2VXWA

Structural and functional studies of the potent anti-hiv chemokine variant p2-rantes
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
69
structure length
69
Chain Sequence
FSPLSSQSSACCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYINSLEMS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and Functional Studies of the Potent Anti-HIV Chemokine Variant P2-Rantes.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords C-C MOTIF CHEMOKINE 5
total genus 14
structure length 69
sequence length 69
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2008-07-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.40 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 2vxwA00
1NR2A 2B2TC 2B2VA 2J7ZA 2NYZD 4OIKA 3FDTA 4U68A 3QO2A 1X32A 1BO0A 2KUMA 3Q6SA 1EOTA 1SSOA 2B2YA 1KNEA 2IL8A 4IUVA 5EPJA 4CJ0B 2HCCA 4IUPA 1PLFA 2KEDA 1GUWA 2BDNA 1F9PA 1PFMA 2X6LA 2H1EA 4ZK9B 3KUPA 3TZDA 1AZQA 1B50A 3FPUB 3MWYW 1QNKA 1DONA 2RSOA 2KVMA 1XYIA 1EL0A 2HDMA 1X3QA 2FINB 4HSVA 3D6WA 1F9QA 2B2TA 2FMMA 1XX8A 2L11A 1B53A 1G2SA 1SAPA 2MGSA 3DEOA 1F2LA 1F9SA 1J9OA 4RA8A 1MSGA 3TN2A 1G2TA 2L9HA 1X3PA 1B3AA 4XDXA 1CA6A 1Q3LA 4R9WA 1EIHA 2B2WC 1RODA 3N52A 4IURA 1WTRA 2KEEA 1PFNA 3I91A 3IFDA 3SVMA 1BF4A 1U4RA 3ONAB 4X3TA 3G7LA 1KNAA 1RTOA 5CMDA 1NR4A 1ICWA 2MP1A 3UI2A 1B4OA 1U4LA 1M8AA 2R3ZA 4MHEA 4ZLTF 1NCVA 1ZXTA 1CA5A 1G6ZA 1O7YA 1RHPA 3IL8A 1ML0D 4HEDA 1HA6A 1RJTA 1O80A 2Q8RE 2K04A 1HUMA 1MSHA 4X3SA 2Q8TA 2FFKB 4XT1B 1RTNA 1C8CA 4HAEA 4CJ1B 2JP1A 1WTPA 4IUQA 1PFBA 5JJZA 2RA4A 5EKIA 1WTXA 1A15A 5EPLA 1QE6A 1U4MA 3F2UA 4OIJA 5DNFA 2EOTA 3KBXA 1VMPA 3H91A 5CBEE 1DOMA 2RVLA 2X6GA 3LWEA 5CORA 5T1IA 1WTVA 2XIWA 4X3KA 1O7ZA 3I3CA 2KECA 1BBXC 1JE4A 2HUGA 1WD0A 4RWSC 2K03A 2L1BA 2FHTA 4IUUA 4LMQD 1BNZA 1HFNA 2JYOA 1TVXA 4DN4M 4UAIA 1EIGA 2K01A 3I8ZA 4X3UA 5CBAE 1AP0A 2K05A 3R93A 2K28A 2HDLA 4ZKBB 2L4NA 1J8IA 2K1BA 4O42A 5COYA 1DZ1A 1VMCA 3P7JA 5EQ0A 2B2YC 2N55A 1U4PA 1F9RA 1E0BA 4IUTA 1WTWA 1ILPA 2L12A 1LV9A 2RSNA 1HHVA 4ZAIA 1G91A 1PDQA 5EJWA 1IKMA 1B2TA 2EPBA 1SDFA 3GV3A 1S4ZA 5EPKA 2D9UA 5T1GA 2M2LA 2KOLA 1WD1A 4QUCA 2MPMA 2DY7A 1DOLA 1MI2A 2X69A 4MN3A 4CJ2C 4HCSA 1MGSA 2FJ2A 5AFWA 1EQTA 5D65A 1ILQA 3I90A 2NWGA 3HP3A 1NAPA 2B2VC 1IL8A 2SDFA 1HFGA 2VXWA 3GV6A 1CM9A 4QUFA 5D14A 2CVRA 2DY8A 1WVLA 4NW2A 1WTQA 1HRJA 1DOKA 1JICA 2B2UA 2B2WA 4ZKCB 3DM1A 1IKLA 4XT3B 1ESRA 2EE1A 2B2UC 2NZ1D 4R8IA 2MJ8A 1WTOA 5E4XA 4RAUC 5E4WC 1HUNA 3DEPA 3MTSA 2N88A 2HCIA 1AZPA 1QG7A
chains in the Genus database with same CATH superfamily
5IGGA 1R4PB 4DR4L 2NYZD 4XXEA 5ELCA 5EPJA 3CCJA 3A8KE 5I6YA 2NTTA 2Q2HA 1Z47A 4OO1G 3FMCA 2VB2X 5NUCA 3PV0A 3S17B 2CHBD 3U4ZA 3QOJA 4EVOA 4HIMA 4JI3Q 1EZ6A 1QCBD 4EGVA 3K59A 1HXYD 1PTOD 3D4DA 4LAAA 2F0TA 2JA9A 4RA8A 5EBCA 2MHVA 1SYCA 1D5XC 2WAQE 1C9OA 4IURA 1VF5C 1EU3A 4KHZA 4BY7G 4MIUA 1YHAA 4QJFA 1PH2A 3Q8DA 3M9BA 4WORA 4A3EH 5C4XG 3TSSA 1RTOA 4QY7A 1CA6A 1U4LA 1CA5A 1GHJA 1S3OA 1D2BA 4KKUA 5C3EG 3E3XA 5BR8Q 3ULJA 1GVPA 1RTNA 1H9JA 4X66Q 2OWOA 3H0GH 1I50H 4JI0Q 1EY0A 1SE2A 5E3FA 4K0KL 1VMPA 2HQLA 3LWEA 3S16H 5DM73 4JG2A 1SXTA 4X3KA 1BBXC 2KECA 4GNXB 1I4XA 3OW7A 1HZBA 4A3LG 3SXHA 5C44B 1PYSB 1LTID 1UE1A 2A73B 2PZUA 4P74A 2DJGC 2EY2A 5IP9G 3CCVA 2C35B 4C3HG 4X65L 5DM63 4PMWA 3QB3A 5COYA 3MHBA 5IIFA 1DYQA 1KDAA 3ERQA 1JORA 3OTOQ 5IGBA 3HKZG 1VQOA 2F3VA 1IBMQ 4LUVA 1V9PA 2H4OA 2E8GA 1Y1VH 1X3GA 1ONLA 1LYLA 5CV9A 1VS0A 4B3RL 1YI2A 4TSSA 2RHQB 3IKJA 5AFWA 4C2MH 4LF9Q 5C3WA 2N49A 1SNPA 3OWFA 1NAPA 4QUFA 2SDFA 1Y8OB 1EQVA 3OW2A 1DOKA 3GTPB 4JI6Q 1X55A 1JC7A 4BXXG 2MJ8A 3GTLH 5HY6A 3JAML 1AH9A 3C46A 3CMEA 3UE0A 5CGKA 1AZPA 3QO2A 2QW7A 2B2YA 1X56A 3PIPA 1DJRD 1D1KA 4GKKL 3EIVA 4A93G 4DUZL 2RBMA 5E7NA 4HIOA 5JEAJ 3F2BA 3RZOB 1IHZA 5AJ3Q 2JA7G 1QZGA 4CKCA 5KNDA 1MSGA 3QIAA 1STEA 1OTCA 1HNXL 1SYBA 1I3QH 1N9WA 1PFNA 3CCLA 1UUPA 3KDFA 4EQ5A 4JI4Q 2RCNA 4LF8Q 3J80E 3GO5A 3NELA 1ZKOA 3GP7A 2MP1A 1H9SA 2ZTEA 4LFBQ 1N34Q 2I5HA 1BUVT 2JK8A 1K3RA 1UAPA 1I50B 4O2DA 1VQ5A 5C4ZA 5DNFA 2EY6A 3N6RA 4A4IA 3A8IE 4ZUJA 3H94A 1BCPD 1CSPA 2AKWB 5JVH3 4NB3A 1LACA 2PI2E 1EIGA 2A74C 1HCZA 1KDCA 2K28A 1EY6A 1WCMG 2TSSA 1CZWA 2JA7B 5M5WH 4BBSB 3I7FA 2QCPX 3KF6B 3MXUA 4CKBA 3A8JE 3PUZA 4HJ8A 1VQJA 3NK9A 3NEMA 3L0OA 2BE5D 1WD1A 1ZYRD 3JAME 4C3HB 1Y1WH 2AUJD 4HCSA 1K8GA 1SNQA 1Q8KA 2E74C 4EQOA 4YWLA 1PRTB 1CM9A 5IT9E 1PYBA 3D6CA 3OMGA 2RHSB 1CTMA 3DM1A 1R9TB 3TP8A 2EE1A 1B7YB 1YBYA 5E4XA 4NXNQ 5D3DA 4TKOB 1M90C 4B3ML 4KHPQ 1LT5D 2OF1A 1GUSA 2KUMA 4CGYB 4L5TA 2EZVA 2JA8G 3LNNA 4QIWB 2KEDA 2F0WA 1HNWL 4G7OC 4OWTB 4XIGS 3UDFA 4UP7A 2KHIA 4G7ZC 1KD1C 1STHA 5IYBG 4L6TB 4B3SQ 1HA5A 4BY7B 1STAA 4Q0FA 4L5SA 2K6AA 3I2ZA 4J15A 2O5IC 1A3VA 3U4VA 4DAMA 2BA0A 2F52A 4P75A 4YY3L 1X54A 3FRPB 2B8FA 3VYRA 4DGZA 2NN6I 3M4OB 1W6JA 2E2HH 2Y0SE 1VQEA 5JJKA 3PO3H 3AU7A 4LUOA 3H15A 4JI7L 3QJYA 4YWMA 3HGBA 1PH7A 1VQKA 4CJ1B 5KYLA 5I9PA 1TT2A 1TS3A 1TU2B 2RVLA 1A63A 2I5LX 1D1IA 2KHSA 3CF5A 2XIWA 4JI8Q 4A93H 2WAQG 3URYA 1XMQQ 4IPDA 2EJFC 4XYOA 2BE5C 3CAMA 3I8ZA 5I6WA 3VR5A 2NBFA 4UY8C 1F2MA 2JA7H 1BCPB 1S5ED 3H0GB 4FXGC 4O42A 2VY3A 3HFZB 2MNAA 4LWCA 1CKNA 3ULLA 1D6EC 4XQJA 2RCFA 3C1FA 1P16A 4ZRZA 1V43A 1KRSA 1PRTF 4KV6A 3VYUA 1XNQQ 1IW7C 1G8ZD 3L3OC 4CHTB 1Q82C 4A3CG 2IHEA 1T5XD 4O1NA 4RG1A 1KL9A 3Q24A 3RR5A 3R8BA 2A1AA 4JI8L 1L0YB 1L0WA 4LF4Q 4JI3L 1E2ZA 2K33A 4A3KB 4RAUC 2ICIA 2A8VA 2EYMA 2HCIA 2OQ0A 4MNOA 1QG7A 5A2QE 1SNOA 4BY1G 1EFID 4JBWA 4IFDH 2JA8H 1QB5D 1E7ZA 1EY8A 4K5VA 1LTSD 4QF4A 2WB1E 1K83H 1PTOH 4PV1C 2Q8IB 2CCZA 2R93H 2RQXA 1HJPA 1I94L 5M5WB 1R4QB 1F9QA 3TS0A 1XMOQ 3GTJB 1QVCA 4DNTB 3S1QH 4EX5A 4HSPA 1TWCB 2BH8A 4KD4A 2K5QA 1I4HA 4DK0A 4R4OA 2R92G 3RMHA 2K50A 1AE3A 2KA7A 3N52A 1GJXA 3TDQA 3U58A 3CHBD 4U673 2CKZB 1TWAH 1C48A 3FEWX 4DK6C 2JSOA 5TSSA 5CMDA 1D5MC 4LF7Q 2JEBI 1G6ZA 4HJAA 1LTLA 4DR2L 2F4VQ 1EZ8A 3AQQA 4C3IB 4ZUIA 3SHLA 5KNCA 4RFBA 1JOOA 4XQNA 3S15H 3TP5A 1GXDC 1H9MA 3TRZA 1B3QA 5IWAQ 4FXDA 3VYTA 4UPAA 1L2FA 1C7YA 1Y69U 4DR7Q 1Q86C 4A3FG 2UUCQ 2B63G 4KLKA 4HR7B 4DV6Q 2F4IA 4BBRB 1WTVA 5DEHA 1VQ8A 3CW2C 3J7YW 1CT1D 4PQXA 3BS1A 1B70B 5G3LF 4CBVA 1CKNB 4IOAA 2UXCQ 4AQYQ 4NKLA 3HOZG 2KCTA 3FPPA 4A3MG 1BBWA 3R93A 3PGZA 4HMJA 3BZCA 4NDXA 3BVMA 4ZAIA 2C9OA 2B8GA 5C0XI 3RN2A 3M3YB 1IKMA 3CD6A 1SDFA 4K2LA 3G6JB 4DR4Q 1IYVA 2F0UA 1TS4A 2BCOA 3I72A 1EEID 1SMYC 4OGQC 3F8TA 2NVXB 3I90A 1U9RA 3UDXA 4K6LA 1EYDA 1PRTC 3CCUA 1HNXQ 3VR4A 3V96A 2UXDQ 1PVOA 5K36G 1Y8PB 1IBLL 2UUBQ 1KHIA 3CC7A 4BY1H 2AQ3B 4KI0A 3C1EA 3Q6SA 1EY9A 2MQHA 4DNIA 3NPPA 3NBHA 2DJFC 2LKVA 2X6LA 3S1MB 4GOPC 5FK9C 3Q0AA 1SNDA 1CK1A 3MWYW 5GROA 3AFQA 4G4KA 3V2TA 1XYIA 2ZT9C 4A3IB 4FXKC 2R7FA 2FMMA 1XX8A 3A74A 3GTQB 1D5ZC 5FO7B 3EA6A 3DEOA 4NPSA 1CZGA 3OMCA 4IFDJ 3HOXB 2A6ED 4JI2L 5FLXE 3OIQA 2R7ZH 1LM0A 4GLVB 2RDGA 3EQLC 3KFUA 4KKTA 1M8AA 1I3QB 1ZXTA 2DUDA 4I7ZC 4Y7NB 3IL8A 5EAYA 2F0MA 1ML0D 4BBSG 2G9DA 1HA6A 2F3WA 4WJ4A 1O80A 1N32L 1ENCA 4MTNA 3HOVH 1PMRA 3F2DA 3W3AA 4A3JH 3CKIB 5CV4A 3S2DB 1VQ9A 2AWOA 2NVTH 3NTHA 4GS3A 5FLXL 5CORA 1XMQL 3MXGA 3TS2A 4FNFA 2R93G 5KNBA 2PZWA 2BOSA 3VDYA 1OO9B 2GVAA 4N9PA 1VF7A 3S1RB 3EBEA 2ZJQA 4HMIA 2R93B 2N55A 1Q1EA 1BCPC 1F9RA 1U4PA 4ILWA 2QGQA 1WTWA 2F0PA 2XN9C 2AWNA 2JA5G 1EWCA 4K14A 1HZCA 3K0YA 4OO1I 2LY7A 2VQEQ 4A3MB 4DR3L 3GTMB 2PZTA 1S5BD 3J81L 4KK7A 2NN6H 1ILQA 3CPFA 2G5DA 2JEAI 4LF6Q 5JJLA 5FJ8G 2B3GA 4A3BH 1HRJA 1UNSA 3BDLA 3CCSA 2PQAA 4DUYL 2QKIC 1IBKL 1Q81C 3NSWA 1QOHA 3DM3A 4HIDA 4H0LC 5JVG3 1YNJC 5IT9c 2WB1B 3J7AV 3KLSA 4A93B 2B2TC 1N8RC 3MVVA 3HOXG 1IW7D 1KNEA 3EROA 2OCEA 2VQFL 4DR6L 3L9AX 1AZQA 4KTAA 2H1EA 3K5NA 4GNXA 1X3EA 2M00A 4H13C 4H44C 1E2VA 4A3IG 1QNKA 1A0IA 1KAWA 4HSVA 3D6WA 4A3DH 5D3IB 2R7ZB 4CDFC 2N78A 2YV5A 3CU7A 2EXZA 2KHJA 4OELB 4OL7A 2SOBA 5IGCA 1XTDA 4XDXA 5M3MG 4GN5A 4Q5VA 5LL6X 1V1PA 1L1OA 2KEEA 2RKSA 1QVGA 3QOLA 3GTKH 2A68D 3ND9A 1A8VA 2F0EA 1ICWA 2SNMA 3TZUA 3U50C 1NCVA 2ZTCA 4AYBG 1RHPA 3T53B 4A3GG 4X66L 3NENA 2E2HB 2QA4A 2OEOA 4LNQA 1UEAB 4KJOA 1K73C 5JJZA 3RZDH 4GN3B 1A15A 3L7ZC 3J80c 1SEBD 1TXYA 1K8MA 1YJNA 3I3CA 1GUGA 2HUGA 4EQNA 2VB3X 2K7VA 1SFOB 1C0AA 4LMQD 1A3UA 2QEXA 3A5UA 2F1MA 1AP0A 2XNAC 3OOCA 4EQPA 3PO2G 4GKKQ 2F0KA 4BBRG 1E0BA 2EY1A 2D0PA 2V4DA 2B63B 1K8AC 2IY5B 2LMCB 2XGTA 1Y1VB 4CDEC 3HOWH 1YIJA 3HOYB 1TWHH 3M4YA 1QNUA 3WDNA 2DNCA 1BBUA 1PH4A 1LTAD 5IYDH 1UE5A 1H9SB 3E9HA 1HFGA 1WTQA 4X64L 4DV2Q 2K75A 1K83B 3T56B 3VA7A 1PH1A 2CWPA 1VQ4A 3BU2A 2WIIB 2HIXA 1Q90A 3PUXA 4RGNA 3ERSX 3S1QB 1VQMA 2E2IH 3DUZA 1CSQA 4U68A 2B2VA 3NP8A 3MXPA 4DA2A 2MO1A 1Y14B 2HCCA 1DXMA 3W1GA 4DUZQ 1XJVA 1PLFA 3CCEA 2UU9Q 1C4QA 1YNND 2NUCA 2WKCA 1EOVA 3HOYH 1BXTA 1SYGA 2PO4A 3CQZH 4GOPB 3RLNA 1TWGH 4DU9A 2B2TA 1MJCA 4DR2Q 2F4VL 1G2SA 4IZ8A 3J80i 4B9WA 2E2DC 1CKOA 4R4CA 4Z9CB 1H9KA 3KF6A 3SEBA 4YIJA 5C4HA 3I4OA 3M4QA 1W2BA 3GTJH 2RDFA 4HCEA 2C5CA 3CMAA 3S14H 3DWAA 3K0XA 1YNNC 1Q1BA 1B4OA 4J1MA 4S3SA 1GUOA 3R3OA 3NQTA 2LFNA 2ICEC 2UXCL 4UP9A 4B3MQ 4KHPL 1RKNA 1RJTA 5J39A 1KXLA 2JA8B 1HUMA 5EBDA 2ZXRA 4N8FA 4A3DB 4FVMA 4DKAC 1CHPD 3T1HL 1FGUA 4K0KQ 1KABA 4JI1L 2ID0A 4IPCA 1VQLA 2VUMB 4DR5L 3VR3A 2KCMA 2F0FA 2CQOA 5T1IA 1S5FD 1HTPA 4DAPA 4L63B 3KJPA 1SE8A 3JAMc 2GA4B 2UUBL 1Z6HA 1EQQA 2D5DA 1N33Q 4X3UA 1NY4A 2ES2A 4CDDC 2L4NA 5C0XH 4DNRB 3AMUA 1YZ6A 4FF2A 3QWNA 2A69D 4IUTA 2L12A 1LV9A 1RF2D 4F87A 1SBBB 1PYWD 1V1QA 2HD3A 4E6IA 1FNVA 2Z0SA 4XQQA 3S15B 2NTSA 5KRUA 1OXXK 4JI1Q 1BVSA 1HH2P 5CV6A 4KN4C 4X62Q 2KCCA 4BA1I 1KRTA 5JPNC 1CI3M 4K6DA 5C5LA 1VQPA 1EIYB 4IFDI 2R7ZG 4XT3B 1I94Q 4OXPA 2R7DA 2YTYA 4FF3A 2WP8J 1WTOA 1HUNA 3SE0A 1I5FA 1OXSC 3BYYB 5LMNW 2LXKA 4MHEA 3D3RA 4WFN3 2IL8A 1TY2A 1Y8NB 4C56C 4JK1C 1KQSA 1UE6A 3BZDB 5KEEA 3HOYG 4JBJA 3FPUB 3S1NH 1SE4A 4WJ3M 2E5LQ 2Q2TA 1EL0A 2HDMA 1YEZA 1D8LA 5IOCA 4RKBA 3KF8A 2KJXA 4DR1L 4TQUS 1JWMD 3E9IA 1LT3D 1HZAA 3LGJA 4GN4B 3QG1A 4R9WA 5IYBH 1S40A 3NTIA 4DAYA 1WTRA 5LMNL 3WOFA 1U5KA 1V1OA 4DV0Q 4FF1A 4QCLA 1L0XB 3OIPA 5CV7A 2QEJC 3BZKA 2E5LL 2JA5B 4ZQ3A 1VQDA 1X3FA 3T1YL 4PZ7A 3A56A 2EYPA 1GKHA 3I4NG 5LMUL 2BDOA 1TWGB 3EVQA 4KJNA 2H5XA 1NMFA 1BR9A 3SR1A 4YHHL 4IJLA 3K7AB 1U0LA 2Q2IA 4JBKA 1Q12A 3K5OA 4RH6A 1JE4A 2Z1CA 2CFMA 2FHTA 5DAUA 2JYOA 1TVXA 3PMFA 1G291 4RGMA 2EIFA 5C6AA 5LL6S 3MAQA 3P7JA 2RF4A 5FLMG 3D0FA 1I6HH 2K5HA 1PV4A 4A3IH 2NVXH 2UXBL 2FMCA 3I4MH 3NUCA 2K5NA 1A62A 4PMCA 3HG9A 1HR0L 1PZKD 1UEBA 4NXMQ 2FJ2A 2K52A 3AEVA 4KKSA 4JC0A 4GZYC 3DXJC 3H3VI 4DV3L 2VNUD 2EYLA 4ZKCB 2IJ0A 4C3HH 1Y1WB 3HOVB 4A3CH 3BDCA 4F8MA 3ITPA 3J81c 4L8JA 1N33L 1VQGA 2F3IA 4POFA 2J7ZA 5BR8L 4V190 1ASYA 1JB3A 3V05A 4CJ0B 4RCNA 4IUPA 2F0IA 3K81C 1B50A 3DWPA 4I7AA 2RSOA 1QWYA 1YNXA 4PG3A 5FLXc 3W2DA 4NXML 1EUJA 4R8NA 1N34L 3E6ZX 1TIID 2XVSA 2K5DA 3GTQH 4NP5A 1NTGA 2OT2A 4LF5Q 3CQZB 1KC8C 1EEFD 1KDBA 3TP6A 2XRSD 4CDCC 1YJWA 2AQ2B 3RZDB 2D62A 2Z6KA 1TWAB 1KTKA 2PI2A 3NHHA 1NBWA 2LSSA 4KY6A 5E1FA 1M4VA 3STBC 1P8LA 2RDHA 5EGTA 4P2CB 1PFSA 3PQIA 3HOWG 1LT6D 4POGA 1RL2A 2CQAA 4DV1Q 3CC4A 1STYA 4LJZC 2Y0SB 1PFBA 1J5EL 4QIWE 1E24A 1BCPF 2E2JH 3T4AC 1T5EA 2M9VA 3IFTA 4X64Q 1WOCA 1SE3A 1M1KC 1FD7D 3B6YA 3C2PA 3RN5A 1BOSA 1SMYD 5JEAH 4RWSC 2K03A 2EQSA 4WRDA 1H95A 1IYUA 2N8NA 1FYCA 1XXGA 2XWJB 1AE2A 1TS5A 2IWHA 1TKWB 5EQ0A 1VQHA 2FXQA 3P1HA 1MHWC 1YVCA 4G7HC 2RSNA 2UUAL 1TS2A 3UDIA 2F0HA 2EPBA 4DAVA 1CUKA 1LUZA 4JV5Q 3OSOA 4A3DG 1J5EQ 2X69A 4X62L 4CJ2C 3BVZA 4H7BA 1SYDA 1PHJA 3KYHC 2IX3A 2GVBA 1IL8A 1VQ7A 4GOPA 5D14A 2I46A 5EKLA 2PPBC 4IALA 2PMZB 2PW7A 1KIXA 4JI4L 2B2WA 1E1OA 5IYCG 5KIXA 4C1NI 1FR3A 3S1RH 5FO9B 3K80C 4M8AA 3EN2A 3MTSA 5FO8B 1VQNA 1EIFA 4HIKA 2NZOA 5C4JH 4LFAQ 3X3NA 3ND8A 1CQVA 1B8AA 2Z6BA 2ZM6L 2ASBA 3TZDA 1ZEQX 2PCFB 1QVFA 3S2DH 5IP7G 1E2WA 5ELEA 3FVQA 4A3KG 4DR5Q 4UDUC 4HJ5A 2HHHL 3TMEA 3VR6A 3A54A 2WACA 1K28A 3I4MB 1SFOH 1K9MC 2NB0A 4I65A 3OTOL 3EFXD 3VR2A 1IBML 1Z7TA 1KNAA 1EY5A 2EJMA 5IGEA 3UI2A 2A6HC 5IP9H 1K0SA 2VQFQ 3E0EA 3PIP3 1LLRD 3M7NA 4LF9L 4X3SA 1FNUA 2DNEA 3BJUA 1D7QA 1Y1VG 1O7IA 1QE6A 1U4MA 4DUYQ 1IBKQ 1FVIA 3H91A 1RD9D 1N36L 3MFGA 1DCZA 4JBMA 5AJ3L 2L1BA 2MUYA 4IPHA 1BNZA 3HOUG 3DLLA 5ELBA 4DV4L 1EFWA 5FOBB 1YHQA 2PNHA 3NTKA 5F2DA 2YU9B 2B2YC 1DGSA 2P5ZX 4QB4A 3HOZH 2K32A 3AB9A 2B29A 4IPGA 2VQEL 2Z8LA 1AEXA 2KOLA 2KBNA 2MPMA 3D4RA 1JMCA 2K14A 2QF7A 4LF6L 1EQTA 1NUCA 2NWGA 3HP3A 3GV6A 2XSCA 4JI6L 5G3LD 1CFMA 4AYBB 2YTVA 4A3EB 1JICA 1MD2D 1IBLQ 1N36Q 4N9TA 1ESRA 1PH6A 3IAYA 1S72A 1MJEA 3PO3B 3P75A 1A2TA 1X32A 1SSOA 3J80L 4IUVA 3SK5A 3OWEB 2UUAQ 1DM0B 1WTHA 2IHFA 1F9PA 4RHRA 4ME5A 3GTOH 1HQMC 4LFCQ 3LX0A 3J7A5 4AYBE 1B9MA 3KLRA 1SAPA 1SNMA 3H0GG 2F0JA 2MGSA 4PZ8A 1F2ZA 3K58A 1QZHA 4BY7H 4ODGA 4OWXB 2PYKA 4N8X1 3T1HQ 2WB1G 3F1ZA 2WAQB 3OHXC 4DV7L 3I91A 1CHQD 3UDGA 2HIVA 1Z9FA 5C0XG 5JPMC 4YHHQ 4DV6L 3CP0A 2MFIA 1VQ6A 1T9HA 2IX0A 2DGYA 3FKIG 2R3ZA 3NE5B 4PMBA 3WWVA 5IE8A 2SNSA 3UE1A 5C0XJ 2CH4W 1WCMH 1TWHB 2ZTDA 4ABNA 1WCMB 2K04A 3HEJA 2KQ3A 2E76C 3G6EA 1K3BC 2O2LD 2ZJPA 2VUMH 3O13A 4KY7A 5C44H 3F2UA 5ELNA 3HKZE 2EYOA 2X6GA 3HOVG 3TBIB 4LK1C 2OQKA 3E5SA 1TWCH 2R61A 2K4KA 5IT9L 3LWUA 1WD0A 2WINB 1SNCA 1JWUD 5DLQE 2EDGA 1HTLD 5ISRA 2O4XA 3K7AH 4TVAB 3EJIA 4ZKBB 4ZYSA 1NJIC 2F0DA 4DV3Q 5KYIA 1PRTD 3TP7A 1Q46A 4X65Q 2CH4A 5BN4A 3NWSA 1EYGA 4FF4A 4JV5L 1G91A 1S5CD 3F2CA 4B3SL 5EPKA 1B44D 3CRKC 3RNUA 4BWGB 3S1NB 1MI2A 3GDEA 4P73A 1PA6A 4B3TQ 3D31A 4DV2L 5M5XH 1O78A 2B2VC 2VXWA 4YY3Q 2HQEA 2CVRA 3T51B 2YYZA 3M4PA 1I4QA 3CCMA 1IKLA 1HR0W 3I56A 4A3MH 4AH6A 2UUCL 3JAMi 3NBHB 4LUZA 2B2UC 5A35A 5E4WC 5KGUA 1JT8A 2DN8A 3GTGB 4ME3A 2IX1A 4AQYL 3A5ZB 3NBIA 3L2PA 4IN3A 2A19A 1A6XA 4DR7L 1I4RA 2WFWA 3FHWA 5FKAC 4DV1L 1E1TA 3E0JA 2F03A 5LHY1 4ULLA 1VQFA 1GO3E 2I0QA 3G48A 3TEHB 4L5RC 4JW0A 4JPBW 4PZ6A 4DXFA 1F2LA 1VCIA 3ULPA 4K5WA 1K0RA 2L9HA 2WV6D 1Q3LA 3M4OH 4A3JB 2IT1A 1JOQA 3J81j 1GHKA 1ENAA 1WFQA 3DMUA 3ONAB 4IOCA 2JJQA 4KMUC 1JJ2A 1BQQT 1VQCA 4JYAQ 5GAGC 2LS01 5FLMH 1ICFB 3HKZB 1IXRA 1HQRD 1UE7A 3GTMH 3SDZA 3ICEA 1AFPA 2NVYB 4H02A 1I6HB 1MSHA 4XT1B 4GKJL 2A69C 5A2QL 4OX9Q 5EKIA 3J81i 5C44G 1J6QA 1FJGL 3X3MA 5M3MH 3K6OA 3FP9A 3S2HH 1VQAA 2ZXOA 1NSNS 3A7LA 5L37A 3Q22A 2ENBA 1H9RA 2VL6A 3PUYA 3ER0A 1QUQA 4MTKA 1F2YA 2VW9A 1JOKA 4DN4M 2YTXA 3DHQA 1PXUA 4UAIA 2K01A 3S16B 3I73A 1S5DD 1EY7A 2HDLA 4B9XA 5ELDA 3GTKB 5ELOA 1HHVA 1LT4D 4A3FB 4K5XA 1ZYRC 2NVQB 5M3FG 4JVZA 2D9UA 3PO2H 5T1GA 3H6MA 3MXNA 1F77A 1TWFH 3S17H 4CKEA 1JJCB 1B9NA 4BXXH 1N32Q 4XTCS 4C3IG 3P20A 4HN7A 2ZM6Q 4UP8A 1YHBA 3S14B 4KY5A 4FO2A 4JCVE 5ELFA 4DV5Q 1XNRL 3BG3A 1Q8IA 1PZID 1IYJB 4QMGA 3PIOA 4OWWB 4RGOS 5JAVA 2JQOA 1I4GA 1XNQL 3PUWA 1GOZA 2R92B 4P72A 3K8AA 5GAEC 1EYAA 1II3A 5CYUA 3KUPA 3PO3G 4BA2I 4DV5L 1XNRQ 1W3SA 3ZYYX 1V1PB 2FINB 3RLFA 1KLGD 4JI0L 2F0SA 2L11A 1B53A 1HNZL 1CQFA 3I70A 2OTLA 3MFYA 2NZHA 4IUNA 4R4IA 3TN2A 3KLWA 3D4WA 4DV0L 1JB7A 4IJHA 5C3XA 3Q23A 5I2YA 3HOUH 2L0CA 3T16A 1U4RA 4X3TA 3NQIA 3T1YQ 2BA1A 1I6VC 1X65A 1IZ6A 2ALYB 4JOIC 4ZLTF 2K5VA 3NXWA 3J81E 1O7YA 1LTBD 2Q2UA 1BDOA 1HNZQ 4OO1H 1FGBD 2Q8RE 2PQEA 1PH8A 2IW3A 4HAEA 2F0QA 1EU4A 5C3EB 1G6PA 2NVTB 5C5MA 1LABA 4YCUA 4LF5L 3CPWA 4Y52H 2KENA 2R6GA 2L15A 1MKHA 1UWVA 3GTGH 1QJOA 4IUUA 2A5HA 3G71A 3K5MA 2ATWA 1JJGA 2L5TA 3IRBA 5K36H 1STGA 1J8IA 1NMGA 4A3GH 3MEFA 1VMCA 2VS1A 3J7AF 5M3FB 1YNJD 2QILA 5M3FH 5M5XB 2OTJA 1VDZA 5IP7H 4C2MB 2O5JC 1S4ZA 4KN7C 1XPUA 1HPCA 1V8QA 4LFCL 1HZ9A 5M5YB 4NMZA 2PQAB 1RIPA 3DWQA 3SK4A 4C3IH 2AUKA 2QDBA 1VQIA 4RMFA 1G2TA 4OHJA 2DY8A 4NW2A 5CV5A 3I4MG 5GAHC 2GN5A 1SJED 2F0VA 4R1JA 3AYHB 4IFDG 3WOEA 2JE6I 4R8IA 3KJOA 3DEPA 4BBRH 4A3LH 4R4QA 2G9HD 2E2IB 2V1CC 1NR2A 3FKIH 3FDTA 1NE3A 3KK7A 3A55A 1SR3A 1GUWA 4A3GB 1JE5A 2BDNA 1PFMA 1LO5D 1G51A 4DF7A 2E2JB 1RCVD 2JN4A 3OYYA 3C3LA 1QILA 2KVMA 2SEBD 1GUTA 5IY0A 1GM5A 3RZOH 1OXUA 3PO2B 4A3JG 3AFPA 4DR3Q 2A6HD 1B3AA 4ZCKA 4A3FH 3M3YH 3TREA 3BDOA 5EKKA 3IFDA 3G7LA 1LTTD 4UHVA 1PH9A 1FNWA 2EJGC 3MEHA 2N3SA 1JR0D 1YJ9A 1L1OB 4HEDA 2XWBB 2B63H 3S2HB 4B08A 4JI2Q 4M1UB 2AQ1B 3BYTB 2JP1A 2Z4IA 3CCQA 3GTOB 3I4NH 3MA2B 1WYDA 1ENFA 2EOTA 2XRQD 3U9OA 2CW0C 1SJHD 2NN6G 1O7ZA 2EYHA 4LFBL 2HHHQ 4C1NK 1A2UA 4J6HA 2A68C 5CV8A 4QGUA 1EWIA 1EWHA 1JCKB 1HFNA 5M3MB 2Y0SG 1WI5A 2EVBA 2CW0D 3MXNB 2K05A 5CBAE 4PNYA 1SMXA 2K1BA 4BS9A 1TY0A 2PNRC 4C3JG 3HOWB 3TQYA 2E75C 1AW7A 4TRDA 2D0OA 5I2XA 2UXBQ 4YWKA 4K2KA 3HZXA 5C3EH 2KCNA 1HNWQ 4QUCA 3S9WA 3HRZC 1DOLA 1FL0A 4DK3C 4V0BA 1W6KA 3KBGA 3NWTA 3RD4A 3M85A 4JI5L 5J22A 3PSIA 1PH5A 1MBYA 2A6EC 3CC2A 3RUZA 2NZ1D 3M7GA 1XWEA 5C4JB 1ASZA 4J8QA 4DR1Q 4A76A 2JA6H 4YCVA 2EYJA 4LW1A 4MZ9A 4OIKA 1XPOA 4DR6Q 3VA5A 4P71A 5IYCH 4FDBA 4R4TA 3KF8B 4ALPA 4F88A 3W5OA 3T13A 4ZK9B 2Z6KC 1OXTA 2J4XA 1GD7A 1KAAA 1X3QA 1FJGQ 2EYFA 1Y1WG 1J9OA 3A7AB 4RKLA 4DV4Q 1X3PA 4GKJQ 2L55A 4XYQA 1RODA 4GLXA 3SVMA 3S1MH 1R9TH 3W1BA 1X6OA 2JXMB 2Z4HA 4FP5D 1BKBA 4DXGA 2F0GA 3STBD 2VZAA 1YITA 2Q8TA 2FFKB 3A0JA 3G4SA 1OXVA 3J7ZC 5LMUQ 1WTPA 2NVQH 2ZJRA 1WTXA 2F0LA 4OEMB 5EPLA 4APVA 4OIJA 3CRLC 3S24A 5CBEE 5BN3A 1DOMA 3MZ5A 4GNXC 1TQOA 3KDFB 1SYFA 5IGDA 1PTOC 5M9OA 4OONA 4RHSA 5HGQA 2XTIA 1IL2A 4LF8L 4AIMA 1DZ1A 3R2IA 3SK8A 4A75A 5J3BA 4DV7Q 3I4NB 5H1SE 2OXPA 1Q7YC 1X9NA 1STBA 3GV3A 3HKSA 1A3TA 1SROA 1PZJD 1WJJA 4GLAC 3D8GA 5FJ8H 1LTGD 4X6AH 2CWAA 3K57A 3VYSA 1XMOL 1LTRD 5D65A 1HR0Q 5C4XH 4O0AA 1QUQB 3HOUB 4B3RQ 2TMPA 1KLUD 4QL5A 1ESFA 3FKIB 4K8IA 1E3PA 4KD3A 5JJIA 3HS0C 5C4XB 3HOXH 4LF7L 3PIO3 1AN8A 2I07B 4YCWA 1EY4A 2HT1A 4RGTA 2N88A 1TR5A 3SGIA 1SN8A 4LFAL 3OPOA 1SYEA 1BO0A 1CKMA 1EOTA 4IO9A 4IQZA 1I4PA 4Y7NH 3GD7A 1PTOB 4K8JA 5IWAL 1DONA 1K8OA 4DAYB 3H3VC 4LF4L 2B39A 4KHVA 3JC66 1B1ZA 1EYCA 1GUNA 1JWSD 4B3TL 4C3JH 1SRUA 2PMZE 4C3JB 2AMCB 1F9SA 2BH2A 4JI5Q 3PF5A 3HOZB 4A3KH 2Z9HA 5JOBA 1EIHA 2B2WC 2I5MX 1RDPD 3QR8A 2YU9H 3H3VH 2UU9L 3K5LA 4BBSH 1BF4A 2WKDA 4NXNL 1NR4A 3KOJA 3RLOA 4A3EG 2AHOB 1ET6A 3ZJYC 1JQYD 4ID6A 3CXCA 1L1OC 4F7XA 2QDLA 3R2TA 1C8CA 3SK6A 5IODA 3KLSX 2EY5A 4IUQA 4BY1B 2JA6G 2RA4A 4A3BB 4DK1A 1EQRA 1NNXA 5I4DA 1PH3A 2J0TD 4HJ9A 2F0OA 2MO0A 3KBXA 5CR3A 3GTLB 5CC4A 4DFAA 5HURA 4WJWA 5I9OA 1MIUA 2UXDL 4HJ7A 2F0NA 5M5YH 2EXDA 2VUMG 4JI7Q 5HGTA 2R92H 3GTPH 4JOIA 1XPRA 2JA5H 3PCOB 5J1ZA 5LMNQ 1PTOF 1VQBA 1ILPA 4L5QA 4RCOA 3I4LA 1E22A 2NVYH 3H09A 1PDQA 5EJWA 1O7LA 3GQBA 5K5PA 5IYDG 1B2TA 2ZXPA 4QQBX 2M2LA 2JA6B 4A3BG 2PW5A 3CCRA 4OX9L 2DY7A 1TWFB 2LXJA 3K7UC 5GQOA 4MN3A 3MC0B 1MGSA 2D2CC 1STNA 5GADC 5JEAG 1WVLA 1XTCD 3U9SA 4HTHA 5BN5A 3BVGA 2B2UA 2K5WA 1SLJA 4JYAL 1ET9A 4G57A 3I55A 3PF4A 4DPGA 4FYDA 2IPKD 1DD2A 3PUVA 5IGFA
chains in the Genus database with same CATH topology
5IGGA 1R4PB 2NYZD 4XXEA 5ELCA 5EPJA 3A8KE 5I6YA 2NTTA 1Z47A 4OO1G 3FMCA 2VB2X 5NUCA 3PV0A 3S17B 2CHBD 3QOJA 4EVOA 1EZ6A 1QCBD 4EGVA 3K59A 1HXYD 1PTOD 3D4DA 4LAAA 2F0TA 4RA8A 5EBCA 2MHVA 1SYCA 1D5XC 4IURA 1VF5C 1EU3A 4KHZA 4MIUA 4WORA 3TSSA 1RTOA 1CA6A 1U4LA 1CA5A 1GHJA 1D2BA 4KKUA 1RTNA 1H9JA 1EY0A 1SE2A 5E3FA 1VMPA 3LWEA 5DM73 1SXTA 4X3KA 1BBXC 2KECA 1I4XA 3OW7A 3SXHA 5C44B 1LTID 2A73B 2PZUA 2EY2A 4C3HG 5DM63 4PMWA 3QB3A 5COYA 3MHBA 5IIFA 1DYQA 1KDAA 3ERQA 1JORA 5IGBA 2F3VA 2H4OA 1ONLA 5CV9A 4TSSA 3IKJA 5AFWA 5C3WA 1SNPA 3OWFA 1NAPA 4QUFA 2SDFA 1Y8OB 1EQVA 1DOKA 3GTPB 1JC7A 2MJ8A 3JAML 3C46A 5CGKA 1AZPA 3QO2A 2B2YA 1DJRD 1D1KA 2RBMA 5JEAJ 3RZOB 1IHZA 4CKCA 5KNDA 1MSGA 3QIAA 1STEA 1SYBA 1PFNA 1UUPA 3J80E 3GO5A 1ZKOA 3GP7A 2MP1A 1H9SA 1BUVT 1UAPA 1I50B 5C4ZA 5DNFA 2EY6A 3N6RA 3A8IE 4ZUJA 3H94A 1BCPD 5JVH3 1LACA 1EIGA 2A74C 1HCZA 1KDCA 2K28A 1EY6A 2TSSA 1CZWA 2JA7B 4BBSB 2QCPX 3MXUA 4CKBA 3A8JE 3PUZA 3NK9A 2BE5D 1WD1A 1ZYRD 3JAME 4C3HB 2AUJD 4HCSA 1SNQA 2E74C 4EQOA 1PRTB 1CM9A 5IT9E 3D6CA 3OMGA 1CTMA 3DM1A 1R9TB 3TP8A 2EE1A 5E4XA 5D3DA 4TKOB 1LT5D 2OF1A 1GUSA 2KUMA 4CGYB 2EZVA 3LNNA 4QIWB 2KEDA 2F0WA 4G7OC 4XIGS 4G7ZC 1STHA 4L6TB 1HA5A 4BY7B 1STAA 4Q0FA 2K6AA 2O5IC 1A3VA 2BA0A 3FRPB 2B8FA 3VYRA 4DGZA 2NN6I 3M4OB 1W6JA 3AU7A 3QJYA 3HGBA 4CJ1B 5KYLA 5I9PA 1TT2A 1TS3A 1TU2B 2RVLA 1D1IA 2KHSA 2XIWA 3URYA 2EJFC 4XYOA 2BE5C 3I8ZA 5I6WA 3VR5A 2NBFA 1F2MA 1BCPB 1S5ED 3H0GB 4FXGC 4O42A 1D6EC 4XQJA 3C1FA 4ZRZA 1V43A 1PRTF 4KV6A 3VYUA 1IW7C 1G8ZD 3L3OC 4CHTB 1T5XD 4O1NA 3Q24A 3R8BA 1L0YB 1E2ZA 2K33A 4A3KB 4RAUC 2ICIA 2EYMA 2HCIA 1QG7A 5A2QE 1SNOA 1EFID 4JBWA 4IFDH 1QB5D 1EY8A 4K5VA 1LTSD 4QF4A 1PTOH 4PV1C 2Q8IB 2RQXA 5M5WB 1R4QB 1F9QA 3GTJB 4DNTB 4HSPA 1TWCB 4KD4A 2K5QA 1I4HA 4DK0A 3RMHA 2KA7A 3N52A 1GJXA 3TDQA 3CHBD 4U673 1C48A 3FEWX 2JSOA 5TSSA 5CMDA 1D5MC 2JEBI 1G6ZA 1EZ8A 4C3IB 4ZUIA 3SHLA 5KNCA 4RFBA 1JOOA 4XQNA 3TP5A 1GXDC 1H9MA 4FXDA 3VYTA 1Y69U 4HR7B 2F4IA 4BBRB 1WTVA 5DEHA 3J7YW 1CT1D 4PQXA 3BS1A 5G3LF 4CBVA 4NKLA 3FPPA 3R93A 4HMJA 4NDXA 3BVMA 4ZAIA 2C9OA 2B8GA 5C0XI 3M3YB 1IKMA 1SDFA 4K2LA 3G6JB 1IYVA 2F0UA 1TS4A 2BCOA 3I72A 1EEID 1SMYC 4OGQC 2NVXB 3I90A 1U9RA 4K6LA 1EYDA 1PRTC 3VR4A 3V96A 5K36G 1Y8PB 2AQ3B 4KI0A 3C1EA 3Q6SA 1EY9A 3NPPA 3NBHA 2LKVA 2X6LA 3S1MB 5FK9C 3Q0AA 1SNDA 1CK1A 3MWYW 4G4KA 3V2TA 1XYIA 2ZT9C 4A3IB 4FXKC 2FMMA 1XX8A 3GTQB 1D5ZC 5FO7B 3EA6A 3DEOA 1CZGA 3OMCA 4IFDJ 3HOXB 2A6ED 5FLXE 3OIQA 2RDGA 3EQLC 4KKTA 1M8AA 1I3QB 1ZXTA 4I7ZC 4Y7NB 3IL8A 2F0MA 1ML0D 2G9DA 1HA6A 2F3WA 1O80A 1ENCA 1PMRA 3W3AA 3CKIB 5CV4A 3S2DB 2AWOA 3NTHA 5FLXL 5CORA 3MXGA 4FNFA 5KNBA 2PZWA 2BOSA 1OO9B 4N9PA 1VF7A 3S1RB 4HMIA 2R93B 2N55A 1Q1EA 1BCPC 1F9RA 1U4PA 4ILWA 1WTWA 2F0PA 2XN9C 2AWNA 1EWCA 4K14A 3K0YA 4OO1I 2LY7A 4A3MB 3GTMB 2PZTA 1S5BD 3J81L 4KK7A 2NN6H 1ILQA 2JEAI 1HRJA 1UNSA 3BDLA 2QKIC 3NSWA 1QOHA 4H0LC 5JVG3 1YNJC 2WB1B 3J7AV 3KLSA 4A93B 2B2TC 3MVVA 1IW7D 1KNEA 3EROA 3L9AX 1AZQA 4KTAA 2H1EA 3K5NA 2M00A 4H13C 4H44C 1E2VA 1QNKA 4HSVA 3D6WA 5D3IB 2R7ZB 3CU7A 2EXZA 4OL7A 2SOBA 5IGCA 4XDXA 4Q5VA 5LL6X 1V1PA 2KEEA 2RKSA 3QOLA 2A68D 3ND9A 2F0EA 1ICWA 2SNMA 3TZUA 1NCVA 1RHPA 3T53B 2E2HB 2OEOA 1UEAB 4KJOA 5JJZA 1A15A 3L7ZC 1SEBD 1K8MA 3I3CA 1GUGA 2HUGA 4EQNA 2VB3X 2K7VA 1SFOB 4LMQD 1A3UA 2F1MA 1AP0A 2XNAC 3OOCA 4EQPA 2F0KA 1E0BA 2EY1A 2V4DA 2B63B 2LMCB 1Y1VB 3HOYB 3M4YA 1QNUA 3WDNA 2DNCA 1LTAD 1H9SB 1HFGA 1WTQA 3T56B 1K83B 3VA7A 2WIIB 1Q90A 3PUXA 4RGNA 3S1QB 3DUZA 4U68A 2B2VA 3NP8A 3MXPA 4DA2A 2HCCA 1DXMA 1PLFA 1C4QA 1YNND 2NUCA 2WKCA 1BXTA 1SYGA 2PO4A 4DU9A 2B2TA 1G2SA 4IZ8A 4B9WA 2E2DC 4Z9CB 1H9KA 3SEBA 4YIJA 5C4HA 2RDFA 4HCEA 2C5CA 3DWAA 1YNNC 1Q1BA 1B4OA 4J1MA 4S3SA 1GUOA 3R3OA 3NQTA 2LFNA 2ICEC 1RKNA 1RJTA 5J39A 2JA8B 1HUMA 5EBDA 2ZXRA 4A3DB 4FVMA 1CHPD 1KABA 2ID0A 2VUMB 3VR3A 2F0FA 5T1IA 1S5FD 1HTPA 4DAPA 4L63B 2GA4B 1Z6HA 2D5DA 4X3UA 5C0XH 2L4NA 4DNRB 3AMUA 4FF2A 3QWNA 2A69D 4IUTA 2L12A 1LV9A 1RF2D 4F87A 1SBBB 1PYWD 4E6IA 1FNVA 4XQQA 3S15B 2NTSA 5KRUA 1OXXK 5CV6A 4KN4C 2KCCA 4BA1I 5JPNC 1CI3M 4K6DA 5C5LA 4IFDI 4XT3B 4FF3A 2WP8J 1WTOA 1HUNA 3SE0A 1OXSC 3BYYB 4MHEA 3D3RA 4WFN3 2IL8A 1TY2A 1Y8NB 4C56C 4JK1C 3BZDB 5KEEA 3FPUB 1SE4A 1EL0A 2HDMA 5IOCA 4RKBA 3KF8A 2KJXA 4TQUS 1JWMD 1LT3D 3QG1A 4R9WA 3NTIA 4DAYA 1WTRA 3WOFA 1V1OA 4FF1A 4QCLA 1L0XB 3OIPA 5CV7A 2QEJC 2JA5B 4ZQ3A 3A56A 2EYPA 2BDOA 1TWGB 3EVQA 4KJNA 1BR9A 3SR1A 3K7AB 1Q12A 3K5OA 4RH6A 1JE4A 2Z1CA 2FHTA 5DAUA 2JYOA 1TVXA 3PMFA 1G291 4RGMA 5C6AA 5LL6S 3MAQA 3P7JA 2FMCA 3NUCA 4PMCA 3HG9A 1PZKD 2FJ2A 4KKSA 4GZYC 3DXJC 2VNUD 2EYLA 4ZKCB 2IJ0A 1Y1WB 3HOVB 3BDCA 4F8MA 3ITPA 4L8JA 2J7ZA 4V190 1JB3A 3V05A 4CJ0B 4RCNA 4IUPA 2F0IA 1B50A 3DWPA 2RSOA 1QWYA 3W2DA 4R8NA 3E6ZX 1TIID 2XVSA 2K5DA 4NP5A 2OT2A 3CQZB 1EEFD 1KDBA 3TP6A 2XRSD 2AQ2B 3RZDB 2D62A 1TWAB 1KTKA 3NHHA 4KY6A 5E1FA 1M4VA 2RDHA 5EGTA 4P2CB 1LT6D 2CQAA 1STYA 4LJZC 2Y0SB 1PFBA 1BCPF 3T4AC 1T5EA 2M9VA 3IFTA 1SE3A 1FD7D 3C2PA 1BOSA 1SMYD 5JEAH 4RWSC 2K03A 4WRDA 1IYUA 1FYCA 1XXGA 2XWJB 1TS5A 2IWHA 1TKWB 5EQ0A 3P1HA 4G7HC 2RSNA 1TS2A 2F0HA 2EPBA 4DAVA 3OSOA 2X69A 4CJ2C 3BVZA 4H7BA 1SYDA 2IX3A 1IL8A 5D14A 2I46A 5EKLA 2PPBC 4IALA 2PMZB 2PW7A 2B2WA 5KIXA 4C1NI 1FR3A 5FO9B 4M8AA 3MTSA 5FO8B 3X3NA 3ND8A 1CQVA 3TZDA 1ZEQX 2PCFB 1E2WA 5ELEA 3FVQA 4UDUC 3TMEA 3VR6A 3A54A 2WACA 3I4MB 2NB0A 4I65A 3EFXD 3VR2A 1Z7TA 1KNAA 1EY5A 2EJMA 5IGEA 3UI2A 2A6HC 3PIP3 1LLRD 3M7NA 4X3SA 1FNUA 2DNEA 1QE6A 1U4MA 3H91A 1RD9D 3MFGA 1DCZA 2L1BA 2MUYA 1BNZA 5ELBA 5FOBB 3NTKA 5F2DA 2YU9B 2B2YC 4QB4A 2K32A 3AB9A 2Z8LA 1AEXA 2KOLA 2MPMA 3D4RA 2QF7A 1EQTA 1NUCA 2NWGA 3HP3A 3GV6A 2XSCA 5G3LD 1CFMA 4AYBB 4A3EB 1JICA 1MD2D 4N9TA 1ESRA 3IAYA 3PO3B 3P75A 1A2TA 1X32A 1SSOA 3J80L 4IUVA 3SK5A 3OWEB 1DM0B 1F9PA 4RHRA 4ME5A 1HQMC 3LX0A 1B9MA 3KLRA 1SAPA 1SNMA 2F0JA 2MGSA 3K58A 1F2ZA 4ODGA 2PYKA 2WAQB 3OHXC 3I91A 1CHQD 5C0XG 5JPMC 2IX0A 2R3ZA 3NE5B 4PMBA 2SNSA 5C0XJ 1TWHB 4ABNA 1WCMB 2K04A 3HEJA 2KQ3A 2E76C 2O2LD 3O13A 4KY7A 3F2UA 2EYOA 2X6GA 3TBIB 4LK1C 3E5SA 2R61A 5IT9L 1WD0A 3LWUA 2WINB 1SNCA 1JWUD 2EDGA 1HTLD 5ISRA 2O4XA 3EJIA 4ZKBB 4ZYSA 2F0DA 5KYIA 1PRTD 3TP7A 5BN4A 3NWSA 4FF4A 1G91A 1S5CD 5EPKA 1B44D 3CRKC 4BWGB 3S1NB 1MI2A 3D31A 1O78A 2B2VC 2VXWA 2HQEA 2CVRA 3T51B 2YYZA 1I4QA 1IKLA 5A35A 2B2UC 5E4WC 5KGUA 2DN8A 3GTGB 2IX1A 3NBIA 4IN3A 1A6XA 1I4RA 5FKAC 3E0JA 2F03A 5LHY1 4ULLA 4DXFA 1F2LA 1VCIA 4K5WA 2L9HA 2WV6D 1Q3LA 4A3JB 2IT1A 1JOQA 1GHKA 1ENAA 3DMUA 3ONAB 4KMUC 1BQQT 2LS01 3HKZB 1HQRD 3SDZA 1AFPA 2NVYB 1I6HB 1MSHA 4XT1B 2A69C 5A2QL 5EKIA 3X3MA 3K6OA 2ZXOA 1NSNS 3A7LA 3Q22A 2ENBA 1H9RA 3PUYA 1F2YA 1JOKA 4DN4M 4UAIA 3DHQA 1PXUA 2K01A 3S16B 3I73A 1S5DD 1EY7A 2HDLA 4B9XA 5ELDA 3GTKB 1HHVA 1LT4D 4A3FB 4K5XA 1ZYRC 2NVQB 2D9UA 5T1GA 3H6MA 3MXNA 1F77A 4CKEA 1B9NA 4XTCS 4C3IG 3P20A 4HN7A 3S14B 4KY5A 4FO2A 5ELFA 3BG3A 1Q8IA 1PZID 4QMGA 4RGOS 5JAVA 1I4GA 3PUWA 1GOZA 2R92B 1EYAA 1II3A 5CYUA 3KUPA 4BA2I 3ZYYX 1V1PB 2FINB 3RLFA 1KLGD 2F0SA 2L11A 1B53A 1CQFA 3I70A 3MFYA 4IUNA 3TN2A 3D4WA 5C3XA 3Q23A 5I2YA 2L0CA 3T16A 1U4RA 4X3TA 3NQIA 2BA1A 1I6VC 4ZLTF 3NXWA 3J81E 1O7YA 1LTBD 1BDOA 4OO1H 1FGBD 2Q8RE 2PQEA 2IW3A 4HAEA 2F0QA 1EU4A 5C3EB 2NVTB 5C5MA 1LABA 2R6GA 1QJOA 4IUUA 2A5HA 3K5MA 2L5TA 5K36H 1STGA 1J8IA 1VMCA 3J7AF 5M3FB 1YNJD 2QILA 5M5XB 1VDZA 2O5JC 4C2MB 1S4ZA 4KN7C 1HPCA 1V8QA 5M5YB 4NMZA 3DWQA 3SK4A 2AUKA 2QDBA 1G2TA 4OHJA 2DY8A 4NW2A 5CV5A 1SJED 2F0VA 4IFDG 3WOEA 2JE6I 4R8IA 3DEPA 2G9HD 2E2IB 1NR2A 3FDTA 3KK7A 3A55A 1GUWA 4A3GB 2BDNA 1PFMA 1LO5D 4DF7A 2E2JB 1RCVD 3C3LA 1QILA 2KVMA 2SEBD 1GUTA 1OXUA 3PO2B 2A6HD 1B3AA 3BDOA 5EKKA 3IFDA 3G7LA 1LTTD 1FNWA 2EJGC 3MEHA 1JR0D 4HEDA 2XWBB 3S2HB 4B08A 4M1UB 2AQ1B 3BYTB 2JP1A 2Z4IA 3GTOB 3MA2B 1ENFA 2EOTA 2XRQD 3U9OA 2CW0C 1SJHD 2NN6G 1O7ZA 2EYHA 4C1NK 1A2UA 4J6HA 2A68C 5CV8A 1EWHA 1JCKB 1HFNA 5M3MB 2EVBA 2CW0D 5CBAE 2K05A 4PNYA 2K1BA 4BS9A 1TY0A 2PNRC 4C3JG 3HOWB 2E75C 1AW7A 4TRDA 5I2XA 4K2KA 3HZXA 2KCNA 4QUCA 3S9WA 3HRZC 1DOLA 4V0BA 1W6KA 3KBGA 3NWTA 3RD4A 3M85A 5J22A 1MBYA 2A6EC 3RUZA 2NZ1D 3M7GA 1XWEA 5C4JB 4J8QA 2EYJA 4OIKA 3VA5A 4F88A 3T13A 4ZK9B 1OXTA 2J4XA 1KAAA 1X3QA 2EYFA 1J9OA 3A7AB 4RKLA 1X3PA 2L55A 4XYQA 1RODA 3SVMA 2JXMB 2Z4HA 4FP5D 4DXGA 2F0GA 2Q8TA 2FFKB 1OXVA 1WTPA 1WTXA 2F0LA 5EPLA 4OIJA 3CRLC 5CBEE 5BN3A 1DOMA 3MZ5A 1TQOA 1SYFA 5IGDA 1PTOC 5M9OA 4RHSA 1DZ1A 3R2IA 3SK8A 3I4NB 2OXPA 1STBA 3GV3A 1A3TA 1PZJD 3D8GA 1LTGD 3K57A 3VYSA 1LTRD 5D65A 3HOUB 2TMPA 1KLUD 1ESFA 3FKIB 4K8IA 4KD3A 3HS0C 5C4XB 3PIO3 1AN8A 2I07B 1EY4A 4RGTA 2N88A 1TR5A 3OPOA 1SYEA 1BO0A 1EOTA 4IQZA 1I4PA 3GD7A 1PTOB 4K8JA 1DONA 1K8OA 3H3VC 2B39A 4KHVA 1B1ZA 1EYCA 1GUNA 1JWSD 4C3JB 1F9SA 3HOZB 5JOBA 1EIHA 2B2WC 1RDPD 3K5LA 1BF4A 2WKDA 1NR4A 1ET6A 1JQYD 4ID6A 4F7XA 3R2TA 1C8CA 3SK6A 5IODA 3KLSX 2EY5A 4IUQA 4BY1B 4A3BB 2RA4A 4DK1A 5I4DA 2J0TD 2F0OA 3KBXA 5CR3A 3GTLB 5CC4A 4DFAA 5HURA 4WJWA 5I9OA 2F0NA 5HGTA 5J1ZA 1PTOF 1ILPA 4RCOA 3I4LA 3H09A 1PDQA 5EJWA 1O7LA 3GQBA 5K5PA 1B2TA 2ZXPA 2M2LA 2JA6B 2PW5A 2DY7A 1TWFB 4MN3A 3MC0B 1MGSA 2D2CC 1STNA 5JEAG 1WVLA 1XTCD 3U9SA 4HTHA 5BN5A 3BVGA 2B2UA 2K5WA 1ET9A 4G57A 4FYDA 2IPKD 1DD2A 3PUVA 5IGFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NR2 A;  2B2T C;  2B2V A;  2J7Z A;  2NYZ D;  4OIK A;  3FDT A;  4U68 A;  3QO2 A;  1X32 A;  1BO0 A;  2KUM A;  3Q6S A;  1EOT A;  1SSO A;  2B2Y A;  1KNE A;  2IL8 A;  4IUV A;  5EPJ A;  4CJ0 B;  2HCC A;  4IUP A;  1PLF A;  2KED A;  1GUW A;  2BDN A;  1F9P A;  1PFM A;  2X6L A;  2H1E A;  4ZK9 B;  3KUP A;  3TZD A;  1AZQ A;  1B50 A;  3FPU B;  3MWY W;  1QNK A;  1DON A;  2RSO A;  2KVM A;  1XYI A;  1EL0 A;  2HDM A;  1X3Q A;  2FIN B;  4HSV A;  3D6W A;  1F9Q A;  2B2T A;  2FMM A;  1XX8 A;  2L11 A;  1B53 A;  1G2S A;  1SAP A;  2MGS A;  3DEO A;  1F2L A;  1F9S A;  1J9O A;  4RA8 A;  1MSG A;  3TN2 A;  1G2T A;  2L9H A;  1X3P A;  1B3A A;  4XDX A;  1CA6 A;  1Q3L A;  4R9W A;  1EIH A;  2B2W C;  1ROD A;  3N52 A;  4IUR A;  1WTR A;  2KEE A;  1PFN A;  3I91 A;  3IFD A;  3SVM A;  1BF4 A;  1U4R A;  3ONA B;  4X3T A;  3G7L A;  1KNA A;  1RTO A;  5CMD A;  1NR4 A;  1ICW A;  2MP1 A;  3UI2 A;  1B4O A;  1U4L A;  1M8A A;  2R3Z A;  4MHE A;  4ZLT F;  1NCV A;  1ZXT A;  1CA5 A;  1G6Z A;  1O7Y A;  1RHP A;  3IL8 A;  1ML0 D;  4HED A;  1HA6 A;  1RJT A;  1O80 A;  2Q8R E;  2K04 A;  1HUM A;  1MSH A;  4X3S A;  2Q8T A;  2FFK B;  4XT1 B;  1RTN A;  1C8C A;  4HAE A;  4CJ1 B;  2JP1 A;  1WTP A;  4IUQ A;  1PFB A;  5JJZ A;  2RA4 A;  5EKI A;  1WTX A;  1A15 A;  5EPL A;  1QE6 A;  1U4M A;  3F2U A;  4OIJ A;  5DNF A;  2EOT A;  3KBX A;  1VMP A;  3H91 A;  5CBE E;  1DOM A;  2RVL A;  2X6G A;  3LWE A;  5COR A;  5T1I A;  1WTV A;  2XIW A;  4X3K A;  1O7Z A;  3I3C A;  2KEC A;  1BBX C;  1JE4 A;  2HUG A;  1WD0 A;  4RWS C;  2K03 A;  2L1B A;  2FHT A;  4IUU A;  4LMQ D;  1BNZ A;  1HFN A;  2JYO A;  1TVX A;  4DN4 M;  4UAI A;  1EIG A;  2K01 A;  3I8Z A;  4X3U A;  5CBA E;  1AP0 A;  2K05 A;  3R93 A;  2K28 A;  2HDL A;  4ZKB B;  2L4N A;  1J8I A;  2K1B A;  4O42 A;  5COY A;  1DZ1 A;  1VMC A;  3P7J A;  5EQ0 A;  2B2Y C;  2N55 A;  1U4P A;  1F9R A;  1E0B A;  4IUT A;  1WTW A;  1ILP A;  2L12 A;  1LV9 A;  2RSN A;  1HHV A;  4ZAI A;  1G91 A;  1PDQ A;  5EJW A;  1IKM A;  1B2T A;  2EPB A;  1SDF A;  3GV3 A;  1S4Z A;  5EPK A;  2D9U A;  5T1G A;  2M2L A;  2KOL A;  1WD1 A;  4QUC A;  2MPM A;  2DY7 A;  1DOL A;  1MI2 A;  2X69 A;  4MN3 A;  4CJ2 C;  4HCS A;  1MGS A;  2FJ2 A;  5AFW A;  1EQT A;  5D65 A;  1ILQ A;  3I90 A;  2NWG A;  3HP3 A;  1NAP A;  2B2V C;  1IL8 A;  2SDF A;  1HFG A;  2VXW A;  3GV6 A;  1CM9 A;  4QUF A;  5D14 A;  2CVR A;  2DY8 A;  1WVL A;  4NW2 A;  1WTQ A;  1HRJ A;  1DOK A;  1JIC A;  2B2U A;  2B2W A;  4ZKC B;  3DM1 A;  1IKL A;  4XT3 B;  1ESR A;  2EE1 A;  2B2U C;  2NZ1 D;  4R8I A;  2MJ8 A;  1WTO A;  5E4X A;  4RAU C;  5E4W C;  1HUN A;  3DEP A;  3MTS A;  2N88 A;  2HCI A;  1AZP A;  1QG7 A; 
#chains in the Genus database with same CATH topology
 5IGG A;  1R4P B;  4DR4 L;  2NYZ D;  4XXE A;  5ELC A;  5EPJ A;  3CCJ A;  3A8K E;  5I6Y A;  2NTT A;  2Q2H A;  1Z47 A;  4OO1 G;  3FMC A;  2VB2 X;  5NUC A;  3PV0 A;  3S17 B;  2CHB D;  3U4Z A;  3QOJ A;  4EVO A;  4HIM A;  4JI3 Q;  1EZ6 A;  1QCB D;  4EGV A;  3K59 A;  1HXY D;  1PTO D;  3D4D A;  4LAA A;  2F0T A;  2JA9 A;  4RA8 A;  5EBC A;  2MHV A;  1SYC A;  1D5X C;  2WAQ E;  1C9O A;  4IUR A;  1VF5 C;  1EU3 A;  4KHZ A;  4BY7 G;  4MIU A;  1YHA A;  4QJF A;  1PH2 A;  3Q8D A;  3M9B A;  4WOR A;  4A3E H;  5C4X G;  3TSS A;  1RTO A;  4QY7 A;  1CA6 A;  1U4L A;  1CA5 A;  1GHJ A;  1S3O A;  1D2B A;  4KKU A;  5C3E G;  3E3X A;  5BR8 Q;  3ULJ A;  1GVP A;  1RTN A;  1H9J A;  4X66 Q;  2OWO A;  3H0G H;  1I50 H;  4JI0 Q;  1EY0 A;  1SE2 A;  5E3F A;  4K0K L;  1VMP A;  2HQL A;  3LWE A;  3S16 H;  5DM7 3;  4JG2 A;  1SXT A;  4X3K A;  1BBX C;  2KEC A;  4GNX B;  1I4X A;  3OW7 A;  1HZB A;  4A3L G;  3SXH A;  5C44 B;  1PYS B;  1LTI D;  1UE1 A;  2A73 B;  2PZU A;  4P74 A;  2DJG C;  2EY2 A;  5IP9 G;  3CCV A;  2C35 B;  4C3H G;  4X65 L;  5DM6 3;  4PMW A;  3QB3 A;  5COY A;  3MHB A;  5IIF A;  1DYQ A;  1KDA A;  3ERQ A;  1JOR A;  3OTO Q;  5IGB A;  3HKZ G;  1VQO A;  2F3V A;  1IBM Q;  4LUV A;  1V9P A;  2H4O A;  2E8G A;  1Y1V H;  1X3G A;  1ONL A;  1LYL A;  5CV9 A;  1VS0 A;  4B3R L;  1YI2 A;  4TSS A;  2RHQ B;  3IKJ A;  5AFW A;  4C2M H;  4LF9 Q;  5C3W A;  2N49 A;  1SNP A;  3OWF A;  1NAP A;  4QUF A;  2SDF A;  1Y8O B;  1EQV A;  3OW2 A;  1DOK A;  3GTP B;  4JI6 Q;  1X55 A;  1JC7 A;  4BXX G;  2MJ8 A;  3GTL H;  5HY6 A;  3JAM L;  1AH9 A;  3C46 A;  3CME A;  3UE0 A;  5CGK A;  1AZP A;  3QO2 A;  2QW7 A;  2B2Y A;  1X56 A;  3PIP A;  1DJR D;  1D1K A;  4GKK L;  3EIV A;  4A93 G;  4DUZ L;  2RBM A;  5E7N A;  4HIO A;  5JEA J;  3F2B A;  3RZO B;  1IHZ A;  5AJ3 Q;  2JA7 G;  1QZG A;  4CKC A;  5KND A;  1MSG A;  3QIA A;  1STE A;  1OTC A;  1HNX L;  1SYB A;  1I3Q H;  1N9W A;  1PFN A;  3CCL A;  1UUP A;  3KDF A;  4EQ5 A;  4JI4 Q;  2RCN A;  4LF8 Q;  3J80 E;  3GO5 A;  3NEL A;  1ZKO A;  3GP7 A;  2MP1 A;  1H9S A;  2ZTE A;  4LFB Q;  1N34 Q;  2I5H A;  1BUV T;  2JK8 A;  1K3R A;  1UAP A;  1I50 B;  4O2D A;  1VQ5 A;  5C4Z A;  5DNF A;  2EY6 A;  3N6R A;  4A4I A;  3A8I E;  4ZUJ A;  3H94 A;  1BCP D;  1CSP A;  2AKW B;  5JVH 3;  4NB3 A;  1LAC A;  2PI2 E;  1EIG A;  2A74 C;  1HCZ A;  1KDC A;  2K28 A;  1EY6 A;  1WCM G;  2TSS A;  1CZW A;  2JA7 B;  5M5W H;  4BBS B;  3I7F A;  2QCP X;  3KF6 B;  3MXU A;  4CKB A;  3A8J E;  3PUZ A;  4HJ8 A;  1VQJ A;  3NK9 A;  3NEM A;  3L0O A;  2BE5 D;  1WD1 A;  1ZYR D;  3JAM E;  4C3H B;  1Y1W H;  2AUJ D;  4HCS A;  1K8G A;  1SNQ A;  1Q8K A;  2E74 C;  4EQO A;  4YWL A;  1PRT B;  1CM9 A;  5IT9 E;  1PYB A;  3D6C A;  3OMG A;  2RHS B;  1CTM A;  3DM1 A;  1R9T B;  3TP8 A;  2EE1 A;  1B7Y B;  1YBY A;  5E4X A;  4NXN Q;  5D3D A;  4TKO B;  1M90 C;  4B3M L;  4KHP Q;  1LT5 D;  2OF1 A;  1GUS A;  2KUM A;  4CGY B;  4L5T A;  2EZV A;  2JA8 G;  3LNN A;  4QIW B;  2KED A;  2F0W A;  1HNW L;  4G7O C;  4OWT B;  4XIG S;  3UDF A;  4UP7 A;  2KHI A;  4G7Z C;  1KD1 C;  1STH A;  5IYB G;  4L6T B;  4B3S Q;  1HA5 A;  4BY7 B;  1STA A;  4Q0F A;  4L5S A;  2K6A A;  3I2Z A;  4J15 A;  2O5I C;  1A3V A;  3U4V A;  4DAM A;  2BA0 A;  2F52 A;  4P75 A;  4YY3 L;  1X54 A;  3FRP B;  2B8F A;  3VYR A;  4DGZ A;  2NN6 I;  3M4O B;  1W6J A;  2E2H H;  2Y0S E;  1VQE A;  5JJK A;  3PO3 H;  3AU7 A;  4LUO A;  3H15 A;  4JI7 L;  3QJY A;  4YWM A;  3HGB A;  1PH7 A;  1VQK A;  4CJ1 B;  5KYL A;  5I9P A;  1TT2 A;  1TS3 A;  1TU2 B;  2RVL A;  1A63 A;  2I5L X;  1D1I A;  2KHS A;  3CF5 A;  2XIW A;  4JI8 Q;  4A93 H;  2WAQ G;  3URY A;  1XMQ Q;  4IPD A;  2EJF C;  4XYO A;  2BE5 C;  3CAM A;  3I8Z A;  5I6W A;  3VR5 A;  2NBF A;  4UY8 C;  1F2M A;  2JA7 H;  1BCP B;  1S5E D;  3H0G B;  4FXG C;  4O42 A;  2VY3 A;  3HFZ B;  2MNA A;  4LWC A;  1CKN A;  3ULL A;  1D6E C;  4XQJ A;  2RCF A;  3C1F A;  1P16 A;  4ZRZ A;  1V43 A;  1KRS A;  1PRT F;  4KV6 A;  3VYU A;  1XNQ Q;  1IW7 C;  1G8Z D;  3L3O C;  4CHT B;  1Q82 C;  4A3C G;  2IHE A;  1T5X D;  4O1N A;  4RG1 A;  1KL9 A;  3Q24 A;  3RR5 A;  3R8B A;  2A1A A;  4JI8 L;  1L0Y B;  1L0W A;  4LF4 Q;  4JI3 L;  1E2Z A;  2K33 A;  4A3K B;  4RAU C;  2ICI A;  2A8V A;  2EYM A;  2HCI A;  2OQ0 A;  4MNO A;  1QG7 A;  5A2Q E;  1SNO A;  4BY1 G;  1EFI D;  4JBW A;  4IFD H;  2JA8 H;  1QB5 D;  1E7Z A;  1EY8 A;  4K5V A;  1LTS D;  4QF4 A;  2WB1 E;  1K83 H;  1PTO H;  4PV1 C;  2Q8I B;  2CCZ A;  2R93 H;  2RQX A;  1HJP A;  1I94 L;  5M5W B;  1R4Q B;  1F9Q A;  3TS0 A;  1XMO Q;  3GTJ B;  1QVC A;  4DNT B;  3S1Q H;  4EX5 A;  4HSP A;  1TWC B;  2BH8 A;  4KD4 A;  2K5Q A;  1I4H A;  4DK0 A;  4R4O A;  2R92 G;  3RMH A;  2K50 A;  1AE3 A;  2KA7 A;  3N52 A;  1GJX A;  3TDQ A;  3U58 A;  3CHB D;  4U67 3;  2CKZ B;  1TWA H;  1C48 A;  3FEW X;  4DK6 C;  2JSO A;  5TSS A;  5CMD A;  1D5M C;  4LF7 Q;  2JEB I;  1G6Z A;  4HJA A;  1LTL A;  4DR2 L;  2F4V Q;  1EZ8 A;  3AQQ A;  4C3I B;  4ZUI A;  3SHL A;  5KNC A;  4RFB A;  1JOO A;  4XQN A;  3S15 H;  3TP5 A;  1GXD C;  1H9M A;  3TRZ A;  1B3Q A;  5IWA Q;  4FXD A;  3VYT A;  4UPA A;  1L2F A;  1C7Y A;  1Y69 U;  4DR7 Q;  1Q86 C;  4A3F G;  2UUC Q;  2B63 G;  4KLK A;  4HR7 B;  4DV6 Q;  2F4I A;  4BBR B;  1WTV A;  5DEH A;  1VQ8 A;  3CW2 C;  3J7Y W;  1CT1 D;  4PQX A;  3BS1 A;  1B70 B;  5G3L F;  4CBV A;  1CKN B;  4IOA A;  2UXC Q;  4AQY Q;  4NKL A;  3HOZ G;  2KCT A;  3FPP A;  4A3M G;  1BBW A;  3R93 A;  3PGZ A;  4HMJ A;  3BZC A;  4NDX A;  3BVM A;  4ZAI A;  2C9O A;  2B8G A;  5C0X I;  3RN2 A;  3M3Y B;  1IKM A;  3CD6 A;  1SDF A;  4K2L A;  3G6J B;  4DR4 Q;  1IYV A;  2F0U A;  1TS4 A;  2BCO A;  3I72 A;  1EEI D;  1SMY C;  4OGQ C;  3F8T A;  2NVX B;  3I90 A;  1U9R A;  3UDX A;  4K6L A;  1EYD A;  1PRT C;  3CCU A;  1HNX Q;  3VR4 A;  3V96 A;  2UXD Q;  1PVO A;  5K36 G;  1Y8P B;  1IBL L;  2UUB Q;  1KHI A;  3CC7 A;  4BY1 H;  2AQ3 B;  4KI0 A;  3C1E A;  3Q6S A;  1EY9 A;  2MQH A;  4DNI A;  3NPP A;  3NBH A;  2DJF C;  2LKV A;  2X6L A;  3S1M B;  4GOP C;  5FK9 C;  3Q0A A;  1SND A;  1CK1 A;  3MWY W;  5GRO A;  3AFQ A;  4G4K A;  3V2T A;  1XYI A;  2ZT9 C;  4A3I B;  4FXK C;  2R7F A;  2FMM A;  1XX8 A;  3A74 A;  3GTQ B;  1D5Z C;  5FO7 B;  3EA6 A;  3DEO A;  4NPS A;  1CZG A;  3OMC A;  4IFD J;  3HOX B;  2A6E D;  4JI2 L;  5FLX E;  3OIQ A;  2R7Z H;  1LM0 A;  4GLV B;  2RDG A;  3EQL C;  3KFU A;  4KKT A;  1M8A A;  1I3Q B;  1ZXT A;  2DUD A;  4I7Z C;  4Y7N B;  3IL8 A;  5EAY A;  2F0M A;  1ML0 D;  4BBS G;  2G9D A;  1HA6 A;  2F3W A;  4WJ4 A;  1O80 A;  1N32 L;  1ENC A;  4MTN A;  3HOV H;  1PMR A;  3F2D A;  3W3A A;  4A3J H;  3CKI B;  5CV4 A;  3S2D B;  1VQ9 A;  2AWO A;  2NVT H;  3NTH A;  4GS3 A;  5FLX L;  5COR A;  1XMQ L;  3MXG A;  3TS2 A;  4FNF A;  2R93 G;  5KNB A;  2PZW A;  2BOS A;  3VDY A;  1OO9 B;  2GVA A;  4N9P A;  1VF7 A;  3S1R B;  3EBE A;  2ZJQ A;  4HMI A;  2R93 B;  2N55 A;  1Q1E A;  1BCP C;  1F9R A;  1U4P A;  4ILW A;  2QGQ A;  1WTW A;  2F0P A;  2XN9 C;  2AWN A;  2JA5 G;  1EWC A;  4K14 A;  1HZC A;  3K0Y A;  4OO1 I;  2LY7 A;  2VQE Q;  4A3M B;  4DR3 L;  3GTM B;  2PZT A;  1S5B D;  3J81 L;  4KK7 A;  2NN6 H;  1ILQ A;  3CPF A;  2G5D A;  2JEA I;  4LF6 Q;  5JJL A;  5FJ8 G;  2B3G A;  4A3B H;  1HRJ A;  1UNS A;  3BDL A;  3CCS A;  2PQA A;  4DUY L;  2QKI C;  1IBK L;  1Q81 C;  3NSW A;  1QOH A;  3DM3 A;  4HID A;  4H0L C;  5JVG 3;  1YNJ C;  5IT9 c;  2WB1 B;  3J7A V;  3KLS A;  4A93 B;  2B2T C;  1N8R C;  3MVV A;  3HOX G;  1IW7 D;  1KNE A;  3ERO A;  2OCE A;  2VQF L;  4DR6 L;  3L9A X;  1AZQ A;  4KTA A;  2H1E A;  3K5N A;  4GNX A;  1X3E A;  2M00 A;  4H13 C;  4H44 C;  1E2V A;  4A3I G;  1QNK A;  1A0I A;  1KAW A;  4HSV A;  3D6W A;  4A3D H;  5D3I B;  2R7Z B;  4CDF C;  2N78 A;  2YV5 A;  3CU7 A;  2EXZ A;  2KHJ A;  4OEL B;  4OL7 A;  2SOB A;  5IGC A;  1XTD A;  4XDX A;  5M3M G;  4GN5 A;  4Q5V A;  5LL6 X;  1V1P A;  1L1O A;  2KEE A;  2RKS A;  1QVG A;  3QOL A;  3GTK H;  2A68 D;  3ND9 A;  1A8V A;  2F0E A;  1ICW A;  2SNM A;  3TZU A;  3U50 C;  1NCV A;  2ZTC A;  4AYB G;  1RHP A;  3T53 B;  4A3G G;  4X66 L;  3NEN A;  2E2H B;  2QA4 A;  2OEO A;  4LNQ A;  1UEA B;  4KJO A;  1K73 C;  5JJZ A;  3RZD H;  4GN3 B;  1A15 A;  3L7Z C;  3J80 c;  1SEB D;  1TXY A;  1K8M A;  1YJN A;  3I3C A;  1GUG A;  2HUG A;  4EQN A;  2VB3 X;  2K7V A;  1SFO B;  1C0A A;  4LMQ D;  1A3U A;  2QEX A;  3A5U A;  2F1M A;  1AP0 A;  2XNA C;  3OOC A;  4EQP A;  3PO2 G;  4GKK Q;  2F0K A;  4BBR G;  1E0B A;  2EY1 A;  2D0P A;  2V4D A;  2B63 B;  1K8A C;  2IY5 B;  2LMC B;  2XGT A;  1Y1V B;  4CDE C;  3HOW H;  1YIJ A;  3HOY B;  1TWH H;  3M4Y A;  1QNU A;  3WDN A;  2DNC A;  1BBU A;  1PH4 A;  1LTA D;  5IYD H;  1UE5 A;  1H9S B;  3E9H A;  1HFG A;  1WTQ A;  4X64 L;  4DV2 Q;  2K75 A;  1K83 B;  3T56 B;  3VA7 A;  1PH1 A;  2CWP A;  1VQ4 A;  3BU2 A;  2WII B;  2HIX A;  1Q90 A;  3PUX A;  4RGN A;  3ERS X;  3S1Q B;  1VQM A;  2E2I H;  3DUZ A;  1CSQ A;  4U68 A;  2B2V A;  3NP8 A;  3MXP A;  4DA2 A;  2MO1 A;  1Y14 B;  2HCC A;  1DXM A;  3W1G A;  4DUZ Q;  1XJV A;  1PLF A;  3CCE A;  2UU9 Q;  1C4Q A;  1YNN D;  2NUC A;  2WKC A;  1EOV A;  3HOY H;  1BXT A;  1SYG A;  2PO4 A;  3CQZ H;  4GOP B;  3RLN A;  1TWG H;  4DU9 A;  2B2T A;  1MJC A;  4DR2 Q;  2F4V L;  1G2S A;  4IZ8 A;  3J80 i;  4B9W A;  2E2D C;  1CKO A;  4R4C A;  4Z9C B;  1H9K A;  3KF6 A;  3SEB A;  4YIJ A;  5C4H A;  3I4O A;  3M4Q A;  1W2B A;  3GTJ H;  2RDF A;  4HCE A;  2C5C A;  3CMA A;  3S14 H;  3DWA A;  3K0X A;  1YNN C;  1Q1B A;  1B4O A;  4J1M A;  4S3S A;  1GUO A;  3R3O A;  3NQT A;  2LFN A;  2ICE C;  2UXC L;  4UP9 A;  4B3M Q;  4KHP L;  1RKN A;  1RJT A;  5J39 A;  1KXL A;  2JA8 B;  1HUM A;  5EBD A;  2ZXR A;  4N8F A;  4A3D B;  4FVM A;  4DKA C;  1CHP D;  3T1H L;  1FGU A;  4K0K Q;  1KAB A;  4JI1 L;  2ID0 A;  4IPC A;  1VQL A;  2VUM B;  4DR5 L;  3VR3 A;  2KCM A;  2F0F A;  2CQO A;  5T1I A;  1S5F D;  1HTP A;  4DAP A;  4L63 B;  3KJP A;  1SE8 A;  3JAM c;  2GA4 B;  2UUB L;  1Z6H A;  1EQQ A;  2D5D A;  1N33 Q;  4X3U A;  1NY4 A;  2ES2 A;  4CDD C;  2L4N A;  5C0X H;  4DNR B;  3AMU A;  1YZ6 A;  4FF2 A;  3QWN A;  2A69 D;  4IUT A;  2L12 A;  1LV9 A;  1RF2 D;  4F87 A;  1SBB B;  1PYW D;  1V1Q A;  2HD3 A;  4E6I A;  1FNV A;  2Z0S A;  4XQQ A;  3S15 B;  2NTS A;  5KRU A;  1OXX K;  4JI1 Q;  1BVS A;  1HH2 P;  5CV6 A;  4KN4 C;  4X62 Q;  2KCC A;  4BA1 I;  1KRT A;  5JPN C;  1CI3 M;  4K6D A;  5C5L A;  1VQP A;  1EIY B;  4IFD I;  2R7Z G;  4XT3 B;  1I94 Q;  4OXP A;  2R7D A;  2YTY A;  4FF3 A;  2WP8 J;  1WTO A;  1HUN A;  3SE0 A;  1I5F A;  1OXS C;  3BYY B;  5LMN W;  2LXK A;  4MHE A;  3D3R A;  4WFN 3;  2IL8 A;  1TY2 A;  1Y8N B;  4C56 C;  4JK1 C;  1KQS A;  1UE6 A;  3BZD B;  5KEE A;  3HOY G;  4JBJ A;  3FPU B;  3S1N H;  1SE4 A;  4WJ3 M;  2E5L Q;  2Q2T A;  1EL0 A;  2HDM A;  1YEZ A;  1D8L A;  5IOC A;  4RKB A;  3KF8 A;  2KJX A;  4DR1 L;  4TQU S;  1JWM D;  3E9I A;  1LT3 D;  1HZA A;  3LGJ A;  4GN4 B;  3QG1 A;  4R9W A;  5IYB H;  1S40 A;  3NTI A;  4DAY A;  1WTR A;  5LMN L;  3WOF A;  1U5K A;  1V1O A;  4DV0 Q;  4FF1 A;  4QCL A;  1L0X B;  3OIP A;  5CV7 A;  2QEJ C;  3BZK A;  2E5L L;  2JA5 B;  4ZQ3 A;  1VQD A;  1X3F A;  3T1Y L;  4PZ7 A;  3A56 A;  2EYP A;  1GKH A;  3I4N G;  5LMU L;  2BDO A;  1TWG B;  3EVQ A;  4KJN A;  2H5X A;  1NMF A;  1BR9 A;  3SR1 A;  4YHH L;  4IJL A;  3K7A B;  1U0L A;  2Q2I A;  4JBK A;  1Q12 A;  3K5O A;  4RH6 A;  1JE4 A;  2Z1C A;  2CFM A;  2FHT A;  5DAU A;  2JYO A;  1TVX A;  3PMF A;  1G29 1;  4RGM A;  2EIF A;  5C6A A;  5LL6 S;  3MAQ A;  3P7J A;  2RF4 A;  5FLM G;  3D0F A;  1I6H H;  2K5H A;  1PV4 A;  4A3I H;  2NVX H;  2UXB L;  2FMC A;  3I4M H;  3NUC A;  2K5N A;  1A62 A;  4PMC A;  3HG9 A;  1HR0 L;  1PZK D;  1UEB A;  4NXM Q;  2FJ2 A;  2K52 A;  3AEV A;  4KKS A;  4JC0 A;  4GZY C;  3DXJ C;  3H3V I;  4DV3 L;  2VNU D;  2EYL A;  4ZKC B;  2IJ0 A;  4C3H H;  1Y1W B;  3HOV B;  4A3C H;  3BDC A;  4F8M A;  3ITP A;  3J81 c;  4L8J A;  1N33 L;  1VQG A;  2F3I A;  4POF A;  2J7Z A;  5BR8 L;  4V19 0;  1ASY A;  1JB3 A;  3V05 A;  4CJ0 B;  4RCN A;  4IUP A;  2F0I A;  3K81 C;  1B50 A;  3DWP A;  4I7A A;  2RSO A;  1QWY A;  1YNX A;  4PG3 A;  5FLX c;  3W2D A;  4NXM L;  1EUJ A;  4R8N A;  1N34 L;  3E6Z X;  1TII D;  2XVS A;  2K5D A;  3GTQ H;  4NP5 A;  1NTG A;  2OT2 A;  4LF5 Q;  3CQZ B;  1KC8 C;  1EEF D;  1KDB A;  3TP6 A;  2XRS D;  4CDC C;  1YJW A;  2AQ2 B;  3RZD B;  2D62 A;  2Z6K A;  1TWA B;  1KTK A;  2PI2 A;  3NHH A;  1NBW A;  2LSS A;  4KY6 A;  5E1F A;  1M4V A;  3STB C;  1P8L A;  2RDH A;  5EGT A;  4P2C B;  1PFS A;  3PQI A;  3HOW G;  1LT6 D;  4POG A;  1RL2 A;  2CQA A;  4DV1 Q;  3CC4 A;  1STY A;  4LJZ C;  2Y0S B;  1PFB A;  1J5E L;  4QIW E;  1E24 A;  1BCP F;  2E2J H;  3T4A C;  1T5E A;  2M9V A;  3IFT A;  4X64 Q;  1WOC A;  1SE3 A;  1M1K C;  1FD7 D;  3B6Y A;  3C2P A;  3RN5 A;  1BOS A;  1SMY D;  5JEA H;  4RWS C;  2K03 A;  2EQS A;  4WRD A;  1H95 A;  1IYU A;  2N8N A;  1FYC A;  1XXG A;  2XWJ B;  1AE2 A;  1TS5 A;  2IWH A;  1TKW B;  5EQ0 A;  1VQH A;  2FXQ A;  3P1H A;  1MHW C;  1YVC A;  4G7H C;  2RSN A;  2UUA L;  1TS2 A;  3UDI A;  2F0H A;  2EPB A;  4DAV A;  1CUK A;  1LUZ A;  4JV5 Q;  3OSO A;  4A3D G;  1J5E Q;  2X69 A;  4X62 L;  4CJ2 C;  3BVZ A;  4H7B A;  1SYD A;  1PHJ A;  3KYH C;  2IX3 A;  2GVB A;  1IL8 A;  1VQ7 A;  4GOP A;  5D14 A;  2I46 A;  5EKL A;  2PPB C;  4IAL A;  2PMZ B;  2PW7 A;  1KIX A;  4JI4 L;  2B2W A;  1E1O A;  5IYC G;  5KIX A;  4C1N I;  1FR3 A;  3S1R H;  5FO9 B;  3K80 C;  4M8A A;  3EN2 A;  3MTS A;  5FO8 B;  1VQN A;  1EIF A;  4HIK A;  2NZO A;  5C4J H;  4LFA Q;  3X3N A;  3ND8 A;  1CQV A;  1B8A A;  2Z6B A;  2ZM6 L;  2ASB A;  3TZD A;  1ZEQ X;  2PCF B;  1QVF A;  3S2D H;  5IP7 G;  1E2W A;  5ELE A;  3FVQ A;  4A3K G;  4DR5 Q;  4UDU C;  4HJ5 A;  2HHH L;  3TME A;  3VR6 A;  3A54 A;  2WAC A;  1K28 A;  3I4M B;  1SFO H;  1K9M C;  2NB0 A;  4I65 A;  3OTO L;  3EFX D;  3VR2 A;  1IBM L;  1Z7T A;  1KNA A;  1EY5 A;  2EJM A;  5IGE A;  3UI2 A;  2A6H C;  5IP9 H;  1K0S A;  2VQF Q;  3E0E A;  3PIP 3;  1LLR D;  3M7N A;  4LF9 L;  4X3S A;  1FNU A;  2DNE A;  3BJU A;  1D7Q A;  1Y1V G;  1O7I A;  1QE6 A;  1U4M A;  4DUY Q;  1IBK Q;  1FVI A;  3H91 A;  1RD9 D;  1N36 L;  3MFG A;  1DCZ A;  4JBM A;  5AJ3 L;  2L1B A;  2MUY A;  4IPH A;  1BNZ A;  3HOU G;  3DLL A;  5ELB A;  4DV4 L;  1EFW A;  5FOB B;  1YHQ A;  2PNH A;  3NTK A;  5F2D A;  2YU9 B;  2B2Y C;  1DGS A;  2P5Z X;  4QB4 A;  3HOZ H;  2K32 A;  3AB9 A;  2B29 A;  4IPG A;  2VQE L;  2Z8L A;  1AEX A;  2KOL A;  2KBN A;  2MPM A;  3D4R A;  1JMC A;  2K14 A;  2QF7 A;  4LF6 L;  1EQT A;  1NUC A;  2NWG A;  3HP3 A;  3GV6 A;  2XSC A;  4JI6 L;  5G3L D;  1CFM A;  4AYB B;  2YTV A;  4A3E B;  1JIC A;  1MD2 D;  1IBL Q;  1N36 Q;  4N9T A;  1ESR A;  1PH6 A;  3IAY A;  1S72 A;  1MJE A;  3PO3 B;  3P75 A;  1A2T A;  1X32 A;  1SSO A;  3J80 L;  4IUV A;  3SK5 A;  3OWE B;  2UUA Q;  1DM0 B;  1WTH A;  2IHF A;  1F9P A;  4RHR A;  4ME5 A;  3GTO H;  1HQM C;  4LFC Q;  3LX0 A;  3J7A 5;  4AYB E;  1B9M A;  3KLR A;  1SAP A;  1SNM A;  3H0G G;  2F0J A;  2MGS A;  4PZ8 A;  1F2Z A;  3K58 A;  1QZH A;  4BY7 H;  4ODG A;  4OWX B;  2PYK A;  4N8X 1;  3T1H Q;  2WB1 G;  3F1Z A;  2WAQ B;  3OHX C;  4DV7 L;  3I91 A;  1CHQ D;  3UDG A;  2HIV A;  1Z9F A;  5C0X G;  5JPM C;  4YHH Q;  4DV6 L;  3CP0 A;  2MFI A;  1VQ6 A;  1T9H A;  2IX0 A;  2DGY A;  3FKI G;  2R3Z A;  3NE5 B;  4PMB A;  3WWV A;  5IE8 A;  2SNS A;  3UE1 A;  5C0X J;  2CH4 W;  1WCM H;  1TWH B;  2ZTD A;  4ABN A;  1WCM B;  2K04 A;  3HEJ A;  2KQ3 A;  2E76 C;  3G6E A;  1K3B C;  2O2L D;  2ZJP A;  2VUM H;  3O13 A;  4KY7 A;  5C44 H;  3F2U A;  5ELN A;  3HKZ E;  2EYO A;  2X6G A;  3HOV G;  3TBI B;  4LK1 C;  2OQK A;  3E5S A;  1TWC H;  2R61 A;  2K4K A;  5IT9 L;  3LWU A;  1WD0 A;  2WIN B;  1SNC A;  1JWU D;  5DLQ E;  2EDG A;  1HTL D;  5ISR A;  2O4X A;  3K7A H;  4TVA B;  3EJI A;  4ZKB B;  4ZYS A;  1NJI C;  2F0D A;  4DV3 Q;  5KYI A;  1PRT D;  3TP7 A;  1Q46 A;  4X65 Q;  2CH4 A;  5BN4 A;  3NWS A;  1EYG A;  4FF4 A;  4JV5 L;  1G91 A;  1S5C D;  3F2C A;  4B3S L;  5EPK A;  1B44 D;  3CRK C;  3RNU A;  4BWG B;  3S1N B;  1MI2 A;  3GDE A;  4P73 A;  1PA6 A;  4B3T Q;  3D31 A;  4DV2 L;  5M5X H;  1O78 A;  2B2V C;  2VXW A;  4YY3 Q;  2HQE A;  2CVR A;  3T51 B;  2YYZ A;  3M4P A;  1I4Q A;  3CCM A;  1IKL A;  1HR0 W;  3I56 A;  4A3M H;  4AH6 A;  2UUC L;  3JAM i;  3NBH B;  4LUZ A;  2B2U C;  5A35 A;  5E4W C;  5KGU A;  1JT8 A;  2DN8 A;  3GTG B;  4ME3 A;  2IX1 A;  4AQY L;  3A5Z B;  3NBI A;  3L2P A;  4IN3 A;  2A19 A;  1A6X A;  4DR7 L;  1I4R A;  2WFW A;  3FHW A;  5FKA C;  4DV1 L;  1E1T A;  3E0J A;  2F03 A;  5LHY 1;  4ULL A;  1VQF A;  1GO3 E;  2I0Q A;  3G48 A;  3TEH B;  4L5R C;  4JW0 A;  4JPB W;  4PZ6 A;  4DXF A;  1F2L A;  1VCI A;  3ULP A;  4K5W A;  1K0R A;  2L9H A;  2WV6 D;  1Q3L A;  3M4O H;  4A3J B;  2IT1 A;  1JOQ A;  3J81 j;  1GHK A;  1ENA A;  1WFQ A;  3DMU A;  3ONA B;  4IOC A;  2JJQ A;  4KMU C;  1JJ2 A;  1BQQ T;  1VQC A;  4JYA Q;  5GAG C;  2LS0 1;  5FLM H;  1ICF B;  3HKZ B;  1IXR A;  1HQR D;  1UE7 A;  3GTM H;  3SDZ A;  3ICE A;  1AFP A;  2NVY B;  4H02 A;  1I6H B;  1MSH A;  4XT1 B;  4GKJ L;  2A69 C;  5A2Q L;  4OX9 Q;  5EKI A;  3J81 i;  5C44 G;  1J6Q A;  1FJG L;  3X3M A;  5M3M H;  3K6O A;  3FP9 A;  3S2H H;  1VQA A;  2ZXO A;  1NSN S;  3A7L A;  5L37 A;  3Q22 A;  2ENB A;  1H9R A;  2VL6 A;  3PUY A;  3ER0 A;  1QUQ A;  4MTK A;  1F2Y A;  2VW9 A;  1JOK A;  4DN4 M;  2YTX A;  3DHQ A;  1PXU A;  4UAI A;  2K01 A;  3S16 B;  3I73 A;  1S5D D;  1EY7 A;  2HDL A;  4B9X A;  5ELD A;  3GTK B;  5ELO A;  1HHV A;  1LT4 D;  4A3F B;  4K5X A;  1ZYR C;  2NVQ B;  5M3F G;  4JVZ A;  2D9U A;  3PO2 H;  5T1G A;  3H6M A;  3MXN A;  1F77 A;  1TWF H;  3S17 H;  4CKE A;  1JJC B;  1B9N A;  4BXX H;  1N32 Q;  4XTC S;  4C3I G;  3P20 A;  4HN7 A;  2ZM6 Q;  4UP8 A;  1YHB A;  3S14 B;  4KY5 A;  4FO2 A;  4JCV E;  5ELF A;  4DV5 Q;  1XNR L;  3BG3 A;  1Q8I A;  1PZI D;  1IYJ B;  4QMG A;  3PIO A;  4OWW B;  4RGO S;  5JAV A;  2JQO A;  1I4G A;  1XNQ L;  3PUW A;  1GOZ A;  2R92 B;  4P72 A;  3K8A A;  5GAE C;  1EYA A;  1II3 A;  5CYU A;  3KUP A;  3PO3 G;  4BA2 I;  4DV5 L;  1XNR Q;  1W3S A;  3ZYY X;  1V1P B;  2FIN B;  3RLF A;  1KLG D;  4JI0 L;  2F0S A;  2L11 A;  1B53 A;  1HNZ L;  1CQF A;  3I70 A;  2OTL A;  3MFY A;  2NZH A;  4IUN A;  4R4I A;  3TN2 A;  3KLW A;  3D4W A;  4DV0 L;  1JB7 A;  4IJH A;  5C3X A;  3Q23 A;  5I2Y A;  3HOU H;  2L0C A;  3T16 A;  1U4R A;  4X3T A;  3NQI A;  3T1Y Q;  2BA1 A;  1I6V C;  1X65 A;  1IZ6 A;  2ALY B;  4JOI C;  4ZLT F;  2K5V A;  3NXW A;  3J81 E;  1O7Y A;  1LTB D;  2Q2U A;  1BDO A;  1HNZ Q;  4OO1 H;  1FGB D;  2Q8R E;  2PQE A;  1PH8 A;  2IW3 A;  4HAE A;  2F0Q A;  1EU4 A;  5C3E B;  1G6P A;  2NVT B;  5C5M A;  1LAB A;  4YCU A;  4LF5 L;  3CPW A;  4Y52 H;  2KEN A;  2R6G A;  2L15 A;  1MKH A;  1UWV A;  3GTG H;  1QJO A;  4IUU A;  2A5H A;  3G71 A;  3K5M A;  2ATW A;  1JJG A;  2L5T A;  3IRB A;  5K36 H;  1STG A;  1J8I A;  1NMG A;  4A3G H;  3MEF A;  1VMC A;  2VS1 A;  3J7A F;  5M3F B;  1YNJ D;  2QIL A;  5M3F H;  5M5X B;  2OTJ A;  1VDZ A;  5IP7 H;  4C2M B;  2O5J C;  1S4Z A;  4KN7 C;  1XPU A;  1HPC A;  1V8Q A;  4LFC L;  1HZ9 A;  5M5Y B;  4NMZ A;  2PQA B;  1RIP A;  3DWQ A;  3SK4 A;  4C3I H;  2AUK A;  2QDB A;  1VQI A;  4RMF A;  1G2T A;  4OHJ A;  2DY8 A;  4NW2 A;  5CV5 A;  3I4M G;  5GAH C;  2GN5 A;  1SJE D;  2F0V A;  4R1J A;  3AYH B;  4IFD G;  3WOE A;  2JE6 I;  4R8I A;  3KJO A;  3DEP A;  4BBR H;  4A3L H;  4R4Q A;  2G9H D;  2E2I B;  2V1C C;  1NR2 A;  3FKI H;  3FDT A;  1NE3 A;  3KK7 A;  3A55 A;  1SR3 A;  1GUW A;  4A3G B;  1JE5 A;  2BDN A;  1PFM A;  1LO5 D;  1G51 A;  4DF7 A;  2E2J B;  1RCV D;  2JN4 A;  3OYY A;  3C3L A;  1QIL A;  2KVM A;  2SEB D;  1GUT A;  5IY0 A;  1GM5 A;  3RZO H;  1OXU A;  3PO2 B;  4A3J G;  3AFP A;  4DR3 Q;  2A6H D;  1B3A A;  4ZCK A;  4A3F H;  3M3Y H;  3TRE A;  3BDO A;  5EKK A;  3IFD A;  3G7L A;  1LTT D;  4UHV A;  1PH9 A;  1FNW A;  2EJG C;  3MEH A;  2N3S A;  1JR0 D;  1YJ9 A;  1L1O B;  4HED A;  2XWB B;  2B63 H;  3S2H B;  4B08 A;  4JI2 Q;  4M1U B;  2AQ1 B;  3BYT B;  2JP1 A;  2Z4I A;  3CCQ A;  3GTO B;  3I4N H;  3MA2 B;  1WYD A;  1ENF A;  2EOT A;  2XRQ D;  3U9O A;  2CW0 C;  1SJH D;  2NN6 G;  1O7Z A;  2EYH A;  4LFB L;  2HHH Q;  4C1N K;  1A2U A;  4J6H A;  2A68 C;  5CV8 A;  4QGU A;  1EWI A;  1EWH A;  1JCK B;  1HFN A;  5M3M B;  2Y0S G;  1WI5 A;  2EVB A;  2CW0 D;  3MXN B;  2K05 A;  5CBA E;  4PNY A;  1SMX A;  2K1B A;  4BS9 A;  1TY0 A;  2PNR C;  4C3J G;  3HOW B;  3TQY A;  2E75 C;  1AW7 A;  4TRD A;  2D0O A;  5I2X A;  2UXB Q;  4YWK A;  4K2K A;  3HZX A;  5C3E H;  2KCN A;  1HNW Q;  4QUC A;  3S9W A;  3HRZ C;  1DOL A;  1FL0 A;  4DK3 C;  4V0B A;  1W6K A;  3KBG A;  3NWT A;  3RD4 A;  3M85 A;  4JI5 L;  5J22 A;  3PSI A;  1PH5 A;  1MBY A;  2A6E C;  3CC2 A;  3RUZ A;  2NZ1 D;  3M7G A;  1XWE A;  5C4J B;  1ASZ A;  4J8Q A;  4DR1 Q;  4A76 A;  2JA6 H;  4YCV A;  2EYJ A;  4LW1 A;  4MZ9 A;  4OIK A;  1XPO A;  4DR6 Q;  3VA5 A;  4P71 A;  5IYC H;  4FDB A;  4R4T A;  3KF8 B;  4ALP A;  4F88 A;  3W5O A;  3T13 A;  4ZK9 B;  2Z6K C;  1OXT A;  2J4X A;  1GD7 A;  1KAA A;  1X3Q A;  1FJG Q;  2EYF A;  1Y1W G;  1J9O A;  3A7A B;  4RKL A;  4DV4 Q;  1X3P A;  4GKJ Q;  2L55 A;  4XYQ A;  1ROD A;  4GLX A;  3SVM A;  3S1M H;  1R9T H;  3W1B A;  1X6O A;  2JXM B;  2Z4H A;  4FP5 D;  1BKB A;  4DXG A;  2F0G A;  3STB D;  2VZA A;  1YIT A;  2Q8T A;  2FFK B;  3A0J A;  3G4S A;  1OXV A;  3J7Z C;  5LMU Q;  1WTP A;  2NVQ H;  2ZJR A;  1WTX A;  2F0L A;  4OEM B;  5EPL A;  4APV A;  4OIJ A;  3CRL C;  3S24 A;  5CBE E;  5BN3 A;  1DOM A;  3MZ5 A;  4GNX C;  1TQO A;  3KDF B;  1SYF A;  5IGD A;  1PTO C;  5M9O A;  4OON A;  4RHS A;  5HGQ A;  2XTI A;  1IL2 A;  4LF8 L;  4AIM A;  1DZ1 A;  3R2I A;  3SK8 A;  4A75 A;  5J3B A;  4DV7 Q;  3I4N B;  5H1S E;  2OXP A;  1Q7Y C;  1X9N A;  1STB A;  3GV3 A;  3HKS A;  1A3T A;  1SRO A;  1PZJ D;  1WJJ A;  4GLA C;  3D8G A;  5FJ8 H;  1LTG D;  4X6A H;  2CWA A;  3K57 A;  3VYS A;  1XMO L;  1LTR D;  5D65 A;  1HR0 Q;  5C4X H;  4O0A A;  1QUQ B;  3HOU B;  4B3R Q;  2TMP A;  1KLU D;  4QL5 A;  1ESF A;  3FKI B;  4K8I A;  1E3P A;  4KD3 A;  5JJI A;  3HS0 C;  5C4X B;  3HOX H;  4LF7 L;  3PIO 3;  1AN8 A;  2I07 B;  4YCW A;  1EY4 A;  2HT1 A;  4RGT A;  2N88 A;  1TR5 A;  3SGI A;  1SN8 A;  4LFA L;  3OPO A;  1SYE A;  1BO0 A;  1CKM A;  1EOT A;  4IO9 A;  4IQZ A;  1I4P A;  4Y7N H;  3GD7 A;  1PTO B;  4K8J A;  5IWA L;  1DON A;  1K8O A;  4DAY B;  3H3V C;  4LF4 L;  2B39 A;  4KHV A;  3JC6 6;  1B1Z A;  1EYC A;  1GUN A;  1JWS D;  4B3T L;  4C3J H;  1SRU A;  2PMZ E;  4C3J B;  2AMC B;  1F9S A;  2BH2 A;  4JI5 Q;  3PF5 A;  3HOZ B;  4A3K H;  2Z9H A;  5JOB A;  1EIH A;  2B2W C;  2I5M X;  1RDP D;  3QR8 A;  2YU9 H;  3H3V H;  2UU9 L;  3K5L A;  4BBS H;  1BF4 A;  2WKD A;  4NXN L;  1NR4 A;  3KOJ A;  3RLO A;  4A3E G;  2AHO B;  1ET6 A;  3ZJY C;  1JQY D;  4ID6 A;  3CXC A;  1L1O C;  4F7X A;  2QDL A;  3R2T A;  1C8C A;  3SK6 A;  5IOD A;  3KLS X;  2EY5 A;  4IUQ A;  4BY1 B;  2JA6 G;  2RA4 A;  4A3B B;  4DK1 A;  1EQR A;  1NNX A;  5I4D A;  1PH3 A;  2J0T D;  4HJ9 A;  2F0O A;  2MO0 A;  3KBX A;  5CR3 A;  3GTL B;  5CC4 A;  4DFA A;  5HUR A;  4WJW A;  5I9O A;  1MIU A;  2UXD L;  4HJ7 A;  2F0N A;  5M5Y H;  2EXD A;  2VUM G;  4JI7 Q;  5HGT A;  2R92 H;  3GTP H;  4JOI A;  1XPR A;  2JA5 H;  3PCO B;  5J1Z A;  5LMN Q;  1PTO F;  1VQB A;  1ILP A;  4L5Q A;  4RCO A;  3I4L A;  1E22 A;  2NVY H;  3H09 A;  1PDQ A;  5EJW A;  1O7L A;  3GQB A;  5K5P A;  5IYD G;  1B2T A;  2ZXP A;  4QQB X;  2M2L A;  2JA6 B;  4A3B G;  2PW5 A;  3CCR A;  4OX9 L;  2DY7 A;  1TWF B;  2LXJ A;  3K7U C;  5GQO A;  4MN3 A;  3MC0 B;  1MGS A;  2D2C C;  1STN A;  5GAD C;  5JEA G;  1WVL A;  1XTC D;  3U9S A;  4HTH A;  5BN5 A;  3BVG A;  2B2U A;  2K5W A;  1SLJ A;  4JYA L;  1ET9 A;  4G57 A;  3I55 A;  3PF4 A;  4DPG A;  4FYD A;  2IPK D;  1DD2 A;  3PUV A;  5IGF A; 
#chains in the Genus database with same CATH homology
 5IGG A;  1R4P B;  2NYZ D;  4XXE A;  5ELC A;  5EPJ A;  3A8K E;  5I6Y A;  2NTT A;  1Z47 A;  4OO1 G;  3FMC A;  2VB2 X;  5NUC A;  3PV0 A;  3S17 B;  2CHB D;  3QOJ A;  4EVO A;  1EZ6 A;  1QCB D;  4EGV A;  3K59 A;  1HXY D;  1PTO D;  3D4D A;  4LAA A;  2F0T A;  4RA8 A;  5EBC A;  2MHV A;  1SYC A;  1D5X C;  4IUR A;  1VF5 C;  1EU3 A;  4KHZ A;  4MIU A;  4WOR A;  3TSS A;  1RTO A;  1CA6 A;  1U4L A;  1CA5 A;  1GHJ A;  1D2B A;  4KKU A;  1RTN A;  1H9J A;  1EY0 A;  1SE2 A;  5E3F A;  1VMP A;  3LWE A;  5DM7 3;  1SXT A;  4X3K A;  1BBX C;  2KEC A;  1I4X A;  3OW7 A;  3SXH A;  5C44 B;  1LTI D;  2A73 B;  2PZU A;  2EY2 A;  4C3H G;  5DM6 3;  4PMW A;  3QB3 A;  5COY A;  3MHB A;  5IIF A;  1DYQ A;  1KDA A;  3ERQ A;  1JOR A;  5IGB A;  2F3V A;  2H4O A;  1ONL A;  5CV9 A;  4TSS A;  3IKJ A;  5AFW A;  5C3W A;  1SNP A;  3OWF A;  1NAP A;  4QUF A;  2SDF A;  1Y8O B;  1EQV A;  1DOK A;  3GTP B;  1JC7 A;  2MJ8 A;  3JAM L;  3C46 A;  5CGK A;  1AZP A;  3QO2 A;  2B2Y A;  1DJR D;  1D1K A;  2RBM A;  5JEA J;  3RZO B;  1IHZ A;  4CKC A;  5KND A;  1MSG A;  3QIA A;  1STE A;  1SYB A;  1PFN A;  1UUP A;  3J80 E;  3GO5 A;  1ZKO A;  3GP7 A;  2MP1 A;  1H9S A;  1BUV T;  1UAP A;  1I50 B;  5C4Z A;  5DNF A;  2EY6 A;  3N6R A;  3A8I E;  4ZUJ A;  3H94 A;  1BCP D;  5JVH 3;  1LAC A;  1EIG A;  2A74 C;  1HCZ A;  1KDC A;  2K28 A;  1EY6 A;  2TSS A;  1CZW A;  2JA7 B;  4BBS B;  2QCP X;  3MXU A;  4CKB A;  3A8J E;  3PUZ A;  3NK9 A;  2BE5 D;  1WD1 A;  1ZYR D;  3JAM E;  4C3H B;  2AUJ D;  4HCS A;  1SNQ A;  2E74 C;  4EQO A;  1PRT B;  1CM9 A;  5IT9 E;  3D6C A;  3OMG A;  1CTM A;  3DM1 A;  1R9T B;  3TP8 A;  2EE1 A;  5E4X A;  5D3D A;  4TKO B;  1LT5 D;  2OF1 A;  1GUS A;  2KUM A;  4CGY B;  2EZV A;  3LNN A;  4QIW B;  2KED A;  2F0W A;  4G7O C;  4XIG S;  4G7Z C;  1STH A;  4L6T B;  1HA5 A;  4BY7 B;  1STA A;  4Q0F A;  2K6A A;  2O5I C;  1A3V A;  2BA0 A;  3FRP B;  2B8F A;  3VYR A;  4DGZ A;  2NN6 I;  3M4O B;  1W6J A;  3AU7 A;  3QJY A;  3HGB A;  4CJ1 B;  5KYL A;  5I9P A;  1TT2 A;  1TS3 A;  1TU2 B;  2RVL A;  1D1I A;  2KHS A;  2XIW A;  3URY A;  2EJF C;  4XYO A;  2BE5 C;  3I8Z A;  5I6W A;  3VR5 A;  2NBF A;  1F2M A;  1BCP B;  1S5E D;  3H0G B;  4FXG C;  4O42 A;  1D6E C;  4XQJ A;  3C1F A;  4ZRZ A;  1V43 A;  1PRT F;  4KV6 A;  3VYU A;  1IW7 C;  1G8Z D;  3L3O C;  4CHT B;  1T5X D;  4O1N A;  3Q24 A;  3R8B A;  1L0Y B;  1E2Z A;  2K33 A;  4A3K B;  4RAU C;  2ICI A;  2EYM A;  2HCI A;  1QG7 A;  5A2Q E;  1SNO A;  1EFI D;  4JBW A;  4IFD H;  1QB5 D;  1EY8 A;  4K5V A;  1LTS D;  4QF4 A;  1PTO H;  4PV1 C;  2Q8I B;  2RQX A;  5M5W B;  1R4Q B;  1F9Q A;  3GTJ B;  4DNT B;  4HSP A;  1TWC B;  4KD4 A;  2K5Q A;  1I4H A;  4DK0 A;  3RMH A;  2KA7 A;  3N52 A;  1GJX A;  3TDQ A;  3CHB D;  4U67 3;  1C48 A;  3FEW X;  2JSO A;  5TSS A;  5CMD A;  1D5M C;  2JEB I;  1G6Z A;  1EZ8 A;  4C3I B;  4ZUI A;  3SHL A;  5KNC A;  4RFB A;  1JOO A;  4XQN A;  3TP5 A;  1GXD C;  1H9M A;  4FXD A;  3VYT A;  1Y69 U;  4HR7 B;  2F4I A;  4BBR B;  1WTV A;  5DEH A;  3J7Y W;  1CT1 D;  4PQX A;  3BS1 A;  5G3L F;  4CBV A;  4NKL A;  3FPP A;  3R93 A;  4HMJ A;  4NDX A;  3BVM A;  4ZAI A;  2C9O A;  2B8G A;  5C0X I;  3M3Y B;  1IKM A;  1SDF A;  4K2L A;  3G6J B;  1IYV A;  2F0U A;  1TS4 A;  2BCO A;  3I72 A;  1EEI D;  1SMY C;  4OGQ C;  2NVX B;  3I90 A;  1U9R A;  4K6L A;  1EYD A;  1PRT C;  3VR4 A;  3V96 A;  5K36 G;  1Y8P B;  2AQ3 B;  4KI0 A;  3C1E A;  3Q6S A;  1EY9 A;  3NPP A;  3NBH A;  2LKV A;  2X6L A;  3S1M B;  5FK9 C;  3Q0A A;  1SND A;  1CK1 A;  3MWY W;  4G4K A;  3V2T A;  1XYI A;  2ZT9 C;  4A3I B;  4FXK C;  2FMM A;  1XX8 A;  3GTQ B;  1D5Z C;  5FO7 B;  3EA6 A;  3DEO A;  1CZG A;  3OMC A;  4IFD J;  3HOX B;  2A6E D;  5FLX E;  3OIQ A;  2RDG A;  3EQL C;  4KKT A;  1M8A A;  1I3Q B;  1ZXT A;  4I7Z C;  4Y7N B;  3IL8 A;  2F0M A;  1ML0 D;  2G9D A;  1HA6 A;  2F3W A;  1O80 A;  1ENC A;  1PMR A;  3W3A A;  3CKI B;  5CV4 A;  3S2D B;  2AWO A;  3NTH A;  5FLX L;  5COR A;  3MXG A;  4FNF A;  5KNB A;  2PZW A;  2BOS A;  1OO9 B;  4N9P A;  1VF7 A;  3S1R B;  4HMI A;  2R93 B;  2N55 A;  1Q1E A;  1BCP C;  1F9R A;  1U4P A;  4ILW A;  1WTW A;  2F0P A;  2XN9 C;  2AWN A;  1EWC A;  4K14 A;  3K0Y A;  4OO1 I;  2LY7 A;  4A3M B;  3GTM B;  2PZT A;  1S5B D;  3J81 L;  4KK7 A;  2NN6 H;  1ILQ A;  2JEA I;  1HRJ A;  1UNS A;  3BDL A;  2QKI C;  3NSW A;  1QOH A;  4H0L C;  5JVG 3;  1YNJ C;  2WB1 B;  3J7A V;  3KLS A;  4A93 B;  2B2T C;  3MVV A;  1IW7 D;  1KNE A;  3ERO A;  3L9A X;  1AZQ A;  4KTA A;  2H1E A;  3K5N A;  2M00 A;  4H13 C;  4H44 C;  1E2V A;  1QNK A;  4HSV A;  3D6W A;  5D3I B;  2R7Z B;  3CU7 A;  2EXZ A;  4OL7 A;  2SOB A;  5IGC A;  4XDX A;  4Q5V A;  5LL6 X;  1V1P A;  2KEE A;  2RKS A;  3QOL A;  2A68 D;  3ND9 A;  2F0E A;  1ICW A;  2SNM A;  3TZU A;  1NCV A;  1RHP A;  3T53 B;  2E2H B;  2OEO A;  1UEA B;  4KJO A;  5JJZ A;  1A15 A;  3L7Z C;  1SEB D;  1K8M A;  3I3C A;  1GUG A;  2HUG A;  4EQN A;  2VB3 X;  2K7V A;  1SFO B;  4LMQ D;  1A3U A;  2F1M A;  1AP0 A;  2XNA C;  3OOC A;  4EQP A;  2F0K A;  1E0B A;  2EY1 A;  2V4D A;  2B63 B;  2LMC B;  1Y1V B;  3HOY B;  3M4Y A;  1QNU A;  3WDN A;  2DNC A;  1LTA D;  1H9S B;  1HFG A;  1WTQ A;  3T56 B;  1K83 B;  3VA7 A;  2WII B;  1Q90 A;  3PUX A;  4RGN A;  3S1Q B;  3DUZ A;  4U68 A;  2B2V A;  3NP8 A;  3MXP A;  4DA2 A;  2HCC A;  1DXM A;  1PLF A;  1C4Q A;  1YNN D;  2NUC A;  2WKC A;  1BXT A;  1SYG A;  2PO4 A;  4DU9 A;  2B2T A;  1G2S A;  4IZ8 A;  4B9W A;  2E2D C;  4Z9C B;  1H9K A;  3SEB A;  4YIJ A;  5C4H A;  2RDF A;  4HCE A;  2C5C A;  3DWA A;  1YNN C;  1Q1B A;  1B4O A;  4J1M A;  4S3S A;  1GUO A;  3R3O A;  3NQT A;  2LFN A;  2ICE C;  1RKN A;  1RJT A;  5J39 A;  2JA8 B;  1HUM A;  5EBD A;  2ZXR A;  4A3D B;  4FVM A;  1CHP D;  1KAB A;  2ID0 A;  2VUM B;  3VR3 A;  2F0F A;  5T1I A;  1S5F D;  1HTP A;  4DAP A;  4L63 B;  2GA4 B;  1Z6H A;  2D5D A;  4X3U A;  5C0X H;  2L4N A;  4DNR B;  3AMU A;  4FF2 A;  3QWN A;  2A69 D;  4IUT A;  2L12 A;  1LV9 A;  1RF2 D;  4F87 A;  1SBB B;  1PYW D;  4E6I A;  1FNV A;  4XQQ A;  3S15 B;  2NTS A;  5KRU A;  1OXX K;  5CV6 A;  4KN4 C;  2KCC A;  4BA1 I;  5JPN C;  1CI3 M;  4K6D A;  5C5L A;  4IFD I;  4XT3 B;  4FF3 A;  2WP8 J;  1WTO A;  1HUN A;  3SE0 A;  1OXS C;  3BYY B;  4MHE A;  3D3R A;  4WFN 3;  2IL8 A;  1TY2 A;  1Y8N B;  4C56 C;  4JK1 C;  3BZD B;  5KEE A;  3FPU B;  1SE4 A;  1EL0 A;  2HDM A;  5IOC A;  4RKB A;  3KF8 A;  2KJX A;  4TQU S;  1JWM D;  1LT3 D;  3QG1 A;  4R9W A;  3NTI A;  4DAY A;  1WTR A;  3WOF A;  1V1O A;  4FF1 A;  4QCL A;  1L0X B;  3OIP A;  5CV7 A;  2QEJ C;  2JA5 B;  4ZQ3 A;  3A56 A;  2EYP A;  2BDO A;  1TWG B;  3EVQ A;  4KJN A;  1BR9 A;  3SR1 A;  3K7A B;  1Q12 A;  3K5O A;  4RH6 A;  1JE4 A;  2Z1C A;  2FHT A;  5DAU A;  2JYO A;  1TVX A;  3PMF A;  1G29 1;  4RGM A;  5C6A A;  5LL6 S;  3MAQ A;  3P7J A;  2FMC A;  3NUC A;  4PMC A;  3HG9 A;  1PZK D;  2FJ2 A;  4KKS A;  4GZY C;  3DXJ C;  2VNU D;  2EYL A;  4ZKC B;  2IJ0 A;  1Y1W B;  3HOV B;  3BDC A;  4F8M A;  3ITP A;  4L8J A;  2J7Z A;  4V19 0;  1JB3 A;  3V05 A;  4CJ0 B;  4RCN A;  4IUP A;  2F0I A;  1B50 A;  3DWP A;  2RSO A;  1QWY A;  3W2D A;  4R8N A;  3E6Z X;  1TII D;  2XVS A;  2K5D A;  4NP5 A;  2OT2 A;  3CQZ B;  1EEF D;  1KDB A;  3TP6 A;  2XRS D;  2AQ2 B;  3RZD B;  2D62 A;  1TWA B;  1KTK A;  3NHH A;  4KY6 A;  5E1F A;  1M4V A;  2RDH A;  5EGT A;  4P2C B;  1LT6 D;  2CQA A;  1STY A;  4LJZ C;  2Y0S B;  1PFB A;  1BCP F;  3T4A C;  1T5E A;  2M9V A;  3IFT A;  1SE3 A;  1FD7 D;  3C2P A;  1BOS A;  1SMY D;  5JEA H;  4RWS C;  2K03 A;  4WRD A;  1IYU A;  1FYC A;  1XXG A;  2XWJ B;  1TS5 A;  2IWH A;  1TKW B;  5EQ0 A;  3P1H A;  4G7H C;  2RSN A;  1TS2 A;  2F0H A;  2EPB A;  4DAV A;  3OSO A;  2X69 A;  4CJ2 C;  3BVZ A;  4H7B A;  1SYD A;  2IX3 A;  1IL8 A;  5D14 A;  2I46 A;  5EKL A;  2PPB C;  4IAL A;  2PMZ B;  2PW7 A;  2B2W A;  5KIX A;  4C1N I;  1FR3 A;  5FO9 B;  4M8A A;  3MTS A;  5FO8 B;  3X3N A;  3ND8 A;  1CQV A;  3TZD A;  1ZEQ X;  2PCF B;  1E2W A;  5ELE A;  3FVQ A;  4UDU C;  3TME A;  3VR6 A;  3A54 A;  2WAC A;  3I4M B;  2NB0 A;  4I65 A;  3EFX D;  3VR2 A;  1Z7T A;  1KNA A;  1EY5 A;  2EJM A;  5IGE A;  3UI2 A;  2A6H C;  3PIP 3;  1LLR D;  3M7N A;  4X3S A;  1FNU A;  2DNE A;  1QE6 A;  1U4M A;  3H91 A;  1RD9 D;  3MFG A;  1DCZ A;  2L1B A;  2MUY A;  1BNZ A;  5ELB A;  5FOB B;  3NTK A;  5F2D A;  2YU9 B;  2B2Y C;  4QB4 A;  2K32 A;  3AB9 A;  2Z8L A;  1AEX A;  2KOL A;  2MPM A;  3D4R A;  2QF7 A;  1EQT A;  1NUC A;  2NWG A;  3HP3 A;  3GV6 A;  2XSC A;  5G3L D;  1CFM A;  4AYB B;  4A3E B;  1JIC A;  1MD2 D;  4N9T A;  1ESR A;  3IAY A;  3PO3 B;  3P75 A;  1A2T A;  1X32 A;  1SSO A;  3J80 L;  4IUV A;  3SK5 A;  3OWE B;  1DM0 B;  1F9P A;  4RHR A;  4ME5 A;  1HQM C;  3LX0 A;  1B9M A;  3KLR A;  1SAP A;  1SNM A;  2F0J A;  2MGS A;  3K58 A;  1F2Z A;  4ODG A;  2PYK A;  2WAQ B;  3OHX C;  3I91 A;  1CHQ D;  5C0X G;  5JPM C;  2IX0 A;  2R3Z A;  3NE5 B;  4PMB A;  2SNS A;  5C0X J;  1TWH B;  4ABN A;  1WCM B;  2K04 A;  3HEJ A;  2KQ3 A;  2E76 C;  2O2L D;  3O13 A;  4KY7 A;  3F2U A;  2EYO A;  2X6G A;  3TBI B;  4LK1 C;  3E5S A;  2R61 A;  5IT9 L;  1WD0 A;  3LWU A;  2WIN B;  1SNC A;  1JWU D;  2EDG A;  1HTL D;  5ISR A;  2O4X A;  3EJI A;  4ZKB B;  4ZYS A;  2F0D A;  5KYI A;  1PRT D;  3TP7 A;  5BN4 A;  3NWS A;  4FF4 A;  1G91 A;  1S5C D;  5EPK A;  1B44 D;  3CRK C;  4BWG B;  3S1N B;  1MI2 A;  3D31 A;  1O78 A;  2B2V C;  2VXW A;  2HQE A;  2CVR A;  3T51 B;  2YYZ A;  1I4Q A;  1IKL A;  5A35 A;  2B2U C;  5E4W C;  5KGU A;  2DN8 A;  3GTG B;  2IX1 A;  3NBI A;  4IN3 A;  1A6X A;  1I4R A;  5FKA C;  3E0J A;  2F03 A;  5LHY 1;  4ULL A;  4DXF A;  1F2L A;  1VCI A;  4K5W A;  2L9H A;  2WV6 D;  1Q3L A;  4A3J B;  2IT1 A;  1JOQ A;  1GHK A;  1ENA A;  3DMU A;  3ONA B;  4KMU C;  1BQQ T;  2LS0 1;  3HKZ B;  1HQR D;  3SDZ A;  1AFP A;  2NVY B;  1I6H B;  1MSH A;  4XT1 B;  2A69 C;  5A2Q L;  5EKI A;  3X3M A;  3K6O A;  2ZXO A;  1NSN S;  3A7L A;  3Q22 A;  2ENB A;  1H9R A;  3PUY A;  1F2Y A;  1JOK A;  4DN4 M;  4UAI A;  3DHQ A;  1PXU A;  2K01 A;  3S16 B;  3I73 A;  1S5D D;  1EY7 A;  2HDL A;  4B9X A;  5ELD A;  3GTK B;  1HHV A;  1LT4 D;  4A3F B;  4K5X A;  1ZYR C;  2NVQ B;  2D9U A;  5T1G A;  3H6M A;  3MXN A;  1F77 A;  4CKE A;  1B9N A;  4XTC S;  4C3I G;  3P20 A;  4HN7 A;  3S14 B;  4KY5 A;  4FO2 A;  5ELF A;  3BG3 A;  1Q8I A;  1PZI D;  4QMG A;  4RGO S;  5JAV A;  1I4G A;  3PUW A;  1GOZ A;  2R92 B;  1EYA A;  1II3 A;  5CYU A;  3KUP A;  4BA2 I;  3ZYY X;  1V1P B;  2FIN B;  3RLF A;  1KLG D;  2F0S A;  2L11 A;  1B53 A;  1CQF A;  3I70 A;  3MFY A;  4IUN A;  3TN2 A;  3D4W A;  5C3X A;  3Q23 A;  5I2Y A;  2L0C A;  3T16 A;  1U4R A;  4X3T A;  3NQI A;  2BA1 A;  1I6V C;  4ZLT F;  3NXW A;  3J81 E;  1O7Y A;  1LTB D;  1BDO A;  4OO1 H;  1FGB D;  2Q8R E;  2PQE A;  2IW3 A;  4HAE A;  2F0Q A;  1EU4 A;  5C3E B;  2NVT B;  5C5M A;  1LAB A;  2R6G A;  1QJO A;  4IUU A;  2A5H A;  3K5M A;  2L5T A;  5K36 H;  1STG A;  1J8I A;  1VMC A;  3J7A F;  5M3F B;  1YNJ D;  2QIL A;  5M5X B;  1VDZ A;  2O5J C;  4C2M B;  1S4Z A;  4KN7 C;  1HPC A;  1V8Q A;  5M5Y B;  4NMZ A;  3DWQ A;  3SK4 A;  2AUK A;  2QDB A;  1G2T A;  4OHJ A;  2DY8 A;  4NW2 A;  5CV5 A;  1SJE D;  2F0V A;  4IFD G;  3WOE A;  2JE6 I;  4R8I A;  3DEP A;  2G9H D;  2E2I B;  1NR2 A;  3FDT A;  3KK7 A;  3A55 A;  1GUW A;  4A3G B;  2BDN A;  1PFM A;  1LO5 D;  4DF7 A;  2E2J B;  1RCV D;  3C3L A;  1QIL A;  2KVM A;  2SEB D;  1GUT A;  1OXU A;  3PO2 B;  2A6H D;  1B3A A;  3BDO A;  5EKK A;  3IFD A;  3G7L A;  1LTT D;  1FNW A;  2EJG C;  3MEH A;  1JR0 D;  4HED A;  2XWB B;  3S2H B;  4B08 A;  4M1U B;  2AQ1 B;  3BYT B;  2JP1 A;  2Z4I A;  3GTO B;  3MA2 B;  1ENF A;  2EOT A;  2XRQ D;  3U9O A;  2CW0 C;  1SJH D;  2NN6 G;  1O7Z A;  2EYH A;  4C1N K;  1A2U A;  4J6H A;  2A68 C;  5CV8 A;  1EWH A;  1JCK B;  1HFN A;  5M3M B;  2EVB A;  2CW0 D;  5CBA E;  2K05 A;  4PNY A;  2K1B A;  4BS9 A;  1TY0 A;  2PNR C;  4C3J G;  3HOW B;  2E75 C;  1AW7 A;  4TRD A;  5I2X A;  4K2K A;  3HZX A;  2KCN A;  4QUC A;  3S9W A;  3HRZ C;  1DOL A;  4V0B A;  1W6K A;  3KBG A;  3NWT A;  3RD4 A;  3M85 A;  5J22 A;  1MBY A;  2A6E C;  3RUZ A;  2NZ1 D;  3M7G A;  1XWE A;  5C4J B;  4J8Q A;  2EYJ A;  4OIK A;  3VA5 A;  4F88 A;  3T13 A;  4ZK9 B;  1OXT A;  2J4X A;  1KAA A;  1X3Q A;  2EYF A;  1J9O A;  3A7A B;  4RKL A;  1X3P A;  2L55 A;  4XYQ A;  1ROD A;  3SVM A;  2JXM B;  2Z4H A;  4FP5 D;  4DXG A;  2F0G A;  2Q8T A;  2FFK B;  1OXV A;  1WTP A;  1WTX A;  2F0L A;  5EPL A;  4OIJ A;  3CRL C;  5CBE E;  5BN3 A;  1DOM A;  3MZ5 A;  1TQO A;  1SYF A;  5IGD A;  1PTO C;  5M9O A;  4RHS A;  1DZ1 A;  3R2I A;  3SK8 A;  3I4N B;  2OXP A;  1STB A;  3GV3 A;  1A3T A;  1PZJ D;  3D8G A;  1LTG D;  3K57 A;  3VYS A;  1LTR D;  5D65 A;  3HOU B;  2TMP A;  1KLU D;  1ESF A;  3FKI B;  4K8I A;  4KD3 A;  3HS0 C;  5C4X B;  3PIO 3;  1AN8 A;  2I07 B;  1EY4 A;  4RGT A;  2N88 A;  1TR5 A;  3OPO A;  1SYE A;  1BO0 A;  1EOT A;  4IQZ A;  1I4P A;  3GD7 A;  1PTO B;  4K8J A;  1DON A;  1K8O A;  3H3V C;  2B39 A;  4KHV A;  1B1Z A;  1EYC A;  1GUN A;  1JWS D;  4C3J B;  1F9S A;  3HOZ B;  5JOB A;  1EIH A;  2B2W C;  1RDP D;  3K5L A;  1BF4 A;  2WKD A;  1NR4 A;  1ET6 A;  1JQY D;  4ID6 A;  4F7X A;  3R2T A;  1C8C A;  3SK6 A;  5IOD A;  3KLS X;  2EY5 A;  4IUQ A;  4BY1 B;  4A3B B;  2RA4 A;  4DK1 A;  5I4D A;  2J0T D;  2F0O A;  3KBX A;  5CR3 A;  3GTL B;  5CC4 A;  4DFA A;  5HUR A;  4WJW A;  5I9O A;  2F0N A;  5HGT A;  5J1Z A;  1PTO F;  1ILP A;  4RCO A;  3I4L A;  3H09 A;  1PDQ A;  5EJW A;  1O7L A;  3GQB A;  5K5P A;  1B2T A;  2ZXP A;  2M2L A;  2JA6 B;  2PW5 A;  2DY7 A;  1TWF B;  4MN3 A;  3MC0 B;  1MGS A;  2D2C C;  1STN A;  5JEA G;  1WVL A;  1XTC D;  3U9S A;  4HTH A;  5BN5 A;  3BVG A;  2B2U A;  2K5W A;  1ET9 A;  4G57 A;  4FYD A;  2IPK D;  1DD2 A;  3PUV A;  5IGF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...