2VXWA

Structural and functional studies of the potent anti-hiv chemokine variant p2-rantes
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
FSPLSSQSSACCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-Rantes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords C-C MOTIF CHEMOKINE 5
total genus 14
structure length 69
sequence length 69
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2vxwA00
5CORA 1X3PA 5E4WC 1DOLA 1EL0A 3KBXA 3TN2A 1QE6A 3ONAB 2Q8RE 2KOLA 5EJWA 2DY8A 2EE1A 1X32A 4CJ0B 1G2SA 1SDFA 1C8CA 1NR4A 1EQTA 3IL8A 3Q6SA 4IURA 2FHTA 2R3ZA 2B2TC 2SDFA 2NZ1D 1MSGA 5D65A 3H91A 2MGSA 5EPKA 1O7YA 1QNKA 3LWEA 1NAPA 3P7JA 2KEEA 4QUCA 1HFGA 2CVRA 4X3TA 3N52A 4DN4M 2K28A 4ZK9B 3I3CA 1KNAA 2FJ2A 3UI2A 2KUMA 1XYIA 2MPMA 1IKMA 4RAUC 1TVXA 1ICWA 2D9UA 1XX8A 4U68A 2HCIA 1LV9A 4O42A 1ZXTA 1HA6A 4CJ2C 1B3AA 1DOMA 3DEOA 1G6ZA 1Q3LA 4IUVA 2M2LA 4NW2A 1WTWA 3FPUB 1NCVA 1BO0A 1O7ZA 4IUPA 1A15A 2K03A 4X3SA 5AFWA 1F2LA 3SVMA 5JJZA 1HHVA 1IL8A 1KNEA 3DEPA 3I91A 3QO2A 1U4MA 1PFBA 2RSNA 4OIJA 4X3UA 2RSOA 2FMMA 1RODA 2HUGA 3HP3A 5DNFA 1WTPA 1WTXA 1ESRA 2MJ8A 1RTOA 1F9RA 2K1BA 4XT3B 1WD0A 2X6GA 1B2TA 2X69A 1PFNA 2KEDA 1ML0D 4MHEA 5E4XA 2HDLA 5CBAE 4R9WA 5CMDA 4ZLTF 1JE4A 1J8IA 1ILPA 1HUNA 2BDNA 2B2VC 2JP1A 1HRJA 1WTVA 1VMCA 1QG7A 2KVMA 2L12A 1AZQA 1HFNA 1E0BA 1PLFA 4IUUA 4ZKCB 1IKLA 2B2VA 3I90A 1MGSA 1U4RA 2N55A 2IL8A 2NYZD 2Q8TA 4MN3A 1F9SA 1O80A 1B53A 2EPBA 2HDMA 2L4NA 3DM1A 5T1IA 1EIGA 2N88A 4IUQA 2KECA 5EQ0A 1WVLA 5D14A 4CJ1B 2H1EA 4UAIA 2B2YA 2RVLA 2K01A 4LMQD 2VXWA 3R93A 3IFDA 2JYOA 1RJTA 1SAPA 1CA5A 1U4PA 1F9PA 5EKIA 4ZKBB 4QUFA 3GV3A 2B2TA 2K05A 1CA6A 1F9QA 1NR2A 1PDQA 2XIWA 4XDXA 1VMPA 4XT1B 1AP0A 1S4ZA 2FINB 2HCCA 2K04A 2RA4A 1GUWA 4HEDA 1B50A 1WTOA 1ILQA 5COYA 4HAEA 2L11A 2X6LA 4OIKA 1JICA 1RTNA 1DOKA 1HUMA 3F2UA 1U4LA 3G7LA 5EPJA 4HSVA 2L9HA 1DZ1A 1EIHA 2B2WA 1MI2A 1CM9A 1J9OA 1BBXC 2B2YC 2FFKB 2EOTA 1WTRA 2B2UA 2J7ZA 5T1GA 3GV6A 1PFMA 1RHPA 4IUTA 1BNZA 2NWGA 4R8IA 2L1BA 4ZAIA 1G2TA 4RWSC 2DY7A 1WTQA 1BF4A 1X3QA 1WD1A 3KUPA 3TZDA 5CBEE 5EPLA 1DONA 1B4OA 1MSHA 3FDTA 4RA8A 1G91A 3MWYW 1M8AA 2B2UC 3MTSA 1EOTA 4HCSA 3I8ZA 3D6WA 1AZPA 4X3KA 2B2WC 2MP1A 1SSOA
chains in the Genus database with same CATH superfamily
2PW7A 1XMQL 3KBXA 2EY1A 1B3QA 3GTOB 2LXKA 5BR8Q 3S1MB 1VS0A 1EFWA 2WAQE 3PV0A 2IX1A 1KTKA 4GOPB 4GLAC 4JC0A 3PSIA 3CRLC 4JI7Q 1RIPA 3A55A 1EIYB 1STNA 1CTMA 3PO2H 1GUNA 2B39A 1FYCA 4O42A 1DOMA 2C5CA 3Q8DA 2RF4A 2M2LA 1PZID 2O5JC 1A15A 5IWAQ 2UXCL 3SVMA 2BE5D 4O2DA 4ZUJA 4HJ9A 1ENCA 1TU2B 3MXPA 1RTOA 4C1NI 3PO3H 4N9PA 1CFMA 3MAQA 2IT1A 3BU2A 4FF4A 3NPPA 4X66Q 1Y8OB 1I6HB 1VMCA 4LF9L 1YITA 4CDDC 3HOXG 4H7BA 4EQPA 1PZKD 2RDGA 4LNQA 2B63G 4NXNQ 3STBD 1XNRL 1Q1BA 2NZHA 3D3RA 2K14A 1K3BC 5GROA 3S17B 5EKKA 3PUYA 3HOWG 2OXPA 3S1QB 1SYFA 3JAML 1STBA 4L5QA 2E5LQ 1AE2A 1H9RA 2E2DC 3UDXA 4BBSG 2K5NA 3W2DA 4YWKA 3KFUA 2AQ1B 3CW2C 1WYDA 2AUKA 3CCUA 2O4XA 3VYRA 4A3KB 3DXJC 2Z6BA 4A3BG 2F4VL 3J80i 1Q46A 5E1FA 4HAEA 1S5DD 4KK7A 4OX9Q 1E1TA 2Q2HA 2F3VA 4JI8Q 3D8GA 5EBCA 3L7ZC 5JJKA 1KRTA 4XQQA 4LUZA 3T53B 4KLKA 5IY0A 5ELCA 1EYCA 5A2QL 3K6OA 4ABNA 3V05A 3M4YA 2MUYA 3IKJA 4HCSA 5LMUQ 1SSOA 3KLRA 4LF5L 1QZHA 1XNRQ 4IFDH 2VZAA 5LMNL 2IPKD 1VQBA 4DXFA 4X62L 2B2TC 5ELBA 5EAYA 5D65A 1QZGA 5M5WH 5EPKA 5FLXE 2JA8G 3S24A 3I73A 1ILPA 3H94A 2F0WA 2HT1A 2MPMA 3Q0AA 4NPSA 4UY8C 1VQEA 1R9TH 2HQLA 2M00A 1ZXTA 4TKOB 4ME3A 2E8GA 1JORA 4DR1Q 1HH2P 4JYAQ 5IP9H 1JWUD 1I6HH 1EYAA 1G291 1ZYRD 4A3JB 3PO2G 5K36G 4IPGA 3T13A 1GUSA 3DM3A 1ET6A 1K3RA 1KL9A 4LF7Q 3S2DB 1SN8A 4C3IG 2ZJQA 1JE4A 1KC8C 2BDNA 4V0BA 3KLSA 2JA7H 2ZTCA 2L12A 1F2MA 4GOPC 4FXDA 1GD7A 1XPOA 1SBBB 1U4RA 4L5RC 1X6OA 2IL8A 4IFDG 4QJFA 3H3VH 3AYHB 2Z4IA 1NSNS 2EXZA 3M85A 5T1IA 4UP8A 4B3SL 2OTLA 4C2MB 3UDIA 1YVCA 2H1EA 2B2YA 3C1FA 1VDZA 4FNFA 4BY1G 1RJTA 4Y52H 1U4PA 1XTCD 4GNXA 1UE5A 2K32A 3HEJA 2K05A 4A4IA 1SNPA 2F0PA 2J0TD 1CUKA 3FRPB 5HURA 1KAWA 4GKJL 1SNOA 2R7ZH 2L9HA 3RZDB 3MC0B 2WAQB 1VQCA 1CKMA 1SNCA 2B2YC 1KIXA 2UXDL 1LTSD 2K5VA 1S5BD 1RD9D 3WWVA 3GV6A 1MIUA 4DV1Q 3MXUA 4A3LG 1WTQA 1EY9A 4K2KA 2NUCA 4J1MA 1ENFA 4N9TA 2F3WA 1ZKOA 2PQAA 5JEAJ 4R4TA 5IYDH 4FF2A 1WJJA 1BOSA 5M5XH 1X3PA 3M4OB 3FPPA 1HA5A 1SDFA 4PZ7A 4NKLA 1HZ9A 2WINB 3RN2A 3IRBA 1YJWA 5G3LF 5HY6A 5FKAC 5CGKA 3HOZG 5JJLA 2VB3X 1RKNA 1V1PA 1EYGA 2E5LL 1L2FA 1LT5D 4G57A 1CHPD 3PIO3 1BUVT 3A0JA 3J81j 4PZ6A 4DA2A 1ICWA 4JYAL 5JEAG 2HCIA 1EU4A 3SXHA 3K80C 2NVYH 2JA6H 4DR4L 2BCOA 1MHWC 2CCZA 4EGVA 5C3XA 3FPUB 3AFPA 2JA8H 3GTPH 1JOQA 5E3FA 1O7IA 4NMZA 3HOYH 1TWGH 3NEMA 1PH5A 5C4ZA 2NVXH 2F0IA 4LFAQ 3NTHA 4OIJA 3MFYA 4B3TL 2SEBD 5DAUA 1WTXA 3KJOA 5H1SE 2YU9B 1A6XA 5CMDA 5CBAE 1UAPA 5IP9G 4PNYA 5DLQE 1AZQA 1PLFA 4PMBA 2I5HA 1I4XA 3OMGA 4DV7Q 1MGSA 3QJYA 4AIMA 4JBMA 4XYQA 2Q8TA 5EKLA 2R93G 4PV1C 2KECA 4FXGC 3AEVA 2WKDA 3TEHB 3GTKH 5HGTA 1JJCB 3I2ZA 1F9PA 3J81c 1HR0Q 1Y14B 1QWYA 5C3EG 4JG2A 4C3JH 3HKZE 2CH4W 2Q2UA 4X65Q 1CT1D 5M5WB 5L37A 3T56B 1B9NA 1CKOA 1AP0A 3PO3B 2LXJA 1TWCH 2PW5A 1SE4A 3PO2B 2PCFB 1TS5A 2F1MA 1N32L 2Z9HA 3NWTA 3CC7A 4HMJA 4IPCA 3T16A 1BQQT 4DV4L 3C46A 4ZAIA 3MEHA 1L0YB 1ONLA 4TQUS 4K8JA 1I50B 2LS01 1SMYC 1BF4A 1X3GA 3KUPA 3T1YL 1EQVA 1V1PB 3FKIG 3FP9A 1VQHA 2QDLA 1I4RA 4F8MA 4A3GH 1BBWA 3I8ZA 1GO3E 4GN4B 1CHQD 4X62Q 1PH4A 4BY1B 2CW0D 2EE1A 1L1OA 1XJVA 1VCIA 1E7ZA 3KDFA 3CRKC 4GKKL 4HSPA 2FHTA 4CKCA 1SYEA 2RHQB 1MSGA 3G48A 3SK4A 5JVH3 5DM73 3HZXA 1ENAA 4ZK9B 1D1KA 1FNUA 1I3QB 4MTKA 4JI6L 4JI7L 4HIOA 1SXTA 4R4OA 2E2JH 4DR7L 2MQHA 3DEOA 2LY7A 1HTPA 2XGTA 4LF4Q 1EU3A 4KY7A 2N49A 4IN3A 4B3ML 2R92H 1O7ZA 2F0JA 4LF8L 2B3GA 2XWBB 3RNUA 4GNXB 4KTAA 2IHFA 1TKWB 3NWSA 4L5SA 1KLGD 1TWFB 2PO4A 5E4XA 3KDFB 2HQEA 3HS0C 4DUYL 3JC66 1JWSD 1LTBD 2ID0A 2K75A 1WTVA 1EUJA 5D3DA 1Y1VB 3S1RH 1IKLA 3PQIA 1J5EL 4YCVA 1V8QA 2OEOA 3S1MH 4I65A 1UE7A 1XTDA 3A8JE 5FLXc 3DM1A 5FLXL 1ICFB 3K7AB 4N8X1 2K01A 5K36H 1C9OA 2JYOA 1SAPA 4RGNA 1DXMA 5IGCA 2DGYA 4FP5D 1PH9A 1QVCA 2ZT9C 5M3MG 4RH6A 3J7A5 3BVGA 3BG3A 2L11A 1VQ9A 1SLJA 4QY7A 4LFAL 4P73A 1A62A 3K57A 3T1YQ 1GHKA 1SEBD 4G7HC 3J81i 1FD7D 3RN5A 3HOYB 3OWEB 4MTNA 5IYCH 4G7OC 1HNXL 1EWHA 2FMCA 2LMCB 1DONA 1HJPA 4QGUA 1RF2D 3M3YB 3M7GA 2QKIC 2RVLA 2L15A 2BA0A 3H0GB 1FGUA 2QGQA 1UWVA 4OEMB 2Z4HA 5FK9C 2A69C 5C4HA 4A3KH 1PTOH 2A6ED 3VR5A 1EQTA 1U9RA 3HOZH 4IURA 1BR9A 2JA7G 2AUJD 4B3SQ 3H91A 4X6AH 3SK6A 4JI3L 5JVG3 3LWEA 1XNQQ 3HFZB 1CKNA 4DV2Q 2AHOB 3VYSA 2FJ2A 3QR8A 4KY6A 1VQKA 4Q0FA 2NN6I 5ELEA 1D7QA 4Y7NB 3ZYYX 3GTLH 3M4PA 1B3AA 2EJFC 4BBRB 5M3MB 1C48A 4C3JB 1NCVA 3BVZA 1GUOA 4LF7L 3K5MA 3CKIB 3E5SA 1N36L 2NVTB 1WCMB 4K0KQ 1IL8A 1EIFA 5C44H 1Y1VH 3RZDH 2R7ZB 3I56A 1N33Q 3MZ5A 3CCSA 3GP7A 5KYIA 4B3MQ 1F9RA 2UUAQ 1TQOA 1N36Q 2JQOA 4TVAB 1EZ8A 3I4NH 2IY5B 4AQYL 5C44B 1TS4A 1N33L 4FF3A 4HTHA 1X56A 3A56A 1KRSA 2Z1CA 2PMZE 2A6HC 3MXNB 4DAYB 3OOCA 3SHLA 5M5XB 3CMEA 3R8BA 1IBML 3KLWA 4WJ4A 2NN6H 1VQ6A 2QW7A 4CJ1B 2NVYB 1A8VA 3S17H 4LMQD 2IHEA 3IFDA 3CPFA 2XRSD 4P75A 3DWAA 4ZRZA 1M1KC 1D5MC 3D4WA 4A3IH 1D5ZC 4A3CH 1CA6A 4IFDI 1EFID 2H4OA 1IL2A 1L1OB 3SEBA 4QB4A 5M9OA 2K04A 3E0JA 1TY0A 1HXYD 1M4VA 2VQEL 3P75A 1GJXA 1DOKA 4A3JH 3KK7A 2EOTA 1B9MA 4YWMA 3MXNA 1FR3A 2E76C 1TWGB 5ISRA 5A35A 2SOBA 1IW7C 1Q1EA 1STYA 5CBEE 1W6JA 5BN4A 2UUCQ 2F0KA 2EVBA 3HOVH 1Q12A 5FO9B 3GTKB 4JI0Q 4MZ9A 2MO0A 3R93A 3AB9A 3K8AA 3Q22A 1BVSA 5IGFA 1NTGA 2NN6G 5EJWA 4CJ0B 1XMOQ 2JJQA 1I4PA 3M7NA 5BN3A 5LMUL 1C4QA 1HR0W 3A8IE 4AH6A 1JOOA 4DXGA 2LKVA 4BBRH 4B08A 2PQAB 4KD3A 4OWWB 2F52A 4LF4L 3U4VA 2F0OA 1A3TA 2XVSA 2ICIA 4DR1L 3I4NG 4R8NA 4CGYB 2G9HD 4DNIA 5I6YA 1PHJA 1LO5D 4IUPA 1YNJD 2WV6D 4C3JG 5JJZA 1E24A 3TZUA 4DV1L 1PH8A 4EQOA 1PFBA 1NUCA 4P74A 4C3HH 2NVQH 3I4MB 1ET9A 2KEDA 4LW1A 1V1OA 5C3EB 4R9WA 3HOUB 1BKBA 3S2DH 5IGGA 1I50H 4KI0A 3L2PA 5IYDG 4UP7A 1GUTA 3TRZA 2JA7B 2QCPX 2N55A 1EY4A 3BS1A 4OGQC 4CKEA 1XMOL 4DR6L 1BCPF 1O80A 1B53A 1W6KA 3E3XA 2RHSB 3DWQA 2IX3A 2PNHA 4GKKQ 1JQYD 3VYUA 4L5TA 1AN8A 4H44C 3ULJA 2DNEA 3HOZB 4IQZA 4IOCA 1G6PA 2E2HB 1W2BA 2B8FA 2YTXA 4LWCA 3D4RA 3NQIA 4J8QA 1KHIA 3J7AF 4ZUIA 3G7LA 2B2WA 1ZYRC 4JI5Q 3S16H 3PIPA 3CCQA 5C4JH 4A93H 4DAPA 1N34Q 1BNZA 1KABA 1KXLA 2VUMH 2F03A 2FXQA 4A3BB 4A3MH 3SK5A 1VQ7A 4B3RL 4ZYSA 3K5OA 3GTOH 4LFCL 2QA4A 2Z0SA 3VDYA 4A3DG 3VR6A 4X3KA 1LTGD 4C2MH 1UNSA 2UUBL 3A8KE 4K2LA 2KHSA 2KOLA 2JN4A 1LTID 3C1EA 4FO2A 2AKWB 5IP7G 2R3ZA 3HOXH 4P72A 4JI2Q 4KV6A 1Y1WH 2MGSA 4BY7H 1K8MA 3TP5A 3IFTA 2KEEA 1RL2A 4ID6A 3A74A 3NP8A 2A6HD 3U9SA 1BCPB 4RGTA 2QEXA 5KNCA 4K0KL 3WOEA 1LTTD 1IZ6A 1WTWA 3F8TA 3KF8B 5CR3A 2VQEQ 1KNEA 4AQYQ 3QO2A 3NE5B 2HUGA 1WTPA 1IXRA 3ULPA 3U50C 3CCEA 1X55A 5GAHC 1CQVA 2UUCL 2HDLA 2K6AA 3HGBA 1Q82C 4FDBA 4HJ5A 4DR3Q 2CWAA 4BY1H 4A3LH 3K7UC 1UUPA 1K9MC 2E2JB 2L4NA 2N88A 3RZOB 1WVLA 4DV3Q 3GTLB 1HTLD 4RCOA 1C0AA 2DJGC 4JBWA 4DKAC 1PTOD 4NDXA 3BDCA 4XT1B 1QOHA 4HEDA 1HPCA 1HZAA 1STAA 2D0PA 1DJRD 2X6LA 5KEEA 1N34L 4BA2I 2TSSA 3I4NB 5GAGC 2AMCB 3I7FA 3HOVG 3QOJA 4IO9A 1TS3A 3M9BA 5IP7H 2F0VA 4RWSC 2KCMA 5E7NA 1WD1A 3K0XA 4AYBG 2WB1G 3TZDA 4JOIC 5IGBA 3NELA 4QF4A 2B2UC 3W5OA 3TS2A 1YNXA 1VQIA 1GM5A 1PFSA 4JI4Q 1YHAA 2NBFA 2K33A 3GTQH 2F0MA 4YY3Q 4OO1H 5CV7A 1JR0D 1IBKL 1XPRA 1ASZA 2SDFA 2UUBQ 2K4KA 3UE0A 2ENBA 3GTPB 2EYOA 4KKTA 1TR5A 2WFWA 1QNKA 1E2VA 2EY6A 4KKSA 1NAPA 4BBSH 2ICEC 2CVRA 4DN4M 4DAYA 5I9PA 1XYIA 2JA5G 5KRUA 3TMEA 2RDHA 2D9UA 2LFNA 2WP8J 1LV9A 3NUCA 5GQOA 4CJ2C 1AFPA 1YHQA 1G6ZA 2A6EC 4QL5A 1QB5D 2B63H 2A69D 1STGA 2F4VQ 1HNZL 1F2YA 1E2ZA 2K7VA 1MD2D 4X3SA 1S72A 3EVQA 5CV6A 1YEZA 1EY5A 1I4HA 3HP3A 5C0XG 2F0TA 2BA1A 2Z6KC 5EGTA 4A3DB 2X69A 2XWJB 4ZQ3A 2KCCA 5KNDA 3RZOH 1D2BA 2JP1A 1VQMA 4E6IA 2AQ3B 4WORA 3CP0A 4RKLA 3TSSA 1YHBA 3FEWX 4L6TB 4I7AA 1DD2A 2F0HA 2A68D 2BOSA 2N8NA 2EPBA 3ITPA 5C5LA 4POGA 1J5EQ 4R1JA 1QNUA 1VF5C 4UAIA 2ASBA 2HIVA 1GXDC 2AQ2B 4HIMA 4KY5A 3D31A 1B70B 1D1IA 4LF6L 2NVTH 1NY4A 2BH2A 2MFIA 4GOPA 3MA2B 4HR7B 4JI3Q 1XPUA 1IYVA 2RCNA 1E1OA 1V43A 3J7YW 2ZXRA 5C0XI 2NVQB 5JOBA 5I9OA 1ILQA 1WTOA 1CK1A 2A19A 4KHZA 4A3GB 2I07B 2ES2A 1EIHA 3GO5A 4G4KA 1B44D 3CPWA 5FJ8H 2VQFQ 2EDGA 2NWGA 2VUMB 1I4GA 4JOIA 1PH1A 2SNSA 3T1HL 1EY8A 1X3QA 4ODGA 3D4DA 5M5YH 4QIWB 1OTCA 5I6WA 4AYBB 5A2QE 4RCNA 3D6WA 3K7AH 1H95A 5JPNC 2F0NA 1T9HA 4JI2L 2QDBA 1Z47A 2KENA 1KDBA 4K6DA 3OIPA 1Z7TA 4OXPA 2NZ1D 3TREA 3PIP3 4DR5Q 1FL0A 3FKIB 2EJMA 1UEBA 5AJ3L 2F0LA 3ERSX 5ELFA 2DJFC 3NENA 2KUMA 1TVXA 2VY3A 3FKIH 4DNRB 3TDQA 4DR2L 4GKJQ 3CCRA 2NVXB 2EY2A 4K8IA 1OXVA 3QOLA 3MEFA 1BO0A 2CFMA 4BWGB 5GAEC 3ERQA 5IOCA 1HZBA 2V1CC 2PPBC 4DAVA 1D8LA 2L5TA 5NUCA 1SJED 2XNAC 2YTYA 1I3QH 2UXCQ 4MHEA 3BDLA 3HOVB 3KJPA 5GADC 1JWMD 1P16A 5FOBB 1YNNC 1R4PB 4DV5L 2PNRC 4YIJA 2F4IA 3BVMA 5IGEA 4P71A 4L8JA 3OPOA 1F9SA 2EYLA 1GKHA 3T51B 5I2XA 1HCZA 1PYSB 4A3FH 1AH9A 1CZGA 1A0IA 1TWFH 3UE1A 4YWLA 1CZWA 4GN5A 3U58A 4IPDA 5G3LD 2K5QA 1E3PA 2MNAA 3OSOA 4RKBA 3Q24A 2PYKA 5M3MH 1K28A 1KDCA 3SDZA 4N8FA 1XNQL 1UE1A 3MXGA 4WJWA 5M3FH 2IJ0A 1H9KA 3EJIA 1STHA 3CCLA 2F0QA 4HMIA 5M3FB 1YI2A 1J9OA 2JA5H 4O1NA 1EOVA 1Y8PB 2DUDA 2JE6I 1L1OC 1PTOB 5KNBA 5J1ZA 4JI1Q 2UUAL 1A3VA 1B4OA 2ZJRA 1JC7A 1SE2A 3GTGH 1LTAD 1GUWA 1LUZA 5CORA 3PUWA 1DOLA 2Y0SG 3ICEA 1GOZA 1QE6A 3DMUA 1T5EA 4EQ5A 1VQJA 3AQQA 1O78A 2KHJA 1NMFA 4BXXG 4DUZL 1FJGQ 2ZJPA 3TP6A 3ZJYC 3S1NH 1A3UA 1O7YA 4PMWA 3I4OA 3H0GG 3I3CA 1KNAA 3VA7A 2VNUD 4RAUC 1Y1VG 1NE3A 1XX8A 5IWAL 4FVMA 4FYDA 1S5FD 5C4XH 5CC4A 1TIID 4ZCKA 2P5ZX 1IHZA 3PF4A 2K03A 3ULLA 1I4QA 5IYCG 4OONA 3I91A 1Q8KA 2PI2A 3DHQA 2JEAI 4H02A 2EYFA 3N6RA 4JI1L 3LNNA 2VQFL 5IYBG 5ELNA 5KYLA 4DK0A 3TP7A 1P8LA 1K0SA 3GD7A 4LJZC 2OCEA 5IT9L 2L55A 1AW7A 5LMNQ 1PYBA 1HQMC 3PF5A 4LF9Q 4LF5Q 3AU7A 1QUQA 1YZ6A 1PH7A 1SNDA 3J80L 1Y1WG 3MHBA 1W3SA 1SR3A 1SNMA 2GN5A 2UXBL 4KJOA 1PTOC 4OO1I 1NR2A 2A5HA 1PDQA 1VQAA 1VQNA 3PGZA 2E75C 4XDXA 2JXMB 3CF5A 4A3DH 1JB7A 1JICA 3QIAA 5EPJA 3F1ZA 2N3SA 3I4MH 1CM9A 4JVZA 1PVOA 3JAMc 5JPMC 5T1GA 1B8AA 3GTGB 5M3FG 4A3IB 4LFBQ 2AWOA 1SYDA 4A3EH 4C56C 4K5XA 2RCFA 2DY7A 3BJUA 3OIQA 4DV6Q 2Y0SE 4JK1C 3OW7A 2KCNA 5EPLA 1PH2A 3FDTA 4RA8A 3CHBD 1JMCA 3HKSA 2C35B 3S1NB 2XRQD 1SYCA 3H15A 3TN2A 4B3RQ 3ONAB 1TT2A 3M4QA 1JCKB 2DY8A 2YYZA 1OXUA 3U9OA 1E2WA 1OXTA 1QJOA 3A54A 4JI6Q 1S3OA 2I46A 1PRTF 3MFGA 3GTMH 2UXBQ 4GZYC 3GDEA 1UEAB 2F0FA 1IKMA 2E74C 3TP8A 5JAVA 3URYA 1HA6A 4NXMQ 4DV2L 2O2LD 4GLVB 1NBWA 3KYHC 5DM63 1TWHB 2V4DA 1FNVA 2EYMA 3NHHA 4KJNA 1J6QA 3GTQB 1R9TB 1CSQA 1CKNB 1NNXA 1X3EA 4LF8Q 2JA5B 1PMRA 1ML0D 2NB0A 1QILA 3K5LA 3T1HQ 5K5PA 4RHRA 4J15A 4XXEA 1DCZA 3D6CA 1JE5A 4K6LA 1QCBD 2CHBD 4XYOA 1S5ED 3ND9A 3S15B 4A3KG 1SNQA 4O0AA 2CW0C 1IYUA 4OO1G 3BZKA 4NXNL 4C3HB 3I4MG 4R4IA 2B8GA 5D14A 3VR2A 4KD4A 1CQFA 4POFA 1I94L 3NBIA 1PH6A 2EZVA 1H9JA 4BBSB 4X65L 1LTRD 1VQDA 3VR4A 3H3VI 4HN7A 4ILWA 4OELB 4DR5L 1IBLQ 1OO9B 5FO7B 2F0EA 3RMHA 2AWNA 4IJHA 4X64L 1L0XB 1PTOF 3RD4A 2UXDQ 2HCCA 4L63B 5F2DA 3AFQA 4OIKA 3CCMA 1HUMA 5BN5A 1JT8A 1MI2A 1K73C 2IW3A 3JAME 1WTRA 2VS1A 3OW2A 5HGQA 2BDOA 4JPBW 1HZCA 2E2HH 1B1ZA 1V9PA 1LACA 3OTOQ 1GVPA 2MHVA 3D0FA 2PI2E 4CDEC 3E9IA 5IT9c 4DGZA 2QEJC 1Q81C 4F87A 4DR3L 1WCMH 1EL0A 4EX5A 1PA6A 3E0EA 3I72A 1DYQA 1K83B 3TS0A 1C8CA 5IIFA 1VQOA 4FXKC 4A76A 2R6GA 3J80c 4KHPL 3EBEA 2UU9L 4UHVA 1QVFA 4HJAA 4WFN3 2HIXA 3OMCA 3L3OC 2O5IC 1FNWA 1PZJD 2GVAA 3N52A 4X3TA 2K28A 4U68A 2R93B 2XN9C 5M5YB 3DLLA 2EIFA 3A7LA 1LLRD 4HJ7A 1JOKA 3KF6B 3E6ZX 4ULLA 3HOXB 3PUVA 1JB3A 2K5DA 4CKBA 1VF7A 4A3JG 5JEAH 1DGSA 1D6EC 1U4MA 3RR5A 4RMFA 1RODA 1BCPC 2K1BA 2WACA 3S1QH 1PRTB 2X6GA 4RFBA 3PO3G 1TY2A 3GQBA 4ZKCB 1MBYA 4AYBE 4LFCQ 3I70A 1X3FA 3EFXD 2KCTA 2NYZD 4MN3A 1A2UA 1LT4D 2A74C 1SROA 5CYUA 1A63A 5FLMG 2JA6B 4CHTB 2IWHA 2OQKA 1CSPA 4FF1A 1G51A 2GVBA 5TSSA 1MKHA 4HIDA 1EQQA 5J22A 3WOFA 5I2YA 2Z8LA 3CU7A 1H9MA 3R3OA 4R4CA 3FVQA 1Q90A 1EYDA 5C3WA 3BYYB 4A3EG 2VL6A 1HNZQ 1QVGA 1FVIA 3DUZA 2N78A 1XXGA 3K81C 1DZ1A 1SMXA 3F2CA 3LX0A 1YJ9A 3U4ZA 4TRDA 4A3MB 3RLOA 1WOCA 3G6JB 2QILA 1PFMA 1RHPA 3KF8A 4GLXA 4RGOS 3V96A 3S14H 1K0RA 4KHVA 3T4AC 4DK3C 1O7LA 3R2IA 2TMPA 1ZEQX 1G91A 3MWYW 1I6VC 2D5DA 1PRTD 1AZPA 1LABA 4XIGS 3BYTB 3KOJA 1MJCA 2CWPA 1GHJA 1VQ5A 2RKSA 4DK1A 2Q8RE 3GTJB 5KIXA 1TWCB 3B6YA 4A93G 3IL8A 3Q6SA 2YTVA 1PYWD 3HOUH 4OHJA 4G7ZC 1OXSC 4RHSA 1WCMG 3HKZB 2WAQG 3G71A 4LF6Q 4IZ8A 5C5MA 3RLFA 1II3A 2K52A 4LK1C 4LUOA 5IE8A 4C1NK 1LT6D 4KKUA 5KGUA 1TWHH 3V2TA 4NW2A 3EQLC 5AFWA 3DEPA 3BDOA 4APVA 2RSNA 3X3MA 4V190 3CD6A 2RSOA 1N9WA 1ESRA 2D0OA 1B2TA 2ZM6Q 1PFNA 1IW7D 2G5DA 4PG3A 4ZLTF 3C2PA 1HUNA 1Q8IA 5CV8A 3BZDB 3LWUA 3OTOL 5LHY1 1QG7A 2KVMA 2IX0A 3W1BA 4U673 4IUUA 2B2VA 1LT3D 1YJNA 2R92G 2E2IB 1FGBD 1VQPA 1H9SA 2RDFA 3C3LA 4R4QA 2OWOA 2UU9Q 1IBLL 2Y0SB 2OT2A 3ER0A 1TWAB 1Z9FA 4A3BH 2F0GA 1CA5A 4NB3A 4GS3A 3PMFA 4BS9A 3P1HA 4PMCA 4KN7C 1Q86C 1SMYD 4A3FG 4QUFA 3GV3A 1I5FA 3S16B 1F77A 5LMNW 4UPAA 3CC2A 1Y69U 3HKZG 3CCJA 4M8AA 1S4ZA 1EZ6A 4MIUA 2G9DA 2L0CA 2C9OA 1JJ2A 3L9AX 5C6AA 2PQEA 4K5WA 1BBXC 4BY7B 2PZUA 4GN3B 4DV6L 4B3TQ 4K14A 1HNXQ 2ZXPA 4IUTA 2KHIA 3J81E 1EEFD 2D2CC 4IPHA 3GTJH 4JI5L 1EY7A 1TXYA 1VQFA 4X66L 1EOTA 1VQ4A 3HOWB 2VB2X 4IUNA 4K5VA 4H13C 5CV9A 1X32A 3I4LA 2F0UA 4OL7A 1NR4A 1E22A 3S15H 4EQNA 3FHWA 2EJGC 4JI4L 1XWEA 1XMQQ 1PXUA 4XQJA 1ESFA 2OF1A 2CKZB 3P7JA 4KHPQ 1AEXA 1S5CD 2F0DA 1HFGA 1OXXK 2R93H 3CCVA 3M4OH 4QCLA 2HD3A 2YV5A 3HOUG 4X64Q 5FO8B 2KA7A 3STBC 5C4XB 2A73B 4JBJA 1S40A 2D62A 1F2LA 4A3EB 3X3NA 1HHVA 4OX9L 4RG1A 4X3UA 4JCVE 4MNOA 2MJ8A 4XT3B 5ELDA 1EWCA 2PMZB 3NSWA 3A7AB 3VYTA 4DV5Q 2Q8IB 2EYJA 1AE3A 3NTIA 2B2VC 4UDUC 3GTMB 5I4DA 1IBMQ 4QQBX 5D3IB 4A93B 5FJ8G 4KN4C 1Z6HA 2EQSA 4YY3L 4Y7NH 1ASYA 2I5MX 2YU9H 5EQ0A 2LSSA 3K0YA 1RDPD 1LYLA 2SNMA 3QG1A 4OWXB 4DV0L 2EY5A 3HOYG 4BXXH 1STEA 4A75A 3UDGA 4NXML 4J6HA 3SR1A 3K5NA 4M1UB 5LL6S 3S2HB 3LGJA 1HQRD 1VMPA 4XQNA 2FINB 2RA4A 5DEHA 3F2UA 2GA4B 1KLUD 1VQGA 1D5XC 1WFQA 2J7ZA 5J3BA 2NTSA 4DFAA 5C0XH 4R8IA 2L1BA 4BY7G 3SE0A 1EWIA 2WIIB 2VUMG 4GNXC 2WKCA 4HIKA 4A3IG 4A3CG 5EBDA 4HCEA 3UDFA 2PZTA 5IT9E 3R2TA 1SJHD 3CQZB 3KBGA 3MTSA 4CBVA 2ZXOA 2I0QA 1YIJA 3RLNA 4A3GG 5JJIA 5E4WC 3G4SA 2K5HA 3NTKA 5IYBH 4C3IH 2JEBI 1RCVD 1WI5A 1G2SA 5IGDA 3NQTA 4JI0L 1JJGA 2CQOA 3KF6A 4B9WA 2JK8A 4CDCC 3TQYA 2A1AA 3H09A 1U0LA 5CV5A 4CDFC 4DV0Q 3J7AV 3KLSX 4YHHL 2Z6KA 3CMAA 3E9HA 4F7XA 3L0OA 2PZWA 5C44G 2BH8A 1PV4A 4DK6C 1Q3LA 4IUVA 3IAYA 3A5UA 2WB1B 3PUZA 4DU9A 3S14B 2RQXA 3S1RB 1EY6A 4H0LC 4DR7Q 4DV4Q 2CH4A 2R7ZG 1SE8A 2M9VA 2MO1A 1SFOB 2J4XA 2KJXA 4IOAA 5DNFA 4JI8L 1WD0A 1EEID 1BCPD 4YCUA 1LTLA 1UE6A 3H6MA 2A8VA 3CAMA 4DF7A 3OYYA 1SFOH 1M90C 1HRJA 1V1QA 5ELOA 2VW9A 3S9WA 3OHXC 2KBNA 3I90A 1QUQB 3O13A 4P2CB 1VQLA 3CC4A 1YBYA 3WDNA 2NZOA 1TWAH 5C3EH 2HDMA 1EIGA 4LUVA 1TS2A 4IUQA 1HR0L 4QIWE 3HOWH 2DN8A 3NBHB 4XTCS 1IBKQ 2BE5C 4RGMA 4BBRG 2VXWA 4C3HG 4ME5A 1CI3M 3F2BA 1KDAA 2Q2IA 3QWNA 1EY0A 3JAMi 4JW0A 1NJIC 1YNND 2B2TA 3F2DA 1N32Q 3NXWA 1KQSA 1YNJC 5IODA 1K8OA 3EA6A 1DM0B 1B50A 3VR3A 3OWFA 2ZTDA 5J39A 2JA9A 1NMGA 4UP9A 2XSCA 1U4LA 4HSVA 3HG9A 3Q23A 3H0GH 2FFKB 5LL6X 1WTHA 2I5LX 4I7ZC 1R4QB 4OWTB 3SK8A 4DNTB 3QB3A 5C4XG 4DUYQ 2B63B 3W1GA 2NTTA 4LFBL 1U5KA 3AMUA 1EQRA 4YCWA 4WJ3M 1M8AA 1SRUA 3K58A 4JV5Q 5CV4A 3FMCA 2B2WC 2MP1A 4ALPA 2WB1E 3J81L 5FLMH 4NP5A 2A68C 4LAAA 4DV7L 1X65A 4BA1I 1B7YB 4A3MG 2Q2TA 2ATWA 1Y8NB 2E2IH 4IJLA 5AJ3Q 4DR6Q 4DPGA 4QMGA 4TSSA 1X54A 2JA6G 2B29A 3RUZA 3P20A 5C0XJ 3PCOB 4KMUC 5BR8L 4DR2Q 1VQ8A 3EROA 2OQ0A 1K8AC 3M3YH 1IYJB 5C4JB 1SE3A 4QUCA 1A2TA 1H9SB 1PRTC 3UI2A 1BBUA 2HHHL 4WRDA 2JSOA 4HJ8A 1HNWL 2H5XA 1N8RC 2R92B 4YHHQ 2ZTEA 1BDOA 1Y1WB 2EYPA 3G6EA 2R7DA 3J7ZC 1MJEA 3J80E 2FMMA 1F2ZA 1KD1C 3PUXA 4A3FB 4EVOA 3HRZC 1J8IA 2R7FA 3W3AA 4JV5L 4PQXA 2F0SA 1GUGA 1K83H 1HFNA 1X9NA 1E0BA 1BXTA 4DV3L 2ALYB 1C7YA 3CQZH 2K5WA 2EXDA 2DNCA 1K8GA 1KAAA 3I55A 4IALA 3SGIA 4B9XA 1FJGL 3NK9A 2EYHA 4PZ8A 1PH3A 2QF7A 3EIVA 5EKIA 3S2HH 1L0WA 2HHHQ 4ZKBB 1HNWQ 1I94Q 2OTJA 1SYBA 2F3IA 3A5ZB 1F9QA 3EN2A 1SYGA 2XIWA 3BZCA 4JBKA 2JA8B 5COYA 4S3SA 4IFDJ 1RTNA 4DR4Q 4Z9CB 3CXCA 2K50A 1G8ZD 2R61A 2B2UA 4DAMA 3ND8A 3VA5A 4F88A 2ZM6L 4Q5VA 1G2TA 1T5XD 2XTIA 1Q7YC 3MVVA 3H3VC 3PIOA 3NBHA 1MSHA 3K59A 2KQ3A 1LM0A 2CQAA 2RBMA 4C3IB 4DUZQ 3DWPA 3TBIB
chains in the Genus database with same CATH topology
2PW7A 3KBXA 2EY1A 3GTOB 3S1MB 3PV0A 2IX1A 1KTKA 3CRLC 3A55A 1STNA 1CTMA 1GUNA 2B39A 1FYCA 4O42A 1DOMA 2C5CA 2M2LA 1PZID 2O5JC 1A15A 3SVMA 2BE5D 4ZUJA 1ENCA 1TU2B 3MXPA 1RTOA 4C1NI 4N9PA 1CFMA 3MAQA 2IT1A 4FF4A 3NPPA 1Y8OB 1I6HB 1VMCA 4H7BA 4EQPA 1PZKD 2RDGA 1Q1BA 3D3RA 3S17B 5EKKA 3PUYA 2OXPA 3S1QB 1SYFA 3JAML 1STBA 1H9RA 2E2DC 3W2DA 2AQ1B 2AUKA 2O4XA 3VYRA 4A3KB 3DXJC 5E1FA 4HAEA 1S5DD 4KK7A 2F3VA 3D8GA 5EBCA 3L7ZC 4XQQA 3T53B 5ELCA 1EYCA 5A2QL 3K6OA 4ABNA 3V05A 3M4YA 2MUYA 3IKJA 4HCSA 1SSOA 3KLRA 4IFDH 2IPKD 4DXFA 2B2TC 5ELBA 5D65A 5EPKA 5FLXE 3I73A 1ILPA 3H94A 2F0WA 2MPMA 3Q0AA 2M00A 1ZXTA 4TKOB 1JORA 1JWUD 1EYAA 1G291 1ZYRD 4A3JB 5K36G 3T13A 1GUSA 1ET6A 3S2DB 4C3IG 1JE4A 2BDNA 4V0BA 3KLSA 2L12A 1F2MA 4FXDA 1SBBB 1U4RA 2IL8A 4IFDG 2Z4IA 1NSNS 2EXZA 3M85A 5T1IA 4C2MB 2H1EA 2B2YA 3C1FA 1VDZA 4FNFA 1RJTA 1U4PA 1XTCD 2K32A 3HEJA 2K05A 1SNPA 2F0PA 2J0TD 3FRPB 5HURA 1SNOA 2L9HA 3RZDB 3MC0B 2WAQB 1SNCA 2B2YC 1LTSD 1S5BD 1RD9D 3GV6A 3MXUA 1WTQA 1EY9A 4K2KA 2NUCA 4J1MA 1ENFA 4N9TA 2F3WA 1ZKOA 5JEAJ 4FF2A 1BOSA 1X3PA 3M4OB 3FPPA 1HA5A 1SDFA 4NKLA 2WINB 5G3LF 5FKAC 5CGKA 2VB3X 1RKNA 1V1PA 4G57A 1LT5D 1CHPD 3PIO3 1BUVT 4DA2A 1ICWA 5JEAG 2HCIA 1EU4A 3SXHA 2BCOA 4EGVA 5C3XA 3FPUB 1JOQA 5E3FA 4NMZA 5C4ZA 2F0IA 3NTHA 4OIJA 3MFYA 2SEBD 5DAUA 1WTXA 2YU9B 1A6XA 5CMDA 5CBAE 1UAPA 4PNYA 1AZQA 1PLFA 4PMBA 1I4XA 3OMGA 1MGSA 3QJYA 4XYQA 2Q8TA 5EKLA 4PV1C 2KECA 4FXGC 2WKDA 5HGTA 1F9PA 1QWYA 5M5WB 1CT1D 3T56B 1B9NA 1AP0A 3PO3B 3PO2B 2PW5A 1SE4A 2PCFB 1TS5A 2F1MA 3NWTA 4HMJA 3T16A 1BQQT 3C46A 4ZAIA 3MEHA 1L0YB 1ONLA 4TQUS 4K8JA 1I50B 2LS01 1SMYC 1BF4A 3KUPA 1EQVA 1V1PB 1I4RA 4F8MA 3I8ZA 1CHQD 4BY1B 2CW0D 2EE1A 1VCIA 3CRKC 4HSPA 2FHTA 4CKCA 1SYEA 1MSGA 3SK4A 5JVH3 5DM73 3HZXA 1ENAA 4ZK9B 1D1KA 1FNUA 1I3QB 1SXTA 3DEOA 2LY7A 1HTPA 1EU3A 4KY7A 4IN3A 1O7ZA 2F0JA 2XWBB 4KTAA 1TKWB 3NWSA 1KLGD 1TWFB 2PO4A 5E4XA 2HQEA 3HS0C 1JWSD 1LTBD 2ID0A 1WTVA 5D3DA 1Y1VB 1IKLA 1V8QA 2OEOA 4I65A 3A8JE 3DM1A 5FLXL 3K7AB 2K01A 5K36H 2JYOA 1SAPA 4RGNA 1DXMA 5IGCA 4FP5D 2ZT9C 4RH6A 3BVGA 3BG3A 2L11A 3K57A 1GHKA 1SEBD 4G7HC 1FD7D 3HOYB 3OWEB 4G7OC 1EWHA 2FMCA 2LMCB 1DONA 1RF2D 3M3YB 3M7GA 2QKIC 2RVLA 2BA0A 3H0GB 2Z4HA 5FK9C 2A69C 5C4HA 1PTOH 2A6ED 3VR5A 1EQTA 1U9RA 4IURA 1BR9A 2AUJD 3H91A 3SK6A 5JVG3 3LWEA 3VYSA 2FJ2A 4KY6A 4Q0FA 2NN6I 5ELEA 4Y7NB 3ZYYX 1B3AA 2EJFC 4BBRB 5M3MB 1C48A 4C3JB 1NCVA 3BVZA 1GUOA 3K5MA 3CKIB 3E5SA 2NVTB 1WCMB 1IL8A 2R7ZB 3MZ5A 3GP7A 5KYIA 1F9RA 1TQOA 1EZ8A 5C44B 1TS4A 4FF3A 4HTHA 3A56A 2Z1CA 2A6HC 3OOCA 3SHLA 5M5XB 3R8BA 2NN6H 4CJ1B 2NVYB 4LMQD 3IFDA 2XRSD 3DWAA 4ZRZA 1D5MC 3D4WA 1D5ZC 1CA6A 4IFDI 1EFID 2H4OA 3SEBA 4QB4A 5M9OA 2K04A 3E0JA 1TY0A 1HXYD 1M4VA 3P75A 1GJXA 1DOKA 3KK7A 2EOTA 1B9MA 3MXNA 1FR3A 2E76C 1TWGB 5ISRA 5A35A 2SOBA 1IW7C 1Q1EA 1STYA 5CBEE 1W6JA 5BN4A 2F0KA 2EVBA 1Q12A 5FO9B 3GTKB 3R93A 3AB9A 3Q22A 5IGFA 2NN6G 5EJWA 4CJ0B 1I4PA 3M7NA 5BN3A 1C4QA 3A8IE 1JOOA 4DXGA 2LKVA 4B08A 4KD3A 2F0OA 1A3TA 2XVSA 2ICIA 4R8NA 4CGYB 2G9HD 5I6YA 1LO5D 4IUPA 1YNJD 2WV6D 4C3JG 5JJZA 3TZUA 4EQOA 1PFBA 1NUCA 3I4MB 1ET9A 2KEDA 1V1OA 5C3EB 4R9WA 3HOUB 5IGGA 4KI0A 1GUTA 2JA7B 2QCPX 2N55A 1EY4A 3BS1A 4OGQC 4CKEA 1BCPF 1O80A 1B53A 1W6KA 3DWQA 2IX3A 1JQYD 3VYUA 1AN8A 4H44C 2DNEA 3HOZB 4IQZA 2E2HB 2B8FA 3D4RA 3NQIA 4J8QA 3J7AF 4ZUIA 3G7LA 2B2WA 1ZYRC 4DAPA 1BNZA 1KABA 2F03A 4A3BB 3SK5A 4ZYSA 3K5OA 3VR6A 4X3KA 1LTGD 1UNSA 3A8KE 4K2LA 2KHSA 2KOLA 1LTID 3C1EA 4FO2A 2R3ZA 4KV6A 2MGSA 1K8MA 3TP5A 3IFTA 2KEEA 4ID6A 3NP8A 2A6HD 3U9SA 1BCPB 4RGTA 5KNCA 3WOEA 1LTTD 1WTWA 5CR3A 1KNEA 3QO2A 3NE5B 2HUGA 1WTPA 1CQVA 2HDLA 2K6AA 3HGBA 1UUPA 2E2JB 2L4NA 2N88A 3RZOB 1WVLA 3GTLB 1HTLD 4RCOA 4JBWA 1PTOD 4NDXA 3BDCA 4XT1B 1QOHA 4HEDA 1HPCA 1STAA 1DJRD 2X6LA 5KEEA 4BA2I 2TSSA 3I4NB 3QOJA 1TS3A 2F0VA 4RWSC 1WD1A 3TZDA 5IGBA 4QF4A 2B2UC 2NBFA 2K33A 2F0MA 4OO1H 5CV7A 1JR0D 2SDFA 2ENBA 3GTPB 2EYOA 4KKTA 1TR5A 1QNKA 1E2VA 2EY6A 4KKSA 1NAPA 4DN4M 2ICEC 2CVRA 5I9PA 4DAYA 1XYIA 5KRUA 3TMEA 2RDHA 2D9UA 2LFNA 2WP8J 1LV9A 3NUCA 4CJ2C 1AFPA 1G6ZA 2A6EC 1QB5D 2A69D 1STGA 1F2YA 1E2ZA 2K7VA 1MD2D 4X3SA 3EVQA 5CV6A 1EY5A 1I4HA 3HP3A 5C0XG 2F0TA 2BA1A 5EGTA 4A3DB 2X69A 2XWJB 4ZQ3A 2KCCA 5KNDA 1D2BA 2JP1A 4E6IA 2AQ3B 4WORA 4RKLA 3TSSA 3FEWX 4L6TB 1DD2A 2F0HA 2A68D 2BOSA 2EPBA 3ITPA 5C5LA 1QNUA 1VF5C 4UAIA 1GXDC 2AQ2B 4KY5A 3D31A 1D1IA 1IYVA 3MA2B 4HR7B 1V43A 3J7YW 2ZXRA 5C0XI 2NVQB 5JOBA 5I9OA 1ILQA 1WTOA 1CK1A 4KHZA 4A3GB 2I07B 1EIHA 3GO5A 4G4KA 1B44D 2EDGA 2NWGA 2VUMB 1I4GA 2SNSA 1EY8A 1X3QA 4ODGA 3D4DA 4QIWB 5I6WA 4AYBB 5A2QE 4RCNA 3D6WA 5JPNC 2F0NA 2QDBA 1Z47A 1KDBA 4K6DA 3OIPA 1Z7TA 2NZ1D 3PIP3 3FKIB 2EJMA 2F0LA 5ELFA 2KUMA 1TVXA 4DNRB 3TDQA 2NVXB 2EY2A 4K8IA 1OXVA 3QOLA 1BO0A 4BWGB 3ERQA 5IOCA 2PPBC 4DAVA 2L5TA 5NUCA 1SJED 2XNAC 4MHEA 3BDLA 3HOVB 1JWMD 5FOBB 1YNNC 1R4PB 2PNRC 4YIJA 2F4IA 3BVMA 5IGEA 4L8JA 3OPOA 1F9SA 2EYLA 3T51B 5I2XA 1HCZA 1CZGA 1CZWA 5G3LD 2K5QA 3OSOA 4RKBA 3Q24A 2PYKA 3SDZA 1KDCA 3MXGA 4WJWA 2IJ0A 1H9KA 3EJIA 1STHA 5M3FB 2F0QA 4HMIA 1J9OA 4O1NA 1Y8PB 2JE6I 1PTOB 5KNBA 5J1ZA 1A3VA 1B4OA 1JC7A 1SE2A 1LTAD 1GUWA 5CORA 3PUWA 1DOLA 1GOZA 1QE6A 3DMUA 1T5EA 1O78A 3TP6A 1A3UA 1O7YA 4PMWA 3I3CA 1KNAA 3VA7A 2VNUD 4RAUC 1XX8A 4FVMA 4FYDA 1S5FD 5CC4A 1TIID 1IHZA 2K03A 1I4QA 3I91A 3DHQA 2JEAI 2EYFA 3N6RA 3LNNA 5KYLA 4DK0A 3TP7A 3GD7A 4LJZC 5IT9L 2L55A 1AW7A 1HQMC 3AU7A 1SNDA 3J80L 3MHBA 1SNMA 4KJOA 1PTOC 4OO1I 1NR2A 2A5HA 1PDQA 2E75C 4XDXA 2JXMB 1JICA 3QIAA 5EPJA 1CM9A 5JPMC 5T1GA 3GTGB 4A3IB 2AWOA 1SYDA 4C56C 4K5XA 3OIQA 2DY7A 4JK1C 3OW7A 2KCNA 5EPLA 3FDTA 4RA8A 3CHBD 3S1NB 2XRQD 1SYCA 3TN2A 3ONAB 1TT2A 1JCKB 2DY8A 2YYZA 1OXUA 3U9OA 1E2WA 1OXTA 1QJOA 3A54A 2I46A 1PRTF 3MFGA 4GZYC 1UEAB 2F0FA 1IKMA 2E74C 3TP8A 5JAVA 3URYA 1HA6A 2O2LD 5DM63 1TWHB 2V4DA 1FNVA 2EYMA 3NHHA 4KJNA 3GTQB 1R9TB 2JA5B 1PMRA 1ML0D 2NB0A 1QILA 3K5LA 5K5PA 4RHRA 4XXEA 1DCZA 3D6CA 4K6LA 1QCBD 2CHBD 4XYOA 1S5ED 3ND9A 3S15B 1SNQA 2CW0C 1IYUA 4OO1G 4C3HB 2B8GA 5D14A 3VR2A 4KD4A 1CQFA 3NBIA 2EZVA 1H9JA 4BBSB 1LTRD 3VR4A 4HN7A 4ILWA 1OO9B 5FO7B 2F0EA 3RMHA 2AWNA 1L0XB 1PTOF 3RD4A 2HCCA 4L63B 5F2DA 4OIKA 1HUMA 5BN5A 1MI2A 2IW3A 3JAME 1WTRA 2BDOA 1B1ZA 1LACA 2MHVA 4DGZA 2QEJC 4F87A 1EL0A 3I72A 1DYQA 1K83B 1C8CA 5IIFA 4FXKC 2R6GA 4WFN3 3OMCA 3L3OC 2O5IC 1FNWA 1PZJD 4X3TA 3N52A 2K28A 4U68A 2R93B 2XN9C 5M5YB 3A7LA 1LLRD 1JOKA 3HOXB 3E6ZX 4ULLA 3PUVA 1JB3A 2K5DA 4CKBA 1VF7A 5JEAH 1D6EC 1U4MA 1RODA 1BCPC 2K1BA 2WACA 1PRTB 2X6GA 4RFBA 1TY2A 3GQBA 4ZKCB 1MBYA 3I70A 2NYZD 3EFXD 1A2UA 1LT4D 2A74C 4MN3A 5CYUA 2JA6B 4CHTB 2IWHA 4FF1A 5TSSA 5J22A 3WOFA 5I2YA 2Z8LA 3CU7A 1H9MA 3R3OA 3FVQA 1Q90A 1EYDA 5C3WA 3BYYB 3DUZA 1XXGA 1DZ1A 3LX0A 4A3MB 4TRDA 3G6JB 2QILA 1PFMA 1RHPA 3KF8A 4RGOS 3V96A 4KHVA 3T4AC 1O7LA 3R2IA 2TMPA 1ZEQX 1G91A 3MWYW 1I6VC 2D5DA 1PRTD 1AZPA 1LABA 4XIGS 3BYTB 1GHJA 2RKSA 4DK1A 2Q8RE 3GTJB 5KIXA 1TWCB 3IL8A 3Q6SA 1PYWD 4OHJA 4G7ZC 1OXSC 4RHSA 3HKZB 4IZ8A 5C5MA 3RLFA 1II3A 4LK1C 4C1NK 1LT6D 4KKUA 5KGUA 3V2TA 4NW2A 3EQLC 5AFWA 3DEPA 3BDOA 2RSNA 3X3MA 4V190 2RSOA 1ESRA 1B2TA 1PFNA 1IW7D 4ZLTF 3C2PA 1HUNA 1Q8IA 5CV8A 3BZDB 3LWUA 5LHY1 1QG7A 2KVMA 2IX0A 4U673 4IUUA 2B2VA 1LT3D 2E2IB 1FGBD 1H9SA 2RDFA 3C3LA 2Y0SB 2OT2A 1TWAB 2F0GA 1CA5A 3PMFA 4BS9A 3P1HA 4PMCA 4KN7C 1SMYD 4QUFA 3GV3A 3S16B 1F77A 1Y69U 4M8AA 1S4ZA 1EZ6A 4MIUA 2G9DA 2L0CA 2C9OA 3L9AX 5C6AA 2PQEA 4K5WA 1BBXC 4BY7B 2PZUA 4K14A 2ZXPA 4IUTA 3J81E 1EEFD 2D2CC 1EY7A 1EOTA 3HOWB 2VB2X 4IUNA 4K5VA 4H13C 5CV9A 1X32A 3I4LA 2F0UA 4OL7A 1NR4A 4EQNA 2EJGC 1XWEA 1PXUA 4XQJA 1ESFA 2OF1A 3P7JA 1AEXA 1S5CD 2F0DA 1HFGA 1OXXK 4QCLA 5FO8B 2KA7A 5C4XB 2A73B 2D62A 1F2LA 4A3EB 3X3NA 1HHVA 4X3UA 5ELDA 2MJ8A 4XT3B 3VYTA 1EWCA 2PMZB 3NSWA 3A7AB 2Q8IB 2EYJA 3NTIA 2B2VC 4UDUC 3GTMB 5I4DA 5D3IB 4A93B 4KN4C 1Z6HA 5EQ0A 3K0YA 1RDPD 2SNMA 3QG1A 2EY5A 1STEA 4J6HA 3SR1A 3K5NA 4M1UB 5LL6S 3S2HB 1HQRD 1VMPA 4XQNA 2FINB 2RA4A 5DEHA 3F2UA 2GA4B 1KLUD 1D5XC 2J7ZA 2NTSA 4DFAA 5C0XH 4R8IA 2L1BA 3SE0A 2WIIB 2WKCA 5EBDA 4HCEA 2PZTA 5IT9E 3R2TA 1SJHD 3CQZB 3KBGA 3MTSA 4CBVA 2ZXOA 5E4WC 3NTKA 2JEBI 1RCVD 1G2SA 5IGDA 3NQTA 4B9WA 3H09A 5CV5A 3J7AV 3KLSX 4F7XA 2PZWA 1Q3LA 4IUVA 3IAYA 2WB1B 3PUZA 4DU9A 3S14B 2RQXA 3S1RB 1EY6A 4H0LC 2M9VA 1SFOB 2J4XA 2KJXA 5DNFA 1WD0A 1EEID 1BCPD 3H6MA 4DF7A 1HRJA 3S9WA 3OHXC 3I90A 3O13A 4P2CB 3WDNA 2HDMA 1EIGA 1TS2A 4IUQA 2DN8A 4XTCS 2BE5C 4RGMA 2VXWA 4C3HG 4ME5A 1CI3M 1KDAA 3QWNA 1EY0A 1YNND 2B2TA 3NXWA 1YNJC 5IODA 1K8OA 3EA6A 1DM0B 1B50A 3VR3A 3OWFA 5J39A 2XSCA 1U4LA 4HSVA 3HG9A 3Q23A 2FFKB 5LL6X 4I7ZC 1R4QB 4DNTB 3SK8A 3QB3A 2B63B 2NTTA 3AMUA 1M8AA 3K58A 5CV4A 3FMCA 2B2WC 2MP1A 3J81L 4NP5A 2A68C 4LAAA 4BA1I 1Y8NB 4QMGA 4TSSA 3RUZA 3P20A 5C0XJ 4KMUC 3EROA 5C4JB 1SE3A 4QUCA 1A2TA 1H9SB 1PRTC 3UI2A 4WRDA 2JSOA 2R92B 1BDOA 1Y1WB 2EYPA 3J80E 2FMMA 1F2ZA 3PUXA 4A3FB 4EVOA 3HRZC 1J8IA 3W3AA 4PQXA 2F0SA 1GUGA 1HFNA 1E0BA 1BXTA 2K5WA 2DNCA 1KAAA 4IALA 4B9XA 3NK9A 2EYHA 2QF7A 5EKIA 4ZKBB 1SYBA 1F9QA 1SYGA 2XIWA 2JA8B 5COYA 4S3SA 4IFDJ 1RTNA 4Z9CB 1G8ZD 2R61A 2B2UA 3ND8A 3VA5A 4F88A 4Q5VA 1G2TA 1T5XD 3MVVA 3H3VC 3NBHA 1MSHA 3K59A 2KQ3A 2CQAA 2RBMA 4C3IB 3DWPA 3TBIB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5COR A;  1X3P A;  5E4W C;  1DOL A;  1EL0 A;  3KBX A;  3TN2 A;  1QE6 A;  3ONA B;  2Q8R E;  2KOL A;  5EJW A;  2DY8 A;  2EE1 A;  1X32 A;  4CJ0 B;  1G2S A;  1SDF A;  1C8C A;  1NR4 A;  1EQT A;  3IL8 A;  3Q6S A;  4IUR A;  2FHT A;  2R3Z A;  2B2T C;  2SDF A;  2NZ1 D;  1MSG A;  5D65 A;  3H91 A;  2MGS A;  5EPK A;  1O7Y A;  1QNK A;  3LWE A;  1NAP A;  3P7J A;  2KEE A;  4QUC A;  1HFG A;  2CVR A;  4X3T A;  3N52 A;  4DN4 M;  2K28 A;  4ZK9 B;  3I3C A;  1KNA A;  2FJ2 A;  3UI2 A;  2KUM A;  1XYI A;  2MPM A;  1IKM A;  4RAU C;  1TVX A;  1ICW A;  2D9U A;  1XX8 A;  4U68 A;  2HCI A;  1LV9 A;  4O42 A;  1ZXT A;  1HA6 A;  4CJ2 C;  1B3A A;  1DOM A;  3DEO A;  1G6Z A;  1Q3L A;  4IUV A;  2M2L A;  4NW2 A;  1WTW A;  3FPU B;  1NCV A;  1BO0 A;  1O7Z A;  4IUP A;  1A15 A;  2K03 A;  4X3S A;  5AFW A;  1F2L A;  3SVM A;  5JJZ A;  1HHV A;  1IL8 A;  1KNE A;  3DEP A;  3I91 A;  3QO2 A;  1U4M A;  1PFB A;  2RSN A;  4OIJ A;  4X3U A;  2RSO A;  2FMM A;  1ROD A;  2HUG A;  3HP3 A;  5DNF A;  1WTP A;  1WTX A;  1ESR A;  2MJ8 A;  1RTO A;  1F9R A;  2K1B A;  4XT3 B;  1WD0 A;  2X6G A;  1B2T A;  2X69 A;  1PFN A;  2KED A;  1ML0 D;  4MHE A;  5E4X A;  2HDL A;  5CBA E;  4R9W A;  5CMD A;  4ZLT F;  1JE4 A;  1J8I A;  1ILP A;  1HUN A;  2BDN A;  2B2V C;  2JP1 A;  1HRJ A;  1WTV A;  1VMC A;  1QG7 A;  2KVM A;  2L12 A;  1AZQ A;  1HFN A;  1E0B A;  1PLF A;  4IUU A;  4ZKC B;  1IKL A;  2B2V A;  3I90 A;  1MGS A;  1U4R A;  2N55 A;  2IL8 A;  2NYZ D;  2Q8T A;  4MN3 A;  1F9S A;  1O80 A;  1B53 A;  2EPB A;  2HDM A;  2L4N A;  3DM1 A;  5T1I A;  1EIG A;  2N88 A;  4IUQ A;  2KEC A;  5EQ0 A;  1WVL A;  5D14 A;  4CJ1 B;  2H1E A;  4UAI A;  2B2Y A;  2RVL A;  2K01 A;  4LMQ D;  2VXW A;  3R93 A;  3IFD A;  2JYO A;  1RJT A;  1SAP A;  1CA5 A;  1U4P A;  1F9P A;  5EKI A;  4ZKB B;  4QUF A;  3GV3 A;  2B2T A;  2K05 A;  1CA6 A;  1F9Q A;  1NR2 A;  1PDQ A;  2XIW A;  4XDX A;  1VMP A;  4XT1 B;  1AP0 A;  1S4Z A;  2FIN B;  2HCC A;  2K04 A;  2RA4 A;  1GUW A;  4HED A;  1B50 A;  1WTO A;  1ILQ A;  5COY A;  4HAE A;  2L11 A;  2X6L A;  4OIK A;  1JIC A;  1RTN A;  1DOK A;  1HUM A;  3F2U A;  1U4L A;  3G7L A;  5EPJ A;  4HSV A;  2L9H A;  1DZ1 A;  1EIH A;  2B2W A;  1MI2 A;  1CM9 A;  1J9O A;  1BBX C;  2B2Y C;  2FFK B;  2EOT A;  1WTR A;  2B2U A;  2J7Z A;  5T1G A;  3GV6 A;  1PFM A;  1RHP A;  4IUT A;  1BNZ A;  2NWG A;  4R8I A;  2L1B A;  4ZAI A;  1G2T A;  4RWS C;  2DY7 A;  1WTQ A;  1BF4 A;  1X3Q A;  1WD1 A;  3KUP A;  3TZD A;  5CBE E;  5EPL A;  1DON A;  1B4O A;  1MSH A;  3FDT A;  4RA8 A;  1G91 A;  3MWY W;  1M8A A;  2B2U C;  3MTS A;  1EOT A;  4HCS A;  3I8Z A;  3D6W A;  1AZP A;  4X3K A;  2B2W C;  2MP1 A;  1SSO A; 
#chains in the Genus database with same CATH topology
 2PW7 A;  1XMQ L;  3KBX A;  2EY1 A;  1B3Q A;  3GTO B;  2LXK A;  5BR8 Q;  3S1M B;  1VS0 A;  1EFW A;  2WAQ E;  3PV0 A;  2IX1 A;  1KTK A;  4GOP B;  4GLA C;  4JC0 A;  3PSI A;  3CRL C;  4JI7 Q;  1RIP A;  3A55 A;  1EIY B;  1STN A;  1CTM A;  3PO2 H;  1GUN A;  2B39 A;  1FYC A;  4O42 A;  1DOM A;  2C5C A;  3Q8D A;  2RF4 A;  2M2L A;  1PZI D;  2O5J C;  1A15 A;  5IWA Q;  2UXC L;  3SVM A;  2BE5 D;  4O2D A;  4ZUJ A;  4HJ9 A;  1ENC A;  1TU2 B;  3MXP A;  1RTO A;  4C1N I;  3PO3 H;  4N9P A;  1CFM A;  3MAQ A;  2IT1 A;  3BU2 A;  4FF4 A;  3NPP A;  4X66 Q;  1Y8O B;  1I6H B;  1VMC A;  4LF9 L;  1YIT A;  4CDD C;  3HOX G;  4H7B A;  4EQP A;  1PZK D;  2RDG A;  4LNQ A;  2B63 G;  4NXN Q;  3STB D;  1XNR L;  1Q1B A;  2NZH A;  3D3R A;  2K14 A;  1K3B C;  5GRO A;  3S17 B;  5EKK A;  3PUY A;  3HOW G;  2OXP A;  3S1Q B;  1SYF A;  3JAM L;  1STB A;  4L5Q A;  2E5L Q;  1AE2 A;  1H9R A;  2E2D C;  3UDX A;  4BBS G;  2K5N A;  3W2D A;  4YWK A;  3KFU A;  2AQ1 B;  3CW2 C;  1WYD A;  2AUK A;  3CCU A;  2O4X A;  3VYR A;  4A3K B;  3DXJ C;  2Z6B A;  4A3B G;  2F4V L;  3J80 i;  1Q46 A;  5E1F A;  4HAE A;  1S5D D;  4KK7 A;  4OX9 Q;  1E1T A;  2Q2H A;  2F3V A;  4JI8 Q;  3D8G A;  5EBC A;  3L7Z C;  5JJK A;  1KRT A;  4XQQ A;  4LUZ A;  3T53 B;  4KLK A;  5IY0 A;  5ELC A;  1EYC A;  5A2Q L;  3K6O A;  4ABN A;  3V05 A;  3M4Y A;  2MUY A;  3IKJ A;  4HCS A;  5LMU Q;  1SSO A;  3KLR A;  4LF5 L;  1QZH A;  1XNR Q;  4IFD H;  2VZA A;  5LMN L;  2IPK D;  1VQB A;  4DXF A;  4X62 L;  2B2T C;  5ELB A;  5EAY A;  5D65 A;  1QZG A;  5M5W H;  5EPK A;  5FLX E;  2JA8 G;  3S24 A;  3I73 A;  1ILP A;  3H94 A;  2F0W A;  2HT1 A;  2MPM A;  3Q0A A;  4NPS A;  4UY8 C;  1VQE A;  1R9T H;  2HQL A;  2M00 A;  1ZXT A;  4TKO B;  4ME3 A;  2E8G A;  1JOR A;  4DR1 Q;  1HH2 P;  4JYA Q;  5IP9 H;  1JWU D;  1I6H H;  1EYA A;  1G29 1;  1ZYR D;  4A3J B;  3PO2 G;  5K36 G;  4IPG A;  3T13 A;  1GUS A;  3DM3 A;  1ET6 A;  1K3R A;  1KL9 A;  4LF7 Q;  3S2D B;  1SN8 A;  4C3I G;  2ZJQ A;  1JE4 A;  1KC8 C;  2BDN A;  4V0B A;  3KLS A;  2JA7 H;  2ZTC A;  2L12 A;  1F2M A;  4GOP C;  4FXD A;  1GD7 A;  1XPO A;  1SBB B;  1U4R A;  4L5R C;  1X6O A;  2IL8 A;  4IFD G;  4QJF A;  3H3V H;  3AYH B;  2Z4I A;  1NSN S;  2EXZ A;  3M85 A;  5T1I A;  4UP8 A;  4B3S L;  2OTL A;  4C2M B;  3UDI A;  1YVC A;  2H1E A;  2B2Y A;  3C1F A;  1VDZ A;  4FNF A;  4BY1 G;  1RJT A;  4Y52 H;  1U4P A;  1XTC D;  4GNX A;  1UE5 A;  2K32 A;  3HEJ A;  2K05 A;  4A4I A;  1SNP A;  2F0P A;  2J0T D;  1CUK A;  3FRP B;  5HUR A;  1KAW A;  4GKJ L;  1SNO A;  2R7Z H;  2L9H A;  3RZD B;  3MC0 B;  2WAQ B;  1VQC A;  1CKM A;  1SNC A;  2B2Y C;  1KIX A;  2UXD L;  1LTS D;  2K5V A;  1S5B D;  1RD9 D;  3WWV A;  3GV6 A;  1MIU A;  4DV1 Q;  3MXU A;  4A3L G;  1WTQ A;  1EY9 A;  4K2K A;  2NUC A;  4J1M A;  1ENF A;  4N9T A;  2F3W A;  1ZKO A;  2PQA A;  5JEA J;  4R4T A;  5IYD H;  4FF2 A;  1WJJ A;  1BOS A;  5M5X H;  1X3P A;  3M4O B;  3FPP A;  1HA5 A;  1SDF A;  4PZ7 A;  4NKL A;  1HZ9 A;  2WIN B;  3RN2 A;  3IRB A;  1YJW A;  5G3L F;  5HY6 A;  5FKA C;  5CGK A;  3HOZ G;  5JJL A;  2VB3 X;  1RKN A;  1V1P A;  1EYG A;  2E5L L;  1L2F A;  1LT5 D;  4G57 A;  1CHP D;  3PIO 3;  1BUV T;  3A0J A;  3J81 j;  4PZ6 A;  4DA2 A;  1ICW A;  4JYA L;  5JEA G;  2HCI A;  1EU4 A;  3SXH A;  3K80 C;  2NVY H;  2JA6 H;  4DR4 L;  2BCO A;  1MHW C;  2CCZ A;  4EGV A;  5C3X A;  3FPU B;  3AFP A;  2JA8 H;  3GTP H;  1JOQ A;  5E3F A;  1O7I A;  4NMZ A;  3HOY H;  1TWG H;  3NEM A;  1PH5 A;  5C4Z A;  2NVX H;  2F0I A;  4LFA Q;  3NTH A;  4OIJ A;  3MFY A;  4B3T L;  2SEB D;  5DAU A;  1WTX A;  3KJO A;  5H1S E;  2YU9 B;  1A6X A;  5CMD A;  5CBA E;  1UAP A;  5IP9 G;  4PNY A;  5DLQ E;  1AZQ A;  1PLF A;  4PMB A;  2I5H A;  1I4X A;  3OMG A;  4DV7 Q;  1MGS A;  3QJY A;  4AIM A;  4JBM A;  4XYQ A;  2Q8T A;  5EKL A;  2R93 G;  4PV1 C;  2KEC A;  4FXG C;  3AEV A;  2WKD A;  3TEH B;  3GTK H;  5HGT A;  1JJC B;  3I2Z A;  1F9P A;  3J81 c;  1HR0 Q;  1Y14 B;  1QWY A;  5C3E G;  4JG2 A;  4C3J H;  3HKZ E;  2CH4 W;  2Q2U A;  4X65 Q;  1CT1 D;  5M5W B;  5L37 A;  3T56 B;  1B9N A;  1CKO A;  1AP0 A;  3PO3 B;  2LXJ A;  1TWC H;  2PW5 A;  1SE4 A;  3PO2 B;  2PCF B;  1TS5 A;  2F1M A;  1N32 L;  2Z9H A;  3NWT A;  3CC7 A;  4HMJ A;  4IPC A;  3T16 A;  1BQQ T;  4DV4 L;  3C46 A;  4ZAI A;  3MEH A;  1L0Y B;  1ONL A;  4TQU S;  4K8J A;  1I50 B;  2LS0 1;  1SMY C;  1BF4 A;  1X3G A;  3KUP A;  3T1Y L;  1EQV A;  1V1P B;  3FKI G;  3FP9 A;  1VQH A;  2QDL A;  1I4R A;  4F8M A;  4A3G H;  1BBW A;  3I8Z A;  1GO3 E;  4GN4 B;  1CHQ D;  4X62 Q;  1PH4 A;  4BY1 B;  2CW0 D;  2EE1 A;  1L1O A;  1XJV A;  1VCI A;  1E7Z A;  3KDF A;  3CRK C;  4GKK L;  4HSP A;  2FHT A;  4CKC A;  1SYE A;  2RHQ B;  1MSG A;  3G48 A;  3SK4 A;  5JVH 3;  5DM7 3;  3HZX A;  1ENA A;  4ZK9 B;  1D1K A;  1FNU A;  1I3Q B;  4MTK A;  4JI6 L;  4JI7 L;  4HIO A;  1SXT A;  4R4O A;  2E2J H;  4DR7 L;  2MQH A;  3DEO A;  2LY7 A;  1HTP A;  2XGT A;  4LF4 Q;  1EU3 A;  4KY7 A;  2N49 A;  4IN3 A;  4B3M L;  2R92 H;  1O7Z A;  2F0J A;  4LF8 L;  2B3G A;  2XWB B;  3RNU A;  4GNX B;  4KTA A;  2IHF A;  1TKW B;  3NWS A;  4L5S A;  1KLG D;  1TWF B;  2PO4 A;  5E4X A;  3KDF B;  2HQE A;  3HS0 C;  4DUY L;  3JC6 6;  1JWS D;  1LTB D;  2ID0 A;  2K75 A;  1WTV A;  1EUJ A;  5D3D A;  1Y1V B;  3S1R H;  1IKL A;  3PQI A;  1J5E L;  4YCV A;  1V8Q A;  2OEO A;  3S1M H;  4I65 A;  1UE7 A;  1XTD A;  3A8J E;  5FLX c;  3DM1 A;  5FLX L;  1ICF B;  3K7A B;  4N8X 1;  2K01 A;  5K36 H;  1C9O A;  2JYO A;  1SAP A;  4RGN A;  1DXM A;  5IGC A;  2DGY A;  4FP5 D;  1PH9 A;  1QVC A;  2ZT9 C;  5M3M G;  4RH6 A;  3J7A 5;  3BVG A;  3BG3 A;  2L11 A;  1VQ9 A;  1SLJ A;  4QY7 A;  4LFA L;  4P73 A;  1A62 A;  3K57 A;  3T1Y Q;  1GHK A;  1SEB D;  4G7H C;  3J81 i;  1FD7 D;  3RN5 A;  3HOY B;  3OWE B;  4MTN A;  5IYC H;  4G7O C;  1HNX L;  1EWH A;  2FMC A;  2LMC B;  1DON A;  1HJP A;  4QGU A;  1RF2 D;  3M3Y B;  3M7G A;  2QKI C;  2RVL A;  2L15 A;  2BA0 A;  3H0G B;  1FGU A;  2QGQ A;  1UWV A;  4OEM B;  2Z4H A;  5FK9 C;  2A69 C;  5C4H A;  4A3K H;  1PTO H;  2A6E D;  3VR5 A;  1EQT A;  1U9R A;  3HOZ H;  4IUR A;  1BR9 A;  2JA7 G;  2AUJ D;  4B3S Q;  3H91 A;  4X6A H;  3SK6 A;  4JI3 L;  5JVG 3;  3LWE A;  1XNQ Q;  3HFZ B;  1CKN A;  4DV2 Q;  2AHO B;  3VYS A;  2FJ2 A;  3QR8 A;  4KY6 A;  1VQK A;  4Q0F A;  2NN6 I;  5ELE A;  1D7Q A;  4Y7N B;  3ZYY X;  3GTL H;  3M4P A;  1B3A A;  2EJF C;  4BBR B;  5M3M B;  1C48 A;  4C3J B;  1NCV A;  3BVZ A;  1GUO A;  4LF7 L;  3K5M A;  3CKI B;  3E5S A;  1N36 L;  2NVT B;  1WCM B;  4K0K Q;  1IL8 A;  1EIF A;  5C44 H;  1Y1V H;  3RZD H;  2R7Z B;  3I56 A;  1N33 Q;  3MZ5 A;  3CCS A;  3GP7 A;  5KYI A;  4B3M Q;  1F9R A;  2UUA Q;  1TQO A;  1N36 Q;  2JQO A;  4TVA B;  1EZ8 A;  3I4N H;  2IY5 B;  4AQY L;  5C44 B;  1TS4 A;  1N33 L;  4FF3 A;  4HTH A;  1X56 A;  3A56 A;  1KRS A;  2Z1C A;  2PMZ E;  2A6H C;  3MXN B;  4DAY B;  3OOC A;  3SHL A;  5M5X B;  3CME A;  3R8B A;  1IBM L;  3KLW A;  4WJ4 A;  2NN6 H;  1VQ6 A;  2QW7 A;  4CJ1 B;  2NVY B;  1A8V A;  3S17 H;  4LMQ D;  2IHE A;  3IFD A;  3CPF A;  2XRS D;  4P75 A;  3DWA A;  4ZRZ A;  1M1K C;  1D5M C;  3D4W A;  4A3I H;  1D5Z C;  4A3C H;  1CA6 A;  4IFD I;  1EFI D;  2H4O A;  1IL2 A;  1L1O B;  3SEB A;  4QB4 A;  5M9O A;  2K04 A;  3E0J A;  1TY0 A;  1HXY D;  1M4V A;  2VQE L;  3P75 A;  1GJX A;  1DOK A;  4A3J H;  3KK7 A;  2EOT A;  1B9M A;  4YWM A;  3MXN A;  1FR3 A;  2E76 C;  1TWG B;  5ISR A;  5A35 A;  2SOB A;  1IW7 C;  1Q1E A;  1STY A;  5CBE E;  1W6J A;  5BN4 A;  2UUC Q;  2F0K A;  2EVB A;  3HOV H;  1Q12 A;  5FO9 B;  3GTK B;  4JI0 Q;  4MZ9 A;  2MO0 A;  3R93 A;  3AB9 A;  3K8A A;  3Q22 A;  1BVS A;  5IGF A;  1NTG A;  2NN6 G;  5EJW A;  4CJ0 B;  1XMO Q;  2JJQ A;  1I4P A;  3M7N A;  5BN3 A;  5LMU L;  1C4Q A;  1HR0 W;  3A8I E;  4AH6 A;  1JOO A;  4DXG A;  2LKV A;  4BBR H;  4B08 A;  2PQA B;  4KD3 A;  4OWW B;  2F52 A;  4LF4 L;  3U4V A;  2F0O A;  1A3T A;  2XVS A;  2ICI A;  4DR1 L;  3I4N G;  4R8N A;  4CGY B;  2G9H D;  4DNI A;  5I6Y A;  1PHJ A;  1LO5 D;  4IUP A;  1YNJ D;  2WV6 D;  4C3J G;  5JJZ A;  1E24 A;  3TZU A;  4DV1 L;  1PH8 A;  4EQO A;  1PFB A;  1NUC A;  4P74 A;  4C3H H;  2NVQ H;  3I4M B;  1ET9 A;  2KED A;  4LW1 A;  1V1O A;  5C3E B;  4R9W A;  3HOU B;  1BKB A;  3S2D H;  5IGG A;  1I50 H;  4KI0 A;  3L2P A;  5IYD G;  4UP7 A;  1GUT A;  3TRZ A;  2JA7 B;  2QCP X;  2N55 A;  1EY4 A;  3BS1 A;  4OGQ C;  4CKE A;  1XMO L;  4DR6 L;  1BCP F;  1O80 A;  1B53 A;  1W6K A;  3E3X A;  2RHS B;  3DWQ A;  2IX3 A;  2PNH A;  4GKK Q;  1JQY D;  3VYU A;  4L5T A;  1AN8 A;  4H44 C;  3ULJ A;  2DNE A;  3HOZ B;  4IQZ A;  4IOC A;  1G6P A;  2E2H B;  1W2B A;  2B8F A;  2YTX A;  4LWC A;  3D4R A;  3NQI A;  4J8Q A;  1KHI A;  3J7A F;  4ZUI A;  3G7L A;  2B2W A;  1ZYR C;  4JI5 Q;  3S16 H;  3PIP A;  3CCQ A;  5C4J H;  4A93 H;  4DAP A;  1N34 Q;  1BNZ A;  1KAB A;  1KXL A;  2VUM H;  2F03 A;  2FXQ A;  4A3B B;  4A3M H;  3SK5 A;  1VQ7 A;  4B3R L;  4ZYS A;  3K5O A;  3GTO H;  4LFC L;  2QA4 A;  2Z0S A;  3VDY A;  4A3D G;  3VR6 A;  4X3K A;  1LTG D;  4C2M H;  1UNS A;  2UUB L;  3A8K E;  4K2L A;  2KHS A;  2KOL A;  2JN4 A;  1LTI D;  3C1E A;  4FO2 A;  2AKW B;  5IP7 G;  2R3Z A;  3HOX H;  4P72 A;  4JI2 Q;  4KV6 A;  1Y1W H;  2MGS A;  4BY7 H;  1K8M A;  3TP5 A;  3IFT A;  2KEE A;  1RL2 A;  4ID6 A;  3A74 A;  3NP8 A;  2A6H D;  3U9S A;  1BCP B;  4RGT A;  2QEX A;  5KNC A;  4K0K L;  3WOE A;  1LTT D;  1IZ6 A;  1WTW A;  3F8T A;  3KF8 B;  5CR3 A;  2VQE Q;  1KNE A;  4AQY Q;  3QO2 A;  3NE5 B;  2HUG A;  1WTP A;  1IXR A;  3ULP A;  3U50 C;  3CCE A;  1X55 A;  5GAH C;  1CQV A;  2UUC L;  2HDL A;  2K6A A;  3HGB A;  1Q82 C;  4FDB A;  4HJ5 A;  4DR3 Q;  2CWA A;  4BY1 H;  4A3L H;  3K7U C;  1UUP A;  1K9M C;  2E2J B;  2L4N A;  2N88 A;  3RZO B;  1WVL A;  4DV3 Q;  3GTL B;  1HTL D;  4RCO A;  1C0A A;  2DJG C;  4JBW A;  4DKA C;  1PTO D;  4NDX A;  3BDC A;  4XT1 B;  1QOH A;  4HED A;  1HPC A;  1HZA A;  1STA A;  2D0P A;  1DJR D;  2X6L A;  5KEE A;  1N34 L;  4BA2 I;  2TSS A;  3I4N B;  5GAG C;  2AMC B;  3I7F A;  3HOV G;  3QOJ A;  4IO9 A;  1TS3 A;  3M9B A;  5IP7 H;  2F0V A;  4RWS C;  2KCM A;  5E7N A;  1WD1 A;  3K0X A;  4AYB G;  2WB1 G;  3TZD A;  4JOI C;  5IGB A;  3NEL A;  4QF4 A;  2B2U C;  3W5O A;  3TS2 A;  1YNX A;  1VQI A;  1GM5 A;  1PFS A;  4JI4 Q;  1YHA A;  2NBF A;  2K33 A;  3GTQ H;  2F0M A;  4YY3 Q;  4OO1 H;  5CV7 A;  1JR0 D;  1IBK L;  1XPR A;  1ASZ A;  2SDF A;  2UUB Q;  2K4K A;  3UE0 A;  2ENB A;  3GTP B;  2EYO A;  4KKT A;  1TR5 A;  2WFW A;  1QNK A;  1E2V A;  2EY6 A;  4KKS A;  1NAP A;  4BBS H;  2ICE C;  2CVR A;  4DN4 M;  4DAY A;  5I9P A;  1XYI A;  2JA5 G;  5KRU A;  3TME A;  2RDH A;  2D9U A;  2LFN A;  2WP8 J;  1LV9 A;  3NUC A;  5GQO A;  4CJ2 C;  1AFP A;  1YHQ A;  1G6Z A;  2A6E C;  4QL5 A;  1QB5 D;  2B63 H;  2A69 D;  1STG A;  2F4V Q;  1HNZ L;  1F2Y A;  1E2Z A;  2K7V A;  1MD2 D;  4X3S A;  1S72 A;  3EVQ A;  5CV6 A;  1YEZ A;  1EY5 A;  1I4H A;  3HP3 A;  5C0X G;  2F0T A;  2BA1 A;  2Z6K C;  5EGT A;  4A3D B;  2X69 A;  2XWJ B;  4ZQ3 A;  2KCC A;  5KND A;  3RZO H;  1D2B A;  2JP1 A;  1VQM A;  4E6I A;  2AQ3 B;  4WOR A;  3CP0 A;  4RKL A;  3TSS A;  1YHB A;  3FEW X;  4L6T B;  4I7A A;  1DD2 A;  2F0H A;  2A68 D;  2BOS A;  2N8N A;  2EPB A;  3ITP A;  5C5L A;  4POG A;  1J5E Q;  4R1J A;  1QNU A;  1VF5 C;  4UAI A;  2ASB A;  2HIV A;  1GXD C;  2AQ2 B;  4HIM A;  4KY5 A;  3D31 A;  1B70 B;  1D1I A;  4LF6 L;  2NVT H;  1NY4 A;  2BH2 A;  2MFI A;  4GOP A;  3MA2 B;  4HR7 B;  4JI3 Q;  1XPU A;  1IYV A;  2RCN A;  1E1O A;  1V43 A;  3J7Y W;  2ZXR A;  5C0X I;  2NVQ B;  5JOB A;  5I9O A;  1ILQ A;  1WTO A;  1CK1 A;  2A19 A;  4KHZ A;  4A3G B;  2I07 B;  2ES2 A;  1EIH A;  3GO5 A;  4G4K A;  1B44 D;  3CPW A;  5FJ8 H;  2VQF Q;  2EDG A;  2NWG A;  2VUM B;  1I4G A;  4JOI A;  1PH1 A;  2SNS A;  3T1H L;  1EY8 A;  1X3Q A;  4ODG A;  3D4D A;  5M5Y H;  4QIW B;  1OTC A;  5I6W A;  4AYB B;  5A2Q E;  4RCN A;  3D6W A;  3K7A H;  1H95 A;  5JPN C;  2F0N A;  1T9H A;  4JI2 L;  2QDB A;  1Z47 A;  2KEN A;  1KDB A;  4K6D A;  3OIP A;  1Z7T A;  4OXP A;  2NZ1 D;  3TRE A;  3PIP 3;  4DR5 Q;  1FL0 A;  3FKI B;  2EJM A;  1UEB A;  5AJ3 L;  2F0L A;  3ERS X;  5ELF A;  2DJF C;  3NEN A;  2KUM A;  1TVX A;  2VY3 A;  3FKI H;  4DNR B;  3TDQ A;  4DR2 L;  4GKJ Q;  3CCR A;  2NVX B;  2EY2 A;  4K8I A;  1OXV A;  3QOL A;  3MEF A;  1BO0 A;  2CFM A;  4BWG B;  5GAE C;  3ERQ A;  5IOC A;  1HZB A;  2V1C C;  2PPB C;  4DAV A;  1D8L A;  2L5T A;  5NUC A;  1SJE D;  2XNA C;  2YTY A;  1I3Q H;  2UXC Q;  4MHE A;  3BDL A;  3HOV B;  3KJP A;  5GAD C;  1JWM D;  1P16 A;  5FOB B;  1YNN C;  1R4P B;  4DV5 L;  2PNR C;  4YIJ A;  2F4I A;  3BVM A;  5IGE A;  4P71 A;  4L8J A;  3OPO A;  1F9S A;  2EYL A;  1GKH A;  3T51 B;  5I2X A;  1HCZ A;  1PYS B;  4A3F H;  1AH9 A;  1CZG A;  1A0I A;  1TWF H;  3UE1 A;  4YWL A;  1CZW A;  4GN5 A;  3U58 A;  4IPD A;  5G3L D;  2K5Q A;  1E3P A;  2MNA A;  3OSO A;  4RKB A;  3Q24 A;  2PYK A;  5M3M H;  1K28 A;  1KDC A;  3SDZ A;  4N8F A;  1XNQ L;  1UE1 A;  3MXG A;  4WJW A;  5M3F H;  2IJ0 A;  1H9K A;  3EJI A;  1STH A;  3CCL A;  2F0Q A;  4HMI A;  5M3F B;  1YI2 A;  1J9O A;  2JA5 H;  4O1N A;  1EOV A;  1Y8P B;  2DUD A;  2JE6 I;  1L1O C;  1PTO B;  5KNB A;  5J1Z A;  4JI1 Q;  2UUA L;  1A3V A;  1B4O A;  2ZJR A;  1JC7 A;  1SE2 A;  3GTG H;  1LTA D;  1GUW A;  1LUZ A;  5COR A;  3PUW A;  1DOL A;  2Y0S G;  3ICE A;  1GOZ A;  1QE6 A;  3DMU A;  1T5E A;  4EQ5 A;  1VQJ A;  3AQQ A;  1O78 A;  2KHJ A;  1NMF A;  4BXX G;  4DUZ L;  1FJG Q;  2ZJP A;  3TP6 A;  3ZJY C;  3S1N H;  1A3U A;  1O7Y A;  4PMW A;  3I4O A;  3H0G G;  3I3C A;  1KNA A;  3VA7 A;  2VNU D;  4RAU C;  1Y1V G;  1NE3 A;  1XX8 A;  5IWA L;  4FVM A;  4FYD A;  1S5F D;  5C4X H;  5CC4 A;  1TII D;  4ZCK A;  2P5Z X;  1IHZ A;  3PF4 A;  2K03 A;  3ULL A;  1I4Q A;  5IYC G;  4OON A;  3I91 A;  1Q8K A;  2PI2 A;  3DHQ A;  2JEA I;  4H02 A;  2EYF A;  3N6R A;  4JI1 L;  3LNN A;  2VQF L;  5IYB G;  5ELN A;  5KYL A;  4DK0 A;  3TP7 A;  1P8L A;  1K0S A;  3GD7 A;  4LJZ C;  2OCE A;  5IT9 L;  2L55 A;  1AW7 A;  5LMN Q;  1PYB A;  1HQM C;  3PF5 A;  4LF9 Q;  4LF5 Q;  3AU7 A;  1QUQ A;  1YZ6 A;  1PH7 A;  1SND A;  3J80 L;  1Y1W G;  3MHB A;  1W3S A;  1SR3 A;  1SNM A;  2GN5 A;  2UXB L;  4KJO A;  1PTO C;  4OO1 I;  1NR2 A;  2A5H A;  1PDQ A;  1VQA A;  1VQN A;  3PGZ A;  2E75 C;  4XDX A;  2JXM B;  3CF5 A;  4A3D H;  1JB7 A;  1JIC A;  3QIA A;  5EPJ A;  3F1Z A;  2N3S A;  3I4M H;  1CM9 A;  4JVZ A;  1PVO A;  3JAM c;  5JPM C;  5T1G A;  1B8A A;  3GTG B;  5M3F G;  4A3I B;  4LFB Q;  2AWO A;  1SYD A;  4A3E H;  4C56 C;  4K5X A;  2RCF A;  2DY7 A;  3BJU A;  3OIQ A;  4DV6 Q;  2Y0S E;  4JK1 C;  3OW7 A;  2KCN A;  5EPL A;  1PH2 A;  3FDT A;  4RA8 A;  3CHB D;  1JMC A;  3HKS A;  2C35 B;  3S1N B;  2XRQ D;  1SYC A;  3H15 A;  3TN2 A;  4B3R Q;  3ONA B;  1TT2 A;  3M4Q A;  1JCK B;  2DY8 A;  2YYZ A;  1OXU A;  3U9O A;  1E2W A;  1OXT A;  1QJO A;  3A54 A;  4JI6 Q;  1S3O A;  2I46 A;  1PRT F;  3MFG A;  3GTM H;  2UXB Q;  4GZY C;  3GDE A;  1UEA B;  2F0F A;  1IKM A;  2E74 C;  3TP8 A;  5JAV A;  3URY A;  1HA6 A;  4NXM Q;  4DV2 L;  2O2L D;  4GLV B;  1NBW A;  3KYH C;  5DM6 3;  1TWH B;  2V4D A;  1FNV A;  2EYM A;  3NHH A;  4KJN A;  1J6Q A;  3GTQ B;  1R9T B;  1CSQ A;  1CKN B;  1NNX A;  1X3E A;  4LF8 Q;  2JA5 B;  1PMR A;  1ML0 D;  2NB0 A;  1QIL A;  3K5L A;  3T1H Q;  5K5P A;  4RHR A;  4J15 A;  4XXE A;  1DCZ A;  3D6C A;  1JE5 A;  4K6L A;  1QCB D;  2CHB D;  4XYO A;  1S5E D;  3ND9 A;  3S15 B;  4A3K G;  1SNQ A;  4O0A A;  2CW0 C;  1IYU A;  4OO1 G;  3BZK A;  4NXN L;  4C3H B;  3I4M G;  4R4I A;  2B8G A;  5D14 A;  3VR2 A;  4KD4 A;  1CQF A;  4POF A;  1I94 L;  3NBI A;  1PH6 A;  2EZV A;  1H9J A;  4BBS B;  4X65 L;  1LTR D;  1VQD A;  3VR4 A;  3H3V I;  4HN7 A;  4ILW A;  4OEL B;  4DR5 L;  1IBL Q;  1OO9 B;  5FO7 B;  2F0E A;  3RMH A;  2AWN A;  4IJH A;  4X64 L;  1L0X B;  1PTO F;  3RD4 A;  2UXD Q;  2HCC A;  4L63 B;  5F2D A;  3AFQ A;  4OIK A;  3CCM A;  1HUM A;  5BN5 A;  1JT8 A;  1MI2 A;  1K73 C;  2IW3 A;  3JAM E;  1WTR A;  2VS1 A;  3OW2 A;  5HGQ A;  2BDO A;  4JPB W;  1HZC A;  2E2H H;  1B1Z A;  1V9P A;  1LAC A;  3OTO Q;  1GVP A;  2MHV A;  3D0F A;  2PI2 E;  4CDE C;  3E9I A;  5IT9 c;  4DGZ A;  2QEJ C;  1Q81 C;  4F87 A;  4DR3 L;  1WCM H;  1EL0 A;  4EX5 A;  1PA6 A;  3E0E A;  3I72 A;  1DYQ A;  1K83 B;  3TS0 A;  1C8C A;  5IIF A;  1VQO A;  4FXK C;  4A76 A;  2R6G A;  3J80 c;  4KHP L;  3EBE A;  2UU9 L;  4UHV A;  1QVF A;  4HJA A;  4WFN 3;  2HIX A;  3OMC A;  3L3O C;  2O5I C;  1FNW A;  1PZJ D;  2GVA A;  3N52 A;  4X3T A;  2K28 A;  4U68 A;  2R93 B;  2XN9 C;  5M5Y B;  3DLL A;  2EIF A;  3A7L A;  1LLR D;  4HJ7 A;  1JOK A;  3KF6 B;  3E6Z X;  4ULL A;  3HOX B;  3PUV A;  1JB3 A;  2K5D A;  4CKB A;  1VF7 A;  4A3J G;  5JEA H;  1DGS A;  1D6E C;  1U4M A;  3RR5 A;  4RMF A;  1ROD A;  1BCP C;  2K1B A;  2WAC A;  3S1Q H;  1PRT B;  2X6G A;  4RFB A;  3PO3 G;  1TY2 A;  3GQB A;  4ZKC B;  1MBY A;  4AYB E;  4LFC Q;  3I70 A;  1X3F A;  3EFX D;  2KCT A;  2NYZ D;  4MN3 A;  1A2U A;  1LT4 D;  2A74 C;  1SRO A;  5CYU A;  1A63 A;  5FLM G;  2JA6 B;  4CHT B;  2IWH A;  2OQK A;  1CSP A;  4FF1 A;  1G51 A;  2GVB A;  5TSS A;  1MKH A;  4HID A;  1EQQ A;  5J22 A;  3WOF A;  5I2Y A;  2Z8L A;  3CU7 A;  1H9M A;  3R3O A;  4R4C A;  3FVQ A;  1Q90 A;  1EYD A;  5C3W A;  3BYY B;  4A3E G;  2VL6 A;  1HNZ Q;  1QVG A;  1FVI A;  3DUZ A;  2N78 A;  1XXG A;  3K81 C;  1DZ1 A;  1SMX A;  3F2C A;  3LX0 A;  1YJ9 A;  3U4Z A;  4TRD A;  4A3M B;  3RLO A;  1WOC A;  3G6J B;  2QIL A;  1PFM A;  1RHP A;  3KF8 A;  4GLX A;  4RGO S;  3V96 A;  3S14 H;  1K0R A;  4KHV A;  3T4A C;  4DK3 C;  1O7L A;  3R2I A;  2TMP A;  1ZEQ X;  1G91 A;  3MWY W;  1I6V C;  2D5D A;  1PRT D;  1AZP A;  1LAB A;  4XIG S;  3BYT B;  3KOJ A;  1MJC A;  2CWP A;  1GHJ A;  1VQ5 A;  2RKS A;  4DK1 A;  2Q8R E;  3GTJ B;  5KIX A;  1TWC B;  3B6Y A;  4A93 G;  3IL8 A;  3Q6S A;  2YTV A;  1PYW D;  3HOU H;  4OHJ A;  4G7Z C;  1OXS C;  4RHS A;  1WCM G;  3HKZ B;  2WAQ G;  3G71 A;  4LF6 Q;  4IZ8 A;  5C5M A;  3RLF A;  1II3 A;  2K52 A;  4LK1 C;  4LUO A;  5IE8 A;  4C1N K;  1LT6 D;  4KKU A;  5KGU A;  1TWH H;  3V2T A;  4NW2 A;  3EQL C;  5AFW A;  3DEP A;  3BDO A;  4APV A;  2RSN A;  3X3M A;  4V19 0;  3CD6 A;  2RSO A;  1N9W A;  1ESR A;  2D0O A;  1B2T A;  2ZM6 Q;  1PFN A;  1IW7 D;  2G5D A;  4PG3 A;  4ZLT F;  3C2P A;  1HUN A;  1Q8I A;  5CV8 A;  3BZD B;  3LWU A;  3OTO L;  5LHY 1;  1QG7 A;  2KVM A;  2IX0 A;  3W1B A;  4U67 3;  4IUU A;  2B2V A;  1LT3 D;  1YJN A;  2R92 G;  2E2I B;  1FGB D;  1VQP A;  1H9S A;  2RDF A;  3C3L A;  4R4Q A;  2OWO A;  2UU9 Q;  1IBL L;  2Y0S B;  2OT2 A;  3ER0 A;  1TWA B;  1Z9F A;  4A3B H;  2F0G A;  1CA5 A;  4NB3 A;  4GS3 A;  3PMF A;  4BS9 A;  3P1H A;  4PMC A;  4KN7 C;  1Q86 C;  1SMY D;  4A3F G;  4QUF A;  3GV3 A;  1I5F A;  3S16 B;  1F77 A;  5LMN W;  4UPA A;  3CC2 A;  1Y69 U;  3HKZ G;  3CCJ A;  4M8A A;  1S4Z A;  1EZ6 A;  4MIU A;  2G9D A;  2L0C A;  2C9O A;  1JJ2 A;  3L9A X;  5C6A A;  2PQE A;  4K5W A;  1BBX C;  4BY7 B;  2PZU A;  4GN3 B;  4DV6 L;  4B3T Q;  4K14 A;  1HNX Q;  2ZXP A;  4IUT A;  2KHI A;  3J81 E;  1EEF D;  2D2C C;  4IPH A;  3GTJ H;  4JI5 L;  1EY7 A;  1TXY A;  1VQF A;  4X66 L;  1EOT A;  1VQ4 A;  3HOW B;  2VB2 X;  4IUN A;  4K5V A;  4H13 C;  5CV9 A;  1X32 A;  3I4L A;  2F0U A;  4OL7 A;  1NR4 A;  1E22 A;  3S15 H;  4EQN A;  3FHW A;  2EJG C;  4JI4 L;  1XWE A;  1XMQ Q;  1PXU A;  4XQJ A;  1ESF A;  2OF1 A;  2CKZ B;  3P7J A;  4KHP Q;  1AEX A;  1S5C D;  2F0D A;  1HFG A;  1OXX K;  2R93 H;  3CCV A;  3M4O H;  4QCL A;  2HD3 A;  2YV5 A;  3HOU G;  4X64 Q;  5FO8 B;  2KA7 A;  3STB C;  5C4X B;  2A73 B;  4JBJ A;  1S40 A;  2D62 A;  1F2L A;  4A3E B;  3X3N A;  1HHV A;  4OX9 L;  4RG1 A;  4X3U A;  4JCV E;  4MNO A;  2MJ8 A;  4XT3 B;  5ELD A;  1EWC A;  2PMZ B;  3NSW A;  3A7A B;  3VYT A;  4DV5 Q;  2Q8I B;  2EYJ A;  1AE3 A;  3NTI A;  2B2V C;  4UDU C;  3GTM B;  5I4D A;  1IBM Q;  4QQB X;  5D3I B;  4A93 B;  5FJ8 G;  4KN4 C;  1Z6H A;  2EQS A;  4YY3 L;  4Y7N H;  1ASY A;  2I5M X;  2YU9 H;  5EQ0 A;  2LSS A;  3K0Y A;  1RDP D;  1LYL A;  2SNM A;  3QG1 A;  4OWX B;  4DV0 L;  2EY5 A;  3HOY G;  4BXX H;  1STE A;  4A75 A;  3UDG A;  4NXM L;  4J6H A;  3SR1 A;  3K5N A;  4M1U B;  5LL6 S;  3S2H B;  3LGJ A;  1HQR D;  1VMP A;  4XQN A;  2FIN B;  2RA4 A;  5DEH A;  3F2U A;  2GA4 B;  1KLU D;  1VQG A;  1D5X C;  1WFQ A;  2J7Z A;  5J3B A;  2NTS A;  4DFA A;  5C0X H;  4R8I A;  2L1B A;  4BY7 G;  3SE0 A;  1EWI A;  2WII B;  2VUM G;  4GNX C;  2WKC A;  4HIK A;  4A3I G;  4A3C G;  5EBD A;  4HCE A;  3UDF A;  2PZT A;  5IT9 E;  3R2T A;  1SJH D;  3CQZ B;  3KBG A;  3MTS A;  4CBV A;  2ZXO A;  2I0Q A;  1YIJ A;  3RLN A;  4A3G G;  5JJI A;  5E4W C;  3G4S A;  2K5H A;  3NTK A;  5IYB H;  4C3I H;  2JEB I;  1RCV D;  1WI5 A;  1G2S A;  5IGD A;  3NQT A;  4JI0 L;  1JJG A;  2CQO A;  3KF6 A;  4B9W A;  2JK8 A;  4CDC C;  3TQY A;  2A1A A;  3H09 A;  1U0L A;  5CV5 A;  4CDF C;  4DV0 Q;  3J7A V;  3KLS X;  4YHH L;  2Z6K A;  3CMA A;  3E9H A;  4F7X A;  3L0O A;  2PZW A;  5C44 G;  2BH8 A;  1PV4 A;  4DK6 C;  1Q3L A;  4IUV A;  3IAY A;  3A5U A;  2WB1 B;  3PUZ A;  4DU9 A;  3S14 B;  2RQX A;  3S1R B;  1EY6 A;  4H0L C;  4DR7 Q;  4DV4 Q;  2CH4 A;  2R7Z G;  1SE8 A;  2M9V A;  2MO1 A;  1SFO B;  2J4X A;  2KJX A;  4IOA A;  5DNF A;  4JI8 L;  1WD0 A;  1EEI D;  1BCP D;  4YCU A;  1LTL A;  1UE6 A;  3H6M A;  2A8V A;  3CAM A;  4DF7 A;  3OYY A;  1SFO H;  1M90 C;  1HRJ A;  1V1Q A;  5ELO A;  2VW9 A;  3S9W A;  3OHX C;  2KBN A;  3I90 A;  1QUQ B;  3O13 A;  4P2C B;  1VQL A;  3CC4 A;  1YBY A;  3WDN A;  2NZO A;  1TWA H;  5C3E H;  2HDM A;  1EIG A;  4LUV A;  1TS2 A;  4IUQ A;  1HR0 L;  4QIW E;  3HOW H;  2DN8 A;  3NBH B;  4XTC S;  1IBK Q;  2BE5 C;  4RGM A;  4BBR G;  2VXW A;  4C3H G;  4ME5 A;  1CI3 M;  3F2B A;  1KDA A;  2Q2I A;  3QWN A;  1EY0 A;  3JAM i;  4JW0 A;  1NJI C;  1YNN D;  2B2T A;  3F2D A;  1N32 Q;  3NXW A;  1KQS A;  1YNJ C;  5IOD A;  1K8O A;  3EA6 A;  1DM0 B;  1B50 A;  3VR3 A;  3OWF A;  2ZTD A;  5J39 A;  2JA9 A;  1NMG A;  4UP9 A;  2XSC A;  1U4L A;  4HSV A;  3HG9 A;  3Q23 A;  3H0G H;  2FFK B;  5LL6 X;  1WTH A;  2I5L X;  4I7Z C;  1R4Q B;  4OWT B;  3SK8 A;  4DNT B;  3QB3 A;  5C4X G;  4DUY Q;  2B63 B;  3W1G A;  2NTT A;  4LFB L;  1U5K A;  3AMU A;  1EQR A;  4YCW A;  4WJ3 M;  1M8A A;  1SRU A;  3K58 A;  4JV5 Q;  5CV4 A;  3FMC A;  2B2W C;  2MP1 A;  4ALP A;  2WB1 E;  3J81 L;  5FLM H;  4NP5 A;  2A68 C;  4LAA A;  4DV7 L;  1X65 A;  4BA1 I;  1B7Y B;  4A3M G;  2Q2T A;  2ATW A;  1Y8N B;  2E2I H;  4IJL A;  5AJ3 Q;  4DR6 Q;  4DPG A;  4QMG A;  4TSS A;  1X54 A;  2JA6 G;  2B29 A;  3RUZ A;  3P20 A;  5C0X J;  3PCO B;  4KMU C;  5BR8 L;  4DR2 Q;  1VQ8 A;  3ERO A;  2OQ0 A;  1K8A C;  3M3Y H;  1IYJ B;  5C4J B;  1SE3 A;  4QUC A;  1A2T A;  1H9S B;  1PRT C;  3UI2 A;  1BBU A;  2HHH L;  4WRD A;  2JSO A;  4HJ8 A;  1HNW L;  2H5X A;  1N8R C;  2R92 B;  4YHH Q;  2ZTE A;  1BDO A;  1Y1W B;  2EYP A;  3G6E A;  2R7D A;  3J7Z C;  1MJE A;  3J80 E;  2FMM A;  1F2Z A;  1KD1 C;  3PUX A;  4A3F B;  4EVO A;  3HRZ C;  1J8I A;  2R7F A;  3W3A A;  4JV5 L;  4PQX A;  2F0S A;  1GUG A;  1K83 H;  1HFN A;  1X9N A;  1E0B A;  1BXT A;  4DV3 L;  2ALY B;  1C7Y A;  3CQZ H;  2K5W A;  2EXD A;  2DNC A;  1K8G A;  1KAA A;  3I55 A;  4IAL A;  3SGI A;  4B9X A;  1FJG L;  3NK9 A;  2EYH A;  4PZ8 A;  1PH3 A;  2QF7 A;  3EIV A;  5EKI A;  3S2H H;  1L0W A;  2HHH Q;  4ZKB B;  1HNW Q;  1I94 Q;  2OTJ A;  1SYB A;  2F3I A;  3A5Z B;  1F9Q A;  3EN2 A;  1SYG A;  2XIW A;  3BZC A;  4JBK A;  2JA8 B;  5COY A;  4S3S A;  4IFD J;  1RTN A;  4DR4 Q;  4Z9C B;  3CXC A;  2K50 A;  1G8Z D;  2R61 A;  2B2U A;  4DAM A;  3ND8 A;  3VA5 A;  4F88 A;  2ZM6 L;  4Q5V A;  1G2T A;  1T5X D;  2XTI A;  1Q7Y C;  3MVV A;  3H3V C;  3PIO A;  3NBH A;  1MSH A;  3K59 A;  2KQ3 A;  1LM0 A;  2CQA A;  2RBM A;  4C3I B;  4DUZ Q;  3DWP A;  3TBI B; 
#chains in the Genus database with same CATH homology
 2PW7 A;  3KBX A;  2EY1 A;  3GTO B;  3S1M B;  3PV0 A;  2IX1 A;  1KTK A;  3CRL C;  3A55 A;  1STN A;  1CTM A;  1GUN A;  2B39 A;  1FYC A;  4O42 A;  1DOM A;  2C5C A;  2M2L A;  1PZI D;  2O5J C;  1A15 A;  3SVM A;  2BE5 D;  4ZUJ A;  1ENC A;  1TU2 B;  3MXP A;  1RTO A;  4C1N I;  4N9P A;  1CFM A;  3MAQ A;  2IT1 A;  4FF4 A;  3NPP A;  1Y8O B;  1I6H B;  1VMC A;  4H7B A;  4EQP A;  1PZK D;  2RDG A;  1Q1B A;  3D3R A;  3S17 B;  5EKK A;  3PUY A;  2OXP A;  3S1Q B;  1SYF A;  3JAM L;  1STB A;  1H9R A;  2E2D C;  3W2D A;  2AQ1 B;  2AUK A;  2O4X A;  3VYR A;  4A3K B;  3DXJ C;  5E1F A;  4HAE A;  1S5D D;  4KK7 A;  2F3V A;  3D8G A;  5EBC A;  3L7Z C;  4XQQ A;  3T53 B;  5ELC A;  1EYC A;  5A2Q L;  3K6O A;  4ABN A;  3V05 A;  3M4Y A;  2MUY A;  3IKJ A;  4HCS A;  1SSO A;  3KLR A;  4IFD H;  2IPK D;  4DXF A;  2B2T C;  5ELB A;  5D65 A;  5EPK A;  5FLX E;  3I73 A;  1ILP A;  3H94 A;  2F0W A;  2MPM A;  3Q0A A;  2M00 A;  1ZXT A;  4TKO B;  1JOR A;  1JWU D;  1EYA A;  1G29 1;  1ZYR D;  4A3J B;  5K36 G;  3T13 A;  1GUS A;  1ET6 A;  3S2D B;  4C3I G;  1JE4 A;  2BDN A;  4V0B A;  3KLS A;  2L12 A;  1F2M A;  4FXD A;  1SBB B;  1U4R A;  2IL8 A;  4IFD G;  2Z4I A;  1NSN S;  2EXZ A;  3M85 A;  5T1I A;  4C2M B;  2H1E A;  2B2Y A;  3C1F A;  1VDZ A;  4FNF A;  1RJT A;  1U4P A;  1XTC D;  2K32 A;  3HEJ A;  2K05 A;  1SNP A;  2F0P A;  2J0T D;  3FRP B;  5HUR A;  1SNO A;  2L9H A;  3RZD B;  3MC0 B;  2WAQ B;  1SNC A;  2B2Y C;  1LTS D;  1S5B D;  1RD9 D;  3GV6 A;  3MXU A;  1WTQ A;  1EY9 A;  4K2K A;  2NUC A;  4J1M A;  1ENF A;  4N9T A;  2F3W A;  1ZKO A;  5JEA J;  4FF2 A;  1BOS A;  1X3P A;  3M4O B;  3FPP A;  1HA5 A;  1SDF A;  4NKL A;  2WIN B;  5G3L F;  5FKA C;  5CGK A;  2VB3 X;  1RKN A;  1V1P A;  4G57 A;  1LT5 D;  1CHP D;  3PIO 3;  1BUV T;  4DA2 A;  1ICW A;  5JEA G;  2HCI A;  1EU4 A;  3SXH A;  2BCO A;  4EGV A;  5C3X A;  3FPU B;  1JOQ A;  5E3F A;  4NMZ A;  5C4Z A;  2F0I A;  3NTH A;  4OIJ A;  3MFY A;  2SEB D;  5DAU A;  1WTX A;  2YU9 B;  1A6X A;  5CMD A;  5CBA E;  1UAP A;  4PNY A;  1AZQ A;  1PLF A;  4PMB A;  1I4X A;  3OMG A;  1MGS A;  3QJY A;  4XYQ A;  2Q8T A;  5EKL A;  4PV1 C;  2KEC A;  4FXG C;  2WKD A;  5HGT A;  1F9P A;  1QWY A;  5M5W B;  1CT1 D;  3T56 B;  1B9N A;  1AP0 A;  3PO3 B;  3PO2 B;  2PW5 A;  1SE4 A;  2PCF B;  1TS5 A;  2F1M A;  3NWT A;  4HMJ A;  3T16 A;  1BQQ T;  3C46 A;  4ZAI A;  3MEH A;  1L0Y B;  1ONL A;  4TQU S;  4K8J A;  1I50 B;  2LS0 1;  1SMY C;  1BF4 A;  3KUP A;  1EQV A;  1V1P B;  1I4R A;  4F8M A;  3I8Z A;  1CHQ D;  4BY1 B;  2CW0 D;  2EE1 A;  1VCI A;  3CRK C;  4HSP A;  2FHT A;  4CKC A;  1SYE A;  1MSG A;  3SK4 A;  5JVH 3;  5DM7 3;  3HZX A;  1ENA A;  4ZK9 B;  1D1K A;  1FNU A;  1I3Q B;  1SXT A;  3DEO A;  2LY7 A;  1HTP A;  1EU3 A;  4KY7 A;  4IN3 A;  1O7Z A;  2F0J A;  2XWB B;  4KTA A;  1TKW B;  3NWS A;  1KLG D;  1TWF B;  2PO4 A;  5E4X A;  2HQE A;  3HS0 C;  1JWS D;  1LTB D;  2ID0 A;  1WTV A;  5D3D A;  1Y1V B;  1IKL A;  1V8Q A;  2OEO A;  4I65 A;  3A8J E;  3DM1 A;  5FLX L;  3K7A B;  2K01 A;  5K36 H;  2JYO A;  1SAP A;  4RGN A;  1DXM A;  5IGC A;  4FP5 D;  2ZT9 C;  4RH6 A;  3BVG A;  3BG3 A;  2L11 A;  3K57 A;  1GHK A;  1SEB D;  4G7H C;  1FD7 D;  3HOY B;  3OWE B;  4G7O C;  1EWH A;  2FMC A;  2LMC B;  1DON A;  1RF2 D;  3M3Y B;  3M7G A;  2QKI C;  2RVL A;  2BA0 A;  3H0G B;  2Z4H A;  5FK9 C;  2A69 C;  5C4H A;  1PTO H;  2A6E D;  3VR5 A;  1EQT A;  1U9R A;  4IUR A;  1BR9 A;  2AUJ D;  3H91 A;  3SK6 A;  5JVG 3;  3LWE A;  3VYS A;  2FJ2 A;  4KY6 A;  4Q0F A;  2NN6 I;  5ELE A;  4Y7N B;  3ZYY X;  1B3A A;  2EJF C;  4BBR B;  5M3M B;  1C48 A;  4C3J B;  1NCV A;  3BVZ A;  1GUO A;  3K5M A;  3CKI B;  3E5S A;  2NVT B;  1WCM B;  1IL8 A;  2R7Z B;  3MZ5 A;  3GP7 A;  5KYI A;  1F9R A;  1TQO A;  1EZ8 A;  5C44 B;  1TS4 A;  4FF3 A;  4HTH A;  3A56 A;  2Z1C A;  2A6H C;  3OOC A;  3SHL A;  5M5X B;  3R8B A;  2NN6 H;  4CJ1 B;  2NVY B;  4LMQ D;  3IFD A;  2XRS D;  3DWA A;  4ZRZ A;  1D5M C;  3D4W A;  1D5Z C;  1CA6 A;  4IFD I;  1EFI D;  2H4O A;  3SEB A;  4QB4 A;  5M9O A;  2K04 A;  3E0J A;  1TY0 A;  1HXY D;  1M4V A;  3P75 A;  1GJX A;  1DOK A;  3KK7 A;  2EOT A;  1B9M A;  3MXN A;  1FR3 A;  2E76 C;  1TWG B;  5ISR A;  5A35 A;  2SOB A;  1IW7 C;  1Q1E A;  1STY A;  5CBE E;  1W6J A;  5BN4 A;  2F0K A;  2EVB A;  1Q12 A;  5FO9 B;  3GTK B;  3R93 A;  3AB9 A;  3Q22 A;  5IGF A;  2NN6 G;  5EJW A;  4CJ0 B;  1I4P A;  3M7N A;  5BN3 A;  1C4Q A;  3A8I E;  1JOO A;  4DXG A;  2LKV A;  4B08 A;  4KD3 A;  2F0O A;  1A3T A;  2XVS A;  2ICI A;  4R8N A;  4CGY B;  2G9H D;  5I6Y A;  1LO5 D;  4IUP A;  1YNJ D;  2WV6 D;  4C3J G;  5JJZ A;  3TZU A;  4EQO A;  1PFB A;  1NUC A;  3I4M B;  1ET9 A;  2KED A;  1V1O A;  5C3E B;  4R9W A;  3HOU B;  5IGG A;  4KI0 A;  1GUT A;  2JA7 B;  2QCP X;  2N55 A;  1EY4 A;  3BS1 A;  4OGQ C;  4CKE A;  1BCP F;  1O80 A;  1B53 A;  1W6K A;  3DWQ A;  2IX3 A;  1JQY D;  3VYU A;  1AN8 A;  4H44 C;  2DNE A;  3HOZ B;  4IQZ A;  2E2H B;  2B8F A;  3D4R A;  3NQI A;  4J8Q A;  3J7A F;  4ZUI A;  3G7L A;  2B2W A;  1ZYR C;  4DAP A;  1BNZ A;  1KAB A;  2F03 A;  4A3B B;  3SK5 A;  4ZYS A;  3K5O A;  3VR6 A;  4X3K A;  1LTG D;  1UNS A;  3A8K E;  4K2L A;  2KHS A;  2KOL A;  1LTI D;  3C1E A;  4FO2 A;  2R3Z A;  4KV6 A;  2MGS A;  1K8M A;  3TP5 A;  3IFT A;  2KEE A;  4ID6 A;  3NP8 A;  2A6H D;  3U9S A;  1BCP B;  4RGT A;  5KNC A;  3WOE A;  1LTT D;  1WTW A;  5CR3 A;  1KNE A;  3QO2 A;  3NE5 B;  2HUG A;  1WTP A;  1CQV A;  2HDL A;  2K6A A;  3HGB A;  1UUP A;  2E2J B;  2L4N A;  2N88 A;  3RZO B;  1WVL A;  3GTL B;  1HTL D;  4RCO A;  4JBW A;  1PTO D;  4NDX A;  3BDC A;  4XT1 B;  1QOH A;  4HED A;  1HPC A;  1STA A;  1DJR D;  2X6L A;  5KEE A;  4BA2 I;  2TSS A;  3I4N B;  3QOJ A;  1TS3 A;  2F0V A;  4RWS C;  1WD1 A;  3TZD A;  5IGB A;  4QF4 A;  2B2U C;  2NBF A;  2K33 A;  2F0M A;  4OO1 H;  5CV7 A;  1JR0 D;  2SDF A;  2ENB A;  3GTP B;  2EYO A;  4KKT A;  1TR5 A;  1QNK A;  1E2V A;  2EY6 A;  4KKS A;  1NAP A;  4DN4 M;  2ICE C;  2CVR A;  5I9P A;  4DAY A;  1XYI A;  5KRU A;  3TME A;  2RDH A;  2D9U A;  2LFN A;  2WP8 J;  1LV9 A;  3NUC A;  4CJ2 C;  1AFP A;  1G6Z A;  2A6E C;  1QB5 D;  2A69 D;  1STG A;  1F2Y A;  1E2Z A;  2K7V A;  1MD2 D;  4X3S A;  3EVQ A;  5CV6 A;  1EY5 A;  1I4H A;  3HP3 A;  5C0X G;  2F0T A;  2BA1 A;  5EGT A;  4A3D B;  2X69 A;  2XWJ B;  4ZQ3 A;  2KCC A;  5KND A;  1D2B A;  2JP1 A;  4E6I A;  2AQ3 B;  4WOR A;  4RKL A;  3TSS A;  3FEW X;  4L6T B;  1DD2 A;  2F0H A;  2A68 D;  2BOS A;  2EPB A;  3ITP A;  5C5L A;  1QNU A;  1VF5 C;  4UAI A;  1GXD C;  2AQ2 B;  4KY5 A;  3D31 A;  1D1I A;  1IYV A;  3MA2 B;  4HR7 B;  1V43 A;  3J7Y W;  2ZXR A;  5C0X I;  2NVQ B;  5JOB A;  5I9O A;  1ILQ A;  1WTO A;  1CK1 A;  4KHZ A;  4A3G B;  2I07 B;  1EIH A;  3GO5 A;  4G4K A;  1B44 D;  2EDG A;  2NWG A;  2VUM B;  1I4G A;  2SNS A;  1EY8 A;  1X3Q A;  4ODG A;  3D4D A;  4QIW B;  5I6W A;  4AYB B;  5A2Q E;  4RCN A;  3D6W A;  5JPN C;  2F0N A;  2QDB A;  1Z47 A;  1KDB A;  4K6D A;  3OIP A;  1Z7T A;  2NZ1 D;  3PIP 3;  3FKI B;  2EJM A;  2F0L A;  5ELF A;  2KUM A;  1TVX A;  4DNR B;  3TDQ A;  2NVX B;  2EY2 A;  4K8I A;  1OXV A;  3QOL A;  1BO0 A;  4BWG B;  3ERQ A;  5IOC A;  2PPB C;  4DAV A;  2L5T A;  5NUC A;  1SJE D;  2XNA C;  4MHE A;  3BDL A;  3HOV B;  1JWM D;  5FOB B;  1YNN C;  1R4P B;  2PNR C;  4YIJ A;  2F4I A;  3BVM A;  5IGE A;  4L8J A;  3OPO A;  1F9S A;  2EYL A;  3T51 B;  5I2X A;  1HCZ A;  1CZG A;  1CZW A;  5G3L D;  2K5Q A;  3OSO A;  4RKB A;  3Q24 A;  2PYK A;  3SDZ A;  1KDC A;  3MXG A;  4WJW A;  2IJ0 A;  1H9K A;  3EJI A;  1STH A;  5M3F B;  2F0Q A;  4HMI A;  1J9O A;  4O1N A;  1Y8P B;  2JE6 I;  1PTO B;  5KNB A;  5J1Z A;  1A3V A;  1B4O A;  1JC7 A;  1SE2 A;  1LTA D;  1GUW A;  5COR A;  3PUW A;  1DOL A;  1GOZ A;  1QE6 A;  3DMU A;  1T5E A;  1O78 A;  3TP6 A;  1A3U A;  1O7Y A;  4PMW A;  3I3C A;  1KNA A;  3VA7 A;  2VNU D;  4RAU C;  1XX8 A;  4FVM A;  4FYD A;  1S5F D;  5CC4 A;  1TII D;  1IHZ A;  2K03 A;  1I4Q A;  3I91 A;  3DHQ A;  2JEA I;  2EYF A;  3N6R A;  3LNN A;  5KYL A;  4DK0 A;  3TP7 A;  3GD7 A;  4LJZ C;  5IT9 L;  2L55 A;  1AW7 A;  1HQM C;  3AU7 A;  1SND A;  3J80 L;  3MHB A;  1SNM A;  4KJO A;  1PTO C;  4OO1 I;  1NR2 A;  2A5H A;  1PDQ A;  2E75 C;  4XDX A;  2JXM B;  1JIC A;  3QIA A;  5EPJ A;  1CM9 A;  5JPM C;  5T1G A;  3GTG B;  4A3I B;  2AWO A;  1SYD A;  4C56 C;  4K5X A;  3OIQ A;  2DY7 A;  4JK1 C;  3OW7 A;  2KCN A;  5EPL A;  3FDT A;  4RA8 A;  3CHB D;  3S1N B;  2XRQ D;  1SYC A;  3TN2 A;  3ONA B;  1TT2 A;  1JCK B;  2DY8 A;  2YYZ A;  1OXU A;  3U9O A;  1E2W A;  1OXT A;  1QJO A;  3A54 A;  2I46 A;  1PRT F;  3MFG A;  4GZY C;  1UEA B;  2F0F A;  1IKM A;  2E74 C;  3TP8 A;  5JAV A;  3URY A;  1HA6 A;  2O2L D;  5DM6 3;  1TWH B;  2V4D A;  1FNV A;  2EYM A;  3NHH A;  4KJN A;  3GTQ B;  1R9T B;  2JA5 B;  1PMR A;  1ML0 D;  2NB0 A;  1QIL A;  3K5L A;  5K5P A;  4RHR A;  4XXE A;  1DCZ A;  3D6C A;  4K6L A;  1QCB D;  2CHB D;  4XYO A;  1S5E D;  3ND9 A;  3S15 B;  1SNQ A;  2CW0 C;  1IYU A;  4OO1 G;  4C3H B;  2B8G A;  5D14 A;  3VR2 A;  4KD4 A;  1CQF A;  3NBI A;  2EZV A;  1H9J A;  4BBS B;  1LTR D;  3VR4 A;  4HN7 A;  4ILW A;  1OO9 B;  5FO7 B;  2F0E A;  3RMH A;  2AWN A;  1L0X B;  1PTO F;  3RD4 A;  2HCC A;  4L63 B;  5F2D A;  4OIK A;  1HUM A;  5BN5 A;  1MI2 A;  2IW3 A;  3JAM E;  1WTR A;  2BDO A;  1B1Z A;  1LAC A;  2MHV A;  4DGZ A;  2QEJ C;  4F87 A;  1EL0 A;  3I72 A;  1DYQ A;  1K83 B;  1C8C A;  5IIF A;  4FXK C;  2R6G A;  4WFN 3;  3OMC A;  3L3O C;  2O5I C;  1FNW A;  1PZJ D;  4X3T A;  3N52 A;  2K28 A;  4U68 A;  2R93 B;  2XN9 C;  5M5Y B;  3A7L A;  1LLR D;  1JOK A;  3HOX B;  3E6Z X;  4ULL A;  3PUV A;  1JB3 A;  2K5D A;  4CKB A;  1VF7 A;  5JEA H;  1D6E C;  1U4M A;  1ROD A;  1BCP C;  2K1B A;  2WAC A;  1PRT B;  2X6G A;  4RFB A;  1TY2 A;  3GQB A;  4ZKC B;  1MBY A;  3I70 A;  2NYZ D;  3EFX D;  1A2U A;  1LT4 D;  2A74 C;  4MN3 A;  5CYU A;  2JA6 B;  4CHT B;  2IWH A;  4FF1 A;  5TSS A;  5J22 A;  3WOF A;  5I2Y A;  2Z8L A;  3CU7 A;  1H9M A;  3R3O A;  3FVQ A;  1Q90 A;  1EYD A;  5C3W A;  3BYY B;  3DUZ A;  1XXG A;  1DZ1 A;  3LX0 A;  4A3M B;  4TRD A;  3G6J B;  2QIL A;  1PFM A;  1RHP A;  3KF8 A;  4RGO S;  3V96 A;  4KHV A;  3T4A C;  1O7L A;  3R2I A;  2TMP A;  1ZEQ X;  1G91 A;  3MWY W;  1I6V C;  2D5D A;  1PRT D;  1AZP A;  1LAB A;  4XIG S;  3BYT B;  1GHJ A;  2RKS A;  4DK1 A;  2Q8R E;  3GTJ B;  5KIX A;  1TWC B;  3IL8 A;  3Q6S A;  1PYW D;  4OHJ A;  4G7Z C;  1OXS C;  4RHS A;  3HKZ B;  4IZ8 A;  5C5M A;  3RLF A;  1II3 A;  4LK1 C;  4C1N K;  1LT6 D;  4KKU A;  5KGU A;  3V2T A;  4NW2 A;  3EQL C;  5AFW A;  3DEP A;  3BDO A;  2RSN A;  3X3M A;  4V19 0;  2RSO A;  1ESR A;  1B2T A;  1PFN A;  1IW7 D;  4ZLT F;  3C2P A;  1HUN A;  1Q8I A;  5CV8 A;  3BZD B;  3LWU A;  5LHY 1;  1QG7 A;  2KVM A;  2IX0 A;  4U67 3;  4IUU A;  2B2V A;  1LT3 D;  2E2I B;  1FGB D;  1H9S A;  2RDF A;  3C3L A;  2Y0S B;  2OT2 A;  1TWA B;  2F0G A;  1CA5 A;  3PMF A;  4BS9 A;  3P1H A;  4PMC A;  4KN7 C;  1SMY D;  4QUF A;  3GV3 A;  3S16 B;  1F77 A;  1Y69 U;  4M8A A;  1S4Z A;  1EZ6 A;  4MIU A;  2G9D A;  2L0C A;  2C9O A;  3L9A X;  5C6A A;  2PQE A;  4K5W A;  1BBX C;  4BY7 B;  2PZU A;  4K14 A;  2ZXP A;  4IUT A;  3J81 E;  1EEF D;  2D2C C;  1EY7 A;  1EOT A;  3HOW B;  2VB2 X;  4IUN A;  4K5V A;  4H13 C;  5CV9 A;  1X32 A;  3I4L A;  2F0U A;  4OL7 A;  1NR4 A;  4EQN A;  2EJG C;  1XWE A;  1PXU A;  4XQJ A;  1ESF A;  2OF1 A;  3P7J A;  1AEX A;  1S5C D;  2F0D A;  1HFG A;  1OXX K;  4QCL A;  5FO8 B;  2KA7 A;  5C4X B;  2A73 B;  2D62 A;  1F2L A;  4A3E B;  3X3N A;  1HHV A;  4X3U A;  5ELD A;  2MJ8 A;  4XT3 B;  3VYT A;  1EWC A;  2PMZ B;  3NSW A;  3A7A B;  2Q8I B;  2EYJ A;  3NTI A;  2B2V C;  4UDU C;  3GTM B;  5I4D A;  5D3I B;  4A93 B;  4KN4 C;  1Z6H A;  5EQ0 A;  3K0Y A;  1RDP D;  2SNM A;  3QG1 A;  2EY5 A;  1STE A;  4J6H A;  3SR1 A;  3K5N A;  4M1U B;  5LL6 S;  3S2H B;  1HQR D;  1VMP A;  4XQN A;  2FIN B;  2RA4 A;  5DEH A;  3F2U A;  2GA4 B;  1KLU D;  1D5X C;  2J7Z A;  2NTS A;  4DFA A;  5C0X H;  4R8I A;  2L1B A;  3SE0 A;  2WII B;  2WKC A;  5EBD A;  4HCE A;  2PZT A;  5IT9 E;  3R2T A;  1SJH D;  3CQZ B;  3KBG A;  3MTS A;  4CBV A;  2ZXO A;  5E4W C;  3NTK A;  2JEB I;  1RCV D;  1G2S A;  5IGD A;  3NQT A;  4B9W A;  3H09 A;  5CV5 A;  3J7A V;  3KLS X;  4F7X A;  2PZW A;  1Q3L A;  4IUV A;  3IAY A;  2WB1 B;  3PUZ A;  4DU9 A;  3S14 B;  2RQX A;  3S1R B;  1EY6 A;  4H0L C;  2M9V A;  1SFO B;  2J4X A;  2KJX A;  5DNF A;  1WD0 A;  1EEI D;  1BCP D;  3H6M A;  4DF7 A;  1HRJ A;  3S9W A;  3OHX C;  3I90 A;  3O13 A;  4P2C B;  3WDN A;  2HDM A;  1EIG A;  1TS2 A;  4IUQ A;  2DN8 A;  4XTC S;  2BE5 C;  4RGM A;  2VXW A;  4C3H G;  4ME5 A;  1CI3 M;  1KDA A;  3QWN A;  1EY0 A;  1YNN D;  2B2T A;  3NXW A;  1YNJ C;  5IOD A;  1K8O A;  3EA6 A;  1DM0 B;  1B50 A;  3VR3 A;  3OWF A;  5J39 A;  2XSC A;  1U4L A;  4HSV A;  3HG9 A;  3Q23 A;  2FFK B;  5LL6 X;  4I7Z C;  1R4Q B;  4DNT B;  3SK8 A;  3QB3 A;  2B63 B;  2NTT A;  3AMU A;  1M8A A;  3K58 A;  5CV4 A;  3FMC A;  2B2W C;  2MP1 A;  3J81 L;  4NP5 A;  2A68 C;  4LAA A;  4BA1 I;  1Y8N B;  4QMG A;  4TSS A;  3RUZ A;  3P20 A;  5C0X J;  4KMU C;  3ERO A;  5C4J B;  1SE3 A;  4QUC A;  1A2T A;  1H9S B;  1PRT C;  3UI2 A;  4WRD A;  2JSO A;  2R92 B;  1BDO A;  1Y1W B;  2EYP A;  3J80 E;  2FMM A;  1F2Z A;  3PUX A;  4A3F B;  4EVO A;  3HRZ C;  1J8I A;  3W3A A;  4PQX A;  2F0S A;  1GUG A;  1HFN A;  1E0B A;  1BXT A;  2K5W A;  2DNC A;  1KAA A;  4IAL A;  4B9X A;  3NK9 A;  2EYH A;  2QF7 A;  5EKI A;  4ZKB B;  1SYB A;  1F9Q A;  1SYG A;  2XIW A;  2JA8 B;  5COY A;  4S3S A;  4IFD J;  1RTN A;  4Z9C B;  1G8Z D;  2R61 A;  2B2U A;  3ND8 A;  3VA5 A;  4F88 A;  4Q5V A;  1G2T A;  1T5X D;  3MVV A;  3H3V C;  3NBH A;  1MSH A;  3K59 A;  2KQ3 A;  2CQA A;  2RBM A;  4C3I B;  3DWP A;  3TBI B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...