2VZAA

Type iv secretion system effector protein bepa
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
TEIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPKAHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
molecule keywords CELL FILAMENTATION PROTEIN
total genus 91
structure length 296
sequence length 296
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2vzaA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vzaA02
1GM5A 3UE1A 2MQHA 1HNZQ 1U0LA 1MKHA 4OONA 3KJOA 3RLNA 2RF4A 4OWXB 5CGLA 4TVAB 4A3KH 1YHQA 3HOUG 4DR4Q 4BY1G 4A3EG 1N34Q 4JCVE 4KI0A 4LF4Q 1BBWA 2ATWA 1FGUA 3K0XA 1K83H 3M85A 3KLWA 2K75A 4ALPA 3SGIA 4YWLA 2E5LL 1TWGH 3ICEA 3CCRA 1EYGA 1W3SA 3AEVA 4IOAA 4DV0Q 4XTCS 1HNWQ 1LM0A 1I3QH 3E9IA 4QJFA 1XTDA 1YI2A 4IPDA 4R1JA 2GVAA 3CUCA 1T9HA 4JBJA 3SN9A 2PQAB 4X64L 4HJ5A 4X66L 4A3CG 5ELOA 2IX0A 3PUWA 1BVSA 2MO1A 2Q2UA 2R92H 4JBKA 3M9BA 2UU9Q 4DR5Q 4AYBE 4A3MH 3TEHB 3KOJA 1MJCA 3PO3H 2UXDL 3J80c 1Y14B 3A74A 3OTOQ 4A3EH 4GS3A 4JI5L 4GNXC 4BY1H 3I55A 1EOVA 3HOZH 4GOPB 2DGYA 1VS0A 1VQ8A 2RHQB 3GDEA 1FJGL 1IXRA 3I4MG 1LYLA 4JV5L 3J81i 4LNQA 2R93G 1WYDA 1Y1VH 3S1MH 1PV4A 3CMEA 1N34L 4U07A 1C7YA 2Z0SA 3S1NH 3HKZE 3ZLMA 4X2DA 3HKSA 1L1OA 1S40A 1JT8A 4P72A 4Y52H 3KF6B 4DV3Q 1HH2P 3CCQA 2JA5G 1V1QA 4B3RQ 3MXNB 2V1CC 1WCMG 3J81j 2CFMA 4R4CA 4U0ZA 2CWPA 1KHIA 2ZTCA 3PUXA 4L5RC 1CSPA 1EWIA 3STBC 4YY3Q 1HNWL 3F2BA 1PVOA 4IPHA 3S2DH 3S6AA 3J7ZC 5HY6A 4QY7A 3Q8DA 2JA7G 1HZBA 1E24A 3ZCBA 4GKKQ 4X64Q 3PIPA 1QVCA 1QUQA 3U50C 4JI0L 4K0KL 1A8VA 4DR7Q 2K4KA 4KLKA 3AFQA 2OQ0A 3J80i 2LXJA 4UP9A 1BKBA 3N3UA 2Q2HA 1NTGA 1JJ2A 1I94Q 3FKIH 1HNXL 4QL5A 1W2BA 2IHFA 2VL6A 3OTOL 2WP8J 4JI5Q 3J81c 1VQEA 2DUDA 4DR2Q 1FJGQ 1SROA 3KF6A 4BA1I 3RN2A 1FVIA 1K0RA 1KQSA 4YWKA 3L0OA 2AMCB 4B3TL 5GROA 1XNQL 2YTVA 1G6PA 3RLFA 4LUVA 1PH9A 4O2DA 4BBSH 1VQBA 1G51A 4R4TA 3ULPA 4JBMA 3HOYH 2KENA 3K7UC 4B3MQ 2VUMH 1X56A 1GO3E 2RCNA 2CKZB 3CXCA 5E7NA 2VUMG 4A93G 4B3RL 2E2HH 4PMWA 2YU9H 1U5KA 1YJNA 2UXCQ 4UY8C 3GTPH 4YY3L 3F2DA 2VQFQ 4POGA 4KHZA 4DV1Q 4JI7L 5M3MH 1XJVA 3F1ZA 1IZ6A 2E2IH 3JC66 1NMFA 3ERSX 4A3LH 5HGQA 2MFIA 1L1OC 1KRTA 2NN6I 4DKAC 4A3FG 4NXML 3BJUA 4OX9Q 1L0WA 4P75A 1CUKA 4K0KQ 3L7ZC 2KCMA 4QIWE 3PUVA 1R9TH 4DV6Q 4JYAL 3FP9A 4DV5Q 1J5EL 1DGSA 3A0JA 1I94L 2Q2TA 5C4JH 3UDGA 2HT1A 1CKNA 1EIFA 3IRBA 4U04A 4NXNL 4JI1Q 4BBRH 5IYCG 4DV7Q 5IYBH 4DUYL 2ZM6L 4GLXA 4AQYL 1NBWA 5C44G 3U4ZA 4DNIA 4PZ6A 1TXYA 4ME3A 4LUOA 4P71A 4QGUA 1VQ7A 4YCWA 3STBD 5C3EG 1N32L 5JJ7A 1UE7A 4YHHQ 1QZGA 3W1BA 1N36Q 2JJQA 1XMOQ 1WJJA 2UXBQ 5C0XG 1PH3A 5J3BA 2NZOA 3D31A 1LTLA 2JA5H 3HOYG 5K36G 4OXPA 2A8VA 2IX1A 4X65Q 3PO2G 2BH2A 2N49A 3S2HH 1AH9A 4DR3L 3KJPA 2N78A 5H1SE 4JI6Q 1JE5A 3G48A 4TQUS 1PA6A 3S1RH 1OXUA 4C3JH 2JA6G 1VQ6A 2YTXA 3ULJA 2VQFL 4LF8Q 4JOIC 4WJ4A 2K5VA 1WFQA 4JI2Q 4JI4L 1VQHA 2ZJRA 1IBMQ 2NVYH 3CPFA 1SE8A 3F8TA 1XNRL 4A93H 2VQEL 1V9PA 2Q2IA 1PH4A 2VNUD 3K81C 4A76A 4JYAQ 1C9OA 4DV5L 3PIOA 4RMFA 3RLOA 1YITA 1OXXK 3E0EA 4JI1L 4NXNQ 1CKMA 4R4QA 1KIXA 4R4OA 4DUYQ 4OWTB 3F2CA 3CC2A 3NELA 1TWAH 4A3BG 5FJ8H 1VQIA 1VQFA 3CMAA 4A3BH 5C3EH 4LWCA 3E9HA 3CC7A 4DR1L 1HR0Q 2IY5B 3BZCA 1N36L 2UXBL 3ZC7A 4B3SL 1P16A 1IL2A 1D7QA 3AYHB 3VDYA 4X65L 4GNXB 1GD7A 2LXKA 2HIXA 3S16H 5AJ3Q 4LF5Q 2BA0A 3W5OA 4HIMA 1YZ6A 3PSIA 4JI6L 4LUZA 1HZCA 3NEMA 3UDIA 2ZJPA 4A3KG 3HOUH 4BA2I 4A3DG 2WAQG 1XMQL 3GTQH 3EBEA 4LFAQ 1FL0A 1YHAA 2R7ZH 5EU0A 4L5QA 5C4XG 1I5FA 1IBML 4U0UA 2NVXH 2UUBL 5IT9c 3CQZH 4L5TA 4X2EA 4LW1A 4UP8A 2EXDA 2VQEQ 2F4VQ 2ES2A 4DUZL 4M16A 2NZHA 4A3FH 1TWFH 3G71A 3EIVA 5IWAQ 4HJ8A 2E8GA 4C3IH 5FLMG 1N33Q 4GN4B 5JJLA 2N8NA 3UE0A 3LGJA 2LSSA 4A3JH 4NPSA 3I56A 4OO1I 1NJIC 2HHHL 5JEAG 1E1OA 5C44H 2PI2A 4EQ5A 4LF6Q 2JA8G 1EIYB 4B3SQ 1JB7A 1I6HH 1VQAA 4JI3L 3PV0A 5GAEC 2PQAA 4JI8Q 4ITRA 3L2PA 1SR3A 2K5HA 1JMCA 1X3GA 3PGZA 2XTIA 1OXTA 3ZJYC 2CCZA 5CMTA 4IFDI 3T1HL 5JEAJ 3CC4A 1Q8KA 2KCTA 5DLQE 1XMQQ 3TS0A 3G4SA 1PH2A 4NB3A 4LFBQ 4AYBG 1EFWA 4LF4L 2F3IA 4LFAL 2R7ZG 1L2FA 2D62A 2L15A 4MNOA 2Z6KA 3OYYA 2UUAL 2UUBQ 3UDXA 3GTKH 3RZDH 3MEFA 4DAMA 3CF5A 3U58A 2EQSA 2F4VL 3CW2C 4P73A 2UUCL 2NN6G 4DUZQ 4A3LG 4IPGA 2E2JH 1Q86C 4IJLA 4UP7A 3AFPA 1Q1EA 5IWAL 1VQDA 1VQ9A 2WFWA 1PH8A 4OO1G 2G03A 3CCMA 2ZTEA 2B63H 5IE8A 4DV2L 1OTCA 2Z6KC 1QZHA 2AWOA 4X66Q 2OTLA 1UE6A 4L5SA 3M3YH 3M4OH 4BXXG 3HOVG 2ALYB 1SN8A 1IBLQ 1E7ZA 4GN3B 4JI8L 4X2CA 1JJCB 3PO3G 1QVFA 3BZKA 3I2ZA 1PFSA 1O7IA 4X62Q 1EUJA 3DM3A 4IPCA 5LMUQ 3M4QA 5C4XH 3TS2A 1VQJA 2JA9A 4IO9A 4POFA 5GAGC 3M7NA 3GTMH 3PO2H 1VQ5A 2MO0A 3KDFB 2I0QA 2E5LQ 2AWNA 2VY3A 3K7AH 4PG3A 2UUAQ 4A3GH 3HFZB 3JAMi 4DV3L 1K9MC 3WWVA 3CCVA 1XPOA 4YCVA 2UUCQ 3S15H 5FLXc 2QEXA 2H5XA 1K8GA 1VQMA 1E22A 5IYBG 2B3GA 1HZAA 1Q46A 1WOCA 4X6AH 1Z9FA 1B7YB 3FHWA 4Y7NH 1YBYA 1A62A 3H0GH 4HIOA 2ZJQA 2WB1G 3M4PA 4GKKL 4JI0Q 3TQYA 1HJPA 2UU9L 4GKJL 2A1AA 4MTNA 2UXDQ 1YJ9A 5M3FH 3S14H 3CAMA 5CKLA 1EQQA 4P74A 1K3RA 5IY0A 1MJEA 3CPWA 1M1KC 2JA8H 4O0AA 3PUZA 1KC8C 3HOWH 2R92G 4JV5Q 4XI8A 3W1GA 1UWVA 4X62L 4DR2L 1VQOA 2JK8A 2KHJA 5LMUL 3T1YQ 3HOWG 1AE3A 2PI2E 2NVQH 1CKNB 3OW2A 1SLJA 1XNQQ 3I7FA 3RZOH 1S3OA 1ASYA 4A3MG 1I50H 1RL2A 2QGQA 5M3FG 3JAMc 1YEZA 5IP9H 4B3ML 5GADC 4A75A 4RG1A 1Y1WG 1XPUA 3GTOH 2IHEA 5IYDH 3TREA 1RIPA 1Y1WH 1G291 3H0GG 1VQLA 2CQOA 2ID0A 1VCIA 2JE6I 3K8AA 3ER0A 2YTYA 4LU4A 4DV1L 3K80C 1YVCA 2QA4A 1VQ4A 4DR7L 1NE3A 1UEBA 4H02A 3PUYA 2Y0SG 4DK6C 1S72A 2N3SA 1UE1A 2JQOA 2YV5A 3UDFA 2VW9A 1HNXQ 4A3GG 4GKJQ 5JJ6A 4C3HH 4HIDA 1WI5A 3H3VI 1CSQA 1MIUA 4QQBX 1A63A 1SMXA 3HOVH 1PYBA 4BXXH 4DV7L 3RNUA 2ZM6Q 1L1OB 4B3TQ 4BY7G 3GO5A 3KDFA 2RHSB 1X3FA 3T1YL 4LFCQ 1XPRA 3CD6A 1N9WA 1E3PA 3S24A 1NMGA 5M3MG 2VS1A 4APVA 4YHHL 2BA1A 4EX5A 4PY3A 4A3IH 4LF7L 5IP9G 2PMZE 2OWOA 2F52A 4DR3Q 1KD1C 5LMNL 2UXCL 2VZAA 2R93H 1TWHH 5LMNW 1CKOA 3SHGA 1X3EA 3LETA 1Z47A 4JBWA 2K5NA 5M5WH 1YHBA 3U4VA 4NXMQ 4WJ3M 1X55A 4JI2L 4JI4Q 4OX9L 3RN5A 2R7FA 4DPGA 4LF9L 1Q82C 4GOPA 2YYZA 4DAYB 1V43A 3EN2A 3NBHB 4DV6L 3CCSA 1PH6A 3I4NH 3I4MH 4JI7Q 4A3CH 3D0FA 3FKIG 1J5EQ 4KHPQ 2B29A 4A4IA 4HJ9A 2I5MX 2IT1A 3ULLA 5BR8Q 1VQCA 1YNXA 4FDBA 2F6SA 4AQYQ 4GLAC 1PHJA 3CP0A 1EQRA 4OWWB 3GTGH 3J7A5 1HZ9A 3A5ZB 1BBUA 1KRSA 3HOXH 4HJAA 2D0PA 1VQKA 1N32Q 2I5LX 4PZ7A 3HKZG 4IJHA 4LFCL 1XMOL 3CCUA 3TRZA 4XIGS 1X6OA 2KBNA 4IOCA 1KAWA 3B6YA 1B70B 3GD7A 4BBRG 1YJWA 1ASZA 1VQPA 3GTLH 4LF7Q 4U0SA 1K73C 1TWCH 1M90C 1IYJB 1PH1A 2BH8A 2C35B 5IP7H 3PCOB 4AH6A 5AJ3L 4LF5L 5LMNQ 1PH7A 2MNAA 4JC0A 3HOXG 4AIMA 5IYCH 4GOPC 1UE5A 4PZ8A 4LF8L 2HQLA 1A0IA 5FLMH 1J6QA 2ZTDA 1XNRQ 4IFDG 4MZ9A 1Q81C 1D8LA 4LF9Q 4A3DH 2EIFA 3SE5A 1IBKL 3HOZG 3RR5A 5IP7G 2GVBA 3PF5A 1X54A 3I4NG 4WGJA 4KHPL 4GN5A 2FXQA 2NVTH 4R4IA 1N8RC 5BR8L 1LUZA 5M5XH 4HJ7A 4DR6Q 4C2MH 3A5UA 3I4OA 2XGTA 1OXVA 1Q1BA 2HIVA 1HR0W 5C0XI 1VQNA 2OTJA 5GQOA 4DR1Q 1HR0L 2KHIA 5GAHC 4A3JG 4GLVB 3H15A 4BY7H 1AE2A 4J15A 1X9NA 1QUQB 3KYHC 1YIJA 3S1QH 4A3IG 2R7DA 1P8LA 3KF8B 3KFUA 1JJGA 4BBSG 1VQGA 1OXSC 4DV4L 5M5YH 3CCEA 4HIKA 1QVGA 4JI3Q 1Q7YC 2D0OA 2PNHA 1NY4A 1K8AC 1HNZL 1SRUA 5FJ8G 4N67A 2OCEA 4UPAA 5JFFA 4GNXA 1SFOH 2ASBA 1KL9A 3S17H 5JJKA 4DR4L 3BU2A 3T1HQ 5JJIA 4LFBL 1Q12A 1GVPA 2AHOB 2WAQE 3CCJA 1KXLA 3AQQA 3PF4A 4JG2A 5C0XJ 2A19A 2JA6H 1IBKQ 3H3VH 2Y0SE 3DLLA 3CCLA 2K52A 4DK3C 1N33L 2K14A 3G6EA 1B8AA 2AKWB 2JA7H 2JEAI 4DV0L 1PH5A 2GN5A 4YCUA 1C0AA 1GKHA 4DR6L 2WB1E 2HHHQ 4YWMA 1WCMH 1Y1VG 4DV2Q 1E1TA 4IFDJ 2OQKA 1X65A 5EAYA 5IYDG 4LF6L 2JEBI 2B63G 1PYSB 2K50A 4DR5L 4JOIA 2CWAA 3NENA 5JFZA 2R6GA 4DV4Q 1H95A 2I5HA 1IBLL 5ELNA 3GTJH
chains in the Genus database with same CATH superfamily
3MAQA 2MQHA 4XYQA 4OONA 5ELDA 4K14A 2RF4A 5CGLA 4DR4Q 1G2TA 1HA5A 1Z7TA 3TBIB 2EVBA 3K7AB 4A3GB 3GP7A 1TWGH 2EYOA 1L0XB 5IT9E 3P7JA 4IOAA 1J8IA 3C46A 3E9IA 1XTDA 4X3KA 3N52A 4R1JA 4IALA 3P1HA 4X64L 2X6GA 3BDOA 3SN9A 2PQAB 4G57A 4JBJA 3TZUA 4JK1C 3I73A 1BVSA 3M9BA 4DXGA 4QB4A 1EQTA 4A3MH 3TEHB 2UXDL 3JAML 1Y14B 3A74A 4GS3A 3HOZH 2RSNA 1FJGL 3FDTA 1LYLA 3J81i 1PV4A 3S1NH 3ZLMA 5C5MA 1UUPA 4P72A 2JA5G 5K36H 4G7HC 3I3CA 3MXNB 5IOCA 4R4CA 1U4LA 3PUXA 1EY7A 1CSPA 3STBC 4ABNA 3F2BA 2PZWA 2RDFA 1K0SA 3S6AA 3J7AF 5HY6A 1EY6A 2FJ2A 3D3RA 1I6HB 3AU7A 4GKKQ 5CBEE 1QVCA 3PIPA 3U50C 2K4KA 4UP9A 3N3UA 1HNXL 3FKIH 1HFGA 1UAPA 2VL6A 3OTOL 4V0BA 2A5HA 1K28A 1VQEA 2DUDA 4P2CB 1C8CA 3KF6A 4C3IB 4JW0A 4B3TL 3D4DA 3L0OA 4YWKA 3RUZA 1VQBA 4R4TA 3HOYH 1JOQA 2IJ0A 3Q0AA 2RCNA 1LT5D 2E2HH 4PMWA 1VF5C 3HOUB 2UXCQ 4POGA 4DV1Q 1XJVA 1NMFA 4R8NA 4A3LH 5HGQA 5FO9B 4CJ0B 1LT3D 4DKAC 4O1NA 4OX9Q 1JWUD 1AZQA 2KCMA 1R9TH 5NUCA 4DV6Q 3FP9A 1DGSA 2HT1A 5ELCA 3IRBA 5KEEA 4U04A 1S5DD 1CQFA 2ZM6L 1AEXA 1EWCA 2B2UA 1GOZA 4P71A 5CV8A 2RSOA 4L63B 1WJJA 1PH3A 1LT6D 2NZOA 2JA5H 5K36G 3HOYG 3MC0B 3OWFA 2ZXOA 3S2HH 5HGTA 1G91A 2K7VA 1QNKA 4IZ8A 2HD3A 3G48A 4TQUS 4L6TB 2JA6G 2A69C 3ULJA 2VQFL 3G7LA 4FF3A 4JOIC 2A74C 4S3SA 1IBMQ 1Y8NB 5CORA 1SE8A 2F0GA 2JA5B 2VQEL 1V9PA 2Q2IA 1SYCA 3K81C 4JYAQ 1C9OA 1TWFB 1XTCD 3RLOA 5A2QE 2F0KA 3E5SA 1V1PA 1CKMA 1BCPF 3TMEA 1KIXA 3SK5A 5I4DA 3F2CA 3NELA 5C4JB 4A3BG 1VQIA 2IY5B 1N36L 3GTQB 4MN3A 3NBIA 1P16A 3AYHB 4X65L 2HIXA 4LF5Q 2PO4A 3S9WA 3QJYA 4HIMA 1YZ6A 1RF2D 3W3AA 2ZJPA 2EOTA 2WAQG 1XMQL 1FL0A 2NUCA 3QIAA 2R7ZH 1ICFB 1UEAB 3LWEA 4CDFC 3CQZH 1BR9A 2F4VQ 4OGQC 2ES2A 4M16A 1BF4A 3TSSA 4FF4A 3G71A 3EIVA 4C3IH 2HCIA 1BNZA 2N8NA 4XQNA 3UE0A 3FKIB 1QB5D 1TVXA 4EQPA 1PZJD 1NH1A 2QDBA 4LF6Q 2JA8G 1SNPA 1I6HH 2F0EA 1AFPA 4ITRA 2H1EA 2JYOA 2CH4A 1VDZA 3PGZA 2C5CA 3CC4A 1Q8KA 1YNJC 2Z9HA 5DLQE 3TS0A 1PH2A 4LFBQ 4NB3A 1EFWA 4LF4L 1LLRD 2R7ZG 2K05A 2D62A 2UUAL 3S1NB 1GUSA 5DM73 2F0WA 4P73A 3MA2B 1T5XD 4DUZQ 1SJED 1KDCA 2DJFC 2E2JH 1Q86C 1Q1EA 1VQDA 4N8X1 1PZKD 4RHRA 1HA6A 4OO1G 4I65A 1R9TB 2Z6KC 1NNXA 1UE6A 1TS4A 3HOVG 2ALYB 1IBLQ 2PNRC 4Q0FA 4JI8L 3PO3G 2E2HB 1JOOA 3BZKA 4J8QA 1GHKA 1TU2B 2EDGA 2MGSA 3LWUA 3DM3A 2JA9A 3GTMH 1EYCA 1KNAA 3KDFB 3DMUA 2EE1A 3K7AH 2M2LA 4A3GH 4JPBW 1ESRA 2MUYA 5FLXc 2QEXA 2F0LA 1QJOA 4X6AH 1Z9FA 1SYDA 3FHWA 4HIOA 1YBYA 3H0GH 2WB1G 4KKSA 5COYA 5CV5A 1WTPA 1BCPD 2UXDQ 4OIKA 3I8ZA 1A3TA 3KLSA 4P74A 1K3RA 2ZT9C 1IW7C 3FPPA 3CPWA 1MJEA 4XT3B 1JQYD 4XI8A 4HMIA 1VQOA 1Q90A 5LMUL 1ASYA 5ELFA 1I50H 2QGQA 2EY6A 2AQ3B 3JAMc 1YEZA 4B3ML 4Q5VA 1Y1WG 2P5ZX 1XPUA 4I7ZC 3HOZB 2VB2X 4PMBA 4H13C 3TREA 4XXEA 3H0GG 2B8FA 1VQLA 2B2TC 1SFOB 2KCNA 4ZYSA 5IODA 2YTYA 1RDPD 2PW5A 1LTBD 4K5XA 2QA4A 2F0OA 3QOJA 1UEBA 1JB3A 3H09A 4DK6C 2K32A 3K5OA 2YV5A 1SE2A 3UDFA 2BDOA 5BN4A 2RVLA 3VR6A 2VW9A 5JJ6A 1NR4A 1LO5D 4HIDA 2RDHA 1WI5A 2XSCA 3HOVH 4R9WA 1B9NA 1FR3A 3RNUA 1XXGA 4BY7G 1QCBD 1ZYRD 4KK7A 1E3PA 3S24A 1PTOC 2VS1A 3J81E 1K8MA 2FINB 4EX5A 4A3KB 5LMNL 2UXCL 2VZAA 2R93H 2EY1A 2RBMA 4UDUC 3SHGA 1Z47A 3LETA 2M00A 5LL6X 4WJ3M 4DPGA 2YYZA 1SMYD 2HQEA 3EN2A 4K2KA 3HZXA 3I4MH 1LTSD 2KUMA 4NKLA 3JAME 4A4IA 2JXMB 2MHVA 3CRLC 4RCNA 1YNXA 1AP0A 3OMCA 4HCSA 1SNMA 2Z4IA 1HZ9A 2JA6B 4HMJA 1KRSA 2D0PA 5L37A 1Y69U 5KGUA 1BBXC 4IJHA 4LFCL 3A8IE 1B44D 1X6OA 1I4PA 3NTIA 3ERQA 3GD7A 3GTLH 5K5PA 2O5JC 1IYJB 3ZYYX 2BH8A 2C35B 2IW3A 2B2VA 2MNAA 4UHVA 4AIMA 1ML0D 4GOPC 1PFMA 1Q3LA 2B2UC 4C3IG 2ZTDA 1XNRQ 2KEEA 2EIFA 3HOZG 4YIJA 2GVBA 5M5XB 2WACA 3VA5A 5EKIA 4KHPL 2A6HC 2FXQA 2XIWA 4GN5A 2NVTH 1BO0A 1SNCA 3I70A 4HJ7A 4FXKC 3SEBA 3I4OA 3WDNA 1OXVA 1HR0W 2B39A 2QEJC 1HR0L 3VR2A 4BY7H 3BVGA 1X9NA 1JJGA 3KF8B 3KFUA 4BBSG 3GV3A 2QCPX 4DV4L 2NTSA 1I6VC 3J80E 3SE0A 1X3PA 4UPAA 1ZXTA 1JC7A 4HR7B 4DR4L 3T1HQ 1Q12A 2WAQE 4B9XA 3CCJA 4ODGA 1ET9A 1FYCA 4KJOA 4WORA 1SYEA 4JG2A 5CGKA 2A19A 2JA6H 4K6LA 1H9MA 4CBVA 1I4RA 2NVQB 1GUTA 1FNUA 3T53B 4G7OC 1B53A 2CH4W 3J7YW 1FNWA 4DR6L 4YWMA 2Z8LA 5M3FB 2KVMA 1E1TA 4DV2Q 2B63G 5EAYA 1F2YA 2BDNA 4OL7A 4DXFA 2K50A 2OXPA 1IYVA 1TWHB 5JFZA 2R6GA 1H95A 2I5HA 4FYDA 3GTJH 3H94A 3EQLC 2XN9C 1F9PA 1HNZQ 2F0JA 1Y8OB 2J7ZA 4PV1C 4A3IB 4A3KH 3HOUG 3NBHA 4A3EG 1N34Q 4LF4Q 4JCVE 1BBWA 5C5LA 1FGUA 1K83H 3K5LA 1D1IA 4WJWA 5C4XB 1EYGA 2H4OA 1I4QA 3RMHA 2B2YC 1XWEA 2L9HA 1WVLA 4IPDA 3T56B 4HJ5A 2X69A 5ELOA 3PUWA 4JBKA 4DR5Q 1ET6A 3KOJA 4RA8A 4A3EH 1RODA 4RH6A 3I55A 1JCKB 4GOPB 1VS0A 3HP3A 2RHQB 4B9WA 4KN7C 1Z6HA 1SE3A 1WTVA 5EJWA 2Z0SA 1HQRD 3TP7A 4TRDA 1L1OA 4Y52H 3KF6B 5M9OA 1V1QA 2K5WA 3K5NA 3K59A 3VR5A 2V1CC 3NHHA 1WCMG 3C3LA 2JP1A 4IUVA 1EWIA 1HCZA 3EJIA 1HNWL 4IPHA 1PVOA 1OO9B 2F0SA 4RGMA 4QY7A 2E74C 1HZBA 3E3XA 2LKVA 3H0GB 1SNQA 4J1MA 4OIJA 5C44B 3J80i 1CHQD 1I94Q 2Q2HA 1NTGA 4FP5D 2WP8J 4JI5Q 1SROA 4BA1I 3K5MA 1FVIA 1K0RA 5E4WC 4A3FB 1G6PA 2YTVA 3RLFA 4LUVA 3GTMB 2PQEA 4BBSH 4OO1H 3ULPA 4LJZC 4DAPA 2VUMH 4B3MQ 4QCLA 1X56A 2NVXB 2CKZB 5E7NA 2I07B 5JPMC 4B3RL 5E1FA 5I9OA 1QILA 1SEBD 1MGSA 2VQFQ 2Y0SB 1KDAA 3M4OB 2E2IH 2PYKA 1L1OC 1KRTA 4OELB 4K0KQ 4DAYA 3L7ZC 3PUVA 4LAAA 1E0BA 5C3EB 4JYAL 1IW7D 3NXWA 1K3BC 5C3XA 1J5EL 3A0JA 4JI1Q 1ENCA 2B2WA 3URYA 3BDCA 2LS01 5D65A 4GLXA 1NBWA 4ME3A 1VQ7A 3STBD 5JJ7A 5I6YA 4YHHQ 1QZGA 3W1BA 2E75C 2UXBQ 2JJQA 1X32A 3D31A 1LTLA 5CYUA 1BDOA 3U9OA 1B9MA 4X65Q 3PO2G 2DNCA 2B2YA 4B08A 2N78A 2TSSA 4C3JH 1CA5A 1VQ6A 4ZAIA 4LF8Q 4WJ4A 4RWSC 2ZJRA 3Q23A 2NVYH 4RKBA 1D5ZC 5CBAE 4A93H 1JICA 1WTOA 1PH4A 2VNUD 3IKJA 1STHA 2HDMA 5I2YA 2FMCA 4NXNQ 1ENFA 3T16A 4DUYQ 4OWTB 1KNEA 1VQFA 3BVMA 3OIPA 2R7ZB 4TSSA 3ZC7A 1IL2A 1GD7A 2LXKA 4C3HG 2NUNA 3S16H 5M3MB 2NN6H 3W5OA 3PSIA 4HEDA 4JI6L 4LUZA 1HZCA 4DK0A 4BA2I 1PXUA 2AQ2B 4A3DG 3GTQH 2YU9B 3SXHA 5EU0A 2A68C 4L5QA 4U0UA 4RGOS 5IT9c 4L5TA 3A55A 5ELEA 1RJTA 1N33Q 1TWFH 3KLSX 4X3UA 1NSNS 4A3JH 1JWSD 4K8JA 3K6OA 1NJIC 1IHZA 5DNFA 1F9RA 2FMMA 4FF2A 2Z4HA 2ENBA 4CKEA 2Z1CA 4AYBB 1D5XC 1TQOA 4JI8Q 4HSVA 1NCVA 1EL0A 1SR3A 1SXTA 2F0QA 2JSOA 1JMCA 4XQJA 4X3SA 3ZJYC 3R3OA 5CMTA 5JEAJ 1STEA 1ZEQX 1F2MA 2SEBD 5I6WA 4MNOA 2UUBQ 1PZID 3GTKH 3RZDH 4HAEA 3MEFA 3CF5A 1MSGA 3U58A 3CW2C 4BBRB 3S1MB 5A35A 4IJLA 4UP7A 5IWAL 2XRSD 1VQ9A 2WFWA 1SE4A 1EFID 3HRZC 3CCMA 2WIIB 3MHBA 2ZTEA 4BY1B 5IE8A 3IL8A 1B3AA 3KK7A 2AWOA 4BS9A 4X66Q 3VYSA 1W6JA 4BXXG 2CHBD 3GTPB 3NWSA 1SN8A 1E7ZA 3NE5B 2EJFC 1QVFA 1I3QB 1O7IA 3DWAA 1PFBA 5LMUQ 2I46A 1W6KA 3HOYB 3TS2A 1VQJA 5G3LF 1TR5A 3VYRA 1AW7A 3PO2H 5G3LD 1STYA 2MO0A 2F0NA 3HFZB 5CC4A 2UUCQ 1FNVA 3S15H 2H5XA 1K8GA 2JN4A 2RDGA 2B3GA 1HZAA 1A2UA 1RTOA 3M4PA 4JI0Q 1GUGA 1HJPA 4GKJL 2A1AA 1YJ9A 1WCMB 4KD3A 3S14H 4OEMB 1F9QA 1PRTD 1JE4A 2JA8H 4O0AA 3HOWH 4A93G 1WD0A 1B3QA 1PRTF 3TP5A 4X62L 4DR2L 3DWQA 1XNQQ 1SLJA 3MFGA 3J7AV 1LT4D 2BCOA 2F4IA 1STNA 5IP9H 4A75A 1HHVA 2IHEA 5IYDH 1RIPA 2EYPA 1G291 2CQOA 1QOHA 2ICEC 4DU9A 4A3MB 1SNDA 2V4DA 2R92B 3C1FA 1VQ4A 1VMPA 4H02A 4PNYA 3VR4A 2Y0SG 1UE1A 3QB3A 1HNXQ 4GZYC 3PIO3 2OF1A 2EYJA 1CSQA 1F77A 2O5IC 3HKZB 1TWGB 4DNTB 4BXXH 4DV7L 1L1OB 4B3TQ 3V96A 2DY7A 1X3FA 4LFCQ 3CD6A 1A6XA 1AZPA 4LF7L 2WAQB 2IL8A 2G9HD 5FK9C 4RGNA 4DA2A 2F52A 4DR3Q 1KD1C 1LACA 3BYTB 4QF4A 3P75A 5IGGA 2R61A 4IUUA 5M5WH 1U4RA 1YHBA 2A73B 5LL6S 2HCCA 1X55A 4JI4Q 4OX9L 1CK1A 3NBHB 1PH6A 4DV6L 3CCSA 4JI7Q 1RTNA 1J5EQ 4KHPQ 3PQIA 3HOXB 1BCPB 2I5MX 2IT1A 4M1UB 3ULLA 3GTGH 2F6SA 2K5QA 3CP0A 4KY5A 3SVMA 3ND8A 2C9OA 3HOXH 4PZ7A 3KBXA 4ULLA 3TDQA 3PMFA 2WV6D 2KBNA 4XIGS 1B70B 1DYQA 2BE5C 1YJWA 3S17B 2PZTA 4U0SA 2SDFA 3UI2A 5AJ3L 5M5YB 1PH7A 2DNEA 4JC0A 3HOXG 3T51B 1A0IA 2EJMA 1PTOH 1Q81C 4A3DH 1ZYRC 3SE5A 4O42A 1O7ZA 3PF5A 1GUOA 1X54A 2E2DC 4CHTB 3VYUA 1TS3A 1N8RC 5BR8L 5T1GA 4DR6Q 4C2MH 1A3UA 1O80A 3G6JB 2XGTA 2F0HA 1Q1BA 1WTWA 1VQNA 2QKIC 2OTJA 1GXDC 1RCVD 2J4XA 5GAHC 4A3JG 4KV6A 1AN8A 3KYHC 3X3MA 1YIJA 4A3IG 2IWHA 1P8LA 3S1QH 5C6AA 3J80L 2A6EC 4HIKA 4JI3Q 1QVGA 5J39A 4G7ZC 2PNHA 4ZCKA 4G4KA 5AFWA 1K8AC 1TWCB 1HNZL 4N67A 2OCEA 4NMZA 2K33A 1KL9A 5F2DA 1SJHD 3SK6A 1IYUA 5JJIA 1Q8IA 1GVPA 2VXWA 1GJXA 2OEOA 3AQQA 2QF7A 3VR3A 5J22A 2K28A 3RZOB 3DLLA 3CCLA 1N33L 4ILWA 2JA7H 2AKWB 2JEAI 3BS1A 4ZLTF 1C0AA 4R8IA 3A8KE 2WB1E 1TY2A 1DXMA 1BXTA 3S14B 2F0DA 4IFDJ 2ZXRA 1WD1A 1MHWC 4LF6L 5E3FA 1CI3M 4JVZA 1XX8A 3T4AC 3D4RA 1GM5A 1DOLA 3HS0C 1U0LA 1MKHA 1NR2A 3RD4A 4TVAB 4DF7A 1YHQA 4BY1G 3NPPA 1MSHA 4ALPA 4ID6A 2E5LL 4J6HA 2O4XA 3ICEA 3QO2A 1H9SA 1W3SA 5EBDA 3AEVA 4XTCS 1I3QH 4CDCC 4QJFA 4LK1C 1YI2A 2GVAA 3CUCA 4A3CG 4X66L 2IX0A 2PW7A 2O2LD 1MJCA 3J80c 1V1OA 3OTOQ 4BY1H 1Y1WB 3BG3A 1EOVA 1HFNA 1VQ8A 3GTOB 1VF7A 4MHEA 4FXDA 4F88A 3I4MG 4JV5L 2R93G 1KABA 1Y1VH 5IGBA 3CMEA 4U07A 1C7YA 3A8JE 3HKZE 3GTKB 3OHXC 2IX3A 1JT8A 3OIQA 1HH2P 3A56A 3ONAB 4HN7A 2CWPA 1EY9A 5EKLA 3QOLA 1HUMA 4FVMA 2JA7G 1D2BA 1E24A 4X64Q 1QUQA 5EKKA 4K0KL 2LY7A 1A8VA 2FFKB 4V190 3AFQA 3NP8A 2LXJA 1BKBA 1S5FD 1JJ2A 3OSOA 1F9SA 3DHQA 2NBFA 5DEHA 4XT1B 2B2VC 1I4XA 2L55A 4DR2Q 3A7LA 1KQSA 1XNQL 2EXZA 3KBGA 5GROA 4DFAA 1KLGD 3LX0A 1EY5A 1G51A 4QMGA 4JBMA 2KENA 3K7UC 2KCCA 1TS2A 1GO3E 1EYAA 3CXCA 1ONLA 2NTTA 2L5TA 3NUCA 1U5KA 4QUCA 1YJNA 4UY8C 4YY3L 4KN4C 4KHZA 3M3YB 4X3TA 3F1ZA 1IZ6A 3EROA 5KNCA 2MFIA 2NN6I 4A3FG 1ZKOA 4NXML 3BJUA 3MTSA 1L0WA 4P75A 1HXYD 2B63B 1ENAA 2L4NA 3EA6A 3QG1A 2NB0A 2B8GA 2Q2TA 2NYZD 5KRUA 4U68A 1B2TA 4NXNL 5EQ0A 5IYCG 4DV7Q 5IYBH 3FPUB 2RCFA 2CW0C 1TXYA 4QGUA 1F2LA 1EIHA 4YCWA 5KYIA 5C3EG 1N32L 1UE7A 1N36Q 1XMOQ 5C0XG 5EBCA 4KKUA 4OXPA 2A8VA 2NVYB 1AH9A 4DR3L 3L3OC 5H1SE 5JVH3 4JI6Q 1JE5A 3S1RH 1OXUA 5JVG3 1WFQA 3OW7A 4JI4L 1VQHA 4WRDA 4ZK9B 1BQQT 1EY0A 4FXGC 2PZUA 4QUFA 1J9OA 3PIP3 1EY8A 2A68D 2VB3X 2QDLA 3CHBD 4A76A 4DV5L 2K04A 3PIOA 1YITA 3M4YA 2B2TA 3E0EA 4U673 2OT2A 4R4QA 5CV7A 4R4OA 4KY6A 3CMAA 3IFTA 3CC7A 3E9HA 3BZCA 4N9TA 4IN3A 1D7QA 3GQBA 2AUKA 5JOBA 4GNXB 2BA0A 2N88A 1STAA 5FKAC 2TMPA 3UDIA 5EGTA 1EOTA 2NUDA 1T5EA 4A3BB 1I5FA 2NVXH 2UUBL 1TWAB 3TN2A 2EY2A 4LW1A 5IT9L 2EXDA 2Q8RE 4DUZL 5JJLA 5FLMG 4GN4B 4RKLA 1KDBA 1DOKA 2LSSA 3SR1A 3I56A 1DCZA 3MXNA 1RD9D 3V2TA 2BE5D 5C44H 1O7LA 1EIYB 2L12A 1G8ZD 2F0FA 4B3SQ 3S1RB 1VQAA 3QR8A 4JI3L 4UAIA 5D14A 5GAEC 3L2PA 3KF8A 1X3GA 2XTIA 4H0LC 1STBA 3T1HL 1XMQQ 1M4VA 4LFAL 3TP6A 1L2FA 2L15A 2Z6KA 3OYYA 2F0TA 2SOBA 4DAMA 2EQSA 3OWEB 4OHJA 2EYHA 1BUVT 4IPGA 3AFPA 1IKMA 4HTHA 3K57A 2G03A 4A3EB 1II3A 4DV2L 1PMRA 4FF1A 3C2PA 3DEPA 2OTLA 4L5SA 1JWMD 2DY8A 4K8IA 5D3IB 5CV6A 1QE6A 4KMUC 3E0JA 3MZ5A 1JJCB 1CZGA 4I7AA 1A2TA 3I2ZA 1PFSA 1QWYA 4NP5A 4X62Q 4KY7A 1E2ZA 3M4QA 4IO9A 4POFA 3M7NA 1EU4A 2EY5A 1VQ5A 2I0QA 3I4LA 2E5LQ 2VY3A 1K83B 3JAMi 1SBBB 2ZXPA 4DV3L 3WWVA 4K5WA 5JEAH 1E22A 5IYBG 1S4ZA 2A69D 1Q46A 1WOCA 3NTKA 1EU3A 4Y7NH 2ZJQA 2KJXA 3TQYA 1B1ZA 3S2DB 4IFDH 5M3FH 4IQZA 3CAMA 5CKLA 5EPKA 3IFDA 1M1KC 3PUZA 5IIFA 1KC8C 2R92G 4JV5Q 1D1KA 3W1GA 1D6EC 2KHJA 1PLFA 1AE3A 1V1PB 1ESFA 1CKNB 1A15A 3RZOH 5JPNC 1HTLD 2LMCB 1RL2A 5M3FG 1EWHA 4XDXA 5LHY1 3OPOA 1ILQA 4RG1A 3GTOH 4CJ2C 1RHPA 1Y1WH 4HCEA 2ID0A 3Q22A 3PO3B 3ER0A 5I2XA 3NQIA 2G5DA 3FVQA 1NE3A 1SMYC 1PDQA 4MTKA 5BN5A 1MI2A 1S72A 4A3GG 2N3SA 2JQOA 3HEJA 4C3HH 3SK8A 3H3VI 1GUWA 1MIUA 2A6HD 1SMXA 2F3WA 4C2MB 1PYBA 2ZM6Q 1STGA 3GO5A 3KDFA 2XNAC 2RHSB 3T1YL 1XPRA 4EQOA 1X3QA 5C4ZA 3K0YA 4HSPA 4A3DB 2BOSA 5IP9G 3NQTA 4CDEC 5CMDA 1X3EA 2K5NA 3U4VA 4JI2L 1U4PA 1SDFA 3GTLB 1CM9A 4GOPA 4DAYB 3I4NH 2QILA 1E2VA 4A3CH 3D0FA 3FKIG 2M9VA 4HJ9A 1DONA 5BR8Q 1VQCA 1PHJA 3J7A5 4OWWB 4GLAC 4CJ1B 1EQRA 3DWPA 3R2IA 1BBUA 5DAUA 4HJAA 3A7AB 4IOCA 3I4MB 1KAWA 4BBRG 1ASZA 1VQPA 1HTPA 1K73C 1PFNA 1M90C 2EYMA 5IP7H 1CTMA 5M5WB 4AH6A 2L11A 4LF5L 2L1BA 3IAYA 1EQVA 1D5MC 4PZ8A 3S1QB 4LF8L 4DGZA 2WKCA 5FLMH 2MP1A 4MZ9A 4H7BA 1D8LA 1KTKA 3CRKC 3H91A 4LF9Q 4K5VA 3I4NG 5IP7G 1ILPA 1F2ZA 2K6AA 1LUZA 5FO8B 5C0XI 2G9DA 1PTOB 5GQOA 3DXJC 1LV9A 4GLVB 3H15A 2A6ED 3D6WA 5E4XA 1AE2A 3H3VC 1QUQB 2R7DA 1GHJA 1VQGA 1OXSC 3CCEA 1EEID 1Q7YC 4N9PA 2D0OA 5CV9A 1NY4A 5BN3A 3WOEA 5C4HA 5JFFA 2ASBA 3FEWX 3R2TA 4LFBL 2AHOB 2PMZB 1H9SB 5HURA 1CZWA 1I50B 1IBKQ 3H3VH 2KA7A 2K52A 4DK3C 2K14A 3G6EA 1B8AA 1S5ED 3WOFA 5ELBA 2GN5A 3CU7A 2RKSA 3HOWB 2JA8B 3I4NB 4M8AA 2L0CA 1I4HA 1WCMH 3I72A 1V8QA 2OQKA 4F87A 4DR5L 4JOIA 2ICIA 5IGCA 2K1BA 1NUCA 5D3DA 4ZQ3A 3SK4A 1IBLL 5ELNA 1L0YB 3UE1A 1H9KA 3KJOA 3RLNA 4OWXB 4KI0A 4K6DA 1A3VA 2ATWA 3K0XA 1EZ8A 3M85A 3KLWA 2K75A 3SGIA 2K03A 4YWLA 3PO2B 2HUGA 1O78A 3CCRA 3T13A 4C3HB 4DV0Q 1HNWQ 1LM0A 1SYGA 2N55A 1YNNC 1T9HA 5JJZA 3F2UA 4XYOA 2R92H 2MO1A 2Q2UA 3MXUA 2UU9Q 4AYBE 1BOSA 1SYFA 3PO3H 1IL8A 4JI5L 4GNXC 1LTTD 3SDZA 2DGYA 3NK9A 3GDEA 1IXRA 4LNQA 1JR0D 4Z9CB 2E2JB 1WYDA 3S1MH 3CKIB 1N34L 3RZDB 2F03A 1DJRD 4X2DA 3HKSA 1S40A 4DV3Q 3CCQA 4B3RQ 4H44C 1ICWA 3J81j 2CFMA 2F0VA 4IURA 4U0ZA 4L5RC 1KHIA 2ZTCA 4YY3Q 3S2DH 4PMCA 3MXGA 1CA6A 3J7ZC 3Q8DA 3ZCBA 2CVRA 4JI0L 4Y7NB 5EPJA 1S5CD 4DR7Q 4KLKA 2OQ0A 4F8MA 2XWBB 3S15B 4QL5A 1W2BA 2IHFA 3KUPA 1BCPC 3J81c 1DD2A 3FMCA 4C3JG 1CFMA 1FJGQ 5KYLA 3RN2A 2AMCB 1S5BD 1B50A 1TY0A 1PH9A 4O2DA 3CQZB 1M8AA 2EJGC 2VUMG 2PCFB 2YU9H 1C4QA 3TP8A 3DUZA 4FO2A 3GTPH 3F2DA 4IUTA 5M3MH 5KIXA 1YNND 1FGBD 1VMCA 3ERSX 3JC66 3M7GA 5ISRA 3S16B 3ITPA 1XYIA 1CUKA 2Q8IB 5IGEA 4QIWE 4DV5Q 1C48A 1I94L 5C4JH 3UDGA 1CKNA 1EIFA 4BBRH 4DUYL 4AQYL 3NTHA 5C44G 3U4ZA 2FHTA 4PZ6A 5TSSA 4DNIA 4LUOA 2EPBA 2CW0D 2B2WC 4RGTA 3V05A 3Q24A 3BVZA 5J3BA 5C3WA 4A93B 4EVOA 2IX1A 1HQMC 2BH2A 2N49A 2KECA 3KJPA 3BDLA 2J0TD 1PA6A 3H6MA 4EGVA 3HG9A 2YTXA 4RAUC 2K5VA 3S2HB 4JI2Q 4N8FA 4FNFA 3CPFA 3F8TA 3MFYA 1HPCA 2XVSA 1XNRL 4TKOB 3VA7A 4A3JB 2KOLA 1PTOD 2QW7A 4RMFA 1HRJA 1OXXK 4JI1L 4KJNA 4LMQD 3CC2A 1TWAH 5FJ8H 4ME5A 3I90A 4A3BH 5C3EH 4LWCA 4DR1L 1HR0Q 4XQQA 2UXBL 4B3SL 3J81L 3VDYA 1QNUA 2F1MA 2E2IB 5AJ3Q 3GV6A 4DNRB 3OOCA 3NEMA 4A3KG 1LTRD 4ZKCB 3HOUH 5FOBB 3LNNA 3EBEA 4LFAQ 1YHAA 5C4XG 2DN8A 1IBML 2VUMB 1I4GA 4X2EA 4UP8A 2VQEQ 4BBSB 2IPKD 1TKWB 2NZHA 4RFBA 1MD2D 4A3FH 4HJ8A 2CQAA 5IWAQ 2E8GA 4KKTA 3LGJA 2X6LA 4QIWB 4NPSA 4OO1I 2HHHL 1SSOA 5JEAG 1E1OA 2PI2A 4EQ5A 3HGBA 4C3JB 1JB7A 3MWYW 1PYWD 3FRPB 5FLXL 3PV0A 4NDXA 2PQAA 2Z6BA 3AB9A 2K5HA 1SYBA 5J1ZA 1DOMA 4PQXA 4ZUJA 1OXTA 2CCZA 3MEHA 4IFDI 2XRQD 3DEOA 2KCTA 4C56C 3G4SA 3AMUA 4AYBG 2F3IA 3X3NA 2F0UA 1H9RA 5I9PA 3UDXA 2AUJD 2NZ1D 4IUQA 3NWTA 2F4VL 4EQNA 2NN6G 1PRTB 2UUCL 4A3LG 3D6CA 1QG7A 2K5DA 1PH8A 2B63H 5CR3A 5JAVA 2F0PA 2SNMA 5KNDA 1EY4A 1QZHA 1OTCA 3M3YH 3M4OH 1KAAA 3R8BA 2LFNA 1DZ1A 4GN3B 3D8GA 4X2CA 3ND9A 2D2CC 1G2SA 1EUJA 1CQVA 4IPCA 5C4XH 5GAGC 3C1EA 4K2LA 1CT1D 4C1NI 2AWNA 3OMGA 2UUAQ 4PG3A 1WTHA 1EZ6A 4RHSA 1K9MC 2KHSA 3CCVA 1U4MA 4YCVA 1XPOA 1VQMA 5FO7B 3GTJB 1B7YB 1A62A 4E6IA 4GKKL 1YNJD 4IUPA 5DM63 2UU9L 4KTAA 4MTNA 3NSWA 2F0MA 1EQQA 3L9AX 3BZDB 2E76C 5IY0A 3O13A 1WTQA 2GA4B 3EFXD 3U9SA 2RA4A 1UNSA 1UWVA 2JK8A 3HOWG 3T1YQ 2PI2E 2NVQH 3DM1A 5EPLA 2F0IA 3OW2A 3I7FA 1S3OA 1WTRA 1LTAD 1Y8PB 2MPMA 2MJ8A 4A3MG 1Y1VB 1JORA 2D5DA 5GADC 2WINB 2EZVA 1VCIA 2JE6I 3K8AA 3N6RA 4CKCA 4LU4A 4DV1L 2RQXA 3K80C 3E6ZX 1YVCA 1TIID 1LTGD 4DR7L 1G6ZA 2F3VA 4BY7B 3PUYA 4JI7L 5T1IA 4GKJQ 3VYTA 2NWGA 3P20A 1EEFD 4QQBX 2WB1B 1A63A 3KLRA 1EYDA 3TZDA 3A54A 5A2QL 1TS5A 2NVTB 4DAVA 2EYLA 1N9WA 5M3MG 1NMGA 4APVA 4YHHL 2WKDA 2BA1A 1LTID 4PY3A 1R4QB 4A3IH 2PMZE 2OWOA 2SNSA 5C0XH 4CDDC 1O7YA 1TWHH 5LMNW 1CKOA 4JBWA 5KNBA 4NXMQ 1PRTC 3RN5A 2R7FA 4LF9L 1Q82C 2R3ZA 1V43A 2D9UA 4NW2A 4C1NK 1B4OA 1KLUD 2B29A 4MIUA 1H9JA 2JA7B 1NAPA 2KEDA 4FDBA 4AQYQ 1DM0B 2K01A 3A5ZB 3W2DA 1VQKA 1N32Q 2I5LX 3HKZG 4CKBA 1XMOL 3CCUA 3TRZA 2KQ3A 4IUNA 3B6YA 1FD7D 4LF7Q 1SNOA 1TWCH 3QWNA 1CHPD 1PH1A 1U9RA 3D4WA 3PCOB 1R4PB 2Q8TA 4WFN3 5LMNQ 4KD4A 2R93B 5IYCH 1UE5A 4ZKBB 2HQLA 1IKLA 1J6QA 4IFDG 1IBKL 3RR5A 1PTOF 4WGJA 4R4IA 4CGYB 4L8JA 5M5XH 3A5UA 3HOVB 2DJGC 1E2WA 5CV4A 2HIVA 4DR1Q 4DN4M 3K58A 2KHIA 3Q6SA 3EVQA 1EIGA 4F7XA 4J15A 1RKNA 2AQ1B 4ZUIA 2EYFA 5IGDA 5M5YH 5FLXE 1SRUA 5FJ8G 4GNXA 1SFOH 3S17H 5JJKA 1HUNA 3BU2A 3I91A 1MBYA 4ZRZA 1WTXA 2XWJB 1SAPA 1KXLA 4KHVA 3PF4A 1K8OA 5C0XJ 2Y0SE 3R93A 1TT2A 3SHLA 3GTGB 4DV0L 1PH5A 4YCUA 5IGFA 1GKHA 4BWGB 3BYYB 2HHHQ 1GUNA 1Y1VG 1JOKA 4RCOA 1X65A 5IYDG 3MXPA 2JEBI 1PYSB 4DK1A 3MVVA 2CWAA 2HDLA 3NENA 4DV4Q 1LABA 2PPBC
chains in the Genus database with same CATH topology
1GM5A 3UE1A 2MQHA 1HNZQ 1U0LA 1MKHA 4OONA 3KJOA 3RLNA 2RF4A 4OWXB 5CGLA 4TVAB 4A3KH 1YHQA 3HOUG 4DR4Q 4BY1G 4A3EG 1N34Q 4JCVE 4KI0A 4LF4Q 1BBWA 2ATWA 1FGUA 3K0XA 1K83H 3M85A 3KLWA 2K75A 4ALPA 3SGIA 4YWLA 2E5LL 1TWGH 3ICEA 3CCRA 1EYGA 1W3SA 3AEVA 4IOAA 4DV0Q 4XTCS 1HNWQ 1LM0A 1I3QH 3E9IA 4QJFA 1XTDA 1YI2A 4IPDA 4R1JA 2GVAA 3CUCA 1T9HA 4JBJA 3SN9A 2PQAB 4X64L 4HJ5A 4X66L 4A3CG 5ELOA 2IX0A 3PUWA 1BVSA 2MO1A 2Q2UA 2R92H 4JBKA 3M9BA 2UU9Q 4DR5Q 4AYBE 4A3MH 3TEHB 3KOJA 1MJCA 3PO3H 2UXDL 3J80c 1Y14B 3A74A 3OTOQ 4A3EH 4GS3A 4JI5L 4GNXC 4BY1H 3I55A 1EOVA 3HOZH 4GOPB 2DGYA 1VS0A 1VQ8A 2RHQB 3GDEA 1FJGL 1IXRA 3I4MG 1LYLA 4JV5L 3J81i 4LNQA 2R93G 1WYDA 1Y1VH 3S1MH 1PV4A 3CMEA 1N34L 4U07A 1C7YA 2Z0SA 3S1NH 3HKZE 3ZLMA 4X2DA 3HKSA 1L1OA 1S40A 1JT8A 4P72A 4Y52H 3KF6B 4DV3Q 1HH2P 3CCQA 2JA5G 1V1QA 4B3RQ 3MXNB 2V1CC 1WCMG 3J81j 2CFMA 4R4CA 4U0ZA 2CWPA 1KHIA 2ZTCA 3PUXA 4L5RC 1CSPA 1EWIA 3STBC 4YY3Q 1HNWL 3F2BA 1PVOA 4IPHA 3S2DH 3S6AA 3J7ZC 5HY6A 4QY7A 3Q8DA 2JA7G 1HZBA 1E24A 3ZCBA 4GKKQ 4X64Q 3PIPA 1QVCA 1QUQA 3U50C 4JI0L 4K0KL 1A8VA 4DR7Q 2K4KA 4KLKA 3AFQA 2OQ0A 3J80i 2LXJA 4UP9A 1BKBA 3N3UA 2Q2HA 1NTGA 1JJ2A 1I94Q 3FKIH 1HNXL 4QL5A 1W2BA 2IHFA 2VL6A 3OTOL 2WP8J 4JI5Q 3J81c 1VQEA 2DUDA 4DR2Q 1FJGQ 1SROA 3KF6A 4BA1I 3RN2A 1FVIA 1K0RA 1KQSA 4YWKA 3L0OA 2AMCB 4B3TL 5GROA 1XNQL 2YTVA 1G6PA 3RLFA 4LUVA 1PH9A 4O2DA 4BBSH 1VQBA 1G51A 4R4TA 3ULPA 4JBMA 3HOYH 2KENA 3K7UC 4B3MQ 2VUMH 1X56A 1GO3E 2RCNA 2CKZB 3CXCA 5E7NA 2VUMG 4A93G 4B3RL 2E2HH 4PMWA 2YU9H 1U5KA 1YJNA 2UXCQ 4UY8C 3GTPH 4YY3L 3F2DA 2VQFQ 4POGA 4KHZA 4DV1Q 4JI7L 5M3MH 1XJVA 3F1ZA 1IZ6A 2E2IH 3JC66 1NMFA 3ERSX 4A3LH 5HGQA 2MFIA 1L1OC 1KRTA 2NN6I 4DKAC 4A3FG 4NXML 3BJUA 4OX9Q 1L0WA 4P75A 1CUKA 4K0KQ 3L7ZC 2KCMA 4QIWE 3PUVA 1R9TH 4DV6Q 4JYAL 3FP9A 4DV5Q 1J5EL 1DGSA 3A0JA 1I94L 2Q2TA 5C4JH 3UDGA 2HT1A 1CKNA 1EIFA 3IRBA 4U04A 4NXNL 4JI1Q 4BBRH 5IYCG 4DV7Q 5IYBH 4DUYL 2ZM6L 4GLXA 4AQYL 1NBWA 5C44G 3U4ZA 4DNIA 4PZ6A 1TXYA 4ME3A 4LUOA 4P71A 4QGUA 1VQ7A 4YCWA 3STBD 5C3EG 1N32L 5JJ7A 1UE7A 4YHHQ 1QZGA 3W1BA 1N36Q 2JJQA 1XMOQ 1WJJA 2UXBQ 5C0XG 1PH3A 5J3BA 2NZOA 3D31A 1LTLA 2JA5H 3HOYG 5K36G 4OXPA 2A8VA 2IX1A 4X65Q 3PO2G 2BH2A 2N49A 3S2HH 1AH9A 4DR3L 3KJPA 2N78A 5H1SE 4JI6Q 1JE5A 3G48A 4TQUS 1PA6A 3S1RH 1OXUA 4C3JH 2JA6G 1VQ6A 2YTXA 3ULJA 2VQFL 4LF8Q 4JOIC 4WJ4A 2K5VA 1WFQA 4JI2Q 4JI4L 1VQHA 2ZJRA 1IBMQ 2NVYH 3CPFA 1SE8A 3F8TA 1XNRL 4A93H 2VQEL 1V9PA 2Q2IA 1PH4A 2VNUD 3K81C 4A76A 4JYAQ 1C9OA 4DV5L 3PIOA 4RMFA 3RLOA 1YITA 1OXXK 3E0EA 4JI1L 4NXNQ 1CKMA 4R4QA 1KIXA 4R4OA 4DUYQ 4OWTB 3F2CA 3CC2A 3NELA 1TWAH 4A3BG 5FJ8H 1VQIA 1VQFA 3CMAA 4A3BH 5C3EH 4LWCA 3E9HA 3CC7A 4DR1L 1HR0Q 2IY5B 3BZCA 1N36L 2UXBL 3ZC7A 4B3SL 1P16A 1IL2A 1D7QA 3AYHB 3VDYA 4X65L 4GNXB 1GD7A 2LXKA 2HIXA 3S16H 5AJ3Q 4LF5Q 2BA0A 3W5OA 4HIMA 1YZ6A 3PSIA 4JI6L 4LUZA 1HZCA 3NEMA 3UDIA 2ZJPA 4A3KG 3HOUH 4BA2I 4A3DG 2WAQG 1XMQL 3GTQH 3EBEA 4LFAQ 1FL0A 1YHAA 2R7ZH 5EU0A 4L5QA 5C4XG 1I5FA 1IBML 4U0UA 2NVXH 2UUBL 5IT9c 3CQZH 4L5TA 4X2EA 4LW1A 4UP8A 2EXDA 2VQEQ 2F4VQ 2ES2A 4DUZL 4M16A 2NZHA 4A3FH 1TWFH 3G71A 3EIVA 5IWAQ 4HJ8A 2E8GA 4C3IH 5FLMG 1N33Q 4GN4B 5JJLA 2N8NA 3UE0A 3LGJA 2LSSA 4A3JH 4NPSA 3I56A 4OO1I 1NJIC 2HHHL 5JEAG 1E1OA 5C44H 2PI2A 4EQ5A 4LF6Q 2JA8G 1EIYB 4B3SQ 1JB7A 1I6HH 1VQAA 4JI3L 3PV0A 5GAEC 2PQAA 4JI8Q 4ITRA 3L2PA 1SR3A 2K5HA 1JMCA 1X3GA 3PGZA 2XTIA 1OXTA 3ZJYC 2CCZA 5CMTA 4IFDI 3T1HL 5JEAJ 3CC4A 1Q8KA 2KCTA 5DLQE 1XMQQ 3TS0A 3G4SA 1PH2A 4NB3A 4LFBQ 4AYBG 1EFWA 4LF4L 2F3IA 4LFAL 2R7ZG 1L2FA 2D62A 2L15A 4MNOA 2Z6KA 3OYYA 2UUAL 2UUBQ 3UDXA 3GTKH 3RZDH 3MEFA 4DAMA 3CF5A 3U58A 2EQSA 2F4VL 3CW2C 4P73A 2UUCL 2NN6G 4DUZQ 4A3LG 4IPGA 2E2JH 1Q86C 4IJLA 4UP7A 3AFPA 1Q1EA 5IWAL 1VQDA 1VQ9A 2WFWA 1PH8A 4OO1G 2G03A 3CCMA 2ZTEA 2B63H 5IE8A 4DV2L 1OTCA 2Z6KC 1QZHA 2AWOA 4X66Q 2OTLA 1UE6A 4L5SA 3M3YH 3M4OH 4BXXG 3HOVG 2ALYB 1SN8A 1IBLQ 1E7ZA 4GN3B 4JI8L 4X2CA 1JJCB 3PO3G 1QVFA 3BZKA 3I2ZA 1PFSA 1O7IA 4X62Q 1EUJA 3DM3A 4IPCA 5LMUQ 3M4QA 5C4XH 3TS2A 1VQJA 2JA9A 4IO9A 4POFA 5GAGC 3M7NA 3GTMH 3PO2H 1VQ5A 2MO0A 3KDFB 2I0QA 2E5LQ 2AWNA 2VY3A 3K7AH 4PG3A 2UUAQ 4A3GH 3HFZB 3JAMi 4DV3L 1K9MC 3WWVA 3CCVA 1XPOA 4YCVA 2UUCQ 3S15H 5FLXc 2QEXA 2H5XA 1K8GA 1VQMA 1E22A 5IYBG 2B3GA 1HZAA 1Q46A 1WOCA 4X6AH 1Z9FA 1B7YB 3FHWA 4Y7NH 1YBYA 1A62A 3H0GH 4HIOA 2ZJQA 2WB1G 3M4PA 4GKKL 4JI0Q 3TQYA 1HJPA 2UU9L 4GKJL 2A1AA 4MTNA 2UXDQ 1YJ9A 5M3FH 3S14H 3CAMA 5CKLA 1EQQA 4P74A 1K3RA 5IY0A 1MJEA 3CPWA 1M1KC 2JA8H 4O0AA 3PUZA 1KC8C 3HOWH 2R92G 4JV5Q 4XI8A 3W1GA 1UWVA 4X62L 4DR2L 1VQOA 2JK8A 2KHJA 5LMUL 3T1YQ 3HOWG 1AE3A 2PI2E 2NVQH 1CKNB 3OW2A 1SLJA 1XNQQ 3I7FA 3RZOH 1S3OA 1ASYA 4A3MG 1I50H 1RL2A 2QGQA 5M3FG 3JAMc 1YEZA 5IP9H 4B3ML 5GADC 4A75A 4RG1A 1Y1WG 1XPUA 3GTOH 2IHEA 5IYDH 3TREA 1RIPA 1Y1WH 1G291 3H0GG 1VQLA 2CQOA 2ID0A 1VCIA 2JE6I 3K8AA 3ER0A 2YTYA 4LU4A 4DV1L 3K80C 1YVCA 2QA4A 1VQ4A 4DR7L 1NE3A 1UEBA 4H02A 3PUYA 2Y0SG 4DK6C 1S72A 2N3SA 1UE1A 2JQOA 2YV5A 3UDFA 2VW9A 1HNXQ 4A3GG 4GKJQ 5JJ6A 4C3HH 4HIDA 1WI5A 3H3VI 1CSQA 1MIUA 4QQBX 1A63A 1SMXA 3HOVH 1PYBA 4BXXH 4DV7L 3RNUA 2ZM6Q 1L1OB 4B3TQ 4BY7G 3GO5A 3KDFA 2RHSB 1X3FA 3T1YL 4LFCQ 1XPRA 3CD6A 1N9WA 1E3PA 3S24A 1NMGA 5M3MG 2VS1A 4APVA 4YHHL 2BA1A 4EX5A 4PY3A 4A3IH 4LF7L 5IP9G 2PMZE 2OWOA 2F52A 4DR3Q 1KD1C 5LMNL 2UXCL 2VZAA 2R93H 1TWHH 5LMNW 1CKOA 3SHGA 1X3EA 3LETA 1Z47A 4JBWA 2K5NA 5M5WH 1YHBA 3U4VA 4NXMQ 4WJ3M 1X55A 4JI2L 4JI4Q 4OX9L 3RN5A 2R7FA 4DPGA 4LF9L 1Q82C 4GOPA 2YYZA 4DAYB 1V43A 3EN2A 3NBHB 4DV6L 3CCSA 1PH6A 3I4NH 3I4MH 4JI7Q 4A3CH 3D0FA 3FKIG 1J5EQ 4KHPQ 2B29A 4A4IA 4HJ9A 2I5MX 2IT1A 3ULLA 5BR8Q 1VQCA 1YNXA 4FDBA 2F6SA 4AQYQ 4GLAC 1PHJA 3CP0A 1EQRA 4OWWB 3GTGH 3J7A5 1HZ9A 3A5ZB 1BBUA 1KRSA 3HOXH 4HJAA 2D0PA 1VQKA 1N32Q 2I5LX 4PZ7A 3HKZG 4IJHA 4LFCL 1XMOL 3CCUA 3TRZA 4XIGS 1X6OA 2KBNA 4IOCA 1KAWA 3B6YA 1B70B 3GD7A 4BBRG 1YJWA 1ASZA 1VQPA 3GTLH 4LF7Q 4U0SA 1K73C 1TWCH 1M90C 1IYJB 1PH1A 2BH8A 2C35B 5IP7H 3PCOB 4AH6A 5AJ3L 4LF5L 5LMNQ 1PH7A 2MNAA 4JC0A 3HOXG 4AIMA 5IYCH 4GOPC 1UE5A 4PZ8A 4LF8L 2HQLA 1A0IA 5FLMH 1J6QA 2ZTDA 1XNRQ 4IFDG 4MZ9A 1Q81C 1D8LA 4LF9Q 4A3DH 2EIFA 3SE5A 1IBKL 3HOZG 3RR5A 5IP7G 2GVBA 3PF5A 1X54A 3I4NG 4WGJA 4KHPL 4GN5A 2FXQA 2NVTH 4R4IA 1N8RC 5BR8L 1LUZA 5M5XH 4HJ7A 4DR6Q 4C2MH 3A5UA 3I4OA 2XGTA 1OXVA 1Q1BA 2HIVA 1HR0W 5C0XI 1VQNA 2OTJA 5GQOA 4DR1Q 1HR0L 2KHIA 5GAHC 4A3JG 4GLVB 3H15A 4BY7H 1AE2A 4J15A 1X9NA 1QUQB 3KYHC 1YIJA 3S1QH 4A3IG 2R7DA 1P8LA 3KF8B 3KFUA 1JJGA 4BBSG 1VQGA 1OXSC 4DV4L 5M5YH 3CCEA 4HIKA 1QVGA 4JI3Q 1Q7YC 2D0OA 2PNHA 1NY4A 1K8AC 1HNZL 1SRUA 5FJ8G 4N67A 2OCEA 4UPAA 5JFFA 4GNXA 1SFOH 2ASBA 1KL9A 3S17H 5JJKA 4DR4L 3BU2A 3T1HQ 5JJIA 4LFBL 1Q12A 1GVPA 2AHOB 2WAQE 3CCJA 1KXLA 3AQQA 3PF4A 4JG2A 5C0XJ 2A19A 2JA6H 1IBKQ 3H3VH 2Y0SE 3DLLA 3CCLA 2K52A 4DK3C 1N33L 2K14A 3G6EA 1B8AA 2AKWB 2JA7H 2JEAI 4DV0L 1PH5A 2GN5A 4YCUA 1C0AA 1GKHA 4DR6L 2WB1E 2HHHQ 4YWMA 1WCMH 1Y1VG 4DV2Q 1E1TA 4IFDJ 2OQKA 1X65A 5EAYA 5IYDG 4LF6L 2JEBI 2B63G 1PYSB 2K50A 4DR5L 4JOIA 2CWAA 3NENA 5JFZA 2R6GA 4DV4Q 1H95A 2I5HA 1IBLL 5ELNA 3GTJH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GM5 A;  3UE1 A;  2MQH A;  1HNZ Q;  1U0L A;  1MKH A;  4OON A;  3KJO A;  3RLN A;  2RF4 A;  4OWX B;  5CGL A;  4TVA B;  4A3K H;  1YHQ A;  3HOU G;  4DR4 Q;  4BY1 G;  4A3E G;  1N34 Q;  4JCV E;  4KI0 A;  4LF4 Q;  1BBW A;  2ATW A;  1FGU A;  3K0X A;  1K83 H;  3M85 A;  3KLW A;  2K75 A;  4ALP A;  3SGI A;  4YWL A;  2E5L L;  1TWG H;  3ICE A;  3CCR A;  1EYG A;  1W3S A;  3AEV A;  4IOA A;  4DV0 Q;  4XTC S;  1HNW Q;  1LM0 A;  1I3Q H;  3E9I A;  4QJF A;  1XTD A;  1YI2 A;  4IPD A;  4R1J A;  2GVA A;  3CUC A;  1T9H A;  4JBJ A;  3SN9 A;  2PQA B;  4X64 L;  4HJ5 A;  4X66 L;  4A3C G;  5ELO A;  2IX0 A;  3PUW A;  1BVS A;  2MO1 A;  2Q2U A;  2R92 H;  4JBK A;  3M9B A;  2UU9 Q;  4DR5 Q;  4AYB E;  4A3M H;  3TEH B;  3KOJ A;  1MJC A;  3PO3 H;  2UXD L;  3J80 c;  1Y14 B;  3A74 A;  3OTO Q;  4A3E H;  4GS3 A;  4JI5 L;  4GNX C;  4BY1 H;  3I55 A;  1EOV A;  3HOZ H;  4GOP B;  2DGY A;  1VS0 A;  1VQ8 A;  2RHQ B;  3GDE A;  1FJG L;  1IXR A;  3I4M G;  1LYL A;  4JV5 L;  3J81 i;  4LNQ A;  2R93 G;  1WYD A;  1Y1V H;  3S1M H;  1PV4 A;  3CME A;  1N34 L;  4U07 A;  1C7Y A;  2Z0S A;  3S1N H;  3HKZ E;  3ZLM A;  4X2D A;  3HKS A;  1L1O A;  1S40 A;  1JT8 A;  4P72 A;  4Y52 H;  3KF6 B;  4DV3 Q;  1HH2 P;  3CCQ A;  2JA5 G;  1V1Q A;  4B3R Q;  3MXN B;  2V1C C;  1WCM G;  3J81 j;  2CFM A;  4R4C A;  4U0Z A;  2CWP A;  1KHI A;  2ZTC A;  3PUX A;  4L5R C;  1CSP A;  1EWI A;  3STB C;  4YY3 Q;  1HNW L;  3F2B A;  1PVO A;  4IPH A;  3S2D H;  3S6A A;  3J7Z C;  5HY6 A;  4QY7 A;  3Q8D A;  2JA7 G;  1HZB A;  1E24 A;  3ZCB A;  4GKK Q;  4X64 Q;  3PIP A;  1QVC A;  1QUQ A;  3U50 C;  4JI0 L;  4K0K L;  1A8V A;  4DR7 Q;  2K4K A;  4KLK A;  3AFQ A;  2OQ0 A;  3J80 i;  2LXJ A;  4UP9 A;  1BKB A;  3N3U A;  2Q2H A;  1NTG A;  1JJ2 A;  1I94 Q;  3FKI H;  1HNX L;  4QL5 A;  1W2B A;  2IHF A;  2VL6 A;  3OTO L;  2WP8 J;  4JI5 Q;  3J81 c;  1VQE A;  2DUD A;  4DR2 Q;  1FJG Q;  1SRO A;  3KF6 A;  4BA1 I;  3RN2 A;  1FVI A;  1K0R A;  1KQS A;  4YWK A;  3L0O A;  2AMC B;  4B3T L;  5GRO A;  1XNQ L;  2YTV A;  1G6P A;  3RLF A;  4LUV A;  1PH9 A;  4O2D A;  4BBS H;  1VQB A;  1G51 A;  4R4T A;  3ULP A;  4JBM A;  3HOY H;  2KEN A;  3K7U C;  4B3M Q;  2VUM H;  1X56 A;  1GO3 E;  2RCN A;  2CKZ B;  3CXC A;  5E7N A;  2VUM G;  4A93 G;  4B3R L;  2E2H H;  4PMW A;  2YU9 H;  1U5K A;  1YJN A;  2UXC Q;  4UY8 C;  3GTP H;  4YY3 L;  3F2D A;  2VQF Q;  4POG A;  4KHZ A;  4DV1 Q;  4JI7 L;  5M3M H;  1XJV A;  3F1Z A;  1IZ6 A;  2E2I H;  3JC6 6;  1NMF A;  3ERS X;  4A3L H;  5HGQ A;  2MFI A;  1L1O C;  1KRT A;  2NN6 I;  4DKA C;  4A3F G;  4NXM L;  3BJU A;  4OX9 Q;  1L0W A;  4P75 A;  1CUK A;  4K0K Q;  3L7Z C;  2KCM A;  4QIW E;  3PUV A;  1R9T H;  4DV6 Q;  4JYA L;  3FP9 A;  4DV5 Q;  1J5E L;  1DGS A;  3A0J A;  1I94 L;  2Q2T A;  5C4J H;  3UDG A;  2HT1 A;  1CKN A;  1EIF A;  3IRB A;  4U04 A;  4NXN L;  4JI1 Q;  4BBR H;  5IYC G;  4DV7 Q;  5IYB H;  4DUY L;  2ZM6 L;  4GLX A;  4AQY L;  1NBW A;  5C44 G;  3U4Z A;  4DNI A;  4PZ6 A;  1TXY A;  4ME3 A;  4LUO A;  4P71 A;  4QGU A;  1VQ7 A;  4YCW A;  3STB D;  5C3E G;  1N32 L;  5JJ7 A;  1UE7 A;  4YHH Q;  1QZG A;  3W1B A;  1N36 Q;  2JJQ A;  1XMO Q;  1WJJ A;  2UXB Q;  5C0X G;  1PH3 A;  5J3B A;  2NZO A;  3D31 A;  1LTL A;  2JA5 H;  3HOY G;  5K36 G;  4OXP A;  2A8V A;  2IX1 A;  4X65 Q;  3PO2 G;  2BH2 A;  2N49 A;  3S2H H;  1AH9 A;  4DR3 L;  3KJP A;  2N78 A;  5H1S E;  4JI6 Q;  1JE5 A;  3G48 A;  4TQU S;  1PA6 A;  3S1R H;  1OXU A;  4C3J H;  2JA6 G;  1VQ6 A;  2YTX A;  3ULJ A;  2VQF L;  4LF8 Q;  4JOI C;  4WJ4 A;  2K5V A;  1WFQ A;  4JI2 Q;  4JI4 L;  1VQH A;  2ZJR A;  1IBM Q;  2NVY H;  3CPF A;  1SE8 A;  3F8T A;  1XNR L;  4A93 H;  2VQE L;  1V9P A;  2Q2I A;  1PH4 A;  2VNU D;  3K81 C;  4A76 A;  4JYA Q;  1C9O A;  4DV5 L;  3PIO A;  4RMF A;  3RLO A;  1YIT A;  1OXX K;  3E0E A;  4JI1 L;  4NXN Q;  1CKM A;  4R4Q A;  1KIX A;  4R4O A;  4DUY Q;  4OWT B;  3F2C A;  3CC2 A;  3NEL A;  1TWA H;  4A3B G;  5FJ8 H;  1VQI A;  1VQF A;  3CMA A;  4A3B H;  5C3E H;  4LWC A;  3E9H A;  3CC7 A;  4DR1 L;  1HR0 Q;  2IY5 B;  3BZC A;  1N36 L;  2UXB L;  3ZC7 A;  4B3S L;  1P16 A;  1IL2 A;  1D7Q A;  3AYH B;  3VDY A;  4X65 L;  4GNX B;  1GD7 A;  2LXK A;  2HIX A;  3S16 H;  5AJ3 Q;  4LF5 Q;  2BA0 A;  3W5O A;  4HIM A;  1YZ6 A;  3PSI A;  4JI6 L;  4LUZ A;  1HZC A;  3NEM A;  3UDI A;  2ZJP A;  4A3K G;  3HOU H;  4BA2 I;  4A3D G;  2WAQ G;  1XMQ L;  3GTQ H;  3EBE A;  4LFA Q;  1FL0 A;  1YHA A;  2R7Z H;  5EU0 A;  4L5Q A;  5C4X G;  1I5F A;  1IBM L;  4U0U A;  2NVX H;  2UUB L;  5IT9 c;  3CQZ H;  4L5T A;  4X2E A;  4LW1 A;  4UP8 A;  2EXD A;  2VQE Q;  2F4V Q;  2ES2 A;  4DUZ L;  4M16 A;  2NZH A;  4A3F H;  1TWF H;  3G71 A;  3EIV A;  5IWA Q;  4HJ8 A;  2E8G A;  4C3I H;  5FLM G;  1N33 Q;  4GN4 B;  5JJL A;  2N8N A;  3UE0 A;  3LGJ A;  2LSS A;  4A3J H;  4NPS A;  3I56 A;  4OO1 I;  1NJI C;  2HHH L;  5JEA G;  1E1O A;  5C44 H;  2PI2 A;  4EQ5 A;  4LF6 Q;  2JA8 G;  1EIY B;  4B3S Q;  1JB7 A;  1I6H H;  1VQA A;  4JI3 L;  3PV0 A;  5GAE C;  2PQA A;  4JI8 Q;  4ITR A;  3L2P A;  1SR3 A;  2K5H A;  1JMC A;  1X3G A;  3PGZ A;  2XTI A;  1OXT A;  3ZJY C;  2CCZ A;  5CMT A;  4IFD I;  3T1H L;  5JEA J;  3CC4 A;  1Q8K A;  2KCT A;  5DLQ E;  1XMQ Q;  3TS0 A;  3G4S A;  1PH2 A;  4NB3 A;  4LFB Q;  4AYB G;  1EFW A;  4LF4 L;  2F3I A;  4LFA L;  2R7Z G;  1L2F A;  2D62 A;  2L15 A;  4MNO A;  2Z6K A;  3OYY A;  2UUA L;  2UUB Q;  3UDX A;  3GTK H;  3RZD H;  3MEF A;  4DAM A;  3CF5 A;  3U58 A;  2EQS A;  2F4V L;  3CW2 C;  4P73 A;  2UUC L;  2NN6 G;  4DUZ Q;  4A3L G;  4IPG A;  2E2J H;  1Q86 C;  4IJL A;  4UP7 A;  3AFP A;  1Q1E A;  5IWA L;  1VQD A;  1VQ9 A;  2WFW A;  1PH8 A;  4OO1 G;  2G03 A;  3CCM A;  2ZTE A;  2B63 H;  5IE8 A;  4DV2 L;  1OTC A;  2Z6K C;  1QZH A;  2AWO A;  4X66 Q;  2OTL A;  1UE6 A;  4L5S A;  3M3Y H;  3M4O H;  4BXX G;  3HOV G;  2ALY B;  1SN8 A;  1IBL Q;  1E7Z A;  4GN3 B;  4JI8 L;  4X2C A;  1JJC B;  3PO3 G;  1QVF A;  3BZK A;  3I2Z A;  1PFS A;  1O7I A;  4X62 Q;  1EUJ A;  3DM3 A;  4IPC A;  5LMU Q;  3M4Q A;  5C4X H;  3TS2 A;  1VQJ A;  2JA9 A;  4IO9 A;  4POF A;  5GAG C;  3M7N A;  3GTM H;  3PO2 H;  1VQ5 A;  2MO0 A;  3KDF B;  2I0Q A;  2E5L Q;  2AWN A;  2VY3 A;  3K7A H;  4PG3 A;  2UUA Q;  4A3G H;  3HFZ B;  3JAM i;  4DV3 L;  1K9M C;  3WWV A;  3CCV A;  1XPO A;  4YCV A;  2UUC Q;  3S15 H;  5FLX c;  2QEX A;  2H5X A;  1K8G A;  1VQM A;  1E22 A;  5IYB G;  2B3G A;  1HZA A;  1Q46 A;  1WOC A;  4X6A H;  1Z9F A;  1B7Y B;  3FHW A;  4Y7N H;  1YBY A;  1A62 A;  3H0G H;  4HIO A;  2ZJQ A;  2WB1 G;  3M4P A;  4GKK L;  4JI0 Q;  3TQY A;  1HJP A;  2UU9 L;  4GKJ L;  2A1A A;  4MTN A;  2UXD Q;  1YJ9 A;  5M3F H;  3S14 H;  3CAM A;  5CKL A;  1EQQ A;  4P74 A;  1K3R A;  5IY0 A;  1MJE A;  3CPW A;  1M1K C;  2JA8 H;  4O0A A;  3PUZ A;  1KC8 C;  3HOW H;  2R92 G;  4JV5 Q;  4XI8 A;  3W1G A;  1UWV A;  4X62 L;  4DR2 L;  1VQO A;  2JK8 A;  2KHJ A;  5LMU L;  3T1Y Q;  3HOW G;  1AE3 A;  2PI2 E;  2NVQ H;  1CKN B;  3OW2 A;  1SLJ A;  1XNQ Q;  3I7F A;  3RZO H;  1S3O A;  1ASY A;  4A3M G;  1I50 H;  1RL2 A;  2QGQ A;  5M3F G;  3JAM c;  1YEZ A;  5IP9 H;  4B3M L;  5GAD C;  4A75 A;  4RG1 A;  1Y1W G;  1XPU A;  3GTO H;  2IHE A;  5IYD H;  3TRE A;  1RIP A;  1Y1W H;  1G29 1;  3H0G G;  1VQL A;  2CQO A;  2ID0 A;  1VCI A;  2JE6 I;  3K8A A;  3ER0 A;  2YTY A;  4LU4 A;  4DV1 L;  3K80 C;  1YVC A;  2QA4 A;  1VQ4 A;  4DR7 L;  1NE3 A;  1UEB A;  4H02 A;  3PUY A;  2Y0S G;  4DK6 C;  1S72 A;  2N3S A;  1UE1 A;  2JQO A;  2YV5 A;  3UDF A;  2VW9 A;  1HNX Q;  4A3G G;  4GKJ Q;  5JJ6 A;  4C3H H;  4HID A;  1WI5 A;  3H3V I;  1CSQ A;  1MIU A;  4QQB X;  1A63 A;  1SMX A;  3HOV H;  1PYB A;  4BXX H;  4DV7 L;  3RNU A;  2ZM6 Q;  1L1O B;  4B3T Q;  4BY7 G;  3GO5 A;  3KDF A;  2RHS B;  1X3F A;  3T1Y L;  4LFC Q;  1XPR A;  3CD6 A;  1N9W A;  1E3P A;  3S24 A;  1NMG A;  5M3M G;  2VS1 A;  4APV A;  4YHH L;  2BA1 A;  4EX5 A;  4PY3 A;  4A3I H;  4LF7 L;  5IP9 G;  2PMZ E;  2OWO A;  2F52 A;  4DR3 Q;  1KD1 C;  5LMN L;  2UXC L;  2VZA A;  2R93 H;  1TWH H;  5LMN W;  1CKO A;  3SHG A;  1X3E A;  3LET A;  1Z47 A;  4JBW A;  2K5N A;  5M5W H;  1YHB A;  3U4V A;  4NXM Q;  4WJ3 M;  1X55 A;  4JI2 L;  4JI4 Q;  4OX9 L;  3RN5 A;  2R7F A;  4DPG A;  4LF9 L;  1Q82 C;  4GOP A;  2YYZ A;  4DAY B;  1V43 A;  3EN2 A;  3NBH B;  4DV6 L;  3CCS A;  1PH6 A;  3I4N H;  3I4M H;  4JI7 Q;  4A3C H;  3D0F A;  3FKI G;  1J5E Q;  4KHP Q;  2B29 A;  4A4I A;  4HJ9 A;  2I5M X;  2IT1 A;  3ULL A;  5BR8 Q;  1VQC A;  1YNX A;  4FDB A;  2F6S A;  4AQY Q;  4GLA C;  1PHJ A;  3CP0 A;  1EQR A;  4OWW B;  3GTG H;  3J7A 5;  1HZ9 A;  3A5Z B;  1BBU A;  1KRS A;  3HOX H;  4HJA A;  2D0P A;  1VQK A;  1N32 Q;  2I5L X;  4PZ7 A;  3HKZ G;  4IJH A;  4LFC L;  1XMO L;  3CCU A;  3TRZ A;  4XIG S;  1X6O A;  2KBN A;  4IOC A;  1KAW A;  3B6Y A;  1B70 B;  3GD7 A;  4BBR G;  1YJW A;  1ASZ A;  1VQP A;  3GTL H;  4LF7 Q;  4U0S A;  1K73 C;  1TWC H;  1M90 C;  1IYJ B;  1PH1 A;  2BH8 A;  2C35 B;  5IP7 H;  3PCO B;  4AH6 A;  5AJ3 L;  4LF5 L;  5LMN Q;  1PH7 A;  2MNA A;  4JC0 A;  3HOX G;  4AIM A;  5IYC H;  4GOP C;  1UE5 A;  4PZ8 A;  4LF8 L;  2HQL A;  1A0I A;  5FLM H;  1J6Q A;  2ZTD A;  1XNR Q;  4IFD G;  4MZ9 A;  1Q81 C;  1D8L A;  4LF9 Q;  4A3D H;  2EIF A;  3SE5 A;  1IBK L;  3HOZ G;  3RR5 A;  5IP7 G;  2GVB A;  3PF5 A;  1X54 A;  3I4N G;  4WGJ A;  4KHP L;  4GN5 A;  2FXQ A;  2NVT H;  4R4I A;  1N8R C;  5BR8 L;  1LUZ A;  5M5X H;  4HJ7 A;  4DR6 Q;  4C2M H;  3A5U A;  3I4O A;  2XGT A;  1OXV A;  1Q1B A;  2HIV A;  1HR0 W;  5C0X I;  1VQN A;  2OTJ A;  5GQO A;  4DR1 Q;  1HR0 L;  2KHI A;  5GAH C;  4A3J G;  4GLV B;  3H15 A;  4BY7 H;  1AE2 A;  4J15 A;  1X9N A;  1QUQ B;  3KYH C;  1YIJ A;  3S1Q H;  4A3I G;  2R7D A;  1P8L A;  3KF8 B;  3KFU A;  1JJG A;  4BBS G;  1VQG A;  1OXS C;  4DV4 L;  5M5Y H;  3CCE A;  4HIK A;  1QVG A;  4JI3 Q;  1Q7Y C;  2D0O A;  2PNH A;  1NY4 A;  1K8A C;  1HNZ L;  1SRU A;  5FJ8 G;  4N67 A;  2OCE A;  4UPA A;  5JFF A;  4GNX A;  1SFO H;  2ASB A;  1KL9 A;  3S17 H;  5JJK A;  4DR4 L;  3BU2 A;  3T1H Q;  5JJI A;  4LFB L;  1Q12 A;  1GVP A;  2AHO B;  2WAQ E;  3CCJ A;  1KXL A;  3AQQ A;  3PF4 A;  4JG2 A;  5C0X J;  2A19 A;  2JA6 H;  1IBK Q;  3H3V H;  2Y0S E;  3DLL A;  3CCL A;  2K52 A;  4DK3 C;  1N33 L;  2K14 A;  3G6E A;  1B8A A;  2AKW B;  2JA7 H;  2JEA I;  4DV0 L;  1PH5 A;  2GN5 A;  4YCU A;  1C0A A;  1GKH A;  4DR6 L;  2WB1 E;  2HHH Q;  4YWM A;  1WCM H;  1Y1V G;  4DV2 Q;  1E1T A;  4IFD J;  2OQK A;  1X65 A;  5EAY A;  5IYD G;  4LF6 L;  2JEB I;  2B63 G;  1PYS B;  2K50 A;  4DR5 L;  4JOI A;  2CWA A;  3NEN A;  5JFZ A;  2R6G A;  4DV4 Q;  1H95 A;  2I5H A;  1IBL L;  5ELN A;  3GTJ H; 
#chains in the Genus database with same CATH topology
 3MAQ A;  2MQH A;  4XYQ A;  4OON A;  5ELD A;  4K14 A;  2RF4 A;  5CGL A;  4DR4 Q;  1G2T A;  1HA5 A;  1Z7T A;  3TBI B;  2EVB A;  3K7A B;  4A3G B;  3GP7 A;  1TWG H;  2EYO A;  1L0X B;  5IT9 E;  3P7J A;  4IOA A;  1J8I A;  3C46 A;  3E9I A;  1XTD A;  4X3K A;  3N52 A;  4R1J A;  4IAL A;  3P1H A;  4X64 L;  2X6G A;  3BDO A;  3SN9 A;  2PQA B;  4G57 A;  4JBJ A;  3TZU A;  4JK1 C;  3I73 A;  1BVS A;  3M9B A;  4DXG A;  4QB4 A;  1EQT A;  4A3M H;  3TEH B;  2UXD L;  3JAM L;  1Y14 B;  3A74 A;  4GS3 A;  3HOZ H;  2RSN A;  1FJG L;  3FDT A;  1LYL A;  3J81 i;  1PV4 A;  3S1N H;  3ZLM A;  5C5M A;  1UUP A;  4P72 A;  2JA5 G;  5K36 H;  4G7H C;  3I3C A;  3MXN B;  5IOC A;  4R4C A;  1U4L A;  3PUX A;  1EY7 A;  1CSP A;  3STB C;  4ABN A;  3F2B A;  2PZW A;  2RDF A;  1K0S A;  3S6A A;  3J7A F;  5HY6 A;  1EY6 A;  2FJ2 A;  3D3R A;  1I6H B;  3AU7 A;  4GKK Q;  5CBE E;  1QVC A;  3PIP A;  3U50 C;  2K4K A;  4UP9 A;  3N3U A;  1HNX L;  3FKI H;  1HFG A;  1UAP A;  2VL6 A;  3OTO L;  4V0B A;  2A5H A;  1K28 A;  1VQE A;  2DUD A;  4P2C B;  1C8C A;  3KF6 A;  4C3I B;  4JW0 A;  4B3T L;  3D4D A;  3L0O A;  4YWK A;  3RUZ A;  1VQB A;  4R4T A;  3HOY H;  1JOQ A;  2IJ0 A;  3Q0A A;  2RCN A;  1LT5 D;  2E2H H;  4PMW A;  1VF5 C;  3HOU B;  2UXC Q;  4POG A;  4DV1 Q;  1XJV A;  1NMF A;  4R8N A;  4A3L H;  5HGQ A;  5FO9 B;  4CJ0 B;  1LT3 D;  4DKA C;  4O1N A;  4OX9 Q;  1JWU D;  1AZQ A;  2KCM A;  1R9T H;  5NUC A;  4DV6 Q;  3FP9 A;  1DGS A;  2HT1 A;  5ELC A;  3IRB A;  5KEE A;  4U04 A;  1S5D D;  1CQF A;  2ZM6 L;  1AEX A;  1EWC A;  2B2U A;  1GOZ A;  4P71 A;  5CV8 A;  2RSO A;  4L63 B;  1WJJ A;  1PH3 A;  1LT6 D;  2NZO A;  2JA5 H;  5K36 G;  3HOY G;  3MC0 B;  3OWF A;  2ZXO A;  3S2H H;  5HGT A;  1G91 A;  2K7V A;  1QNK A;  4IZ8 A;  2HD3 A;  3G48 A;  4TQU S;  4L6T B;  2JA6 G;  2A69 C;  3ULJ A;  2VQF L;  3G7L A;  4FF3 A;  4JOI C;  2A74 C;  4S3S A;  1IBM Q;  1Y8N B;  5COR A;  1SE8 A;  2F0G A;  2JA5 B;  2VQE L;  1V9P A;  2Q2I A;  1SYC A;  3K81 C;  4JYA Q;  1C9O A;  1TWF B;  1XTC D;  3RLO A;  5A2Q E;  2F0K A;  3E5S A;  1V1P A;  1CKM A;  1BCP F;  3TME A;  1KIX A;  3SK5 A;  5I4D A;  3F2C A;  3NEL A;  5C4J B;  4A3B G;  1VQI A;  2IY5 B;  1N36 L;  3GTQ B;  4MN3 A;  3NBI A;  1P16 A;  3AYH B;  4X65 L;  2HIX A;  4LF5 Q;  2PO4 A;  3S9W A;  3QJY A;  4HIM A;  1YZ6 A;  1RF2 D;  3W3A A;  2ZJP A;  2EOT A;  2WAQ G;  1XMQ L;  1FL0 A;  2NUC A;  3QIA A;  2R7Z H;  1ICF B;  1UEA B;  3LWE A;  4CDF C;  3CQZ H;  1BR9 A;  2F4V Q;  4OGQ C;  2ES2 A;  4M16 A;  1BF4 A;  3TSS A;  4FF4 A;  3G71 A;  3EIV A;  4C3I H;  2HCI A;  1BNZ A;  2N8N A;  4XQN A;  3UE0 A;  3FKI B;  1QB5 D;  1TVX A;  4EQP A;  1PZJ D;  1NH1 A;  2QDB A;  4LF6 Q;  2JA8 G;  1SNP A;  1I6H H;  2F0E A;  1AFP A;  4ITR A;  2H1E A;  2JYO A;  2CH4 A;  1VDZ A;  3PGZ A;  2C5C A;  3CC4 A;  1Q8K A;  1YNJ C;  2Z9H A;  5DLQ E;  3TS0 A;  1PH2 A;  4LFB Q;  4NB3 A;  1EFW A;  4LF4 L;  1LLR D;  2R7Z G;  2K05 A;  2D62 A;  2UUA L;  3S1N B;  1GUS A;  5DM7 3;  2F0W A;  4P73 A;  3MA2 B;  1T5X D;  4DUZ Q;  1SJE D;  1KDC A;  2DJF C;  2E2J H;  1Q86 C;  1Q1E A;  1VQD A;  4N8X 1;  1PZK D;  4RHR A;  1HA6 A;  4OO1 G;  4I65 A;  1R9T B;  2Z6K C;  1NNX A;  1UE6 A;  1TS4 A;  3HOV G;  2ALY B;  1IBL Q;  2PNR C;  4Q0F A;  4JI8 L;  3PO3 G;  2E2H B;  1JOO A;  3BZK A;  4J8Q A;  1GHK A;  1TU2 B;  2EDG A;  2MGS A;  3LWU A;  3DM3 A;  2JA9 A;  3GTM H;  1EYC A;  1KNA A;  3KDF B;  3DMU A;  2EE1 A;  3K7A H;  2M2L A;  4A3G H;  4JPB W;  1ESR A;  2MUY A;  5FLX c;  2QEX A;  2F0L A;  1QJO A;  4X6A H;  1Z9F A;  1SYD A;  3FHW A;  4HIO A;  1YBY A;  3H0G H;  2WB1 G;  4KKS A;  5COY A;  5CV5 A;  1WTP A;  1BCP D;  2UXD Q;  4OIK A;  3I8Z A;  1A3T A;  3KLS A;  4P74 A;  1K3R A;  2ZT9 C;  1IW7 C;  3FPP A;  3CPW A;  1MJE A;  4XT3 B;  1JQY D;  4XI8 A;  4HMI A;  1VQO A;  1Q90 A;  5LMU L;  1ASY A;  5ELF A;  1I50 H;  2QGQ A;  2EY6 A;  2AQ3 B;  3JAM c;  1YEZ A;  4B3M L;  4Q5V A;  1Y1W G;  2P5Z X;  1XPU A;  4I7Z C;  3HOZ B;  2VB2 X;  4PMB A;  4H13 C;  3TRE A;  4XXE A;  3H0G G;  2B8F A;  1VQL A;  2B2T C;  1SFO B;  2KCN A;  4ZYS A;  5IOD A;  2YTY A;  1RDP D;  2PW5 A;  1LTB D;  4K5X A;  2QA4 A;  2F0O A;  3QOJ A;  1UEB A;  1JB3 A;  3H09 A;  4DK6 C;  2K32 A;  3K5O A;  2YV5 A;  1SE2 A;  3UDF A;  2BDO A;  5BN4 A;  2RVL A;  3VR6 A;  2VW9 A;  5JJ6 A;  1NR4 A;  1LO5 D;  4HID A;  2RDH A;  1WI5 A;  2XSC A;  3HOV H;  4R9W A;  1B9N A;  1FR3 A;  3RNU A;  1XXG A;  4BY7 G;  1QCB D;  1ZYR D;  4KK7 A;  1E3P A;  3S24 A;  1PTO C;  2VS1 A;  3J81 E;  1K8M A;  2FIN B;  4EX5 A;  4A3K B;  5LMN L;  2UXC L;  2VZA A;  2R93 H;  2EY1 A;  2RBM A;  4UDU C;  3SHG A;  1Z47 A;  3LET A;  2M00 A;  5LL6 X;  4WJ3 M;  4DPG A;  2YYZ A;  1SMY D;  2HQE A;  3EN2 A;  4K2K A;  3HZX A;  3I4M H;  1LTS D;  2KUM A;  4NKL A;  3JAM E;  4A4I A;  2JXM B;  2MHV A;  3CRL C;  4RCN A;  1YNX A;  1AP0 A;  3OMC A;  4HCS A;  1SNM A;  2Z4I A;  1HZ9 A;  2JA6 B;  4HMJ A;  1KRS A;  2D0P A;  5L37 A;  1Y69 U;  5KGU A;  1BBX C;  4IJH A;  4LFC L;  3A8I E;  1B44 D;  1X6O A;  1I4P A;  3NTI A;  3ERQ A;  3GD7 A;  3GTL H;  5K5P A;  2O5J C;  1IYJ B;  3ZYY X;  2BH8 A;  2C35 B;  2IW3 A;  2B2V A;  2MNA A;  4UHV A;  4AIM A;  1ML0 D;  4GOP C;  1PFM A;  1Q3L A;  2B2U C;  4C3I G;  2ZTD A;  1XNR Q;  2KEE A;  2EIF A;  3HOZ G;  4YIJ A;  2GVB A;  5M5X B;  2WAC A;  3VA5 A;  5EKI A;  4KHP L;  2A6H C;  2FXQ A;  2XIW A;  4GN5 A;  2NVT H;  1BO0 A;  1SNC A;  3I70 A;  4HJ7 A;  4FXK C;  3SEB A;  3I4O A;  3WDN A;  1OXV A;  1HR0 W;  2B39 A;  2QEJ C;  1HR0 L;  3VR2 A;  4BY7 H;  3BVG A;  1X9N A;  1JJG A;  3KF8 B;  3KFU A;  4BBS G;  3GV3 A;  2QCP X;  4DV4 L;  2NTS A;  1I6V C;  3J80 E;  3SE0 A;  1X3P A;  4UPA A;  1ZXT A;  1JC7 A;  4HR7 B;  4DR4 L;  3T1H Q;  1Q12 A;  2WAQ E;  4B9X A;  3CCJ A;  4ODG A;  1ET9 A;  1FYC A;  4KJO A;  4WOR A;  1SYE A;  4JG2 A;  5CGK A;  2A19 A;  2JA6 H;  4K6L A;  1H9M A;  4CBV A;  1I4R A;  2NVQ B;  1GUT A;  1FNU A;  3T53 B;  4G7O C;  1B53 A;  2CH4 W;  3J7Y W;  1FNW A;  4DR6 L;  4YWM A;  2Z8L A;  5M3F B;  2KVM A;  1E1T A;  4DV2 Q;  2B63 G;  5EAY A;  1F2Y A;  2BDN A;  4OL7 A;  4DXF A;  2K50 A;  2OXP A;  1IYV A;  1TWH B;  5JFZ A;  2R6G A;  1H95 A;  2I5H A;  4FYD A;  3GTJ H;  3H94 A;  3EQL C;  2XN9 C;  1F9P A;  1HNZ Q;  2F0J A;  1Y8O B;  2J7Z A;  4PV1 C;  4A3I B;  4A3K H;  3HOU G;  3NBH A;  4A3E G;  1N34 Q;  4LF4 Q;  4JCV E;  1BBW A;  5C5L A;  1FGU A;  1K83 H;  3K5L A;  1D1I A;  4WJW A;  5C4X B;  1EYG A;  2H4O A;  1I4Q A;  3RMH A;  2B2Y C;  1XWE A;  2L9H A;  1WVL A;  4IPD A;  3T56 B;  4HJ5 A;  2X69 A;  5ELO A;  3PUW A;  4JBK A;  4DR5 Q;  1ET6 A;  3KOJ A;  4RA8 A;  4A3E H;  1ROD A;  4RH6 A;  3I55 A;  1JCK B;  4GOP B;  1VS0 A;  3HP3 A;  2RHQ B;  4B9W A;  4KN7 C;  1Z6H A;  1SE3 A;  1WTV A;  5EJW A;  2Z0S A;  1HQR D;  3TP7 A;  4TRD A;  1L1O A;  4Y52 H;  3KF6 B;  5M9O A;  1V1Q A;  2K5W A;  3K5N A;  3K59 A;  3VR5 A;  2V1C C;  3NHH A;  1WCM G;  3C3L A;  2JP1 A;  4IUV A;  1EWI A;  1HCZ A;  3EJI A;  1HNW L;  4IPH A;  1PVO A;  1OO9 B;  2F0S A;  4RGM A;  4QY7 A;  2E74 C;  1HZB A;  3E3X A;  2LKV A;  3H0G B;  1SNQ A;  4J1M A;  4OIJ A;  5C44 B;  3J80 i;  1CHQ D;  1I94 Q;  2Q2H A;  1NTG A;  4FP5 D;  2WP8 J;  4JI5 Q;  1SRO A;  4BA1 I;  3K5M A;  1FVI A;  1K0R A;  5E4W C;  4A3F B;  1G6P A;  2YTV A;  3RLF A;  4LUV A;  3GTM B;  2PQE A;  4BBS H;  4OO1 H;  3ULP A;  4LJZ C;  4DAP A;  2VUM H;  4B3M Q;  4QCL A;  1X56 A;  2NVX B;  2CKZ B;  5E7N A;  2I07 B;  5JPM C;  4B3R L;  5E1F A;  5I9O A;  1QIL A;  1SEB D;  1MGS A;  2VQF Q;  2Y0S B;  1KDA A;  3M4O B;  2E2I H;  2PYK A;  1L1O C;  1KRT A;  4OEL B;  4K0K Q;  4DAY A;  3L7Z C;  3PUV A;  4LAA A;  1E0B A;  5C3E B;  4JYA L;  1IW7 D;  3NXW A;  1K3B C;  5C3X A;  1J5E L;  3A0J A;  4JI1 Q;  1ENC A;  2B2W A;  3URY A;  3BDC A;  2LS0 1;  5D65 A;  4GLX A;  1NBW A;  4ME3 A;  1VQ7 A;  3STB D;  5JJ7 A;  5I6Y A;  4YHH Q;  1QZG A;  3W1B A;  2E75 C;  2UXB Q;  2JJQ A;  1X32 A;  3D31 A;  1LTL A;  5CYU A;  1BDO A;  3U9O A;  1B9M A;  4X65 Q;  3PO2 G;  2DNC A;  2B2Y A;  4B08 A;  2N78 A;  2TSS A;  4C3J H;  1CA5 A;  1VQ6 A;  4ZAI A;  4LF8 Q;  4WJ4 A;  4RWS C;  2ZJR A;  3Q23 A;  2NVY H;  4RKB A;  1D5Z C;  5CBA E;  4A93 H;  1JIC A;  1WTO A;  1PH4 A;  2VNU D;  3IKJ A;  1STH A;  2HDM A;  5I2Y A;  2FMC A;  4NXN Q;  1ENF A;  3T16 A;  4DUY Q;  4OWT B;  1KNE A;  1VQF A;  3BVM A;  3OIP A;  2R7Z B;  4TSS A;  3ZC7 A;  1IL2 A;  1GD7 A;  2LXK A;  4C3H G;  2NUN A;  3S16 H;  5M3M B;  2NN6 H;  3W5O A;  3PSI A;  4HED A;  4JI6 L;  4LUZ A;  1HZC A;  4DK0 A;  4BA2 I;  1PXU A;  2AQ2 B;  4A3D G;  3GTQ H;  2YU9 B;  3SXH A;  5EU0 A;  2A68 C;  4L5Q A;  4U0U A;  4RGO S;  5IT9 c;  4L5T A;  3A55 A;  5ELE A;  1RJT A;  1N33 Q;  1TWF H;  3KLS X;  4X3U A;  1NSN S;  4A3J H;  1JWS D;  4K8J A;  3K6O A;  1NJI C;  1IHZ A;  5DNF A;  1F9R A;  2FMM A;  4FF2 A;  2Z4H A;  2ENB A;  4CKE A;  2Z1C A;  4AYB B;  1D5X C;  1TQO A;  4JI8 Q;  4HSV A;  1NCV A;  1EL0 A;  1SR3 A;  1SXT A;  2F0Q A;  2JSO A;  1JMC A;  4XQJ A;  4X3S A;  3ZJY C;  3R3O A;  5CMT A;  5JEA J;  1STE A;  1ZEQ X;  1F2M A;  2SEB D;  5I6W A;  4MNO A;  2UUB Q;  1PZI D;  3GTK H;  3RZD H;  4HAE A;  3MEF A;  3CF5 A;  1MSG A;  3U58 A;  3CW2 C;  4BBR B;  3S1M B;  5A35 A;  4IJL A;  4UP7 A;  5IWA L;  2XRS D;  1VQ9 A;  2WFW A;  1SE4 A;  1EFI D;  3HRZ C;  3CCM A;  2WII B;  3MHB A;  2ZTE A;  4BY1 B;  5IE8 A;  3IL8 A;  1B3A A;  3KK7 A;  2AWO A;  4BS9 A;  4X66 Q;  3VYS A;  1W6J A;  4BXX G;  2CHB D;  3GTP B;  3NWS A;  1SN8 A;  1E7Z A;  3NE5 B;  2EJF C;  1QVF A;  1I3Q B;  1O7I A;  3DWA A;  1PFB A;  5LMU Q;  2I46 A;  1W6K A;  3HOY B;  3TS2 A;  1VQJ A;  5G3L F;  1TR5 A;  3VYR A;  1AW7 A;  3PO2 H;  5G3L D;  1STY A;  2MO0 A;  2F0N A;  3HFZ B;  5CC4 A;  2UUC Q;  1FNV A;  3S15 H;  2H5X A;  1K8G A;  2JN4 A;  2RDG A;  2B3G A;  1HZA A;  1A2U A;  1RTO A;  3M4P A;  4JI0 Q;  1GUG A;  1HJP A;  4GKJ L;  2A1A A;  1YJ9 A;  1WCM B;  4KD3 A;  3S14 H;  4OEM B;  1F9Q A;  1PRT D;  1JE4 A;  2JA8 H;  4O0A A;  3HOW H;  4A93 G;  1WD0 A;  1B3Q A;  1PRT F;  3TP5 A;  4X62 L;  4DR2 L;  3DWQ A;  1XNQ Q;  1SLJ A;  3MFG A;  3J7A V;  1LT4 D;  2BCO A;  2F4I A;  1STN A;  5IP9 H;  4A75 A;  1HHV A;  2IHE A;  5IYD H;  1RIP A;  2EYP A;  1G29 1;  2CQO A;  1QOH A;  2ICE C;  4DU9 A;  4A3M B;  1SND A;  2V4D A;  2R92 B;  3C1F A;  1VQ4 A;  1VMP A;  4H02 A;  4PNY A;  3VR4 A;  2Y0S G;  1UE1 A;  3QB3 A;  1HNX Q;  4GZY C;  3PIO 3;  2OF1 A;  2EYJ A;  1CSQ A;  1F77 A;  2O5I C;  3HKZ B;  1TWG B;  4DNT B;  4BXX H;  4DV7 L;  1L1O B;  4B3T Q;  3V96 A;  2DY7 A;  1X3F A;  4LFC Q;  3CD6 A;  1A6X A;  1AZP A;  4LF7 L;  2WAQ B;  2IL8 A;  2G9H D;  5FK9 C;  4RGN A;  4DA2 A;  2F52 A;  4DR3 Q;  1KD1 C;  1LAC A;  3BYT B;  4QF4 A;  3P75 A;  5IGG A;  2R61 A;  4IUU A;  5M5W H;  1U4R A;  1YHB A;  2A73 B;  5LL6 S;  2HCC A;  1X55 A;  4JI4 Q;  4OX9 L;  1CK1 A;  3NBH B;  1PH6 A;  4DV6 L;  3CCS A;  4JI7 Q;  1RTN A;  1J5E Q;  4KHP Q;  3PQI A;  3HOX B;  1BCP B;  2I5M X;  2IT1 A;  4M1U B;  3ULL A;  3GTG H;  2F6S A;  2K5Q A;  3CP0 A;  4KY5 A;  3SVM A;  3ND8 A;  2C9O A;  3HOX H;  4PZ7 A;  3KBX A;  4ULL A;  3TDQ A;  3PMF A;  2WV6 D;  2KBN A;  4XIG S;  1B70 B;  1DYQ A;  2BE5 C;  1YJW A;  3S17 B;  2PZT A;  4U0S A;  2SDF A;  3UI2 A;  5AJ3 L;  5M5Y B;  1PH7 A;  2DNE A;  4JC0 A;  3HOX G;  3T51 B;  1A0I A;  2EJM A;  1PTO H;  1Q81 C;  4A3D H;  1ZYR C;  3SE5 A;  4O42 A;  1O7Z A;  3PF5 A;  1GUO A;  1X54 A;  2E2D C;  4CHT B;  3VYU A;  1TS3 A;  1N8R C;  5BR8 L;  5T1G A;  4DR6 Q;  4C2M H;  1A3U A;  1O80 A;  3G6J B;  2XGT A;  2F0H A;  1Q1B A;  1WTW A;  1VQN A;  2QKI C;  2OTJ A;  1GXD C;  1RCV D;  2J4X A;  5GAH C;  4A3J G;  4KV6 A;  1AN8 A;  3KYH C;  3X3M A;  1YIJ A;  4A3I G;  2IWH A;  1P8L A;  3S1Q H;  5C6A A;  3J80 L;  2A6E C;  4HIK A;  4JI3 Q;  1QVG A;  5J39 A;  4G7Z C;  2PNH A;  4ZCK A;  4G4K A;  5AFW A;  1K8A C;  1TWC B;  1HNZ L;  4N67 A;  2OCE A;  4NMZ A;  2K33 A;  1KL9 A;  5F2D A;  1SJH D;  3SK6 A;  1IYU A;  5JJI A;  1Q8I A;  1GVP A;  2VXW A;  1GJX A;  2OEO A;  3AQQ A;  2QF7 A;  3VR3 A;  5J22 A;  2K28 A;  3RZO B;  3DLL A;  3CCL A;  1N33 L;  4ILW A;  2JA7 H;  2AKW B;  2JEA I;  3BS1 A;  4ZLT F;  1C0A A;  4R8I A;  3A8K E;  2WB1 E;  1TY2 A;  1DXM A;  1BXT A;  3S14 B;  2F0D A;  4IFD J;  2ZXR A;  1WD1 A;  1MHW C;  4LF6 L;  5E3F A;  1CI3 M;  4JVZ A;  1XX8 A;  3T4A C;  3D4R A;  1GM5 A;  1DOL A;  3HS0 C;  1U0L A;  1MKH A;  1NR2 A;  3RD4 A;  4TVA B;  4DF7 A;  1YHQ A;  4BY1 G;  3NPP A;  1MSH A;  4ALP A;  4ID6 A;  2E5L L;  4J6H A;  2O4X A;  3ICE A;  3QO2 A;  1H9S A;  1W3S A;  5EBD A;  3AEV A;  4XTC S;  1I3Q H;  4CDC C;  4QJF A;  4LK1 C;  1YI2 A;  2GVA A;  3CUC A;  4A3C G;  4X66 L;  2IX0 A;  2PW7 A;  2O2L D;  1MJC A;  3J80 c;  1V1O A;  3OTO Q;  4BY1 H;  1Y1W B;  3BG3 A;  1EOV A;  1HFN A;  1VQ8 A;  3GTO B;  1VF7 A;  4MHE A;  4FXD A;  4F88 A;  3I4M G;  4JV5 L;  2R93 G;  1KAB A;  1Y1V H;  5IGB A;  3CME A;  4U07 A;  1C7Y A;  3A8J E;  3HKZ E;  3GTK B;  3OHX C;  2IX3 A;  1JT8 A;  3OIQ A;  1HH2 P;  3A56 A;  3ONA B;  4HN7 A;  2CWP A;  1EY9 A;  5EKL A;  3QOL A;  1HUM A;  4FVM A;  2JA7 G;  1D2B A;  1E24 A;  4X64 Q;  1QUQ A;  5EKK A;  4K0K L;  2LY7 A;  1A8V A;  2FFK B;  4V19 0;  3AFQ A;  3NP8 A;  2LXJ A;  1BKB A;  1S5F D;  1JJ2 A;  3OSO A;  1F9S A;  3DHQ A;  2NBF A;  5DEH A;  4XT1 B;  2B2V C;  1I4X A;  2L55 A;  4DR2 Q;  3A7L A;  1KQS A;  1XNQ L;  2EXZ A;  3KBG A;  5GRO A;  4DFA A;  1KLG D;  3LX0 A;  1EY5 A;  1G51 A;  4QMG A;  4JBM A;  2KEN A;  3K7U C;  2KCC A;  1TS2 A;  1GO3 E;  1EYA A;  3CXC A;  1ONL A;  2NTT A;  2L5T A;  3NUC A;  1U5K A;  4QUC A;  1YJN A;  4UY8 C;  4YY3 L;  4KN4 C;  4KHZ A;  3M3Y B;  4X3T A;  3F1Z A;  1IZ6 A;  3ERO A;  5KNC A;  2MFI A;  2NN6 I;  4A3F G;  1ZKO A;  4NXM L;  3BJU A;  3MTS A;  1L0W A;  4P75 A;  1HXY D;  2B63 B;  1ENA A;  2L4N A;  3EA6 A;  3QG1 A;  2NB0 A;  2B8G A;  2Q2T A;  2NYZ D;  5KRU A;  4U68 A;  1B2T A;  4NXN L;  5EQ0 A;  5IYC G;  4DV7 Q;  5IYB H;  3FPU B;  2RCF A;  2CW0 C;  1TXY A;  4QGU A;  1F2L A;  1EIH A;  4YCW A;  5KYI A;  5C3E G;  1N32 L;  1UE7 A;  1N36 Q;  1XMO Q;  5C0X G;  5EBC A;  4KKU A;  4OXP A;  2A8V A;  2NVY B;  1AH9 A;  4DR3 L;  3L3O C;  5H1S E;  5JVH 3;  4JI6 Q;  1JE5 A;  3S1R H;  1OXU A;  5JVG 3;  1WFQ A;  3OW7 A;  4JI4 L;  1VQH A;  4WRD A;  4ZK9 B;  1BQQ T;  1EY0 A;  4FXG C;  2PZU A;  4QUF A;  1J9O A;  3PIP 3;  1EY8 A;  2A68 D;  2VB3 X;  2QDL A;  3CHB D;  4A76 A;  4DV5 L;  2K04 A;  3PIO A;  1YIT A;  3M4Y A;  2B2T A;  3E0E A;  4U67 3;  2OT2 A;  4R4Q A;  5CV7 A;  4R4O A;  4KY6 A;  3CMA A;  3IFT A;  3CC7 A;  3E9H A;  3BZC A;  4N9T A;  4IN3 A;  1D7Q A;  3GQB A;  2AUK A;  5JOB A;  4GNX B;  2BA0 A;  2N88 A;  1STA A;  5FKA C;  2TMP A;  3UDI A;  5EGT A;  1EOT A;  2NUD A;  1T5E A;  4A3B B;  1I5F A;  2NVX H;  2UUB L;  1TWA B;  3TN2 A;  2EY2 A;  4LW1 A;  5IT9 L;  2EXD A;  2Q8R E;  4DUZ L;  5JJL A;  5FLM G;  4GN4 B;  4RKL A;  1KDB A;  1DOK A;  2LSS A;  3SR1 A;  3I56 A;  1DCZ A;  3MXN A;  1RD9 D;  3V2T A;  2BE5 D;  5C44 H;  1O7L A;  1EIY B;  2L12 A;  1G8Z D;  2F0F A;  4B3S Q;  3S1R B;  1VQA A;  3QR8 A;  4JI3 L;  4UAI A;  5D14 A;  5GAE C;  3L2P A;  3KF8 A;  1X3G A;  2XTI A;  4H0L C;  1STB A;  3T1H L;  1XMQ Q;  1M4V A;  4LFA L;  3TP6 A;  1L2F A;  2L15 A;  2Z6K A;  3OYY A;  2F0T A;  2SOB A;  4DAM A;  2EQS A;  3OWE B;  4OHJ A;  2EYH A;  1BUV T;  4IPG A;  3AFP A;  1IKM A;  4HTH A;  3K57 A;  2G03 A;  4A3E B;  1II3 A;  4DV2 L;  1PMR A;  4FF1 A;  3C2P A;  3DEP A;  2OTL A;  4L5S A;  1JWM D;  2DY8 A;  4K8I A;  5D3I B;  5CV6 A;  1QE6 A;  4KMU C;  3E0J A;  3MZ5 A;  1JJC B;  1CZG A;  4I7A A;  1A2T A;  3I2Z A;  1PFS A;  1QWY A;  4NP5 A;  4X62 Q;  4KY7 A;  1E2Z A;  3M4Q A;  4IO9 A;  4POF A;  3M7N A;  1EU4 A;  2EY5 A;  1VQ5 A;  2I0Q A;  3I4L A;  2E5L Q;  2VY3 A;  1K83 B;  3JAM i;  1SBB B;  2ZXP A;  4DV3 L;  3WWV A;  4K5W A;  5JEA H;  1E22 A;  5IYB G;  1S4Z A;  2A69 D;  1Q46 A;  1WOC A;  3NTK A;  1EU3 A;  4Y7N H;  2ZJQ A;  2KJX A;  3TQY A;  1B1Z A;  3S2D B;  4IFD H;  5M3F H;  4IQZ A;  3CAM A;  5CKL A;  5EPK A;  3IFD A;  1M1K C;  3PUZ A;  5IIF A;  1KC8 C;  2R92 G;  4JV5 Q;  1D1K A;  3W1G A;  1D6E C;  2KHJ A;  1PLF A;  1AE3 A;  1V1P B;  1ESF A;  1CKN B;  1A15 A;  3RZO H;  5JPN C;  1HTL D;  2LMC B;  1RL2 A;  5M3F G;  1EWH A;  4XDX A;  5LHY 1;  3OPO A;  1ILQ A;  4RG1 A;  3GTO H;  4CJ2 C;  1RHP A;  1Y1W H;  4HCE A;  2ID0 A;  3Q22 A;  3PO3 B;  3ER0 A;  5I2X A;  3NQI A;  2G5D A;  3FVQ A;  1NE3 A;  1SMY C;  1PDQ A;  4MTK A;  5BN5 A;  1MI2 A;  1S72 A;  4A3G G;  2N3S A;  2JQO A;  3HEJ A;  4C3H H;  3SK8 A;  3H3V I;  1GUW A;  1MIU A;  2A6H D;  1SMX A;  2F3W A;  4C2M B;  1PYB A;  2ZM6 Q;  1STG A;  3GO5 A;  3KDF A;  2XNA C;  2RHS B;  3T1Y L;  1XPR A;  4EQO A;  1X3Q A;  5C4Z A;  3K0Y A;  4HSP A;  4A3D B;  2BOS A;  5IP9 G;  3NQT A;  4CDE C;  5CMD A;  1X3E A;  2K5N A;  3U4V A;  4JI2 L;  1U4P A;  1SDF A;  3GTL B;  1CM9 A;  4GOP A;  4DAY B;  3I4N H;  2QIL A;  1E2V A;  4A3C H;  3D0F A;  3FKI G;  2M9V A;  4HJ9 A;  1DON A;  5BR8 Q;  1VQC A;  1PHJ A;  3J7A 5;  4OWW B;  4GLA C;  4CJ1 B;  1EQR A;  3DWP A;  3R2I A;  1BBU A;  5DAU A;  4HJA A;  3A7A B;  4IOC A;  3I4M B;  1KAW A;  4BBR G;  1ASZ A;  1VQP A;  1HTP A;  1K73 C;  1PFN A;  1M90 C;  2EYM A;  5IP7 H;  1CTM A;  5M5W B;  4AH6 A;  2L11 A;  4LF5 L;  2L1B A;  3IAY A;  1EQV A;  1D5M C;  4PZ8 A;  3S1Q B;  4LF8 L;  4DGZ A;  2WKC A;  5FLM H;  2MP1 A;  4MZ9 A;  4H7B A;  1D8L A;  1KTK A;  3CRK C;  3H91 A;  4LF9 Q;  4K5V A;  3I4N G;  5IP7 G;  1ILP A;  1F2Z A;  2K6A A;  1LUZ A;  5FO8 B;  5C0X I;  2G9D A;  1PTO B;  5GQO A;  3DXJ C;  1LV9 A;  4GLV B;  3H15 A;  2A6E D;  3D6W A;  5E4X A;  1AE2 A;  3H3V C;  1QUQ B;  2R7D A;  1GHJ A;  1VQG A;  1OXS C;  3CCE A;  1EEI D;  1Q7Y C;  4N9P A;  2D0O A;  5CV9 A;  1NY4 A;  5BN3 A;  3WOE A;  5C4H A;  5JFF A;  2ASB A;  3FEW X;  3R2T A;  4LFB L;  2AHO B;  2PMZ B;  1H9S B;  5HUR A;  1CZW A;  1I50 B;  1IBK Q;  3H3V H;  2KA7 A;  2K52 A;  4DK3 C;  2K14 A;  3G6E A;  1B8A A;  1S5E D;  3WOF A;  5ELB A;  2GN5 A;  3CU7 A;  2RKS A;  3HOW B;  2JA8 B;  3I4N B;  4M8A A;  2L0C A;  1I4H A;  1WCM H;  3I72 A;  1V8Q A;  2OQK A;  4F87 A;  4DR5 L;  4JOI A;  2ICI A;  5IGC A;  2K1B A;  1NUC A;  5D3D A;  4ZQ3 A;  3SK4 A;  1IBL L;  5ELN A;  1L0Y B;  3UE1 A;  1H9K A;  3KJO A;  3RLN A;  4OWX B;  4KI0 A;  4K6D A;  1A3V A;  2ATW A;  3K0X A;  1EZ8 A;  3M85 A;  3KLW A;  2K75 A;  3SGI A;  2K03 A;  4YWL A;  3PO2 B;  2HUG A;  1O78 A;  3CCR A;  3T13 A;  4C3H B;  4DV0 Q;  1HNW Q;  1LM0 A;  1SYG A;  2N55 A;  1YNN C;  1T9H A;  5JJZ A;  3F2U A;  4XYO A;  2R92 H;  2MO1 A;  2Q2U A;  3MXU A;  2UU9 Q;  4AYB E;  1BOS A;  1SYF A;  3PO3 H;  1IL8 A;  4JI5 L;  4GNX C;  1LTT D;  3SDZ A;  2DGY A;  3NK9 A;  3GDE A;  1IXR A;  4LNQ A;  1JR0 D;  4Z9C B;  2E2J B;  1WYD A;  3S1M H;  3CKI B;  1N34 L;  3RZD B;  2F03 A;  1DJR D;  4X2D A;  3HKS A;  1S40 A;  4DV3 Q;  3CCQ A;  4B3R Q;  4H44 C;  1ICW A;  3J81 j;  2CFM A;  2F0V A;  4IUR A;  4U0Z A;  4L5R C;  1KHI A;  2ZTC A;  4YY3 Q;  3S2D H;  4PMC A;  3MXG A;  1CA6 A;  3J7Z C;  3Q8D A;  3ZCB A;  2CVR A;  4JI0 L;  4Y7N B;  5EPJ A;  1S5C D;  4DR7 Q;  4KLK A;  2OQ0 A;  4F8M A;  2XWB B;  3S15 B;  4QL5 A;  1W2B A;  2IHF A;  3KUP A;  1BCP C;  3J81 c;  1DD2 A;  3FMC A;  4C3J G;  1CFM A;  1FJG Q;  5KYL A;  3RN2 A;  2AMC B;  1S5B D;  1B50 A;  1TY0 A;  1PH9 A;  4O2D A;  3CQZ B;  1M8A A;  2EJG C;  2VUM G;  2PCF B;  2YU9 H;  1C4Q A;  3TP8 A;  3DUZ A;  4FO2 A;  3GTP H;  3F2D A;  4IUT A;  5M3M H;  5KIX A;  1YNN D;  1FGB D;  1VMC A;  3ERS X;  3JC6 6;  3M7G A;  5ISR A;  3S16 B;  3ITP A;  1XYI A;  1CUK A;  2Q8I B;  5IGE A;  4QIW E;  4DV5 Q;  1C48 A;  1I94 L;  5C4J H;  3UDG A;  1CKN A;  1EIF A;  4BBR H;  4DUY L;  4AQY L;  3NTH A;  5C44 G;  3U4Z A;  2FHT A;  4PZ6 A;  5TSS A;  4DNI A;  4LUO A;  2EPB A;  2CW0 D;  2B2W C;  4RGT A;  3V05 A;  3Q24 A;  3BVZ A;  5J3B A;  5C3W A;  4A93 B;  4EVO A;  2IX1 A;  1HQM C;  2BH2 A;  2N49 A;  2KEC A;  3KJP A;  3BDL A;  2J0T D;  1PA6 A;  3H6M A;  4EGV A;  3HG9 A;  2YTX A;  4RAU C;  2K5V A;  3S2H B;  4JI2 Q;  4N8F A;  4FNF A;  3CPF A;  3F8T A;  3MFY A;  1HPC A;  2XVS A;  1XNR L;  4TKO B;  3VA7 A;  4A3J B;  2KOL A;  1PTO D;  2QW7 A;  4RMF A;  1HRJ A;  1OXX K;  4JI1 L;  4KJN A;  4LMQ D;  3CC2 A;  1TWA H;  5FJ8 H;  4ME5 A;  3I90 A;  4A3B H;  5C3E H;  4LWC A;  4DR1 L;  1HR0 Q;  4XQQ A;  2UXB L;  4B3S L;  3J81 L;  3VDY A;  1QNU A;  2F1M A;  2E2I B;  5AJ3 Q;  3GV6 A;  4DNR B;  3OOC A;  3NEM A;  4A3K G;  1LTR D;  4ZKC B;  3HOU H;  5FOB B;  3LNN A;  3EBE A;  4LFA Q;  1YHA A;  5C4X G;  2DN8 A;  1IBM L;  2VUM B;  1I4G A;  4X2E A;  4UP8 A;  2VQE Q;  4BBS B;  2IPK D;  1TKW B;  2NZH A;  4RFB A;  1MD2 D;  4A3F H;  4HJ8 A;  2CQA A;  5IWA Q;  2E8G A;  4KKT A;  3LGJ A;  2X6L A;  4QIW B;  4NPS A;  4OO1 I;  2HHH L;  1SSO A;  5JEA G;  1E1O A;  2PI2 A;  4EQ5 A;  3HGB A;  4C3J B;  1JB7 A;  3MWY W;  1PYW D;  3FRP B;  5FLX L;  3PV0 A;  4NDX A;  2PQA A;  2Z6B A;  3AB9 A;  2K5H A;  1SYB A;  5J1Z A;  1DOM A;  4PQX A;  4ZUJ A;  1OXT A;  2CCZ A;  3MEH A;  4IFD I;  2XRQ D;  3DEO A;  2KCT A;  4C56 C;  3G4S A;  3AMU A;  4AYB G;  2F3I A;  3X3N A;  2F0U A;  1H9R A;  5I9P A;  3UDX A;  2AUJ D;  2NZ1 D;  4IUQ A;  3NWT A;  2F4V L;  4EQN A;  2NN6 G;  1PRT B;  2UUC L;  4A3L G;  3D6C A;  1QG7 A;  2K5D A;  1PH8 A;  2B63 H;  5CR3 A;  5JAV A;  2F0P A;  2SNM A;  5KND A;  1EY4 A;  1QZH A;  1OTC A;  3M3Y H;  3M4O H;  1KAA A;  3R8B A;  2LFN A;  1DZ1 A;  4GN3 B;  3D8G A;  4X2C A;  3ND9 A;  2D2C C;  1G2S A;  1EUJ A;  1CQV A;  4IPC A;  5C4X H;  5GAG C;  3C1E A;  4K2L A;  1CT1 D;  4C1N I;  2AWN A;  3OMG A;  2UUA Q;  4PG3 A;  1WTH A;  1EZ6 A;  4RHS A;  1K9M C;  2KHS A;  3CCV A;  1U4M A;  4YCV A;  1XPO A;  1VQM A;  5FO7 B;  3GTJ B;  1B7Y B;  1A62 A;  4E6I A;  4GKK L;  1YNJ D;  4IUP A;  5DM6 3;  2UU9 L;  4KTA A;  4MTN A;  3NSW A;  2F0M A;  1EQQ A;  3L9A X;  3BZD B;  2E76 C;  5IY0 A;  3O13 A;  1WTQ A;  2GA4 B;  3EFX D;  3U9S A;  2RA4 A;  1UNS A;  1UWV A;  2JK8 A;  3HOW G;  3T1Y Q;  2PI2 E;  2NVQ H;  3DM1 A;  5EPL A;  2F0I A;  3OW2 A;  3I7F A;  1S3O A;  1WTR A;  1LTA D;  1Y8P B;  2MPM A;  2MJ8 A;  4A3M G;  1Y1V B;  1JOR A;  2D5D A;  5GAD C;  2WIN B;  2EZV A;  1VCI A;  2JE6 I;  3K8A A;  3N6R A;  4CKC A;  4LU4 A;  4DV1 L;  2RQX A;  3K80 C;  3E6Z X;  1YVC A;  1TII D;  1LTG D;  4DR7 L;  1G6Z A;  2F3V A;  4BY7 B;  3PUY A;  4JI7 L;  5T1I A;  4GKJ Q;  3VYT A;  2NWG A;  3P20 A;  1EEF D;  4QQB X;  2WB1 B;  1A63 A;  3KLR A;  1EYD A;  3TZD A;  3A54 A;  5A2Q L;  1TS5 A;  2NVT B;  4DAV A;  2EYL A;  1N9W A;  5M3M G;  1NMG A;  4APV A;  4YHH L;  2WKD A;  2BA1 A;  1LTI D;  4PY3 A;  1R4Q B;  4A3I H;  2PMZ E;  2OWO A;  2SNS A;  5C0X H;  4CDD C;  1O7Y A;  1TWH H;  5LMN W;  1CKO A;  4JBW A;  5KNB A;  4NXM Q;  1PRT C;  3RN5 A;  2R7F A;  4LF9 L;  1Q82 C;  2R3Z A;  1V43 A;  2D9U A;  4NW2 A;  4C1N K;  1B4O A;  1KLU D;  2B29 A;  4MIU A;  1H9J A;  2JA7 B;  1NAP A;  2KED A;  4FDB A;  4AQY Q;  1DM0 B;  2K01 A;  3A5Z B;  3W2D A;  1VQK A;  1N32 Q;  2I5L X;  3HKZ G;  4CKB A;  1XMO L;  3CCU A;  3TRZ A;  2KQ3 A;  4IUN A;  3B6Y A;  1FD7 D;  4LF7 Q;  1SNO A;  1TWC H;  3QWN A;  1CHP D;  1PH1 A;  1U9R A;  3D4W A;  3PCO B;  1R4P B;  2Q8T A;  4WFN 3;  5LMN Q;  4KD4 A;  2R93 B;  5IYC H;  1UE5 A;  4ZKB B;  2HQL A;  1IKL A;  1J6Q A;  4IFD G;  1IBK L;  3RR5 A;  1PTO F;  4WGJ A;  4R4I A;  4CGY B;  4L8J A;  5M5X H;  3A5U A;  3HOV B;  2DJG C;  1E2W A;  5CV4 A;  2HIV A;  4DR1 Q;  4DN4 M;  3K58 A;  2KHI A;  3Q6S A;  3EVQ A;  1EIG A;  4F7X A;  4J15 A;  1RKN A;  2AQ1 B;  4ZUI A;  2EYF A;  5IGD A;  5M5Y H;  5FLX E;  1SRU A;  5FJ8 G;  4GNX A;  1SFO H;  3S17 H;  5JJK A;  1HUN A;  3BU2 A;  3I91 A;  1MBY A;  4ZRZ A;  1WTX A;  2XWJ B;  1SAP A;  1KXL A;  4KHV A;  3PF4 A;  1K8O A;  5C0X J;  2Y0S E;  3R93 A;  1TT2 A;  3SHL A;  3GTG B;  4DV0 L;  1PH5 A;  4YCU A;  5IGF A;  1GKH A;  4BWG B;  3BYY B;  2HHH Q;  1GUN A;  1Y1V G;  1JOK A;  4RCO A;  1X65 A;  5IYD G;  3MXP A;  2JEB I;  1PYS B;  4DK1 A;  3MVV A;  2CWA A;  2HDL A;  3NEN A;  4DV4 Q;  1LAB A;  2PPB C; 
#chains in the Genus database with same CATH homology
 1GM5 A;  3UE1 A;  2MQH A;  1HNZ Q;  1U0L A;  1MKH A;  4OON A;  3KJO A;  3RLN A;  2RF4 A;  4OWX B;  5CGL A;  4TVA B;  4A3K H;  1YHQ A;  3HOU G;  4DR4 Q;  4BY1 G;  4A3E G;  1N34 Q;  4JCV E;  4KI0 A;  4LF4 Q;  1BBW A;  2ATW A;  1FGU A;  3K0X A;  1K83 H;  3M85 A;  3KLW A;  2K75 A;  4ALP A;  3SGI A;  4YWL A;  2E5L L;  1TWG H;  3ICE A;  3CCR A;  1EYG A;  1W3S A;  3AEV A;  4IOA A;  4DV0 Q;  4XTC S;  1HNW Q;  1LM0 A;  1I3Q H;  3E9I A;  4QJF A;  1XTD A;  1YI2 A;  4IPD A;  4R1J A;  2GVA A;  3CUC A;  1T9H A;  4JBJ A;  3SN9 A;  2PQA B;  4X64 L;  4HJ5 A;  4X66 L;  4A3C G;  5ELO A;  2IX0 A;  3PUW A;  1BVS A;  2MO1 A;  2Q2U A;  2R92 H;  4JBK A;  3M9B A;  2UU9 Q;  4DR5 Q;  4AYB E;  4A3M H;  3TEH B;  3KOJ A;  1MJC A;  3PO3 H;  2UXD L;  3J80 c;  1Y14 B;  3A74 A;  3OTO Q;  4A3E H;  4GS3 A;  4JI5 L;  4GNX C;  4BY1 H;  3I55 A;  1EOV A;  3HOZ H;  4GOP B;  2DGY A;  1VS0 A;  1VQ8 A;  2RHQ B;  3GDE A;  1FJG L;  1IXR A;  3I4M G;  1LYL A;  4JV5 L;  3J81 i;  4LNQ A;  2R93 G;  1WYD A;  1Y1V H;  3S1M H;  1PV4 A;  3CME A;  1N34 L;  4U07 A;  1C7Y A;  2Z0S A;  3S1N H;  3HKZ E;  3ZLM A;  4X2D A;  3HKS A;  1L1O A;  1S40 A;  1JT8 A;  4P72 A;  4Y52 H;  3KF6 B;  4DV3 Q;  1HH2 P;  3CCQ A;  2JA5 G;  1V1Q A;  4B3R Q;  3MXN B;  2V1C C;  1WCM G;  3J81 j;  2CFM A;  4R4C A;  4U0Z A;  2CWP A;  1KHI A;  2ZTC A;  3PUX A;  4L5R C;  1CSP A;  1EWI A;  3STB C;  4YY3 Q;  1HNW L;  3F2B A;  1PVO A;  4IPH A;  3S2D H;  3S6A A;  3J7Z C;  5HY6 A;  4QY7 A;  3Q8D A;  2JA7 G;  1HZB A;  1E24 A;  3ZCB A;  4GKK Q;  4X64 Q;  3PIP A;  1QVC A;  1QUQ A;  3U50 C;  4JI0 L;  4K0K L;  1A8V A;  4DR7 Q;  2K4K A;  4KLK A;  3AFQ A;  2OQ0 A;  3J80 i;  2LXJ A;  4UP9 A;  1BKB A;  3N3U A;  2Q2H A;  1NTG A;  1JJ2 A;  1I94 Q;  3FKI H;  1HNX L;  4QL5 A;  1W2B A;  2IHF A;  2VL6 A;  3OTO L;  2WP8 J;  4JI5 Q;  3J81 c;  1VQE A;  2DUD A;  4DR2 Q;  1FJG Q;  1SRO A;  3KF6 A;  4BA1 I;  3RN2 A;  1FVI A;  1K0R A;  1KQS A;  4YWK A;  3L0O A;  2AMC B;  4B3T L;  5GRO A;  1XNQ L;  2YTV A;  1G6P A;  3RLF A;  4LUV A;  1PH9 A;  4O2D A;  4BBS H;  1VQB A;  1G51 A;  4R4T A;  3ULP A;  4JBM A;  3HOY H;  2KEN A;  3K7U C;  4B3M Q;  2VUM H;  1X56 A;  1GO3 E;  2RCN A;  2CKZ B;  3CXC A;  5E7N A;  2VUM G;  4A93 G;  4B3R L;  2E2H H;  4PMW A;  2YU9 H;  1U5K A;  1YJN A;  2UXC Q;  4UY8 C;  3GTP H;  4YY3 L;  3F2D A;  2VQF Q;  4POG A;  4KHZ A;  4DV1 Q;  4JI7 L;  5M3M H;  1XJV A;  3F1Z A;  1IZ6 A;  2E2I H;  3JC6 6;  1NMF A;  3ERS X;  4A3L H;  5HGQ A;  2MFI A;  1L1O C;  1KRT A;  2NN6 I;  4DKA C;  4A3F G;  4NXM L;  3BJU A;  4OX9 Q;  1L0W A;  4P75 A;  1CUK A;  4K0K Q;  3L7Z C;  2KCM A;  4QIW E;  3PUV A;  1R9T H;  4DV6 Q;  4JYA L;  3FP9 A;  4DV5 Q;  1J5E L;  1DGS A;  3A0J A;  1I94 L;  2Q2T A;  5C4J H;  3UDG A;  2HT1 A;  1CKN A;  1EIF A;  3IRB A;  4U04 A;  4NXN L;  4JI1 Q;  4BBR H;  5IYC G;  4DV7 Q;  5IYB H;  4DUY L;  2ZM6 L;  4GLX A;  4AQY L;  1NBW A;  5C44 G;  3U4Z A;  4DNI A;  4PZ6 A;  1TXY A;  4ME3 A;  4LUO A;  4P71 A;  4QGU A;  1VQ7 A;  4YCW A;  3STB D;  5C3E G;  1N32 L;  5JJ7 A;  1UE7 A;  4YHH Q;  1QZG A;  3W1B A;  1N36 Q;  2JJQ A;  1XMO Q;  1WJJ A;  2UXB Q;  5C0X G;  1PH3 A;  5J3B A;  2NZO A;  3D31 A;  1LTL A;  2JA5 H;  3HOY G;  5K36 G;  4OXP A;  2A8V A;  2IX1 A;  4X65 Q;  3PO2 G;  2BH2 A;  2N49 A;  3S2H H;  1AH9 A;  4DR3 L;  3KJP A;  2N78 A;  5H1S E;  4JI6 Q;  1JE5 A;  3G48 A;  4TQU S;  1PA6 A;  3S1R H;  1OXU A;  4C3J H;  2JA6 G;  1VQ6 A;  2YTX A;  3ULJ A;  2VQF L;  4LF8 Q;  4JOI C;  4WJ4 A;  2K5V A;  1WFQ A;  4JI2 Q;  4JI4 L;  1VQH A;  2ZJR A;  1IBM Q;  2NVY H;  3CPF A;  1SE8 A;  3F8T A;  1XNR L;  4A93 H;  2VQE L;  1V9P A;  2Q2I A;  1PH4 A;  2VNU D;  3K81 C;  4A76 A;  4JYA Q;  1C9O A;  4DV5 L;  3PIO A;  4RMF A;  3RLO A;  1YIT A;  1OXX K;  3E0E A;  4JI1 L;  4NXN Q;  1CKM A;  4R4Q A;  1KIX A;  4R4O A;  4DUY Q;  4OWT B;  3F2C A;  3CC2 A;  3NEL A;  1TWA H;  4A3B G;  5FJ8 H;  1VQI A;  1VQF A;  3CMA A;  4A3B H;  5C3E H;  4LWC A;  3E9H A;  3CC7 A;  4DR1 L;  1HR0 Q;  2IY5 B;  3BZC A;  1N36 L;  2UXB L;  3ZC7 A;  4B3S L;  1P16 A;  1IL2 A;  1D7Q A;  3AYH B;  3VDY A;  4X65 L;  4GNX B;  1GD7 A;  2LXK A;  2HIX A;  3S16 H;  5AJ3 Q;  4LF5 Q;  2BA0 A;  3W5O A;  4HIM A;  1YZ6 A;  3PSI A;  4JI6 L;  4LUZ A;  1HZC A;  3NEM A;  3UDI A;  2ZJP A;  4A3K G;  3HOU H;  4BA2 I;  4A3D G;  2WAQ G;  1XMQ L;  3GTQ H;  3EBE A;  4LFA Q;  1FL0 A;  1YHA A;  2R7Z H;  5EU0 A;  4L5Q A;  5C4X G;  1I5F A;  1IBM L;  4U0U A;  2NVX H;  2UUB L;  5IT9 c;  3CQZ H;  4L5T A;  4X2E A;  4LW1 A;  4UP8 A;  2EXD A;  2VQE Q;  2F4V Q;  2ES2 A;  4DUZ L;  4M16 A;  2NZH A;  4A3F H;  1TWF H;  3G71 A;  3EIV A;  5IWA Q;  4HJ8 A;  2E8G A;  4C3I H;  5FLM G;  1N33 Q;  4GN4 B;  5JJL A;  2N8N A;  3UE0 A;  3LGJ A;  2LSS A;  4A3J H;  4NPS A;  3I56 A;  4OO1 I;  1NJI C;  2HHH L;  5JEA G;  1E1O A;  5C44 H;  2PI2 A;  4EQ5 A;  4LF6 Q;  2JA8 G;  1EIY B;  4B3S Q;  1JB7 A;  1I6H H;  1VQA A;  4JI3 L;  3PV0 A;  5GAE C;  2PQA A;  4JI8 Q;  4ITR A;  3L2P A;  1SR3 A;  2K5H A;  1JMC A;  1X3G A;  3PGZ A;  2XTI A;  1OXT A;  3ZJY C;  2CCZ A;  5CMT A;  4IFD I;  3T1H L;  5JEA J;  3CC4 A;  1Q8K A;  2KCT A;  5DLQ E;  1XMQ Q;  3TS0 A;  3G4S A;  1PH2 A;  4NB3 A;  4LFB Q;  4AYB G;  1EFW A;  4LF4 L;  2F3I A;  4LFA L;  2R7Z G;  1L2F A;  2D62 A;  2L15 A;  4MNO A;  2Z6K A;  3OYY A;  2UUA L;  2UUB Q;  3UDX A;  3GTK H;  3RZD H;  3MEF A;  4DAM A;  3CF5 A;  3U58 A;  2EQS A;  2F4V L;  3CW2 C;  4P73 A;  2UUC L;  2NN6 G;  4DUZ Q;  4A3L G;  4IPG A;  2E2J H;  1Q86 C;  4IJL A;  4UP7 A;  3AFP A;  1Q1E A;  5IWA L;  1VQD A;  1VQ9 A;  2WFW A;  1PH8 A;  4OO1 G;  2G03 A;  3CCM A;  2ZTE A;  2B63 H;  5IE8 A;  4DV2 L;  1OTC A;  2Z6K C;  1QZH A;  2AWO A;  4X66 Q;  2OTL A;  1UE6 A;  4L5S A;  3M3Y H;  3M4O H;  4BXX G;  3HOV G;  2ALY B;  1SN8 A;  1IBL Q;  1E7Z A;  4GN3 B;  4JI8 L;  4X2C A;  1JJC B;  3PO3 G;  1QVF A;  3BZK A;  3I2Z A;  1PFS A;  1O7I A;  4X62 Q;  1EUJ A;  3DM3 A;  4IPC A;  5LMU Q;  3M4Q A;  5C4X H;  3TS2 A;  1VQJ A;  2JA9 A;  4IO9 A;  4POF A;  5GAG C;  3M7N A;  3GTM H;  3PO2 H;  1VQ5 A;  2MO0 A;  3KDF B;  2I0Q A;  2E5L Q;  2AWN A;  2VY3 A;  3K7A H;  4PG3 A;  2UUA Q;  4A3G H;  3HFZ B;  3JAM i;  4DV3 L;  1K9M C;  3WWV A;  3CCV A;  1XPO A;  4YCV A;  2UUC Q;  3S15 H;  5FLX c;  2QEX A;  2H5X A;  1K8G A;  1VQM A;  1E22 A;  5IYB G;  2B3G A;  1HZA A;  1Q46 A;  1WOC A;  4X6A H;  1Z9F A;  1B7Y B;  3FHW A;  4Y7N H;  1YBY A;  1A62 A;  3H0G H;  4HIO A;  2ZJQ A;  2WB1 G;  3M4P A;  4GKK L;  4JI0 Q;  3TQY A;  1HJP A;  2UU9 L;  4GKJ L;  2A1A A;  4MTN A;  2UXD Q;  1YJ9 A;  5M3F H;  3S14 H;  3CAM A;  5CKL A;  1EQQ A;  4P74 A;  1K3R A;  5IY0 A;  1MJE A;  3CPW A;  1M1K C;  2JA8 H;  4O0A A;  3PUZ A;  1KC8 C;  3HOW H;  2R92 G;  4JV5 Q;  4XI8 A;  3W1G A;  1UWV A;  4X62 L;  4DR2 L;  1VQO A;  2JK8 A;  2KHJ A;  5LMU L;  3T1Y Q;  3HOW G;  1AE3 A;  2PI2 E;  2NVQ H;  1CKN B;  3OW2 A;  1SLJ A;  1XNQ Q;  3I7F A;  3RZO H;  1S3O A;  1ASY A;  4A3M G;  1I50 H;  1RL2 A;  2QGQ A;  5M3F G;  3JAM c;  1YEZ A;  5IP9 H;  4B3M L;  5GAD C;  4A75 A;  4RG1 A;  1Y1W G;  1XPU A;  3GTO H;  2IHE A;  5IYD H;  3TRE A;  1RIP A;  1Y1W H;  1G29 1;  3H0G G;  1VQL A;  2CQO A;  2ID0 A;  1VCI A;  2JE6 I;  3K8A A;  3ER0 A;  2YTY A;  4LU4 A;  4DV1 L;  3K80 C;  1YVC A;  2QA4 A;  1VQ4 A;  4DR7 L;  1NE3 A;  1UEB A;  4H02 A;  3PUY A;  2Y0S G;  4DK6 C;  1S72 A;  2N3S A;  1UE1 A;  2JQO A;  2YV5 A;  3UDF A;  2VW9 A;  1HNX Q;  4A3G G;  4GKJ Q;  5JJ6 A;  4C3H H;  4HID A;  1WI5 A;  3H3V I;  1CSQ A;  1MIU A;  4QQB X;  1A63 A;  1SMX A;  3HOV H;  1PYB A;  4BXX H;  4DV7 L;  3RNU A;  2ZM6 Q;  1L1O B;  4B3T Q;  4BY7 G;  3GO5 A;  3KDF A;  2RHS B;  1X3F A;  3T1Y L;  4LFC Q;  1XPR A;  3CD6 A;  1N9W A;  1E3P A;  3S24 A;  1NMG A;  5M3M G;  2VS1 A;  4APV A;  4YHH L;  2BA1 A;  4EX5 A;  4PY3 A;  4A3I H;  4LF7 L;  5IP9 G;  2PMZ E;  2OWO A;  2F52 A;  4DR3 Q;  1KD1 C;  5LMN L;  2UXC L;  2VZA A;  2R93 H;  1TWH H;  5LMN W;  1CKO A;  3SHG A;  1X3E A;  3LET A;  1Z47 A;  4JBW A;  2K5N A;  5M5W H;  1YHB A;  3U4V A;  4NXM Q;  4WJ3 M;  1X55 A;  4JI2 L;  4JI4 Q;  4OX9 L;  3RN5 A;  2R7F A;  4DPG A;  4LF9 L;  1Q82 C;  4GOP A;  2YYZ A;  4DAY B;  1V43 A;  3EN2 A;  3NBH B;  4DV6 L;  3CCS A;  1PH6 A;  3I4N H;  3I4M H;  4JI7 Q;  4A3C H;  3D0F A;  3FKI G;  1J5E Q;  4KHP Q;  2B29 A;  4A4I A;  4HJ9 A;  2I5M X;  2IT1 A;  3ULL A;  5BR8 Q;  1VQC A;  1YNX A;  4FDB A;  2F6S A;  4AQY Q;  4GLA C;  1PHJ A;  3CP0 A;  1EQR A;  4OWW B;  3GTG H;  3J7A 5;  1HZ9 A;  3A5Z B;  1BBU A;  1KRS A;  3HOX H;  4HJA A;  2D0P A;  1VQK A;  1N32 Q;  2I5L X;  4PZ7 A;  3HKZ G;  4IJH A;  4LFC L;  1XMO L;  3CCU A;  3TRZ A;  4XIG S;  1X6O A;  2KBN A;  4IOC A;  1KAW A;  3B6Y A;  1B70 B;  3GD7 A;  4BBR G;  1YJW A;  1ASZ A;  1VQP A;  3GTL H;  4LF7 Q;  4U0S A;  1K73 C;  1TWC H;  1M90 C;  1IYJ B;  1PH1 A;  2BH8 A;  2C35 B;  5IP7 H;  3PCO B;  4AH6 A;  5AJ3 L;  4LF5 L;  5LMN Q;  1PH7 A;  2MNA A;  4JC0 A;  3HOX G;  4AIM A;  5IYC H;  4GOP C;  1UE5 A;  4PZ8 A;  4LF8 L;  2HQL A;  1A0I A;  5FLM H;  1J6Q A;  2ZTD A;  1XNR Q;  4IFD G;  4MZ9 A;  1Q81 C;  1D8L A;  4LF9 Q;  4A3D H;  2EIF A;  3SE5 A;  1IBK L;  3HOZ G;  3RR5 A;  5IP7 G;  2GVB A;  3PF5 A;  1X54 A;  3I4N G;  4WGJ A;  4KHP L;  4GN5 A;  2FXQ A;  2NVT H;  4R4I A;  1N8R C;  5BR8 L;  1LUZ A;  5M5X H;  4HJ7 A;  4DR6 Q;  4C2M H;  3A5U A;  3I4O A;  2XGT A;  1OXV A;  1Q1B A;  2HIV A;  1HR0 W;  5C0X I;  1VQN A;  2OTJ A;  5GQO A;  4DR1 Q;  1HR0 L;  2KHI A;  5GAH C;  4A3J G;  4GLV B;  3H15 A;  4BY7 H;  1AE2 A;  4J15 A;  1X9N A;  1QUQ B;  3KYH C;  1YIJ A;  3S1Q H;  4A3I G;  2R7D A;  1P8L A;  3KF8 B;  3KFU A;  1JJG A;  4BBS G;  1VQG A;  1OXS C;  4DV4 L;  5M5Y H;  3CCE A;  4HIK A;  1QVG A;  4JI3 Q;  1Q7Y C;  2D0O A;  2PNH A;  1NY4 A;  1K8A C;  1HNZ L;  1SRU A;  5FJ8 G;  4N67 A;  2OCE A;  4UPA A;  5JFF A;  4GNX A;  1SFO H;  2ASB A;  1KL9 A;  3S17 H;  5JJK A;  4DR4 L;  3BU2 A;  3T1H Q;  5JJI A;  4LFB L;  1Q12 A;  1GVP A;  2AHO B;  2WAQ E;  3CCJ A;  1KXL A;  3AQQ A;  3PF4 A;  4JG2 A;  5C0X J;  2A19 A;  2JA6 H;  1IBK Q;  3H3V H;  2Y0S E;  3DLL A;  3CCL A;  2K52 A;  4DK3 C;  1N33 L;  2K14 A;  3G6E A;  1B8A A;  2AKW B;  2JA7 H;  2JEA I;  4DV0 L;  1PH5 A;  2GN5 A;  4YCU A;  1C0A A;  1GKH A;  4DR6 L;  2WB1 E;  2HHH Q;  4YWM A;  1WCM H;  1Y1V G;  4DV2 Q;  1E1T A;  4IFD J;  2OQK A;  1X65 A;  5EAY A;  5IYD G;  4LF6 L;  2JEB I;  2B63 G;  1PYS B;  2K50 A;  4DR5 L;  4JOI A;  2CWA A;  3NEN A;  5JFZ A;  2R6G A;  4DV4 Q;  1H95 A;  2I5H A;  1IBL L;  5ELN A;  3GTJ H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...