2VYIA

Crystal structure of the tpr domain of human sgt
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
131
structure length
128
Chain Sequence
GPLEDSAEAERLKTEGNEQMKVENFEAAVHFYGKAIELNPANAVYFCNRAAAYSKLGNYAGAVQDCERAICIDPAYSKAYGRMGLALSSLNKHVEAVAYYKKALELDPDNETYKSNLKIAELKLREAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SGTA PROTEIN
publication title Structural and Functional Characterization of Human Sgt and its Interaction with Vpu of the Human Immunodeficiency Virus Type 1.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 54
structure length 128
sequence length 131
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00515 TPR_1 Tetratricopeptide repeat
A PF13181 TPR_8 Tetratricopeptide repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.25.40.10 Mainly Alpha Alpha Horseshoe Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat 2vyiA00
5BW8C 4N5CA 3ZFWA 4YVOA 4H7YA 4JA7A 4U07A 3TGOA 3QWWA 3MEKA 2XEVA 2IF4A 2UWJG 4NRHB 4BT8A 3CVNA 4N39A 5KJNA 3LYAA 2ONDA 4HOTA 5D0OD 4GPKA 2YQ8A 3CKBA 3N71A 3ZHEA 5A7DB 2KC7A 3KS2A 1E96B 3QWVA 4GZ6A 3E4BA 3CK9A 3NF1A 4I1AA 3URZA 1FCHA 2AVPA 3GW4A 3ESKA 1HH8A 3TG4A 4I9EA 5CCMA 4UI9K 4CGWA 2KATA 2VGXA 5G05J 3RKVA 2L6JA 1ELWA 2XCCA 3Q4AB 3RO3A 5KJKA 3CKCA 1WM5A 4CGVA 4G23A 2OOEA 4I17A 5JJ6A 4KBQA 2XGMA 3UPVA 1P5QA 1ZBPA 4Y6CA 4W9RA 4XIFA 5FZRA 4NQ0A 2GW1A 1QZ2A 3CEQA 3OXGA 5BNWA 4ME2A 3QKYA 2QFCA 3KAEA 3SF4A 4WNEA 2MHKA 2VGXB 4UQZA 3QDNA 2KCVA 2NC9A 3AS8A 3RU0A 4WNDA 2WPVA 4BTBA 3ZGQA 2XGSA 5KJMA 4UI9J 1W3BA 4WNFA 2HO1A 4UI9C 3LY9A 3K9IA 5AYWD 4ABNA 3PE3A 1KT0A 3ASFA 2BUGA 2LSUA 3FFLA 2V5FA 2E2EA 4J8DA 3FWVA 4GYWA 2PQNA 5BT1A 3TG5A 3CVPA 4U04A 2VQ2A 3GZ1A 3BEEA 4KXKB 2XPIA 1HZ4A 4GCOA 3PDNA 2VSNA 4APOA 3S7DA 2PZIA 3Q47B 3S7FA 3S7JA 2FO7A 5DBKA 4B94A 4LEUA 4G26A 2KCKA 4I9CA 5FZQA 2J9QA 4A1SA 4YNDA 3ASHA 3QWPA 4GA0A 3CV0A 3CK8A 2JLBA 5EX0A 3JYSA 3LY7A 4N3CA 4BWRA 2Y4UA 4XI9A 1QQEA 3OXFA 2XCBA 1WAO1 4G24A 1ELRA 1IHGA 4CDRA 4I2ZA 1Y8MA 4XI0A 1NA3A 4AY5A 2UY1A 4WNGA 3R9AB 2FI7A 2FEZA 3QOUA 4J0UA 4J8FA 3WXXA 3UUXA 3CVLA 2PL2A 2YHCA 3MA5A 5CHEE 1KLXA 3UQ3A 3MKRA 4HORA 2C0LA 1ZU2A 3OXLA 2FBNA 5G04C 3O48A 5HI7A 3LPZA 2UY1B 5DIZA 5C1DA 4GA2A 4AIFA 3Q49B 4N3BA 3S7BA 1NZNA 4AY6A 5D0QD 1HXIA 3AS5A 4G2VA 1NA0A 4O6FA 3RIBA 4HOQA 2PQRA 2C0MA 4F3VA 4GYOA 3U3WA 3ASGA 4YVQC 1YA0A 3RO2A 2LSVA 4I2WA 2DBAA 2R5SA 4GZ3A 3EDTB 1TJCA 4H7XA 5JJTA 2VSYA 2VYIA 4EQFA 2WQHA 2FF4A 4HOSA 3ZPJA 4UQYA 5KJLA 4N3AA 2KCLA 4J8EA 1IYGA 3KD7A 5ARFA 4Y6WA 4UQXA 3TAXA 2LNIA 2VGYA 4N2SA 3LKUA 4G1TA 3PE4A 4N2QA 5CCLA 1KT1A 4BT9A 2P58C 3GYZA 3ZN3A 5EKQD 3IEGA 3HYMB 3FP3A 4WUYA 3CK7A 1A17A 4BTAA 3VTXA 2Q7FA 5LCWJ 5LCWC 4GZ5A 3LCAA 3MV3B 4G25A 3ZHEB 1B89A 4HOUA 5G05C 4RG9A 3VTYA 5HQ8A 2HYZA 3MV2B 4GYYA 5EX3A 4U0UA 5FT9A 4JA9A 5FJYA 5G04J 3GZ2A 1XNFA 4GA1A 3U4TA 3Q15A 3SZ7A 5A6CA 3ASDA 2IFUA 4JL0A 4AM9A 3RJVA 3CVQA 4RG6A 5JJ7A 4GCNA 5M72A 4U0ZA 2HR2A 4JHRA 2Y4TA 5FTPA 2C2LA 2I6HA 5ARGA 3ULQA 3AS4A 5FZSA 1PC2A 3Q5MA 4U0SA 1OUVA 3LY8A 4IN3B 4KYOB 2XGOA
chains in the Genus database with same CATH superfamily
2WB2A 3RRNB 3ZU7B 1Z3XA 4K03A 4G8LA 4JA7A 5EYLA 4I6GA 1MYOA 3QWWA 3V2OA 1YMPA 1OCZE 4DJAA 3BU8A 2XEVA 1E90A 3KEAA 1HG2A 1OWMA 4N39A 5FIOA 2WXLA 3BG1B 1HE8A 2ONDA 4FC8A 5D0OD 3CVWA 1HO8A 5ANLA 4GZCA 4F1SA 2DZNA 5ENPD 3KS2A 1LTXA 3L54A 4B0ZA 5AQBA 1E7VA 4AV7A 1NFIE 3QWVA 3ML8A 4GZ6A 4TUUA 3E4BA 3KSLA 4ANVA 4MRUA 2WQ7A 3FTZA 3CHSA 1UW4B 5CCMA 3D9NA 2KATA 3X2QE 5G05J 2IU1A 3NOCD 3RKVA 2XCCA 3AG1E 3FH5A 3RO3A 2J8SD 3CKCA 3SNXA 3C5RA 5AARA 5EN5D 1LD8A 5KNHD 2DCPA 1N4QA 4K0RA 4L2YA 1P5QA 1WY6A 2KXPC 2ZIRA 3D9JA 5EILA 3HXCA 4XEIG 4XIFA 2GW1A 1QZ2A 2HM8A 1GW6A 3CEQA 3FUHA 3OXGA 1DC2A 3IHVA 3NQPA 3KAEA 4LERA 3SFXA 3SF4A 4WNEA 3TWUA 1SZAA 3IHYA 2IQCA 2XGSA 3DXMG 4FULA 3Q7AA 4WWNA 1Z6TA 1FT2A 3ABLE 1MJ0A 4C9BB 1H19A 3JCKC 1EYHA 5EDSA 4QQIA 3FFLA 3V79K 1HG5A 3TWVA 2PQNA 5FQ6A 3LEWA 3CQGB 4L7TA 1TNZA 1OCRE 2VQ2A 3L22A 3Q75A 4KXKB 2KZTA 3FUKA 5G55A 5ENQD 2EIJE 2WXFA 4DUIA 3B7RL 3LVQE 5T8IA 4CZ2D 4GCOA 3ONLA 3CHPA 3V2XA 4K5AB 2XPYA 4ANUA 4TV3A 4F53A 1IQRA 2RKKA 3S7FA 3ZYMA 2LXLA 2AXZA 4LEUA 1UJKA 2BF0X 3ZVVA 2KCKA 4I9CA 2IO2C 1INZA 2OEWA 4YNDA 3U66A 3I4GA 4J8YA 3VLFA 3PUJA 3PH0C 3QWPA 4HXIA 1D8DA 3CSTA 1H6PA 1V55E 1K1AA 3JYSA 3LY7A 4N3CA 4JVSA 2Y4UA 4XI9A 4OAVB 3W9GA 3FUJA 2KM4A 5CMWA 1OWNA 1IHGA 2V4HC 3DPYA 4EZLA 1X5BA 3FTVA 3FHEA 4J0UA 4AXHA 4DI4A 2PL2A 2YHCA 5ENNA 1YYHA 3TWWA 3TWRA 4APFA 2NYJA 4ATZD 4PS3A 2CFUA 3NZUA 3LDZA 4AVXA 5CMYA 2AWIA 3ZEFA 2XS1A 5A23A 3MX3A 3CVXA 2WXPA 3T8MA 3U9WA 3IBEA 3RK6A 5G04C 3O48A 5HI7A 2UY1B 2JABA 4GA2A 3FTYA 4AIFA 3S7BA 2J09A 1NA0A 4O6FA 3EU9A 3RIBA 4ILHB 4DX7D 2C0MA 1L5JA 2MYOA 5BXUA 3U3WA 4YVQC 3RSEG 1HFAA 2LSVA 2DBAA 1TEZA 3PZ4A 3IXEA 5JJTA 4GZDA 3TXNA 2GRPB 3DSWA 3LJ3A 3TXMA 3D9PA 2HE0A 3S2AA 3KD7A 1U3CA 2QY7A 3P2BA 2X6KA 2FO1E 3SI5A 1TNOA 2L0TB 3SO8A 3JUIA 4N2SA 4A63B 3LKUA 4G1TA 1E8XA 4N2QA 4CDMA 3CHRA 3SGHA 2CG3A 3AG3E 5EKQD 3FUMA 3C98A 4MKTA 3VTXA 4HFGA 3ZYLA 5LCWJ 5LP0A 3LCAA 3L6AA 4R7LA 4L23A 4DX1A 2I2OA 1O5MA 4GYYA 4TUMA 3FUNA 4ILIA 3CSFA 1E8YA 1DCQA 4JA9A 5FJYA 5G04J 3GZ2A 2LO6A 4HVBA 4FJZA 1H2VC 3U4TA 3SZ7A 3ASDA 1BD8A 1Q2ZA 4RG6A 4U0ZA 4DK5A 3HXDA 1VDYA 4A3VA 1U2VG 2XEHA 2C2LA 2MOWA 3W9FA 2I1KA 1N52A 2X3MA 1UN9A 3FTXA 4U0SA 2BEDA 2JEKA 3DRAA 4YDWA 3UIOC 4CYMD 3MCXA 4KYOB 2XGOA 4JB8P 5BW8C 4H7YA 1OY3D 2XZDG 3TGOA 4LCTA 1E8ZA 4GAAA 3IV0A 4DPRA 4BT8A 5CRUA 4BERA 4WAFA 2GROB 4J6IA 2WXMA 3I5PA 1SW6A 3ZHEA 2IO3C 3RRUA 1E96B 4ACLA 1MHQA 3Q79A 3BG0B 3CK9A 4G11A 1PY1A 1N4PA 3GW4A 3ESKA 2ZGGA 2H6GA 1AP7A 4WWPA 1MX4A 4DX6D 4FP7A 3RRMB 4B93B 2E0IA 1OXJA 4I43A 2AJAA 4AOFA 3R7QA 2R2LA 4I17A 4K5BA 2XGMA 3UPVA 1ZBPA 3G2SA 1O1TA 4P29A 2V5QC 1RZ4A 3JXIA 3C3QA 2MRIA 5BNWA 2QFCA 4GB9A 2VGXB 5IY5E 3QDNA 4WNDA 4AP2A 2I9CA 4JW1A 1AWCB 5KJMA 4UI9J 2HO1A 4OVUA 2XRZA 4I6JA 1H0AA 2WXKA 3K9IA 5AYWD 2WXNA 3ASFA 1EDUA 3AG2E 4D10C 3E30A 3UIPC 1FVFA 4XZ4A 3GZ1A 3CGHA 4CT0A 3UM1A 4O1PA 4LUNU 3FU6A 4BSZB 4GTQA 3Q73A 2OVBA 1D9SA 1LF8A 5BPPA 4PS8A 2L9BA 3AG4E 2PM7A 3FUIA 4I6EA 4V3IA 3LJNA 3PDNA 4JZYA 4APOA 2PZIA 3Q47B 2WXHA 3QK0A 5DBKA 3SQVA 2J07A 5B3SE 5FZQA 4FJYA 5CEDB 4B8CB 3ASHA 3HG0D 1OWLA 1MX6A 4GA0A 3CV0A 1MQSA 2R02A 3HRAA 1TNYA 1OT8A 2DIWA 4C0EA 4KVMA 3OXFA 4G24A 4XKCA 1ELRA 3G2TA 4I2ZA 4XI0A 1NA3A 4UWHA 1DVPA 1OCOE 2UY1A 4AJWA 5ENSD 5AJLA 3HXEA 3WXXA 3CVLA 4K5CA 1K3ZD 4M7CA 4KZCA 2LUHA 1S0PA 5CHEE 3TL5A 1PAQA 1KLXA 3Q7FA 2WQ6A 3UQ3A 2QYJA 3AAAC 3D9MA 3FTSA 2C0LA 4HORA 1ZU2A 5J08A 2IJGX 4UWGA 1OWPA 5DIZA 5C1DA 4U8VD 4AY6A 1S63A 4LNGA 2QC9A 1N0QA 3CR3A 3EU5A 1DNPA 5KCMA 2P2CP 1JPLA 3AU5A 3ZXSA 4GYOA 2WMNA 3HVEB 3VLEA 1Y6IA 1YA0A 3RO2A 2P9PG 4U8HA 1N11A 3TWSA 3T5VA 3Q78A 4GZ3A 4JHKA 3EDTB 2PNNA 2XHEA 2R17C 2XEEA 3FUFA 1D8EA 3NOGD 4FHKA 4GU5A 2VSYA 3PZ1A 4EQFA 2WQHA 3PRZA 4BETA 2RFMA 4UQYA 3Q9NC 4DLOA 4J8EA 1EF1C 1IYGA 1H2UA 1SZ9A 3CHOA 4IRUA 4EHMA 2F37A 3TAXA 3T8KA 3PUKA 4TXQA 3PS6A 2VGYA 1UN8A 2P58C 3ZN3A 2DYRE 5HS0A 2F8YA 2M63A 5LOZA 4KVOA 2XQ0A 4OAUC 3UT4A 5LCWC 4HRMB 1MX2A 3C3OA 3MV3B 4RVBA 3TJPA 4HOUA 4HI8A 1E8WA 3QJZA 2J49A 5LX8A 2LAIA 3BUAA 5EX3A 1G3NB 5ENOD 2L0IA 2ZXWE 5JHBA 2J08A 4BEPA 1XNFA 2OVFA 3UTMA 5AIJA 2V4LA 1BU9A 1FT1A 3PZ3A 4AM9A 3RJVA 3CVQA 3CVUA 1Z3YA 3PNTB 3EIJA 5M72A 4BX9A 5FTPA 4LSZE 4UUCA 5G2NA 5ARGA 3ULQA 5FZSA 1PC2A 3DXKG 1SA5A 2ZISA 2AXVA 1OUVA 3LY8A 3UM0A 2R59A 4N5CA 2OCCE 4YVOA 3ZFWA 1H2TC 1DCEA 3ABKE 2P9UG 2F0YA 2ZU6B 3L16A 4B89A 4EPZA 3FU3A 3G2WA 5EIDA 3TWQA 2IF4A 3SHFA 4EECA 3CVNA 4EZKA 5KJNA 4EBAA 3SFYA 3ZYQA 4LG6A 4IYPA 4HBDA 4GTTA 4M3OA 1FPPA 3CKBA 3FEXA 4KT6B 3MKQB 5A7DB 2KC7A 1UG3A 3UM2A 1K1BA 3HXFA 1N4SA 5FWQA 2P9KG 4DRXE 4FA6A 3SBTB 4EZJA 2J4DA 4BSXA 5B1AE 4FADA 3ULEG 4JEHA 5E75A 1FCHA 2CHZA 3TG4A 4I9EA 3DSSA 4B8AA 4UI9K 4CGWA 2ZGDA 2VGXA 2X6HA 4NACA 1ELWA 5AAOA 3FU0A 5KJKA 3L13A 3FH7A 3J5PA 1XGWA 2OOEA 2Y0BG 4PDXA 3NB2A 4YDOA 3JUEA 1YCSB 2P9SG 4Y6CA 4XE0A 5FZRA 4NQ0A 4O60A 2LAHA 1TN7A 2VSXE 3QKYA 3FUEA 3T9KA 2MHKA 4UQZA 4CRWA 2KCVA 1SA4A 2KBXA 3AS8A 3P1UA 4F6RD 4GTRA 2AXUA 3ZGQA 2CFZA 3ZRHA 4LNBA 3ASNE 1W3BA 2WXOA 1X81A 3PZ2A 4JPSA 4UI9C 5CRVA 3V31A 3LY9A 3FY4A 1SVXA 5ITZF 4U63A 1MZCA 4OYSA 1KT0A 4FHJA 3UI2A 2LSUA 2A5UA 2R03A 3QARA 2E2EA 3EHRA 4J8DA 4GYWA 2X38A 5BT1A 3TG5A 4E6HA 3ZXPA 4BESA 3BEEA 2Y69E 2NXPA 3UINC 3HHMA 3AJIA 3UXGA 4F7AA 3FUDA 4MBGA 3J5QB 1IXVA 3ISMC 3DSXA 4C0MA 4A3TA 3ABME 4HS2A 3FU5A 1IHBA 4YDEA 4HRNA 3B7TA 3S7DA 4I1OB 4CCAA 2J4BA 3S7JA 2FO7A 1HS6A 4GTOA 3B95A 4IULA 4LNUD 4G26A 1HX8A 4PUCA 2J9QA 4A1SA 3ZNGA 4JEUA 3CVYA 1EPUA 4ZFHA 3DEOA 2I1JA 5EX0A 3E37A 2ETAA 4UWFA 4BWRA 1QQEA 2CHWA 2XCBA 4ILGA 3CVVA 4Q96A 5AJDA 3KSQA 3E33A 1Y8MA 2V0PA 4WNGA 3R9AB 1HF8A 2WXRA 4I1MA 3BQOA 2H6HA 2FEZA 4OVVA 3EJNA 3L17A 4GMLA 3UUXA 1N95A 2DVWA 3MA5A 1BI7B 4ATGA 1SQMA 5H7PA 1WDYA 3UKUG 3D9OA 3WG7E 1HU3A 3JXJA 4XX5A 3KEZA 2WXJA 4DX5D 3HVEA 1JUQA 3B7BA 3PREA 3OXLA 1TNUA 2FBNA 1JWFA 3LPZA 1N4RA 3PEUB 3Q49B 4N3BA 4JXTA 1NZNA 5D0QD 3AS5A 2IY0C 5AQAA 1N9AA 4O1OA 1BLXB 4XKBA 4HOQA 2GRLA 2R05A 1ZB1A 5AQ9A 5KBAA 2P9LG 2EIKE 4KMOA 1NP7A 3SFZA 3HDXA 3MYVA 4HLEA 1TJCA 4RQIA 3ENEA 4H7XA 3V30A 5JHAA 3FEYA 3ZPJA 3ZKJA 3FTWA 1RW2A 4N3AA 3R7RA 2KCLA 5B1BE 2GRRB 5FQ7A 4L2LA 3PNLB 4Y6WA 2EIME 4UQXA 2ILRA 2LNIA 3R9MA 5C2YA 1TN8A 3APFA 3MGBA 4HB5A 4HQDA 4YDYA 4WUYA 1A17A 2WXQA 3ZUVB 1KZOA 4GMJA 2Q7FA 2GRMA 2F8XK 1H6KA 1N0RA 4GZ5A 5AN8A 3DSTA 4G25A 3ZHEB 1B89A 3ESLA 2WXIA 2BKGA 3DEPA 3VTYA 3T5XA 2WMOA 3CIAA 2HYZA 1JWGA 5HQ8A 1NI1A 3I4RB 1NL4A 4KZ0A 2RFAA 4GTSA 2X6JA 2OV8A 5BV1A 5LFAA 4HNAD 2A4ZA 3Q15A 1KZPA 3MJWA 3LXUX 2VSOE 5FQ4A 5KWDA 4HRLA 4JL0A 2OEVA 4GCNA 4PH4B 1LD7A 1JCRA 1H6OA 3G2UA 2Y4TA 1IQUA 4ANXA 2B6CA 3EHNA 3FDHA 3NZSA 2Y3AA 3Q5MA 4F1PA 4UWKA 5FINA 5EIBE 4HLLA 1FVHA 4IN3B 3MKQA 4J8SA 5T4YA 3G2VA 2H6FA 2YINA 4U07A 3MEKA 3JQ0A 2UWJG 4NRHB 4JHJA 3LYAA 4Q94A 4HOTA 4GPKA 4DX2A 3ASOE 4WWOA 3EHMA 2YQ8A 4N5QA 3N71A 2VTBB 1E7UA 3SD5A 4FU3A 5CBOA 4X8QA 5E76A 2L6BA 2XENA 3UT8A 3EUVA 4ANWA 2EILE 3AU4A 1BPOA 3NAWA 3DPDA 3NF1A 4I1AA 3URZA 2AVPA 5CBNA 4A55A 3B13A 1OCCE 1HH8A 2RG8A 1Z5SC 4BX8A 5BUZA 4FLHA 1BI8B 2ETCA 3MZLB 2L6JA 3Q4AB 5HRYA 3ZYKA 1WM5A 3RAUA 4PS7A 2EQXA 4CGVA 1K8KG 2IOLA 3APDA 2GRNB 4G23A 4JC8A 5JJ6A 4KBQA 5EYPF 3SY2A 5KNGA 3UMVA 1WG0A 4W9RA 3D3MA 4ME2A 5ENTD 4MS6A 2DWZA 2NC9A 3RU0A 3C72A 2WPVA 4BTBA 2XPZA 1O1SA 3D9LA 1UJJA 4WNFA 1KPSB 3FULA 2X6FA 5AENA 4ABNA 2WM9A 1V54E 3PE3A 4A1GA 3DWLG 2IOSA 5BXOA 2BUGA 3EIQC 4GPMA 4J7WA 3UKRG 2V5FA 1TJFA 3FWVA 1IKND 4JD2G 1OWOA 2X6IA 2DYSE 3O4ZA 3ONKA 4Q69A 1TYQG 3CVPA 2XZTG 4TRQA 4U04A 2VGEA 5CECB 3I3NA 2P9NG 5FQ8A 4NIKA 2PM6A 1TNBA 2XPIA 2BKKB 1HZ4A 4DLQA 3CHQA 4DI3A 5BV0A 2VSNA 3UM3A 3F6QA 2YNQA 4B94A 4GMRA 4L9PA 2CG2A 4CT4A 3SBSA 3ZIMA 2KZTB 3QB2A 3DBSA 1U3DA 3DSVA 5J90A 2A5EA 4GTVA 3OAWA 4U95D 2NSZA 3CK8A 2JLBA 3E32A 4LRZA 2GGFA 1WAO1 4G8KA 3B7SA 4CDRA 4AY5A 4AEZC 2QYUA 3B7UX 3ULYA 5D2MC 2FI7A 3VLDA 3D9IA 3HIZA 3QOUA 4J8FA 5ENRD 5JMND 3GZSA 3LVRE 3L08A 4RSYA 3MKRA 3FH8A 3EHQA 2LXMA 1S70B 1S64A 2Y1LE 4GTMA 2ETBA 3D9KA 4HI9A 4RLYA 3UX4A 1JCQA 2WXGA 3D9HA 2QZAA 2V8SE 1HXIA 2YHEA 4G2VA 2DZOA 5CEAA 3TWTA 2PQRA 4F3VA 3ZW3A 3ASGA 2P9IG 3QAQA 4I2WA 4MLPA 2R5SA 3FTUA 5HKPA 3UT7A 1ELKA 5CERB 2XRYA 3E34A 2VYIA 3QNKA 2FF4A 4TXPA 4BFRA 3LS8A 3C3RA 4L1BA 4HOSA 1QYMA 2BTDA 2RD0A 5KJLA 4QFVA 4EBAG 2CHXA 3IKOB 5ARFA 1TN6A 2WVIA 4GTPA 1TR4A 4ACKA 3CLJA 3PE4A 4U8YD 5CCLA 1KT1A 3OTNA 4NURA 2H6IA 4BT9A 3GYZA 2FULA 3CHMA 5T3RA 3Q9UC 3IEGA 3HYMB 4C48B 3FP3A 3CK7A 3L9TA 5ANRA 4BTAA 1O1RA 1QNFA 3PZDA 4Z68A 1A5EA 3JQ1A 4CEMA 5G05C 1QBQA 4RG9A 1N94A 3MV2B 3DSUA 1UOHA 2AW6A 3PEVB 4U0UA 1N54A 4URKA 5FT9A 2IONA 3QC1A 4GA1A 2XS8A 5A6CA 2IFUA 4CDNA 4TXRA 3PVLA 1JCSA 2GRQB 2VJ8A 3CQCB 5JJ7A 4U96D 5JA4D 2HR2A 4JHRA 4ZHBA 3HXBA 5D66A 2IEJA 4U7EB 3NBNB 2I6HA 2B0OE 3TWXA 5AQ7A 3L82A 4UWLA 3AS4A 3U64A 3ML9A 3APCA 4E85A 2EINE 4BY6A 4FLBA 2VTBA
chains in the Genus database with same CATH topology
5BW8C 2R59A 2WB2A 4N5CA 3RRNB 4J8SA 4YVOA 3ZFWA 4H7YA 5T4YA 1H2TC 1Z3XA 4K03A 3G2VA 4JA7A 2YINA 4U07A 2ZU6B 3TGOA 4I6GA 4LCTA 1E8ZA 3L16A 3QWWA 4B89A 4EPZA 3FU3A 3MEKA 4DJAA 2XEVA 3G2WA 1E90A 4GAAA 2IF4A 3SHFA 4EECA 3IV0A 2UWJG 3JQ0A 4NRHB 4BT8A 4DPRA 4JHJA 1HG2A 3CVNA 4EZKA 1OWMA 4N39A 4EBAA 5KJNA 3LYAA 3ZYQA 2WXLA 3BG1B 4Q94A 1HE8A 4IYPA 2ONDA 4WAFA 4FC8A 4HOTA 5D0OD 3CVWA 4GPKA 1HO8A 4J6IA 4WWOA 2WXMA 5ANLA 3EHMA 4M3OA 4GZCA 3I5PA 2YQ8A 4F1SA 3CKBA 3FEXA 3N71A 4KT6B 3ZHEA 3MKQB 2VTBB 1E7UA 5A7DB 3SD5A 2KC7A 4FU3A 3KS2A 1E96B 3RRUA 4ACLA 1MHQA 1UG3A 3BG0B 3L54A 4B0ZA 5E76A 1E7VA 4AV7A 5FWQA 3QWVA 3UT8A 4FA6A 3SBTB 4EZJA 2J4DA 3ML8A 4GZ6A 4TUUA 3E4BA 4ANWA 3AU4A 4BSXA 1BPOA 4FADA 3DPDA 3CK9A 4G11A 3NF1A 4I1AA 4JEHA 1PY1A 5E75A 3URZA 1FCHA 2AVPA 4ANVA 3GW4A 4MRUA 4A55A 3B13A 2WQ7A 3ESKA 2CHZA 1HH8A 3TG4A 3FTZA 2RG8A 4WWPA 4I9EA 3CHSA 4BX8A 1UW4B 5CCMA 5BUZA 4FLHA 4B8AA 3D9NA 4UI9K 4CGWA 3MZLB 2KATA 4FP7A 2VGXA 2IU1A 2X6HA 5G05J 4NACA 3RKVA 2L6JA 1ELWA 2XCCA 3RRMB 3FH5A 2E0IA 3Q4AB 3RO3A 3FU0A 5KJKA 3CKCA 3ZYKA 1WM5A 3SNXA 4I43A 4AOFA 3L13A 3FH7A 4PS7A 2EQXA 1XGWA 3R7QA 4CGVA 2IOLA 3APDA 4G23A 2OOEA 4JC8A 4PDXA 4I17A 5JJ6A 4KBQA 2XGMA 3UPVA 2DCPA 4K0RA 4L2YA 1P5QA 1WY6A 3UMVA 1ZBPA 3D9JA 4Y6CA 3G2SA 4W9RA 4XE0A 4XIFA 5FZRA 4NQ0A 4P29A 2LAHA 2GW1A 1QZ2A 2HM8A 3CEQA 1GW6A 2MRIA 3FUHA 2VSXE 3D3MA 3IHVA 3OXGA 5BNWA 4ME2A 3QKYA 2QFCA 4GB9A 3FUEA 3NQPA 3KAEA 4LERA 3SF4A 4WNEA 2MHKA 1SZAA 2VGXB 3QDNA 4UQZA 4CRWA 4MS6A 2KCVA 2NC9A 3AS8A 3RU0A 3P1UA 3IHYA 4WNDA 2IQCA 2WPVA 4AP2A 2AXUA 4BTBA 3ZGQA 2CFZA 2XGSA 2XPZA 3ZRHA 2I9CA 4FULA 4JW1A 3D9LA 5KJMA 4WWNA 1UJJA 4UI9J 1W3BA 2WXOA 4WNFA 4JPSA 1Z6TA 2HO1A 4OVUA 4UI9C 2XRZA 3FULA 2X6FA 4I6JA 1H0AA 2WXKA 4C9BB 1H19A 3JCKC 5AENA 3LY9A 3K9IA 5AYWD 4ABNA 2WM9A 4A1GA 3PE3A 3FY4A 1EYHA 4U63A 2WXNA 2IOSA 4OYSA 1KT0A 3ASFA 1EDUA 4FHJA 2BUGA 5EDSA 2LSUA 3EIQC 4D10C 2A5UA 3FFLA 3QARA 2V5FA 1HG5A 2E2EA 4J8DA 1TJFA 3FWVA 4GYWA 2PQNA 2X38A 5FQ6A 3LEWA 1OWOA 3CQGB 3TG5A 5BT1A 2X6IA 4L7TA 3O4ZA 3ONKA 4Q69A 3CVPA 1FVFA 4TRQA 4E6HA 4U04A 4XZ4A 2VQ2A 3GZ1A 3L22A 3BEEA 3CGHA 4CT0A 4KXKB 2KZTA 2NXPA 3FUKA 5G55A 4LUNU 3I3NA 3HHMA 4F7AA 3FU6A 3FUDA 2WXFA 5FQ8A 3B7RL 2OVBA 2PM6A 3LVQE 2XPIA 5T8IA 1LF8A 5BPPA 1HZ4A 4GCOA 3ONLA 4PS8A 2L9BA 4C0MA 3CHPA 4DLQA 2PM7A 3FUIA 2XPYA 4HS2A 4A3TA 4I6EA 4TV3A 4ANUA 3CHQA 4DI3A 5BV0A 4V3IA 3FU5A 3PDNA 4JZYA 2VSNA 4F53A 1IQRA 4APOA 3B7TA 3S7DA 2PZIA 3Q47B 3S7FA 2WXHA 3QK0A 4I1OB 4CCAA 2J4BA 3S7JA 2YNQA 2FO7A 5DBKA 1HS6A 3ZYMA 4B94A 2AXZA 4LEUA 4IULA 1UJKA 2BF0X 3ZVVA 4G26A 2KCKA 1HX8A 2CG2A 4I9CA 4CT4A 4PUCA 3SBSA 2J07A 3ZIMA 5FZQA 2J9QA 4A1SA 2KZTB 1INZA 4YNDA 3QB2A 3U66A 4FJYA 3DBSA 3I4GA 3ASHA 3VLFA 1OWLA 1U3DA 4B8CB 3PUJA 3PH0C 3QWPA 4HXIA 5J90A 4JEUA 3OAWA 3CVYA 1EPUA 3CSTA 2NSZA 4GA0A 3CV0A 1MQSA 2I1JA 3CK8A 2JLBA 5EX0A 3JYSA 3LY7A 4LRZA 4UWFA 4N3CA 4JVSA 2GGFA 2Y4UA 2DIWA 4XI9A 4KVMA 3FUJA 4C0EA 4BWRA 1QQEA 2CHWA 2KM4A 2XCBA 1WAO1 3OXFA 5CMWA 4ILGA 4G24A 3CVVA 4Q96A 5AJDA 3B7SA 1OWNA 4XKCA 1ELRA 1IHGA 4CDRA 3G2TA 4I2ZA 1Y8MA 4XI0A 2V0PA 1NA3A 4UWHA 4AY5A 1DVPA 2UY1A 4WNGA 4AEZC 4EZLA 3R9AB 1HF8A 4AJWA 2WXRA 1X5BA 3B7UX 4I1MA 2FI7A 3VLDA 2FEZA 4OVVA 3EJNA 3FHEA 3D9IA 3FTVA 3L17A 3HIZA 3QOUA 5AJLA 4J0UA 4GMLA 4J8FA 3WXXA 3UUXA 4AXHA 3CVLA 2PL2A 4DI4A 4KZCA 1S0PA 2YHCA 5ENNA 3MA5A 4APFA 5CHEE 3TL5A 4ATGA 1PAQA 1KLXA 1SQMA 4PS3A 2CFUA 3NZUA 3LDZA 4AVXA 2WQ6A 5CMYA 3GZSA 3D9OA 2AWIA 3LVRE 3L08A 1HU3A 4RSYA 3UQ3A 3ZEFA 3MKRA 4XX5A 5A23A 3KEZA 2WXJA 3FH8A 3MX3A 3D9MA 3FTSA 2C0LA 3CVXA 3HVEA 4HORA 1JUQA 1ZU2A 3PREA 5J08A 3OXLA 2WXPA 3T8MA 3U9WA 3D9KA 2IJGX 2FBNA 3IBEA 3RK6A 5G04C 3O48A 1JWFA 5HI7A 4UWGA 3LPZA 2UY1B 1OWPA 5DIZA 5C1DA 3PEUB 3UX4A 2WXGA 3FTYA 4GA2A 4AIFA 3Q49B 4N3BA 3S7BA 4JXTA 1NZNA 4AY6A 2V8SE 5D0QD 1HXIA 2J09A 3AS5A 2YHEA 4G2VA 1NA0A 4O6FA 3CR3A 3RIBA 4XKBA 1DNPA 4HOQA 5KCMA 4ILHB 2PQRA 1JPLA 2C0MA 2GRLA 1L5JA 4F3VA 3ZW3A 3AU5A 3ZXSA 4GYOA 2WMNA 3U3WA 3ASGA 3HVEB 4YVQC 3VLEA 1Y6IA 1YA0A 3RO2A 4U8HA 1HFAA 3QAQA 2LSVA 4I2WA 4KMOA 1NP7A 2DBAA 4MLPA 1TEZA 3T5VA 3SFZA 3HDXA 2R5SA 3FTUA 3MYVA 4GZ3A 4JHKA 3UT7A 4HLEA 1ELKA 3EDTB 2XRYA 2XHEA 1TJCA 2R17C 3FUFA 3ENEA 4H7XA 5JJTA 4FHKA 4GU5A 2VSYA 2VYIA 5JHAA 4EQFA 3FEYA 2WQHA 3QNKA 4GZDA 3PRZA 2FF4A 3TXNA 4BFRA 3LJ3A 3LS8A 4L1BA 4HOSA 3ZPJA 4UQYA 2BTDA 3FTWA 2RD0A 5KJLA 4QFVA 4N3AA 3R7RA 3TXMA 2KCLA 4EBAG 2CHXA 3D9PA 4DLOA 4J8EA 1EF1C 1IYGA 3S2AA 1H2UA 3KD7A 1SZ9A 3IKOB 3CHOA 1U3CA 5FQ7A 4L2LA 5ARFA 2QY7A 3P2BA 4IRUA 3PNLB 2X6KA 4Y6WA 4UQXA 3SI5A 2WVIA 3TAXA 2ILRA 2L0TB 3PUKA 4ACKA 3PS6A 3JUIA 2LNIA 2VGYA 4N2SA 3CLJA 3LKUA 4G1TA 1E8XA 3PE4A 4N2QA 5CCLA 1KT1A 4CDMA 3OTNA 3CHRA 4NURA 2CG3A 5C2YA 1UN8A 3SGHA 3APFA 4BT9A 2P58C 3GYZA 3ZN3A 2FULA 3CHMA 3MGBA 5EKQD 5T3RA 3IEGA 3FUMA 3HYMB 3FP3A 4WUYA 3CK7A 1A17A 5ANRA 2WXQA 3C98A 4MKTA 2M63A 4BTAA 5LOZA 4KVOA 2XQ0A 3VTXA 4IN3B 3UT4A 4GMJA 4HFGA 3ZYLA 1QNFA 2Q7FA 2GRMA 3PZDA 5LCWJ 5LCWC 5LP0A 1H6KA 4GZ5A 3LCAA 3L6AA 4R7LA 3MV3B 3JQ1A 4G25A 3ZHEB 1B89A 4RVBA 3TJPA 3ESLA 4CEMA 4HOUA 5G05C 1E8WA 2WXIA 3QJZA 4RG9A 4L23A 3VTYA 3T5XA 2WMOA 3CIAA 2HYZA 1JWGA 2J49A 3MV2B 2I2OA 5HQ8A 5LX8A 4GYYA 2AW6A 2LAIA 3PEVB 5EX3A 3I4RB 4U0UA 1N54A 3FUNA 4URKA 4KZ0A 4ILIA 5FT9A 2X6JA 2OV8A 5BV1A 2IONA 3CSFA 3QC1A 5LFAA 1E8YA 2L0IA 5JHBA 2J08A 4JA9A 5FJYA 5G04J 3GZ2A 1XNFA 2LO6A 4GA1A 2A4ZA 2OVFA 4HVBA 4FJZA 1H2VC 3U4TA 5AIJA 3Q15A 3SZ7A 3MJWA 5A6CA 3LXUX 2VSOE 3ASDA 5FQ4A 2IFUA 2V4LA 4CDNA 4JL0A 4AM9A 3PVLA 3RJVA 3CVQA 3CVUA 2VJ8A 3CQCB 1Z3YA 4RG6A 4GCNA 4PH4B 3PNTB 5JJ7A 3EIJA 5M72A 4U0ZA 4DK5A 2HR2A 1VDYA 4A3VA 3G2UA 4JHRA 2Y4TA 4BX9A 5FTPA 1IQUA 2C2LA 2MOWA 4ANXA 5G2NA 2I6HA 2I1KA 5ARGA 3ULQA 1N52A 3EHNA 3FDHA 4UWLA 3AS4A 3NZSA 5FZSA 2Y3AA 1PC2A 3Q5MA 2X3MA 1UN9A 3FTXA 4U0SA 3U64A 3ML9A 3APCA 4UWKA 2JEKA 4E85A 2AXVA 1OUVA 3LY8A 4BY6A 4FLBA 1FVHA 3MCXA 4KYOB 2VTBA 3MKQA 2XGOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BW8 C;  4N5C A;  3ZFW A;  4YVO A;  4H7Y A;  4JA7 A;  4U07 A;  3TGO A;  3QWW A;  3MEK A;  2XEV A;  2IF4 A;  2UWJ G;  4NRH B;  4BT8 A;  3CVN A;  4N39 A;  5KJN A;  3LYA A;  2OND A;  4HOT A;  5D0O D;  4GPK A;  2YQ8 A;  3CKB A;  3N71 A;  3ZHE A;  5A7D B;  2KC7 A;  3KS2 A;  1E96 B;  3QWV A;  4GZ6 A;  3E4B A;  3CK9 A;  3NF1 A;  4I1A A;  3URZ A;  1FCH A;  2AVP A;  3GW4 A;  3ESK A;  1HH8 A;  3TG4 A;  4I9E A;  5CCM A;  4UI9 K;  4CGW A;  2KAT A;  2VGX A;  5G05 J;  3RKV A;  2L6J A;  1ELW A;  2XCC A;  3Q4A B;  3RO3 A;  5KJK A;  3CKC A;  1WM5 A;  4CGV A;  4G23 A;  2OOE A;  4I17 A;  5JJ6 A;  4KBQ A;  2XGM A;  3UPV A;  1P5Q A;  1ZBP A;  4Y6C A;  4W9R A;  4XIF A;  5FZR A;  4NQ0 A;  2GW1 A;  1QZ2 A;  3CEQ A;  3OXG A;  5BNW A;  4ME2 A;  3QKY A;  2QFC A;  3KAE A;  3SF4 A;  4WNE A;  2MHK A;  2VGX B;  4UQZ A;  3QDN A;  2KCV A;  2NC9 A;  3AS8 A;  3RU0 A;  4WND A;  2WPV A;  4BTB A;  3ZGQ A;  2XGS A;  5KJM A;  4UI9 J;  1W3B A;  4WNF A;  2HO1 A;  4UI9 C;  3LY9 A;  3K9I A;  5AYW D;  4ABN A;  3PE3 A;  1KT0 A;  3ASF A;  2BUG A;  2LSU A;  3FFL A;  2V5F A;  2E2E A;  4J8D A;  3FWV A;  4GYW A;  2PQN A;  5BT1 A;  3TG5 A;  3CVP A;  4U04 A;  2VQ2 A;  3GZ1 A;  3BEE A;  4KXK B;  2XPI A;  1HZ4 A;  4GCO A;  3PDN A;  2VSN A;  4APO A;  3S7D A;  2PZI A;  3Q47 B;  3S7F A;  3S7J A;  2FO7 A;  5DBK A;  4B94 A;  4LEU A;  4G26 A;  2KCK A;  4I9C A;  5FZQ A;  2J9Q A;  4A1S A;  4YND A;  3ASH A;  3QWP A;  4GA0 A;  3CV0 A;  3CK8 A;  2JLB A;  5EX0 A;  3JYS A;  3LY7 A;  4N3C A;  4BWR A;  2Y4U A;  4XI9 A;  1QQE A;  3OXF A;  2XCB A;  1WAO 1;  4G24 A;  1ELR A;  1IHG A;  4CDR A;  4I2Z A;  1Y8M A;  4XI0 A;  1NA3 A;  4AY5 A;  2UY1 A;  4WNG A;  3R9A B;  2FI7 A;  2FEZ A;  3QOU A;  4J0U A;  4J8F A;  3WXX A;  3UUX A;  3CVL A;  2PL2 A;  2YHC A;  3MA5 A;  5CHE E;  1KLX A;  3UQ3 A;  3MKR A;  4HOR A;  2C0L A;  1ZU2 A;  3OXL A;  2FBN A;  5G04 C;  3O48 A;  5HI7 A;  3LPZ A;  2UY1 B;  5DIZ A;  5C1D A;  4GA2 A;  4AIF A;  3Q49 B;  4N3B A;  3S7B A;  1NZN A;  4AY6 A;  5D0Q D;  1HXI A;  3AS5 A;  4G2V A;  1NA0 A;  4O6F A;  3RIB A;  4HOQ A;  2PQR A;  2C0M A;  4F3V A;  4GYO A;  3U3W A;  3ASG A;  4YVQ C;  1YA0 A;  3RO2 A;  2LSV A;  4I2W A;  2DBA A;  2R5S A;  4GZ3 A;  3EDT B;  1TJC A;  4H7X A;  5JJT A;  2VSY A;  2VYI A;  4EQF A;  2WQH A;  2FF4 A;  4HOS A;  3ZPJ A;  4UQY A;  5KJL A;  4N3A A;  2KCL A;  4J8E A;  1IYG A;  3KD7 A;  5ARF A;  4Y6W A;  4UQX A;  3TAX A;  2LNI A;  2VGY A;  4N2S A;  3LKU A;  4G1T A;  3PE4 A;  4N2Q A;  5CCL A;  1KT1 A;  4BT9 A;  2P58 C;  3GYZ A;  3ZN3 A;  5EKQ D;  3IEG A;  3HYM B;  3FP3 A;  4WUY A;  3CK7 A;  1A17 A;  4BTA A;  3VTX A;  2Q7F A;  5LCW J;  5LCW C;  4GZ5 A;  3LCA A;  3MV3 B;  4G25 A;  3ZHE B;  1B89 A;  4HOU A;  5G05 C;  4RG9 A;  3VTY A;  5HQ8 A;  2HYZ A;  3MV2 B;  4GYY A;  5EX3 A;  4U0U A;  5FT9 A;  4JA9 A;  5FJY A;  5G04 J;  3GZ2 A;  1XNF A;  4GA1 A;  3U4T A;  3Q15 A;  3SZ7 A;  5A6C A;  3ASD A;  2IFU A;  4JL0 A;  4AM9 A;  3RJV A;  3CVQ A;  4RG6 A;  5JJ7 A;  4GCN A;  5M72 A;  4U0Z A;  2HR2 A;  4JHR A;  2Y4T A;  5FTP A;  2C2L A;  2I6H A;  5ARG A;  3ULQ A;  3AS4 A;  5FZS A;  1PC2 A;  3Q5M A;  4U0S A;  1OUV A;  3LY8 A;  4IN3 B;  4KYO B;  2XGO A; 
#chains in the Genus database with same CATH topology
 2WB2 A;  3RRN B;  3ZU7 B;  1Z3X A;  4K03 A;  4G8L A;  4JA7 A;  5EYL A;  4I6G A;  1MYO A;  3QWW A;  3V2O A;  1YMP A;  1OCZ E;  4DJA A;  3BU8 A;  2XEV A;  1E90 A;  3KEA A;  1HG2 A;  1OWM A;  4N39 A;  5FIO A;  2WXL A;  3BG1 B;  1HE8 A;  2OND A;  4FC8 A;  5D0O D;  3CVW A;  1HO8 A;  5ANL A;  4GZC A;  4F1S A;  2DZN A;  5ENP D;  3KS2 A;  1LTX A;  3L54 A;  4B0Z A;  5AQB A;  1E7V A;  4AV7 A;  1NFI E;  3QWV A;  3ML8 A;  4GZ6 A;  4TUU A;  3E4B A;  3KSL A;  4ANV A;  4MRU A;  2WQ7 A;  3FTZ A;  3CHS A;  1UW4 B;  5CCM A;  3D9N A;  2KAT A;  3X2Q E;  5G05 J;  2IU1 A;  3NOC D;  3RKV A;  2XCC A;  3AG1 E;  3FH5 A;  3RO3 A;  2J8S D;  3CKC A;  3SNX A;  3C5R A;  5AAR A;  5EN5 D;  1LD8 A;  5KNH D;  2DCP A;  1N4Q A;  4K0R A;  4L2Y A;  1P5Q A;  1WY6 A;  2KXP C;  2ZIR A;  3D9J A;  5EIL A;  3HXC A;  4XEI G;  4XIF A;  2GW1 A;  1QZ2 A;  2HM8 A;  1GW6 A;  3CEQ A;  3FUH A;  3OXG A;  1DC2 A;  3IHV A;  3NQP A;  3KAE A;  4LER A;  3SFX A;  3SF4 A;  4WNE A;  3TWU A;  1SZA A;  3IHY A;  2IQC A;  2XGS A;  3DXM G;  4FUL A;  3Q7A A;  4WWN A;  1Z6T A;  1FT2 A;  3ABL E;  1MJ0 A;  4C9B B;  1H19 A;  3JCK C;  1EYH A;  5EDS A;  4QQI A;  3FFL A;  3V79 K;  1HG5 A;  3TWV A;  2PQN A;  5FQ6 A;  3LEW A;  3CQG B;  4L7T A;  1TNZ A;  1OCR E;  2VQ2 A;  3L22 A;  3Q75 A;  4KXK B;  2KZT A;  3FUK A;  5G55 A;  5ENQ D;  2EIJ E;  2WXF A;  4DUI A;  3B7R L;  3LVQ E;  5T8I A;  4CZ2 D;  4GCO A;  3ONL A;  3CHP A;  3V2X A;  4K5A B;  2XPY A;  4ANU A;  4TV3 A;  4F53 A;  1IQR A;  2RKK A;  3S7F A;  3ZYM A;  2LXL A;  2AXZ A;  4LEU A;  1UJK A;  2BF0 X;  3ZVV A;  2KCK A;  4I9C A;  2IO2 C;  1INZ A;  2OEW A;  4YND A;  3U66 A;  3I4G A;  4J8Y A;  3VLF A;  3PUJ A;  3PH0 C;  3QWP A;  4HXI A;  1D8D A;  3CST A;  1H6P A;  1V55 E;  1K1A A;  3JYS A;  3LY7 A;  4N3C A;  4JVS A;  2Y4U A;  4XI9 A;  4OAV B;  3W9G A;  3FUJ A;  2KM4 A;  5CMW A;  1OWN A;  1IHG A;  2V4H C;  3DPY A;  4EZL A;  1X5B A;  3FTV A;  3FHE A;  4J0U A;  4AXH A;  4DI4 A;  2PL2 A;  2YHC A;  5ENN A;  1YYH A;  3TWW A;  3TWR A;  4APF A;  2NYJ A;  4ATZ D;  4PS3 A;  2CFU A;  3NZU A;  3LDZ A;  4AVX A;  5CMY A;  2AWI A;  3ZEF A;  2XS1 A;  5A23 A;  3MX3 A;  3CVX A;  2WXP A;  3T8M A;  3U9W A;  3IBE A;  3RK6 A;  5G04 C;  3O48 A;  5HI7 A;  2UY1 B;  2JAB A;  4GA2 A;  3FTY A;  4AIF A;  3S7B A;  2J09 A;  1NA0 A;  4O6F A;  3EU9 A;  3RIB A;  4ILH B;  4DX7 D;  2C0M A;  1L5J A;  2MYO A;  5BXU A;  3U3W A;  4YVQ C;  3RSE G;  1HFA A;  2LSV A;  2DBA A;  1TEZ A;  3PZ4 A;  3IXE A;  5JJT A;  4GZD A;  3TXN A;  2GRP B;  3DSW A;  3LJ3 A;  3TXM A;  3D9P A;  2HE0 A;  3S2A A;  3KD7 A;  1U3C A;  2QY7 A;  3P2B A;  2X6K A;  2FO1 E;  3SI5 A;  1TNO A;  2L0T B;  3SO8 A;  3JUI A;  4N2S A;  4A63 B;  3LKU A;  4G1T A;  1E8X A;  4N2Q A;  4CDM A;  3CHR A;  3SGH A;  2CG3 A;  3AG3 E;  5EKQ D;  3FUM A;  3C98 A;  4MKT A;  3VTX A;  4HFG A;  3ZYL A;  5LCW J;  5LP0 A;  3LCA A;  3L6A A;  4R7L A;  4L23 A;  4DX1 A;  2I2O A;  1O5M A;  4GYY A;  4TUM A;  3FUN A;  4ILI A;  3CSF A;  1E8Y A;  1DCQ A;  4JA9 A;  5FJY A;  5G04 J;  3GZ2 A;  2LO6 A;  4HVB A;  4FJZ A;  1H2V C;  3U4T A;  3SZ7 A;  3ASD A;  1BD8 A;  1Q2Z A;  4RG6 A;  4U0Z A;  4DK5 A;  3HXD A;  1VDY A;  4A3V A;  1U2V G;  2XEH A;  2C2L A;  2MOW A;  3W9F A;  2I1K A;  1N52 A;  2X3M A;  1UN9 A;  3FTX A;  4U0S A;  2BED A;  2JEK A;  3DRA A;  4YDW A;  3UIO C;  4CYM D;  3MCX A;  4KYO B;  2XGO A;  4JB8 P;  5BW8 C;  4H7Y A;  1OY3 D;  2XZD G;  3TGO A;  4LCT A;  1E8Z A;  4GAA A;  3IV0 A;  4DPR A;  4BT8 A;  5CRU A;  4BER A;  4WAF A;  2GRO B;  4J6I A;  2WXM A;  3I5P A;  1SW6 A;  3ZHE A;  2IO3 C;  3RRU A;  1E96 B;  4ACL A;  1MHQ A;  3Q79 A;  3BG0 B;  3CK9 A;  4G11 A;  1PY1 A;  1N4P A;  3GW4 A;  3ESK A;  2ZGG A;  2H6G A;  1AP7 A;  4WWP A;  1MX4 A;  4DX6 D;  4FP7 A;  3RRM B;  4B93 B;  2E0I A;  1OXJ A;  4I43 A;  2AJA A;  4AOF A;  3R7Q A;  2R2L A;  4I17 A;  4K5B A;  2XGM A;  3UPV A;  1ZBP A;  3G2S A;  1O1T A;  4P29 A;  2V5Q C;  1RZ4 A;  3JXI A;  3C3Q A;  2MRI A;  5BNW A;  2QFC A;  4GB9 A;  2VGX B;  5IY5 E;  3QDN A;  4WND A;  4AP2 A;  2I9C A;  4JW1 A;  1AWC B;  5KJM A;  4UI9 J;  2HO1 A;  4OVU A;  2XRZ A;  4I6J A;  1H0A A;  2WXK A;  3K9I A;  5AYW D;  2WXN A;  3ASF A;  1EDU A;  3AG2 E;  4D10 C;  3E30 A;  3UIP C;  1FVF A;  4XZ4 A;  3GZ1 A;  3CGH A;  4CT0 A;  3UM1 A;  4O1P A;  4LUN U;  3FU6 A;  4BSZ B;  4GTQ A;  3Q73 A;  2OVB A;  1D9S A;  1LF8 A;  5BPP A;  4PS8 A;  2L9B A;  3AG4 E;  2PM7 A;  3FUI A;  4I6E A;  4V3I A;  3LJN A;  3PDN A;  4JZY A;  4APO A;  2PZI A;  3Q47 B;  2WXH A;  3QK0 A;  5DBK A;  3SQV A;  2J07 A;  5B3S E;  5FZQ A;  4FJY A;  5CED B;  4B8C B;  3ASH A;  3HG0 D;  1OWL A;  1MX6 A;  4GA0 A;  3CV0 A;  1MQS A;  2R02 A;  3HRA A;  1TNY A;  1OT8 A;  2DIW A;  4C0E A;  4KVM A;  3OXF A;  4G24 A;  4XKC A;  1ELR A;  3G2T A;  4I2Z A;  4XI0 A;  1NA3 A;  4UWH A;  1DVP A;  1OCO E;  2UY1 A;  4AJW A;  5ENS D;  5AJL A;  3HXE A;  3WXX A;  3CVL A;  4K5C A;  1K3Z D;  4M7C A;  4KZC A;  2LUH A;  1S0P A;  5CHE E;  3TL5 A;  1PAQ A;  1KLX A;  3Q7F A;  2WQ6 A;  3UQ3 A;  2QYJ A;  3AAA C;  3D9M A;  3FTS A;  2C0L A;  4HOR A;  1ZU2 A;  5J08 A;  2IJG X;  4UWG A;  1OWP A;  5DIZ A;  5C1D A;  4U8V D;  4AY6 A;  1S63 A;  4LNG A;  2QC9 A;  1N0Q A;  3CR3 A;  3EU5 A;  1DNP A;  5KCM A;  2P2C P;  1JPL A;  3AU5 A;  3ZXS A;  4GYO A;  2WMN A;  3HVE B;  3VLE A;  1Y6I A;  1YA0 A;  3RO2 A;  2P9P G;  4U8H A;  1N11 A;  3TWS A;  3T5V A;  3Q78 A;  4GZ3 A;  4JHK A;  3EDT B;  2PNN A;  2XHE A;  2R17 C;  2XEE A;  3FUF A;  1D8E A;  3NOG D;  4FHK A;  4GU5 A;  2VSY A;  3PZ1 A;  4EQF A;  2WQH A;  3PRZ A;  4BET A;  2RFM A;  4UQY A;  3Q9N C;  4DLO A;  4J8E A;  1EF1 C;  1IYG A;  1H2U A;  1SZ9 A;  3CHO A;  4IRU A;  4EHM A;  2F37 A;  3TAX A;  3T8K A;  3PUK A;  4TXQ A;  3PS6 A;  2VGY A;  1UN8 A;  2P58 C;  3ZN3 A;  2DYR E;  5HS0 A;  2F8Y A;  2M63 A;  5LOZ A;  4KVO A;  2XQ0 A;  4OAU C;  3UT4 A;  5LCW C;  4HRM B;  1MX2 A;  3C3O A;  3MV3 B;  4RVB A;  3TJP A;  4HOU A;  4HI8 A;  1E8W A;  3QJZ A;  2J49 A;  5LX8 A;  2LAI A;  3BUA A;  5EX3 A;  1G3N B;  5ENO D;  2L0I A;  2ZXW E;  5JHB A;  2J08 A;  4BEP A;  1XNF A;  2OVF A;  3UTM A;  5AIJ A;  2V4L A;  1BU9 A;  1FT1 A;  3PZ3 A;  4AM9 A;  3RJV A;  3CVQ A;  3CVU A;  1Z3Y A;  3PNT B;  3EIJ A;  5M72 A;  4BX9 A;  5FTP A;  4LSZ E;  4UUC A;  5G2N A;  5ARG A;  3ULQ A;  5FZS A;  1PC2 A;  3DXK G;  1SA5 A;  2ZIS A;  2AXV A;  1OUV A;  3LY8 A;  3UM0 A;  2R59 A;  4N5C A;  2OCC E;  4YVO A;  3ZFW A;  1H2T C;  1DCE A;  3ABK E;  2P9U G;  2F0Y A;  2ZU6 B;  3L16 A;  4B89 A;  4EPZ A;  3FU3 A;  3G2W A;  5EID A;  3TWQ A;  2IF4 A;  3SHF A;  4EEC A;  3CVN A;  4EZK A;  5KJN A;  4EBA A;  3SFY A;  3ZYQ A;  4LG6 A;  4IYP A;  4HBD A;  4GTT A;  4M3O A;  1FPP A;  3CKB A;  3FEX A;  4KT6 B;  3MKQ B;  5A7D B;  2KC7 A;  1UG3 A;  3UM2 A;  1K1B A;  3HXF A;  1N4S A;  5FWQ A;  2P9K G;  4DRX E;  4FA6 A;  3SBT B;  4EZJ A;  2J4D A;  4BSX A;  5B1A E;  4FAD A;  3ULE G;  4JEH A;  5E75 A;  1FCH A;  2CHZ A;  3TG4 A;  4I9E A;  3DSS A;  4B8A A;  4UI9 K;  4CGW A;  2ZGD A;  2VGX A;  2X6H A;  4NAC A;  1ELW A;  5AAO A;  3FU0 A;  5KJK A;  3L13 A;  3FH7 A;  3J5P A;  1XGW A;  2OOE A;  2Y0B G;  4PDX A;  3NB2 A;  4YDO A;  3JUE A;  1YCS B;  2P9S G;  4Y6C A;  4XE0 A;  5FZR A;  4NQ0 A;  4O60 A;  2LAH A;  1TN7 A;  2VSX E;  3QKY A;  3FUE A;  3T9K A;  2MHK A;  4UQZ A;  4CRW A;  2KCV A;  1SA4 A;  2KBX A;  3AS8 A;  3P1U A;  4F6R D;  4GTR A;  2AXU A;  3ZGQ A;  2CFZ A;  3ZRH A;  4LNB A;  3ASN E;  1W3B A;  2WXO A;  1X81 A;  3PZ2 A;  4JPS A;  4UI9 C;  5CRV A;  3V31 A;  3LY9 A;  3FY4 A;  1SVX A;  5ITZ F;  4U63 A;  1MZC A;  4OYS A;  1KT0 A;  4FHJ A;  3UI2 A;  2LSU A;  2A5U A;  2R03 A;  3QAR A;  2E2E A;  3EHR A;  4J8D A;  4GYW A;  2X38 A;  5BT1 A;  3TG5 A;  4E6H A;  3ZXP A;  4BES A;  3BEE A;  2Y69 E;  2NXP A;  3UIN C;  3HHM A;  3AJI A;  3UXG A;  4F7A A;  3FUD A;  4MBG A;  3J5Q B;  1IXV A;  3ISM C;  3DSX A;  4C0M A;  4A3T A;  3ABM E;  4HS2 A;  3FU5 A;  1IHB A;  4YDE A;  4HRN A;  3B7T A;  3S7D A;  4I1O B;  4CCA A;  2J4B A;  3S7J A;  2FO7 A;  1HS6 A;  4GTO A;  3B95 A;  4IUL A;  4LNU D;  4G26 A;  1HX8 A;  4PUC A;  2J9Q A;  4A1S A;  3ZNG A;  4JEU A;  3CVY A;  1EPU A;  4ZFH A;  3DEO A;  2I1J A;  5EX0 A;  3E37 A;  2ETA A;  4UWF A;  4BWR A;  1QQE A;  2CHW A;  2XCB A;  4ILG A;  3CVV A;  4Q96 A;  5AJD A;  3KSQ A;  3E33 A;  1Y8M A;  2V0P A;  4WNG A;  3R9A B;  1HF8 A;  2WXR A;  4I1M A;  3BQO A;  2H6H A;  2FEZ A;  4OVV A;  3EJN A;  3L17 A;  4GML A;  3UUX A;  1N95 A;  2DVW A;  3MA5 A;  1BI7 B;  4ATG A;  1SQM A;  5H7P A;  1WDY A;  3UKU G;  3D9O A;  3WG7 E;  1HU3 A;  3JXJ A;  4XX5 A;  3KEZ A;  2WXJ A;  4DX5 D;  3HVE A;  1JUQ A;  3B7B A;  3PRE A;  3OXL A;  1TNU A;  2FBN A;  1JWF A;  3LPZ A;  1N4R A;  3PEU B;  3Q49 B;  4N3B A;  4JXT A;  1NZN A;  5D0Q D;  3AS5 A;  2IY0 C;  5AQA A;  1N9A A;  4O1O A;  1BLX B;  4XKB A;  4HOQ A;  2GRL A;  2R05 A;  1ZB1 A;  5AQ9 A;  5KBA A;  2P9L G;  2EIK E;  4KMO A;  1NP7 A;  3SFZ A;  3HDX A;  3MYV A;  4HLE A;  1TJC A;  4RQI A;  3ENE A;  4H7X A;  3V30 A;  5JHA A;  3FEY A;  3ZPJ A;  3ZKJ A;  3FTW A;  1RW2 A;  4N3A A;  3R7R A;  2KCL A;  5B1B E;  2GRR B;  5FQ7 A;  4L2L A;  3PNL B;  4Y6W A;  2EIM E;  4UQX A;  2ILR A;  2LNI A;  3R9M A;  5C2Y A;  1TN8 A;  3APF A;  3MGB A;  4HB5 A;  4HQD A;  4YDY A;  4WUY A;  1A17 A;  2WXQ A;  3ZUV B;  1KZO A;  4GMJ A;  2Q7F A;  2GRM A;  2F8X K;  1H6K A;  1N0R A;  4GZ5 A;  5AN8 A;  3DST A;  4G25 A;  3ZHE B;  1B89 A;  3ESL A;  2WXI A;  2BKG A;  3DEP A;  3VTY A;  3T5X A;  2WMO A;  3CIA A;  2HYZ A;  1JWG A;  5HQ8 A;  1NI1 A;  3I4R B;  1NL4 A;  4KZ0 A;  2RFA A;  4GTS A;  2X6J A;  2OV8 A;  5BV1 A;  5LFA A;  4HNA D;  2A4Z A;  3Q15 A;  1KZP A;  3MJW A;  3LXU X;  2VSO E;  5FQ4 A;  5KWD A;  4HRL A;  4JL0 A;  2OEV A;  4GCN A;  4PH4 B;  1LD7 A;  1JCR A;  1H6O A;  3G2U A;  2Y4T A;  1IQU A;  4ANX A;  2B6C A;  3EHN A;  3FDH A;  3NZS A;  2Y3A A;  3Q5M A;  4F1P A;  4UWK A;  5FIN A;  5EIB E;  4HLL A;  1FVH A;  4IN3 B;  3MKQ A;  4J8S A;  5T4Y A;  3G2V A;  2H6F A;  2YIN A;  4U07 A;  3MEK A;  3JQ0 A;  2UWJ G;  4NRH B;  4JHJ A;  3LYA A;  4Q94 A;  4HOT A;  4GPK A;  4DX2 A;  3ASO E;  4WWO A;  3EHM A;  2YQ8 A;  4N5Q A;  3N71 A;  2VTB B;  1E7U A;  3SD5 A;  4FU3 A;  5CBO A;  4X8Q A;  5E76 A;  2L6B A;  2XEN A;  3UT8 A;  3EUV A;  4ANW A;  2EIL E;  3AU4 A;  1BPO A;  3NAW A;  3DPD A;  3NF1 A;  4I1A A;  3URZ A;  2AVP A;  5CBN A;  4A55 A;  3B13 A;  1OCC E;  1HH8 A;  2RG8 A;  1Z5S C;  4BX8 A;  5BUZ A;  4FLH A;  1BI8 B;  2ETC A;  3MZL B;  2L6J A;  3Q4A B;  5HRY A;  3ZYK A;  1WM5 A;  3RAU A;  4PS7 A;  2EQX A;  4CGV A;  1K8K G;  2IOL A;  3APD A;  2GRN B;  4G23 A;  4JC8 A;  5JJ6 A;  4KBQ A;  5EYP F;  3SY2 A;  5KNG A;  3UMV A;  1WG0 A;  4W9R A;  3D3M A;  4ME2 A;  5ENT D;  4MS6 A;  2DWZ A;  2NC9 A;  3RU0 A;  3C72 A;  2WPV A;  4BTB A;  2XPZ A;  1O1S A;  3D9L A;  1UJJ A;  4WNF A;  1KPS B;  3FUL A;  2X6F A;  5AEN A;  4ABN A;  2WM9 A;  1V54 E;  3PE3 A;  4A1G A;  3DWL G;  2IOS A;  5BXO A;  2BUG A;  3EIQ C;  4GPM A;  4J7W A;  3UKR G;  2V5F A;  1TJF A;  3FWV A;  1IKN D;  4JD2 G;  1OWO A;  2X6I A;  2DYS E;  3O4Z A;  3ONK A;  4Q69 A;  1TYQ G;  3CVP A;  2XZT G;  4TRQ A;  4U04 A;  2VGE A;  5CEC B;  3I3N A;  2P9N G;  5FQ8 A;  4NIK A;  2PM6 A;  1TNB A;  2XPI A;  2BKK B;  1HZ4 A;  4DLQ A;  3CHQ A;  4DI3 A;  5BV0 A;  2VSN A;  3UM3 A;  3F6Q A;  2YNQ A;  4B94 A;  4GMR A;  4L9P A;  2CG2 A;  4CT4 A;  3SBS A;  3ZIM A;  2KZT B;  3QB2 A;  3DBS A;  1U3D A;  3DSV A;  5J90 A;  2A5E A;  4GTV A;  3OAW A;  4U95 D;  2NSZ A;  3CK8 A;  2JLB A;  3E32 A;  4LRZ A;  2GGF A;  1WAO 1;  4G8K A;  3B7S A;  4CDR A;  4AY5 A;  4AEZ C;  2QYU A;  3B7U X;  3ULY A;  5D2M C;  2FI7 A;  3VLD A;  3D9I A;  3HIZ A;  3QOU A;  4J8F A;  5ENR D;  5JMN D;  3GZS A;  3LVR E;  3L08 A;  4RSY A;  3MKR A;  3FH8 A;  3EHQ A;  2LXM A;  1S70 B;  1S64 A;  2Y1L E;  4GTM A;  2ETB A;  3D9K A;  4HI9 A;  4RLY A;  3UX4 A;  1JCQ A;  2WXG A;  3D9H A;  2QZA A;  2V8S E;  1HXI A;  2YHE A;  4G2V A;  2DZO A;  5CEA A;  3TWT A;  2PQR A;  4F3V A;  3ZW3 A;  3ASG A;  2P9I G;  3QAQ A;  4I2W A;  4MLP A;  2R5S A;  3FTU A;  5HKP A;  3UT7 A;  1ELK A;  5CER B;  2XRY A;  3E34 A;  2VYI A;  3QNK A;  2FF4 A;  4TXP A;  4BFR A;  3LS8 A;  3C3R A;  4L1B A;  4HOS A;  1QYM A;  2BTD A;  2RD0 A;  5KJL A;  4QFV A;  4EBA G;  2CHX A;  3IKO B;  5ARF A;  1TN6 A;  2WVI A;  4GTP A;  1TR4 A;  4ACK A;  3CLJ A;  3PE4 A;  4U8Y D;  5CCL A;  1KT1 A;  3OTN A;  4NUR A;  2H6I A;  4BT9 A;  3GYZ A;  2FUL A;  3CHM A;  5T3R A;  3Q9U C;  3IEG A;  3HYM B;  4C48 B;  3FP3 A;  3CK7 A;  3L9T A;  5ANR A;  4BTA A;  1O1R A;  1QNF A;  3PZD A;  4Z68 A;  1A5E A;  3JQ1 A;  4CEM A;  5G05 C;  1QBQ A;  4RG9 A;  1N94 A;  3MV2 B;  3DSU A;  1UOH A;  2AW6 A;  3PEV B;  4U0U A;  1N54 A;  4URK A;  5FT9 A;  2ION A;  3QC1 A;  4GA1 A;  2XS8 A;  5A6C A;  2IFU A;  4CDN A;  4TXR A;  3PVL A;  1JCS A;  2GRQ B;  2VJ8 A;  3CQC B;  5JJ7 A;  4U96 D;  5JA4 D;  2HR2 A;  4JHR A;  4ZHB A;  3HXB A;  5D66 A;  2IEJ A;  4U7E B;  3NBN B;  2I6H A;  2B0O E;  3TWX A;  5AQ7 A;  3L82 A;  4UWL A;  3AS4 A;  3U64 A;  3ML9 A;  3APC A;  4E85 A;  2EIN E;  4BY6 A;  4FLB A;  2VTB A; 
#chains in the Genus database with same CATH homology
 5BW8 C;  2R59 A;  2WB2 A;  4N5C A;  3RRN B;  4J8S A;  4YVO A;  3ZFW A;  4H7Y A;  5T4Y A;  1H2T C;  1Z3X A;  4K03 A;  3G2V A;  4JA7 A;  2YIN A;  4U07 A;  2ZU6 B;  3TGO A;  4I6G A;  4LCT A;  1E8Z A;  3L16 A;  3QWW A;  4B89 A;  4EPZ A;  3FU3 A;  3MEK A;  4DJA A;  2XEV A;  3G2W A;  1E90 A;  4GAA A;  2IF4 A;  3SHF A;  4EEC A;  3IV0 A;  2UWJ G;  3JQ0 A;  4NRH B;  4BT8 A;  4DPR A;  4JHJ A;  1HG2 A;  3CVN A;  4EZK A;  1OWM A;  4N39 A;  4EBA A;  5KJN A;  3LYA A;  3ZYQ A;  2WXL A;  3BG1 B;  4Q94 A;  1HE8 A;  4IYP A;  2OND A;  4WAF A;  4FC8 A;  4HOT A;  5D0O D;  3CVW A;  4GPK A;  1HO8 A;  4J6I A;  4WWO A;  2WXM A;  5ANL A;  3EHM A;  4M3O A;  4GZC A;  3I5P A;  2YQ8 A;  4F1S A;  3CKB A;  3FEX A;  3N71 A;  4KT6 B;  3ZHE A;  3MKQ B;  2VTB B;  1E7U A;  5A7D B;  3SD5 A;  2KC7 A;  4FU3 A;  3KS2 A;  1E96 B;  3RRU A;  4ACL A;  1MHQ A;  1UG3 A;  3BG0 B;  3L54 A;  4B0Z A;  5E76 A;  1E7V A;  4AV7 A;  5FWQ A;  3QWV A;  3UT8 A;  4FA6 A;  3SBT B;  4EZJ A;  2J4D A;  3ML8 A;  4GZ6 A;  4TUU A;  3E4B A;  4ANW A;  3AU4 A;  4BSX A;  1BPO A;  4FAD A;  3DPD A;  3CK9 A;  4G11 A;  3NF1 A;  4I1A A;  4JEH A;  1PY1 A;  5E75 A;  3URZ A;  1FCH A;  2AVP A;  4ANV A;  3GW4 A;  4MRU A;  4A55 A;  3B13 A;  2WQ7 A;  3ESK A;  2CHZ A;  1HH8 A;  3TG4 A;  3FTZ A;  2RG8 A;  4WWP A;  4I9E A;  3CHS A;  4BX8 A;  1UW4 B;  5CCM A;  5BUZ A;  4FLH A;  4B8A A;  3D9N A;  4UI9 K;  4CGW A;  3MZL B;  2KAT A;  4FP7 A;  2VGX A;  2IU1 A;  2X6H A;  5G05 J;  4NAC A;  3RKV A;  2L6J A;  1ELW A;  2XCC A;  3RRM B;  3FH5 A;  2E0I A;  3Q4A B;  3RO3 A;  3FU0 A;  5KJK A;  3CKC A;  3ZYK A;  1WM5 A;  3SNX A;  4I43 A;  4AOF A;  3L13 A;  3FH7 A;  4PS7 A;  2EQX A;  1XGW A;  3R7Q A;  4CGV A;  2IOL A;  3APD A;  4G23 A;  2OOE A;  4JC8 A;  4PDX A;  4I17 A;  5JJ6 A;  4KBQ A;  2XGM A;  3UPV A;  2DCP A;  4K0R A;  4L2Y A;  1P5Q A;  1WY6 A;  3UMV A;  1ZBP A;  3D9J A;  4Y6C A;  3G2S A;  4W9R A;  4XE0 A;  4XIF A;  5FZR A;  4NQ0 A;  4P29 A;  2LAH A;  2GW1 A;  1QZ2 A;  2HM8 A;  3CEQ A;  1GW6 A;  2MRI A;  3FUH A;  2VSX E;  3D3M A;  3IHV A;  3OXG A;  5BNW A;  4ME2 A;  3QKY A;  2QFC A;  4GB9 A;  3FUE A;  3NQP A;  3KAE A;  4LER A;  3SF4 A;  4WNE A;  2MHK A;  1SZA A;  2VGX B;  3QDN A;  4UQZ A;  4CRW A;  4MS6 A;  2KCV A;  2NC9 A;  3AS8 A;  3RU0 A;  3P1U A;  3IHY A;  4WND A;  2IQC A;  2WPV A;  4AP2 A;  2AXU A;  4BTB A;  3ZGQ A;  2CFZ A;  2XGS A;  2XPZ A;  3ZRH A;  2I9C A;  4FUL A;  4JW1 A;  3D9L A;  5KJM A;  4WWN A;  1UJJ A;  4UI9 J;  1W3B A;  2WXO A;  4WNF A;  4JPS A;  1Z6T A;  2HO1 A;  4OVU A;  4UI9 C;  2XRZ A;  3FUL A;  2X6F A;  4I6J A;  1H0A A;  2WXK A;  4C9B B;  1H19 A;  3JCK C;  5AEN A;  3LY9 A;  3K9I A;  5AYW D;  4ABN A;  2WM9 A;  4A1G A;  3PE3 A;  3FY4 A;  1EYH A;  4U63 A;  2WXN A;  2IOS A;  4OYS A;  1KT0 A;  3ASF A;  1EDU A;  4FHJ A;  2BUG A;  5EDS A;  2LSU A;  3EIQ C;  4D10 C;  2A5U A;  3FFL A;  3QAR A;  2V5F A;  1HG5 A;  2E2E A;  4J8D A;  1TJF A;  3FWV A;  4GYW A;  2PQN A;  2X38 A;  5FQ6 A;  3LEW A;  1OWO A;  3CQG B;  3TG5 A;  5BT1 A;  2X6I A;  4L7T A;  3O4Z A;  3ONK A;  4Q69 A;  3CVP A;  1FVF A;  4TRQ A;  4E6H A;  4U04 A;  4XZ4 A;  2VQ2 A;  3GZ1 A;  3L22 A;  3BEE A;  3CGH A;  4CT0 A;  4KXK B;  2KZT A;  2NXP A;  3FUK A;  5G55 A;  4LUN U;  3I3N A;  3HHM A;  4F7A A;  3FU6 A;  3FUD A;  2WXF A;  5FQ8 A;  3B7R L;  2OVB A;  2PM6 A;  3LVQ E;  2XPI A;  5T8I A;  1LF8 A;  5BPP A;  1HZ4 A;  4GCO A;  3ONL A;  4PS8 A;  2L9B A;  4C0M A;  3CHP A;  4DLQ A;  2PM7 A;  3FUI A;  2XPY A;  4HS2 A;  4A3T A;  4I6E A;  4TV3 A;  4ANU A;  3CHQ A;  4DI3 A;  5BV0 A;  4V3I A;  3FU5 A;  3PDN A;  4JZY A;  2VSN A;  4F53 A;  1IQR A;  4APO A;  3B7T A;  3S7D A;  2PZI A;  3Q47 B;  3S7F A;  2WXH A;  3QK0 A;  4I1O B;  4CCA A;  2J4B A;  3S7J A;  2YNQ A;  2FO7 A;  5DBK A;  1HS6 A;  3ZYM A;  4B94 A;  2AXZ A;  4LEU A;  4IUL A;  1UJK A;  2BF0 X;  3ZVV A;  4G26 A;  2KCK A;  1HX8 A;  2CG2 A;  4I9C A;  4CT4 A;  4PUC A;  3SBS A;  2J07 A;  3ZIM A;  5FZQ A;  2J9Q A;  4A1S A;  2KZT B;  1INZ A;  4YND A;  3QB2 A;  3U66 A;  4FJY A;  3DBS A;  3I4G A;  3ASH A;  3VLF A;  1OWL A;  1U3D A;  4B8C B;  3PUJ A;  3PH0 C;  3QWP A;  4HXI A;  5J90 A;  4JEU A;  3OAW A;  3CVY A;  1EPU A;  3CST A;  2NSZ A;  4GA0 A;  3CV0 A;  1MQS A;  2I1J A;  3CK8 A;  2JLB A;  5EX0 A;  3JYS A;  3LY7 A;  4LRZ A;  4UWF A;  4N3C A;  4JVS A;  2GGF A;  2Y4U A;  2DIW A;  4XI9 A;  4KVM A;  3FUJ A;  4C0E A;  4BWR A;  1QQE A;  2CHW A;  2KM4 A;  2XCB A;  1WAO 1;  3OXF A;  5CMW A;  4ILG A;  4G24 A;  3CVV A;  4Q96 A;  5AJD A;  3B7S A;  1OWN A;  4XKC A;  1ELR A;  1IHG A;  4CDR A;  3G2T A;  4I2Z A;  1Y8M A;  4XI0 A;  2V0P A;  1NA3 A;  4UWH A;  4AY5 A;  1DVP A;  2UY1 A;  4WNG A;  4AEZ C;  4EZL A;  3R9A B;  1HF8 A;  4AJW A;  2WXR A;  1X5B A;  3B7U X;  4I1M A;  2FI7 A;  3VLD A;  2FEZ A;  4OVV A;  3EJN A;  3FHE A;  3D9I A;  3FTV A;  3L17 A;  3HIZ A;  3QOU A;  5AJL A;  4J0U A;  4GML A;  4J8F A;  3WXX A;  3UUX A;  4AXH A;  3CVL A;  2PL2 A;  4DI4 A;  4KZC A;  1S0P A;  2YHC A;  5ENN A;  3MA5 A;  4APF A;  5CHE E;  3TL5 A;  4ATG A;  1PAQ A;  1KLX A;  1SQM A;  4PS3 A;  2CFU A;  3NZU A;  3LDZ A;  4AVX A;  2WQ6 A;  5CMY A;  3GZS A;  3D9O A;  2AWI A;  3LVR E;  3L08 A;  1HU3 A;  4RSY A;  3UQ3 A;  3ZEF A;  3MKR A;  4XX5 A;  5A23 A;  3KEZ A;  2WXJ A;  3FH8 A;  3MX3 A;  3D9M A;  3FTS A;  2C0L A;  3CVX A;  3HVE A;  4HOR A;  1JUQ A;  1ZU2 A;  3PRE A;  5J08 A;  3OXL A;  2WXP A;  3T8M A;  3U9W A;  3D9K A;  2IJG X;  2FBN A;  3IBE A;  3RK6 A;  5G04 C;  3O48 A;  1JWF A;  5HI7 A;  4UWG A;  3LPZ A;  2UY1 B;  1OWP A;  5DIZ A;  5C1D A;  3PEU B;  3UX4 A;  2WXG A;  3FTY A;  4GA2 A;  4AIF A;  3Q49 B;  4N3B A;  3S7B A;  4JXT A;  1NZN A;  4AY6 A;  2V8S E;  5D0Q D;  1HXI A;  2J09 A;  3AS5 A;  2YHE A;  4G2V A;  1NA0 A;  4O6F A;  3CR3 A;  3RIB A;  4XKB A;  1DNP A;  4HOQ A;  5KCM A;  4ILH B;  2PQR A;  1JPL A;  2C0M A;  2GRL A;  1L5J A;  4F3V A;  3ZW3 A;  3AU5 A;  3ZXS A;  4GYO A;  2WMN A;  3U3W A;  3ASG A;  3HVE B;  4YVQ C;  3VLE A;  1Y6I A;  1YA0 A;  3RO2 A;  4U8H A;  1HFA A;  3QAQ A;  2LSV A;  4I2W A;  4KMO A;  1NP7 A;  2DBA A;  4MLP A;  1TEZ A;  3T5V A;  3SFZ A;  3HDX A;  2R5S A;  3FTU A;  3MYV A;  4GZ3 A;  4JHK A;  3UT7 A;  4HLE A;  1ELK A;  3EDT B;  2XRY A;  2XHE A;  1TJC A;  2R17 C;  3FUF A;  3ENE A;  4H7X A;  5JJT A;  4FHK A;  4GU5 A;  2VSY A;  2VYI A;  5JHA A;  4EQF A;  3FEY A;  2WQH A;  3QNK A;  4GZD A;  3PRZ A;  2FF4 A;  3TXN A;  4BFR A;  3LJ3 A;  3LS8 A;  4L1B A;  4HOS A;  3ZPJ A;  4UQY A;  2BTD A;  3FTW A;  2RD0 A;  5KJL A;  4QFV A;  4N3A A;  3R7R A;  3TXM A;  2KCL A;  4EBA G;  2CHX A;  3D9P A;  4DLO A;  4J8E A;  1EF1 C;  1IYG A;  3S2A A;  1H2U A;  3KD7 A;  1SZ9 A;  3IKO B;  3CHO A;  1U3C A;  5FQ7 A;  4L2L A;  5ARF A;  2QY7 A;  3P2B A;  4IRU A;  3PNL B;  2X6K A;  4Y6W A;  4UQX A;  3SI5 A;  2WVI A;  3TAX A;  2ILR A;  2L0T B;  3PUK A;  4ACK A;  3PS6 A;  3JUI A;  2LNI A;  2VGY A;  4N2S A;  3CLJ A;  3LKU A;  4G1T A;  1E8X A;  3PE4 A;  4N2Q A;  5CCL A;  1KT1 A;  4CDM A;  3OTN A;  3CHR A;  4NUR A;  2CG3 A;  5C2Y A;  1UN8 A;  3SGH A;  3APF A;  4BT9 A;  2P58 C;  3GYZ A;  3ZN3 A;  2FUL A;  3CHM A;  3MGB A;  5EKQ D;  5T3R A;  3IEG A;  3FUM A;  3HYM B;  3FP3 A;  4WUY A;  3CK7 A;  1A17 A;  5ANR A;  2WXQ A;  3C98 A;  4MKT A;  2M63 A;  4BTA A;  5LOZ A;  4KVO A;  2XQ0 A;  3VTX A;  4IN3 B;  3UT4 A;  4GMJ A;  4HFG A;  3ZYL A;  1QNF A;  2Q7F A;  2GRM A;  3PZD A;  5LCW J;  5LCW C;  5LP0 A;  1H6K A;  4GZ5 A;  3LCA A;  3L6A A;  4R7L A;  3MV3 B;  3JQ1 A;  4G25 A;  3ZHE B;  1B89 A;  4RVB A;  3TJP A;  3ESL A;  4CEM A;  4HOU A;  5G05 C;  1E8W A;  2WXI A;  3QJZ A;  4RG9 A;  4L23 A;  3VTY A;  3T5X A;  2WMO A;  3CIA A;  2HYZ A;  1JWG A;  2J49 A;  3MV2 B;  2I2O A;  5HQ8 A;  5LX8 A;  4GYY A;  2AW6 A;  2LAI A;  3PEV B;  5EX3 A;  3I4R B;  4U0U A;  1N54 A;  3FUN A;  4URK A;  4KZ0 A;  4ILI A;  5FT9 A;  2X6J A;  2OV8 A;  5BV1 A;  2ION A;  3CSF A;  3QC1 A;  5LFA A;  1E8Y A;  2L0I A;  5JHB A;  2J08 A;  4JA9 A;  5FJY A;  5G04 J;  3GZ2 A;  1XNF A;  2LO6 A;  4GA1 A;  2A4Z A;  2OVF A;  4HVB A;  4FJZ A;  1H2V C;  3U4T A;  5AIJ A;  3Q15 A;  3SZ7 A;  3MJW A;  5A6C A;  3LXU X;  2VSO E;  3ASD A;  5FQ4 A;  2IFU A;  2V4L A;  4CDN A;  4JL0 A;  4AM9 A;  3PVL A;  3RJV A;  3CVQ A;  3CVU A;  2VJ8 A;  3CQC B;  1Z3Y A;  4RG6 A;  4GCN A;  4PH4 B;  3PNT B;  5JJ7 A;  3EIJ A;  5M72 A;  4U0Z A;  4DK5 A;  2HR2 A;  1VDY A;  4A3V A;  3G2U A;  4JHR A;  2Y4T A;  4BX9 A;  5FTP A;  1IQU A;  2C2L A;  2MOW A;  4ANX A;  5G2N A;  2I6H A;  2I1K A;  5ARG A;  3ULQ A;  1N52 A;  3EHN A;  3FDH A;  4UWL A;  3AS4 A;  3NZS A;  5FZS A;  2Y3A A;  1PC2 A;  3Q5M A;  2X3M A;  1UN9 A;  3FTX A;  4U0S A;  3U64 A;  3ML9 A;  3APC A;  4UWK A;  2JEK A;  4E85 A;  2AXV A;  1OUV A;  3LY8 A;  4BY6 A;  4FLB A;  1FVH A;  3MCX A;  4KYO B;  2VTB A;  3MKQ A;  2XGO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...