2VYRE

Structure of human mdm4 n-terminal domain bound to a single domain antibody
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
124
structure length
124
Chain Sequence
EVQLLESGGGLVQPGGSLRLSCAASGFTFEEYAMLWVRQAPGKGLEWVSGINARGYTTYYADSVKGRFTISRDNSKNTLYLQMNSLRTEDTAVYYCAKPWYPFMASKGSEFDYWGQGTLVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Human Mdm4 N-Terminal Domain Bound to a Single-Domain Antibody.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords MDM4 PROTEIN
total genus 27
structure length 124
sequence length 124
chains with identical sequence F, G, H, I, J, K, L
ec nomenclature
pdb deposition date 2008-07-28
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vyrE00
1NC4D 3H9SA 1IC5H 3S37L 5E9DE 3MLWL 1G9MH 1YEIL 4JFFA 2R69L 3RU8H 2E9BA 1Q9LA 4UOJA 2OTWA 4D9QD 2IALA 3FZUC 2BRRL 5DJ0B 4OFDA 5F88B 1CT8B 2H8PA 4YAQB 2EKSB 3T3MF 4RMWA 4N5UA 1A7OH 2JK5A 2RFXA 4QHUA 1XAUA 2Y36H 2YD4A 2V2WA 5E8DH 3I02B 3OR7B 4TUJA 2K1MA 5E0QA 1TJGH 1BIIB 5FB8B 3O3EB 1F4YH 3LN9A 1DBAL 2QJDA 5F3BA 4PP2A 3V6FA 5CHNA 1BM3L 3TN0A 5A2JH 4H25B 1C8PA 5DRWB 1T22A 1ZHNB 1NMBH 1JWMA 4JLRA 1TFHA 4HFUH 1ZT7B 3WEXB 5ABDE 1V3KA 3TNNA 3SO3C 3OKDB 3VXUD 3O6FC 2ARJQ 3B6SB 4AM0A 2CJUL 3PWUB 4YQXL 2HMIC 3RX5A 3GSOA 5T3ZE 1WWWX 2X1XR 1PD6A 3SDAA 4B41A 3UZVB 3KAAA 1A7RH 4MAYD 3Q1SH 4K8RH 2B5IB 4HPYL 5E2UH 2BK8A 4F57H 3HI5L 4AH2A 2QADC 1AGBA 5F1KC 1WBXA 1LDPH 2PETA 1MJUL 1CGUA 3ROOA 1A1OA 3BGAA 1LO5A 2JJTC 2A9NL 3MREA 3LPFA 4FQXC 2H26B 1KGCE 4LLVA 3RVWD 1UWEL 4HMCA 4HKZA 4BZ2H 4MD0B 5D6CA 3CSYB 4HK0A 2F54A 1H5BB 2BVTA 3CLFL 3PWLA 4CAGA 5T3XH 1JPGB 3GSQB 1C7SA 2C9AA 3WJLA 1HOCA 2JELL 3VG9B 5DJAB 4KZEL 4S0SD 3MRBA 4Z77A 5A3ID 5EO0A 2I27N 2ZG3A 3FJTA 4EI5B 4R7NA 5ICZB 3VDAA 1FC2D 2R56L 1G9NH 3BH9B 2ITDA 4HIIA 2YD5A 1H3UA 2VAAB 1MCRA 4XWGL 2VWEC 1DQLL 4M7ZB 4AENB 4O5LL 1BZ7B 4FZ8H 4UNVA 4HGMA 3VWJA 3GHBL 3QIWD 1VEOA 2I07A 1MJ7L 1CVRA 1IGYB 4HBCH 3GUTA 4XPGH 3U79A 3QUMA 4MA1C 2Z92A 2Y5TA 3V0WL 5H2BA 4JRXA 2EEBA 3BYTA 3TBWA 1EUUA 1ZHLB 2R0WH 1RZFH 2ATKA 2GY7B 3MRKB 1J1XL 2RCSH 5AZ2H 3QYCA 5CAYB 3Q6FA 4P2RD 4GKSB 4L4TB 4LLYB 1UA6L 3WJJC 3X11A 1L0QA 5EU6A 3DBXB 1JFQL 5JHDD 1G9NL 4YHZL 2Q3ZA 4P3DB 3ZYIA 4GRLD 3QUXA 1LK2A 5ALBH 1AR1D 3T0EC 4XP1H 1KEGH 5KVGH 1MY5A 2XIDA 1BD2A 3BQUB 4JE4B 1HOCB 5A1AA 5FA3A 5AAMA 4ZG1A 1O0VA 2YSSA 1DQDL 4R6UA 4LHUB 5I6XB 3NBNA 3O11A 2WIIB 1JIBA 2IBZY 4ZXBA 5JIHA 1IC1A 4UV7H 5HI3C 3IFNL 2GI7A 3DSNA 2H26A 4WVRA 4Q2ZA 4N1CA 4FFVD 2DM2A 4Z5RB 4NSKA 1EAJA 3BQUD 5T3XL 1ZHKA 2YWYA 4S1RH 1UM6H 4NCC2 1JPST 4QXTA 4QHLB 5DQ9A 2VN7A 2XN9D 4R0LA 4Y8DC 3O3EA 4Y1AA 1NCNA 3EO0A 3BIBX 1I85A 3FKUS 1XZ0B 4TPRH 5EUOE 1FYTA 1ZA3A 5CSGA 3DXAB 1DQDH 5F96H 2BSTA 2CRZA 3MOQA 3SO3B 2NXZC 5D2LB 2O26U 5BV7L 2RJMA 4Y4FC 1DVFD 4QRUB 2QR0A 4IBLT 2ZOLB 4FMFA 3QXWA 3BGMA 3RL2A 3ILPA 2HLFC 3LDBC 1HHJA 5D93C 4WHTA 3U2SA 4WI5A 4YUEL 2CGRL 1DSFH 4BK5A 4PJAA 2UY6A 2EIBA 5IKCB 3CVHB 1SVCP 2X9XA 3I02A 1K3ZA 1XFPA 3PQYA 3V9FA 1X6LA 3RIAF 4X98B 2EYTA 4MX7B 1UZ8B 3FB6B 5KSBB 2RGSA 4CVWA 3C5ZA 2VRAA 4P5TC 3TO4A 1CN4A 1FVCA 5C09B 5I0ZA 1YMMA 4QHKI 3IXTA 5C08D 4HKJA 3RTQD 2HTLD 4MJ2A 1J1PH 3D0LA 3AXLB 1XGRA 1JWUA 2G5RA 1BEYH 3HC0B 4KTYA 5D72H 5JW5A 5ESVA 2XQYG 5CS7A 3H9SB 1NBQA 3NVQA 1DANU 5DD3H 4X9BA 1A3RL 5HJ3A 2FYYA 1JZ4A 4U1HB 4XNQB 3BP4B 3SDYL 4X6CB 1L7IH 2NY4B 5IOPA 4PB0L 4U33A 2AJVL 4P57B 3E8UL 4MJ5B 1JHKH 3ARDD 3QDHA 3PJSA 4JM2C 4XCNA 2HH0H 5E56A 3MGOA 5D7IA 4ZTPH 1VKXA 5I15H 3CDGA 4EBQH 5IFJB 4JRXD 4OCSH 4UINL 2DQCL 5I8OL 1GJIA 4U1GC 5DURB 4V1DB 5HVHC 2ZCKL 4HKXB 5BMFL 4R4BB 1T1ZA 4U4BA 1A4KA 1KB9J 3FQWA 3QA3A 4LKCB 5DT1L 3THMH 4FQXA 2X4RB 1K5NB 5EUOB 4PJDA 4YHNB 4MD4B 1Q9KA 5FYJD 4YHLL 5ALCH 3MRRA 4KRPD 4F7PB 3NCCB 1I75A 2Y23A 4N0CD 3O2WL 2ZUYA 4PUBH 1HHIB 3UJJL 1C08B 4JG1H 5JPNB 4YEEA 2NW3B 5MI0B 4X4XA 2X89D 4LU5L 1LEIA 2AXFB 4FP8H 4LASL 2XKNA 3EJZC 4ENED 2A6IA 6CGTA 3ZKND 3UMTA 1OGTB 4NPYA 1I9RH 4LPYA 4P2QB 2ESVE 3SKMB 1UQSB 4HUXB 2ARJA 1DLHA 4JFHD 3B9VA 2FZ3A 4P59H 1EJOL 4X5XB 3VXSD 2ADIB 4PJ9D 3DUSB 5L9DL 4YBLC 3CLEH 1UJ3C 4OLXH 3DGCR 2MCPL 5CGMA 3MJ6A 1D6EA 2X1OA 3HUJE 5IIEB 2O93L 1ZWIB 2OMBA 1DQQA 5TH2A 4LGSB 1S7VB 2ADFH 3K8MA 3QJFA 4Z78A 3FONA 1F90H 5I19L 4ODSH 3FB6A 1Y6NR 4HUXA 4KUZL 3CDCA 1NGPL 4I3GA 4LEXH 1P9MC 1KELH 1GZQA 1T4KA 3NACL 4EBQL 4MQ7A 2DQCH 5EUKB 3BKJH 4ENEC 4KPHH 1UFUA 3IFLL 3BEVB 1AP2B 1L4IA 3UJTL 1E6JH 4YBHA 2ZOLA 2X4RA 4S11A 3V4UL 4OCXH 4YHYB 3S9DB 5DT1H 4CN1A 4WI2A 1VADB 5BCAA 1IL1B 3P11H 1G7QA 1S9WA 4CN4A 2L7JA 4QTHA 4QRRA 4CL7A 1GOFA 2F8VA 2V2XB 5TF1H 4NRZA 5J1TC 2AJXL 2GUOA 1RIUH 2I9TA 2EEDA 3H7BB 3MNZB 1P53A 2WBJB 3ULVE 5DHYA 3VI3F 5IMMB 3VXME 3VI4E 1OF2B 4UDUA 1G1YA 1IM9B 3W81A 1T21B 5DMKA 1DE4A 4ZO7A 3ARTA 5K9OA 3EYUL 5KG9B 5GGRB 4MXVE 3BMVA 2AEIT 4XC1L 5KJRL 3CFKA 4OCRH 5HYJD 2AERT 5C3TA 1HSAA 1S7XB 3MNVB 2IH1A 1WBYA 6FABH 3GMOB 3VFOB 1UCBH 5D8JH 3MRIB 1AQKL 3ARDC 3DV6B 2PYED 1T89C 1JNNH 3S88H 4FQPA 3ZTJH 5TE7H 1S9YA 5KSBA 4TRPL 4R96B 1RUKL 4JFXB 1NSNL 4LBEB 5BXFB 3MUY1 1IC7H 5GGSY 3FOLA 1UWGH 3VE0B 4YJZL 2IFFL 4L4VA 4NYLA 4M7LT 4UOW0 2ZUTA 4BZ1L 1RVFL 2Z8WC 3EYFB 1A8JH 3MOBL 3NIFE 1YNKH 5JR1L 1ZLVK 1RI8A 2ZPKH 2NY4C 3K81A 3FTGB 1LEGA 3D6GA 1GZQB 1T4KB 4U3HA 5TQ2H 2JTDA 1HHKA 3BPOB 4YHPA 1TJHH 3FB7A 2P5WA 1S7SA 1MRFH 3BKML 4OLZH 4Y4FB 4B7LA 1J86A 3FFCB 4LFHG 4JAMB 3B4NA 1IGML 3SQBA 1AQKH 4ZPTB 5E8OA 3KLSA 3LKOA 3GIVB 1J5OL 5FM8A 5TH2B 3ES6A 3B9KA 2EIEA 1BFTA 4RNRA 1FVEB 3BT2H 3NAAL 4YDKH 1RD6A 1HILB 2I9LB 5JHDA 1PGRB 1U8PA 3MROB 4J3SA 1KTKE 4ACPA 3HS0A 3STZB 2I24N 2AP2A 2UZIL 1ZT1B 2E7LC 3OG6B 5C92A 1YEFH 1DR9A 1MH5A 3MZGB 1A21A 3KYNA 5ENWA 3TV3H 2DBLH 3X3GL 4ERSL 5FO8A 5F21B 3WUWG 5F6HI 4KAQH 5EBGA 1BF2A 1P7HL 3ARGB 2BSRB 1L0XA 4HC1A 4OCNC 5GRXG 1KULA 4ZFGH 1HQ4B 3ECBA 4K94H 1BJ1H 3RGVA 5FK9B 1F3JA 1OHQA 5F7LB 4N8VG 2XNAA 4JRYD 4Y16B 4OT1L 5FYKU 2NW3A 5CCKL 3CH1B 5E2WL 4ZUVB 3U7YL 3MXWL 4P46D 3CPLB 4PS4L 2JF1A 4YR6B 1RK1B 3WNOA 1QPXA 3MRPB 5DK2A 1S7QB 4OV5B 3KYOA 3QHZL 4XPFH 4OM1H 2Q8BL 1FJ1B 4EN3A 5DEFA 4YDIH 5IV2A 1F3JB 1TPXC 5JIIA 1T1YA 3QRFM 2C3VA 1R6VA 1RFDL 4L5FH 5CZXC 5D2NB 2FJFA 3QNXB 5KAQF 4RSVA 5IVOA 3ZL4H 4N90E 4J8RA 1V7NH 4UIKH 2UWEA 3H8NA 3BYYA 3B9KC 3HLAB 4O2EA 1TCMA 3ARWA 2OXGA 2YA2A 5MEPB 3CX5K 4GRLC 4UNUA 4F57L 3T2PA 2P8LA 3WV0A 3U6RA 4OZFH 4JAMA 5M95B 3DETC 3IDIB 5D7LE 5DJCB 1QFOA 3TNMB 3WE6A 3WFZA 35C8H 3MRDB 4PRID 4NQED 4U1HA 3QUMB 2AI0H 2MOVA 1JYNA 3C08L 1SHMA 3MRCB 3ARSA 2P24A 1IMHC 1ORSA 5IW1B 4JZNB 1B6UA 4A6YB 4F8TA 1N5YL 3HAEA 2P5WB 4WCYL 5D1ZC 3IJSA 2IWGA 1HHKB 4UT7H 4DKEH 1VERA 4DVBA 1OVZA 4OKDA 3KXFD 3AMLA 1UEMA 4PJBF 3LN4A 4GSDL 3ARDA 2F54B 4G6FD 3EYQD 5F7EH 1UZ8A 2FIKB 3RWJB 4Q97A 1ZKAA 1PFCA 1U9KA 3OGCB 3IS1X 1ZXQA 4FS0A 5DHVA 5F9OL 3S4SA 5MENA 3NCFB 4RFEA 5JLZB 5E2UL 3MRCA 3PWPE 1QA9A 4ODHH 1PLGL 5EBWB 4HIHA 2XWJB 3G6JF 4DOHB 2B1HH 4D8PB 1U36A 1QACA 4LPXA 1D5IH 1L6ZA 5EC1A 5D1QB 5D2LA 3H3BC 4EVNA 3ULUF 2VLKE 4POUB 4OGXH 1CXLA 1ZT7A 1CLZH 4FQXD 3T8XA 3D85A 8FABB 3TT1L 1Z6JT 4HUUB 4P4KB 2BY0A 1KIPB 3BEWB 2HKFH 2QADD 3BP6A 3FO0H 4U49A 4LAJH 4UIKL 5E5UB 3OX8B 3ULSB 1QR4A 2VLJE 5C6TH 3U6RB 1UWXK 2XTLA 2R56H 5DS8A 3T0VA 1MCKA 3V4PH 5DEFB 3QJHB 3VA6A 4U1KB 4EI6B 3K7UA 5IBUG 2EDTA 3QQ4B 2JK5B 2RFXB 5D6DC 5HHPB 1KTDA 4XVUD 5LAXA 1GYAA 5C2BH 4P99A 5HDLA 2VQ1A 4ZYKB 3IVKB 1CLOH 3QXDA 3S97C 1ZWIA 3BH8B 1E4XI 1GH7A 3L6FA 3TH3T 1NBYB 2AJSH 4KMLB 4PJBB 2JKXA 5F6HJ 1FSKC 3ECBB 4PJ9A 2Q1EA 3TBYA 1G9ML 4QF1B 3OKOA 1UM6L 1JGDA 2BVPA 3G6AA 4AG4H 2H1PH 3L9RA 5C6TL 1T3FB 3BZ4B 2CLZB 3F5WA 5CP3H 4Q9RH 3E3QC 4WNQA 5F97E 1BQLL 5FHAH 3UPAA 2EO9A 3IDNA 3PXJA 3KGRA 1INQA 4UAOC 5BV7H 4ZUUA 4IOIB 3A6CL 2PO6C 3GBML 3PWPB 3VG9C 5C2BL 1XF4A 2KPNA 5CD5C 3TT3L 2IBGA 3OTTA 4DN3H 4OZGB 4IM8A 1FZKB 4X4XB 2R2HA 5CILL 2XYCA 3QWQB 1KJVA 3WS3A 3MRHA 2R1WB 4RFNB 2V17H 2CDEA 3T2NH 1LE9A 4S0TD 3U1SH 4YXHL 4HKBB 3VXNB 5SWZA 3EHBC 1ACZA 2F15A 4NKMB 5DD0H 4CVXA 2ENYA 3O3BA 5I18L 5T1MB 1FNGA 2WLZA 3ARFD 1PY9A 5C6WH 3TPKA 4K7PH 1D7FA 4LHUD 4X6DE 4NRYA 4KY1H 4GKZA 4ZPTA 5E8OB 3V0VA 4NC1E 5TDNA 1A6TB 4EQ3A 4X7TA 4YDJA 2H9GB 2X7LA 3S6CA 4GUPB 4AEHL 2KBGA 3S35X 4Z18A 1JL8A 2AV7A 3NFPA 4QEGA 1AQDA 3V5HB 3EYFA 3DYPA 4QRPD 4NQEE 1CFNB 5D7IE 4NO2B 4U1JB 3T4AA 3CUPB 1AJ7H 4Q74A 1CE1L 5DRNA 3G5ZA 3HG1E 4KZDH 1KJ2L 3FOLB 4KI5D 5IVXF 1CLYL 1HIMH 1NL0H 3S3SA 4Z7NF 1CD1A 5A16A 5E8PA 4KROC 5SWSA 5JQ6L 4NNXB 2EC8A 4PRNA 3HRZB 4OAWA 5EN2B 2HFTA 4KKCD 1QSFE 2EXYD 3ZTNH 4LLAA 5KSAD 1LK3L 5E8EB 5TDOB 4R26L 3QUMH 3GHEL 2AABL 3L7EB 4AEIL 4I4WB 3MV8A 1T0NA 2PW2A 4U31A 4M43L 4Z6AT 2C1OB 4EQ2A 1XT5A 3OBAA 3QEHA 3EFDL 2VZVA 3GKZA 3IRZA 4G8GA 3OKDA 4D0BB 4JB9H 3NIGE 4XNXH 2WW8A 2G60H 4M00A 4Z7QF 2JB5L 5EA0H 4HPYH 2I9TB 1K4CA 1T3FA 5D7SL 4PG2A 3RDTD 3QUYB 3E1F1 1C16B 4QF1A 3WNNA 1SEQH 1VADA 2IC2A 2I9LA 3RZWA 5JHDB 4GW5A 4HDIA 2E7CA 5FOBA 1WLHA 4WHTB 5D1XC 3MYJA 1UZ6E 3DYOA 4N90D 3BGMB 1YJDH 1NCCL 3OSKA 2V2TB 5C86A 2LV4A 1JWSB 3TZVA 1UM4L 2HWZH 2GJJA 3QEQD 5GRZA 1AY1H 5SX4I 1MHCB 1CT8A 4MA8L 4U1KA 5I15L 4QXGL 3RZCD 2OP4H 2G60L 1S3KL 2AEWA 4KKLD 3WHE1 1TQCC 2HVJA 1EO5A 1T1WA 3MRGB 4DFHA 1FIGL 1B9ZA 3GMNA 5KVDL 4WGWB 2B2XH 3N1MC 5C09E 4YXKH 4UB0H 2R1WA 1NEZB 4ZUWB 2F53A 2YXMA 4NQDE 4HG4J 4XCEB 2GSGA 3MV9D 3R8QA 4HJ0C 1IGJA 4KHXL 4KI5C 1RULH 1IM3B 5HHOB 1JHTA 1OAUH 2B4CH 3B83A 3LAFA 4UMGA 3IU4H 1D9KA 1J0YA 5A2IH 5TQ0H 4OF8A 5BS0D 2A1WH 1T0PB 3PDGA 2CKBB 5DJYA 1A6ZB 4Z95L 4G8GB 1UQSA 3V8OA 5K9KA 3DX6A 1Z9MA 2Z31A 1EUTA 3P2TA 3VXOB 5L2KA 5EA0L 3PIQA 1A22B 5DGQA 1YPZE 1RURH 5EU6B 3W9EB 1HINL 1YEEH 3H3PH 3QUXD 4WEMB 2XFXB 3U82B 3WBDA 4NQVB 1TVDA 5KSAC 1C5BL 5ERWA 3F7QA 3T1FA 3AS0A 5F9WC 4A6YA 4MJIE 5JORB 4U1MB 2NXYB 3EDEA 3V5KB 4D0CA 4YEFA 2H3NA 1KJ3H 2KUTA 1DSFL 1K6QH 1A7NH 3SPVB 5HSFA 2VZSA 4BSWB 4EN3C 3SKOB 4O2FA 1DCLA 3VWJC 4ZD3H 4P48A 5IEHB 1NGQH 3HG1B 2WBJD 2ZCLL 4GKSA 1CE6A 4L4TA 3ULUH 5DJ8A 1E6OH 5CZVL 2A38A 1MCQA 3D9AL 1NAMH 4IJ3C 4XNZB 3VXSA 4K2UL 4RDQF 1JZ2A 2PKDA 4Y4HB 3O8XB 5D8JL 4LMQE 5HGHB 5KS9A 1TZHA 1KPRA 1NEUA 1UYWH 2Z92B 1NC2A 2BNRE 1QEWB 3T8XB 3DHMA 4JVUA 3DOSA 4FQCH 3OAZH 1OP5H 5IFAL 3MTRA 4GMSH 4DQOL 3O3DA 2BC4A 2EDOA 4J3UA 1F4XL 3L5IA 3ARFC 1GOHA 4Y4KC 1ZLVH 3FN0L 1IQDB 3O81A 2R0ZL 2D7OA 2P48B 3EHBD 4X5XA 4Y7MA 2X40A 4GKNA 5IWLA 1M05A 3TVMD 4P23A 4HIJA 3W9DA 4K71B 4YGVB 1P9MA 3EOAA 2QSQA 4LCWE 4OF6A 4X99B 4L8BA 1MCPL 3PWJB 3HUJB 2W65B 2EDNA 4OFIA 1IEAB 1EMTH 1E4KA 3TJHD 3QXDB 2VSCA 1UJTA 2CR3A 5JA8B 3LEVH 3CH8A 3REWA 5HYIA 1ES0A 3KNBA 2OZ4L 3HAEB 1G0YR 2YPKB 5F7HA 3SY0B 5JDJA 1FNEB 4HWBA 2ADGB 4BFEA 3MJ9A 5DMGD 5GJSL 3RWCA 1SM3H 1MHEB 3VXTB 1H3GA 3PGDB 2BNQB 4D9LH 3HZVA 3GSXB 3FRUA 1F90L 1MUJA 4E5XA 4QRUA 4XXCA 3E6FA 4AMKL 2BVOB 3SCMD 3ULUC 4IMLA 4I1NB 3QUYA 1AO7D 3BEWA 2HRLA 3QFJB 1QSEA 1PG7L 3QEGH 4OJFL 4JFZL 3LN5A 3I3BA 4RFEB 1RJYA 2OK0L 2L7UA 4PJEA 4NGHL 4RAHA 3BUTA 1OGAD 5L6YL 3DURB 1BOYA 4WUKL 4LRNL 1N3NB 4KUCD 4F58L 1XGQA 4EVNB 1NAMB 2OJZH 1FAIL 4QRPA 2EDQA 3MBXL 1S9XB 5EIVA 3RAJH 5D1ZD 5I1CH 2GT9B 2DTML 3NTCH 3X3FL 2GK0A 4UZGA 1F3DJ 5K9JL 2OTWB 2ZUUA 2XZQL 5DUBB 4YHLH 3SOBH 1N6QH 3TCXA 5T5FL 5ESQB 2OX5A 3MC0A 4ODXB 4E41D 5J12B 3SBWC 1GGIL 5JQHC 3ZL4L 4EXKA 4JANB 1TENA 3MBEA 3REVA 2N7AA 4JQVC 1B2WH 3ARDB 3FMGH 2J6EH 1W8NA 2GT9A 2AXJA 4L3EE 3HUJA 3D3VB 4PJIA 1F13A 1XGTA 3MRQA 3H0TA 1IT9L 2DS4A 3GEWB 4L3ED 3C08H 4G6AD 4KPHL 4XMLH 4X6DF 2DWDB 2FRGP 5ANMA 4O2EB 2E7HA 2CD0A 3HAEG 2RAMA 4OLWL 4QLRA 4I3RH 4WIQA 4HJGB 4WUUE 1R0AL 1B0WA 4ZOBA 4HK3N 3BPOC 4S1SH 2C7UA 2VC2H 3IJYA 1NGXA 5FV2A 3HZVB 5IV2B 1YEIH 2R23A 3CXDL 1FYTB 4UT7L 2GUOB 4PB9L 5DC9B 3KPNB 1U3HA 3AS1A 3O6LL 5ID1B 3C6SB 2ZG1A 3O8XA 1U8HA 4TSAL 1X4YA 1KLGA 5B3JE 3V52H 1LE5A 4NQVA 3AC0A 4OM0L 3GSQA 5DFVC 1LHZA 3CFJB 1A6AA 1PLGH 4GLRI 4NQSB 4I0CC 3FB8A 5F93C 5JA9A 1P6AB 1A02N 1JGEA 5E6YA 3L3IB 3RUGF 2A9ML 5DVOA 1T04A 1IBGL 1CVSC 3GJFA 5I1EL 4EUPG 5FDYA 5CGTA 1A7QL 4XPBH 1UKQA 3S3JA 5C07E 3L5HA 4LF3A 4OKVA 1CDGA 2XZQH 4HJJH 1AGCB 1H3VA 4YDVA 1KCVL 3EFFA 1NMCB 1UH2A 3LHPL 3ZZ1A 5CMAB 1D6EB 5C0AD 3SDAB 1DBML 3OAZK 5TE6L 4U6VL 1NUGA 1U8MA 2CJUH 5EU5B 1T04B 1UH4A 3PP4L 3S98A 1GXEA 3V4PL 1XCTA 1WBXB 2ICWB 1KIRA 2ADIA 3PV7A 4MA7L 4HMDA 3F7VA 4FQIL 5HGHA 1J0KA 4I48B 4NCDA 1CGSL 5TGBA 2CSPA 2DQDH 1TJHL 2EE3A 5T3XD 1T21A 3MXWH 4JO3H 5JW4N 2EDBA 3MQIA 2EECA 3RP1A 5IHUL 2OI9C 3MV7E 3PV6A 1RK0B 1AHWA 3G9AB 2J12B 3PHQA 3F6IA 4AY0A 3V5KA 3H2WA 3WFCH 1WT5A 3GGWB 3OZ9H 2O5XL 1PSKH 2GITA 4HXBH 3QWRA 4YLQT 2W0KA 3BGFC 3EO9H 3N0PB 3RI5K 4EUPA 4GBXA 3UP1A 5BS0E 1IC7L 4XNMA 1G7QB 1CK0H 1OWWA 4FABL 2CK2A 2G9HA 2YZ1A 5J4MA 1TIUA 2H1PL 4TUOA 2DN7A 3BIKB 5JPMB 2JCCB 2E6JA 5D1XA 4OD2A 1D9KD 3IAGC 2ADGA 4KDTA 4GRWE 1FO0H 4LVNB 4Q9BA 5JW4Q 4G8EB 3UTQB 3QUZA 4GO6B 4FFWC 4LHJB 2EE6A 1RUMH 4Y4KB 3HMWL 4X4YB 5A40E 2P47B 2BNQE 1AO7E 3T1WA 5D6CB 4L4VD 4PGEA 2VDKL 3VFPA 5I8KH 5CILH 4ZSOA 1WQVT 4YZFF 2VLJA 4DKFH 3VGGA 3KPSA 3S5LG 4P23B 1AGDB 3DO7B 1JHTB 4Z7VA 4EZMA 2VMFA 2VDRH 4DVRH 1S9YB 3DUSA 2HJFA 5IB1B 1FG9C 5INCA 5SX5H 2FO4B 3TYFB 4ZO8A 4QRRB 3CXHK 4MAYA 5KVGL 5C0DA 2ZUWA 5D2LE 1JYWA 5D1QC 3HG1A 1XR8A 2Z9TA 4XP1L 5T1LB 4NQCB 2QLVB 2UUDH 1QFWL 5E70A 2WQRA 4DGYH 1Q8MA 2A6DA 5CD3B 2J3SA 3U36A 4TSBH 3IKCB 1L0YA 1YMME 4PJHE 1R5VA 2VLRA 5EOTA 4E42A 3BD4A 5F3BB 4YDJB 2YWZA 2D7TH 1DUZB 5D6DA 4PJAB 1JN6B 2JJTA 2MQ3A 2APXA 2WWKT 2PXYA 2NY1D 2BNRB 1J11A 1XCQA 1XR9B 4LSUH 1FGVL 3WJJA 2EDHA 2F54D 2FJGB 2H2SC 4PJDB 2M1KA 4U1IB 3UC0L 3GMQA 4N0FB 4R26H 1Y6KR 4Z0BL 3HUJF 1ES0B 3DMMB 2AQ1A 5HHQA 5CJOH 4M7LH 4PJFB 5F1IA 2WSKA 3WKMH 5LKNA 4JB9L 1YYLH 1CXIA 4NN6C 2ED9A 3B3IB 2CKBA 3ZKNC 4YNYB 4YDLC 3PV6B 4K3GA 3MGOB 5CSZB 4L29A 2C1OA 4HS3B 2Y4SA 3MV8B 1YEJH 4K07A 4RAVB 4O5LH 3IU3B 4IIQA 3V79C 5ETUB 4MQSB 1GGUA 5J9PB 1JPSL 2ADFL 3FONB 3H9YA 4MJ4A 4FQJL 1NCWH 4G9FD 1I9JH 4OZGA 3TP4A 4RIRA 4BSJA 1I1FA 4KZDL 3BD5A 3LPGA 4IRSC 2DMBA 4UAOB 2FB4H 1RZFL 1N5AA 3PWPA 1G6RA 4WFGD 5E2TL 5HYSA 1BQSA 1B4JL 5EIIB 1I1AB 4X8JB 2Z4QB 3MCKA 5B38A 3BPNC 1KEMH 3GJFK 4HKJB 3VXQB 3DVIA 4IRSD 1HNFA 3C09C 4YHNA 2VKWA 3ULVF 4PRIA 2XOTA 1UGNA 3WDIA 3R0NA 3BDBA 1YEKL 2C3GA 3BN9D 3TA3D 1PX3A 1ADQA 4UB0L 1FFQA 2P45B 3U4BH 1OLZA 2BY2A 2XKNB 3UYRH 4UT9L 1KIQB 3G5XB 3KPQB 4WUUB 4N9OB 4QKXB 5IQ7L 3MRGA 1RIHL 4WFED 1BD2D 5C0NC 5DD5H 1QSED 3EJZD 2YN3A 1AD9A 4MQXD 3RL2B 1XEDA 4BFBD 4HMEA 1JHKL 4U7MA 2W59A 3C6SA 9CGTA 5CLTA 2NY0B 3WXWH 4JR9H 2V2TA 4JN1H 1FZKA 2BHYA 1SJEA 4EDXB 4DUXA 4ZTPL 5ID0B 2YK1H 4KRPC 4JZJB 5CD3A 4B7IA 5JW5B 4OQTH 5A43C 2PO6B 5GISH 2EEAA 3F62A 1CFVH 1SY6A 2NY5H 1RMFL 2OZ4A 1BBDH 5BMFH 1OSPL 3RWFA 1NQBA 1R5VB 4Q9RL 4GXUM 2NPLX 4FFWD 1JNNL 1K4CB 5DJYB 1G7IA 4QT5A 5ANMB 3MJ8A 2JJWA 4TN9A 4HXAH 2J88L 1RZJL 3PJSB 4XCNB 5J1AA 2EDYA 1CL7I 3T09A 3HNTL 4X80L 2FX8H 4LSSH 4R9HA 5BV7B 3DVGA 2YPVL 4JM2D 3DI3B 1R3JB 1UB5B 1H5BC 3GFUA 5D1QD 4LCUA 4KQ3H 3C2AH 3C5ZB 4KTEH 1MFEH 4G6JL 2BCKA 1U6AH 1CD1B 5A16B 1MY7A 4GH7B 4AL8H 2A1WL 2AV1A 4PJ5A 4H5SB 1YZZA 3QCVH 3UTSB 3QCTL 1NJ9A 3LKNA 4IRJB 3RIAK 3MOAL 4LQ1A 4P3DA 4HV8A 2EH8H 3L1OH 5E2VL 1HEZA 3C60B 3VRIA 5C9JB 5IFAH 4L9LB 3JTTA 4ZAKD 3IJSB 1NFDE 5FYKL 1SBSH 3UTPD 3P0GB 1C7TA 2BNUB 4PLJC 3TBWB 1Y6MR 1WGOA 3P9MB 5EFIB 4DN3L 4RFOH 3VD4A 4JY6A 4HUMB 3FQUA 3MV9E 3WXVH 2GIYA 2XT1B 1PKOA 2DQEH 5GZNC 1G7PB 2UWEF 4ZUSB 4A6YL 3PGFH 1KCKA 1WIOA 5CMAA 1NBVL 5CEZL 1RZKL 4D8PA 3DRTA 4KI5F 1OP9A 4NQDA 1AR1C 1I3GH 4PJCF 4RQQA 5FA3B 1T2JA 1F58L 2FZ3B 1RUAL 1JYXA 4HULB 4PJXB 2MMXA 4LP4A 1IFHH 4NM4H 2E6QA 2EIZA 4L4TE 2FX7L 5EULV 4DUWA 3SKNA 3HTLX 4OD3L 3UO1L 4ETYA 5ADPL 5BZDA 1DQTA 3EJJX 5IMLA 1HZHL 3QG7L 5IVXB 3L95A 4HD9A 1CS6A 1ED3A 2HFFA 3FAWA 5CJXA 4NUGH 1ORQB 3KPTA 4XB8A 3QXUA 2R1YA 4LF3B 3X17A 4ZYKA 1JI2A 3SDCA 5GS3A 4FQ1H 2MCPH 2FHCA 2ILLA 2X89A 5DJZB 4JJ5A 5KVEL 4W81A 3OJDA 4W4NA 1YNLH 2VXUL 5TQ0L 1QSZA 5HI3D 1BJMA 4G6KH 1YPZA 3VXPB 4LU5H 5IM7A 2XZCL 3BX7C 4YHIB 1LK3H 3E0GA 1VEPA 1EEQA 4MXWL 3FQNA 5AUMB 1U8HB 1T1ZB 5JNYB 4AM0B 1ZHBA 4XXDB 2VLRB 3GJFB 5EOTB 4PJCB 4J3XA 1I1CA 4M7JL 4BQ8A 1K2DB 2X4OB 1N6VA 5HDOA 1NCBL 2VZ1A 1OPGH 4XAKD 3MMEB 1T0MB 4LCIH 4W4OC 5IJKA 3I9GL 4M5YH 1UG9A 1LO2H 2P42B 3G6DH 3V6OC 4CDHA 4EJ1C 4AENA 4K3DL 3U83A 3DX8B 3PWLB 4IJ3B 5J3HC 1MCLA 5IB1A 3WL9B 1B6DA 3SGEH 2ZSVA 5KOMC 1KXVC 3P0YL 4XP6L 3GUTB 3P9WB 4O4YL 5JLZA 2I25N 2J8OA 1IKNA 4YZFE 1X5FA 2RBLA 4V1DD 5DHVB 1M6OB 5KW9H 2D7PA 3B8SA 5ESQA 3MRQB 3MLRH 4V1DE 5DZOA 2R1YB 3ARFB 1PYWB 3QXAB 3NACH 3JWDH 5E4EC 4ISVA 4F9LA 5DJ0A 4JANA 1UVQB 3O6FD 3GMLB 3VWKA 1TLKA 1HSBA 1NAKL 3MCLL 3UJTH 4M5YL 1J1PL 4YHOL 1N7MH 1UJ3A 3VFMA 5AEAA 2XWTB 4NN7B 1G9NC 4NQDB 2GJ6D 4M6NL 1SYSB 4AH2B 4KHXH 2CPCA 4DOHE 3ULUD 5EZJA 1QRNE 3TO4C 4DCQB 1UKSA 2R29H 4XNZC 1PEWA 4LCYB 1NFDB 4HCRH 4CVZA 1LP9E 2CLRA 2IFGA 5DMGC 1IAMA 2EH7L 3OKKB 4I0PB 1MHEA 3T77A 3U7YH 3RVUC 2DKMA 5FHBH 3QIUD 5BW7C 3CMGA 5JDSB 2ED8A 3TH2T 5C0BD 2OZ4H 1KJ2B 1N3NA 4XPFL 2YUWA 5CUSL 4NQDD 2FBOJ 3EJYD 3VDCA 4M3JA 1B88A 4QCIB 1N0XL 5HPMA 5ISZD 3IDJA 2BY3A 4R4FL 4KZEH 3LZFH 4AMKH 4PRHE 1CXHA 3QIBD 3VXMD 2WANA 2M26A 4FA8A 4XNYL 4FQIH 5J13B 1P4IL 2V7HB 4FOMA 5K9QI 3FQXB 1GZPA 4QRSA 4AEFA 3R4DA 1QA9B 2P5WD 1AC6A 3BW9A 5FK9A 4FG6C 1JGUH 3TN0D 4HDIB 3INUL 4JFFB 2DMKA 1I7TA 4KK5C 4A2LA 2A77L 1WAAF 5C0CE 15C8L 3P9LB 3CU1A 2OTUA 5F88A 3QEUA 3U46A 4P9MH 1FN4B 2A73B 3H9SD 1DUYB 3BP5A 5SWQA 1HK6A 4L8DA 4HXBL 1UEYA 4UQ3B 1QQDA 3JWOL 3NFNB 3MLWH 3MLSL 3WUWB 4W6XB 5T3ZL 5H35A 4XP4L 1BQHA 4NDMA 4PREA 3I84A 1YNTB 1RZ8A 1OGAA 1RZGB 2AEPH 2WBJA 4L4TD 4F3FB 1SM3L 3U7AA 2Y72A 5ID0A 1QEWA 2R0ZH 4PFEA 1ZHBB 3SDDB 5EPMA 4NZJA 1F2XK 3UTZA 1A0QL 3SE3C 3MA9L 2GQHA 4P2OC 15C8H 5GRYA 3W9EA 1CFNA 2VNCA 1MQKL 3SKOA 1J1OH 1A6PA 3CFEA 1MPAH 3SE8L 1FZJA 3H42H 5EC2B 4LLMA 2YOCA 3HMXL 4OD1H 5EFIA 5BVJB 2VDKH 5MERA 1ZGLP 2R4RH 3SDCB 5IVZB 5DJ8B 2FJFB 1AXIB 1FL5B 2WINB 4ZS6D 5EBMA 3L3HA 5TF1L 1F42A 2DJSA 4XCFH 2X09A 2Y9RT 3QIBB 2AEQL 5FO9B 3SPVA 5FYLL 4NJAH 5HHXL 2WBJC 2HT2D 3C5SA 4Y5YC 5IVNA 1O7SA 3U9PL 2X4PA 2O5XH 3VFTA 4MMZC 4IMKA 3CNKA 3GSVB 2AJYH 5GGTA 5L2KB 1HN1A 1MLCB 3RY6A 4TTGA 4OIIL 4DK3A 4OIAA 3HI5H 1D5MB 1A3LL 2J6EL 3MR9B 5F9JB 4ZFOL 1Q94A 2Q7YA 4X6DA 3VH8A 1MAML 1MJ8H 4FRWA 1NGWA 2AJZB 4F3FA 1Q1JL 3WNPA 4YPGB 4DN4L 1D9KB 1E28B 3GSOB 2OCFD 4Y5XB 3QISA 4N5EC 1SEBA 1CDIA 5F7YC 3VRJB 4WWKB 1G9EA 3QULB 2XG5A 4DFIA 5IR1B 5GXBB 4FZEH 5E6IC 3SDXA 5TE7L 1KB5B 4FNLH 5I9QC 5EG6C 3TN0B 1C12B 3G6AB 2LU3A 2Q87A 1QD0A 5L88H 1IC4H 5F1SA 1BJ8A 5D1XD 2M8XA 4F37K 1U2HA 2BNQA 1XCQB 3WSQH 2AAVA 1MFAH 4TUOB 3B43A 4GG8A 4GAGL 2B2XL 3IYLW 4DKDC 3JV4B 1JP5A 3GMQB 3RWGB 2R0KL 1MREL 2W9EL 2I5YL 3NA4A 4LCWD 4PJCE 4FXKA 4ONFL 3WLBB 1QRNB 1QBAA 4KKBC 4KQ4H 4MQ7B 3ARBD 3FO2B 1QOKA 4ODBD 1AE6L 1LNUB 1U8NA 3P3YA 2BOCA 4D3CL 4KKLC 3WO4C 4XRCB 1DBAH 4I4WA 2D7TL 4M93C 3RZCC 1BGXL 4DWHA 1QR1A 5FOJA 2IANE 5GRUL 4LNRB 4KROD 4WO4A 3DUHA 2CUHA 5INCB 4Z78B 2MCG1 3DXAD 4I0PA 4R8WL 4CMMA 5DRXA 3QEHB 4RZCB 4DK6A 4HZLB 3MJ7A 1A9EA 4LVEA 4ZSOE 3GSVA 5EC1B 5LGJB 1DP0A 2YEZB 2Q7YB 1C12A 4MNGE 3U4BL 4H88L 1I1RA 2DM4A 2HJFB 1U3HD 1U8LB 5CBAB 1D5MA 3ZDXE 3G9VA 1CGXA 5IG7B 2ENSA 1CR9H 1QYGH 1ZA6A 1JTTA 3UJJH 4H0IA 5TDNB 5IWLC 2PYEB 4OGYH 4F33A 1N64L 1MRCH 1EA9C 1QBMH 3MR9A 1R5WA 2X41A 5F9JA 1D3CA 2JELH 4ALAH 3QPXH 1H9VA 4LGRB 3UTTD 5L88L 3RGVD 5D96C 5GHWH 1E6OL 2XTJE 5DD0L 3RUGB 4JRYA 1OM3L 4Y88A 4HWUA 1YEHL 2MPAH 4N8CH 4PRIB 3R8BB 2XFXA 4J23A 5B39A 1MFAL 4PRDA 1HHGB 4KY1L 1A5FH 3QCUL 3JWOC 4RRPG 3GM8A 5HTSA 1NPUA 3PP3K 4PJHA 3R1GH 1A3QA 2CRMA 3E6HA 1DQJB 1FDLL 1SEQL 4HLZG 4KXZI 2VSDA 3S34H 3LQMA 2CDEB 2NNAB 1A4KB 4HBQA 4AEHH 3P0VL 5CEZE 1DN2A 4G7VH 3VCLB 3VW3H 2I60H 4MS8D 1GSMA 3D25B 3MRMA 1MFBH 1GGBL 2GTWB 3T0XA 5ESVB 4FG6D 1DL7L 4ZS7H 5HYSB 5I6XC 1HYSC 3U1SL 4PRHB 3X12A 1T1XA 4X6DB 3VH8B 4RZCA 4LDEB 1AGCA 3BP4A 1YPZB 2OTUB 1E6JL 3SO5A 4WO4B 3IDMA 5GISL 5E6IB 3VI3E 3OL2A 3BZ4A 3FCTB 5SX5K 3HE7D 2EYTB 4MX7A 1PQZB 1OGTA 4J3OC 2AK1L 1W72L 5DVNA 4ZUUB 4JQIL 3GI8L 4IDJH 4YNYA 5DHXB 3DBXA 2PO6D 3ZSTA 3C5JA 4DGIH 2PUQT 2BNQD 2W91A 3GKWH 3RVUD 1JF6A 1FO0B 1A9BB 3W2DL 3PHOB 5IW6A 3ZT7A 1YYML 4GAJH 4A6YH 4CGTA 4G80A 4KVCL 4PJBA 2EE9A 2BNRA 1X5KA 5D93B 5I1GH 2V7HA 4FQ2L 3O0RL 3TN0C 1QRND 2VL5B 4RAUB 3WHXB 2C7UB 3UTSE 4M7KL 3BP6B 2P7TA 3VXRB 2KZ1B 1B0RA 4JHWL 2AK4E 3UTSD 1BIIA 4OQ1A 5FB8A 1YEGH 3OWEA 1BWWA 3NIFF 5F72S 3ES6B 1DBBL 2CKBL 1ZHKB 3CSBA 4JREC 5T1LA 5LQBH 2HT4D 4ONGH 12E8H 1LVEA 4NWUH 2OR9H 5D1QA 1I1AD 4LLWB 1ZVSA 5FA4A 3U48A 2NY2B 1RHHB 3FN3A 3DX9A 3P4MB 2QQNH 4JM2F 4X0KB 1KN2H 4OLVL 4ZPVA 3O6KL 2ZCLH 1F4WL 4PRNB 3QIUC 3ZKMC 1NUFA 1AGDA 3DO7A 3JTSA 4ELKA 2AV1B 4PJ5B 5EZLB 1ZGLB 5FGSA 4W70A 2CLRB 5IMKB 1ORSB 3OGCA 4YHML 4WJ5A 5GGTH 5AZEH 1UYWL 4J3VA 2YUVA 5E6IA 3T0WA 5C0EB 4GG6B 4GRMB 5FO9A 5J57B 1RHHA 1I8MB 3GO1H 5MEOA 5I16B 5AG8A 1YUHB 5IVZA 5B3JF 3GMOA 3UO1H 1AFVH 4OLUH 4LSSL 3BZEA 3NGBC 1JK8B 1K8DB 2AVGA 2IPUG 4GKOA 1FE8L 2DBLL 4RGNB 4TUKH 2QKIA 3B2VH 3ULVL 4PB0H 2KQMA 5KVFL 4RFNC 3CFJA 4Y4HA 3EYQC 4ELMB 1HNGA 1LE5B 2Q3AA 4Q9CA 1KFAL 3W39B 4CVUA 4ZFGL 5IEHA 2X4TA 3B9EA 4H26A 4PJEB 5ELIA 5H2BB 3GK8L 3O2DH 3TIEB 3W5MA 5TFSH 4NBXB 1X7QA 2AKRA 2X70B 3ZHKA 4LGPB 2VLKA 4Z8FH 1DDHB 4GOSA 1NGXB 2I07B 3SY0A 4PRPD 1O5DT 3CFCL 4NDMB 1NAKH 3MCLH 4PREB 1A9BA 4ODWB 4M93B 3I2CH 1CFSB 3GBLA 4NN5C 2ZP0T 5TGBB 3L3KB 5DRZA 3STLB 1OAZH 3QEQB 1RIVL 5BRZB 3CVHH 4JPIB 2VZ3A 1MWAH 1XCTB 12E8L 1EZVX 1RPQA 4NWUL 3VU2A 3DO3A 5GJTH 3O3UN 5EU5A 1QHOA 3SKNB 1P7KB 4P2QE 3LEYL 1X9QA 4FQLL 1XGYH 3L3IA 1AKJD 3C60C 1MCJA 1ZOXA 4NHUA 2XN9B 3BPCB 4J4PA 4IHOB 5CZXD 4QTIL 4F58H 5CLWA 1BD2B 4NFBA 3S3PA 1I9IL 5FDWA 2WV3A 4WUUD 4J12A 4OD3H 1SBBA 3ROOB 2NW2B 5I66B 4Q6IC 4JPIA 2LABA 1F45A 4JFFD 1DVFB 2HJKB 2X44D 5DK0A 3ZE2F 4YO0A 4P4RB 4H26B 1A6AB 5GZOD 3T3ME 2EYSB 3FB7B 4RA0C 4XRCA 1BAFH 4Y2OA 3AM8A 5JHLL 4KK9C 4RMVA 3ARBA 1XF2A 1FVEA 4BSWA 3FN0H 1NH6A 5C0JA 4P0DA 2ZPKL 2X4OA 8FABA 3O2DA 2CUMA 5ENWB 1MFEL 3VXSB 3EIFA 2W1NA 5GGRY 1EHNA 4TSCL 5GSVB 3HMWH 4BQ9A 2W92A 3QPQD 2YXFA 1TQCB 2HFEB 4FMKA 5CBEB 1BHGA 2F5AH 4AT6B 3FB5B 2P8PB 3WLWD 4HGWB 3JWOH 3BHBA 4KTDL 1NCDH 4JKKA 3MLSH 3VFRB 5BW7A 3MV01 3GIZL 3MLYH 4A2MA 3TZVD 5J7CC 2OR7A 4LAQH 4QHNA 4LSQL 3KYKH 4PP1C 4F33B 3MBEB 1Q9LB 5DZLA 3LKPB 1DBKL 3MRIA 3DURA 3V5DB 4JRXE 3S96A 1T0NB 3UX9B 5F89B 1A1OB 1MQKH 3PG2A 4RDQG 4JFPA 3WN5B 3T08A 4X6CA 4RCAA 2CLVB 3BZFB 3TJEH 5EN2A 5D7KD 4PGCA 4FTVE 5C0ND 3MODH 1FFPB 1KTLB 1MHHA 3TEUA 4C56A 5J1AB 2P8LB 3RJQB 3PGCB 4WTZG 4ZO6A 1T2QH 3BPLC 1QRNA 3W11C 4G80B 4LNRA 2P5WE 3EBAA 1NSNH 4NZDA 1KGCD 3O2WH 4XWOC 1IKNC 3VMNA 4X7EC 2J8HA 1AP2A 4XXCC 3WHXA 4E5XB 2D0GA 4HGWA 1A6WL 3AREB 3P0YH 1GVIA 4XP6H 1RVFH 4EN3B 3OR7A 2H3NB 1RU9L 2QQQA 1VHPA 1EAPA 4I2XA 5C0GA 1LGVA 2V7NA 1Q1JH 4WHYG 4NO0B 5SWZB 4WI3A 3BE1L 4POYA 1U42A 1FO0A 2ARWA 2OL3A 4K2UH 3VXRD 1INEH 1WSST 3GBNH 2YD9A 3B9AA 4P2RA 4MNQB 4NFCA 3C5JB 1N6UA 5J13C 1YMHB 1IQDA 2Z4QA 3MCKB 1P7QB 4QWWD 4ZOEA 2QADB 2BXYA 1IC4L 3ARPA 4MQXC 3ME0A 1PX4A 4QWWC 4XC3L 1A7QH 4PRIE 1FL3B 2YHGA 1VGEH 4KH2A 3S36X 3WUWA 2GTWA 2DM7A 4K3DH 4WHCA 3BWUC 5KN5B 3HPJB 4G42B 2XN9E 1J0HA 5DSCA 3MLTB 5D7IF 4N0CC 1TNNA 4S1QL 4OZ4A 1KIRB 3MJ9L 2XZAH 1RU9H 2NW2A 4HUWA 1CE6B 1YEDB 3NN8A 3TC9A 5KW9L 2HFGL 2YMXH 3T0EB 3L7EA 5E4IA 4NRXA 3BUYB 5D5MA 2DLGA 2NCMA 5J0BA 3PQYE 4OT1H 1RJZA 2XXCB 1J8HD 4QXWA 1MJUH 5EU3A 3VXMA 1WWCA 5JXEA 5GQBA 3GDBA 3FFCA 1FL5A 1FYTD 4TYUA 2NNAA 1BLNB 3C2SA 1CLZL 1LEGB 1N59A 1KTRL 4CW1A 4U6TA 1WWAX 3UPCA 1EPFA 1AQDB 3V5HA 4QCIA 1FZJB 1A1NA 1S9VA 5JW4R 4PD4K 4X7SL 4M5ZL 5EUOA 4JPWL 5IB5B 2IANB 1S7TB 3V0AC 3U30C 3IDYB 1EEUA 4L3EB 3F12B 3ARQA 4ZOAA 1FQ9C 1QSFD 3P4OB 1UB5A 2H2SD 2HTLC 5TDPB 4Y5YB 3LS5H 1DUZA 1QLEL 3MLVH 2NY1C 4P23C 4AEEA 3HB3C 3DIFB 2DL9A 4HC1H 4KJYB 1I1FB 1OT2A 2LTQB 3KR3H 4J7RA 3IDNB 4OFPA 2D2OA 4E41B 4PJGB 2NMSA 3DUUA 4ZUWA 1X5HA 1DE4B 3C5ZD 5DA4A 2WBWB 3QZWG 1NFDF 4NC2B 1QR1B 3WLWC 1IM9A 2ICWJ 4XP4H 4TOYL 3ZKXC 4C56D 2ZUSA 5K59F 3BRDA 1D9KC 3G6JB 1IC5L 3QWRD 5B39G 4FABH 3ZHDA 4YE4L 2YD8A 2R1XB 5EU4B 5I30H 1U41A 1DVFC 4K3EL 4NJ9H 3PNWB 1T03L 2JJUA 2UWEE 3TCLB 2Z91B 1GGCH 5DHVH 1ZSDA 4QTHB 1BEYL 4ESKA 4Y4HD 5GPRA 5D72L 1VFOA 2IH3A 4KI5E 3WN5C 2GJZA 4NOFA 1X5AA 3FQXA 2FGZA 3O4OB 4QRSB 1T1WB 3O41B 3I6GB 4N9GB 2XWBA 4BH8A 1XF1A 5JMOC 2ATPA 4QYOB 4HS8H 1F2QA 1C16A 5EO1B 3BQUC 4PD4J 5EBLB 1U8IA 3GGWA 2IF7A 4JO1H 1EHXA 4NN6B 1M1SA 5BVPL 5HPMB 4OB5L 4OCSL 1QSVA 2XV6B 1BREA 4JLRB 3SE9H 1A6UH 1AIFA 4OD2B 1DVFA 3KJ6L 4YX2H 1ZHNA 1HXMA 3GM0A 3QHFL 1A1MA 1YDPB 4IS6A 4NM4L 1JPTL 2HKHL 1WZKA 3QRGH 4CVXB 1NBZB 1MCHA 1W72H 3G5YB 5IBUB 5KBNC 1DN0B 4LCWB 4NUJB 2EYSA 4ODUA 4QGTA 4JFHE 3N06B 4RGMB 4DCQA 3OAYH 3CDYA 3WNLA 4Y4FD 3OJMB 4ORZC 2NXZD 4OFVA 5HHMB 4PRAA 1TCRA 2FX9L 4LSPH 2LU4A 5B21A 2G75A 3HHRB 3P77A 4MB3A 4K3JL 3Q2CA 3HNSH 5FECB 5IW6B 3RI5F 5C08A 3CH1A 2HVKA 1W0WB 5GRUH 2XWJA 1I9JL 2XNAB 3LN4B 1VFUA 1BMGA 5K93A 2F74B 1F6AB 2IAND 3MFGB 4KRNA 3VG0L 1TETL 3GSNA 3S4SB 2BVQB 1CFVL 3HI1B 1JYVA 1I9RL 5FGRA 5FCUL 4QRTB 4Y19E 5I1KL 4JFEE 4PV9A 1HWGB 1V3JA 4NP4L 3EUUA 2FSEA 3L3JA 3QIWC 2ITCA 2FHBA 2P43B 4M6AA 4ELME 1ZK9A 1HYRC 2YC1A 4CDGC 3OR6B 4GAGH 3DX8A 2DQTH 3WS6A 3PF2A 1EEYB 3SJVD 3GHBH 2NTFB 4JO3L 3UTZB 1ZHLA 5ITBL 1CI5A 2EDLA 3FT2A 3MRKA 4P5TB 2WK2A 1ACYH 4KHTH 5DEGA 5C7XL 4GKZB 5DD5L 3V0WH 4GAFB 1IGYA 3MLUL 3CDGB 5IFJA 1AE6H 2XY2A 3HLAA 3PWPD 1MEXL 1KT2B 1HCFX 1NGPH 1Q0YH 1Q72L 2IADA 2UWEB 1Z0MA 2A6KB 2W07A 4P2OA 2J7LA 4PG9A 3RZCA 5DJAA 3R06B 4RMQA 4P57A 1T7XA 1JPGA 5AZ2L 2OR8A 4UINH 4U6YA 4DAGL 1QFUH 4C55A 1FIGH 1FRGL 2F53E 4F2MB 1KB5L 5I8CA 5ICZA 4TVSa 5DC0A 3U9UA 1RZGA 1RK1A 5IMKA 2DKSA 4PJIB 5DI8B 1BZ7A 3D0LB 5T5NG 1PZUB 3L6FB 3EYOB 4ZSOB 4JQXC 1GZPB 1H3PH 4LCUB 4P9HH 3S35H 2NY6B 4KQ4L 5I8EB 4PV9B 3VFNA 1HQ4A 4K3JH 5C08B 5FYJH 1A7BA 2BFVL 4G6AC 5FO7B 2EH7H 1BZ9A 4OZIB 2VXSL 4FFYH 1I3GL 3UBXB 2FIKA 3CFKB 4JKLA 1J05B 1BF8A 5D1XB 4QT5B 3M07A 4J2XA 1KCUH 4H1LA 3BSZH 1IFHL 4G9FB 1RJLB 1HH9A 2Z8RA 2AK1H 4P4KA 1HH6A 3CFBB 3DYMA 3NA9L 2W9DH 1FFRA 5EBLA 4DGIL 3S35L 5FYKH 3G5VB 3ULSA 3QDJE 1WAAE 4FQQA 2IBBA 2PW1A 3W2DH 5JXAL 3RJDA 2HLAB 2FDBP 1YDPA 1KIPA 3MUJA 4YUEH 5CZKA 4TUKL 4UIMB 1IVLA 3ULVH 4YBLB 3AS3A 1MNUL 1Q0YL 1Q72H 1XMWA 2ZG2A 1UJ3B 3KPMB 4UILL 4UTBL 2P4AB 2BHUA 4XNUL 4Y4FA 1ETZB 2XICA 5ECJE 4LVHB 4JO4H 1BBJA 3M45A 2DIBA 4LVOC 4PP2B 3ZT6A 1I3RA 4QYOA 1F3DH 1CFTB 1ZEAL 1IAOA 1NGYB 5DJ6A 5IMOB 5FUOH 3MV8E 3RVXD 1KF9B 3GJEA 5LBSH 1KXTB 5C0CD 2DMCA 2VISA 1ULVA 4LL9A 1JPFB 3VFMB 4UU9A 1PQZA 3BKCH 2IG2H 3U9UB 2P24B 2UZIH 1UT9A 2PTTA 1IRAY 3LPWA 1DBJL 1EJ6A 3NZHL 2E27H 3RUGE 1TZHB 4F80A 3D2UD 3KPRE 4DVBB 4Z9KB 3VWJD 3TJHC 4FQLH 5F7UA 1MCPH 1WBYB 4HIXL 2ATKB 2XI9A 4MJIB 2A6IB 2APFA 3ARUA 4CMHB 5DZNA 1WT5C 5SV4A 2ZWLT 3B3IA 4K7PL 4QRQB 4E41A 4OUUA 3QEQE 1PG7W 4RGNC 1CTNA 1EEZA 3I3EA 1CTOA 1NCDL 5EU6E 2A6JB 3HN3A 2YS4A 3AM8C 1QSFA 4NQCD 5INDB 3X14A 4Y4KD 1R5WB 1WFNA 4NBYB 2JB6B 4IDJL 4PJ5D 5HI5D 1CGVA 4MD4A 3LS4L 1OQOA 3HE7A 1RUKH 4R2GD 4LLQA 1DBKH 1X5LA 1IJ9A 5F9WB 1EXUA 3K1KC 3MYZA 4N68A 1U3HC 1MOEA 2XG4A 4IRZH 2VLLA 3KWWB 3EYUH 3WXWL 5TPWH 5DJ2A 3ROLA 5BJTA 5ESAB 3IRPX 1K6QL 2E7BA 4GT7A 2GJ6B 3BD3A 3CGTA 5HVGB 4UUJB 1BP3B 4HUWB 2VLME 3TBVB 3NN8B 1ZEAH 1P2CB 1S5IH 2LFGA 3W82A 5DJXA 1O7VA 1A47A 2PR4L 1I8LC 4TRPH 5IP4A 1QNZH 4GRWF 4GG6E 5IVXA 4JPKH 1GGIH 4Z7VF 4WRLA 2BDNH 1L9NA 4X4ME 2EDRA 1GHFL 3NABL 4NIKB 2EIDA 2ID5A 3IDUA 1NC2B 3G6JE 4PJ8B 1OWRM 2O5YH 3JV6A 4QOKD 1VENA 1XGPA 2ZCHH 3B5HA 1P2CA 5I1IL 5HGBB 3P9LA 5HHQB 1MHPH 5TF0A 4HF5L 4PTTB 1NLDL 4NO0A 1PAMA 5IK3A 4DW2H 4G43A 5I74C 4YWGH 2VABA 3BISA 1WEJL 3AREA 4W6YB 4HV8B 4X9IA 1AKJA 5I1DB 4GRLB 4QO1A 2GYSA 4GW5B 1MVUA 2VC2L 4YHKL 3QFJD 3T0BA 3W0WD 4XBGB 5CIPB 2JCCF 5CEZD 3AU1A 1T2QL 1ZA3B 4HFUL 1PDKA 2A6DB 4KAQL 3CAFA 3I6KA 1IGTA 4WFHD 1F6LL 1BD2E 1NFIB 2D7QA 3MJ9H 3O45B 4KRMB 2FR4A 3K2UH 4AJ0A 4MJ5A 2EXYC 4XMPL 5DUPH 4APQD 1G7HA 4JFXA 2BXZA 1HDMA 4Q0XL 5CBAA 1I1YA 1U95A 4I48A 2NYYD 3KLDA 3B9DA 5DMKB 4GBXD 1WEJH 1S7RA 4Q6IA 3H42L 3VRJA 3OHXA 1UWEH 1EBAA 3VFOA 1XGRB 1PBYA 5CJBA 3VWKC 2G5BB 4QXUL 1E4KC 3VFTB 1FVCB 5I1CL 1I7UA 2VITA 2FGWL 2W0FB 1EBPA 3DNKA 5CP7B 1NMCC 2XKSA 3RDTC 5IESL 1I4FA 2EXWD 1YNLL 3LDBB 5HPOA 4NZRL 4Z7UF 5L8KB 1OD7A 1EFXB 5M7QA 4J3TA 2XZCH 3RBSA 3GMRB 3ARFA 1WC7A 3WIIL 5I1AB 1M7DA 3EDKA 4K7PY 5E95B 1JF5A 5ERWB 4GRLA 5FXCH 3BZDA 5CD5D 1DJSA 2JCCA 2V9TA 3JV5A 4OD1L 4HWEL 4TOYH 1AD0B 4FQHA 3NAAH 4QHMB 3RVTD 1L7TL 1IEHA 4G8FA 2P5EE 4P4RA 3KYKL 2VAAA 1DLFL 4BK4A 1XZ0A 5DK0B 3CFBA 3VGBA 4TVPE 5HI4C 4F7EA 4WWKA 1FO0L 5GGVY 4H8WL 5IVXE 1NGZB 3D0VB 4WU5A 4LSDA 3VMPA 1N4XL 4NM8H 1KIUA 2Z35A 1A0QH 4H1LB 5E8NB 3LH2H 2C3VB 1CL7L 5HHOA 1H15A 1JBJA 2XN9A 5J8OA 5I9QB 2VLLB 3KWWA 4XVUC 4Y1AD 1Q9OB 2DIAA 2NY7H 1F5WA 3V8CA 3LQZA 4OBRA 3AXLA 5AYUH 5ANME 3NIGF 4Z7QE 4OBSA 4E41E 3QAZC 1NBYA 4AQ1B 3IAQA 1UC6A 3RU8L 3MLXL 3CZJA 1CFQB 2BERA 2VIRA 1Z5LB 4JO2H 4IHOA 3KVQA 4LLUA 1DLFH 4QRRE 2B7DT 2AEQH 3ROLB 4L1DA 4MXQD 3RWEA 5HVFB 1YY8B 1CIUA 5TE6H 4WU7B 1J0IA 4JKPL 3MXVL 4KWUA 3NIDE 5KSUB 1R24B 3HC3H 1MFCL 1EEZB 4I8DA 5MI0C 2D0FA 1A6TA 4WFEE 4JRXB 5DQDL 4JFYA 1UZ6F 5J6HA 4LDLB 5KOVC 4TVPL 5I1LA 1Z9SA 4XP5H 5DS8B 3NZ8B 2FX9H 4WW2C 4RQQB 2DQGL 4ZFOB 1E4WH 2B1HL 1QYGL 3FFCE 4H25A 1ZLUK 3W39A 3A6CH 1F97A 1KLGB 1B0GA 3TO4D 4MAYB 4Z0XB 1AGEA 1KJMA 1U3HB 2VXVH 3M17A 5EU7E 1X7QB 3BZFA 1IM9D 2UY7A 1OD9A 3TT1H 1GL4B 4HWBL 5JOPE 4DZBB 1OAYL 5EO0B 2YKLL 25C8L 3LVEA 1UA6H 4HUVB 3WKML 4MLIA 3T0DA 1B90A 1BQLH 1XGUB 5CIPH 5F7EL 3Q5YA 1FN4A 1G7JB 4ISVB 1I3RB 5IHZA 2WLYA 4XCCH 3T3PE 1J0JA 5DR5L 1UCTA 3VFRA 4LVNC 3LKSB 5SWSE 2MQCA 5FKAB 5J3HD 3M8OH 4OF3A 1BQHG 1INEL 4UIMA 1LILA 4Q9QH 3A6BL 5D7LD 1DQMH 3AB0B 3IVKA 4JZOA 5D7JD 1RUPL 4EIZC 4I3RL 5F7DA 5J89A 3DETD 2AJ3B 4HQQH 3BN3B 3MACH 2N7BA 3UTQA 2FCBA 3QT2A 3FN9A 1ETZA 2HH0L 3DXAA 1YPZF 3B9KD 1MRCL 5TFSL 2VL4A 1FFOB 2DKUA 1RJYB 3CXDH 4X7SH 3AGVA 1G7MA 1KB5H 1UXWB 4DAGH 5SWZE 1CDJA 4Z7WB 5KS9B 3O4OC 2ZCKH 7FABL 4XWGH 2XZAL 2VAJA 1A7RL 1P84J 2BOBB 2ZJSL 2ZZUT 5HHVH 4P2OB 2D03L 5JW4M 1QFWH 4DGYL 4PPTA 3V52L 4KV5F 3MRFA 3GSXA 3RNQA 5IF0B 2D9QB 3WFDH 4O9HL 1FZOA 2YRLA 1UXSA 3VXPA 1LP9A 1KOAA 3OKKA 5BRZE 2CH8A 1Y0LA 4X7FC 2E8YA 4M6MH 3QNZA 1KJMB 2FEEL 3DARA 5JORA 1QRKA 2VE6A 3MACL 4QHLA 5DQ9B 3CK0H 2CDGA 3MUGB 4R3SA 1TVHA 2H8PB 3W0WB 2YD1A 3BDXA 3EOTL 4M6OL 4N9GA 5DMIL 4MDJB 5DTFA 4LQFH 3ZE2E 2SEBB 4MJ6B 4YDIL 3UC0H 2V2WB 5IGXL 4Z7VE 1JVKA 1EO8H 4I18C 1U92B 1JGDB 1KPUB 2X4NB 4M02A 1MF2H 4HS6B 3FRPG 1Z9LA 1UKTA 4M1GL 1JUFB 4X83A 3BRGC 1JGEB 3THML 3T4YB 1KB9K 4NT6A 1WIUA 1NCTA 2VLRE 2DDQH 3N9GL 5CP3A 5GZND 4GW4B 2FHFA 4ZFFB 4M6ML 4F7TA 2EDFA 4ONGL 2EIZB 5DJDB 3ARGA 4FTVD 1WZLA 5FFLA 3PDOB 3FQRB 5C0CB 4F7EB 1J8HE 4M61A 1NDMA 4PLJD 4JY6B 1YJDC 5C0AB 3TIEA 4YHYC 2GSGB 4HQQL 4QRRD 3ARXA 4WTZA 3MRFB 4P46C 2X4TB 3GHEH 5B4MD 1DLHB 4UI2A 1V7ML 2ZUQC 4JKMA 3SDDD 3E6HB 4NO5B 2Y6SD 1R3HA 1MLBA 5MEQA 4XNXL 4PJHB 4JREB 5MEPA 3C09B 3SE4A 3D85B 1HHGA 1GC1L 2WZPD 4KRPB 1WFTA 2FBJL 4MA3B 4KC3B 1LP9F 2FATH 4I5BA 2F53D 1T5WA 3MV9A 4MSWA 1FH5L 5D9SB 2VDNH 1TDQA 4JG0H 4Z7OE 1RUML 2ICEB 2FJGA 5C9JA 1ZS8B 3VXRE 3JBG7 4RGOH 1K8IA 5LQBL 2N56A 2P5EB 4ZXBC 2PYEA 4FQXB 4XH2B 1JE6A 3SQOH 5F7MC 2XRAL 3OJDB 5FUZH 1P4LB 3QA3B 2R2EB 4KUCF 1M7DB 4LEXL 1U58A 4G9FE 5EU3B 2DI7A 3VXMB 3K4AA 4JHZA 1G6VK 5C07D 1N0LA 4OCRL 1FYHB 4S1RL 2JJSA 4OI9A 5HGDB 3VFWB 1CD8A 3CSGA 2BMKB 2X4UA 4QRPB 2NY4D 5I1GL 3DVGB 3PXHA 5BO1H 3MJ7B 4NFDA 3VE0A 5ITFA 1BBDL 1HXMB 1P4BH 1RV6X 4ZTOH 1OCWH 5ILTL 1CG9B 2OQJA 3I2CL 5DUBA 2FO4A 4LRIC 1I7ZB 5IB3B 1T22B 4C83A 2AJXH 4HX1A 4WY7L 4X6BA 4HXAL 5CHNB 2RQ8A 4UDUB 1T5XB 1E0OB 4Z7VB 4UQ2A 1LWRA 4N1HB 2NY5C 4X80H 4GRWB 5J12C 4TQEH 3LEYH 3SDCD 1QLFB 5DRNB 5JIPA 2XWBB 3FQUB 4EUPH 3MOBH 1FGNH 1AD9B 4TTDD 2GJZB 3GIVA 4AIOA 4HIEA 3SDAD 2B4CC 3BN9C 5J6HB 1NEZA 3INUH 2HJLA 2HWZL 4QTIH 1MRFL 3BKMH 4OLZL 2IPKA 3QUZB 5GHWL 5EO1A 1KENL 3QNXA 5I1JH 5C6PB 3PNWA 3L5WA 2YPLD 3BKJL 3CCHB 4BH8B 1RURL 5DMYA 1S7VA 4GW1B 3DV4A 2EH8L 1Q0XH 2W65A 3WNKA 4MD5A 5KTEH 4L8SB 3G6JA 1WWBX 5MP6H 5T3ZH 3Q48A 4P5KA 3QDJA 4JFOB 2E7MA 4PJ9C 5CEXA 4WI8A 5I73C 4GG8B 2Z0BA 3REWB 4MMXC 4YXKL 4G7VL 3UTTA 4HWZA 4XPTL 3RA7H 3SDXB 4WFHE 2Q6WB 3QULA 4LPTA 3K4DA 4MZ2A 2XA8L 5T1KB 5KVFH 2VQUA 3A67L 5DD6A 4DW2L 4XNUH 1CZ8L 1FIEA 2HFGH 4OZFG 1TVBA 2FEDD 4YGVA 2OTPA 1A14H 1S8DA 2VLKD 1JHLL 2YUXA 2VZTA 3KYNB 1EJOH 1H8SA 1LQSR 1QFUL 1W0YT 3K0WA 3EYSH 5J9PA 5DQJA 3KLHD 3N85L 4M8QB 4U0RC 1HHIA 1NCAH 1MIEL 1U0QA 1OLLA 1IQWH 3O6FA 3BO8B 3PHSA 2BMKA 2X4UB 3V6OA 5DWUL 1LO4H 3RIFK 1S9VB 1TZGL 2DQIH 5ALCL 1F3RB 4Q6YA 1YA5A 1UACH 4L3EA 4L5FL 1SJHB 5JOFB 3IJHA 2QQKL 1FAKT 1F8TH 2ARJB 3NMEA 4NQEA 4XHJD 4XZUA 4JHAL 4Q0XH 1T7VA 3JUZA 4JFDB 1E4XH 3NABH 5AYQA 3ALXA 2P44B 2WIMA 4WV1A 4AIZB 2DYPB 2ORBL 3EDDA 3IDGA 3PL6C 3MO1A 1INDL 4LASH 1TTUA 1FORL 5BJTB 3KPQA 4WUUA 4NYLB 3HPLA 1OSZA 2HG5A 4OF0A 5SWSD 1UB6A 5I1JL 2H9GA 1SJHA 3VXNA 1T80A 3HE6B 1BZQK 1K4DA 4PRBB 4LCCA 3QHZH 1TMCB 5EO9A 3BT2L 4BQBA 4P59L 5D1ZA 2DQJH 1LO2L 3G6DL 4YGAB 3JSSA 3Q3GB 1PEZA 4FQCL 1BQUA 1FG2B 1G6RB 4U3XA 4U6HB 3CLEL 4IRJD 1MAJA 3GZKA 4P5TD 4ONOA 4M8QA 2AW2A 3QDME 3U46B 3BOVA 5KZCB 3RHWK 2F19H 5EBWA 3ETBF 3UTTB 4S2SA 4XBEH 1U93A 4MAUL 4WEBL 3BE1H 4HIXH 2BVPB 1U2CA 5GS0D 3ZYOA 1JI1A 4K8RC 1XGTB 3LEXA 4GW4A 4KMTH 5JHDE 5DD6B 5CSZA 4PV8B 5E99H 2D31A 1LEKB 4WENB 1JGLL 4PGDA 2J4WL 3SGJC 3TJEL 3F5WB 3S88L 5F7WC 5HYJB 1C08A 2O5ZL 4HWZB 2QR0B 4XBGA 3JV4A 1T2XA 2NY2D 2VZOA 4U2YA 5C0AE 4L9DA 4JY4B 2YD3A 1LO5B 3KPRB 5CGYD 3HG1D 1KNOA 2SEBA 4ZODA 3KJ6H 2ZKHH 3NOIA 4Y2DA 1J18A 1IKFH 4K7FA 1CBVL 1CDUA 4O2CB 3MCG1 1XGQB 1DDHA 4HAGA 1YN6B 4LSVL 4FFVC 4G6ML 3U36B 3LH2L 1CG9A 2OQJB 1FSKB 1EZVY 4JFZH 1CR9L 1T83A 4R0LB 4YDKL 4WTWA 4Y2DC 4CVZB 3V7MA 4GRWH 4KU1A 5IHUH 2HLFD 4S1SL 4XCFL 3HCVA 1CLOL 1Q94B 2DQUL 4PYGA 1G7MB 2E7LA 3VXTA 2X5PA 3PE9A 4PBVC 3QPXL 2C26A 3CVHL 4G8GE 1UWGL 3KJ4C 4UNTA 5HDQL 4XX1E 4DTGL 1YEHH 2MPAL 5DQDH 1EGJA 4NZTH 2PCPA 2X2YA 3HMXA 3VWKB 3C5SB 4Q58C 3VDBA 2DQDL 3QIBA 3WFEH 1NC4B 2IALB 4X4MA 4Y4KA 2G2RA 4PLNC 4RMUA 3I50L 1SVZA 1T5WB 3MV9B 3ESVF 4MSWB 4HC1L 1OGAE 3F7YA 3QUXB 3P0VH 5EU6D 2WIIA 2BSSB 4XBPA 5IJVA 3KPMA 1H0DA 1OTUC 5C0JB 1T6WA 4IOFC 3OF6D 5I76A 1XF2B 3KPPA 3EYOA 4XAWL 5KZCD 2EDXA 3NCJL 1XIWB 5K33A 2RB8A 4D9RE 1MCWM 3MUHL 3O2VH 4PJXF 3VD3A 2VOTA 3WSQL 5I30L 1K2DA 4MNHB 2VWEE 3T0ED 5A3IC 3TBSA 3EO0B 1R3HB 1I7RB 5BS0A 1OTSC 1G6RH 3QUZD 3D1MC 1YEKH 4NNYA 3TPUB 5DMJB 2R4SH 3Q6GH 4QXTB 2VL5A 4BH7A 1T7WA 3GB7A 5GS2D 3LB6C 3N1FC 3MMEA 1KJVB 3QR2A 1QG3A 3RVWC 4O58L 1BZ9B 4G8GD 3L9RB 2WUBH 3E2HB 4HWEH 2AK4D 2LAAA 3HR5B 4JJ5B 1BFOA 4J8RB 4PS4H 4PGJA 1A6VH 5DJDA 3MRNB 4NO3B 1FFNA 1SYVA 3IF1B 1EEYA 2NY0C 4U1SA 3TO2A 2VISB 4FHBD 5IFHL 4BUHA 2MHAB 2Q8BH 4PJ7B 2GTZA 1Z5LA 4NO0D 3J7HA 4AYFA 2BRRH 3O0RH 4MD0A 2ITCB 3DV6A 1J8HB 3F6LA 2NY5L 1KEGL 1MWAB 2CIIB 4JGUA 1NFKA 1ADQL 1EGJH 4U1LA 5FCSH 3CPLA 4JGMA 1XF5A 5F9OH 1HSAB 1YYLL 3QJHA 3QAZB 3X11B 3IFPA 4NO3A 4OLYH 1GRWA 3HS0B 2VDLL 3STZA 5LXGH 3B6SA 3AMKA 5C8JA 1CLYH 1HIML 1NL0L 1I9EA 4HUUA 4JM4H 2BSTB 3QI9A 1II4E 4ZAKA 2OJEB 1AGBB 1K8DA 5H8DA 3FQTA 5HVHB 5L2JB 5J6GB 2X42A 1WZ1L 5L7XL 5FCUH 1HQRB 5D96B 3L7FA 4FNLL 4U7KA 3EGSA 5MEOB 2DD8H 3KNBB 1W72B 4LFHD 4L9LA 3MGTB 1HILA 3RPIB 1I7RA 1UXWA 4MAYC 4WCYH 2EDDA 2O61A 2K3TA 2HMID 4NP4H 1J88A 4NSKB 3LD8B 1L9MA 3P9MA 3P4LA 3LKNB 4IRJA 4YIQA 3UBXI 1U8OA 3Q0HA 2A9NH 1U91B 2QTEA 1GGCL 1K85A 5FGBC 3KPPB 2X9WA 1R3KA 2R0KH 2H6PA 3P73A 4MGXA 5I8EA 2HP4A 1NCWL 3JTTB 3GSNL 4OUOA 1GOGA 3VFNB 5FGCB 1TJGL 2F9BT 1RUQL 2WQ8A 4M9OA 4QY8A 1R3JA 3HFMH 3K74B 5JW3H 3G04B 5E1AA 5GIRB 1MEXH 2NY3C 1OTUD 5H37H 3LKSA 3S36H 4P2YA 2BC4B 3SE3A 3KYMA 4HT1H 1ZSDB 1QZ1A 1IGFL 5JZ7D 4JO1L 5BVPH 3FFDB 2LE9A 5HD8D 5K9OB 4CU8A 3MRDA 3UPRB 1FNFA 1G9MC 4GAYB 1RMFH 4PJEF 3WFHB 5I2IA 5IT2H 4EOWH 4HUVA 2VDNL 2VDQL 1FG2A 2PO6A 4NM8L 3QDAA 3FQTB 1KT2A 2HA1A 4LIQH 1M7XA 3C8KB 4Z76B 1X5GA 3EOBA 3OXSB 5I1LB 3NPZB 1IAII 1JWMB 1RIVH 3SE8H 2BJML 1ROWA 1A64A 4KDWA 1A4JA 3O3AB 4L9LC 3QUXC 4PIRF 5E8PB 1XGYL 4XP9H 3MRLB 4BSVA 1GPOH 5GS2H 2ATPB 3OG4B 2FECL 1S7WA 4K9EL 2YK1L 3PGDA 1IGFH 4Y2DD 3BJLA 1KV3A 4HWBH 2AK4A 3RIFF 3SHSA 4N8PA 1SJEB 3GSRA 4GG6F 5FKPB 3OJVC 1U6AL 3QI9C 3U0PB 1OB1A 2DD8L 3SKUD 3U0TB 3VFUB 4JCMA 1MAKA 2AJUH 3TWCL 1L6XA 2Z31B 3BWAB 4D9RD 5GS1A 1EV2E 3KPLB 1FVDB 3F7PC 1FJ1A 3KDMA 5EU7C 3D85D 5DXWA 3KYOB 4KJWC 1BAFL 5CGYC 2QSCL 3KHOA 4JFQB 3QQ3A 1HXYA 4HJ0D 4I18B 1DANT 3CK0L 2FLBT 4JN1L 1PKQB 4JDZB 3EAKA 5KN5A 2EZ0C 3VXQA 1ZT1A 4TNWK 2AXGA 3B5GA 2YEZA 2NLJB 3LRSA 3VXUE 2GKIA 1KLUB 2GAZB 4YPGA 4X6CF 2BSRA 4M62H 5JTWA 4OCYH 4HLJA 1A1MB 1IAIH 4G9DB 4JHBA 4I3SH 3IETA 1IGJB 4WEUD 1WK0A 3ZO0A 3VJ6A 2AXFA 4P4KC 1KCUL 1VA9A 4PJFA 5F1IB 3BIAX 4K3HA 3KYAA 3TLRA 4JRYB 1S9KC 4I18A 4RWYH 2QHRL 5LVEA 1MFDH 2D03H 5DVLA 3UDWC 5DK3A 1UB6B 3CVIH 2Y06H 4HS3A 5CINL 4X5LA 3K2MC 5ICYB 1QFWM 4L29B 1FE8H 3DTXB 4R90H 3DROA 3T04D 5KSBF 2C1PB 3BH8A 5IQ7H 2IPTL 1YJDL 5TE4L 4ODTL 1Q9KB 4BSVB 4MLSA 1MHCA 3JWNC 1KFAH 3LY6A 4YH6A 3HR6A 5I19H 4JN2A 2R0WL 3RWGA 4KUZH 1ZANL 4XMPH 3KXFB 4JR9L 3VMOA 4R96A 1ZV5A 3GRWH 4N0UA 3IXAB 3KPSE 3MO1B 3V95A 2VXSH 4FFYL 1IE5A 4I9WD 2AABH 1LO0H 1HHHA 2BHZA 2VH5L 1OARL 2FH8A 3NPSC 5LCVL 4MWFB 4KFZC 3VXOA 5IB2A 1R3LB 1GGTA 1KENH 3EFDH 1E27A 1NCAL 4H0GA 4M7KH 5HHVL 5DRXB 1ZVYA 3CX5J 1I4FB 2DTMH 3C9NA 3LSOB 2HYMA 1TNMA 2Q20A 1I7ZA 3LCYA 4LSRH 4NN5B 1KLFA 1KBGL 2KDGA 5C71A 3JZ7A 4JPVH 3A0OA 4LCIL 5GGQL 3U4AA 4OI8A 2LU7A 5CSBA 3HRZA 4OAWB 1U8KA 2DQEL 1UACL 4P3CH 3IU4L 1EHLL 4G5ZH 5E94B 1A6WH 1X4XA 1QTYT 1T66D 4EDWL 1KN2L 4IRZL 4OLVH 3ZE1E 4FN0A 3I6LD 4UDTB 4PGEB 2YSSB 4EDXA 5GGVL 4NRZB 2ED7A 3LSOA 2OSLB 1KN4L 2FL5B 4OSUL 1D5BA 1CZ8H 1AY1L 3QDGB 4PJXE 5D5MF 5E9DB 5L6YH 5GGTL 5AZEL 4M7JH 5FM5O 2PXYD 3CUPA 4LDOB 3PWNB 3QIWB 5E5MA 3QCTH 3V0VB 3K8LA 4DGVH 1HHJB 2M2DA 3CCHA 5F9AC 2PR4H 4XCYB 2WAHA 5CIPA 3OAUH 5ICYA 1S5HA 4P5KB 4PBXA 1BVKA 4KVNH 3O8XD 4XGZB 4X7TB 4EI5D 2YN5A 4DJMA 4QNPF 1MRDH 3WO3B 5C1MB 2P8PA 2WNGA 5MEND 4ODTH 3V6ZA 3JUYA 3PWNA 3OMZA 3CIQA 3E8UH 3BAEL 4N0YL 2DI8A 3O4LA 4FP8L 5IK3B 4W68A 3WXVL 1F4AA 2G9HB 4MAUH 1A7OL 1IARB 2V9RA 3MA9H 3BP7A 3SDXE 1V7MH 3GRWL 1T7ZA 5CZVH 4YC2B 1MHPL 2E3VA 5DJCA 1QVOA 1CICD 1PG7H 3H9ZA 4UOW1 2J4WH 1VFBA 2BVYA 5C0AA 4K7PX 4WW1A 3ARZA 3SDAC 5BO1L 1F58H 3NIDF 1WUNT 4LRNH 4TVPD 2VZUA 4DQOH 4HLZH 4LPWA 1CDBA 3HZYA 3LRHA 2UZXB 2GW5A 4I0PC 3NFNA 4LAQL 3NTCL 3X3FH 4DUVA 4NJAL 1D5XA 3QXVA 4JQVA 1SYVB 1M4KA 3IF1A 3P40A 3QDGD 4NUGL 3MBEC 1ZLSL 1L7IL 3ZTJG 1IKFL 2F8OA 1CBVH 2CRYA 3ULVD 3QSKB 2ADJB 2XRAH 2V5TA 5GJTL 3VFUA 4F7PA 4D9QE 3KDMB 4GXVL 4KDVA 1FGNL 1FLRL 4BZYA 1AGFB 1A7NL 1JNLL 3RKDD 4U1NB 4G6MH 3KPLA 5E2WH 3BDYL 4FFZH 5INDA 1BX2B 1LEIB 1I8IA 3BGFB 1ZLUH 3RGVB 2VB5A 4GUPA 4R3SB 4R97C 5EWIL 1NAML 1N2RB 2BX5A 3QB7C 1AO7B 4QXUH 5I1EH 4NHCL 1K9TA 2Y1VA 4OTXH 3OKMA 3K4ZA 2PYFB 1QFHA 4HWNA 4JM2B 4ZTOL 4U3CA 3X14B 5HY9B 3ZE0F 3PL6B 4G7YH 2J88H 4POZC 2FGWH 5BZWB 1KCVH 1V5JA 4KJQD 1XIWA 4KVNL 4ODWA 2VXQL 5D70H 1H3XA 2A6KA 2Z31C 5JXAH 5C9KA 1EH9A 1RZ7L 1LD9B 4NWTH 5GGSB 3PP4H 3TESA 4HJGA 1RZKC 2MTPA 3TBSB 2FYYB 4G9DA 2P8MB 2PYFA 5DEGB 4WFGE 4F7CB 4MJIA 4WDIA 2B8OT 5I75B 2C3HA 4FZ8L 2A77H 2F5BH 3PUCA 2W9EH 4PBWD 3ILQD 3JWDL 4HF5H 1A2YA 4WI6A 1INQB 5F7DB 1JV5A 3RWJA 1E4JA 3BPCA 3DSFL 1QSEE 1MIMH 1SJXA 5DDHA 3ZT5A 1NGYA 3L3JB 3OPZL 3SGJA 1MCWW 1EDQA 3RWDB 5HDBF 1OTTC 4XNQA 3RX7A 2VLMD 1EFXD 2H6PB 3P73B 4PJEE 4XC3H 3RY6C 1ZGLM 3WFCL 1IQWL 4HS6A 4I9WE 5EZLA 1ZGLA 4LP5A 4G8EA 3LZFL 4MCYA 2IG2L 4Y5VA 4MNQD 3LKRA 1GAFL 3WFBH 1CFBA 1OP3K 4XPTH 3RFZC 1ED3B 4RGNE 3ZDXF 3RNKB 3NZHH 4GSDH 4RRPA 2DJUA 2QQKH 1A2YB 2PCPB 2J8UB 1HE7A 1TZIB 3EGSB 3P77B 4JDTL 1BBJB 3QFDA 3K2UL 5C0IB 3RTQA 1KELL 3IDJB 4P3WA 4AK1A 2NZIA 1A14L 1W0VA 1FL6B 2QSVA 4X6EA 4ODVL 1AXTH 4Z0XA 3D39A 4K7FB 35C8L 4NUJA 5E08L 4WUKH 5CEYB 2H32B 1KCRL 3VFVA 3TH4T 3QO1B 1MI5D 1UH3A 3ZDZF 1TZGH 2DQIL 4KK8C 5T1KD 3F7VB 3U9PH 4E9LA 1T7YA 3O4LE 4MCZA 3VGDA 4JM2A 1QSEB 1MWAL 3HA0A 4UV4H 5T5FH 3AAZB 1WFOA 4R0LC 2EC9T 1N2RA 5D2NA 3HZMB 3Q1SL 4O02L 1FYTE 5FV1L 1GGYA 2EDEA 2H2PD 3GNML 5IEKA 4RAUA 3AREC 1W0VB 1XH3A 4GRMA 2GK2A 2E6PA 4K23H 3UBXA 2C4FT 3TBTB 3C87A 4HGKC 1P1ZA 5L2KD 4HH9B 5EORH 2R8SH 3QDMA 5I1HH 4X6CE 2AJ3A 4YC2C 3GBNL 2W60A 4N8VB 4HIJB 1MIML 4ONFH 5HYFA 2QV2A 4NQXB 3L3GB 1NANH 3TA3A 2J1KA 2R1XA 5EU4A 1X44A 3DVNA 3LIZL 3PWVA 5D7JC 4LLYA 4Y5VB 3MRNA 3D69B 3RBGA 2ESVB 4D3CH 25C8H 4JZNA 5HYEA 5IBLD 4IOSD 1U8PB 2GCYB 4Z0BH 1CXKA 2IFFH 3WNMA 4DVRL 4NZTL 5EO9B 4JCLA 3TV3L 3MJ8B 5EOCH 5BQ7A 4MDIA 1JV5B 5HYQA 1AGEB 1MCSA 4JKPH 4WO4C 2X1QA 4PG9B 3RZCB 4WTXA 3MROA 3TPUA 4K94L 3HZKB 4JRYE 1G7PA 5I74B 1YEJL 1ITBB 2DQFB 1MPAL 3UAJC 2ITDB 2ERJC 4WV1B 3ULVC 3HMXH 2FSEB 3MV7D 1J5OH 5JW3L 1YC8A 2XXMB 3MBED 2D3VA 5C8JB 4G6FB 4PR5A 4YFEA 2O5ZH 4XZUB 1S7TA 3FQNB 5AUMA 4PJ8D 2R4RL 3M1BA 4I0PD 3SGEI 4HT1L 4BQCA 4XVJL 1Q9WB 1F6AA 4V2BA 5CJ5A 1HEZB 3QHFH 3T4YA 5BZDB 4U1NA 4R2GB 4N8VA 4PGBA 4U6VH 1MCDA 3BO8A 1OAYH 2V6HA 1P6FA 2IEPA 4RBPH 3F7RA 2VDQH 1D6VL 1OM3H 1Z3GH 1T6VN 1JRHH 4PJIF 1MCOL 1CICC 2Y36L 1YEGL 2X6MA 4ETQA 1MCNA 3GSNB 1YECH 2EC9U 5ACZA 2HTKC 2ESVD 4MXQC 5EIIA