0RA 2H1EA 5C0XI 3CMEA 1I5FA 1GD7A 5EAYA 5M9OA 3HOXB 2GVBA 3TZUA 2AQ3B 3D0FA 3PO2G 2J7ZA 2JA8B 2JN4A 1U4LA 2MJ8A 3SR1A 2R7ZH 4L8JA 4K2LA 3FKIH 3UI2A 2WB1G 4DU9A 1CHPD 2WACA 3EIVA 5CGKA 4BBSH 4HCEA 1K0SA 1G6ZA 1DOKA 1Q1EA 1CI3M 3FDTA 4LF6Q 3ERSX 2D9UA 4A93G 2K6AA 3DMUA 2JA6G 4K5VA 3GTJH 3S1QH 1D7QA 2LXKA 4YCVA 1TIID 2Z9HA 1KIXA 2OT2A 2YTXA 1K9MC 1H9SB 1IXRA 1RJTA 1WCMG 4GN4B 4QUCA 1RKNA 4WJ4A 5JAVA 1HNXL 1PFNA 3R8BA 2IHEA 4XYQA 4DV2L 4GN5A 1HCZA 3BS1A 2F4IA 1Y1WG 1PH1A 4BY1H 2B8FA 2F0EA 2K05A 3BVZA 3PUXA 4K5WA 5CBEE 5IP7G 4DR4L 5IYCG 3HOUB 2AUKA 4OGQC 4DPGA 4BWGB 4TSSA 1Y8OB 3S1NB 2WFWA 3QJYA 3NWSA 4DR3Q 2ZJRA 4LFCQ 4HSVA 5I2YA 1X32A 1KABA 3A56A 1F77A 5KYLA 1NCVA 3UDXA 1K3BC 2JK8A 1SE8A 4YCUA 4RAUC 4CJ0B 5CV7A 1NNXA 3SGIA 3G4SA 4C56C 1JOQA 2JE6I 5LMNL 3T1HQ 4A3FB 1N32Q 2GVAA 5D14A 3PO3G 2UU9L 4HEDA 4QY7A 5FLXE 4GLAC 3BYYB 4MTKA 5CV4A 2CCZA 4CKBA 3RD4A 3G7LA 1STAA 1VQ8A 1DD2A 5G3LF 2D62A 1TWHB 1H95A 1Q8KA 3F2UA 1QWYA 3BVMA 1TS2A 3ND8A 4DUZL 4LUZA 4A3IB 5A2QE 2ATWA 2JA9A 1GO3E 3RMHA 5ISRA 2KHSA 4FVMA 4IUTA 2G5DA 2RSOA 2C35B 3EVQA 2E2HH 1VQGA 4KK7A 2IW3A 1EQRA 4DUYQ 3KLSX 4DV6L 1SROA 4GN3B 1CSQA 4G4KA 4B3RL 3E5SA 3K5NA 1ILQA 2AHOB 3PF5A 1BVSA 2VQEL 1H9KA 1E24A 3KF8B 1SNOA 5FJ8H 4JI2L 5CBAE 2YYZA 4LF4L 2F0UA 1GUOA 1D1KA 5C3WA 2F0WA 1K8OA 2R93B 2ZTDA 2GN5A 4DR7L 1BBXC 1IKMA 3HKZB 1GOZA 4XQQA 2N3SA 2Q2UA 5IGEA 4HMIA 3OW7A 1I4HA 2CHBD 2ASBA 2E5LQ 4IFDH 1F2YA 2ZXRA 4XXEA 2L55A 3I4MH 3STBC 2B63B 3NE5B 1B3QA 1X3FA 3K80C 1GUWA 4KHZA 5I9OA 1WTOA 3AFPA 2EYJA 4RGMA 3PUWA 4EQOA 3NQTA 1Y1VG 1HNZL 5E7NA 1B7YB 1PMRA 4LAAA 1RD9D 1U5KA 4KTAA 1T9HA 3CRLC 4OO1I 1PH9A 2F03A 1SE4A 2PMZB 1X55A 1YHBA 2QW7A 2EYPA 3P7JA 3T13A 4A3EB 2EQSA 4XQJA 3QIAA 1I50B 1R4QB 4BY7G 1VQIA 2NVXH 2ZXOA 3BZCA 4IJLA 3GTLB 1IBLL 3PCOB 1J5EQ 3DEPA 1YNNC 5LMUQ 5FO9B 1PFMA 4MZ9A 4EGVA 4RKLA 3KLSA 1Z7TA 1NSNS 1GHJA 2WB1B 3RNUA 5C44H 1PYBA 1IBKQ 4H13C 2F3IA 1CK1A 3T51B 5C4HA 4LW1A 3CCLA 5GAEC 1STHA 4QIWE 4ME5A 1STYA 1I6HH 2NBFA 1PHJA 1NJIC 1NAPA 1BDOA 4A3GH 1BBWA 1KL9A 1VDZA 3S15B 2KA7A 2FMCA 2L1BA 4NXNQ 2WKDA 3GTPH 1WCMB 1X56A 2CKZB 1LTLA 1SNPA 4JG2A 2NN6G 2HT1A 1JC7A 2ICIA 1F9SA 1PZKD 4JI6L 1AN8A 5I9PA 1P8LA 3J80c 3X3NA 1O7ZA 4DNRB 4RG1A 3MHBA 3PIP3 1V1PB 3H3VC 3D4RA 3M4QA 2PO4A 3P1HA 3NP8A 2UUAQ 3GV3A 3HOYG 1C7YA 4DAVA 3GTGH 4KN7C 4ABNA 2DJGC 4IPGA 1VQ4A 2F0DA 3H09A 4P75A 1EWHA 4JI3L 1I3QB 2N88A 2YU9B 4V0BA 5HGQA 3M3YH 4AIMA 4R8IA 1SR3A 4C3HG 1N8RC 2KCMA 4DXGA 4LFAL 3G71A 4A4IA 2E2JB 1ENAA 4X64Q 5K5PA 2K5WA 5AJ3Q 1RODA 2IHFA 5JPNC 4RFBA 2UXBQ 4GKKL 1QVGA 1CKNA 2JEAI 4IURA 4B3TQ 1GUSA 3C3LA 1W3SA 3HOZH 2B8GA 1YNJC 2RKSA 1I4PA 3A8JE 2XVSA 2Q2IA 3VA7A 2F0PA 4A3MG 1G2SA 3MEFA 4DV1L 2SNSA 4B3SL 2B39A 4CDCC 3S24A 4WJWA 4GNXA 1PTOH 3D6WA 3CC7A 4X62Q 4LF7Q 5FLMG 4V190 1M1KC 1A6XA 2B2WA 1XTCD 1PH5A 1N33Q 4DR1L 2AMCB 4PZ6A 4A3KH 4JBKA 4DV5L 3I4NB 4ME3A 1UE1A 4PMBA 3OHXC 1EY4A 1Q90A 2JA5B 1OXUA 1SYEA 2XGTA 4J15A 4BY1G 1R4PB 4DV3L 5DLQE 4IUNA 3VDYA 2VZAA 4E6IA 4LFBL 2DUDA 1CKOA 2KHJA 2F3WA 4LF5L 4H02A 1TWGH 2F0FA 3KF8A 4LF8L 1A15A 2I5HA 1QOHA 2L4NA 1CKMA 2Q8IB 1JWUD 3F1ZA 1UAPA 2F0QA 1P16A 2BOSA 3WWVA 2EZVA 1G2TA 1QUQA 1S3OA 4OXPA 1VQBA 1Z9FA 2F0LA 4A3JG 4JI7Q 1Y8PB 3J81j 1D1IA 5EBCA 5LL6S 1S5DD 2N55A 4EX5A 1FNUA 4YHHL 4A3DG 2N49A 1YHQA 5ELDA 1X65A 4UDUC 1YI2A 2NWGA 1B1ZA 2Z4IA 4DR5L 1Y1VB 5FOBB 1WTRA 4EQ5A 3JAML 1EQQA 5GADC 4WRDA 4UHVA 1T5XD 1WYDA 4A3BH 1E1OA 5FO7B 2FFKB 2SEBD 1VS0A 4K8IA 5M3MB 3QO2A 1PLFA 4RGTA 3CHBD 2E74C 1VQHA 4IUUA 1PDQA 2B2VC 5M5YH 2F1MA 1STGA 1A8VA 3TP6A 3BDLA 4Q5VA 2D0OA 3FMCA 2CH4W 4FF2A 4K0KQ 3HOXG 1VQOA 1BCPF 1NMGA 4QMGA 1JICA 4J6HA 1E2ZA 4ILWA 2Y0SB 1HNWL 2EYHA 2JA8G 2OTLA 3K5MA 2B3GA 3TSSA 4OL7A 4HJ5A 3QWNA 3RZDH 3R93A 2RDHA 1M8AA 4X65L 3I7FA 3P20A 1S4ZA 2PI2E 1PH3A 1DXMA 3CPWA 3FVQA 2JXMB 3KJPA 3DM1A 4DV7L 3S17H 4F87A 3VYTA 4XIGS 1SNMA 2QGQA 2CVRA 4OWWB 4Y7NB 1E7ZA 1KQSA 4IQZA 5E3FA 1WTWA 4XTCS 1RL2A 4L5SA 4TVAB 5G3LD 2HUGA 3I4MG 1SFOH 2D0PA 2PZUA 4S3SA 1EY8A 2VUMB 1B53A 1WTVA 4ZKCB 3A8KE 4HCSA 1Z6HA 4KN4C 2EVBA 4BBRH 5EGTA 1LT3D 1HNXQ 1ASYA 2HIVA 2JA7B 5COYA 3MXNA 4DV2Q 3CCRA 1KLGD 4CKCA 1HA5A 2HDMA 3U50C 1WTPA 2DGYA 4PMCA 3W5OA 1QVCA 3VR3A 1II3A 5C3EH 1DONA 2NVYH 3MZ5A 1VQMA 4DR4Q 1MBYA 3SHLA 4DAMA 1OXTA 1TXYA 3J7ZC 4LMQD 1F2LA 2IL8A 3I72A 4I7AA 4O2DA 1LM0A 2F0IA 5EKIA 4A3FG 3F2DA 5IP9H 4RHSA 5IYBG 1H9MA 2DY8A 4B9WA 3DWQA 2R7DA 2R7ZB 3FKIB 1TVXA 4JBJA 1EEFD 2CFMA 1I94L 3L2PA 4FXDA 1JWMD 4BBSB 4YY3L 1Q8IA 5LMNQ 5D3DA 2F3VA 4QUFA 1RDPD 2UU9Q 4ULLA 3GTJB 3S1QB 3C2PA 4KJNA 2NTTA 2Z1CA 4JCVE 4P74A 3C1EA 3V96A 2L11A 1WTHA 3WOEA 4A3IG 3QR8A 4FXGC 3I3CA 4B08A 4FF1A 5DNFA 1TWCB 4HJ9A 2Z4HA 3VR4A 5IWAL 1YIJA 4ZK9B 2XN9C 2Q8TA 4DUZQ 4POGA 2NUCA 3RLOA 2EY5A 2ZXPA 4PZ7A 3KF6A 4BY1B 2EOTA 3L0OA 5FLXL 3VR5A 1H9JA 1WD1A 4A3LG 4GOPA 1JR0D 3RLNA 1DYQA 3WDNA 3MA2B 3JAME 1OXXK 1WTQA 3EROA 3S1MH 3CQZH 1EIYB 2JSOA 3RR5A 3GTQH 2QCPX 4DV6Q 3CKIB 2EY2A 2JP1A 2R93G 3M4OH 1VQCA 4B3RQ 3U9OA 4EQPA 4IPDA 2VQEQ 1XPRA 5EPLA 1BBUA 3K57A 5LMNW 3MXGA 3LWEA 4JI2Q 1MJEA 4LF4Q 4UY8C 1C8CA 1XX8A 4IJHA 5LL6X 2DNCA 1NR2A 4U68A 4DR7Q 3NBHA 4HR7B 1ONLA 5IE8A 4RCOA 3H0GH 2EY1A 2V1CC 3OIQA 1BKBA 1NMFA 5DAUA 4R8NA 1CZWA 3TREA 3SDZA 4MIUA 3IFDA 1HXYD 2EJFC 1PRTB 3PF4A 1U4RA 2MNAA 4GLVB 3NTKA 3OMCA 1ICWA 2D2CC 3H3VH 3CCJA 1RTNA 2F52A 3BZKA 1JJGA 1HNZQ 1TKWB 1NY4A 1KXLA 4IO9A 1PH8A 1VQ7A 2E2HB 4PQXA 3EJIA 5CV6A 5BR8L 5GQOA 4A3KG 3K6OA 1O7YA 1OO9B 1B8AA 4MNOA 1Q3LA 4XDXA 1S72A 1VQ6A 4WJ3M 3SVMA 3S14H 3A55A 4BXXG 3TP5A 2IT1A 3ZYYX 1XNRL 3GTKH 4TKOB 2R3ZA 1B44D 3K5LA 1IBLQ 1VMCA 3J7AV 2ZJPA 5IOCA 3NQIA 2BE5C 4DAYA 2Q2TA 3I4OA 5JJIA 1QILA 2WV6D 4IUPA 4IOCA 3DEOA 5CR3A 1A62A 2WAQE 4HIMA 1TY0A 1BXTA 3L7ZC 1FL0A 3JAMi 4NDXA 1M90C 2A69D 3LGJA 3GTMH 1IHZA 4C3IG 5FO8B 3PMFA 1GJXA 4ZLTF 3I4MB 2RCNA 1R9TB 3CCEA 2B2UA 1U4MA 1I4RA 4ZRZA 2K5QA 4JI6Q 5C0XG 3ND9A 1L1OA 1JMCA 5K36H 3M7NA 4OEMB 4QB4A 5FLXc 2NVTH 2BCOA 4NXML 1BCPB 1QG7A 4C3JH 4F7XA 3CPFA 1QNKA 1EY7A 5EPJA 4IN3A 1X3PA 2LMCB 3K81C 4MHEA 1HHVA 2XTIA 1LTID 4JI8L 1X6OA 1X54A 4OWXB 4C2MH 1CKNB 3DXJC 4JI3Q 2OTJA 4DAPA 4JYAL 1JB7A 1ZYRD 1Q86C 2KCCA 2I0QA 3AMUA 5IYDG 1I4QA 2K1BA 4LFAQ 4C1NI 4KKUA 1HH2P 2EIFA 3ZJYC 3H91A 3LX0A 4FO2A 3G6EA 4OWTB 2R92H 4GKKQ 5EKLA 2RHSB 2H5XA 1LTBD 5IODA 1L0YB 1W6JA 1G291 4GNXB 1G8ZD 3VYSA 3ERQA 1VQPA 4ZAIA 3MVVA 3J81L 1BUVT 1PVOA 3CCMA 4AYBE 1KAWA 5JEAG 1PH4A 1A3TA 2AWOA 1CUKA 2R61A 4DV1Q 4B3SQ 1IYJB 3HOWH 1F2ZA 5H1SE 1Y8NB 3I4NG 4KV6A 5M3FH 3K5OA 2QILA 1WJJA 1KDCA 2JA5G 3AFQA 4KHPL 2PNRC 2PI2A 1LTAD 3GTGB 4DR1Q 3KBXA 3A5UA 4DR2L 1N36L 1QZGA 2G9DA 1I4GA 1PYSB 2JQOA 4DV5Q 3M3YB 1MHWC 1UE7A 2OXPA 2GA4B 5A35A 2NTSA 4DV3Q 5E4WC 4LFBQ 3I4LA 5BN5A 5J39A 1QUQB 2B2YC 1BCPD 1SXTA 4K14A 5C4ZA 2UXCL 4AH6A 2CWPA 4LF8Q 2B2TC 1WOCA 4HAEA 1LLRD 4OONA 1OTCA 1MKHA 3CMAA 1CQFA 2A1AA 3M9BA 5ELCA 5M5XH 1RHPA 2FHTA 3Q6SA 2PZWA 2TSSA 3K59A 1VMPA 1DOLA 5JJZA 1YJNA 1KAAA 4YHHQ 1PTOB 2EYFA 2HCCA 5M3MG 4DR5Q 1XTDA 3PV0A 3O13A 2M9VA 2EXZA 5IT9L 4DV4L 4A3KB 4FP5D 4DK1A 3K7UC 2WINB 3SK5A 3HOUH 4A3CG 3T53B 1W6KA 4C1NK 4G7OC 2VL6A 3CD6A 2A6ED 2Y0SG 1WI5A 3H3VI 3QB3A 4X3TA 4JBWA 1TWGB 1K3RA 1SNDA 2ZJQA 3N6RA 1RCVD 3P75A 4KKTA 1HNWQ 1KD1C 2ZTEA 4JOIC 3HP3A 1DZ1A 5EKKA 1YHAA 1LTSD 3KLWA 4JV5L 2NB0A 4X65Q 1AZQA 2RSNA 2A5HA 4OX9L 3CC4A 1C9OA 3NBIA 1ET9A 3MXUA 4C3IB 3J81c 3E0JA 4KY7A 1O7LA 3TEHB 4DV7Q 1UWVA 1TWAB 3IRBA 4OO1G 2HHHL 3V05A 2VS1A 5IGFA 4HIDA 1EUJA 1BO0A 3VYUA 3MXNB 4LF9L 2EE1A 1EYGA 2KBNA 1MGSA 2FINB 1BNZA 2QKIC 2VUMG 3NPPA 3RZOH 3S9WA 2EYOA 5FKAC 3I56A 2UXDL 3A7LA 4A3BB 2ID0A 2JA7G 3X3MA 3J81E 3EBEA 1SE2A 1Y14B 1FGUA 2EXDA 1XJVA 1LO5D 1MJCA 4QCLA 2CQAA 1AZPA 5GROA 4LWCA 3TBIB 5C4XH 3HOVH 1E1TA 1SYFA 1Q7YC 2Z6KA 1PTOD 4QL5A 1SE3A 1SN8A 1IKLA 3R2TA 1BF4A 4YWLA 2PNHA 1VF7A 1ZKOA 2OEOA 1EOTA 2R7ZG 2LFNA 3FKIG 3OYYA 3D3RA 4HJAA 3RZDB 2VY3A 3R2IA 4UP8A 1LT5D 4BBSG 5L37A 4ZCKA 2A6HD 2KJXA 3IL8A 4OIKA 5CV5A 3S2HH 3CW2C 3S17B 5C4JB 1HFNA 5ELFA 1STBA 1VQDA 1STEA 5LHY1 1I94Q 4L5QA 1YNXA 3C1FA 3ULPA 4YY3Q 1SJHD 4ID6A 2F0SA 1WVLA 3GTOH 1ML0D 3OWFA 2DN8A 1ESRA 1Q81C 1VQLA 1EU3A 3TS2A 3ONAB 1PRTF 3KF6B 1PZJD 2B63H 3ITPA 1B70B 1Q1BA 3IAYA 4QIWB 3TP8A 4GOPB 5JPMC 3W1BA 1Q12A 3G6JB 1TR5A 2HDLA 3AYHB 1U4PA 5IT9c 5E1FA 1X3QA 3HFZB 1B9NA 4BBRB 2CW0D 2AQ1B 5IWAQ 3A5ZB 3K7AH 3H15A 1V8QA 2Q8RE 4FXKC 5KNBA 4UP9A 4A3EH 4DV0L 2EJGC 1G51A 1SNCA 2NVYB 1I50H 3BJUA 5T1GA 1CTMA 1LT6D 1NUCA 1XNQL 4QQBX 2VB2X 4L6TB 3D6CA 3PO2H 1VF5C 3NBHB 1CT1D 1IBML 2RHQB 1GM5A 4G7HC 5IT9E 4QJFA 2MFIA 1YJWA 4AQYL 3K58A 1PH7A 2LSSA 3J81i 2OF1A 1O80A 3KLRA 4ODGA 4N9PA 2K01A 4A93H 2JA6H 3F8TA 4F88A 1YVCA 1SYBA 2BA1A 3ER0A 2UUBL 3BU2A 3TDQA 1SMYD 2PW7A 1F9RA 1GUTA 4WFN3 5CMDA 3LWUA 4RGNA 1WCMH 3U9SA 3A8IE 4KLKA 4N8X1 4IFDI 2BH2A 3I90A 3I55A 3A7AB 3CXCA 1Y1WH 4XT1B 4DK0A 5IP7H 5JJLA 3T1YL 5IYCH 5C6AA 1HRJA 5EJWA 2B29A 2RDGA 2IWHA 2K28A 3Q24A 1AFPA 2EPBA 4DAYB 1UUPA 3TRZA 1N9WA 1PH2A 5FJ8G 3SEBA 5BR8Q 3GTQB 4N9TA 1JE4A 2XSCA 2A8VA 3M4OB 3SK4A 1B50A 5I4DA 1EZ8A 4ZYSA 2NZHA 3U58A 1JORA 2QDBA 3PO3H 4PZ8A 1XNRQ 1O78A 4O42A 2XWJB 1EIHA 2SNMA 2ZTCA 3KK7A 3H94A 4R4OA 1K83H 1B3AA 2I5MX 1MI2A 1HFGA 1GKHA 1HJPA 1V1OA 4NXNL 2F4VL 1V1QA 4IFDG 1V9PA 3CCQA 5C5LA 4O1NA 3V2TA 4YWKA 1L1OB 4CJ2C 1NR4A 5KEEA 4TRDA 2WIIB 3KDFA 1PA6A 1A2UA 4CHTB 2Z8LA 3N52A 4HTHA 1KDAA 5M5WH 1NTGA 1O7IA 3NWTA 2F0HA 4KMUC 4DNIA 3NELA 1HZCA 1S5CD 2YTYA 2X6GA 4K8JA 5BN3A 3HS0C 4NXMQ 3CCSA 3A0JA 4QF4A 1LV9A 2VXWA 1X3GA 3W2DA 2VQFL 2K14A 4JI8Q 5BN4A 2L9HA 5C44G 2KUMA 2E2DC 1E22A 5D3IB 2K04A 5ELNA 4JYAQ 1EQVA 3DWAA 1PZID 2K4KA 2M00A 1S5FD 3AU7A 3I2ZA 4FYDA 4A3GG 5CV9A 1HZBA 1YNND 3HOYB 4K5XA 4G57A 4NP5A 3JAMc 3SK8A 4APVA 1JJ2A 4GNXC 1EY9A 1D5XC 3UDGA 2UUCL 4X3KA 3GTMB 4IUVA 3I8ZA 5F2DA 3PIO3 1LTGD 1EFID 3S2DH 2B2WC 3OWEB 2NVQH 2G9HD 5KIXA 4R4IA 1Y1VH 2D5DA 1CA5A 3SE0A 1PTOF 2A6EC 2ES2A 2I46A 1EFWA 3HRZC 2N78A 2R6GA 2NVTB 1E2WA 2JYOA 1G91A 4C3JB 5KNCA 3FPUB 1IL2A 4BY7H 3OOCA 2IPKD 4UAIA 3DWPA 4JI4L 2JEBI 3M4YA 4KHPQ 5CYUA 1PXUA 2A74C 1K8MA 4IZ8A 1N36Q 4DR2Q 3I70A 2NYZD 4B3ML 1KHIA 5J22A 3HGBA 2PQAA 5C0XJ 1B9MA 1XPOA 1F2MA 1SEBD 1PFBA 4R4CA 4HJ7A 2F0JA 3D4WA 3HEJA 3TMEA 4CDFC 4X6AH 1JJCB 5IGCA 2ZM6L 2MPMA 3HOZG 3QOJA 4JI7L 2R92B 4X3UA 2B2YA 1VCIA 3TS0A 2L15A 2KOLA 2UXCQ 1ZEQX 2RVLA 1GUGA 2MQHA 1EYCA 4KJOA 5IGBA 3EQLC 3T16A 1C0AA 2NN6H 3GQBA 2ALYB 2X6LA 3J7YW 2IY5B 3D31A 2E2IH 4P72A 3EFXD 3E9HA 1W2BA 1CSPA 1OXSC 3MC0B 4PMWA 1SLJA 2RDFA 5IGGA 2P5ZX 2FMMA 1YITA 1CQVA 1PFSA 2LS01 3HOWB 1HTLD 1NBWA 4RGOS 1GVPA 3U4VA 4KY6A 5GAGC 1UE6A 5KRUA 3E9IA 4HMJA 1A63A 1QE6A 4FNFA 2BDOA 4JBMA 5M3FB 3M85A 3MFGA 1N34L 4DK3C 2F0VA 4JVZA 3DLLA 1S40A 2XRQD 3T56B 4C3HH 3CC2A 4DV4Q 4JI0L 5IGDA 2A6HC 1HUNA 5JEAJ 4AYBG 4JC0A 1K73C 2A68D 2KQ3A 4K6LA 2L12A 2A73B 1DGSA 1MSGA 1UE5A 1TQOA 4RMFA 2Z0SA 3PUYA 4DGZA 1HA6A 4POFA 1YJ9A 5AFWA 1EWIA 5C5MA 3S1RH 1IW7D 1XXGA 2WKCA 4A3MH 4RKBA 1HR0L 1HUMA 5EPKA 4JOIA 5IY0A 3VA5A 5M5XB 4DR6L 4JV5Q 3SXHA 3R3OA 4OX9Q 2CW0C 2F0NA 3CCVA 1T5EA 2TMPA 4DXFA 2OCEA 3GD7A 2HHHQ 2IX3A 4HIKA 2MP1A 5FLMH 1I6VC 4A3BG 4N8FA 3EN2A 1EIGA 3OTOL 1JOKA 1TWCH 1PRTD 4LF9Q 4NB3A 1L2FA 1EZ6A 1F9PA 3HG9A 3HKZE 4ALPA 1Q82C 2UXDQ 3KBGA 1VQJA 2QA4A 1TU2B 2KECA 2NVXB 1TWFH 3UDFA 2AKWB 1EYAA 4IALA 1STNA 2VNUD 4U673 4HN7A 5HY6A 3NEMA 4FF4A 1EOVA 3CRKC 4JI1L 1ICFB 1A0IA 5C44B 2BA0A 4EVOA 4JI5L 1SNQA 3FPPA 4GKJL 4IOAA 1ESFA 1JOOA 2K7VA 1SMYC 3FP9A 1HQMC 1I6HB 2DY7A 1WD0A 1JWSD 5IIFA 1NE3A 1JE5A 4I7ZC 2DNEA 4A3GB 3K0YA 1U9RA 5NUCA 4O0AA 1EL0A 4A3JH 1VQNA 3GTPB 3GDEA 2PMZE 4X66L 4G7ZC 1XMQL 2RA4A 4A3DH 1TT2A 4LK1C 1ET6A 1WFQA 4JPBW 3WOFA 4CDDC 4QGUA 2AUJD 1CFMA 3CU7A 4YIJA 4DKAC 2LXJA 2K75A 3RZOB 2WB1E 1SYDA 1RF2D 2WAQB 2F0KA 4BBRG 4GOPC 3OPOA 3J80L 1LT4D 3MWYW 3VR6A 1SAPA 4CBVA 1IYUA 1EQTA 1KRSA 3PGZA 1EY5A 1JB3A 5C3EG 1J6QA 2IX1A 3HOXH 1IYVA 4LNQA 1XWEA 4DK6C 4Y52H 5C4XB 2MO1A 3HOVB 4K2KA 2K5HA 3RLFA 2CQOA 3UDIA 4LF5Q 2JA8H 2O5IC 3ICEA 1AH9A 4DV0Q 3OMGA 5IP9G 1KTKA 1FJGL 1XMOL 4IPHA 2XIWA 1XNQQ 5FK9C 1EYDA 3HOZB 5DEHA 1IBMQ 3K8AA 5DM73 4F8MA 2HCIA 4P2CB 3TQYA 3KOJA 4AQYQ 4DNTB 3I73A 1AW7A 3S2HB 1MD2D 1A2TA 1IZ6A 4FDBA 1V43A 3MXPA 4R9WA 1TS3A 4MTNA 2OQ0A 2Q2HA 1PV4A 2UUBQ 3GTOB 3SK6A 1E2VA 1EEID 1VQAA 3QOLA 2F0GA 1R9TH 4NPSA 4M8AA 4DA2A 5JJKA 5D65A 1SYCA 3TP7A 4ZUIA 5J3BA 2HIXA 3CAMA 2NN6I 2V4DA 2WP8J 2LKVA 3S1NH 4P73A 2F0TA 1B2TA 2B2VA 4OIJA 3K7AB 3T1YQ 4BA2I 2MUYA 3I91A 3URYA 1MSHA 4AYBB 4IUQA 2JJQA 4HJ8A 1JT8A 2HQEA 2LY7A 1QNUA 4A3FH 3LNNA 3PO2B 3KUPA 2XNAC 5IYBH 4LF6L 3MAQA 2HQLA 1RIPA 1TS5A 2K32A 1C4QA 3D8GA 3RN5A 4CGYB 3PIOA 3KDFB 1SYGA 3MTSA 3H0GG 2O4XA 1HQRD 1JQYD 4A93B 2JA6B 1AEXA 1TWHH 1KNEA 3K0XA 2KCNA 1QVFA 3CCUA 2B2UC 4A3IH 1Q46A 2F4VQ 1K8AC 2K52A 5HGTA 1FD7D 1L1OC 1ASZA 1VQ9A 1AP0A 2XWBB 1DM0B 1LUZA 3OW2A 1H9SA 3CP0A 3NXWA 2KCTA 2KENA 4KHVA 3T4AC 1SRUA 2ZT9C 5M5YB 1Y1WB 4DR3L 4GZYC 4R4QA 3NSWA 4LFCL 4A3LH 2PQEA 2F0MA 1UEBA 5TSSA 1S5ED 3F2CA 4RHRA 3BG3A 2EYMA 2SOBA 3VYRA 4BS9A 1BOSA 1ENCA 3T1HL 4KD3A 5DM63 1VQKA 1N32L 1FGBD 2R93H 2KEDA 4NMZA 3J80E 5C3XA 1TS4A 4TQUS 1GUNA 2K50A 2MO0A 4J1MA 4KKSA 2VQFQ 3PO3B 4Q0FA 2SDFA 1D2BA 4Z9CB 4KY5A 1TY2A 1AE2A 1K83B 3QG1A 1EU4A 4XT3B 4H0LC 1YEZA 1J8IA 4R1JA 1VQFA 2QEJC 5CC4A 2AWNA 3NK9A 5CV8A 2RCFA 2BE5D 1SFOB 3GV6A 2E75C 1SDFA 2EY6A 1DJRD 1KLUD 1D6EC 2FJ2A 5KYIA 2Y0SE 2UUCQ 1QJOA 2YV5A 4DUYL 5K36G 3Q23A 5M5WB 3Q8DA 1BQQT 3E6ZX 1WTXA 1SBBB 5KGUA 5GAHC 4C3JG 4RCNA 5C3EB 2A68C 2DJFC 2K33A 4IFDJ 1DCZA 3BYTB 4GS3A 2PQAB 5EBDA 3GTLH 3E3XA 2OQKA 2IX0A 4BXXH 2L5TA 3RUZA 2A69C 4JI4Q 5I2XA 3UE0A 1IW7C 1EY0A 4RH6A 1HZ9A 1LTTD 1OXVA 4WORA 5T1IA 1D8LA 3HZXA 2E5LL 3HKSA 4B3MQ 1SSOA 1J9OA 1EWCA 1SJED 2R92G 4A76A 1VQEA 1BR9A 1A3VA 3H6MA 3S15H 2IJ0A 3L3OC 1G6PA 1H9RA 5J1ZA 5E4XA 2ZM6Q 2PZTA 3ULJA 4C3IH 1PRTC 5JVG3 1TWAH 1YZ6A 3J80i 1IL8A 1GXDC 3S2DB 2BDNA 5C0XH 2NVQB 4EQNA 1E3PA 2C9OA 3HOWG 1ZYRC 4RWSC 3AEVA 3DM3A 3BDCA 1KC8C 1M4VA 4M1UB 5M3FG 3D4DA 5EQ0A 4DF7A 3BDOA 1MIUA 3C46A 1I3QH 2YU9H 1J5EL 5LMUL 2RBMA 3S1MB 3CQZB 3TZDA 1UNSA 3A74A 3OIPA 4GLXA 4BY7B 2KVMA 1HPCA 2CH4A 3KYHC 2E2JH 4CKEA 3PQIA 2EJMA 1IBKL 2NZ1D 1SMXA 1N34Q 3U4ZA 5I6YA 1C48A 1QB5D 2O5JC 5IYDH 1S5BD 4JI0Q 5JOBA 3F2BA 2FXQA 4PNYA 4PG3A 4LUVA 1GHKA 3IFTA 5CORA 1U0LA 3H0GB 3A54A 1LABA 4X3SA 2KHIA 3MFYA 1A3UA 2CWAA 2ICEC 2KEEA 3DHQA 5C4JH 5ELEA 3PSIA 3NENA 4FF3A 1FNWA 4ZQ3A 4XQNA 4B9XA 4XYOA 4IPCA 5ELOA 2Z6BA 4H7BA 3E0EA 5JEAH 2EDGA 1HR0Q 4DR6Q 3KJOA 2QDLA 2E2IB 1CA6A 2UUAL 3DUZA 4YCWA 4ZKBB 2M2LA 2YTVA 2C5CA 3NHHA 4LJZC 3CF5A 3STBD 3PUVA 3I4NH 1BCPC 4OELB 3BZDB 2JA5H 3NTHA 1PH6A 2OWOA 5KNDA 2RF4A 4H44C 2N8NA 3OTOQ 2HD3A 2R7FA 3L9AX 3HOUG 2E8GA 4X64L 2Z6KC 5AJ3L 3S14B 2VB3X 1V1PA 4PV1C 2PPBC 2UXBL 4C3HB 3FEWX 3GTKB 1LYLA 3UE1A 4OHJA 3IKJA 4B3TL 1JCKB 3GO5A 2AQ2B 1X3EA 2ENBA 2I5LX 1I4XA 2BH8A 4JW0A 4JI1Q 2PW5A 4LUOA 1L0WA 1L0XB 4JI5Q 3AQQA 2MHVA 4GKJQ 3PUZA 3W1GA 2J0TD 1CZGA 1Y69U 2K03A 4L63B 3S1RB 1HR0W 1FVIA 1EY6A 2RQXA 3G48A 3J7A5 4A3MB 1LACA 1B4OA 2I07B 4L5TA 1ILPA 4X62L 1X9NA 4LF7L 3RN2A 4X66Q 2A19A 1N33L 3J7AF 1XMQQ 3OSOA 3M4PA 3EA6A 1KNAA 1K28A 3S16B
chains in the Genus database with same CATH topology
1UEAB 3TN2A 3NUCA 5JVH3 2E76C 2X69A 2H4OA 1CHQD 4NW2A 1LTRD 4HSPA 1XYIA 5I6WA 4ZUJA 4C2MB 1TWFB 2PCFB 4J8QA 5ELBA 2F0OA 1FR3A 2PYKA 3FRPB 1FNVA 3MEHA 1CM9A 4DN4M 4KI0A 3GP7A 1D5ZC 1D5MC 2K5DA 1ZXTA 4KD4A 2XRSD 3W3AA 4JK1C 1F9QA 2O2LD 5A2QL 3VR2A 5HURA 4RA8A 3NTIA 2B2TA 4A3JB 3BVGA 1DOMA 4BA1I 3Q0AA 4OO1H 2QF7A 4A3DB 4MN3A 1QCBD 1YNJD 4K6DA 4CJ1B 1PTOC 2L0CA 4I65A 1PYWD 4DFAA 1FYCA 3AB9A 1KDBA 1Z47A 1HTPA 1E0BA 1RTOA 2MGSA 3Q22A 2EYLA 3M7GA 4NKLA 1ENFA 2J4XA 2H1EA 5C0XI 5M9OA 3HOXB 3TZUA 2AQ3B 2J7ZA 2JA8B 1U4LA 2MJ8A 3SR1A 4L8JA 4K2LA 3UI2A 4DU9A 1CHPD 2WACA 5CGKA 4HCEA 1G6ZA 1DOKA 1Q1EA 1CI3M 3FDTA 2D9UA 2K6AA 3DMUA 4K5VA 1TIID 2OT2A 1H9SB 1RJTA 4QUCA 1RKNA 5JAVA 1PFNA 3R8BA 4XYQA 1HCZA 3BS1A 2F4IA 2B8FA 2F0EA 2K05A 3BVZA 3PUXA 4K5WA 5CBEE 3HOUB 2AUKA 4OGQC 4BWGB 4TSSA 1Y8OB 3S1NB 3QJYA 3NWSA 4HSVA 5I2YA 1X32A 1KABA 3A56A 1F77A 5KYLA 1NCVA 4RAUC 4CJ0B 5CV7A 4C56C 1JOQA 2JE6I 4A3FB 5D14A 4HEDA 5FLXE 3BYYB 5CV4A 4CKBA 3RD4A 3G7LA 1STAA 1DD2A 5G3LF 2D62A 1TWHB 3F2UA 1QWYA 3BVMA 1TS2A 3ND8A 4A3IB 5A2QE 3RMHA 5ISRA 2KHSA 4FVMA 4IUTA 2RSOA 3EVQA 4KK7A 2IW3A 3KLSX 4G4KA 3E5SA 3K5NA 1ILQA 1H9KA 1SNOA 5CBAE 2YYZA 2F0UA 1GUOA 1D1KA 5C3WA 2F0WA 1K8OA 2R93B 1BBXC 1IKMA 3HKZB 1GOZA 4XQQA 5IGEA 4HMIA 3OW7A 1I4HA 2CHBD 4IFDH 1F2YA 2ZXRA 4XXEA 2L55A 2B63B 3NE5B 1GUWA 4KHZA 5I9OA 1WTOA 2EYJA 4RGMA 3PUWA 4EQOA 3NQTA 1PMRA 4LAAA 1RD9D 4KTAA 3CRLC 4OO1I 2F03A 1SE4A 2PMZB 2EYPA 3P7JA 3T13A 4A3EB 4XQJA 3QIAA 1I50B 1R4QB 2ZXOA 3GTLB 3DEPA 1YNNC 5FO9B 1PFMA 4EGVA 4RKLA 3KLSA 1Z7TA 1NSNS 1GHJA 2WB1B 4H13C 1CK1A 3T51B 5C4HA 1STHA 4ME5A 1STYA 2NBFA 1NAPA 1BDOA 1VDZA 3S15B 2KA7A 2FMCA 2L1BA 2WKDA 1WCMB 1SNPA 2NN6G 1JC7A 2ICIA 1F9SA 1PZKD 1AN8A 5I9PA 3X3NA 1O7ZA 4DNRB 3MHBA 3PIP3 1V1PB 3H3VC 3D4RA 2PO4A 3P1HA 3NP8A 3GV3A 4DAVA 4KN7C 4ABNA 2F0DA 3H09A 1EWHA 1I3QB 2N88A 2YU9B 4V0BA 4R8IA 4C3HG 4DXGA 2E2JB 1ENAA 5K5PA 2K5WA 1RODA 5JPNC 4RFBA 2JEAI 4IURA 1GUSA 3C3LA 2B8GA 1YNJC 2RKSA 1I4PA 3A8JE 2XVSA 3VA7A 2F0PA 1G2SA 2SNSA 2B39A 4WJWA 1PTOH 3D6WA 4V190 1A6XA 2B2WA 1XTCD 3I4NB 4PMBA 3OHXC 1EY4A 1Q90A 2JA5B 1OXUA 1SYEA 1R4PB 4IUNA 4E6IA 2F3WA 2F0FA 3KF8A 1A15A 1QOHA 2L4NA 2Q8IB 1JWUD 1UAPA 2F0QA 2EZVA 2BOSA 1G2TA 2F0LA 1Y8PB 1D1IA 5EBCA 5LL6S 1S5DD 2N55A 1FNUA 5ELDA 4UDUC 2NWGA 1B1ZA 2Z4IA 1Y1VB 5FOBB 1WTRA 3JAML 4WRDA 1T5XD 5FO7B 2FFKB 2SEBD 5M3MB 4K8IA 3QO2A 1PLFA 4RGTA 3CHBD 2E74C 4IUUA 1PDQA 2B2VC 2F1MA 1STGA 3TP6A 3BDLA 4Q5VA 3FMCA 4FF2A 1BCPF 4QMGA 1JICA 4J6HA 1E2ZA 4ILWA 2Y0SB 2EYHA 3K5MA 3TSSA 4OL7A 3QWNA 3R93A 2RDHA 1M8AA 3P20A 1S4ZA 1DXMA 3FVQA 2JXMB 3DM1A 4F87A 3VYTA 4XIGS 1SNMA 2CVRA 4Y7NB 4IQZA 5E3FA 1WTWA 4XTCS 5G3LD 2HUGA 2PZUA 4S3SA 1EY8A 2VUMB 1B53A 1WTVA 4ZKCB 3A8KE 4HCSA 1Z6HA 4KN4C 2EVBA 3HOYB 5EGTA 1LT3D 3S16B 2JA7B 5COYA 3MXNA 1KLGD 4CKCA 1HA5A 2HDMA 1WTPA 4PMCA 3VR3A 1II3A 1DONA 3MZ5A 1MBYA 3SHLA 1OXTA 4LMQD 1F2LA 2IL8A 3I72A 2F0IA 5EKIA 4RHSA 1H9MA 2DY8A 4B9WA 3DWQA 2R7ZB 3FKIB 1TVXA 1EEFD 4FXDA 1JWMD 4BBSB 1Q8IA 5D3DA 2F3VA 4QUFA 1RDPD 4ULLA 3GTJB 3S1QB 3C2PA 4KJNA 2NTTA 2Z1CA 3C1EA 3V96A 2L11A 3WOEA 4FXGC 3I3CA 4B08A 4FF1A 5DNFA 1TWCB 2Z4HA 3VR4A 4ZK9B 2XN9C 2Q8TA 2NUCA 2EY5A 2ZXPA 4BY1B 2EOTA 5FLXL 3VR5A 1H9JA 1WD1A 1JR0D 1DYQA 3WDNA 3MA2B 3JAME 1OXXK 1WTQA 3EROA 2JSOA 2QCPX 3CKIB 2EY2A 2JP1A 3U9OA 4EQPA 5EPLA 3K57A 3MXGA 3LWEA 1C8CA 1XX8A 5LL6X 2DNCA 1NR2A 4U68A 3NBHA 4HR7B 1ONLA 4RCOA 2EY1A 3OIQA 5DAUA 4R8NA 1CZWA 3SDZA 4MIUA 3IFDA 1HXYD 2EJFC 1PRTB 1U4RA 3NTKA 3OMCA 1ICWA 2D2CC 1RTNA 1TKWB 2E2HB 4PQXA 3EJIA 5CV6A 3K6OA 1O7YA 1OO9B 4XDXA 1Q3LA 3SVMA 3A55A 3TP5A 2IT1A 3ZYYX 4TKOB 2R3ZA 1B44D 3K5LA 1VMCA 3J7AV 5IOCA 3NQIA 2BE5C 4DAYA 1QILA 2WV6D 4IUPA 3DEOA 5CR3A 1TY0A 1BXTA 3L7ZC 4NDXA 2A69D 1IHZA 4C3IG 5FO8B 3PMFA 1GJXA 4ZLTF 3I4MB 1R9TB 2B2UA 1U4MA 1I4RA 4ZRZA 2K5QA 5C0XG 3ND9A 5K36H 3M7NA 4QB4A 2BCOA 1BCPB 1QG7A 4F7XA 1QNKA 1EY7A 5EPJA 4IN3A 1X3PA 2LMCB 4MHEA 1HHVA 1LTID 3DXJC 4DAPA 1ZYRD 2KCCA 3AMUA 1I4QA 2K1BA 4C1NI 4KKUA 3H91A 3LX0A 4FO2A 5EKLA 1LTBD 5IODA 1L0YB 1W6JA 1G291 1G8ZD 3VYSA 3ERQA 4ZAIA 3MVVA 3J81L 1BUVT 5JEAG 1A3TA 2AWOA 2R61A 1F2ZA 1Y8NB 4KV6A 3K5OA 2QILA 1KDCA 2PNRC 1LTAD 3GTGB 3KBXA 2G9DA 1I4GA 3M3YB 2OXPA 2GA4B 5A35A 2NTSA 5E4WC 3I4LA 5BN5A 5J39A 2B2YC 1BCPD 1SXTA 4K14A 5C4ZA 2B2TC 4HAEA 1LLRD 1CQFA 5ELCA 1RHPA 2FHTA 3Q6SA 2PZWA 2TSSA 3K59A 1VMPA 1DOLA 5JJZA 1KAAA 1PTOB 2EYFA 2HCCA 3PV0A 3O13A 2M9VA 2EXZA 5IT9L 4A3KB 4FP5D 4DK1A 3SK5A 2WINB 3T53B 1W6KA 4C1NK 4G7OC 2A6ED 3QB3A 4X3TA 4JBWA 1TWGB 1SNDA 3N6RA 1RCVD 3P75A 4KKTA 3HP3A 1DZ1A 5EKKA 1LTSD 2NB0A 1AZQA 2RSNA 2A5HA 3NBIA 1ET9A 3MXUA 4C3IB 3E0JA 4KY7A 1O7LA 1TWAB 4OO1G 3V05A 5IGFA 1BO0A 3VYUA 2EE1A 1MGSA 2FINB 1BNZA 2QKIC 3NPPA 3S9WA 2EYOA 5FKAC 3A7LA 4A3BB 2ID0A 3X3MA 3J81E 1SE2A 1LO5D 4QCLA 2CQAA 1AZPA 3TBIB 1SYFA 1PTOD 1SE3A 1IKLA 3R2TA 1BF4A 1VF7A 1ZKOA 2OEOA 1EOTA 2LFNA 3D3RA 3RZDB 3R2IA 1LT5D 2A6HD 2KJXA 3IL8A 4OIKA 5CV5A 3S17B 5C4JB 1HFNA 5ELFA 1STBA 1STEA 5LHY1 3C1FA 1SJHD 4ID6A 2F0SA 1WVLA 1ML0D 3OWFA 2DN8A 1ESRA 1EU3A 3ONAB 1PRTF 1PZJD 3ITPA 1Q1BA 3IAYA 4QIWB 3TP8A 5JPMC 1Q12A 3G6JB 1TR5A 2HDLA 1U4PA 5E1FA 1X3QA 1B9NA 4BBRB 2CW0D 2AQ1B 1V8QA 2Q8RE 4FXKC 5KNBA 2EJGC 1SNCA 2NVYB 5T1GA 1CTMA 1LT6D 1NUCA 2VB2X 4L6TB 3D6CA 1VF5C 1CT1D 4G7HC 5IT9E 3K58A 2OF1A 1O80A 3KLRA 4ODGA 4N9PA 2K01A 4F88A 1SYBA 2BA1A 3TDQA 1SMYD 2PW7A 1F9RA 1GUTA 4WFN3 5CMDA 3LWUA 4RGNA 3U9SA 3A8IE 4IFDI 3I90A 3A7AB 4XT1B 4DK0A 5C6AA 1HRJA 5EJWA 2RDGA 2IWHA 2K28A 3Q24A 1AFPA 2EPBA 1UUPA 3SEBA 3GTQB 4N9TA 1JE4A 2XSCA 3M4OB 3SK4A 1B50A 5I4DA 1EZ8A 4ZYSA 1JORA 2QDBA 1O78A 4O42A 2XWJB 1EIHA 2SNMA 3KK7A 3H94A 1B3AA 1MI2A 1HFGA 1V1OA 4IFDG 5C5LA 4O1NA 3V2TA 4CJ2C 1NR4A 5KEEA 4TRDA 2WIIB 1A2UA 4CHTB 2Z8LA 3N52A 4HTHA 1KDAA 3NWTA 2F0HA 4KMUC 1S5CD 2X6GA 4K8JA 5BN3A 3HS0C 4QF4A 1LV9A 2VXWA 3W2DA 5BN4A 2L9HA 2KUMA 2E2DC 5D3IB 2K04A 1EQVA 3DWAA 1PZID 2M00A 1S5FD 3AU7A 4FYDA 5CV9A 1YNND 4K5XA 4G57A 4NP5A 3SK8A 1EY9A 1D5XC 3GTMB 4X3KA 4IUVA 3I8ZA 5F2DA 3PIO3 1LTGD 1EFID 2B2WC 3OWEB 2G9HD 5KIXA 2D5DA 1CA5A 3SE0A 1PTOF 2A6EC 2I46A 3HRZC 2R6GA 2NVTB 1E2WA 2JYOA 1G91A 4C3JB 5KNCA 3FPUB 3OOCA 2IPKD 4UAIA 3DWPA 2JEBI 3M4YA 5CYUA 1PXUA 2A74C 1K8MA 4IZ8A 3I70A 2NYZD 5J22A 3HGBA 5C0XJ 1B9MA 1F2MA 1SEBD 1PFBA 2F0JA 3D4WA 3HEJA 3TMEA 5IGCA 2MPMA 3QOJA 2R92B 4X3UA 2B2YA 1VCIA 2KOLA 1ZEQX 2RVLA 1GUGA 1EYCA 4KJOA 5IGBA 3EQLC 3T16A 2NN6H 3GQBA 2X6LA 3J7YW 3D31A 3EFXD 1OXSC 3MC0B 4PMWA 2RDFA 5IGGA 2FMMA 1CQVA 2LS01 3HOWB 1HTLD 4RGOS 4KY6A 5KRUA 4HMJA 1QE6A 4FNFA 2BDOA 5M3FB 3M85A 3MFGA 2F0VA 2XRQD 3T56B 5IGDA 2A6HC 1HUNA 5JEAJ 2A68D 2KQ3A 4K6LA 2L12A 2A73B 1MSGA 1TQOA 3PUYA 4DGZA 1HA6A 5AFWA 5C5MA 1IW7D 1XXGA 2WKCA 4RKBA 1HUMA 5EPKA 3VA5A 5M5XB 3SXHA 3R3OA 2CW0C 2F0NA 1T5EA 2TMPA 4DXFA 3GD7A 2IX3A 2MP1A 1I6VC 1EIGA 1JOKA 1PRTD 1EZ6A 1F9PA 3HG9A 3KBGA 2NVXB 1TU2B 2KECA 1EYAA 4IALA 1STNA 2VNUD 4U673 4HN7A 4FF4A 3CRKC 5C44B 2BA0A 4EVOA 1SNQA 3FPPA 1ESFA 1JOOA 2K7VA 1SMYC 1HQMC 1I6HB 2DY7A 1WD0A 1JWSD 5IIFA 4I7ZC 2DNEA 4A3GB 3K0YA 1U9RA 5NUCA 1EL0A 3GTPB 4G7ZC 2RA4A 1TT2A 4LK1C 1ET6A 3WOFA 2AUJD 1CFMA 3CU7A 4YIJA 3RZOB 1SYDA 1RF2D 2WAQB 2F0KA 3OPOA 3J80L 1LT4D 3MWYW 4CBVA 1SAPA 3VR6A 1IYUA 1EQTA 1EY5A 1JB3A 2IX1A 1IYVA 1XWEA 5C4XB 3HOVB 4K2KA 3RLFA 2O5IC 3OMGA 1KTKA 2XIWA 5FK9C 1EYDA 3HOZB 5DEHA 5DM73 4F8MA 2HCIA 4P2CB 4DNTB 3I73A 1AW7A 3S2HB 1MD2D 1A2TA 1V43A 3MXPA 4R9WA 1TS3A 3GTOB 3SK6A 1E2VA 1EEID 3QOLA 2F0GA 4M8AA 4DA2A 5D65A 1SYCA 3TP7A 4ZUIA 2NN6I 2V4DA 2WP8J 2LKVA 2F0TA 1B2TA 2B2VA 4OIJA 3K7AB 4BA2I 2MUYA 3I91A 3URYA 1MSHA 4AYBB 4IUQA 2HQEA 2LY7A 1QNUA 3LNNA 3PO2B 3KUPA 2XNAC 3MAQA 1TS5A 2K32A 1C4QA 3D8GA 4CGYB 1SYGA 3MTSA 2O4XA 1HQRD 1JQYD 4A93B 2JA6B 1AEXA 1KNEA 2KCNA 2B2UC 5HGTA 1FD7D 1AP0A 2XWBB 1DM0B 1H9SA 3NXWA 4KHVA 3T4AC 2ZT9C 5M5YB 1Y1WB 4GZYC 3NSWA 2PQEA 2F0MA 5TSSA 1S5ED 4RHRA 3BG3A 2EYMA 2SOBA 3VYRA 4BS9A 1BOSA 1ENCA 4KD3A 5DM63 1FGBD 2KEDA 4NMZA 3J80E 5C3XA 1TS4A 4TQUS 1GUNA 4J1MA 4KKSA 3PO3B 4Q0FA 2SDFA 1D2BA 4Z9CB 4KY5A 1TY2A 1K83B 3QG1A 1EU4A 4XT3B 4H0LC 1J8IA 2QEJC 5CC4A 2AWNA 3NK9A 5CV8A 2BE5D 1SFOB 3GV6A 2E75C 1SDFA 2EY6A 1DJRD 1KLUD 1D6EC 2FJ2A 5KYIA 1QJOA 5K36G 3Q23A 5M5WB 1BQQT 3E6ZX 1WTXA 1SBBB 5KGUA 4C3JG 4RCNA 5C3EB 2A68C 2K33A 4IFDJ 1DCZA 3BYTB 5EBDA 2IX0A 2L5TA 3RUZA 2A69C 5I2XA 1IW7C 1EY0A 4RH6A 1LTTD 1OXVA 4WORA 5T1IA 3HZXA 1SSOA 1J9OA 1EWCA 1SJED 1BR9A 1A3VA 3H6MA 2IJ0A 3L3OC 1H9RA 5J1ZA 5E4XA 2PZTA 1PRTC 5JVG3 1IL8A 1GXDC 3S2DB 2BDNA 5C0XH 2NVQB 4EQNA 2C9OA 1ZYRC 4RWSC 3BDCA 1M4VA 4M1UB 3D4DA 5EQ0A 4DF7A 3BDOA 3C46A 2RBMA 3S1MB 3CQZB 3TZDA 1UNSA 3OIPA 4BY7B 2KVMA 1HPCA 4CKEA 2EJMA 2NZ1D 5I6YA 1C48A 1QB5D 2O5JC 1S5BD 5JOBA 4PNYA 1GHKA 3IFTA 5CORA 3H0GB 3A54A 1LABA 4X3SA 3MFYA 1A3UA 2ICEC 2KEEA 3DHQA 5ELEA 4FF3A 1FNWA 4ZQ3A 4XQNA 4B9XA 4XYOA 4H7BA 5JEAH 2EDGA 2E2IB 1CA6A 3DUZA 4ZKBB 2M2LA 2C5CA 3NHHA 4LJZC 3PUVA 1BCPC 3BZDB 3NTHA 5KNDA 4H44C 3L9AX 3S14B 2VB3X 1V1PA 4PV1C 2PPBC 4C3HB 3FEWX 3GTKB 4OHJA 3IKJA 1JCKB 3GO5A 2AQ2B 2ENBA 1I4XA 2PW5A 1L0XB 2MHVA 3PUZA 2J0TD 1CZGA 1Y69U 2K03A 4L63B 3S1RB 2RQXA 1EY6A 4A3MB 1LACA 1B4OA 2I07B 1ILPA 3J7AF 3OSOA 3EA6A 1KNAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NZ1 D;  2Q8R E;  2N55 A;  3TN2 A;  2DY8 A;  2MPM A;  3GV3 A;  5D65 A;  3HP3 A;  1DZ1 A;  2X69 A;  3N52 A;  4X3U A;  1BBX C;  1RJT A;  2B2Y A;  2KOL A;  4NW2 A;  2NWG A;  4XT3 B;  1TVX A;  1O7Y A;  5EKI A;  4XDX A;  5T1G A;  1Q3L A;  2RVL A;  1IKM A;  1WTR A;  2N88 A;  1J8I A;  1AZQ A;  2RSN A;  3SVM A;  1XYI A;  4QUC A;  4R8I A;  4QUF A;  1PFN A;  3GV6 A;  5COR A;  1B2T A;  2DY7 A;  1SDF A;  2B2V A;  2FFK B;  2X6L A;  4OIJ A;  1WD0 A;  2R3Z A;  3QO2 A;  2FJ2 A;  1PLF A;  1ROD A;  1VMC A;  2X6G A;  3I91 A;  1CM9 A;  4X3S A;  1BO0 A;  4DN4 M;  1MSH A;  1PDQ A;  4IUU A;  2B2V C;  3KBX A;  1EL0 A;  4IUQ A;  2K05 A;  1O80 A;  2KEE A;  2EE1 A;  5CBE E;  2L11 A;  1MGS A;  2FIN B;  1LV9 A;  2K01 A;  2VXW A;  1BNZ A;  2FMM A;  3I3C A;  1WTX A;  5DNF A;  4IUP A;  4IUR A;  3DEO A;  1ZXT A;  3KUP A;  2RA4 A;  1GUW A;  1WTO A;  1QE6 A;  1F9R A;  4ZK9 B;  2Q8T A;  2L9H A;  1F9Q A;  1JIC A;  2KUM A;  5E4W C;  5CMD A;  4CJ1 B;  4HSV A;  1X32 A;  2B2Y C;  2K04 A;  1CA6 A;  1NCV A;  4RA8 A;  1AZP A;  4ZKB B;  2EOT A;  2B2T A;  2M2L A;  1G2S A;  3MTS A;  4RAU C;  4ZLT F;  4CJ0 B;  1DOM A;  1WD1 A;  3R93 A;  1M8A A;  3I90 A;  3P7J A;  1S4Z A;  1U4M A;  2B2U A;  2B2T C;  1WTQ A;  1KNE A;  1HUN A;  5D14 A;  4HAE A;  4HED A;  4MN3 A;  3DM1 A;  2B2U C;  5T1I A;  2L12 A;  3MWY W;  1IKL A;  1SAP A;  3D6W A;  4XT1 B;  2JP1 A;  1EQT A;  1BF4 A;  1MSG A;  1HRJ A;  1EOT A;  1SSO A;  1J9O A;  2B2W A;  3DEP A;  1RHP A;  2FHT A;  2CVR A;  3G7L A;  4X3K A;  1PFM A;  3Q6S A;  4IUV A;  5EJW A;  1QG7 A;  3I8Z A;  5EPL A;  1AP0 A;  1HA6 A;  1VMP A;  3LWE A;  2B2W C;  1DOL A;  1QNK A;  5AFW A;  5EPJ A;  2K28 A;  5JJZ A;  1X3P A;  2EPB A;  1XX8 A;  1WTW A;  1C8C A;  4MHE A;  1E0B A;  1NR2 A;  3F2U A;  3IL8 A;  1HHV A;  4OIK A;  5E4X A;  4U68 A;  1CA5 A;  1RTO A;  2MGS A;  2HUG A;  1JE4 A;  1HUM A;  2HCC A;  5EPK A;  1HFN A;  2XIW A;  1B50 A;  1NAP A;  1B53 A;  1WTV A;  1WVL A;  2H1E A;  2JYO A;  4ZKC B;  4HCS A;  1G91 A;  1IL8 A;  1ML0 D;  1ESR A;  2BDN A;  3FPU B;  2K1B A;  5CBA E;  5COY A;  2L1B A;  3IFD A;  4O42 A;  4IUT A;  4UAI A;  2K03 A;  2HCI A;  3ONA B;  1EIH A;  4RWS C;  2MP1 A;  1A15 A;  2HDM A;  1U4R A;  2RSO A;  2J7Z A;  3H91 A;  1F9S A;  1WTP A;  1U4L A;  2KED A;  2L4N A;  2MJ8 A;  1EIG A;  1B3A A;  1DON A;  1B4O A;  1ILP A;  1MI2 A;  1HFG A;  5EQ0 A;  4R9W A;  3UI2 A;  2NYZ D;  1ICW A;  4LMQ D;  1F2L A;  2IL8 A;  1ILQ A;  1F9P A;  2HDL A;  4X3T A;  1G2T A;  1U4P A;  1DOK A;  3TZD A;  1G6Z A;  1PFB A;  3FDT A;  1X3Q A;  4CJ2 C;  1O7Z A;  1RTN A;  1NR4 A;  2D9U A;  4ZAI A;  2KEC A;  1KNA A;  2KVM A;  2SDF A; 
#chains in the Genus database with same CATH topology
 2WAQ G;  5M3M H;  1UEA B;  3TN2 A;  3NUC A;  5JVH 3;  2E76 C;  2X69 A;  2H4O A;  1CHQ D;  4NW2 A;  1LTR D;  4HSP A;  4A75 A;  1XYI A;  4A3C H;  5I6W A;  4ZUJ A;  4C2M B;  1TWF B;  5C4X G;  2PCF B;  4J8Q A;  3HOV G;  5ELB A;  2F0O A;  3B6Y A;  1FR3 A;  2PYK A;  3FRP B;  1EIF A;  1FNV A;  4UPA A;  3MEH A;  1CM9 A;  4DN4 M;  4KI0 A;  3GP7 A;  1D5Z C;  1QZH A;  1D5M C;  1KRT A;  2QEX A;  2K5D A;  1ZXT A;  4KD4 A;  2XRS D;  3W3A A;  4JK1 C;  3JC6 6;  1F9Q A;  2O2L D;  1FJG Q;  1XMO Q;  3HKZ G;  5A2Q L;  3VR2 A;  5HUR A;  4RA8 A;  4Y7N H;  3NTI A;  2B2T A;  4A3J B;  3BVG A;  4CDE C;  3KFU A;  1DOM A;  4BA1 I;  3Q0A A;  4R4T A;  4OO1 H;  2QF7 A;  2K5N A;  1AE3 A;  4A3D B;  2VW9 A;  4L5R C;  4MN3 A;  1QCB D;  1YBY A;  1K8G A;  4P71 A;  1YNJ D;  3PIP A;  4K6D A;  4YWM A;  2B63 G;  1HZA A;  1XPU A;  2VUM H;  4CJ1 B;  4HIO A;  1PTO C;  2L0C A;  3FHW A;  4I65 A;  1PYW D;  4DFA A;  3HOY H;  3S16 H;  3ULL A;  4UP7 A;  2JA7 H;  1FYC A;  2K5V A;  3AB9 A;  1KDB A;  1Z47 A;  1HTP A;  1E0B A;  4K0K L;  1RTO A;  2MGS A;  3Q22 A;  1VQ5 A;  2EYL A;  3M7G A;  4NKL A;  2NZO A;  1ENF A;  4A3E G;  2J4X A;  1K0R A;  2H1E A;  5C0X I;  3CME A;  1I5F A;  1GD7 A;  5EAY A;  5M9O A;  3HOX B;  2GVB A;  3TZU A;  2AQ3 B;  3D0F A;  3PO2 G;  2J7Z A;  2JA8 B;  2JN4 A;  1U4L A;  2MJ8 A;  3SR1 A;  2R7Z H;  4L8J A;  4K2L A;  3FKI H;  3UI2 A;  2WB1 G;  4DU9 A;  1CHP D;  2WAC A;  3EIV A;  5CGK A;  4BBS H;  4HCE A;  1K0S A;  1G6Z A;  1DOK A;  1Q1E A;  1CI3 M;  3FDT A;  4LF6 Q;  3ERS X;  2D9U A;  4A93 G;  2K6A A;  3DMU A;  2JA6 G;  4K5V A;  3GTJ H;  3S1Q H;  1D7Q A;  2LXK A;  4YCV A;  1TII D;  2Z9H A;  1KIX A;  2OT2 A;  2YTX A;  1K9M C;  1H9S B;  1IXR A;  1RJT A;  1WCM G;  4GN4 B;  4QUC A;  1RKN A;  4WJ4 A;  5JAV A;  1HNX L;  1PFN A;  3R8B A;  2IHE A;  4XYQ A;  4DV2 L;  4GN5 A;  1HCZ A;  3BS1 A;  2F4I A;  1Y1W G;  1PH1 A;  4BY1 H;  2B8F A;  2F0E A;  2K05 A;  3BVZ A;  3PUX A;  4K5W A;  5CBE E;  5IP7 G;  4DR4 L;  5IYC G;  3HOU B;  2AUK A;  4OGQ C;  4DPG A;  4BWG B;  4TSS A;  1Y8O B;  3S1N B;  2WFW A;  3QJY A;  3NWS A;  4DR3 Q;  2ZJR A;  4LFC Q;  4HSV A;  5I2Y A;  1X32 A;  1KAB A;  3A56 A;  1F77 A;  5KYL A;  1NCV A;  3UDX A;  1K3B C;  2JK8 A;  1SE8 A;  4YCU A;  4RAU C;  4CJ0 B;  5CV7 A;  1NNX A;  3SGI A;  3G4S A;  4C56 C;  1JOQ A;  2JE6 I;  5LMN L;  3T1H Q;  4A3F B;  1N32 Q;  2GVA A;  5D14 A;  3PO3 G;  2UU9 L;  4HED A;  4QY7 A;  5FLX E;  4GLA C;  3BYY B;  4MTK A;  5CV4 A;  2CCZ A;  4CKB A;  3RD4 A;  3G7L A;  1STA A;  1VQ8 A;  1DD2 A;  5G3L F;  2D62 A;  1TWH B;  1H95 A;  1Q8K A;  3F2U A;  1QWY A;  3BVM A;  1TS2 A;  3ND8 A;  4DUZ L;  4LUZ A;  4A3I B;  5A2Q E;  2ATW A;  2JA9 A;  1GO3 E;  3RMH A;  5ISR A;  2KHS A;  4FVM A;  4IUT A;  2G5D A;  2RSO A;  2C35 B;  3EVQ A;  2E2H H;  1VQG A;  4KK7 A;  2IW3 A;  1EQR A;  4DUY Q;  3KLS X;  4DV6 L;  1SRO A;  4GN3 B;  1CSQ A;  4G4K A;  4B3R L;  3E5S A;  3K5N A;  1ILQ A;  2AHO B;  3PF5 A;  1BVS A;  2VQE L;  1H9K A;  1E24 A;  3KF8 B;  1SNO A;  5FJ8 H;  4JI2 L;  5CBA E;  2YYZ A;  4LF4 L;  2F0U A;  1GUO A;  1D1K A;  5C3W A;  2F0W A;  1K8O A;  2R93 B;  2ZTD A;  2GN5 A;  4DR7 L;  1BBX C;  1IKM A;  3HKZ B;  1GOZ A;  4XQQ A;  2N3S A;  2Q2U A;  5IGE A;  4HMI A;  3OW7 A;  1I4H A;  2CHB D;  2ASB A;  2E5L Q;  4IFD H;  1F2Y A;  2ZXR A;  4XXE A;  2L55 A;  3I4M H;  3STB C;  2B63 B;  3NE5 B;  1B3Q A;  1X3F A;  3K80 C;  1GUW A;  4KHZ A;  5I9O A;  1WTO A;  3AFP A;  2EYJ A;  4RGM A;  3PUW A;  4EQO A;  3NQT A;  1Y1V G;  1HNZ L;  5E7N A;  1B7Y B;  1PMR A;  4LAA A;  1RD9 D;  1U5K A;  4KTA A;  1T9H A;  3CRL C;  4OO1 I;  1PH9 A;  2F03 A;  1SE4 A;  2PMZ B;  1X55 A;  1YHB A;  2QW7 A;  2EYP A;  3P7J A;  3T13 A;  4A3E B;  2EQS A;  4XQJ A;  3QIA A;  1I50 B;  1R4Q B;  4BY7 G;  1VQI A;  2NVX H;  2ZXO A;  3BZC A;  4IJL A;  3GTL B;  1IBL L;  3PCO B;  1J5E Q;  3DEP A;  1YNN C;  5LMU Q;  5FO9 B;  1PFM A;  4MZ9 A;  4EGV A;  4RKL A;  3KLS A;  1Z7T A;  1NSN S;  1GHJ A;  2WB1 B;  3RNU A;  5C44 H;  1PYB A;  1IBK Q;  4H13 C;  2F3I A;  1CK1 A;  3T51 B;  5C4H A;  4LW1 A;  3CCL A;  5GAE C;  1STH A;  4QIW E;  4ME5 A;  1STY A;  1I6H H;  2NBF A;  1PHJ A;  1NJI C;  1NAP A;  1BDO A;  4A3G H;  1BBW A;  1KL9 A;  1VDZ A;  3S15 B;  2KA7 A;  2FMC A;  2L1B A;  4NXN Q;  2WKD A;  3GTP H;  1WCM B;  1X56 A;  2CKZ B;  1LTL A;  1SNP A;  4JG2 A;  2NN6 G;  2HT1 A;  1JC7 A;  2ICI A;  1F9S A;  1PZK D;  4JI6 L;  1AN8 A;  5I9P A;  1P8L A;  3J80 c;  3X3N A;  1O7Z A;  4DNR B;  4RG1 A;  3MHB A;  3PIP 3;  1V1P B;  3H3V C;  3D4R A;  3M4Q A;  2PO4 A;  3P1H A;  3NP8 A;  2UUA Q;  3GV3 A;  3HOY G;  1C7Y A;  4DAV A;  3GTG H;  4KN7 C;  4ABN A;  2DJG C;  4IPG A;  1VQ4 A;  2F0D A;  3H09 A;  4P75 A;  1EWH A;  4JI3 L;  1I3Q B;  2N88 A;  2YU9 B;  4V0B A;  5HGQ A;  3M3Y H;  4AIM A;  4R8I A;  1SR3 A;  4C3H G;  1N8R C;  2KCM A;  4DXG A;  4LFA L;  3G71 A;  4A4I A;  2E2J B;  1ENA A;  4X64 Q;  5K5P A;  2K5W A;  5AJ3 Q;  1ROD A;  2IHF A;  5JPN C;  4RFB A;  2UXB Q;  4GKK L;  1QVG A;  1CKN A;  2JEA I;  4IUR A;  4B3T Q;  1GUS A;  3C3L A;  1W3S A;  3HOZ H;  2B8G A;  1YNJ C;  2RKS A;  1I4P A;  3A8J E;  2XVS A;  2Q2I A;  3VA7 A;  2F0P A;  4A3M G;  1G2S A;  3MEF A;  4DV1 L;  2SNS A;  4B3S L;  2B39 A;  4CDC C;  3S24 A;  4WJW A;  4GNX A;  1PTO H;  3D6W A;  3CC7 A;  4X62 Q;  4LF7 Q;  5FLM G;  4V19 0;  1M1K C;  1A6X A;  2B2W A;  1XTC D;  1PH5 A;  1N33 Q;  4DR1 L;  2AMC B;  4PZ6 A;  4A3K H;  4JBK A;  4DV5 L;  3I4N B;  4ME3 A;  1UE1 A;  4PMB A;  3OHX C;  1EY4 A;  1Q90 A;  2JA5 B;  1OXU A;  1SYE A;  2XGT A;  4J15 A;  4BY1 G;  1R4P B;  4DV3 L;  5DLQ E;  4IUN A;  3VDY A;  2VZA A;  4E6I A;  4LFB L;  2DUD A;  1CKO A;  2KHJ A;  2F3W A;  4LF5 L;  4H02 A;  1TWG H;  2F0F A;  3KF8 A;  4LF8 L;  1A15 A;  2I5H A;  1QOH A;  2L4N A;  1CKM A;  2Q8I B;  1JWU D;  3F1Z A;  1UAP A;  2F0Q A;  1P16 A;  2BOS A;  3WWV A;  2EZV A;  1G2T A;  1QUQ A;  1S3O A;  4OXP A;  1VQB A;  1Z9F A;  2F0L A;  4A3J G;  4JI7 Q;  1Y8P B;  3J81 j;  1D1I A;  5EBC A;  5LL6 S;  1S5D D;  2N55 A;  4EX5 A;  1FNU A;  4YHH L;  4A3D G;  2N49 A;  1YHQ A;  5ELD A;  1X65 A;  4UDU C;  1YI2 A;  2NWG A;  1B1Z A;  2Z4I A;  4DR5 L;  1Y1V B;  5FOB B;  1WTR A;  4EQ5 A;  3JAM L;  1EQQ A;  5GAD C;  4WRD A;  4UHV A;  1T5X D;  1WYD A;  4A3B H;  1E1O A;  5FO7 B;  2FFK B;  2SEB D;  1VS0 A;  4K8I A;  5M3M B;  3QO2 A;  1PLF A;  4RGT A;  3CHB D;  2E74 C;  1VQH A;  4IUU A;  1PDQ A;  2B2V C;  5M5Y H;  2F1M A;  1STG A;  1A8V A;  3TP6 A;  3BDL A;  4Q5V A;  2D0O A;  3FMC A;  2CH4 W;  4FF2 A;  4K0K Q;  3HOX G;  1VQO A;  1BCP F;  1NMG A;  4QMG A;  1JIC A;  4J6H A;  1E2Z A;  4ILW A;  2Y0S B;  1HNW L;  2EYH A;  2JA8 G;  2OTL A;  3K5M A;  2B3G A;  3TSS A;  4OL7 A;  4HJ5 A;  3QWN A;  3RZD H;  3R93 A;  2RDH A;  1M8A A;  4X65 L;  3I7F A;  3P20 A;  1S4Z A;  2PI2 E;  1PH3 A;  1DXM A;  3CPW A;  3FVQ A;  2JXM B;  3KJP A;  3DM1 A;  4DV7 L;  3S17 H;  4F87 A;  3VYT A;  4XIG S;  1SNM A;  2QGQ A;  2CVR A;  4OWW B;  4Y7N B;  1E7Z A;  1KQS A;  4IQZ A;  5E3F A;  1WTW A;  4XTC S;  1RL2 A;  4L5S A;  4TVA B;  5G3L D;  2HUG A;  3I4M G;  1SFO H;  2D0P A;  2PZU A;  4S3S A;  1EY8 A;  2VUM B;  1B53 A;  1WTV A;  4ZKC B;  3A8K E;  4HCS A;  1Z6H A;  4KN4 C;  2EVB A;  4BBR H;  5EGT A;  1LT3 D;  1HNX Q;  1ASY A;  2HIV A;  2JA7 B;  5COY A;  3MXN A;  4DV2 Q;  3CCR A;  1KLG D;  4CKC A;  1HA5 A;  2HDM A;  3U50 C;  1WTP A;  2DGY A;  4PMC A;  3W5O A;  1QVC A;  3VR3 A;  1II3 A;  5C3E H;  1DON A;  2NVY H;  3MZ5 A;  1VQM A;  4DR4 Q;  1MBY A;  3SHL A;  4DAM A;  1OXT A;  1TXY A;  3J7Z C;  4LMQ D;  1F2L A;  2IL8 A;  3I72 A;  4I7A A;  4O2D A;  1LM0 A;  2F0I A;  5EKI A;  4A3F G;  3F2D A;  5IP9 H;  4RHS A;  5IYB G;  1H9M A;  2DY8 A;  4B9W A;  3DWQ A;  2R7D A;  2R7Z B;  3FKI B;  1TVX A;  4JBJ A;  1EEF D;  2CFM A;  1I94 L;  3L2P A;  4FXD A;  1JWM D;  4BBS B;  4YY3 L;  1Q8I A;  5LMN Q;  5D3D A;  2F3V A;  4QUF A;  1RDP D;  2UU9 Q;  4ULL A;  3GTJ B;  3S1Q B;  3C2P A;  4KJN A;  2NTT A;  2Z1C A;  4JCV E;  4P74 A;  3C1E A;  3V96 A;  2L11 A;  1WTH A;  3WOE A;  4A3I G;  3QR8 A;  4FXG C;  3I3C A;  4B08 A;  4FF1 A;  5DNF A;  1TWC B;  4HJ9 A;  2Z4H A;  3VR4 A;  5IWA L;  1YIJ A;  4ZK9 B;  2XN9 C;  2Q8T A;  4DUZ Q;  4POG A;  2NUC A;  3RLO A;  2EY5 A;  2ZXP A;  4PZ7 A;  3KF6 A;  4BY1 B;  2EOT A;  3L0O A;  5FLX L;  3VR5 A;  1H9J A;  1WD1 A;  4A3L G;  4GOP A;  1JR0 D;  3RLN A;  1DYQ A;  3WDN A;  3MA2 B;  3JAM E;  1OXX K;  1WTQ A;  3ERO A;  3S1M H;  3CQZ H;  1EIY B;  2JSO A;  3RR5 A;  3GTQ H;  2QCP X;  4DV6 Q;  3CKI B;  2EY2 A;  2JP1 A;  2R93 G;  3M4O H;  1VQC A;  4B3R Q;  3U9O A;  4EQP A;  4IPD A;  2VQE Q;  1XPR A;  5EPL A;  1BBU A;  3K57 A;  5LMN W;  3MXG A;  3LWE A;  4JI2 Q;  1MJE A;  4LF4 Q;  4UY8 C;  1C8C A;  1XX8 A;  4IJH A;  5LL6 X;  2DNC A;  1NR2 A;  4U68 A;  4DR7 Q;  3NBH A;  4HR7 B;  1ONL A;  5IE8 A;  4RCO A;  3H0G H;  2EY1 A;  2V1C C;  3OIQ A;  1BKB A;  1NMF A;  5DAU A;  4R8N A;  1CZW A;  3TRE A;  3SDZ A;  4MIU A;  3IFD A;  1HXY D;  2EJF C;  1PRT B;  3PF4 A;  1U4R A;  2MNA A;  4GLV B;  3NTK A;  3OMC A;  1ICW A;  2D2C C;  3H3V H;  3CCJ A;  1RTN A;  2F52 A;  3BZK A;  1JJG A;  1HNZ Q;  1TKW B;  1NY4 A;  1KXL A;  4IO9 A;  1PH8 A;  1VQ7 A;  2E2H B;  4PQX A;  3EJI A;  5CV6 A;  5BR8 L;  5GQO A;  4A3K G;  3K6O A;  1O7Y A;  1OO9 B;  1B8A A;  4MNO A;  1Q3L A;  4XDX A;  1S72 A;  1VQ6 A;  4WJ3 M;  3SVM A;  3S14 H;  3A55 A;  4BXX G;  3TP5 A;  2IT1 A;  3ZYY X;  1XNR L;  3GTK H;  4TKO B;  2R3Z A;  1B44 D;  3K5L A;  1IBL Q;  1VMC A;  3J7A V;  2ZJP A;  5IOC A;  3NQI A;  2BE5 C;  4DAY A;  2Q2T A;  3I4O A;  5JJI A;  1QIL A;  2WV6 D;  4IUP A;  4IOC A;  3DEO A;  5CR3 A;  1A62 A;  2WAQ E;  4HIM A;  1TY0 A;  1BXT A;  3L7Z C;  1FL0 A;  3JAM i;  4NDX A;  1M90 C;  2A69 D;  3LGJ A;  3GTM H;  1IHZ A;  4C3I G;  5FO8 B;  3PMF A;  1GJX A;  4ZLT F;  3I4M B;  2RCN A;  1R9T B;  3CCE A;  2B2U A;  1U4M A;  1I4R A;  4ZRZ A;  2K5Q A;  4JI6 Q;  5C0X G;  3ND9 A;  1L1O A;  1JMC A;  5K36 H;  3M7N A;  4OEM B;  4QB4 A;  5FLX c;  2NVT H;  2BCO A;  4NXM L;  1BCP B;  1QG7 A;  4C3J H;  4F7X A;  3CPF A;  1QNK A;  1EY7 A;  5EPJ A;  4IN3 A;  1X3P A;  2LMC B;  3K81 C;  4MHE A;  1HHV A;  2XTI A;  1LTI D;  4JI8 L;  1X6O A;  1X54 A;  4OWX B;  4C2M H;  1CKN B;  3DXJ C;  4JI3 Q;  2OTJ A;  4DAP A;  4JYA L;  1JB7 A;  1ZYR D;  1Q86 C;  2KCC A;  2I0Q A;  3AMU A;  5IYD G;  1I4Q A;  2K1B A;  4LFA Q;  4C1N I;  4KKU A;  1HH2 P;  2EIF A;  3ZJY C;  3H91 A;  3LX0 A;  4FO2 A;  3G6E A;  4OWT B;  2R92 H;  4GKK Q;  5EKL A;  2RHS B;  2H5X A;  1LTB D;  5IOD A;  1L0Y B;  1W6J A;  1G29 1;  4GNX B;  1G8Z D;  3VYS A;  3ERQ A;  1VQP A;  4ZAI A;  3MVV A;  3J81 L;  1BUV T;  1PVO A;  3CCM A;  4AYB E;  1KAW A;  5JEA G;  1PH4 A;  1A3T A;  2AWO A;  1CUK A;  2R61 A;  4DV1 Q;  4B3S Q;  1IYJ B;  3HOW H;  1F2Z A;  5H1S E;  1Y8N B;  3I4N G;  4KV6 A;  5M3F H;  3K5O A;  2QIL A;  1WJJ A;  1KDC A;  2JA5 G;  3AFQ A;  4KHP L;  2PNR C;  2PI2 A;  1LTA D;  3GTG B;  4DR1 Q;  3KBX A;  3A5U A;  4DR2 L;  1N36 L;  1QZG A;  2G9D A;  1I4G A;  1PYS B;  2JQO A;  4DV5 Q;  3M3Y B;  1MHW C;  1UE7 A;  2OXP A;  2GA4 B;  5A35 A;  2NTS A;  4DV3 Q;  5E4W C;  4LFB Q;  3I4L A;  5BN5 A;  5J39 A;  1QUQ B;  2B2Y C;  1BCP D;  1SXT A;  4K14 A;  5C4Z A;  2UXC L;  4AH6 A;  2CWP A;  4LF8 Q;  2B2T C;  1WOC A;  4HAE A;  1LLR D;  4OON A;  1OTC A;  1MKH A;  3CMA A;  1CQF A;  2A1A A;  3M9B A;  5ELC A;  5M5X H;  1RHP A;  2FHT A;  3Q6S A;  2PZW A;  2TSS A;  3K59 A;  1VMP A;  1DOL A;  5JJZ A;  1YJN A;  1KAA A;  4YHH Q;  1PTO B;  2EYF A;  2HCC A;  5M3M G;  4DR5 Q;  1XTD A;  3PV0 A;  3O13 A;  2M9V A;  2EXZ A;  5IT9 L;  4DV4 L;  4A3K B;  4FP5 D;  4DK1 A;  3K7U C;  2WIN B;  3SK5 A;  3HOU H;  4A3C G;  3T53 B;  1W6K A;  4C1N K;  4G7O C;  2VL6 A;  3CD6 A;  2A6E D;  2Y0S G;  1WI5 A;  3H3V I;  3QB3 A;  4X3T A;  4JBW A;  1TWG B;  1K3R A;  1SND A;  2ZJQ A;  3N6R A;  1RCV D;  3P75 A;  4KKT A;  1HNW Q;  1KD1 C;  2ZTE A;  4JOI C;  3HP3 A;  1DZ1 A;  5EKK A;  1YHA A;  1LTS D;  3KLW A;  4JV5 L;  2NB0 A;  4X65 Q;  1AZQ A;  2RSN A;  2A5H A;  4OX9 L;  3CC4 A;  1C9O A;  3NBI A;  1ET9 A;  3MXU A;  4C3I B;  3J81 c;  3E0J A;  4KY7 A;  1O7L A;  3TEH B;  4DV7 Q;  1UWV A;  1TWA B;  3IRB A;  4OO1 G;  2HHH L;  3V05 A;  2VS1 A;  5IGF A;  4HID A;  1EUJ A;  1BO0 A;  3VYU A;  3MXN B;  4LF9 L;  2EE1 A;  1EYG A;  2KBN A;  1MGS A;  2FIN B;  1BNZ A;  2QKI C;  2VUM G;  3NPP A;  3RZO H;  3S9W A;  2EYO A;  5FKA C;  3I56 A;  2UXD L;  3A7L A;  4A3B B;  2ID0 A;  2JA7 G;  3X3M A;  3J81 E;  3EBE A;  1SE2 A;  1Y14 B;  1FGU A;  2EXD A;  1XJV A;  1LO5 D;  1MJC A;  4QCL A;  2CQA A;  1AZP A;  5GRO A;  4LWC A;  3TBI B;  5C4X H;  3HOV H;  1E1T A;  1SYF A;  1Q7Y C;  2Z6K A;  1PTO D;  4QL5 A;  1SE3 A;  1SN8 A;  1IKL A;  3R2T A;  1BF4 A;  4YWL A;  2PNH A;  1VF7 A;  1ZKO A;  2OEO A;  1EOT A;  2R7Z G;  2LFN A;  3FKI G;  3OYY A;  3D3R A;  4HJA A;  3RZD B;  2VY3 A;  3R2I A;  4UP8 A;  1LT5 D;  4BBS G;  5L37 A;  4ZCK A;  2A6H D;  2KJX A;  3IL8 A;  4OIK A;  5CV5 A;  3S2H H;  3CW2 C;  3S17 B;  5C4J B;  1HFN A;  5ELF A;  1STB A;  1VQD A;  1STE A;  5LHY 1;  1I94 Q;  4L5Q A;  1YNX A;  3C1F A;  3ULP A;  4YY3 Q;  1SJH D;  4ID6 A;  2F0S A;  1WVL A;  3GTO H;  1ML0 D;  3OWF A;  2DN8 A;  1ESR A;  1Q81 C;  1VQL A;  1EU3 A;  3TS2 A;  3ONA B;  1PRT F;  3KF6 B;  1PZJ D;  2B63 H;  3ITP A;  1B70 B;  1Q1B A;  3IAY A;  4QIW B;  3TP8 A;  4GOP B;  5JPM C;  3W1B A;  1Q12 A;  3G6J B;  1TR5 A;  2HDL A;  3AYH B;  1U4P A;  5IT9 c;  5E1F A;  1X3Q A;  3HFZ B;  1B9N A;  4BBR B;  2CW0 D;  2AQ1 B;  5IWA Q;  3A5Z B;  3K7A H;  3H15 A;  1V8Q A;  2Q8R E;  4FXK C;  5KNB A;  4UP9 A;  4A3E H;  4DV0 L;  2EJG C;  1G51 A;  1SNC A;  2NVY B;  1I50 H;  3BJU A;  5T1G A;  1CTM A;  1LT6 D;  1NUC A;  1XNQ L;  4QQB X;  2VB2 X;  4L6T B;  3D6C A;  3PO2 H;  1VF5 C;  3NBH B;  1CT1 D;  1IBM L;  2RHQ B;  1GM5 A;  4G7H C;  5IT9 E;  4QJF A;  2MFI A;  1YJW A;  4AQY L;  3K58 A;  1PH7 A;  2LSS A;  3J81 i;  2OF1 A;  1O80 A;  3KLR A;  4ODG A;  4N9P A;  2K01 A;  4A93 H;  2JA6 H;  3F8T A;  4F88 A;  1YVC A;  1SYB A;  2BA1 A;  3ER0 A;  2UUB L;  3BU2 A;  3TDQ A;  1SMY D;  2PW7 A;  1F9R A;  1GUT A;  4WFN 3;  5CMD A;  3LWU A;  4RGN A;  1WCM H;  3U9S A;  3A8I E;  4KLK A;  4N8X 1;  4IFD I;  2BH2 A;  3I90 A;  3I55 A;  3A7A B;  3CXC A;  1Y1W H;  4XT1 B;  4DK0 A;  5IP7 H;  5JJL A;  3T1Y L;  5IYC H;  5C6A A;  1HRJ A;  5EJW A;  2B29 A;  2RDG A;  2IWH A;  2K28 A;  3Q24 A;  1AFP A;  2EPB A;  4DAY B;  1UUP A;  3TRZ A;  1N9W A;  1PH2 A;  5FJ8 G;  3SEB A;  5BR8 Q;  3GTQ B;  4N9T A;  1JE4 A;  2XSC A;  2A8V A;  3M4O B;  3SK4 A;  1B50 A;  5I4D A;  1EZ8 A;  4ZYS A;  2NZH A;  3U58 A;  1JOR A;  2QDB A;  3PO3 H;  4PZ8 A;  1XNR Q;  1O78 A;  4O42 A;  2XWJ B;  1EIH A;  2SNM A;  2ZTC A;  3KK7 A;  3H94 A;  4R4O A;  1K83 H;  1B3A A;  2I5M X;  1MI2 A;  1HFG A;  1GKH A;  1HJP A;  1V1O A;  4NXN L;  2F4V L;  1V1Q A;  4IFD G;  1V9P A;  3CCQ A;  5C5L A;  4O1N A;  3V2T A;  4YWK A;  1L1O B;  4CJ2 C;  1NR4 A;  5KEE A;  4TRD A;  2WII B;  3KDF A;  1PA6 A;  1A2U A;  4CHT B;  2Z8L A;  3N52 A;  4HTH A;  1KDA A;  5M5W H;  1NTG A;  1O7I A;  3NWT A;  2F0H A;  4KMU C;  4DNI A;  3NEL A;  1HZC A;  1S5C D;  2YTY A;  2X6G A;  4K8J A;  5BN3 A;  3HS0 C;  4NXM Q;  3CCS A;  3A0J A;  4QF4 A;  1LV9 A;  2VXW A;  1X3G A;  3W2D A;  2VQF L;  2K14 A;  4JI8 Q;  5BN4 A;  2L9H A;  5C44 G;  2KUM A;  2E2D C;  1E22 A;  5D3I B;  2K04 A;  5ELN A;  4JYA Q;  1EQV A;  3DWA A;  1PZI D;  2K4K A;  2M00 A;  1S5F D;  3AU7 A;  3I2Z A;  4FYD A;  4A3G G;  5CV9 A;  1HZB A;  1YNN D;  3HOY B;  4K5X A;  4G57 A;  4NP5 A;  3JAM c;  3SK8 A;  4APV A;  1JJ2 A;  4GNX C;  1EY9 A;  1D5X C;  3UDG A;  2UUC L;  4X3K A;  3GTM B;  4IUV A;  3I8Z A;  5F2D A;  3PIO 3;  1LTG D;  1EFI D;  3S2D H;  2B2W C;  3OWE B;  2NVQ H;  2G9H D;  5KIX A;  4R4I A;  1Y1V H;  2D5D A;  1CA5 A;  3SE0 A;  1PTO F;  2A6E C;  2ES2 A;  2I46 A;  1EFW A;  3HRZ C;  2N78 A;  2R6G A;  2NVT B;  1E2W A;  2JYO A;  1G91 A;  4C3J B;  5KNC A;  3FPU B;  1IL2 A;  4BY7 H;  3OOC A;  2IPK D;  4UAI A;  3DWP A;  4JI4 L;  2JEB I;  3M4Y A;  4KHP Q;  5CYU A;  1PXU A;  2A74 C;  1K8M A;  4IZ8 A;  1N36 Q;  4DR2 Q;  3I70 A;  2NYZ D;  4B3M L;  1KHI A;  5J22 A;  3HGB A;  2PQA A;  5C0X J;  1B9M A;  1XPO A;  1F2M A;  1SEB D;  1PFB A;  4R4C A;  4HJ7 A;  2F0J A;  3D4W A;  3HEJ A;  3TME A;  4CDF C;  4X6A H;  1JJC B;  5IGC A;  2ZM6 L;  2MPM A;  3HOZ G;  3QOJ A;  4JI7 L;  2R92 B;  4X3U A;  2B2Y A;  1VCI A;  3TS0 A;  2L15 A;  2KOL A;  2UXC Q;  1ZEQ X;  2RVL A;  1GUG A;  2MQH A;  1EYC A;  4KJO A;  5IGB A;  3EQL C;  3T16 A;  1C0A A;  2NN6 H;  3GQB A;  2ALY B;  2X6L A;  3J7Y W;  2IY5 B;  3D31 A;  2E2I H;  4P72 A;  3EFX D;  3E9H A;  1W2B A;  1CSP A;  1OXS C;  3MC0 B;  4PMW A;  1SLJ A;  2RDF A;  5IGG A;  2P5Z X;  2FMM A;  1YIT A;  1CQV A;  1PFS A;  2LS0 1;  3HOW B;  1HTL D;  1NBW A;  4RGO S;  1GVP A;  3U4V A;  4KY6 A;  5GAG C;  1UE6 A;  5KRU A;  3E9I A;  4HMJ A;  1A63 A;  1QE6 A;  4FNF A;  2BDO A;  4JBM A;  5M3F B;  3M85 A;  3MFG A;  1N34 L;  4DK3 C;  2F0V A;  4JVZ A;  3DLL A;  1S40 A;  2XRQ D;  3T56 B;  4C3H H;  3CC2 A;  4DV4 Q;  4JI0 L;  5IGD A;  2A6H C;  1HUN A;  5JEA J;  4AYB G;  4JC0 A;  1K73 C;  2A68 D;  2KQ3 A;  4K6L A;  2L12 A;  2A73 B;  1DGS A;  1MSG A;  1UE5 A;  1TQO A;  4RMF A;  2Z0S A;  3PUY A;  4DGZ A;  1HA6 A;  4POF A;  1YJ9 A;  5AFW A;  1EWI A;  5C5M A;  3S1R H;  1IW7 D;  1XXG A;  2WKC A;  4A3M H;  4RKB A;  1HR0 L;  1HUM A;  5EPK A;  4JOI A;  5IY0 A;  3VA5 A;  5M5X B;  4DR6 L;  4JV5 Q;  3SXH A;  3R3O A;  4OX9 Q;  2CW0 C;  2F0N A;  3CCV A;  1T5E A;  2TMP A;  4DXF A;  2OCE A;  3GD7 A;  2HHH Q;  2IX3 A;  4HIK A;  2MP1 A;  5FLM H;  1I6V C;  4A3B G;  4N8F A;  3EN2 A;  1EIG A;  3OTO L;  1JOK A;  1TWC H;  1PRT D;  4LF9 Q;  4NB3 A;  1L2F A;  1EZ6 A;  1F9P A;  3HG9 A;  3HKZ E;  4ALP A;  1Q82 C;  2UXD Q;  3KBG A;  1VQJ A;  2QA4 A;  1TU2 B;  2KEC A;  2NVX B;  1TWF H;  3UDF A;  2AKW B;  1EYA A;  4IAL A;  1STN A;  2VNU D;  4U67 3;  4HN7 A;  5HY6 A;  3NEM A;  4FF4 A;  1EOV A;  3CRK C;  4JI1 L;  1ICF B;  1A0I A;  5C44 B;  2BA0 A;  4EVO A;  4JI5 L;  1SNQ A;  3FPP A;  4GKJ L;  4IOA A;  1ESF A;  1JOO A;  2K7V A;  1SMY C;  3FP9 A;  1HQM C;  1I6H B;  2DY7 A;  1WD0 A;  1JWS D;  5IIF A;  1NE3 A;  1JE5 A;  4I7Z C;  2DNE A;  4A3G B;  3K0Y A;  1U9R A;  5NUC A;  4O0A A;  1EL0 A;  4A3J H;  1VQN A;  3GTP B;  3GDE A;  2PMZ E;  4X66 L;  4G7Z C;  1XMQ L;  2RA4 A;  4A3D H;  1TT2 A;  4LK1 C;  1ET6 A;  1WFQ A;  4JPB W;  3WOF A;  4CDD C;  4QGU A;  2AUJ D;  1CFM A;  3CU7 A;  4YIJ A;  4DKA C;  2LXJ A;  2K75 A;  3RZO B;  2WB1 E;  1SYD A;  1RF2 D;  2WAQ B;  2F0K A;  4BBR G;  4GOP C;  3OPO A;  3J80 L;  1LT4 D;  3MWY W;  3VR6 A;  1SAP A;  4CBV A;  1IYU A;  1EQT A;  1KRS A;  3PGZ A;  1EY5 A;  1JB3 A;  5C3E G;  1J6Q A;  2IX1 A;  3HOX H;  1IYV A;  4LNQ A;  1XWE A;  4DK6 C;  4Y52 H;  5C4X B;  2MO1 A;  3HOV B;  4K2K A;  2K5H A;  3RLF A;  2CQO A;  3UDI A;  4LF5 Q;  2JA8 H;  2O5I C;  3ICE A;  1AH9 A;  4DV0 Q;  3OMG A;  5IP9 G;  1KTK A;  1FJG L;  1XMO L;  4IPH A;  2XIW A;  1XNQ Q;  5FK9 C;  1EYD A;  3HOZ B;  5DEH A;  1IBM Q;  3K8A A;  5DM7 3;  4F8M A;  2HCI A;  4P2C B;  3TQY A;  3KOJ A;  4AQY Q;  4DNT B;  3I73 A;  1AW7 A;  3S2H B;  1MD2 D;  1A2T A;  1IZ6 A;  4FDB A;  1V43 A;  3MXP A;  4R9W A;  1TS3 A;  4MTN A;  2OQ0 A;  2Q2H A;  1PV4 A;  2UUB Q;  3GTO B;  3SK6 A;  1E2V A;  1EEI D;  1VQA A;  3QOL A;  2F0G A;  1R9T H;  4NPS A;  4M8A A;  4DA2 A;  5JJK A;  5D65 A;  1SYC A;  3TP7 A;  4ZUI A;  5J3B A;  2HIX A;  3CAM A;  2NN6 I;  2V4D A;  2WP8 J;  2LKV A;  3S1N H;  4P73 A;  2F0T A;  1B2T A;  2B2V A;  4OIJ A;  3K7A B;  3T1Y Q;  4BA2 I;  2MUY A;  3I91 A;  3URY A;  1MSH A;  4AYB B;  4IUQ A;  2JJQ A;  4HJ8 A;  1JT8 A;  2HQE A;  2LY7 A;  1QNU A;  4A3F H;  3LNN A;  3PO2 B;  3KUP A;  2XNA C;  5IYB H;  4LF6 L;  3MAQ A;  2HQL A;  1RIP A;  1TS5 A;  2K32 A;  1C4Q A;  3D8G A;  3RN5 A;  4CGY B;  3PIO A;  3KDF B;  1SYG A;  3MTS A;  3H0G G;  2O4X A;  1HQR D;  1JQY D;  4A93 B;  2JA6 B;  1AEX A;  1TWH H;  1KNE A;  3K0X A;  2KCN A;  1QVF A;  3CCU A;  2B2U C;  4A3I H;  1Q46 A;  2F4V Q;  1K8A C;  2K52 A;  5HGT A;  1FD7 D;  1L1O C;  1ASZ A;  1VQ9 A;  1AP0 A;  2XWB B;  1DM0 B;  1LUZ A;  3OW2 A;  1H9S A;  3CP0 A;  3NXW A;  2KCT A;  2KEN A;  4KHV A;  3T4A C;  1SRU A;  2ZT9 C;  5M5Y B;  1Y1W B;  4DR3 L;  4GZY C;  4R4Q A;  3NSW A;  4LFC L;  4A3L H;  2PQE A;  2F0M A;  1UEB A;  5TSS A;  1S5E D;  3F2C A;  4RHR A;  3BG3 A;  2EYM A;  2SOB A;  3VYR A;  4BS9 A;  1BOS A;  1ENC A;  3T1H L;  4KD3 A;  5DM6 3;  1VQK A;  1N32 L;  1FGB D;  2R93 H;  2KED A;  4NMZ A;  3J80 E;  5C3X A;  1TS4 A;  4TQU S;  1GUN A;  2K50 A;  2MO0 A;  4J1M A;  4KKS A;  2VQF Q;  3PO3 B;  4Q0F A;  2SDF A;  1D2B A;  4Z9C B;  4KY5 A;  1TY2 A;  1AE2 A;  1K83 B;  3QG1 A;  1EU4 A;  4XT3 B;  4H0L C;  1YEZ A;  1J8I A;  4R1J A;  1VQF A;  2QEJ C;  5CC4 A;  2AWN A;  3NK9 A;  5CV8 A;  2RCF A;  2BE5 D;  1SFO B;  3GV6 A;  2E75 C;  1SDF A;  2EY6 A;  1DJR D;  1KLU D;  1D6E C;  2FJ2 A;  5KYI A;  2Y0S E;  2UUC Q;  1QJO A;  2YV5 A;  4DUY L;  5K36 G;  3Q23 A;  5M5W B;  3Q8D A;  1BQQ T;  3E6Z X;  1WTX A;  1SBB B;  5KGU A;  5GAH C;  4C3J G;  4RCN A;  5C3E B;  2A68 C;  2DJF C;  2K33 A;  4IFD J;  1DCZ A;  3BYT B;  4GS3 A;  2PQA B;  5EBD A;  3GTL H;  3E3X A;  2OQK A;  2IX0 A;  4BXX H;  2L5T A;  3RUZ A;  2A69 C;  4JI4 Q;  5I2X A;  3UE0 A;  1IW7 C;  1EY0 A;  4RH6 A;  1HZ9 A;  1LTT D;  1OXV A;  4WOR A;  5T1I A;  1D8L A;  3HZX A;  2E5L L;  3HKS A;  4B3M Q;  1SSO A;  1J9O A;  1EWC A;  1SJE D;  2R92 G;  4A76 A;  1VQE A;  1BR9 A;  1A3V A;  3H6M A;  3S15 H;  2IJ0 A;  3L3O C;  1G6P A;  1H9R A;  5J1Z A;  5E4X A;  2ZM6 Q;  2PZT A;  3ULJ A;  4C3I H;  1PRT C;  5JVG 3;  1TWA H;  1YZ6 A;  3J80 i;  1IL8 A;  1GXD C;  3S2D B;  2BDN A;  5C0X H;  2NVQ B;  4EQN A;  1E3P A;  2C9O A;  3HOW G;  1ZYR C;  4RWS C;  3AEV A;  3DM3 A;  3BDC A;  1KC8 C;  1M4V A;  4M1U B;  5M3F G;  3D4D A;  5EQ0 A;  4DF7 A;  3BDO A;  1MIU A;  3C46 A;  1I3Q H;  2YU9 H;  1J5E L;  5LMU L;  2RBM A;  3S1M B;  3CQZ B;  3TZD A;  1UNS A;  3A74 A;  3OIP A;  4GLX A;  4BY7 B;  2KVM A;  1HPC A;  2CH4 A;  3KYH C;  2E2J H;  4CKE A;  3PQI A;  2EJM A;  1IBK L;  2NZ1 D;  1SMX A;  1N34 Q;  3U4Z A;  5I6Y A;  1C48 A;  1QB5 D;  2O5J C;  5IYD H;  1S5B D;  4JI0 Q;  5JOB A;  3F2B A;  2FXQ A;  4PNY A;  4PG3 A;  4LUV A;  1GHK A;  3IFT A;  5COR A;  1U0L A;  3H0G B;  3A54 A;  1LAB A;  4X3S A;  2KHI A;  3MFY A;  1A3U A;  2CWA A;  2ICE C;  2KEE A;  3DHQ A;  5C4J H;  5ELE A;  3PSI A;  3NEN A;  4FF3 A;  1FNW A;  4ZQ3 A;  4XQN A;  4B9X A;  4XYO A;  4IPC A;  5ELO A;  2Z6B A;  4H7B A;  3E0E A;  5JEA H;  2EDG A;  1HR0 Q;  4DR6 Q;  3KJO A;  2QDL A;  2E2I B;  1CA6 A;  2UUA L;  3DUZ A;  4YCW A;  4ZKB B;  2M2L A;  2YTV A;  2C5C A;  3NHH A;  4LJZ C;  3CF5 A;  3STB D;  3PUV A;  3I4N H;  1BCP C;  4OEL B;  3BZD B;  2JA5 H;  3NTH A;  1PH6 A;  2OWO A;  5KND A;  2RF4 A;  4H44 C;  2N8N A;  3OTO Q;  2HD3 A;  2R7F A;  3L9A X;  3HOU G;  2E8G A;  4X64 L;  2Z6K C;  5AJ3 L;  3S14 B;  2VB3 X;  1V1P A;  4PV1 C;  2PPB C;  2UXB L;  4C3H B;  3FEW X;  3GTK B;  1LYL A;  3UE1 A;  4OHJ A;  3IKJ A;  4B3T L;  1JCK B;  3GO5 A;  2AQ2 B;  1X3E A;  2ENB A;  2I5L X;  1I4X A;  2BH8 A;  4JW0 A;  4JI1 Q;  2PW5 A;  4LUO A;  1L0W A;  1L0X B;  4JI5 Q;  3AQQ A;  2MHV A;  4GKJ Q;  3PUZ A;  3W1G A;  2J0T D;  1CZG A;  1Y69 U;  2K03 A;  4L63 B;  3S1R B;  1HR0 W;  1FVI A;  1EY6 A;  2RQX A;  3G48 A;  3J7A 5;  4A3M B;  1LAC A;  1B4O A;  2I07 B;  4L5T A;  1ILP A;  4X62 L;  1X9N A;  4LF7 L;  3RN2 A;  4X66 Q;  2A19 A;  1N33 L;  3J7A F;  1XMQ Q;  3OSO A;  3M4P A;  3EA6 A;  1KNA A;  1K28 A;  3S16 B; 
#chains in the Genus database with same CATH homology
 1UEA B;  3TN2 A;  3NUC A;  5JVH 3;  2E76 C;  2X69 A;  2H4O A;  1CHQ D;  4NW2 A;  1LTR D;  4HSP A;  1XYI A;  5I6W A;  4ZUJ A;  4C2M B;  1TWF B;  2PCF B;  4J8Q A;  5ELB A;  2F0O A;  1FR3 A;  2PYK A;  3FRP B;  1FNV A;  3MEH A;  1CM9 A;  4DN4 M;  4KI0 A;  3GP7 A;  1D5Z C;  1D5M C;  2K5D A;  1ZXT A;  4KD4 A;  2XRS D;  3W3A A;  4JK1 C;  1F9Q A;  2O2L D;  5A2Q L;  3VR2 A;  5HUR A;  4RA8 A;  3NTI A;  2B2T A;  4A3J B;  3BVG A;  1DOM A;  4BA1 I;  3Q0A A;  4OO1 H;  2QF7 A;  4A3D B;  4MN3 A;  1QCB D;  1YNJ D;  4K6D A;  4CJ1 B;  1PTO C;  2L0C A;  4I65 A;  1PYW D;  4DFA A;  1FYC A;  3AB9 A;  1KDB A;  1Z47 A;  1HTP A;  1E0B A;  1RTO A;  2MGS A;  3Q22 A;  2EYL A;  3M7G A;  4NKL A;  1ENF A;  2J4X A;  2H1E A;  5C0X I;  5M9O A;  3HOX B;  3TZU A;  2AQ3 B;  2J7Z A;  2JA8 B;  1U4L A;  2MJ8 A;  3SR1 A;  4L8J A;  4K2L A;  3UI2 A;  4DU9 A;  1CHP D;  2WAC A;  5CGK A;  4HCE A;  1G6Z A;  1DOK A;  1Q1E A;  1CI3 M;  3FDT A;  2D9U A;  2K6A A;  3DMU A;  4K5V A;  1TII D;  2OT2 A;  1H9S B;  1RJT A;  4QUC A;  1RKN A;  5JAV A;  1PFN A;  3R8B A;  4XYQ A;  1HCZ A;  3BS1 A;  2F4I A;  2B8F A;  2F0E A;  2K05 A;  3BVZ A;  3PUX A;  4K5W A;  5CBE E;  3HOU B;  2AUK A;  4OGQ C;  4BWG B;  4TSS A;  1Y8O B;  3S1N B;  3QJY A;  3NWS A;  4HSV A;  5I2Y A;  1X32 A;  1KAB A;  3A56 A;  1F77 A;  5KYL A;  1NCV A;  4RAU C;  4CJ0 B;  5CV7 A;  4C56 C;  1JOQ A;  2JE6 I;  4A3F B;  5D14 A;  4HED A;  5FLX E;  3BYY B;  5CV4 A;  4CKB A;  3RD4 A;  3G7L A;  1STA A;  1DD2 A;  5G3L F;  2D62 A;  1TWH B;  3F2U A;  1QWY A;  3BVM A;  1TS2 A;  3ND8 A;  4A3I B;  5A2Q E;  3RMH A;  5ISR A;  2KHS A;  4FVM A;  4IUT A;  2RSO A;  3EVQ A;  4KK7 A;  2IW3 A;  3KLS X;  4G4K A;  3E5S A;  3K5N A;  1ILQ A;  1H9K A;  1SNO A;  5CBA E;  2YYZ A;  2F0U A;  1GUO A;  1D1K A;  5C3W A;  2F0W A;  1K8O A;  2R93 B;  1BBX C;  1IKM A;  3HKZ B;  1GOZ A;  4XQQ A;  5IGE A;  4HMI A;  3OW7 A;  1I4H A;  2CHB D;  4IFD H;  1F2Y A;  2ZXR A;  4XXE A;  2L55 A;  2B63 B;  3NE5 B;  1GUW A;  4KHZ A;  5I9O A;  1WTO A;  2EYJ A;  4RGM A;  3PUW A;  4EQO A;  3NQT A;  1PMR A;  4LAA A;  1RD9 D;  4KTA A;  3CRL C;  4OO1 I;  2F03 A;  1SE4 A;  2PMZ B;  2EYP A;  3P7J A;  3T13 A;  4A3E B;  4XQJ A;  3QIA A;  1I50 B;  1R4Q B;  2ZXO A;  3GTL B;  3DEP A;  1YNN C;  5FO9 B;  1PFM A;  4EGV A;  4RKL A;  3KLS A;  1Z7T A;  1NSN S;  1GHJ A;  2WB1 B;  4H13 C;  1CK1 A;  3T51 B;  5C4H A;  1STH A;  4ME5 A;  1STY A;  2NBF A;  1NAP A;  1BDO A;  1VDZ A;  3S15 B;  2KA7 A;  2FMC A;  2L1B A;  2WKD A;  1WCM B;  1SNP A;  2NN6 G;  1JC7 A;  2ICI A;  1F9S A;  1PZK D;  1AN8 A;  5I9P A;  3X3N A;  1O7Z A;  4DNR B;  3MHB A;  3PIP 3;  1V1P B;  3H3V C;  3D4R A;  2PO4 A;  3P1H A;  3NP8 A;  3GV3 A;  4DAV A;  4KN7 C;  4ABN A;  2F0D A;  3H09 A;  1EWH A;  1I3Q B;  2N88 A;  2YU9 B;  4V0B A;  4R8I A;  4C3H G;  4DXG A;  2E2J B;  1ENA A;  5K5P A;  2K5W A;  1ROD A;  5JPN C;  4RFB A;  2JEA I;  4IUR A;  1GUS A;  3C3L A;  2B8G A;  1YNJ C;  2RKS A;  1I4P A;  3A8J E;  2XVS A;  3VA7 A;  2F0P A;  1G2S A;  2SNS A;  2B39 A;  4WJW A;  1PTO H;  3D6W A;  4V19 0;  1A6X A;  2B2W A;  1XTC D;  3I4N B;  4PMB A;  3OHX C;  1EY4 A;  1Q90 A;  2JA5 B;  1OXU A;  1SYE A;  1R4P B;  4IUN A;  4E6I A;  2F3W A;  2F0F A;  3KF8 A;  1A15 A;  1QOH A;  2L4N A;  2Q8I B;  1JWU D;  1UAP A;  2F0Q A;  2EZV A;  2BOS A;  1G2T A;  2F0L A;  1Y8P B;  1D1I A;  5EBC A;  5LL6 S;  1S5D D;  2N55 A;  1FNU A;  5ELD A;  4UDU C;  2NWG A;  1B1Z A;  2Z4I A;  1Y1V B;  5FOB B;  1WTR A;  3JAM L;  4WRD A;  1T5X D;  5FO7 B;  2FFK B;  2SEB D;  5M3M B;  4K8I A;  3QO2 A;  1PLF A;  4RGT A;  3CHB D;  2E74 C;  4IUU A;  1PDQ A;  2B2V C;  2F1M A;  1STG A;  3TP6 A;  3BDL A;  4Q5V A;  3FMC A;  4FF2 A;  1BCP F;  4QMG A;  1JIC A;  4J6H A;  1E2Z A;  4ILW A;  2Y0S B;  2EYH A;  3K5M A;  3TSS A;  4OL7 A;  3QWN A;  3R93 A;  2RDH A;  1M8A A;  3P20 A;  1S4Z A;  1DXM A;  3FVQ A;  2JXM B;  3DM1 A;  4F87 A;  3VYT A;  4XIG S;  1SNM A;  2CVR A;  4Y7N B;  4IQZ A;  5E3F A;  1WTW A;  4XTC S;  5G3L D;  2HUG A;  2PZU A;  4S3S A;  1EY8 A;  2VUM B;  1B53 A;  1WTV A;  4ZKC B;  3A8K E;  4HCS A;  1Z6H A;  4KN4 C;  2EVB A;  3HOY B;  5EGT A;  1LT3 D;  3S16 B;  2JA7 B;  5COY A;  3MXN A;  1KLG D;  4CKC A;  1HA5 A;  2HDM A;  1WTP A;  4PMC A;  3VR3 A;  1II3 A;  1DON A;  3MZ5 A;  1MBY A;  3SHL A;  1OXT A;  4LMQ D;  1F2L A;  2IL8 A;  3I72 A;  2F0I A;  5EKI A;  4RHS A;  1H9M A;  2DY8 A;  4B9W A;  3DWQ A;  2R7Z B;  3FKI B;  1TVX A;  1EEF D;  4FXD A;  1JWM D;  4BBS B;  1Q8I A;  5D3D A;  2F3V A;  4QUF A;  1RDP D;  4ULL A;  3GTJ B;  3S1Q B;  3C2P A;  4KJN A;  2NTT A;  2Z1C A;  3C1E A;  3V96 A;  2L11 A;  3WOE A;  4FXG C;  3I3C A;  4B08 A;  4FF1 A;  5DNF A;  1TWC B;  2Z4H A;  3VR4 A;  4ZK9 B;  2XN9 C;  2Q8T A;  2NUC A;  2EY5 A;  2ZXP A;  4BY1 B;  2EOT A;  5FLX L;  3VR5 A;  1H9J A;  1WD1 A;  1JR0 D;  1DYQ A;  3WDN A;  3MA2 B;  3JAM E;  1OXX K;  1WTQ A;  3ERO A;  2JSO A;  2QCP X;  3CKI B;  2EY2 A;  2JP1 A;  3U9O A;  4EQP A;  5EPL A;  3K57 A;  3MXG A;  3LWE A;  1C8C A;  1XX8 A;  5LL6 X;  2DNC A;  1NR2 A;  4U68 A;  3NBH A;  4HR7 B;  1ONL A;  4RCO A;  2EY1 A;  3OIQ A;  5DAU A;  4R8N A;  1CZW A;  3SDZ A;  4MIU A;  3IFD A;  1HXY D;  2EJF C;  1PRT B;  1U4R A;  3NTK A;  3OMC A;  1ICW A;  2D2C C;  1RTN A;  1TKW B;  2E2H B;  4PQX A;  3EJI A;  5CV6 A;  3K6O A;  1O7Y A;  1OO9 B;  4XDX A;  1Q3L A;  3SVM A;  3A55 A;  3TP5 A;  2IT1 A;  3ZYY X;  4TKO B;  2R3Z A;  1B44 D;  3K5L A;  1VMC A;  3J7A V;  5IOC A;  3NQI A;  2BE5 C;  4DAY A;  1QIL A;  2WV6 D;  4IUP A;  3DEO A;  5CR3 A;  1TY0 A;  1BXT A;  3L7Z C;  4NDX A;  2A69 D;  1IHZ A;  4C3I G;  5FO8 B;  3PMF A;  1GJX A;  4ZLT F;  3I4M B;  1R9T B;  2B2U A;  1U4M A;  1I4R A;  4ZRZ A;  2K5Q A;  5C0X G;  3ND9 A;  5K36 H;  3M7N A;  4QB4 A;  2BCO A;  1BCP B;  1QG7 A;  4F7X A;  1QNK A;  1EY7 A;  5EPJ A;  4IN3 A;  1X3P A;  2LMC B;  4MHE A;  1HHV A;  1LTI D;  3DXJ C;  4DAP A;  1ZYR D;  2KCC A;  3AMU A;  1I4Q A;  2K1B A;  4C1N I;  4KKU A;  3H91 A;  3LX0 A;  4FO2 A;  5EKL A;  1LTB D;  5IOD A;  1L0Y B;  1W6J A;  1G29 1;  1G8Z D;  3VYS A;  3ERQ A;  4ZAI A;  3MVV A;  3J81 L;  1BUV T;  5JEA G;  1A3T A;  2AWO A;  2R61 A;  1F2Z A;  1Y8N B;  4KV6 A;  3K5O A;  2QIL A;  1KDC A;  2PNR C;  1LTA D;  3GTG B;  3KBX A;  2G9D A;  1I4G A;  3M3Y B;  2OXP A;  2GA4 B;  5A35 A;  2NTS A;  5E4W C;  3I4L A;  5BN5 A;  5J39 A;  2B2Y C;  1BCP D;  1SXT A;  4K14 A;  5C4Z A;  2B2T C;  4HAE A;  1LLR D;  1CQF A;  5ELC A;  1RHP A;  2FHT A;  3Q6S A;  2PZW A;  2TSS A;  3K59 A;  1VMP A;  1DOL A;  5JJZ A;  1KAA A;  1PTO B;  2EYF A;  2HCC A;  3PV0 A;  3O13 A;  2M9V A;  2EXZ A;  5IT9 L;  4A3K B;  4FP5 D;  4DK1 A;  3SK5 A;  2WIN B;  3T53 B;  1W6K A;  4C1N K;  4G7O C;  2A6E D;  3QB3 A;  4X3T A;  4JBW A;  1TWG B;  1SND A;  3N6R A;  1RCV D;  3P75 A;  4KKT A;  3HP3 A;  1DZ1 A;  5EKK A;  1LTS D;  2NB0 A;  1AZQ A;  2RSN A;  2A5H A;  3NBI A;  1ET9 A;  3MXU A;  4C3I B;  3E0J A;  4KY7 A;  1O7L A;  1TWA B;  4OO1 G;  3V05 A;  5IGF A;  1BO0 A;  3VYU A;  2EE1 A;  1MGS A;  2FIN B;  1BNZ A;  2QKI C;  3NPP A;  3S9W A;  2EYO A;  5FKA C;  3A7L A;  4A3B B;  2ID0 A;  3X3M A;  3J81 E;  1SE2 A;  1LO5 D;  4QCL A;  2CQA A;  1AZP A;  3TBI B;  1SYF A;  1PTO D;  1SE3 A;  1IKL A;  3R2T A;  1BF4 A;  1VF7 A;  1ZKO A;  2OEO A;  1EOT A;  2LFN A;  3D3R A;  3RZD B;  3R2I A;  1LT5 D;  2A6H D;  2KJX A;  3IL8 A;  4OIK A;  5CV5 A;  3S17 B;  5C4J B;  1HFN A;  5ELF A;  1STB A;  1STE A;  5LHY 1;  3C1F A;  1SJH D;  4ID6 A;  2F0S A;  1WVL A;  1ML0 D;  3OWF A;  2DN8 A;  1ESR A;  1EU3 A;  3ONA B;  1PRT F;  1PZJ D;  3ITP A;  1Q1B A;  3IAY A;  4QIW B;  3TP8 A;  5JPM C;  1Q12 A;  3G6J B;  1TR5 A;  2HDL A;  1U4P A;  5E1F A;  1X3Q A;  1B9N A;  4BBR B;  2CW0 D;  2AQ1 B;  1V8Q A;  2Q8R E;  4FXK C;  5KNB A;  2EJG C;  1SNC A;  2NVY B;  5T1G A;  1CTM A;  1LT6 D;  1NUC A;  2VB2 X;  4L6T B;  3D6C A;  1VF5 C;  1CT1 D;  4G7H C;  5IT9 E;  3K58 A;  2OF1 A;  1O80 A;  3KLR A;  4ODG A;  4N9P A;  2K01 A;  4F88 A;  1SYB A;  2BA1 A;  3TDQ A;  1SMY D;  2PW7 A;  1F9R A;  1GUT A;  4WFN 3;  5CMD A;  3LWU A;  4RGN A;  3U9S A;  3A8I E;  4IFD I;  3I90 A;  3A7A B;  4XT1 B;  4DK0 A;  5C6A A;  1HRJ A;  5EJW A;  2RDG A;  2IWH A;  2K28 A;  3Q24 A;  1AFP A;  2EPB A;  1UUP A;  3SEB A;  3GTQ B;  4N9T A;  1JE4 A;  2XSC A;  3M4O B;  3SK4 A;  1B50 A;  5I4D A;  1EZ8 A;  4ZYS A;  1JOR A;  2QDB A;  1O78 A;  4O42 A;  2XWJ B;  1EIH A;  2SNM A;  3KK7 A;  3H94 A;  1B3A A;  1MI2 A;  1HFG A;  1V1O A;  4IFD G;  5C5L A;  4O1N A;  3V2T A;  4CJ2 C;  1NR4 A;  5KEE A;  4TRD A;  2WII B;  1A2U A;  4CHT B;  2Z8L A;  3N52 A;  4HTH A;  1KDA A;  3NWT A;  2F0H A;  4KMU C;  1S5C D;  2X6G A;  4K8J A;  5BN3 A;  3HS0 C;  4QF4 A;  1LV9 A;  2VXW A;  3W2D A;  5BN4 A;  2L9H A;  2KUM A;  2E2D C;  5D3I B;  2K04 A;  1EQV A;  3DWA A;  1PZI D;  2M00 A;  1S5F D;  3AU7 A;  4FYD A;  5CV9 A;  1YNN D;  4K5X A;  4G57 A;  4NP5 A;  3SK8 A;  1EY9 A;  1D5X C;  3GTM B;  4X3K A;  4IUV A;  3I8Z A;  5F2D A;  3PIO 3;  1LTG D;  1EFI D;  2B2W C;  3OWE B;  2G9H D;  5KIX A;  2D5D A;  1CA5 A;  3SE0 A;  1PTO F;  2A6E C;  2I46 A;  3HRZ C;  2R6G A;  2NVT B;  1E2W A;  2JYO A;  1G91 A;  4C3J B;  5KNC A;  3FPU B;  3OOC A;  2IPK D;  4UAI A;  3DWP A;  2JEB I;  3M4Y A;  5CYU A;  1PXU A;  2A74 C;  1K8M A;  4IZ8 A;  3I70 A;  2NYZ D;  5J22 A;  3HGB A;  5C0X J;  1B9M A;  1F2M A;  1SEB D;  1PFB A;  2F0J A;  3D4W A;  3HEJ A;  3TME A;  5IGC A;  2MPM A;  3QOJ A;  2R92 B;  4X3U A;  2B2Y A;  1VCI A;  2KOL A;  1ZEQ X;  2RVL A;  1GUG A;  1EYC A;  4KJO A;  5IGB A;  3EQL C;  3T16 A;  2NN6 H;  3GQB A;  2X6L A;  3J7Y W;  3D31 A;  3EFX D;  1OXS C;  3MC0 B;  4PMW A;  2RDF A;  5IGG A;  2FMM A;  1CQV A;  2LS0 1;  3HOW B;  1HTL D;  4RGO S;  4KY6 A;  5KRU A;  4HMJ A;  1QE6 A;  4FNF A;  2BDO A;  5M3F B;  3M85 A;  3MFG A;  2F0V A;  2XRQ D;  3T56 B;  5IGD A;  2A6H C;  1HUN A;  5JEA J;  2A68 D;  2KQ3 A;  4K6L A;  2L12 A;  2A73 B;  1MSG A;  1TQO A;  3PUY A;  4DGZ A;  1HA6 A;  5AFW A;  5C5M A;  1IW7 D;  1XXG A;  2WKC A;  4RKB A;  1HUM A;  5EPK A;  3VA5 A;  5M5X B;  3SXH A;  3R3O A;  2CW0 C;  2F0N A;  1T5E A;  2TMP A;  4DXF A;  3GD7 A;  2IX3 A;  2MP1 A;  1I6V C;  1EIG A;  1JOK A;  1PRT D;  1EZ6 A;  1F9P A;  3HG9 A;  3KBG A;  2NVX B;  1TU2 B;  2KEC A;  1EYA A;  4IAL A;  1STN A;  2VNU D;  4U67 3;  4HN7 A;  4FF4 A;  3CRK C;  5C44 B;  2BA0 A;  4EVO A;  1SNQ A;  3FPP A;  1ESF A;  1JOO A;  2K7V A;  1SMY C;  1HQM C;  1I6H B;  2DY7 A;  1WD0 A;  1JWS D;  5IIF A;  4I7Z C;  2DNE A;  4A3G B;  3K0Y A;  1U9R A;  5NUC A;  1EL0 A;  3GTP B;  4G7Z C;  2RA4 A;  1TT2 A;  4LK1 C;  1ET6 A;  3WOF A;  2AUJ D;  1CFM A;  3CU7 A;  4YIJ A;  3RZO B;  1SYD A;  1RF2 D;  2WAQ B;  2F0K A;  3OPO A;  3J80 L;  1LT4 D;  3MWY W;  4CBV A;  1SAP A;  3VR6 A;  1IYU A;  1EQT A;  1EY5 A;  1JB3 A;  2IX1 A;  1IYV A;  1XWE A;  5C4X B;  3HOV B;  4K2K A;  3RLF A;  2O5I C;  3OMG A;  1KTK A;  2XIW A;  5FK9 C;  1EYD A;  3HOZ B;  5DEH A;  5DM7 3;  4F8M A;  2HCI A;  4P2C B;  4DNT B;  3I73 A;  1AW7 A;  3S2H B;  1MD2 D;  1A2T A;  1V43 A;  3MXP A;  4R9W A;  1TS3 A;  3GTO B;  3SK6 A;  1E2V A;  1EEI D;  3QOL A;  2F0G A;  4M8A A;  4DA2 A;  5D65 A;  1SYC A;  3TP7 A;  4ZUI A;  2NN6 I;  2V4D A;  2WP8 J;  2LKV A;  2F0T A;  1B2T A;  2B2V A;  4OIJ A;  3K7A B;  4BA2 I;  2MUY A;  3I91 A;  3URY A;  1MSH A;  4AYB B;  4IUQ A;  2HQE A;  2LY7 A;  1QNU A;  3LNN A;  3PO2 B;  3KUP A;  2XNA C;  3MAQ A;  1TS5 A;  2K32 A;  1C4Q A;  3D8G A;  4CGY B;  1SYG A;  3MTS A;  2O4X A;  1HQR D;  1JQY D;  4A93 B;  2JA6 B;  1AEX A;  1KNE A;  2KCN A;  2B2U C;  5HGT A;  1FD7 D;  1AP0 A;  2XWB B;  1DM0 B;  1H9S A;  3NXW A;  4KHV A;  3T4A C;  2ZT9 C;  5M5Y B;  1Y1W B;  4GZY C;  3NSW A;  2PQE A;  2F0M A;  5TSS A;  1S5E D;  4RHR A;  3BG3 A;  2EYM A;  2SOB A;  3VYR A;  4BS9 A;  1BOS A;  1ENC A;  4KD3 A;  5DM6 3;  1FGB D;  2KED A;  4NMZ A;  3J80 E;  5C3X A;  1TS4 A;  4TQU S;  1GUN A;  4J1M A;  4KKS A;  3PO3 B;  4Q0F A;  2SDF A;  1D2B A;  4Z9C B;  4KY5 A;  1TY2 A;  1K83 B;  3QG1 A;  1EU4 A;  4XT3 B;  4H0L C;  1J8I A;  2QEJ C;  5CC4 A;  2AWN A;  3NK9 A;  5CV8 A;  2BE5 D;  1SFO B;  3GV6 A;  2E75 C;  1SDF A;  2EY6 A;  1DJR D;  1KLU D;  1D6E C;  2FJ2 A;  5KYI A;  1QJO A;  5K36 G;  3Q23 A;  5M5W B;  1BQQ T;  3E6Z X;  1WTX A;  1SBB B;  5KGU A;  4C3J G;  4RCN A;  5C3E B;  2A68 C;  2K33 A;  4IFD J;  1DCZ A;  3BYT B;  5EBD A;  2IX0 A;  2L5T A;  3RUZ A;  2A69 C;  5I2X A;  1IW7 C;  1EY0 A;  4RH6 A;  1LTT D;  1OXV A;  4WOR A;  5T1I A;  3HZX A;  1SSO A;  1J9O A;  1EWC A;  1SJE D;  1BR9 A;  1A3V A;  3H6M A;  2IJ0 A;  3L3O C;  1H9R A;  5J1Z A;  5E4X A;  2PZT A;  1PRT C;  5JVG 3;  1IL8 A;  1GXD C;  3S2D B;  2BDN A;  5C0X H;  2NVQ B;  4EQN A;  2C9O A;  1ZYR C;  4RWS C;  3BDC A;  1M4V A;  4M1U B;  3D4D A;  5EQ0 A;  4DF7 A;  3BDO A;  3C46 A;  2RBM A;  3S1M B;  3CQZ B;  3TZD A;  1UNS A;  3OIP A;  4BY7 B;  2KVM A;  1HPC A;  4CKE A;  2EJM A;  2NZ1 D;  5I6Y A;  1C48 A;  1QB5 D;  2O5J C;  1S5B D;  5JOB A;  4PNY A;  1GHK A;  3IFT A;  5COR A;  3H0G B;  3A54 A;  1LAB A;  4X3S A;  3MFY A;  1A3U A;  2ICE C;  2KEE A;  3DHQ A;  5ELE A;  4FF3 A;  1FNW A;  4ZQ3 A;  4XQN A;  4B9X A;  4XYO A;  4H7B A;  5JEA H;  2EDG A;  2E2I B;  1CA6 A;  3DUZ A;  4ZKB B;  2M2L A;  2C5C A;  3NHH A;  4LJZ C;  3PUV A;  1BCP C;  3BZD B;  3NTH A;  5KND A;  4H44 C;  3L9A X;  3S14 B;  2VB3 X;  1V1P A;  4PV1 C;  2PPB C;  4C3H B;  3FEW X;  3GTK B;  4OHJ A;  3IKJ A;  1JCK B;  3GO5 A;  2AQ2 B;  2ENB A;  1I4X A;  2PW5 A;  1L0X B;  2MHV A;  3PUZ A;  2J0T D;  1CZG A;  1Y69 U;  2K03 A;  4L63 B;  3S1R B;  2RQX A;  1EY6 A;  4A3M B;  1LAC A;  1B4O A;  2I07 B;  1ILP A;  3J7A F;  3OSO A;  3EA6 A;  1KNA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...