2VZAA

Type iv secretion system effector protein bepa
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
TEIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPKAHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL FILAMENTATION PROTEIN
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
total genus 91
structure length 296
sequence length 296
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2vzaA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vzaA02
4U0SA 3KLWA 1I94L 2ATWA 3H3VI 1WCMG 1OXXK 4BBSG 1VQ7A 2VZAA 4NXMQ 2K52A 3GTKH 3S1RH 1IL2A 4DV1Q 1S40A 4A3MH 2OTLA 3GTPH 3J81c 2L15A 3WWVA 3J7ZC 4DUYQ 1JT8A 1L2FA 5HY6A 4LF6Q 2YYZA 5EU0A 4LF5L 2RF4A 1ASYA 3NBHB 4P73A 1DGSA 2RHSB 4IPCA 1IBKL 5JJ6A 3GDEA 4ITRA 1VQIA 3UDFA 1Y14B 5C0XJ 2XTIA 4JI4Q 2N78A 4DV6Q 3PO3H 3E9HA 1UE6A 2NN6I 4J15A 5LMNL 1PH5A 1YJWA 3K8AA 1G51A 1YHBA 4A93G 4B3RQ 2NZHA 1Q8KA 2Z6KA 4B3TL 1A0IA 2UXBL 5JFZA 1L1OB 4DR1Q 4N67A 4JYAL 4HJAA 4C3JH 3HOXH 3CQZH 4POGA 5HGQA 2JA8H 5FLMH 1RL2A 3PUVA 3HOUH 3PF5A 4JI7Q 2E8GA 1IXRA 5J3BA 4POFA 3HFZB 1KD1C 3J7A5 3U50C 1XJVA 2AMCB 1YVCA 3HOZH 1WFQA 4EX5A 2D0PA 3Q8DA 1R9TH 4JI2Q 1J5EQ 2MQHA 2UU9Q 5JJLA 3OYYA 2I5MX 3AEVA 1Z47A 3M3YH 3W1GA 1A8VA 1HR0Q 3CCVA 2Z6KC 4LF4L 4IO9A 1OXUA 2F3IA 3G4SA 3G6EA 3CCEA 4UY8C 2A8VA 5GAGC 1LTLA 1PFSA 3MXNB 3KJPA 3U58A 1C0AA 4DUZL 1FVIA 3AQQA 2OWOA 5JEAJ 4BBRG 1PHJA 3ZCBA 2V1CC 2ZM6Q 4GOPB 3M85A 3CW2C 3H15A 1VQ6A 1Y1WG 2JA6G 1CKOA 4Y52H 4L5SA 5IYCG 1C7YA 2A19A 2ZJPA 1JJGA 4K0KQ 3CMAA 3F2CA 2F4VL 1BKBA 1XNRL 3A5ZB 1JMCA 3CD6A 3UDGA 1WYDA 2PQAA 2WP8J 4JV5L 3CC7A 1SROA 4A3IH 4OX9Q 1W3SA 4A3LG 1A62A 3M4QA 3GTQH 4YCVA 4DR7Q 1N32L 5C4XG 2D62A 3A74A 3KF8B 4X2EA 1P16A 1N36Q 3GTLH 3F2DA 2KBNA 1WOCA 4A3JG 4YWMA 4X64Q 2GVBA 3J80i 4AH6A 1VQLA 1HH2P 4YHHQ 2QGQA 3F8TA 1YHQA 2LSSA 3M4OH 2VS1A 1XPUA 2R93H 4UP9A 1VQCA 1VQJA 1EQQA 1HZBA 4L5QA 4TVAB 4JOIA 4A3FH 1KXLA 5C44H 1J6QA 3H0GH 4BY1H 3PF4A 1XPOA 2MO1A 2E5LL 1B7YB 3I7FA 4JBKA 2AWOA 3S16H 2Q2UA 1QZGA 1S3OA 3OTOQ 4GNXC 3CF5A 2HHHL 4A3MG 4WJ4A 2ES2A 4R1JA 3KF6B 1IBLL 4PZ7A 2JA7G 4ME3A 3J80c 2WAQG 1PH9A 4JI5Q 1MKHA 4IFDG 4A3GH 4DR5L 1E3PA 5IT9c 3I55A 4JI8L 1EIFA 2NZOA 4ALPA 2UUCL 4GKJQ 3S15H 3ZLMA 4X2DA 4OONA 3K0XA 4JOIC 4LFAQ 4LFCQ 1MIUA 1PH4A 2VL6A 1NJIC 1M1KC 3M7NA 2JE6I 2N3SA 3S1NH 1H95A 2PNHA 1HNWL 4X62Q 3GD7A 4GN4B 4BXXG 2UXDQ 3KDFA 2LXJA 3KFUA 1QUQA 1X6OA 2RHQB 3PCOB 4H02A 5BR8Q 4DV0L 3S17H 2UUBL 3T1YQ 1N34Q 1UE1A 2K5VA 4R4CA 1BBWA 3HOXG 2EIFA 1HZ9A 2WAQE 5M3MH 1FJGQ 2JA8G 5FLMG 2BA0A 4GKKQ 4QL5A 3HOUG 1VQPA 3B6YA 4NB3A 3HOWH 3PIOA 3CC2A 3GTJH 1YI2A 2NVYH 1UWVA 2HIVA 5AJ3L 4RG1A 1QVFA 4DR7L 4HJ8A 4B3ML 4LUVA 4GLVB 4APVA 4PY3A 4X65L 2R7DA 1A63A 1BVSA 1VQ5A 1WJJA 2HIXA 1UE5A 2HT1A 3K7AH 4IJLA 2QA4A 2WB1G 4IOAA 5FJ8H 2DGYA 4JBJA 4JI1L 1JE5A 3MEFA 3CCUA 4TQUS 4UPAA 3PUWA 2E2JH 4JBMA 4BY7H 1EYGA 3PV0A 5DLQE 4JCVE 4DR2L 4JI3Q 3JC66 1HNXQ 3LGJA 5IP9H 1HJPA 2ZTEA 4DV4L 4IFDI 4A3CH 1Z9FA 4GLAC 1E22A 1BBUA 1PYBA 1XMOQ 4BXXH 4DR3Q 1KQSA 4YWLA 3CC4A 4DV7L 4A3IG 2DUDA 1U5KA 2VQFL 4DR4L 4HJ5A 4LFBQ 4LF8Q 2R7FA 3CXCA 1JJCB 2BA1A 3I4MH 1XMQQ 4JI0Q 1NBWA 1X55A 4U0UA 1SLJA 1HZCA 4XIGS 4YCWA 4HIMA 3S1QH 3L0OA 3GO5A 2VQEQ 1N33Q 1B70B 4UP7A 5GAHC 4U0ZA 1TXYA 1JJ2A 2Q2TA 1CSPA 3AYHB 1Q86C 3NELA 3RZOH 3VDYA 4BA2I 5M5XH 2CFMA 4DV5Q 2R93G 2KCTA 2IY5B 1VQEA 2I5HA 2WFWA 4PZ6A 1GD7A 2B29A 1L1OC 5C4JH 4A3FG 2JA5G 4NXML 5C44G 2R92G 1CSQA 4BY1G 4DV1L 4IFDJ 4X6AH 1SFOH 1G6PA 1NY4A 3T1HQ 4DUYL 1NMFA 1FL0A 4DV3L 3CCLA 1KIXA 1VQOA 3SHGA 1HR0W 4LF6L 4JBWA 3E0EA 4LF7Q 4RMFA 5M5YH 1T9HA 1PH2A 1HNZQ 3L7ZC 3TS0A 1XNQQ 3KJOA 1KHIA 1UE7A 4JI4L 1E7ZA 4DV6L 4A3GG 2FXQA 3FHWA 1N8RC 4EQ5A 5LMUQ 1VQHA 1X3EA 3CCJA 2KHIA 4PMWA 4QY7A 1VQAA 4B3RL 5JJIA 3HKSA 2JJQA 3BJUA 4AQYQ 4DR1L 4NXNQ 3M9BA 3ZJYC 3ICEA 4GS3A 3U4ZA 2NVTH 2Z0SA 4GNXA 1OXVA 4JI7L 1KRSA 4GOPC 1Q1BA 1I6HH 3CUCA 1CKMA 1K0RA 1Y1VH 1IBMQ 5M3MG 1YHAA 1XTDA 3TEHB 2B63H 2VNUD 2CWPA 4R4OA 4JI2L 2ZTCA 3HOWG 1EUJA 4MTNA 1J5EL 5M3FH 4IPDA 1I5FA 3A0JA 2UU9L 2IX0A 1O7IA 3LETA 2CQOA 3TREA 3RLFA 4DV7Q 3PSIA 4A3EH 2UUAL 1Q1EA 4LWCA 2ZJRA 1EQRA 5EAYA 3UDXA 1HR0L 3AFQA 4A3KH 4DV2Q 4JI8Q 4LUOA 5IP7H 2I0QA 5IYBH 4KI0A 3NENA 5ELOA 1EFWA 3KF6A 1WI5A 2XGTA 2VW9A 2OCEA 2JEBI 1K8GA 3K80C 2K5HA 2ZM6L 4KHPQ 2UXCQ 1NMGA 4P75A 4C3HH 1OXSC 4X66Q 5FJ8G 3CCQA 1AE3A 4A3DH 4YY3Q 3HOYH 3FP9A 4JI6L 2AWNA 1S72A 2VUMH 4A3BH 2K75A 3SE5A 3PUXA 3RR5A 4BY7G 4K0KL 5IWAQ 4IPHA 3G71A 1X54A 4JG2A 1HZAA 2ASBA 1VQ9A 2K50A 4PZ8A 1B8AA 3CMEA 2PMZE 3F1ZA 1RIPA 4M16A 3NEMA 4DPGA 5IP9G 3ULPA 3PO3G 1XPRA 3SN9A 4OX9L 4LF9Q 3TS2A 4QIWE 1YNXA 1CKNB 4XTCS 4A3CG 4C3IH 2A1AA 5JJ7A 4KHZA 2OQKA 1X65A 4A75A 1D8LA 2EQSA 3ER0A 3UE0A 1AE2A 1N36L 3S24A 4DAMA 1I94Q 4DR6Q 4FDBA 1KC8C 2CCZA 4LUZA 4X64L 2JQOA 5E7NA 1GM5A 4B3SL 1IYJB 1GVPA 4YHHL 4MZ9A 3ERSX 3I4MG 1SR3A 3RNUA 1PYSB 3JAMi 4PG3A 4DAYB 4LF5Q 5K36G 4WGJA 4OO1G 1IBKQ 3S6AA 3GTOH 1UEBA 1N9WA 2MFIA 3OTOL 1YZ6A 4R4QA 2YV5A 4HIOA 1VQBA 5JEAG 2VY3A 2ID0A 4C2MH 5GQOA 3CPWA 5LMNQ 1K73C 4LU4A 3PO2H 2B3GA 5CGLA 4UP8A 2IX1A 2K5NA 3J81i 4JI5L 4B3TQ 2UXBQ 3K7UC 4OWXB 1K3RA 4A4IA 1CUKA 1QUQB 4JYAQ 5H1SE 1JB7A 4YCUA 4BA1I 1YIJA 1VQFA 1PH3A 4GKJL 3H3VH 3I56A 4LFCL 1QVGA 4LFAL 4R4IA 4AIMA 2YU9H 2G03A 4GN5A 1E24A 1L1OA 4X62L 2UXDL 3TQYA 1ASZA 1LM0A 5BR8L 1VS0A 1W2BA 2E2HH 1E1TA 3T1YL 1N34L 1GKHA 4YWKA 1FJGL 4XI8A 2I5LX 2WB1E 4OWTB 1E1OA 4GKKL 3EN2A 3S14H 1U0LA 3A5UA 3I2ZA 4KLKA 4DV3Q 4LF4Q 2JA7H 1Y1VG 3BZCA 4AYBG 4U07A 1SE8A 4GN3B 2B63G 5ELNA 4DUZQ 4O0AA 2OTJA 3HKZG 2CKZB 5GAEC 1K9MC 5M3FG 1Q12A 1V1QA 1YEZA 3CCRA 3HOZG 4A3EG 1EIYB 1VQGA 1AH9A 3DLLA 4IJHA 2AKWB 3STBD 4DK6C 5CKLA 2OQ0A 4NPSA 1SN8A 3H0GG 1SMXA 1VCIA 2Y0SG 3FKIH 4A3KG 1XNRQ 5IP7G 2F4VQ 4OO1I 1IZ6A 5IYBG 4O2DA 5IYDH 1V43A 4JV5Q 4GOPA 4HJ9A 3IRBA 3AFPA 2AHOB 4DK3C 2N8NA 4AYBE 3HOVH 2HQLA 4A76A 2ALYB 4A3DG 1Q82C 4OWWB 1PVOA 3HKZE 5C3EH 4JI3L 3HOYG 1HNXL 1TWGH 5JFFA 2R7ZH 1PH8A 2VUMG 2KENA 2JA9A 4QGUA 4A3BG 3D0FA 2EXDA 3PUZA 2K14A 3I4NH 2GN5A 3TRZA 4LNQA 4WJ3M 1XMOL 4X2CA 1X3FA 3L2PA 3DM3A 1P8LA 4DR3L 1MJEA 1VQKA 2Y0SE 3J81j 2PI2A 2MO0A 1G291 4LFBL 4LF8L 1WCMH 4BBSH 2D0OA 2UUAQ 4HJ7A 3UE1A 5M5WH 1XMQL 4JI0L 1VQNA 1KRTA 2Q2HA 3RLNA 2E5LQ 4DNIA 2VQEL 1N33L 1TWHH 2RCNA 1X9NA 4L5TA 2HHHQ 1VQDA 4Y7NH 1YJNA 3F2BA 3N3UA 4DV5L 2MNAA 1LUZA 1PH6A 1IBLQ 3S2DH 1TWFH 4JI6Q 2BH8A 3W5OA 1VQMA 2KCMA 1OTCA 1YJ9A 3D31A 4DR5Q 1X56A 2R6GA 3T1HL 1OXTA 1KAWA 1V9PA 2ZJQA 3S1MH 1X3GA 2UUCQ 4LF7L 4A93H 1EWIA 1I3QH 4JC0A 1HNZL 4OXPA 3PO2G 2PQAB 1XNQL 1HNWQ 4P74A 3STBC 2IHFA 3W1BA 4DV0Q 5JJKA 1PA6A 5C0XG 4GNXB 1NE3A 2UUBQ 4B3SQ 4LW1A 5LMUL 5IE8A 4HIDA 3SGIA 3BZKA 2NVQH 1CKNA 4AQYL 4NXNL 3PGZA 3OW2A 3RN2A 1TWAH 2C35B 3E9IA 1YITA 2JA5H 2N49A 5IY0A 1M90C 2JEAI 2R92H 1QVCA 3CAMA 1QZHA 1L0WA 3S2HH 1GO3E 5AJ3Q 3BU2A 3KOJA 1Q46A 2K4KA 5FLXc 4B3MQ 3G48A 1IBML 2LXKA 2QEXA 4X65Q 1K83H 4P72A 2YTVA 4BBRH 1Q81C 5GROA 5GADC 2IT1A 1KL9A 2PI2E 2GVAA 1Y1WH 1LYLA 2IHEA 3CP0A 4MNOA 4JI1Q 2NN6G 2JK8A 3CCMA 5IYCH 2KHJA 3RN5A 3ULJA 3UDIA 4DV2L 1K8AC 4U04A 4P71A 2ZTDA 1PV4A 1Q7YC 1PH1A 3EBEA 2JA6H 4IOCA 3CPFA 4L5RC 2Q2IA 3RLOA 3M4PA 1I50H 4DR2Q 4KHPL 2UXCL 2CWAA 3FKIG 4DV4Q 1YBYA 5IYDG 4A3LH 4X66L 5CMTA 1N32Q 1C9OA 2F52A 2E2IH 1MJCA 5C4XH 2F6SA 4YY3L 5LMNW 4GLXA 1PH7A 3U4VA 1SRUA 3K81C 3KYHC 1FGUA 2VQFQ 3CCSA 4A3JH 3KDFB 3HOVG 5IWAL 4DR4Q 1VQ8A 4QQBX 4R4TA 3JAMc 2YTYA 4HIKA 2BH2A 2H5XA 5C3EG 3GTMH 3RZDH 3PIPA 2YTXA 2NVXH 2R7ZG 1EOVA 3PUYA 5C0XI 4LF9L 3I4OA 1VQ4A 3GTGH 3ULLA 3I4NG 3ZC7A 4IPGA 1D7QA 1TWCH 1NTGA 3EIVA 4DKAC 4QJFA 4DR6L
chains in the Genus database with same CATH superfamily
3KLWA 5CV9A 2ATWA 3H3VI 2M00A 2F1MA 4DV1Q 1K28A 2WKCA 3NE5B 3J7ZC 4DUYQ 2R93B 3K59A 1ASYA 4IFDH 3NBHB 1F9RA 1DGSA 2RHSB 3H0GB 1IBKL 3EQLC 5JJ6A 3F2UA 3GDEA 4HTHA 1Y14B 5C0XJ 2XTIA 2BCOA 4JI4Q 3S16B 2N78A 5T1IA 4J15A 2NN6I 2L55A 3KUPA 1YJWA 4H13C 4CKCA 1EU3A 2O2LD 2UXBL 4XQQA 4KTAA 3LNNA 4C3JH 4POGA 1A6XA 2A5HA 4ME5A 3S9WA 1IXRA 5J3BA 3S15B 3KLSA 2AMCB 2EYLA 2PZTA 1WFQA 4FYDA 2UU9Q 5JJLA 1I6VC 1Z47A 1EQVA 3HZXA 2XN9C 5CYUA 1OXUA 4UHVA 1PFSA 4DUZL 3AQQA 2OWOA 5JEAJ 4BBRG 2V1CC 2ZM6Q 4GOPB 2L1BA 3NHHA 1E2WA 1CKOA 5KGUA 4K0KQ 1BKBA 2PQAA 2Z4IA 2EOTA 1SROA 2B2UC 4A3IH 5C4HA 5LL6S 4V190 3A74A 1P16A 1F9QA 3MTSA 2KBNA 5EGTA 5I2XA 4ZK9B 4AH6A 1ENAA 1BR9A 1LTTD 2K28A 1YHQA 4NDXA 2LSSA 2CQAA 3M4OH 1HPCA 1XPUA 3X3MA 1BOSA 1EQQA 2SNMA 4NKLA 1UEAB 3EROA 3VA7A 4BY1H 4KJOA 1W6JA 3PF4A 2MO1A 1B7YB 1LTSD 2AWOA 4DNTB 1A2UA 5CV7A 1O78A 1S3OA 1QZGA 2Q2UA 2HHHL 3WOEA 2SEBD 2MGSA 3RZOB 3SE0A 2JA7G 1PZJD 2KVMA 1PH9A 1KDBA 1MKHA 5C4JB 3N52A 1SFOB 2MP1A 3K6OA 2NB0A 2UUCL 3BVMA 4GKJQ 2D2CC 4OONA 5C6AA 4JOIC 2ENBA 1MIUA 1H95A 2JE6I 1HNWL 4X62Q 2O4XA 3PCOB 3S17H 3T1YQ 2EIFA 5M3MH 4GKKQ 1CT1D 3HOUG 1VQPA 3B6YA 4NB3A 3GTJH 2NVYH 1D1KA 2X6LA 1CZGA 3C3LA 4X65L 1TKWB 2K5DA 4ZUJA 3VR4A 3K7AH 4IJLA 2KQ3A 2QA4A 2WB1G 5FJ8H 2DGYA 1JE5A 3MEFA 2F0EA 1XX8A 4UPAA 2B2WA 3T13A 4BY7H 1PRTB 4L6TB 5DLQE 3SHLA 4A3KB 5C3XA 4KD4A 4KMUC 3A8KE 4JCVE 4DR2L 3H94A 3FMCA 5IP9H 4C1NI 1LT3D 1Z9FA 1E22A 1U4PA 1V1PB 3NXWA 1PYBA 3QG1A 3CC4A 3MWYW 4FF1A 2DUDA 1U5KA 3HOYB 3KLSX 1WTQA 4LFBQ 1B44D 3WDNA 2R7FA 3I4MH 4U68A 1X55A 4C56C 4U0UA 1BXTA 1SLJA 1ZYRD 4XIGS 4YCWA 4DAVA 2G9HD 4U0ZA 2Q2TA 1B2TA 3AYHB 3DM1A 3EVQA 3VDYA 1HFNA 3TSSA 4BA2I 5M5XH 1LV9A 2R93G 1ILPA 1VQEA 1LTID 4RH6A 1GD7A 5E4XA 1CSQA 5JEAH 3L9AX 3T1HQ 2RSNA 2HCCA 1SSOA 2HDMA 1KIXA 4NMZA 1HR0W 3SHGA 4LF6L 3DWAA 4KHVA 5M5YH 2RDGA 2DN8A 1GUGA 3L7ZC 4NP5A 1LTBD 1UE7A 1PLFA 1A2TA 1SYCA 3J81E 3D8GA 3R93A 4C2MB 1Y69U 4Q0FA 2RDHA 4NW2A 1VQAA 3BJUA 4ULLA 4DR1L 3ICEA 3R2IA 3TBIB 3U4ZA 1MSGA 2V4DA 3CHBD 1II3A 1CKMA 3OOCA 1BCPC 5ELCA 1Y1VH 2KUMA 2QDBA 1YHAA 2CWPA 3NSWA 3C1EA 1I5FA 3HOZH 1O7IA 4A3EH 2CQOA 3TREA 1CA6A 3PSIA 1HR0L 1F2ZA 5ELOA 1EFWA 2OT2A 3NQTA 3KF6A 3SXHA 2OCEA 5EQ0A 4KHPQ 2UXCQ 1S5ED 4P75A 4X66Q 1OXSC 4F88A 2AWNA 4ILWA 2VUMH 3SE5A 3VR6A 2PCFB 4F8MA 5IWAQ 1VQ9A 1STGA 4DPGA 2A69C 3TS2A 4RHSA 4QIWE 4KJNA 1YNXA 2B2TC 4XTCS 1KDAA 4A3CG 2A1AA 5JJ7A 3K5OA 5DM73 1X65A 2NUCA 1N32Q 3ER0A 2B2VC 1KC8C 1TWGB 5E7NA 1IYJB 2EPBA 1GVPA 2ZXRA 4MZ9A 4K2LA 1JC7A 4H44C 4MN3A 1A3UA 4XQNA 4J6HA 5M5WB 4J8QA 1EEFD 5CGKA 1UEBA 3OTOL 1TWHB 1HA6A 3PQIA 1S5DD 2B3GA 1NAPA 5C3WA 3S2DB 4B3TQ 5F2DA 1EY4A 4OHJA 1TQOA 1KABA 3QO2A 4A93B 2FFKB 2HD3A 4AIMA 2YU9H 3EFXD 4GN5A 1L1OA 5BR8L 1HQMC 5ELBA 1YNNC 2E2HH 1E1TA 2MHVA 2NBFA 5IT9E 1U4MA 3DMUA 3OWEB 3JAML 1FR3A 2NVQB 1SNQA 1TWAB 2ICEC 4U07A 1SE8A 3HG9A 3SK8A 1STNA 2R92B 3SVMA 4O0AA 1F77A 5GAEC 3NTHA 3BDLA 3CCRA 5EKIA 5A2QL 1PMRA 1VQGA 1G8ZD 4A3KG 2Y0SG 2F4VQ 4OO1I 5TSSA 5IP7G 1S5FD 4O2DA 3MC0B 2IJ0A 1Y8OB 2JA6B 3T53B 2DY8A 4HSVA 2NZ1D 2F0FA 2FHTA 3IRBA 4AYBE 2ALYB 4IZ8A 4N9TA 3HKZE 4RGMA 3HOYG 1HNXL 1WD1A 2R7ZH 2KENA 1B4OA 1I50B 3D0FA 2EXDA 3Q0AA 2K14A 1Z7TA 4TRDA 4RHRA 1LLRD 3DM3A 2QF7A 1G291 4WRDA 1EIHA 2UUAQ 3HP3A 1VQNA 4JI0L 2Q2HA 2PO4A 3RLNA 2PNRC 1LABA 1X9NA 4L5TA 2EJFC 3IAYA 4Y7NH 5KNDA 2MNAA 2MJ8A 2F0SA 1QE6A 3MAQA 4QIWB 2DJFC 2A6HC 1YNJD 1OTCA 3D31A 4DR5Q 3S1RB 1OXTA 1LO5D 1X3GA 2EYJA 1HNZL 5IGBA 3H3VC 5BN5A 4IUTA 2EYFA 3LX0A 2BE5C 1C4QA 2ZXPA 1ESFA 4DXGA 1XNQL 3QIAA 4P74A 3K57A 2IHFA 3J7AV 3W1BA 1R4PB 5C0XG 1RTOA 1RDPD 5DEHA 5FO9B 3H09A 1ENFA 2J0TD 3NQIA 4NXNL 3IFDA 3RN2A 2C35B 2F0PA 1X3PA 2JA5H 5IY0A 1QZHA 1CK1A 5L37A 2JA8B 3S2HH 1GO3E 2WACA 5I4DA 5FLXc 2L11A 5NUCA 1U9RA 1DOLA 4P72A 4BBRH 5GROA 5GADC 2GVAA 3MFYA 5DAUA 3CCMA 3GP7A 4HMJA 2FJ2A 1PV4A 1PH1A 3QR8A 3CPFA 2X6GA 4F87A 4DV4Q 5CMTA 3VR5A 2FMCA 3U4VA 3K81C 3KDFB 4DR4Q 1SJHD 3BDCA 2H5XA 3FPPA 3RZDH 2NVXH 4ZAIA 1EOVA 2B2YC 3I4OA 3GTGH 1BBXC 3NPPA 1TWCH 4MTNA 1NTGA 3EIVA 4FVMA 4QJFA 1PH8A 4EVOA 1G2SA 2KOLA 3GTLB 4IUUA 2VZAA 4NXMQ 2K52A 4N8FA 3HKZB 3GTPH 5IGGA 2Q8IB 3WWVA 4P2CB 2RSOA 5HY6A 2YYZA 5EU0A 2KCNA 4P73A 5C44B 4IPCA 3SEBA 3SK6A 3VR2A 4DN4M 1TS2A 3PO3H 1NNXA 3E9HA 2XWJB 4PNYA 3MFGA 1YHBA 4A93G 4B3RQ 2Z6KA 5JFZA 5ELFA 3CQZH 5HGQA 1O80A 1RL2A 3HOUH 1L0YB 3PF5A 4JI7Q 4POFA 3J7A5 1NCVA 3U50C 2B2WC 4XDXA 1DOMA 3KBXA 4IUVA 1FNWA 2D0PA 3Q8DA 1TR5A 1R9TH 4JI2Q 1J5EQ 4XYQA 1STHA 2EYMA 3J7YW 1A8VA 4IO9A 2VB2X 3D4RA 3CCEA 4UY8C 3MXNB 3U58A 2JSOA 4FXKC 3M85A 1BCPB 2F0KA 2JA6G 2NYZD 3LWEA 1OO9B 3R2TA 2A68C 1XNRL 3CD6A 1CA5A 2WP8J 2OF1A 3MVVA 4OX9Q 4YCVA 2D62A 3KF8B 4K5XA 4ZCKA 1WOCA 2CW0C 4X64Q 3J80i 1DZ1A 2R93H 4ZKBB 1VQJA 1MSHA 4L5QA 1ICFB 5D65A 3H0GH 2E5LL 3S16H 3CF5A 1KLUD 5EBDA 4R1JA 4KY6A 3J80c 3R3OA 3O13A 4JI8L 4ALPA 1DJRD 3S15H 4X2DA 1M1KC 2F0OA 3M7NA 3VYRA 2PNHA 1AZQA 2BDNA 2UXDQ 1F9SA 2LXJA 3KFUA 1DXMA 4H02A 2PW5A 4CDFC 1GUTA 2WAQE 2JA8G 5FLMG 4UAIA 4QL5A 5DNFA 2LMCB 4N8X1 3D4DA 1SE3A 4ODGA 3CC2A 4DNRB 1QVFA 4HJ8A 1I6HB 4UDUC 4GLVB 4PY3A 3SK5A 3TZUA 1VQ5A 2B63B 1WJJA 1UE5A 4HSPA 3RMHA 5M3FB 4EQOA 4CJ2C 2AUKA 3PUWA 3FVQA 3I3CA 2NWGA 3PV0A 3P20A 5M9OA 1T5EA 1EYDA 4IFDI 4A3CH 1BBUA 4C3HB 1XMOQ 1G6ZA 4XT3B 2Z9HA 2PQEA 2VQFL 4HJ5A 3RUZA 4LF8Q 5ELDA 3CU7A 1BNZA 2MUYA 3CXCA 1JJCB 1XMQQ 1IYVA 3BG3A 4QCLA 1B70B 3C1FA 1TXYA 3A7LA 1TS3A 1Q86C 3NELA 3RZOH 3K5MA 4I7ZC 2IY5B 2KCTA 3NWTA 5C4JH 1L1OC 2JA5G 3JAME 5C44G 4X6AH 4DV1L 1WTHA 3NUCA 2F0IA 4HR7B 1SFOH 1NUCA 1FD7D 1SYGA 1G6PA 1HXYD 1NMFA 4DUYL 1B1ZA 1VQOA 1PTOC 3CKIB 4KY7A 2Q8TA 1T9HA 1FNVA 4K14A 3V96A 1TU2B 3KJOA 4JI4L 3GTOB 1E7ZA 4OL7A 4HCSA 2FXQA 5A35A 5LMUQ 4LK1C 2X69A 3CCJA 4G4KA 3HKSA 4AQYQ 5FOBB 3M9BA 4GS3A 2Z0SA 3PIP3 2RKSA 1QB5D 3URYA 2A6ED 1RKNA 1KAAA 1EUJA 4IPDA 2UU9L 2KCCA 4DXFA 3E0JA 3RLFA 1ZYRC 4LWCA 3T56B 2KEEA 5EAYA 3UDXA 1WTOA 4A3KH 1EFID 2F0WA 5IP7H 3NENA 2WAQB 2F0GA 3AU7A 2JEBI 1K8GA 2ZM6L 5C5LA 1AE3A 4DGZA 3HOYH 4X3KA 2E75C 4O42A 3PUXA 3RR5A 4K0KL 3TZDA 3I91A 1SMYC 4IPHA 1TIID 4G7OC 3FKIB 4PZ8A 2PMZE 1Q8IA 3ULPA 3PO3G 2F0JA 4LF9Q 3HOVB 5AFWA 1H9SB 1K8MA 2OQKA 1QILA 3UE0A 4DR6Q 4DAMA 1I94Q 3J7AF 5FO8B 4ABNA 1JICA 1STBA 4KKTA 4B3SL 1HRJA 5EBCA 5KIXA 3TP5A 1IW7C 1JB3A 2XSCA 5IIFA 1BCPF 2NUDA 4LF5Q 1SNMA 1W6KA 2MPMA 1VF5C 4RGNA 1GUNA 1BUVT 5FLXL 3GV3A 1BDOA 1YZ6A 2YV5A 1PDQA 2ID0A 4C2MH 5GQOA 5LMNQ 1K73C 4CKBA 5CGLA 4UP8A 3NTKA 3J81i 1AZPA 5C0XH 1D6EC 3C46A 4A4IA 1CUKA 4JYAQ 5H1SE 1YIJA 5E1FA 1PH3A 2NUNA 4GKJL 3S1MB 1RCVD 3I56A 1D5ZC 5IGCA 1JWMD 1QVGA 1I3QB 3NP8A 4R4IA 4X62L 1E24A 3OWFA 3TQYA 2SNSA 1LM0A 1SYBA 1W2BA 4X3UA 3T1YL 2IPKD 4YWKA 4XI8A 2I5LX 1E1OA 2AQ2B 3EN2A 4GKKL 1O7ZA 1QJOA 2J7ZA 5HGTA 4LF4Q 3G7LA 1I4HA 5C5MA 4PMCA 2B63G 1HTLD 5M3FG 1CZWA 1Q12A 1YEZA 1EIYB 1UAPA 2AKWB 4OIJA 3STBD 5JJZA 4NPSA 1K83B 2RA4A 3H0GG 1SMXA 3T16A 1RHPA 1IZ6A 5IYBG 4I7AA 4JV5Q 4C3HG 1PVOA 4OWWB 5KYIA 1TWGH 4QGUA 2JA9A 2GN5A 1VQKA 5C4XB 2PI2A 2MO0A 4LFBL 3ZYYX 1RD9D 2D0OA 2EDGA 4A3JB 4HJ7A 5M5WH 1EOTA 4G57A 3GTMB 1QCBD 1TWHH 1VQDA 4F7XA 1YJNA 3N3UA 2PMZB 1LUZA 1IBLQ 3S2DH 3SK4A 1QNUA 3GTKB 3C2PA 3T1HL 4A3MB 4RGTA 2ZJQA 4A93H 1EWIA 4JC0A 1BF4A 3A7AB 2B8FA 4DV0Q 1PA6A 1WTVA 1STEA 3P1HA 1NE3A 1AEXA 2UUBQ 1VF7A 2EVBA 3K0YA 3BZKA 2NVQH 1TWAH 2N55A 1NH1A 4KKUA 2R92H 1M90C 3HOXB 3CAMA 5AJ3Q 3KOJA 3VYTA 1Q46A 2K4KA 4B3MQ 4KD3A 2LXKA 2QEXA 2K32A 2CHBD 1Q81C 5EKKA 2IT1A 2F0DA 3CP0A 3RN5A 2JA6H 4JI1Q 2NN6G 3M3YB 3DEOA 3UDIA 3Q6SA 4U04A 1EYAA 3EBEA 4L5RC 1I50H 5JOBA 4KHPL 2UXCL 2CWAA 3FKIG 4L8JA 5IYDG 4X66L 1C9OA 2F52A 5IOCA 1MJCA 3J80L 1PH7A 3KYHC 3D3RA 1F2YA 1FGUA 3HOVG 3OHXC 3CRLC 5IWAL 2QW7A 4R4TA 5KYLA 1SYFA 4HAEA 3PIPA 3A8IE 2YTXA 4Q5VA 3PUYA 3IFTA 4IPGA 1D7QA 3GTQB 1N32L 1IL8A 3U9SA 1PFBA 1A3VA 1OXXK 1VQ7A 2HUGA 1EY8A 3S1RH 1VDZA 2OTLA 1IL2A 2L15A 2QEJC 1JT8A 1L2FA 1WTXA 3SDZA 4ZKCB 5K5PA 5JVG3 4A3FB 3UI2A 4ITRA 1VQIA 4WFN3 4DV6Q 1UE6A 1BCPD 2BDOA 3OMGA 3E5SA 3K8AA 1Q8KA 4B3TL 1L1OB 1ZXTA 2RCFA 1ET9A 4N67A 4HJAA 4A3GB 1QG7A 1B9MA 5FLMH 2JA8H 3OIQA 4FO2A 1PTOB 3HFZB 2DNEA 1KD1C 1EWHA 5ISRA 1YVCA 1GXDC 3S1NB 4M8AA 2HCIA 4TKOB 2MQHA 4OIKA 4R9WA 4CJ1B 2I46A 2I5MX 2LFNA 3W3AA 2AUJD 2Z1CA 3FRPB 3V05A 2F3IA 3G4SA 3HOWB 2A8VA 5GAGC 1LTLA 1CQVA 3KJPA 1FVIA 2A69D 1I4XA 2C9OA 1K0SA 1ZEQX 1VQ6A 3CW2C 1WVLA 4L5SA 5IYCG 1C7YA 1PRTF 2IWHA 2ZJPA 1JJGA 1BO0A 3CMAA 2F4VL 3UDGA 1PYWD 1VMCA 5KRUA 3I72A 2E2JB 1W3SA 3BVZA 4A3LG 1A62A 3M4QA 3T51B 4IN3A 1HHVA 3OSOA 5C4XG 4O1NA 3ERQA 1N36Q 3GTLH 1KNEA 4B9WA 3F2DA 4A3JG 1M8AA 1KNAA 3N6RA 1VQLA 4I65A 4YHHQ 2QGQA 1EY9A 1VQCA 2IW3A 1HZBA 1KXLA 4JOIA 5ELEA 5C44H 1J6QA 1XPOA 4CHTB 5CV5A 4JBKA 3I7FA 3QJYA 3S1QB 2KHSA 2Z4HA 3VYUA 4A3MG 3LWUA 2B8GA 1CHQD 2L5TA 4ME3A 2J4XA 2F0VA 4R8IA 4JI5Q 1XYIA 1YNND 1GHJA 2CVRA 2K05A 4S3SA 5G3LF 2K01A 4DR5L 1EIFA 2NZOA 3ZLMA 3P75A 4LFCQ 4LFAQ 1PH4A 1NJIC 2VL6A 1FNUA 3GD7A 3FPUB 3KDFA 1QUQA 1X6OA 1IKLA 2RHQB 1HUMA 3GQBA 4OEMB 1N34Q 4R4CA 3HOXG 1FJGQ 1HZ9A 1TT2A 2EYHA 3PIOA 4FF3A 1YI2A 1UWVA 2HIVA 2NVTB 1CM9A 4DR7L 4LUVA 2SDFA 4APVA 2R7DA 4AYBB 1BVSA 1BQQT 2HT1A 1TS5A 3OMCA 1EY7A 1B3QA 4IOAA 3DWQA 5IGEA 1EU4A 3CRKC 4IALA 5FLXE 4JI3Q 3JC66 3LGJA 1HJPA 5I9PA 1X3QA 2L4NA 4DV4L 2QDLA 4U673 4A3DB 4DR3Q 1EZ6A 5EKLA 4DR4L 3NWSA 4A3BB 4MIUA 1D1IA 1DM0B 2BA1A 1NBWA 1XTCD 2O5IC 1PFMA 4HIMA 4QB4A 3L0OA 2VQEQ 1N33Q 1JJ2A 1IKMA 1PFNA 3TMEA 1CSPA 3K58A 2EJMA 1EIGA 3P7JA 4C3IB 4DV5Q 2I5HA 3K5NA 2KECA 4CKEA 4A3FG 4IFDJ 4NXML 2R92G 2K03A 2F0MA 1B3AA 4DV3L 1FL0A 3CCLA 2OXPA 2XNAC 3E0EA 4LF7Q 2SOBA 4RMFA 2AQ3B 1PH2A 3MEHA 3OW7A 3TS0A 1TS4A 3HEJA 1KHIA 1LACA 4JW0A 3D4WA 1I4PA 4A3GG 1J8IA 3FHWA 1WTPA 4EQ5A 3PO2B 1Q3LA 1X3EA 5D3IB 4QY7A 5JJIA 4B3RL 2JJQA 4QUCA 1KDCA 3KF8A 3KK7A 3FEWX 1LTAD 1OXVA 4GNXA 4JI7L 1KRSA 4X3TA 1H9RA 3GV6A 5J22A 1I6HH 1K0RA 1IBMQ 1JE4A 2XWBB 5E3FA 1XTDA 4IUQA 2B63H 2VNUD 2L0CA 4H0LC 4JI2L 3HOWG 1J5EL 1V1OA 5M3FH 1AFPA 1C48A 2IX0A 4DV7Q 3LETA 1M4VA 1PZKD 3E6ZX 3S14B 2B2TA 2TSSA 4DV2Q 2K04A 1SXTA 4JI8Q 1X32A 4LUOA 3D6WA 4EGVA 5IYBH 2I0QA 1CI3M 2JA7B 2R3ZA 2B2VA 1S5BD 2EZVA 3K80C 3HRZC 2K5HA 4FF2A 1NMGA 4C3HH 1MI2A 4CDCC 4ZUIA 4YY3Q 3FP9A 4JI6L 1S72A 1B9NA 2K75A 3MXUA 1PTOF 1SNOA 1GUSA 1X54A 2JYOA 4RA8A 5E4WC 5EJWA 2LKVA 1MBYA 1PRTD 3SN9A 4OX9L 1CKNB 1QNKA 4KHZA 2EQSA 4BXXG 3V2TA 5C3EB 4FDBA 2XRSD 2CCZA 4X64L 3I70A 2G5DA 3ERSX 3I4NB 1SR3A 1PYSB 3JAMi 5CMDA 4PG3A 4DAYB 1WCMB 4BBSB 5K36G 1SNCA 3BYTB 4OO1G 3IKJA 2A6EC 3S6AA 1EWCA 3TP7A 1I4RA 1IBKQ 3GTOH 4YIJA 2MFIA 3PMFA 4R4QA 4HIOA 3M7GA 1VQBA 4LAAA 3Q24A 3CPWA 2IX1A 3NBHA 1Y8NB 2K5WA 1TWFB 3KLRA 2UXBQ 1K3RA 1H9JA 2TMPA 3DEPA 4BA1I 2F0TA 1VQFA 3KBGA 3H3VH 1DCZA 1UUPA 5G3LD 5EPKA 2G03A 2UXDL 1RJTA 3J80E 1ASZA 2QKIC 1S5CD 1SE2A 4M1UB 1Q90A 4DF7A 1GKHA 1GJXA 1GUWA 1ESRA 3A5UA 3I2ZA 4KLKA 5FK9C 2A68D 1CTMA 4AYBG 2NN6H 4DUZQ 2OTJA 3HKZG 4E6IA 1JOOA 2CKZB 1K9MC 4C1NK 1V1QA 3H91A 4IJHA 1MD2D 5CKLA 5CR3A 2OQ0A 2ICIA 2K5QA 2KA7A 2CW0D 3FKIH 3BS1A 5IYDH 3BDOA 5KNBA 1Y1WB 4GOPA 4HJ9A 3AFPA 2AHOB 4DK3C 2N8NA 3HOVH 2HQLA 4ZLTF 4A76A 2NTTA 4A3DG 1E2ZA 5A2QE 5JFFA 4A3BG 2PZWA 4LNQA 1XMOL 4X2CA 1X3FA 4K6DA 2E2IB 2Y0SE 4FXDA 3QOJA 1LT4D 1TVXA 2F0NA 4LF8L 2F0HA 4C3IG 1XMQL 1K8OA 3FDTA 3Q22A 2E74C 4DNIA 2M2LA 2RCNA 3DHQA 5J1ZA 2HHHQ 1SNDA 1WTWA 1CHPD 1QWYA 2K1BA 1PH6A 4RKBA 5LHY1 2VB3X 2EY1A 2DJGC 3W5OA 1VQMA 2KCMA 1JORA 1YJ9A 1EEID 1WD0A 1KAWA 3S1MH 1DONA 2UUCQ 1I3QH 1Z6HA 2A73B 3HGBA 3PO2G 2B39A 1EY5A 1SDFA 2PQAB 2JN4A 1HNWQ 2PZUA 3STBC 4B3SQ 5LMUL 1E0BA 5DM63 1ET6A 4WORA 4CJ0B 1G91A 4AQYL 3PGZA 3OW2A 1H9SA 1A3TA 3E9IA 1YITA 2N49A 3H6MA 1CFMA 2JEAI 1E2VA 4C3JB 4BS9A 3VA5A 1NR4A 4X65Q 1K83H 2F3VA 2RBMA 4RWSC 1K3BC 2FINB 3E3XA 2PI2E 1LYLA 4MNOA 2JK8A 2R61A 4HEDA 2KHJA 5IYCH 2B2YA 3BYYB 4CGYB 1K8AC 2ZTDA 4XYOA 4DR2Q 1I4GA 2WIIB 1YBYA 2DY7A 4A3LH 5C4XH 5LMNW 4MHEA 2A74C 3TP6A 3CCSA 4A3JH 4HIKA 2YTYA 2BH2A 5C3EG 1EY6A 3GTMH 3NTIA 1V1PA 4LF9L 1SYEA 5C0XI 4A3IB 1PTOD 3I4NG 3OPOA 2WINB 1SJED 1H9MA 4DR6L 4U0SA 1I94L 2P5ZX 1WCMG 2F3WA 4BBSG 3GTKH 1S40A 4A3MH 2E76C 4K5VA 3J81c 3M4OB 3DUZA 4LF6Q 4PMBA 4LF5L 2RF4A 1R4QB 4BY1B 2Y0SB 4DU9A 2WV6D 3UDFA 4Z9CB 1LT6D 3D6CA 4ZRZA 4RKLA 3QB3A 5LMNL 1PH5A 1STAA 4KN4C 2XRQD 1G51A 1GHKA 2NZHA 1D5MC 1A0IA 4DR1Q 3DWPA 1SYDA 4JYAL 1DOKA 3HOXH 3OIPA 1MHWC 3PUVA 1HQRD 4K6LA 2E8GA 1XJVA 1ML0D 4EX5A 1RODA 4KN7C 3S17B 3OYYA 3AEVA 3M3YH 3W1GA 4EQNA 4RGOS 5M3MB 3CCVA 1HR0Q 4QUFA 3PIO3 1F2MA 2Z6KC 4LF4L 1SMYD 2EY2A 3G6EA 1O7YA 1C0AA 3GTJB 2NVYB 4G7HC 1PHJA 3ZCBA 3H15A 1Y1WG 5FO7B 4Y52H 2A19A 3Q23A 1EYCA 3F2CA 3A5ZB 1JMCA 3K7AB 1IYUA 1WYDA 2Z6BA 4JV5L 3I90A 3CC7A 1L0XB 1IW7D 1FGBD 4BY7B 3GTQH 2N88A 5CBAE 2I07B 4X2EA 1JOKA 2XIWA 4YWMA 1C8CA 2GVBA 3QWNA 5HURA 1CQFA 1HH2P 4HMIA 3F8TA 3VYSA 2VS1A 4FF4A 4UP9A 2F4IA 1RTNA 3A55A 4TVAB 4A3FH 4RFBA 3MXGA 3I4MB 2ZT9C 3IL8A 3OTOQ 4GNXC 3BZDB 4WJ4A 2ES2A 3KF6B 1IBLL 4PZ7A 5M5XB 2WAQG 2D5DA 4IFDG 4A3GH 4JK1C 1E3PA 5IT9c 3I55A 1PTOH 3EA6A 3K0XA 5M5YB 3S1NH 2N3SA 5LL6X 2HQEA 2Z8LA 4GN4B 5I9OA 3NBIA 5BR8Q 4DV0L 4H7BA 4K8JA 1YNJC 2UUBL 3ND9A 1F2LA 1UE1A 2JP1A 1BBWA 2K5VA 4C3JG 2KEDA 2BA0A 4B08A 2O5JC 4TSSA 3HOWH 2IX3A 4EQPA 1SNPA 3T4AC 3MZ5A 3TP8A 3W2DA 5AJ3L 4RG1A 4B3ML 3AMUA 1Y1VB 1JR0D 4IURA 1A63A 2HIXA 4JBJA 4JI1L 3CCUA 4TQUS 2PYKA 3HOZB 1ICWA 4A3EB 2E2JH 4JBMA 2GA4B 1ONLA 1EYGA 3MXPA 5JPNC 1JQYD 2XVSA 5COYA 1HNXQ 2ZTEA 5CV6A 4K8IA 4GLAC 1SAPA 3K5LA 4BXXH 1KQSA 4YWLA 4A3IG 1HTPA 2VUMB 1XXGA 4CDEC 4JI0Q 3AB9A 1HZCA 1GOZA 3S1QH 2L9HA 3GO5A 4CBVA 4UP7A 5GAHC 3BVGA 5K36H 4OO1H 1KLGD 2CFMA 5D14A 2WFWA 4PZ6A 2B29A 1FYCA 1EL0A 1ILQA 2PW7A 4JVZA 4BY1G 2B2UA 5FKAC 5I6YA 1NY4A 5EPLA 2K6AA 1EY0A 2OEOA 4JBWA 1HNZQ 2F03A 5IGDA 1G2TA 1TY2A 1XNQQ 4G7ZC 4J1MA 5JAVA 3ND8A 1RF2D 5KEEA 4DV6L 4DAPA 1XWEA 4XQJA 1N8RC 1VQHA 2KHIA 4PMWA 4N9PA 4NXNQ 5JVH3 2BOSA 3ZJYC 2NVTH 2KJXA 4GOPC 1Q1BA 4K5WA 4KKSA 3CUCA 4FP5D 5CV8A 5M3MG 2YU9B 3TEHB 1QOHA 4B9XA 4R4OA 2ZTCA 4DA2A 4KY5A 2E2HB 3A0JA 2EXZA 5T1GA 2F0UA 5CV4A 1Q1EA 2ZJRA 2UUAL 1EQRA 2VXWA 4OGQC 2CH4A 3AFQA 3VR3A 2G9DA 4KI0A 4IUNA 2VW9A 1WI5A 2XGTA 4IUPA 5CC4A 3I73A 2E2DC 4FXGC 3U9OA 5FJ8G 2H4OA 3CCQA 4A3DH 1V8QA 1B53A 1H9KA 4A3BH 2EY5A 4BY7G 1JOQA 1LTGD 4XXEA 4ID6A 3MA2B 3G71A 4QMGA 4JG2A 1AN8A 1HZAA 2ASBA 2K50A 3A54A 1B8AA 3CMEA 3F1ZA 1RIPA 4M16A 3NEMA 4DK1A 5IP9G 2RQXA 1XPRA 2L12A 3ONAB 3HS0C 4C3IH 2EYOA 2AQ1B 4A75A 1D8LA 4DR7Q 1AE2A 2EJGC 3S24A 1N36L 4LUZA 2R7ZB 2JQOA 1GM5A 1IHZA 1TY0A 4YHHL 3I4MG 4BWGB 3RNUA 3L3OC 1D5XC 1SEBD 3NK9A 3MHBA 4IQZA 4WGJA 1U4LA 2C5CA 1N9WA 1Y8PB 4HN7A 5JEAG 2VY3A 4Y7NB 3PO2H 4LU4A 1MGSA 3R8BA 1O7LA 2K5NA 4JI5L 3RD4A 3K7UC 4OWXB 4KK7A 1QUQB 1JB7A 2QILA 4YCUA 2Q8RE 5C4ZA 4LFCL 2M9VA 4LFAL 1GUOA 4ZYSA 1VS0A 1PXUA 3EJIA 1N34L 1FJGL 2ZXOA 2WB1E 4OWTB 5IGFA 3S14H 1PRTC 1U0LA 4OELB 4DV3Q 2A6HD 2JA7H 2FMMA 1Y1VG 3BZCA 1J9OA 4GN3B 1F9PA 2JA5B 5ELNA 3A8JE 3S2HB 2BE5D 3HOZG 4A3EG 1AH9A 2EE1A 3DLLA 4QF4A 4DK6C 1SN8A 1VCIA 3MXNA 2RVLA 1DD2A 3J81L 4BBRB 1XNRQ 1V43A 1T5XD 1SBBB 2LY7A 1NSNS 1NR2A 4XT1B 4PQXA 1Q82C 5C3EH 4JI3L 5CBEE 5J39A 4X3SA 4V0BA 2VUMG 1PZID 4RCNA 3TN2A 2NTSA 1EZ8A 3PUZA 3I4NH 3TRZA 4WJ3M 3L2PA 4DR3L 1MJEA 1P8LA 4R8NA 3I4LA 4LMQD 3J81j 1B50A 3X3NA 1WCMH 4BBSH 4DFAA 3UE1A 1HA5A 1KRTA 5IODA 3RZDB 2E5LQ 2VQEL 1N33L 2NVXB 1UNSA 2EYPA 3GTGB 3F2BA 1AW7A 1TWCB 4DV5L 4ZQ3A 1TWFH 4JI6Q 2BH8A 1DYQA 3TDQA 2JXMB 1KTKA 1X56A 2R6GA 1V9PA 3GTPB 5EPJA 4CDDC 4LF7L 1HUNA 1U4RA 1JCKB 2F0QA 2CH4W 1ENCA 1VMPA 4OXPA 1WTRA 4MTKA 2WKDA 5JJKA 2K7VA 4LJZC 4GNXB 3M4YA 2D9UA 5D3DA 3PO3B 2H1EA 4LW1A 5I6WA 1A15A 5IE8A 4HIDA 3SGIA 1CKNA 2RDFA 4GZYC 2QCPX 5JPMC 1EQTA 3ITPA 1JWSD 3G6JB 3CQZB 1QVCA 1L0WA 3I8ZA 3BU2A 4DK0A 3HOUB 4HCEA 3G48A 1IBML 5I2YA 2IL8A 3QOLA 1SE4A 1LTRD 2YTVA 3SR1A 4DAYA 5BN4A 2LS01 4K2KA 1R9TB 1KL9A 3A56A 5BN3A 1Y1WH 2IHEA 4DV7L 4RCOA 1S4ZA 4JPBW 3ULJA 3WOFA 5KNCA 4DV2L 4P71A 4WJWA 1Q7YC 1LT5D 4IOCA 5CORA 2WB1B 2Q2IA 3RLOA 3M4PA 1D2BA 1AP0A 1JWUD 2PPBC 2HDLA 2E2IH 1I4QA 4YY3L 2F6SA 4GLXA 1SRUA 2DNCA 4FNFA 2VQFQ 2F0LA 1HFGA 1VQ8A 4QQBX 2K33A 3JAMc 5IT9L 1HCZA 2EY6A 4L63B 2R7ZG 1ZKOA 4RAUC 1STYA 4KV6A 4PV1C 1VQ4A 3ULLA 3ZC7A 3DXJC 4DKAC
chains in the Genus database with same CATH topology
4U0SA 3KLWA 1I94L 2ATWA 3H3VI 1WCMG 1OXXK 4BBSG 1VQ7A 2VZAA 4NXMQ 2K52A 3GTKH 3S1RH 1IL2A 4DV1Q 1S40A 4A3MH 2OTLA 3GTPH 3J81c 2L15A 3WWVA 3J7ZC 4DUYQ 1JT8A 1L2FA 5HY6A 4LF6Q 2YYZA 5EU0A 4LF5L 2RF4A 1ASYA 3NBHB 4P73A 1DGSA 2RHSB 4IPCA 1IBKL 5JJ6A 3GDEA 4ITRA 1VQIA 3UDFA 1Y14B 5C0XJ 2XTIA 4JI4Q 2N78A 4DV6Q 3PO3H 3E9HA 1UE6A 2NN6I 4J15A 5LMNL 1PH5A 1YJWA 3K8AA 1G51A 1YHBA 4A93G 4B3RQ 2NZHA 1Q8KA 2Z6KA 4B3TL 1A0IA 2UXBL 5JFZA 1L1OB 4DR1Q 4N67A 4JYAL 4HJAA 4C3JH 3HOXH 3CQZH 4POGA 5HGQA 2JA8H 5FLMH 1RL2A 3PUVA 3HOUH 3PF5A 4JI7Q 2E8GA 1IXRA 5J3BA 4POFA 3HFZB 1KD1C 3J7A5 3U50C 1XJVA 2AMCB 1YVCA 3HOZH 1WFQA 4EX5A 2D0PA 3Q8DA 1R9TH 4JI2Q 1J5EQ 2MQHA 2UU9Q 5JJLA 3OYYA 2I5MX 3AEVA 1Z47A 3M3YH 3W1GA 1A8VA 1HR0Q 3CCVA 2Z6KC 4LF4L 4IO9A 1OXUA 2F3IA 3G4SA 3G6EA 3CCEA 4UY8C 2A8VA 5GAGC 1LTLA 1PFSA 3MXNB 3KJPA 3U58A 1C0AA 4DUZL 1FVIA 3AQQA 2OWOA 5JEAJ 4BBRG 1PHJA 3ZCBA 2V1CC 2ZM6Q 4GOPB 3M85A 3CW2C 3H15A 1VQ6A 1Y1WG 2JA6G 1CKOA 4Y52H 4L5SA 5IYCG 1C7YA 2A19A 2ZJPA 1JJGA 4K0KQ 3CMAA 3F2CA 2F4VL 1BKBA 1XNRL 3A5ZB 1JMCA 3CD6A 3UDGA 1WYDA 2PQAA 2WP8J 4JV5L 3CC7A 1SROA 4A3IH 4OX9Q 1W3SA 4A3LG 1A62A 3M4QA 3GTQH 4YCVA 4DR7Q 1N32L 5C4XG 2D62A 3A74A 3KF8B 4X2EA 1P16A 1N36Q 3GTLH 3F2DA 2KBNA 1WOCA 4A3JG 4YWMA 4X64Q 2GVBA 3J80i 4AH6A 1VQLA 1HH2P 4YHHQ 2QGQA 3F8TA 1YHQA 2LSSA 3M4OH 2VS1A 1XPUA 2R93H 4UP9A 1VQCA 1VQJA 1EQQA 1HZBA 4L5QA 4TVAB 4JOIA 4A3FH 1KXLA 5C44H 1J6QA 3H0GH 4BY1H 3PF4A 1XPOA 2MO1A 2E5LL 1B7YB 3I7FA 4JBKA 2AWOA 3S16H 2Q2UA 1QZGA 1S3OA 3OTOQ 4GNXC 3CF5A 2HHHL 4A3MG 4WJ4A 2ES2A 4R1JA 3KF6B 1IBLL 4PZ7A 2JA7G 4ME3A 3J80c 2WAQG 1PH9A 4JI5Q 1MKHA 4IFDG 4A3GH 4DR5L 1E3PA 5IT9c 3I55A 4JI8L 1EIFA 2NZOA 4ALPA 2UUCL 4GKJQ 3S15H 3ZLMA 4X2DA 4OONA 3K0XA 4JOIC 4LFAQ 4LFCQ 1MIUA 1PH4A 2VL6A 1NJIC 1M1KC 3M7NA 2JE6I 2N3SA 3S1NH 1H95A 2PNHA 1HNWL 4X62Q 3GD7A 4GN4B 4BXXG 2UXDQ 3KDFA 2LXJA 3KFUA 1QUQA 1X6OA 2RHQB 3PCOB 4H02A 5BR8Q 4DV0L 3S17H 2UUBL 3T1YQ 1N34Q 1UE1A 2K5VA 4R4CA 1BBWA 3HOXG 2EIFA 1HZ9A 2WAQE 5M3MH 1FJGQ 2JA8G 5FLMG 2BA0A 4GKKQ 4QL5A 3HOUG 1VQPA 3B6YA 4NB3A 3HOWH 3PIOA 3CC2A 3GTJH 1YI2A 2NVYH 1UWVA 2HIVA 5AJ3L 4RG1A 1QVFA 4DR7L 4HJ8A 4B3ML 4LUVA 4GLVB 4APVA 4PY3A 4X65L 2R7DA 1A63A 1BVSA 1VQ5A 1WJJA 2HIXA 1UE5A 2HT1A 3K7AH 4IJLA 2QA4A 2WB1G 4IOAA 5FJ8H 2DGYA 4JBJA 4JI1L 1JE5A 3MEFA 3CCUA 4TQUS 4UPAA 3PUWA 2E2JH 4JBMA 4BY7H 1EYGA 3PV0A 5DLQE 4JCVE 4DR2L 4JI3Q 3JC66 1HNXQ 3LGJA 5IP9H 1HJPA 2ZTEA 4DV4L 4IFDI 4A3CH 1Z9FA 4GLAC 1E22A 1BBUA 1PYBA 1XMOQ 4BXXH 4DR3Q 1KQSA 4YWLA 3CC4A 4DV7L 4A3IG 2DUDA 1U5KA 2VQFL 4DR4L 4HJ5A 4LFBQ 4LF8Q 2R7FA 3CXCA 1JJCB 2BA1A 3I4MH 1XMQQ 4JI0Q 1NBWA 1X55A 4U0UA 1SLJA 1HZCA 4XIGS 4YCWA 4HIMA 3S1QH 3L0OA 3GO5A 2VQEQ 1N33Q 1B70B 4UP7A 5GAHC 4U0ZA 1TXYA 1JJ2A 2Q2TA 1CSPA 3AYHB 1Q86C 3NELA 3RZOH 3VDYA 4BA2I 5M5XH 2CFMA 4DV5Q 2R93G 2KCTA 2IY5B 1VQEA 2I5HA 2WFWA 4PZ6A 1GD7A 2B29A 1L1OC 5C4JH 4A3FG 2JA5G 4NXML 5C44G 2R92G 1CSQA 4BY1G 4DV1L 4IFDJ 4X6AH 1SFOH 1G6PA 1NY4A 3T1HQ 4DUYL 1NMFA 1FL0A 4DV3L 3CCLA 1KIXA 1VQOA 3SHGA 1HR0W 4LF6L 4JBWA 3E0EA 4LF7Q 4RMFA 5M5YH 1T9HA 1PH2A 1HNZQ 3L7ZC 3TS0A 1XNQQ 3KJOA 1KHIA 1UE7A 4JI4L 1E7ZA 4DV6L 4A3GG 2FXQA 3FHWA 1N8RC 4EQ5A 5LMUQ 1VQHA 1X3EA 3CCJA 2KHIA 4PMWA 4QY7A 1VQAA 4B3RL 5JJIA 3HKSA 2JJQA 3BJUA 4AQYQ 4DR1L 4NXNQ 3M9BA 3ZJYC 3ICEA 4GS3A 3U4ZA 2NVTH 2Z0SA 4GNXA 1OXVA 4JI7L 1KRSA 4GOPC 1Q1BA 1I6HH 3CUCA 1CKMA 1K0RA 1Y1VH 1IBMQ 5M3MG 1YHAA 1XTDA 3TEHB 2B63H 2VNUD 2CWPA 4R4OA 4JI2L 2ZTCA 3HOWG 1EUJA 4MTNA 1J5EL 5M3FH 4IPDA 1I5FA 3A0JA 2UU9L 2IX0A 1O7IA 3LETA 2CQOA 3TREA 3RLFA 4DV7Q 3PSIA 4A3EH 2UUAL 1Q1EA 4LWCA 2ZJRA 1EQRA 5EAYA 3UDXA 1HR0L 3AFQA 4A3KH 4DV2Q 4JI8Q 4LUOA 5IP7H 2I0QA 5IYBH 4KI0A 3NENA 5ELOA 1EFWA 3KF6A 1WI5A 2XGTA 2VW9A 2OCEA 2JEBI 1K8GA 3K80C 2K5HA 2ZM6L 4KHPQ 2UXCQ 1NMGA 4P75A 4C3HH 1OXSC 4X66Q 5FJ8G 3CCQA 1AE3A 4A3DH 4YY3Q 3HOYH 3FP9A 4JI6L 2AWNA 1S72A 2VUMH 4A3BH 2K75A 3SE5A 3PUXA 3RR5A 4BY7G 4K0KL 5IWAQ 4IPHA 3G71A 1X54A 4JG2A 1HZAA 2ASBA 1VQ9A 2K50A 4PZ8A 1B8AA 3CMEA 2PMZE 3F1ZA 1RIPA 4M16A 3NEMA 4DPGA 5IP9G 3ULPA 3PO3G 1XPRA 3SN9A 4OX9L 4LF9Q 3TS2A 4QIWE 1YNXA 1CKNB 4XTCS 4A3CG 4C3IH 2A1AA 5JJ7A 4KHZA 2OQKA 1X65A 4A75A 1D8LA 2EQSA 3ER0A 3UE0A 1AE2A 1N36L 3S24A 4DAMA 1I94Q 4DR6Q 4FDBA 1KC8C 2CCZA 4LUZA 4X64L 2JQOA 5E7NA 1GM5A 4B3SL 1IYJB 1GVPA 4YHHL 4MZ9A 3ERSX 3I4MG 1SR3A 3RNUA 1PYSB 3JAMi 4PG3A 4DAYB 4LF5Q 5K36G 4WGJA 4OO1G 1IBKQ 3S6AA 3GTOH 1UEBA 1N9WA 2MFIA 3OTOL 1YZ6A 4R4QA 2YV5A 4HIOA 1VQBA 5JEAG 2VY3A 2ID0A 4C2MH 5GQOA 3CPWA 5LMNQ 1K73C 4LU4A 3PO2H 2B3GA 5CGLA 4UP8A 2IX1A 2K5NA 3J81i 4JI5L 4B3TQ 2UXBQ 3K7UC 4OWXB 1K3RA 4A4IA 1CUKA 1QUQB 4JYAQ 5H1SE 1JB7A 4YCUA 4BA1I 1YIJA 1VQFA 1PH3A 4GKJL 3H3VH 3I56A 4LFCL 1QVGA 4LFAL 4R4IA 4AIMA 2YU9H 2G03A 4GN5A 1E24A 1L1OA 4X62L 2UXDL 3TQYA 1ASZA 1LM0A 5BR8L 1VS0A 1W2BA 2E2HH 1E1TA 3T1YL 1N34L 1GKHA 4YWKA 1FJGL 4XI8A 2I5LX 2WB1E 4OWTB 1E1OA 4GKKL 3EN2A 3S14H 1U0LA 3A5UA 3I2ZA 4KLKA 4DV3Q 4LF4Q 2JA7H 1Y1VG 3BZCA 4AYBG 4U07A 1SE8A 4GN3B 2B63G 5ELNA 4DUZQ 4O0AA 2OTJA 3HKZG 2CKZB 5GAEC 1K9MC 5M3FG 1Q12A 1V1QA 1YEZA 3CCRA 3HOZG 4A3EG 1EIYB 1VQGA 1AH9A 3DLLA 4IJHA 2AKWB 3STBD 4DK6C 5CKLA 2OQ0A 4NPSA 1SN8A 3H0GG 1SMXA 1VCIA 2Y0SG 3FKIH 4A3KG 1XNRQ 5IP7G 2F4VQ 4OO1I 1IZ6A 5IYBG 4O2DA 5IYDH 1V43A 4JV5Q 4GOPA 4HJ9A 3IRBA 3AFPA 2AHOB 4DK3C 2N8NA 4AYBE 3HOVH 2HQLA 4A76A 2ALYB 4A3DG 1Q82C 4OWWB 1PVOA 3HKZE 5C3EH 4JI3L 3HOYG 1HNXL 1TWGH 5JFFA 2R7ZH 1PH8A 2VUMG 2KENA 2JA9A 4QGUA 4A3BG 3D0FA 2EXDA 3PUZA 2K14A 3I4NH 2GN5A 3TRZA 4LNQA 4WJ3M 1XMOL 4X2CA 1X3FA 3L2PA 3DM3A 1P8LA 4DR3L 1MJEA 1VQKA 2Y0SE 3J81j 2PI2A 2MO0A 1G291 4LFBL 4LF8L 1WCMH 4BBSH 2D0OA 2UUAQ 4HJ7A 3UE1A 5M5WH 1XMQL 4JI0L 1VQNA 1KRTA 2Q2HA 3RLNA 2E5LQ 4DNIA 2VQEL 1N33L 1TWHH 2RCNA 1X9NA 4L5TA 2HHHQ 1VQDA 4Y7NH 1YJNA 3F2BA 3N3UA 4DV5L 2MNAA 1LUZA 1PH6A 1IBLQ 3S2DH 1TWFH 4JI6Q 2BH8A 3W5OA 1VQMA 2KCMA 1OTCA 1YJ9A 3D31A 4DR5Q 1X56A 2R6GA 3T1HL 1OXTA 1KAWA 1V9PA 2ZJQA 3S1MH 1X3GA 2UUCQ 4LF7L 4A93H 1EWIA 1I3QH 4JC0A 1HNZL 4OXPA 3PO2G 2PQAB 1XNQL 1HNWQ 4P74A 3STBC 2IHFA 3W1BA 4DV0Q 5JJKA 1PA6A 5C0XG 4GNXB 1NE3A 2UUBQ 4B3SQ 4LW1A 5LMUL 5IE8A 4HIDA 3SGIA 3BZKA 2NVQH 1CKNA 4AQYL 4NXNL 3PGZA 3OW2A 3RN2A 1TWAH 2C35B 3E9IA 1YITA 2JA5H 2N49A 5IY0A 1M90C 2JEAI 2R92H 1QVCA 3CAMA 1QZHA 1L0WA 3S2HH 1GO3E 5AJ3Q 3BU2A 3KOJA 1Q46A 2K4KA 5FLXc 4B3MQ 3G48A 1IBML 2LXKA 2QEXA 4X65Q 1K83H 4P72A 2YTVA 4BBRH 1Q81C 5GROA 5GADC 2IT1A 1KL9A 2PI2E 2GVAA 1Y1WH 1LYLA 2IHEA 3CP0A 4MNOA 4JI1Q 2NN6G 2JK8A 3CCMA 5IYCH 2KHJA 3RN5A 3ULJA 3UDIA 4DV2L 1K8AC 4U04A 4P71A 2ZTDA 1PV4A 1Q7YC 1PH1A 3EBEA 2JA6H 4IOCA 3CPFA 4L5RC 2Q2IA 3RLOA 3M4PA 1I50H 4DR2Q 4KHPL 2UXCL 2CWAA 3FKIG 4DV4Q 1YBYA 5IYDG 4A3LH 4X66L 5CMTA 1N32Q 1C9OA 2F52A 2E2IH 1MJCA 5C4XH 2F6SA 4YY3L 5LMNW 4GLXA 1PH7A 3U4VA 1SRUA 3K81C 3KYHC 1FGUA 2VQFQ 3CCSA 4A3JH 3KDFB 3HOVG 5IWAL 4DR4Q 1VQ8A 4QQBX 4R4TA 3JAMc 2YTYA 4HIKA 2BH2A 2H5XA 5C3EG 3GTMH 3RZDH 3PIPA 2YTXA 2NVXH 2R7ZG 1EOVA 3PUYA 5C0XI 4LF9L 3I4OA 1VQ4A 3GTGH 3ULLA 3I4NG 3ZC7A 4IPGA 1D7QA 1TWCH 1NTGA 3EIVA 4DKAC 4QJFA 4DR6L
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4U0S A;  3KLW A;  1I94 L;  2ATW A;  3H3V I;  1WCM G;  1OXX K;  4BBS G;  1VQ7 A;  2VZA A;  4NXM Q;  2K52 A;  3GTK H;  3S1R H;  1IL2 A;  4DV1 Q;  1S40 A;  4A3M H;  2OTL A;  3GTP H;  3J81 c;  2L15 A;  3WWV A;  3J7Z C;  4DUY Q;  1JT8 A;  1L2F A;  5HY6 A;  4LF6 Q;  2YYZ A;  5EU0 A;  4LF5 L;  2RF4 A;  1ASY A;  3NBH B;  4P73 A;  1DGS A;  2RHS B;  4IPC A;  1IBK L;  5JJ6 A;  3GDE A;  4ITR A;  1VQI A;  3UDF A;  1Y14 B;  5C0X J;  2XTI A;  4JI4 Q;  2N78 A;  4DV6 Q;  3PO3 H;  3E9H A;  1UE6 A;  2NN6 I;  4J15 A;  5LMN L;  1PH5 A;  1YJW A;  3K8A A;  1G51 A;  1YHB A;  4A93 G;  4B3R Q;  2NZH A;  1Q8K A;  2Z6K A;  4B3T L;  1A0I A;  2UXB L;  5JFZ A;  1L1O B;  4DR1 Q;  4N67 A;  4JYA L;  4HJA A;  4C3J H;  3HOX H;  3CQZ H;  4POG A;  5HGQ A;  2JA8 H;  5FLM H;  1RL2 A;  3PUV A;  3HOU H;  3PF5 A;  4JI7 Q;  2E8G A;  1IXR A;  5J3B A;  4POF A;  3HFZ B;  1KD1 C;  3J7A 5;  3U50 C;  1XJV A;  2AMC B;  1YVC A;  3HOZ H;  1WFQ A;  4EX5 A;  2D0P A;  3Q8D A;  1R9T H;  4JI2 Q;  1J5E Q;  2MQH A;  2UU9 Q;  5JJL A;  3OYY A;  2I5M X;  3AEV A;  1Z47 A;  3M3Y H;  3W1G A;  1A8V A;  1HR0 Q;  3CCV A;  2Z6K C;  4LF4 L;  4IO9 A;  1OXU A;  2F3I A;  3G4S A;  3G6E A;  3CCE A;  4UY8 C;  2A8V A;  5GAG C;  1LTL A;  1PFS A;  3MXN B;  3KJP A;  3U58 A;  1C0A A;  4DUZ L;  1FVI A;  3AQQ A;  2OWO A;  5JEA J;  4BBR G;  1PHJ A;  3ZCB A;  2V1C C;  2ZM6 Q;  4GOP B;  3M85 A;  3CW2 C;  3H15 A;  1VQ6 A;  1Y1W G;  2JA6 G;  1CKO A;  4Y52 H;  4L5S A;  5IYC G;  1C7Y A;  2A19 A;  2ZJP A;  1JJG A;  4K0K Q;  3CMA A;  3F2C A;  2F4V L;  1BKB A;  1XNR L;  3A5Z B;  1JMC A;  3CD6 A;  3UDG A;  1WYD A;  2PQA A;  2WP8 J;  4JV5 L;  3CC7 A;  1SRO A;  4A3I H;  4OX9 Q;  1W3S A;  4A3L G;  1A62 A;  3M4Q A;  3GTQ H;  4YCV A;  4DR7 Q;  1N32 L;  5C4X G;  2D62 A;  3A74 A;  3KF8 B;  4X2E A;  1P16 A;  1N36 Q;  3GTL H;  3F2D A;  2KBN A;  1WOC A;  4A3J G;  4YWM A;  4X64 Q;  2GVB A;  3J80 i;  4AH6 A;  1VQL A;  1HH2 P;  4YHH Q;  2QGQ A;  3F8T A;  1YHQ A;  2LSS A;  3M4O H;  2VS1 A;  1XPU A;  2R93 H;  4UP9 A;  1VQC A;  1VQJ A;  1EQQ A;  1HZB A;  4L5Q A;  4TVA B;  4JOI A;  4A3F H;  1KXL A;  5C44 H;  1J6Q A;  3H0G H;  4BY1 H;  3PF4 A;  1XPO A;  2MO1 A;  2E5L L;  1B7Y B;  3I7F A;  4JBK A;  2AWO A;  3S16 H;  2Q2U A;  1QZG A;  1S3O A;  3OTO Q;  4GNX C;  3CF5 A;  2HHH L;  4A3M G;  4WJ4 A;  2ES2 A;  4R1J A;  3KF6 B;  1IBL L;  4PZ7 A;  2JA7 G;  4ME3 A;  3J80 c;  2WAQ G;  1PH9 A;  4JI5 Q;  1MKH A;  4IFD G;  4A3G H;  4DR5 L;  1E3P A;  5IT9 c;  3I55 A;  4JI8 L;  1EIF A;  2NZO A;  4ALP A;  2UUC L;  4GKJ Q;  3S15 H;  3ZLM A;  4X2D A;  4OON A;  3K0X A;  4JOI C;  4LFA Q;  4LFC Q;  1MIU A;  1PH4 A;  2VL6 A;  1NJI C;  1M1K C;  3M7N A;  2JE6 I;  2N3S A;  3S1N H;  1H95 A;  2PNH A;  1HNW L;  4X62 Q;  3GD7 A;  4GN4 B;  4BXX G;  2UXD Q;  3KDF A;  2LXJ A;  3KFU A;  1QUQ A;  1X6O A;  2RHQ B;  3PCO B;  4H02 A;  5BR8 Q;  4DV0 L;  3S17 H;  2UUB L;  3T1Y Q;  1N34 Q;  1UE1 A;  2K5V A;  4R4C A;  1BBW A;  3HOX G;  2EIF A;  1HZ9 A;  2WAQ E;  5M3M H;  1FJG Q;  2JA8 G;  5FLM G;  2BA0 A;  4GKK Q;  4QL5 A;  3HOU G;  1VQP A;  3B6Y A;  4NB3 A;  3HOW H;  3PIO A;  3CC2 A;  3GTJ H;  1YI2 A;  2NVY H;  1UWV A;  2HIV A;  5AJ3 L;  4RG1 A;  1QVF A;  4DR7 L;  4HJ8 A;  4B3M L;  4LUV A;  4GLV B;  4APV A;  4PY3 A;  4X65 L;  2R7D A;  1A63 A;  1BVS A;  1VQ5 A;  1WJJ A;  2HIX A;  1UE5 A;  2HT1 A;  3K7A H;  4IJL A;  2QA4 A;  2WB1 G;  4IOA A;  5FJ8 H;  2DGY A;  4JBJ A;  4JI1 L;  1JE5 A;  3MEF A;  3CCU A;  4TQU S;  4UPA A;  3PUW A;  2E2J H;  4JBM A;  4BY7 H;  1EYG A;  3PV0 A;  5DLQ E;  4JCV E;  4DR2 L;  4JI3 Q;  3JC6 6;  1HNX Q;  3LGJ A;  5IP9 H;  1HJP A;  2ZTE A;  4DV4 L;  4IFD I;  4A3C H;  1Z9F A;  4GLA C;  1E22 A;  1BBU A;  1PYB A;  1XMO Q;  4BXX H;  4DR3 Q;  1KQS A;  4YWL A;  3CC4 A;  4DV7 L;  4A3I G;  2DUD A;  1U5K A;  2VQF L;  4DR4 L;  4HJ5 A;  4LFB Q;  4LF8 Q;  2R7F A;  3CXC A;  1JJC B;  2BA1 A;  3I4M H;  1XMQ Q;  4JI0 Q;  1NBW A;  1X55 A;  4U0U A;  1SLJ A;  1HZC A;  4XIG S;  4YCW A;  4HIM A;  3S1Q H;  3L0O A;  3GO5 A;  2VQE Q;  1N33 Q;  1B70 B;  4UP7 A;  5GAH C;  4U0Z A;  1TXY A;  1JJ2 A;  2Q2T A;  1CSP A;  3AYH B;  1Q86 C;  3NEL A;  3RZO H;  3VDY A;  4BA2 I;  5M5X H;  2CFM A;  4DV5 Q;  2R93 G;  2KCT A;  2IY5 B;  1VQE A;  2I5H A;  2WFW A;  4PZ6 A;  1GD7 A;  2B29 A;  1L1O C;  5C4J H;  4A3F G;  2JA5 G;  4NXM L;  5C44 G;  2R92 G;  1CSQ A;  4BY1 G;  4DV1 L;  4IFD J;  4X6A H;  1SFO H;  1G6P A;  1NY4 A;  3T1H Q;  4DUY L;  1NMF A;  1FL0 A;  4DV3 L;  3CCL A;  1KIX A;  1VQO A;  3SHG A;  1HR0 W;  4LF6 L;  4JBW A;  3E0E A;  4LF7 Q;  4RMF A;  5M5Y H;  1T9H A;  1PH2 A;  1HNZ Q;  3L7Z C;  3TS0 A;  1XNQ Q;  3KJO A;  1KHI A;  1UE7 A;  4JI4 L;  1E7Z A;  4DV6 L;  4A3G G;  2FXQ A;  3FHW A;  1N8R C;  4EQ5 A;  5LMU Q;  1VQH A;  1X3E A;  3CCJ A;  2KHI A;  4PMW A;  4QY7 A;  1VQA A;  4B3R L;  5JJI A;  3HKS A;  2JJQ A;  3BJU A;  4AQY Q;  4DR1 L;  4NXN Q;  3M9B A;  3ZJY C;  3ICE A;  4GS3 A;  3U4Z A;  2NVT H;  2Z0S A;  4GNX A;  1OXV A;  4JI7 L;  1KRS A;  4GOP C;  1Q1B A;  1I6H H;  3CUC A;  1CKM A;  1K0R A;  1Y1V H;  1IBM Q;  5M3M G;  1YHA A;  1XTD A;  3TEH B;  2B63 H;  2VNU D;  2CWP A;  4R4O A;  4JI2 L;  2ZTC A;  3HOW G;  1EUJ A;  4MTN A;  1J5E L;  5M3F H;  4IPD A;  1I5F A;  3A0J A;  2UU9 L;  2IX0 A;  1O7I A;  3LET A;  2CQO A;  3TRE A;  3RLF A;  4DV7 Q;  3PSI A;  4A3E H;  2UUA L;  1Q1E A;  4LWC A;  2ZJR A;  1EQR A;  5EAY A;  3UDX A;  1HR0 L;  3AFQ A;  4A3K H;  4DV2 Q;  4JI8 Q;  4LUO A;  5IP7 H;  2I0Q A;  5IYB H;  4KI0 A;  3NEN A;  5ELO A;  1EFW A;  3KF6 A;  1WI5 A;  2XGT A;  2VW9 A;  2OCE A;  2JEB I;  1K8G A;  3K80 C;  2K5H A;  2ZM6 L;  4KHP Q;  2UXC Q;  1NMG A;  4P75 A;  4C3H H;  1OXS C;  4X66 Q;  5FJ8 G;  3CCQ A;  1AE3 A;  4A3D H;  4YY3 Q;  3HOY H;  3FP9 A;  4JI6 L;  2AWN A;  1S72 A;  2VUM H;  4A3B H;  2K75 A;  3SE5 A;  3PUX A;  3RR5 A;  4BY7 G;  4K0K L;  5IWA Q;  4IPH A;  3G71 A;  1X54 A;  4JG2 A;  1HZA A;  2ASB A;  1VQ9 A;  2K50 A;  4PZ8 A;  1B8A A;  3CME A;  2PMZ E;  3F1Z A;  1RIP A;  4M16 A;  3NEM A;  4DPG A;  5IP9 G;  3ULP A;  3PO3 G;  1XPR A;  3SN9 A;  4OX9 L;  4LF9 Q;  3TS2 A;  4QIW E;  1YNX A;  1CKN B;  4XTC S;  4A3C G;  4C3I H;  2A1A A;  5JJ7 A;  4KHZ A;  2OQK A;  1X65 A;  4A75 A;  1D8L A;  2EQS A;  3ER0 A;  3UE0 A;  1AE2 A;  1N36 L;  3S24 A;  4DAM A;  1I94 Q;  4DR6 Q;  4FDB A;  1KC8 C;  2CCZ A;  4LUZ A;  4X64 L;  2JQO A;  5E7N A;  1GM5 A;  4B3S L;  1IYJ B;  1GVP A;  4YHH L;  4MZ9 A;  3ERS X;  3I4M G;  1SR3 A;  3RNU A;  1PYS B;  3JAM i;  4PG3 A;  4DAY B;  4LF5 Q;  5K36 G;  4WGJ A;  4OO1 G;  1IBK Q;  3S6A A;  3GTO H;  1UEB A;  1N9W A;  2MFI A;  3OTO L;  1YZ6 A;  4R4Q A;  2YV5 A;  4HIO A;  1VQB A;  5JEA G;  2VY3 A;  2ID0 A;  4C2M H;  5GQO A;  3CPW A;  5LMN Q;  1K73 C;  4LU4 A;  3PO2 H;  2B3G A;  5CGL A;  4UP8 A;  2IX1 A;  2K5N A;  3J81 i;  4JI5 L;  4B3T Q;  2UXB Q;  3K7U C;  4OWX B;  1K3R A;  4A4I A;  1CUK A;  1QUQ B;  4JYA Q;  5H1S E;  1JB7 A;  4YCU A;  4BA1 I;  1YIJ A;  1VQF A;  1PH3 A;  4GKJ L;  3H3V H;  3I56 A;  4LFC L;  1QVG A;  4LFA L;  4R4I A;  4AIM A;  2YU9 H;  2G03 A;  4GN5 A;  1E24 A;  1L1O A;  4X62 L;  2UXD L;  3TQY A;  1ASZ A;  1LM0 A;  5BR8 L;  1VS0 A;  1W2B A;  2E2H H;  1E1T A;  3T1Y L;  1N34 L;  1GKH A;  4YWK A;  1FJG L;  4XI8 A;  2I5L X;  2WB1 E;  4OWT B;  1E1O A;  4GKK L;  3EN2 A;  3S14 H;  1U0L A;  3A5U A;  3I2Z A;  4KLK A;  4DV3 Q;  4LF4 Q;  2JA7 H;  1Y1V G;  3BZC A;  4AYB G;  4U07 A;  1SE8 A;  4GN3 B;  2B63 G;  5ELN A;  4DUZ Q;  4O0A A;  2OTJ A;  3HKZ G;  2CKZ B;  5GAE C;  1K9M C;  5M3F G;  1Q12 A;  1V1Q A;  1YEZ A;  3CCR A;  3HOZ G;  4A3E G;  1EIY B;  1VQG A;  1AH9 A;  3DLL A;  4IJH A;  2AKW B;  3STB D;  4DK6 C;  5CKL A;  2OQ0 A;  4NPS A;  1SN8 A;  3H0G G;  1SMX A;  1VCI A;  2Y0S G;  3FKI H;  4A3K G;  1XNR Q;  5IP7 G;  2F4V Q;  4OO1 I;  1IZ6 A;  5IYB G;  4O2D A;  5IYD H;  1V43 A;  4JV5 Q;  4GOP A;  4HJ9 A;  3IRB A;  3AFP A;  2AHO B;  4DK3 C;  2N8N A;  4AYB E;  3HOV H;  2HQL A;  4A76 A;  2ALY B;  4A3D G;  1Q82 C;  4OWW B;  1PVO A;  3HKZ E;  5C3E H;  4JI3 L;  3HOY G;  1HNX L;  1TWG H;  5JFF A;  2R7Z H;  1PH8 A;  2VUM G;  2KEN A;  2JA9 A;  4QGU A;  4A3B G;  3D0F A;  2EXD A;  3PUZ A;  2K14 A;  3I4N H;  2GN5 A;  3TRZ A;  4LNQ A;  4WJ3 M;  1XMO L;  4X2C A;  1X3F A;  3L2P A;  3DM3 A;  1P8L A;  4DR3 L;  1MJE A;  1VQK A;  2Y0S E;  3J81 j;  2PI2 A;  2MO0 A;  1G29 1;  4LFB L;  4LF8 L;  1WCM H;  4BBS H;  2D0O A;  2UUA Q;  4HJ7 A;  3UE1 A;  5M5W H;  1XMQ L;  4JI0 L;  1VQN A;  1KRT A;  2Q2H A;  3RLN A;  2E5L Q;  4DNI A;  2VQE L;  1N33 L;  1TWH H;  2RCN A;  1X9N A;  4L5T A;  2HHH Q;  1VQD A;  4Y7N H;  1YJN A;  3F2B A;  3N3U A;  4DV5 L;  2MNA A;  1LUZ A;  1PH6 A;  1IBL Q;  3S2D H;  1TWF H;  4JI6 Q;  2BH8 A;  3W5O A;  1VQM A;  2KCM A;  1OTC A;  1YJ9 A;  3D31 A;  4DR5 Q;  1X56 A;  2R6G A;  3T1H L;  1OXT A;  1KAW A;  1V9P A;  2ZJQ A;  3S1M H;  1X3G A;  2UUC Q;  4LF7 L;  4A93 H;  1EWI A;  1I3Q H;  4JC0 A;  1HNZ L;  4OXP A;  3PO2 G;  2PQA B;  1XNQ L;  1HNW Q;  4P74 A;  3STB C;  2IHF A;  3W1B A;  4DV0 Q;  5JJK A;  1PA6 A;  5C0X G;  4GNX B;  1NE3 A;  2UUB Q;  4B3S Q;  4LW1 A;  5LMU L;  5IE8 A;  4HID A;  3SGI A;  3BZK A;  2NVQ H;  1CKN A;  4AQY L;  4NXN L;  3PGZ A;  3OW2 A;  3RN2 A;  1TWA H;  2C35 B;  3E9I A;  1YIT A;  2JA5 H;  2N49 A;  5IY0 A;  1M90 C;  2JEA I;  2R92 H;  1QVC A;  3CAM A;  1QZH A;  1L0W A;  3S2H H;  1GO3 E;  5AJ3 Q;  3BU2 A;  3KOJ A;  1Q46 A;  2K4K A;  5FLX c;  4B3M Q;  3G48 A;  1IBM L;  2LXK A;  2QEX A;  4X65 Q;  1K83 H;  4P72 A;  2YTV A;  4BBR H;  1Q81 C;  5GRO A;  5GAD C;  2IT1 A;  1KL9 A;  2PI2 E;  2GVA A;  1Y1W H;  1LYL A;  2IHE A;  3CP0 A;  4MNO A;  4JI1 Q;  2NN6 G;  2JK8 A;  3CCM A;  5IYC H;  2KHJ A;  3RN5 A;  3ULJ A;  3UDI A;  4DV2 L;  1K8A C;  4U04 A;  4P71 A;  2ZTD A;  1PV4 A;  1Q7Y C;  1PH1 A;  3EBE A;  2JA6 H;  4IOC A;  3CPF A;  4L5R C;  2Q2I A;  3RLO A;  3M4P A;  1I50 H;  4DR2 Q;  4KHP L;  2UXC L;  2CWA A;  3FKI G;  4DV4 Q;  1YBY A;  5IYD G;  4A3L H;  4X66 L;  5CMT A;  1N32 Q;  1C9O A;  2F52 A;  2E2I H;  1MJC A;  5C4X H;  2F6S A;  4YY3 L;  5LMN W;  4GLX A;  1PH7 A;  3U4V A;  1SRU A;  3K81 C;  3KYH C;  1FGU A;  2VQF Q;  3CCS A;  4A3J H;  3KDF B;  3HOV G;  5IWA L;  4DR4 Q;  1VQ8 A;  4QQB X;  4R4T A;  3JAM c;  2YTY A;  4HIK A;  2BH2 A;  2H5X A;  5C3E G;  3GTM H;  3RZD H;  3PIP A;  2YTX A;  2NVX H;  2R7Z G;  1EOV A;  3PUY A;  5C0X I;  4LF9 L;  3I4O A;  1VQ4 A;  3GTG H;  3ULL A;  3I4N G;  3ZC7 A;  4IPG A;  1D7Q A;  1TWC H;  1NTG A;  3EIV A;  4DKA C;  4QJF A;  4DR6 L; 
#chains in the Genus database with same CATH topology
 3KLW A;  5CV9 A;  2ATW A;  3H3V I;  2M00 A;  2F1M A;  4DV1 Q;  1K28 A;  2WKC A;  3NE5 B;  3J7Z C;  4DUY Q;  2R93 B;  3K59 A;  1ASY A;  4IFD H;  3NBH B;  1F9R A;  1DGS A;  2RHS B;  3H0G B;  1IBK L;  3EQL C;  5JJ6 A;  3F2U A;  3GDE A;  4HTH A;  1Y14 B;  5C0X J;  2XTI A;  2BCO A;  4JI4 Q;  3S16 B;  2N78 A;  5T1I A;  4J15 A;  2NN6 I;  2L55 A;  3KUP A;  1YJW A;  4H13 C;  4CKC A;  1EU3 A;  2O2L D;  2UXB L;  4XQQ A;  4KTA A;  3LNN A;  4C3J H;  4POG A;  1A6X A;  2A5H A;  4ME5 A;  3S9W A;  1IXR A;  5J3B A;  3S15 B;  3KLS A;  2AMC B;  2EYL A;  2PZT A;  1WFQ A;  4FYD A;  2UU9 Q;  5JJL A;  1I6V C;  1Z47 A;  1EQV A;  3HZX A;  2XN9 C;  5CYU A;  1OXU A;  4UHV A;  1PFS A;  4DUZ L;  3AQQ A;  2OWO A;  5JEA J;  4BBR G;  2V1C C;  2ZM6 Q;  4GOP B;  2L1B A;  3NHH A;  1E2W A;  1CKO A;  5KGU A;  4K0K Q;  1BKB A;  2PQA A;  2Z4I A;  2EOT A;  1SRO A;  2B2U C;  4A3I H;  5C4H A;  5LL6 S;  4V19 0;  3A74 A;  1P16 A;  1F9Q A;  3MTS A;  2KBN A;  5EGT A;  5I2X A;  4ZK9 B;  4AH6 A;  1ENA A;  1BR9 A;  1LTT D;  2K28 A;  1YHQ A;  4NDX A;  2LSS A;  2CQA A;  3M4O H;  1HPC A;  1XPU A;  3X3M A;  1BOS A;  1EQQ A;  2SNM A;  4NKL A;  1UEA B;  3ERO A;  3VA7 A;  4BY1 H;  4KJO A;  1W6J A;  3PF4 A;  2MO1 A;  1B7Y B;  1LTS D;  2AWO A;  4DNT B;  1A2U A;  5CV7 A;  1O78 A;  1S3O A;  1QZG A;  2Q2U A;  2HHH L;  3WOE A;  2SEB D;  2MGS A;  3RZO B;  3SE0 A;  2JA7 G;  1PZJ D;  2KVM A;  1PH9 A;  1KDB A;  1MKH A;  5C4J B;  3N52 A;  1SFO B;  2MP1 A;  3K6O A;  2NB0 A;  2UUC L;  3BVM A;  4GKJ Q;  2D2C C;  4OON A;  5C6A A;  4JOI C;  2ENB A;  1MIU A;  1H95 A;  2JE6 I;  1HNW L;  4X62 Q;  2O4X A;  3PCO B;  3S17 H;  3T1Y Q;  2EIF A;  5M3M H;  4GKK Q;  1CT1 D;  3HOU G;  1VQP A;  3B6Y A;  4NB3 A;  3GTJ H;  2NVY H;  1D1K A;  2X6L A;  1CZG A;  3C3L A;  4X65 L;  1TKW B;  2K5D A;  4ZUJ A;  3VR4 A;  3K7A H;  4IJL A;  2KQ3 A;  2QA4 A;  2WB1 G;  5FJ8 H;  2DGY A;  1JE5 A;  3MEF A;  2F0E A;  1XX8 A;  4UPA A;  2B2W A;  3T13 A;  4BY7 H;  1PRT B;  4L6T B;  5DLQ E;  3SHL A;  4A3K B;  5C3X A;  4KD4 A;  4KMU C;  3A8K E;  4JCV E;  4DR2 L;  3H94 A;  3FMC A;  5IP9 H;  4C1N I;  1LT3 D;  1Z9F A;  1E22 A;  1U4P A;  1V1P B;  3NXW A;  1PYB A;  3QG1 A;  3CC4 A;  3MWY W;  4FF1 A;  2DUD A;  1U5K A;  3HOY B;  3KLS X;  1WTQ A;  4LFB Q;  1B44 D;  3WDN A;  2R7F A;  3I4M H;  4U68 A;  1X55 A;  4C56 C;  4U0U A;  1BXT A;  1SLJ A;  1ZYR D;  4XIG S;  4YCW A;  4DAV A;  2G9H D;  4U0Z A;  2Q2T A;  1B2T A;  3AYH B;  3DM1 A;  3EVQ A;  3VDY A;  1HFN A;  3TSS A;  4BA2 I;  5M5X H;  1LV9 A;  2R93 G;  1ILP A;  1VQE A;  1LTI D;  4RH6 A;  1GD7 A;  5E4X A;  1CSQ A;  5JEA H;  3L9A X;  3T1H Q;  2RSN A;  2HCC A;  1SSO A;  2HDM A;  1KIX A;  4NMZ A;  1HR0 W;  3SHG A;  4LF6 L;  3DWA A;  4KHV A;  5M5Y H;  2RDG A;  2DN8 A;  1GUG A;  3L7Z C;  4NP5 A;  1LTB D;  1UE7 A;  1PLF A;  1A2T A;  1SYC A;  3J81 E;  3D8G A;  3R93 A;  4C2M B;  1Y69 U;  4Q0F A;  2RDH A;  4NW2 A;  1VQA A;  3BJU A;  4ULL A;  4DR1 L;  3ICE A;  3R2I A;  3TBI B;  3U4Z A;  1MSG A;  2V4D A;  3CHB D;  1II3 A;  1CKM A;  3OOC A;  1BCP C;  5ELC A;  1Y1V H;  2KUM A;  2QDB A;  1YHA A;  2CWP A;  3NSW A;  3C1E A;  1I5F A;  3HOZ H;  1O7I A;  4A3E H;  2CQO A;  3TRE A;  1CA6 A;  3PSI A;  1HR0 L;  1F2Z A;  5ELO A;  1EFW A;  2OT2 A;  3NQT A;  3KF6 A;  3SXH A;  2OCE A;  5EQ0 A;  4KHP Q;  2UXC Q;  1S5E D;  4P75 A;  4X66 Q;  1OXS C;  4F88 A;  2AWN A;  4ILW A;  2VUM H;  3SE5 A;  3VR6 A;  2PCF B;  4F8M A;  5IWA Q;  1VQ9 A;  1STG A;  4DPG A;  2A69 C;  3TS2 A;  4RHS A;  4QIW E;  4KJN A;  1YNX A;  2B2T C;  4XTC S;  1KDA A;  4A3C G;  2A1A A;  5JJ7 A;  3K5O A;  5DM7 3;  1X65 A;  2NUC A;  1N32 Q;  3ER0 A;  2B2V C;  1KC8 C;  1TWG B;  5E7N A;  1IYJ B;  2EPB A;  1GVP A;  2ZXR A;  4MZ9 A;  4K2L A;  1JC7 A;  4H44 C;  4MN3 A;  1A3U A;  4XQN A;  4J6H A;  5M5W B;  4J8Q A;  1EEF D;  5CGK A;  1UEB A;  3OTO L;  1TWH B;  1HA6 A;  3PQI A;  1S5D D;  2B3G A;  1NAP A;  5C3W A;  3S2D B;  4B3T Q;  5F2D A;  1EY4 A;  4OHJ A;  1TQO A;  1KAB A;  3QO2 A;  4A93 B;  2FFK B;  2HD3 A;  4AIM A;  2YU9 H;  3EFX D;  4GN5 A;  1L1O A;  5BR8 L;  1HQM C;  5ELB A;  1YNN C;  2E2H H;  1E1T A;  2MHV A;  2NBF A;  5IT9 E;  1U4M A;  3DMU A;  3OWE B;  3JAM L;  1FR3 A;  2NVQ B;  1SNQ A;  1TWA B;  2ICE C;  4U07 A;  1SE8 A;  3HG9 A;  3SK8 A;  1STN A;  2R92 B;  3SVM A;  4O0A A;  1F77 A;  5GAE C;  3NTH A;  3BDL A;  3CCR A;  5EKI A;  5A2Q L;  1PMR A;  1VQG A;  1G8Z D;  4A3K G;  2Y0S G;  2F4V Q;  4OO1 I;  5TSS A;  5IP7 G;  1S5F D;  4O2D A;  3MC0 B;  2IJ0 A;  1Y8O B;  2JA6 B;  3T53 B;  2DY8 A;  4HSV A;  2NZ1 D;  2F0F A;  2FHT A;  3IRB A;  4AYB E;  2ALY B;  4IZ8 A;  4N9T A;  3HKZ E;  4RGM A;  3HOY G;  1HNX L;  1WD1 A;  2R7Z H;  2KEN A;  1B4O A;  1I50 B;  3D0F A;  2EXD A;  3Q0A A;  2K14 A;  1Z7T A;  4TRD A;  4RHR A;  1LLR D;  3DM3 A;  2QF7 A;  1G29 1;  4WRD A;  1EIH A;  2UUA Q;  3HP3 A;  1VQN A;  4JI0 L;  2Q2H A;  2PO4 A;  3RLN A;  2PNR C;  1LAB A;  1X9N A;  4L5T A;  2EJF C;  3IAY A;  4Y7N H;  5KND A;  2MNA A;  2MJ8 A;  2F0S A;  1QE6 A;  3MAQ A;  4QIW B;  2DJF C;  2A6H C;  1YNJ D;  1OTC A;  3D31 A;  4DR5 Q;  3S1R B;  1OXT A;  1LO5 D;  1X3G A;  2EYJ A;  1HNZ L;  5IGB A;  3H3V C;  5BN5 A;  4IUT A;  2EYF A;  3LX0 A;  2BE5 C;  1C4Q A;  2ZXP A;  1ESF A;  4DXG A;  1XNQ L;  3QIA A;  4P74 A;  3K57 A;  2IHF A;  3J7A V;  3W1B A;  1R4P B;  5C0X G;  1RTO A;  1RDP D;  5DEH A;  5FO9 B;  3H09 A;  1ENF A;  2J0T D;  3NQI A;  4NXN L;  3IFD A;  3RN2 A;  2C35 B;  2F0P A;  1X3P A;  2JA5 H;  5IY0 A;  1QZH A;  1CK1 A;  5L37 A;  2JA8 B;  3S2H H;  1GO3 E;  2WAC A;  5I4D A;  5FLX c;  2L11 A;  5NUC A;  1U9R A;  1DOL A;  4P72 A;  4BBR H;  5GRO A;  5GAD C;  2GVA A;  3MFY A;  5DAU A;  3CCM A;  3GP7 A;  4HMJ A;  2FJ2 A;  1PV4 A;  1PH1 A;  3QR8 A;  3CPF A;  2X6G A;  4F87 A;  4DV4 Q;  5CMT A;  3VR5 A;  2FMC A;  3U4V A;  3K81 C;  3KDF B;  4DR4 Q;  1SJH D;  3BDC A;  2H5X A;  3FPP A;  3RZD H;  2NVX H;  4ZAI A;  1EOV A;  2B2Y C;  3I4O A;  3GTG H;  1BBX C;  3NPP A;  1TWC H;  4MTN A;  1NTG A;  3EIV A;  4FVM A;  4QJF A;  1PH8 A;  4EVO A;  1G2S A;  2KOL A;  3GTL B;  4IUU A;  2VZA A;  4NXM Q;  2K52 A;  4N8F A;  3HKZ B;  3GTP H;  5IGG A;  2Q8I B;  3WWV A;  4P2C B;  2RSO A;  5HY6 A;  2YYZ A;  5EU0 A;  2KCN A;  4P73 A;  5C44 B;  4IPC A;  3SEB A;  3SK6 A;  3VR2 A;  4DN4 M;  1TS2 A;  3PO3 H;  1NNX A;  3E9H A;  2XWJ B;  4PNY A;  3MFG A;  1YHB A;  4A93 G;  4B3R Q;  2Z6K A;  5JFZ A;  5ELF A;  3CQZ H;  5HGQ A;  1O80 A;  1RL2 A;  3HOU H;  1L0Y B;  3PF5 A;  4JI7 Q;  4POF A;  3J7A 5;  1NCV A;  3U50 C;  2B2W C;  4XDX A;  1DOM A;  3KBX A;  4IUV A;  1FNW A;  2D0P A;  3Q8D A;  1TR5 A;  1R9T H;  4JI2 Q;  1J5E Q;  4XYQ A;  1STH A;  2EYM A;  3J7Y W;  1A8V A;  4IO9 A;  2VB2 X;  3D4R A;  3CCE A;  4UY8 C;  3MXN B;  3U58 A;  2JSO A;  4FXK C;  3M85 A;  1BCP B;  2F0K A;  2JA6 G;  2NYZ D;  3LWE A;  1OO9 B;  3R2T A;  2A68 C;  1XNR L;  3CD6 A;  1CA5 A;  2WP8 J;  2OF1 A;  3MVV A;  4OX9 Q;  4YCV A;  2D62 A;  3KF8 B;  4K5X A;  4ZCK A;  1WOC A;  2CW0 C;  4X64 Q;  3J80 i;  1DZ1 A;  2R93 H;  4ZKB B;  1VQJ A;  1MSH A;  4L5Q A;  1ICF B;  5D65 A;  3H0G H;  2E5L L;  3S16 H;  3CF5 A;  1KLU D;  5EBD A;  4R1J A;  4KY6 A;  3J80 c;  3R3O A;  3O13 A;  4JI8 L;  4ALP A;  1DJR D;  3S15 H;  4X2D A;  1M1K C;  2F0O A;  3M7N A;  3VYR A;  2PNH A;  1AZQ A;  2BDN A;  2UXD Q;  1F9S A;  2LXJ A;  3KFU A;  1DXM A;  4H02 A;  2PW5 A;  4CDF C;  1GUT A;  2WAQ E;  2JA8 G;  5FLM G;  4UAI A;  4QL5 A;  5DNF A;  2LMC B;  4N8X 1;  3D4D A;  1SE3 A;  4ODG A;  3CC2 A;  4DNR B;  1QVF A;  4HJ8 A;  1I6H B;  4UDU C;  4GLV B;  4PY3 A;  3SK5 A;  3TZU A;  1VQ5 A;  2B63 B;  1WJJ A;  1UE5 A;  4HSP A;  3RMH A;  5M3F B;  4EQO A;  4CJ2 C;  2AUK A;  3PUW A;  3FVQ A;  3I3C A;  2NWG A;  3PV0 A;  3P20 A;  5M9O A;  1T5E A;  1EYD A;  4IFD I;  4A3C H;  1BBU A;  4C3H B;  1XMO Q;  1G6Z A;  4XT3 B;  2Z9H A;  2PQE A;  2VQF L;  4HJ5 A;  3RUZ A;  4LF8 Q;  5ELD A;  3CU7 A;  1BNZ A;  2MUY A;  3CXC A;  1JJC B;  1XMQ Q;  1IYV A;  3BG3 A;  4QCL A;  1B70 B;  3C1F A;  1TXY A;  3A7L A;  1TS3 A;  1Q86 C;  3NEL A;  3RZO H;  3K5M A;  4I7Z C;  2IY5 B;  2KCT A;  3NWT A;  5C4J H;  1L1O C;  2JA5 G;  3JAM E;  5C44 G;  4X6A H;  4DV1 L;  1WTH A;  3NUC A;  2F0I A;  4HR7 B;  1SFO H;  1NUC A;  1FD7 D;  1SYG A;  1G6P A;  1HXY D;  1NMF A;  4DUY L;  1B1Z A;  1VQO A;  1PTO C;  3CKI B;  4KY7 A;  2Q8T A;  1T9H A;  1FNV A;  4K14 A;  3V96 A;  1TU2 B;  3KJO A;  4JI4 L;  3GTO B;  1E7Z A;  4OL7 A;  4HCS A;  2FXQ A;  5A35 A;  5LMU Q;  4LK1 C;  2X69 A;  3CCJ A;  4G4K A;  3HKS A;  4AQY Q;  5FOB B;  3M9B A;  4GS3 A;  2Z0S A;  3PIP 3;  2RKS A;  1QB5 D;  3URY A;  2A6E D;  1RKN A;  1KAA A;  1EUJ A;  4IPD A;  2UU9 L;  2KCC A;  4DXF A;  3E0J A;  3RLF A;  1ZYR C;  4LWC A;  3T56 B;  2KEE A;  5EAY A;  3UDX A;  1WTO A;  4A3K H;  1EFI D;  2F0W A;  5IP7 H;  3NEN A;  2WAQ B;  2F0G A;  3AU7 A;  2JEB I;  1K8G A;  2ZM6 L;  5C5L A;  1AE3 A;  4DGZ A;  3HOY H;  4X3K A;  2E75 C;  4O42 A;  3PUX A;  3RR5 A;  4K0K L;  3TZD A;  3I91 A;  1SMY C;  4IPH A;  1TII D;  4G7O C;  3FKI B;  4PZ8 A;  2PMZ E;  1Q8I A;  3ULP A;  3PO3 G;  2F0J A;  4LF9 Q;  3HOV B;  5AFW A;  1H9S B;  1K8M A;  2OQK A;  1QIL A;  3UE0 A;  4DR6 Q;  4DAM A;  1I94 Q;  3J7A F;  5FO8 B;  4ABN A;  1JIC A;  1STB A;  4KKT A;  4B3S L;  1HRJ A;  5EBC A;  5KIX A;  3TP5 A;  1IW7 C;  1JB3 A;  2XSC A;  5IIF A;  1BCP F;  2NUD A;  4LF5 Q;  1SNM A;  1W6K A;  2MPM A;  1VF5 C;  4RGN A;  1GUN A;  1BUV T;  5FLX L;  3GV3 A;  1BDO A;  1YZ6 A;  2YV5 A;  1PDQ A;  2ID0 A;  4C2M H;  5GQO A;  5LMN Q;  1K73 C;  4CKB A;  5CGL A;  4UP8 A;  3NTK A;  3J81 i;  1AZP A;  5C0X H;  1D6E C;  3C46 A;  4A4I A;  1CUK A;  4JYA Q;  5H1S E;  1YIJ A;  5E1F A;  1PH3 A;  2NUN A;  4GKJ L;  3S1M B;  1RCV D;  3I56 A;  1D5Z C;  5IGC A;  1JWM D;  1QVG A;  1I3Q B;  3NP8 A;  4R4I A;  4X62 L;  1E24 A;  3OWF A;  3TQY A;  2SNS A;  1LM0 A;  1SYB A;  1W2B A;  4X3U A;  3T1Y L;  2IPK D;  4YWK A;  4XI8 A;  2I5L X;  1E1O A;  2AQ2 B;  3EN2 A;  4GKK L;  1O7Z A;  1QJO A;  2J7Z A;  5HGT A;  4LF4 Q;  3G7L A;  1I4H A;  5C5M A;  4PMC A;  2B63 G;  1HTL D;  5M3F G;  1CZW A;  1Q12 A;  1YEZ A;  1EIY B;  1UAP A;  2AKW B;  4OIJ A;  3STB D;  5JJZ A;  4NPS A;  1K83 B;  2RA4 A;  3H0G G;  1SMX A;  3T16 A;  1RHP A;  1IZ6 A;  5IYB G;  4I7A A;  4JV5 Q;  4C3H G;  1PVO A;  4OWW B;  5KYI A;  1TWG H;  4QGU A;  2JA9 A;  2GN5 A;  1VQK A;  5C4X B;  2PI2 A;  2MO0 A;  4LFB L;  3ZYY X;  1RD9 D;  2D0O A;  2EDG A;  4A3J B;  4HJ7 A;  5M5W H;  1EOT A;  4G57 A;  3GTM B;  1QCB D;  1TWH H;  1VQD A;  4F7X A;  1YJN A;  3N3U A;  2PMZ B;  1LUZ A;  1IBL Q;  3S2D H;  3SK4 A;  1QNU A;  3GTK B;  3C2P A;  3T1H L;  4A3M B;  4RGT A;  2ZJQ A;  4A93 H;  1EWI A;  4JC0 A;  1BF4 A;  3A7A B;  2B8F A;  4DV0 Q;  1PA6 A;  1WTV A;  1STE A;  3P1H A;  1NE3 A;  1AEX A;  2UUB Q;  1VF7 A;  2EVB A;  3K0Y A;  3BZK A;  2NVQ H;  1TWA H;  2N55 A;  1NH1 A;  4KKU A;  2R92 H;  1M90 C;  3HOX B;  3CAM A;  5AJ3 Q;  3KOJ A;  3VYT A;  1Q46 A;  2K4K A;  4B3M Q;  4KD3 A;  2LXK A;  2QEX A;  2K32 A;  2CHB D;  1Q81 C;  5EKK A;  2IT1 A;  2F0D A;  3CP0 A;  3RN5 A;  2JA6 H;  4JI1 Q;  2NN6 G;  3M3Y B;  3DEO A;  3UDI A;  3Q6S A;  4U04 A;  1EYA A;  3EBE A;  4L5R C;  1I50 H;  5JOB A;  4KHP L;  2UXC L;  2CWA A;  3FKI G;  4L8J A;  5IYD G;  4X66 L;  1C9O A;  2F52 A;  5IOC A;  1MJC A;  3J80 L;  1PH7 A;  3KYH C;  3D3R A;  1F2Y A;  1FGU A;  3HOV G;  3OHX C;  3CRL C;  5IWA L;  2QW7 A;  4R4T A;  5KYL A;  1SYF A;  4HAE A;  3PIP A;  3A8I E;  2YTX A;  4Q5V A;  3PUY A;  3IFT A;  4IPG A;  1D7Q A;  3GTQ B;  1N32 L;  1IL8 A;  3U9S A;  1PFB A;  1A3V A;  1OXX K;  1VQ7 A;  2HUG A;  1EY8 A;  3S1R H;  1VDZ A;  2OTL A;  1IL2 A;  2L15 A;  2QEJ C;  1JT8 A;  1L2F A;  1WTX A;  3SDZ A;  4ZKC B;  5K5P A;  5JVG 3;  4A3F B;  3UI2 A;  4ITR A;  1VQI A;  4WFN 3;  4DV6 Q;  1UE6 A;  1BCP D;  2BDO A;  3OMG A;  3E5S A;  3K8A A;  1Q8K A;  4B3T L;  1L1O B;  1ZXT A;  2RCF A;  1ET9 A;  4N67 A;  4HJA A;  4A3G B;  1QG7 A;  1B9M A;  5FLM H;  2JA8 H;  3OIQ A;  4FO2 A;  1PTO B;  3HFZ B;  2DNE A;  1KD1 C;  1EWH A;  5ISR A;  1YVC A;  1GXD C;  3S1N B;  4M8A A;  2HCI A;  4TKO B;  2MQH A;  4OIK A;  4R9W A;  4CJ1 B;  2I46 A;  2I5M X;  2LFN A;  3W3A A;  2AUJ D;  2Z1C A;  3FRP B;  3V05 A;  2F3I A;  3G4S A;  3HOW B;  2A8V A;  5GAG C;  1LTL A;  1CQV A;  3KJP A;  1FVI A;  2A69 D;  1I4X A;  2C9O A;  1K0S A;  1ZEQ X;  1VQ6 A;  3CW2 C;  1WVL A;  4L5S A;  5IYC G;  1C7Y A;  1PRT F;  2IWH A;  2ZJP A;  1JJG A;  1BO0 A;  3CMA A;  2F4V L;  3UDG A;  1PYW D;  1VMC A;  5KRU A;  3I72 A;  2E2J B;  1W3S A;  3BVZ A;  4A3L G;  1A62 A;  3M4Q A;  3T51 B;  4IN3 A;  1HHV A;  3OSO A;  5C4X G;  4O1N A;  3ERQ A;  1N36 Q;  3GTL H;  1KNE A;  4B9W A;  3F2D A;  4A3J G;  1M8A A;  1KNA A;  3N6R A;  1VQL A;  4I65 A;  4YHH Q;  2QGQ A;  1EY9 A;  1VQC A;  2IW3 A;  1HZB A;  1KXL A;  4JOI A;  5ELE A;  5C44 H;  1J6Q A;  1XPO A;  4CHT B;  5CV5 A;  4JBK A;  3I7F A;  3QJY A;  3S1Q B;  2KHS A;  2Z4H A;  3VYU A;  4A3M G;  3LWU A;  2B8G A;  1CHQ D;  2L5T A;  4ME3 A;  2J4X A;  2F0V A;  4R8I A;  4JI5 Q;  1XYI A;  1YNN D;  1GHJ A;  2CVR A;  2K05 A;  4S3S A;  5G3L F;  2K01 A;  4DR5 L;  1EIF A;  2NZO A;  3ZLM A;  3P75 A;  4LFC Q;  4LFA Q;  1PH4 A;  1NJI C;  2VL6 A;  1FNU A;  3GD7 A;  3FPU B;  3KDF A;  1QUQ A;  1X6O A;  1IKL A;  2RHQ B;  1HUM A;  3GQB A;  4OEM B;  1N34 Q;  4R4C A;  3HOX G;  1FJG Q;  1HZ9 A;  1TT2 A;  2EYH A;  3PIO A;  4FF3 A;  1YI2 A;  1UWV A;  2HIV A;  2NVT B;  1CM9 A;  4DR7 L;  4LUV A;  2SDF A;  4APV A;  2R7D A;  4AYB B;  1BVS A;  1BQQ T;  2HT1 A;  1TS5 A;  3OMC A;  1EY7 A;  1B3Q A;  4IOA A;  3DWQ A;  5IGE A;  1EU4 A;  3CRK C;  4IAL A;  5FLX E;  4JI3 Q;  3JC6 6;  3LGJ A;  1HJP A;  5I9P A;  1X3Q A;  2L4N A;  4DV4 L;  2QDL A;  4U67 3;  4A3D B;  4DR3 Q;  1EZ6 A;  5EKL A;  4DR4 L;  3NWS A;  4A3B B;  4MIU A;  1D1I A;  1DM0 B;  2BA1 A;  1NBW A;  1XTC D;  2O5I C;  1PFM A;  4HIM A;  4QB4 A;  3L0O A;  2VQE Q;  1N33 Q;  1JJ2 A;  1IKM A;  1PFN A;  3TME A;  1CSP A;  3K58 A;  2EJM A;  1EIG A;  3P7J A;  4C3I B;  4DV5 Q;  2I5H A;  3K5N A;  2KEC A;  4CKE A;  4A3F G;  4IFD J;  4NXM L;  2R92 G;  2K03 A;  2F0M A;  1B3A A;  4DV3 L;  1FL0 A;  3CCL A;  2OXP A;  2XNA C;  3E0E A;  4LF7 Q;  2SOB A;  4RMF A;  2AQ3 B;  1PH2 A;  3MEH A;  3OW7 A;  3TS0 A;  1TS4 A;  3HEJ A;  1KHI A;  1LAC A;  4JW0 A;  3D4W A;  1I4P A;  4A3G G;  1J8I A;  3FHW A;  1WTP A;  4EQ5 A;  3PO2 B;  1Q3L A;  1X3E A;  5D3I B;  4QY7 A;  5JJI A;  4B3R L;  2JJQ A;  4QUC A;  1KDC A;  3KF8 A;  3KK7 A;  3FEW X;  1LTA D;  1OXV A;  4GNX A;  4JI7 L;  1KRS A;  4X3T A;  1H9R A;  3GV6 A;  5J22 A;  1I6H H;  1K0R A;  1IBM Q;  1JE4 A;  2XWB B;  5E3F A;  1XTD A;  4IUQ A;  2B63 H;  2VNU D;  2L0C A;  4H0L C;  4JI2 L;  3HOW G;  1J5E L;  1V1O A;  5M3F H;  1AFP A;  1C48 A;  2IX0 A;  4DV7 Q;  3LET A;  1M4V A;  1PZK D;  3E6Z X;  3S14 B;  2B2T A;  2TSS A;  4DV2 Q;  2K04 A;  1SXT A;  4JI8 Q;  1X32 A;  4LUO A;  3D6W A;  4EGV A;  5IYB H;  2I0Q A;  1CI3 M;  2JA7 B;  2R3Z A;  2B2V A;  1S5B D;  2EZV A;  3K80 C;  3HRZ C;  2K5H A;  4FF2 A;  1NMG A;  4C3H H;  1MI2 A;  4CDC C;  4ZUI A;  4YY3 Q;  3FP9 A;  4JI6 L;  1S72 A;  1B9N A;  2K75 A;  3MXU A;  1PTO F;  1SNO A;  1GUS A;  1X54 A;  2JYO A;  4RA8 A;  5E4W C;  5EJW A;  2LKV A;  1MBY A;  1PRT D;  3SN9 A;  4OX9 L;  1CKN B;  1QNK A;  4KHZ A;  2EQS A;  4BXX G;  3V2T A;  5C3E B;  4FDB A;  2XRS D;  2CCZ A;  4X64 L;  3I70 A;  2G5D A;  3ERS X;  3I4N B;  1SR3 A;  1PYS B;  3JAM i;  5CMD A;  4PG3 A;  4DAY B;  1WCM B;  4BBS B;  5K36 G;  1SNC A;  3BYT B;  4OO1 G;  3IKJ A;  2A6E C;  3S6A A;  1EWC A;  3TP7 A;  1I4R A;  1IBK Q;  3GTO H;  4YIJ A;  2MFI A;  3PMF A;  4R4Q A;  4HIO A;  3M7G A;  1VQB A;  4LAA A;  3Q24 A;  3CPW A;  2IX1 A;  3NBH A;  1Y8N B;  2K5W A;  1TWF B;  3KLR A;  2UXB Q;  1K3R A;  1H9J A;  2TMP A;  3DEP A;  4BA1 I;  2F0T A;  1VQF A;  3KBG A;  3H3V H;  1DCZ A;  1UUP A;  5G3L D;  5EPK A;  2G03 A;  2UXD L;  1RJT A;  3J80 E;  1ASZ A;  2QKI C;  1S5C D;  1SE2 A;  4M1U B;  1Q90 A;  4DF7 A;  1GKH A;  1GJX A;  1GUW A;  1ESR A;  3A5U A;  3I2Z A;  4KLK A;  5FK9 C;  2A68 D;  1CTM A;  4AYB G;  2NN6 H;  4DUZ Q;  2OTJ A;  3HKZ G;  4E6I A;  1JOO A;  2CKZ B;  1K9M C;  4C1N K;  1V1Q A;  3H91 A;  4IJH A;  1MD2 D;  5CKL A;  5CR3 A;  2OQ0 A;  2ICI A;  2K5Q A;  2KA7 A;  2CW0 D;  3FKI H;  3BS1 A;  5IYD H;  3BDO A;  5KNB A;  1Y1W B;  4GOP A;  4HJ9 A;  3AFP A;  2AHO B;  4DK3 C;  2N8N A;  3HOV H;  2HQL A;  4ZLT F;  4A76 A;  2NTT A;  4A3D G;  1E2Z A;  5A2Q E;  5JFF A;  4A3B G;  2PZW A;  4LNQ A;  1XMO L;  4X2C A;  1X3F A;  4K6D A;  2E2I B;  2Y0S E;  4FXD A;  3QOJ A;  1LT4 D;  1TVX A;  2F0N A;  4LF8 L;  2F0H A;  4C3I G;  1XMQ L;  1K8O A;  3FDT A;  3Q22 A;  2E74 C;  4DNI A;  2M2L A;  2RCN A;  3DHQ A;  5J1Z A;  2HHH Q;  1SND A;  1WTW A;  1CHP D;  1QWY A;  2K1B A;  1PH6 A;  4RKB A;  5LHY 1;  2VB3 X;  2EY1 A;  2DJG C;  3W5O A;  1VQM A;  2KCM A;  1JOR A;  1YJ9 A;  1EEI D;  1WD0 A;  1KAW A;  3S1M H;  1DON A;  2UUC Q;  1I3Q H;  1Z6H A;  2A73 B;  3HGB A;  3PO2 G;  2B39 A;  1EY5 A;  1SDF A;  2PQA B;  2JN4 A;  1HNW Q;  2PZU A;  3STB C;  4B3S Q;  5LMU L;  1E0B A;  5DM6 3;  1ET6 A;  4WOR A;  4CJ0 B;  1G91 A;  4AQY L;  3PGZ A;  3OW2 A;  1H9S A;  1A3T A;  3E9I A;  1YIT A;  2N49 A;  3H6M A;  1CFM A;  2JEA I;  1E2V A;  4C3J B;  4BS9 A;  3VA5 A;  1NR4 A;  4X65 Q;  1K83 H;  2F3V A;  2RBM A;  4RWS C;  1K3B C;  2FIN B;  3E3X A;  2PI2 E;  1LYL A;  4MNO A;  2JK8 A;  2R61 A;  4HED A;  2KHJ A;  5IYC H;  2B2Y A;  3BYY B;  4CGY B;  1K8A C;  2ZTD A;  4XYO A;  4DR2 Q;  1I4G A;  2WII B;  1YBY A;  2DY7 A;  4A3L H;  5C4X H;  5LMN W;  4MHE A;  2A74 C;  3TP6 A;  3CCS A;  4A3J H;  4HIK A;  2YTY A;  2BH2 A;  5C3E G;  1EY6 A;  3GTM H;  3NTI A;  1V1P A;  4LF9 L;  1SYE A;  5C0X I;  4A3I B;  1PTO D;  3I4N G;  3OPO A;  2WIN B;  1SJE D;  1H9M A;  4DR6 L;  4U0S A;  1I94 L;  2P5Z X;  1WCM G;  2F3W A;  4BBS G;  3GTK H;  1S40 A;  4A3M H;  2E76 C;  4K5V A;  3J81 c;  3M4O B;  3DUZ A;  4LF6 Q;  4PMB A;  4LF5 L;  2RF4 A;  1R4Q B;  4BY1 B;  2Y0S B;  4DU9 A;  2WV6 D;  3UDF A;  4Z9C B;  1LT6 D;  3D6C A;  4ZRZ A;  4RKL A;  3QB3 A;  5LMN L;  1PH5 A;  1STA A;  4KN4 C;  2XRQ D;  1G51 A;  1GHK A;  2NZH A;  1D5M C;  1A0I A;  4DR1 Q;  3DWP A;  1SYD A;  4JYA L;  1DOK A;  3HOX H;  3OIP A;  1MHW C;  3PUV A;  1HQR D;  4K6L A;  2E8G A;  1XJV A;  1ML0 D;  4EX5 A;  1ROD A;  4KN7 C;  3S17 B;  3OYY A;  3AEV A;  3M3Y H;  3W1G A;  4EQN A;  4RGO S;  5M3M B;  3CCV A;  1HR0 Q;  4QUF A;  3PIO 3;  1F2M A;  2Z6K C;  4LF4 L;  1SMY D;  2EY2 A;  3G6E A;  1O7Y A;  1C0A A;  3GTJ B;  2NVY B;  4G7H C;  1PHJ A;  3ZCB A;  3H15 A;  1Y1W G;  5FO7 B;  4Y52 H;  2A19 A;  3Q23 A;  1EYC A;  3F2C A;  3A5Z B;  1JMC A;  3K7A B;  1IYU A;  1WYD A;  2Z6B A;  4JV5 L;  3I90 A;  3CC7 A;  1L0X B;  1IW7 D;  1FGB D;  4BY7 B;  3GTQ H;  2N88 A;  5CBA E;  2I07 B;  4X2E A;  1JOK A;  2XIW A;  4YWM A;  1C8C A;  2GVB A;  3QWN A;  5HUR A;  1CQF A;  1HH2 P;  4HMI A;  3F8T A;  3VYS A;  2VS1 A;  4FF4 A;  4UP9 A;  2F4I A;  1RTN A;  3A55 A;  4TVA B;  4A3F H;  4RFB A;  3MXG A;  3I4M B;  2ZT9 C;  3IL8 A;  3OTO Q;  4GNX C;  3BZD B;  4WJ4 A;  2ES2 A;  3KF6 B;  1IBL L;  4PZ7 A;  5M5X B;  2WAQ G;  2D5D A;  4IFD G;  4A3G H;  4JK1 C;  1E3P A;  5IT9 c;  3I55 A;  1PTO H;  3EA6 A;  3K0X A;  5M5Y B;  3S1N H;  2N3S A;  5LL6 X;  2HQE A;  2Z8L A;  4GN4 B;  5I9O A;  3NBI A;  5BR8 Q;  4DV0 L;  4H7B A;  4K8J A;  1YNJ C;  2UUB L;  3ND9 A;  1F2L A;  1UE1 A;  2JP1 A;  1BBW A;  2K5V A;  4C3J G;  2KED A;  2BA0 A;  4B08 A;  2O5J C;  4TSS A;  3HOW H;  2IX3 A;  4EQP A;  1SNP A;  3T4A C;  3MZ5 A;  3TP8 A;  3W2D A;  5AJ3 L;  4RG1 A;  4B3M L;  3AMU A;  1Y1V B;  1JR0 D;  4IUR A;  1A63 A;  2HIX A;  4JBJ A;  4JI1 L;  3CCU A;  4TQU S;  2PYK A;  3HOZ B;  1ICW A;  4A3E B;  2E2J H;  4JBM A;  2GA4 B;  1ONL A;  1EYG A;  3MXP A;  5JPN C;  1JQY D;  2XVS A;  5COY A;  1HNX Q;  2ZTE A;  5CV6 A;  4K8I A;  4GLA C;  1SAP A;  3K5L A;  4BXX H;  1KQS A;  4YWL A;  4A3I G;  1HTP A;  2VUM B;  1XXG A;  4CDE C;  4JI0 Q;  3AB9 A;  1HZC A;  1GOZ A;  3S1Q H;  2L9H A;  3GO5 A;  4CBV A;  4UP7 A;  5GAH C;  3BVG A;  5K36 H;  4OO1 H;  1KLG D;  2CFM A;  5D14 A;  2WFW A;  4PZ6 A;  2B29 A;  1FYC A;  1EL0 A;  1ILQ A;  2PW7 A;  4JVZ A;  4BY1 G;  2B2U A;  5FKA C;  5I6Y A;  1NY4 A;  5EPL A;  2K6A A;  1EY0 A;  2OEO A;  4JBW A;  1HNZ Q;  2F03 A;  5IGD A;  1G2T A;  1TY2 A;  1XNQ Q;  4G7Z C;  4J1M A;  5JAV A;  3ND8 A;  1RF2 D;  5KEE A;  4DV6 L;  4DAP A;  1XWE A;  4XQJ A;  1N8R C;  1VQH A;  2KHI A;  4PMW A;  4N9P A;  4NXN Q;  5JVH 3;  2BOS A;  3ZJY C;  2NVT H;  2KJX A;  4GOP C;  1Q1B A;  4K5W A;  4KKS A;  3CUC A;  4FP5 D;  5CV8 A;  5M3M G;  2YU9 B;  3TEH B;  1QOH A;  4B9X A;  4R4O A;  2ZTC A;  4DA2 A;  4KY5 A;  2E2H B;  3A0J A;  2EXZ A;  5T1G A;  2F0U A;  5CV4 A;  1Q1E A;  2ZJR A;  2UUA L;  1EQR A;  2VXW A;  4OGQ C;  2CH4 A;  3AFQ A;  3VR3 A;  2G9D A;  4KI0 A;  4IUN A;  2VW9 A;  1WI5 A;  2XGT A;  4IUP A;  5CC4 A;  3I73 A;  2E2D C;  4FXG C;  3U9O A;  5FJ8 G;  2H4O A;  3CCQ A;  4A3D H;  1V8Q A;  1B53 A;  1H9K A;  4A3B H;  2EY5 A;  4BY7 G;  1JOQ A;  1LTG D;  4XXE A;  4ID6 A;  3MA2 B;  3G71 A;  4QMG A;  4JG2 A;  1AN8 A;  1HZA A;  2ASB A;  2K50 A;  3A54 A;  1B8A A;  3CME A;  3F1Z A;  1RIP A;  4M16 A;  3NEM A;  4DK1 A;  5IP9 G;  2RQX A;  1XPR A;  2L12 A;  3ONA B;  3HS0 C;  4C3I H;  2EYO A;  2AQ1 B;  4A75 A;  1D8L A;  4DR7 Q;  1AE2 A;  2EJG C;  3S24 A;  1N36 L;  4LUZ A;  2R7Z B;  2JQO A;  1GM5 A;  1IHZ A;  1TY0 A;  4YHH L;  3I4M G;  4BWG B;  3RNU A;  3L3O C;  1D5X C;  1SEB D;  3NK9 A;  3MHB A;  4IQZ A;  4WGJ A;  1U4L A;  2C5C A;  1N9W A;  1Y8P B;  4HN7 A;  5JEA G;  2VY3 A;  4Y7N B;  3PO2 H;  4LU4 A;  1MGS A;  3R8B A;  1O7L A;  2K5N A;  4JI5 L;  3RD4 A;  3K7U C;  4OWX B;  4KK7 A;  1QUQ B;  1JB7 A;  2QIL A;  4YCU A;  2Q8R E;  5C4Z A;  4LFC L;  2M9V A;  4LFA L;  1GUO A;  4ZYS A;  1VS0 A;  1PXU A;  3EJI A;  1N34 L;  1FJG L;  2ZXO A;  2WB1 E;  4OWT B;  5IGF A;  3S14 H;  1PRT C;  1U0L A;  4OEL B;  4DV3 Q;  2A6H D;  2JA7 H;  2FMM A;  1Y1V G;  3BZC A;  1J9O A;  4GN3 B;  1F9P A;  2JA5 B;  5ELN A;  3A8J E;  3S2H B;  2BE5 D;  3HOZ G;  4A3E G;  1AH9 A;  2EE1 A;  3DLL A;  4QF4 A;  4DK6 C;  1SN8 A;  1VCI A;  3MXN A;  2RVL A;  1DD2 A;  3J81 L;  4BBR B;  1XNR Q;  1V43 A;  1T5X D;  1SBB B;  2LY7 A;  1NSN S;  1NR2 A;  4XT1 B;  4PQX A;  1Q82 C;  5C3E H;  4JI3 L;  5CBE E;  5J39 A;  4X3S A;  4V0B A;  2VUM G;  1PZI D;  4RCN A;  3TN2 A;  2NTS A;  1EZ8 A;  3PUZ A;  3I4N H;  3TRZ A;  4WJ3 M;  3L2P A;  4DR3 L;  1MJE A;  1P8L A;  4R8N A;  3I4L A;  4LMQ D;  3J81 j;  1B50 A;  3X3N A;  1WCM H;  4BBS H;  4DFA A;  3UE1 A;  1HA5 A;  1KRT A;  5IOD A;  3RZD B;  2E5L Q;  2VQE L;  1N33 L;  2NVX B;  1UNS A;  2EYP A;  3GTG B;  3F2B A;  1AW7 A;  1TWC B;  4DV5 L;  4ZQ3 A;  1TWF H;  4JI6 Q;  2BH8 A;  1DYQ A;  3TDQ A;  2JXM B;  1KTK A;  1X56 A;  2R6G A;  1V9P A;  3GTP B;  5EPJ A;  4CDD C;  4LF7 L;  1HUN A;  1U4R A;  1JCK B;  2F0Q A;  2CH4 W;  1ENC A;  1VMP A;  4OXP A;  1WTR A;  4MTK A;  2WKD A;  5JJK A;  2K7V A;  4LJZ C;  4GNX B;  3M4Y A;  2D9U A;  5D3D A;  3PO3 B;  2H1E A;  4LW1 A;  5I6W A;  1A15 A;  5IE8 A;  4HID A;  3SGI A;  1CKN A;  2RDF A;  4GZY C;  2QCP X;  5JPM C;  1EQT A;  3ITP A;  1JWS D;  3G6J B;  3CQZ B;  1QVC A;  1L0W A;  3I8Z A;  3BU2 A;  4DK0 A;  3HOU B;  4HCE A;  3G48 A;  1IBM L;  5I2Y A;  2IL8 A;  3QOL A;  1SE4 A;  1LTR D;  2YTV A;  3SR1 A;  4DAY A;  5BN4 A;  2LS0 1;  4K2K A;  1R9T B;  1KL9 A;  3A56 A;  5BN3 A;  1Y1W H;  2IHE A;  4DV7 L;  4RCO A;  1S4Z A;  4JPB W;  3ULJ A;  3WOF A;  5KNC A;  4DV2 L;  4P71 A;  4WJW A;  1Q7Y C;  1LT5 D;  4IOC A;  5COR A;  2WB1 B;  2Q2I A;  3RLO A;  3M4P A;  1D2B A;  1AP0 A;  1JWU D;  2PPB C;  2HDL A;  2E2I H;  1I4Q A;  4YY3 L;  2F6S A;  4GLX A;  1SRU A;  2DNC A;  4FNF A;  2VQF Q;  2F0L A;  1HFG A;  1VQ8 A;  4QQB X;  2K33 A;  3JAM c;  5IT9 L;  1HCZ A;  2EY6 A;  4L63 B;  2R7Z G;  1ZKO A;  4RAU C;  1STY A;  4KV6 A;  4PV1 C;  1VQ4 A;  3ULL A;  3ZC7 A;  3DXJ C;  4DKA C; 
#chains in the Genus database with same CATH homology
 4U0S A;  3KLW A;  1I94 L;  2ATW A;  3H3V I;  1WCM G;  1OXX K;  4BBS G;  1VQ7 A;  2VZA A;  4NXM Q;  2K52 A;  3GTK H;  3S1R H;  1IL2 A;  4DV1 Q;  1S40 A;  4A3M H;  2OTL A;  3GTP H;  3J81 c;  2L15 A;  3WWV A;  3J7Z C;  4DUY Q;  1JT8 A;  1L2F A;  5HY6 A;  4LF6 Q;  2YYZ A;  5EU0 A;  4LF5 L;  2RF4 A;  1ASY A;  3NBH B;  4P73 A;  1DGS A;  2RHS B;  4IPC A;  1IBK L;  5JJ6 A;  3GDE A;  4ITR A;  1VQI A;  3UDF A;  1Y14 B;  5C0X J;  2XTI A;  4JI4 Q;  2N78 A;  4DV6 Q;  3PO3 H;  3E9H A;  1UE6 A;  2NN6 I;  4J15 A;  5LMN L;  1PH5 A;  1YJW A;  3K8A A;  1G51 A;  1YHB A;  4A93 G;  4B3R Q;  2NZH A;  1Q8K A;  2Z6K A;  4B3T L;  1A0I A;  2UXB L;  5JFZ A;  1L1O B;  4DR1 Q;  4N67 A;  4JYA L;  4HJA A;  4C3J H;  3HOX H;  3CQZ H;  4POG A;  5HGQ A;  2JA8 H;  5FLM H;  1RL2 A;  3PUV A;  3HOU H;  3PF5 A;  4JI7 Q;  2E8G A;  1IXR A;  5J3B A;  4POF A;  3HFZ B;  1KD1 C;  3J7A 5;  3U50 C;  1XJV A;  2AMC B;  1YVC A;  3HOZ H;  1WFQ A;  4EX5 A;  2D0P A;  3Q8D A;  1R9T H;  4JI2 Q;  1J5E Q;  2MQH A;  2UU9 Q;  5JJL A;  3OYY A;  2I5M X;  3AEV A;  1Z47 A;  3M3Y H;  3W1G A;  1A8V A;  1HR0 Q;  3CCV A;  2Z6K C;  4LF4 L;  4IO9 A;  1OXU A;  2F3I A;  3G4S A;  3G6E A;  3CCE A;  4UY8 C;  2A8V A;  5GAG C;  1LTL A;  1PFS A;  3MXN B;  3KJP A;  3U58 A;  1C0A A;  4DUZ L;  1FVI A;  3AQQ A;  2OWO A;  5JEA J;  4BBR G;  1PHJ A;  3ZCB A;  2V1C C;  2ZM6 Q;  4GOP B;  3M85 A;  3CW2 C;  3H15 A;  1VQ6 A;  1Y1W G;  2JA6 G;  1CKO A;  4Y52 H;  4L5S A;  5IYC G;  1C7Y A;  2A19 A;  2ZJP A;  1JJG A;  4K0K Q;  3CMA A;  3F2C A;  2F4V L;  1BKB A;  1XNR L;  3A5Z B;  1JMC A;  3CD6 A;  3UDG A;  1WYD A;  2PQA A;  2WP8 J;  4JV5 L;  3CC7 A;  1SRO A;  4A3I H;  4OX9 Q;  1W3S A;  4A3L G;  1A62 A;  3M4Q A;  3GTQ H;  4YCV A;  4DR7 Q;  1N32 L;  5C4X G;  2D62 A;  3A74 A;  3KF8 B;  4X2E A;  1P16 A;  1N36 Q;  3GTL H;  3F2D A;  2KBN A;  1WOC A;  4A3J G;  4YWM A;  4X64 Q;  2GVB A;  3J80 i;  4AH6 A;  1VQL A;  1HH2 P;  4YHH Q;  2QGQ A;  3F8T A;  1YHQ A;  2LSS A;  3M4O H;  2VS1 A;  1XPU A;  2R93 H;  4UP9 A;  1VQC A;  1VQJ A;  1EQQ A;  1HZB A;  4L5Q A;  4TVA B;  4JOI A;  4A3F H;  1KXL A;  5C44 H;  1J6Q A;  3H0G H;  4BY1 H;  3PF4 A;  1XPO A;  2MO1 A;  2E5L L;  1B7Y B;  3I7F A;  4JBK A;  2AWO A;  3S16 H;  2Q2U A;  1QZG A;  1S3O A;  3OTO Q;  4GNX C;  3CF5 A;  2HHH L;  4A3M G;  4WJ4 A;  2ES2 A;  4R1J A;  3KF6 B;  1IBL L;  4PZ7 A;  2JA7 G;  4ME3 A;  3J80 c;  2WAQ G;  1PH9 A;  4JI5 Q;  1MKH A;  4IFD G;  4A3G H;  4DR5 L;  1E3P A;  5IT9 c;  3I55 A;  4JI8 L;  1EIF A;  2NZO A;  4ALP A;  2UUC L;  4GKJ Q;  3S15 H;  3ZLM A;  4X2D A;  4OON A;  3K0X A;  4JOI C;  4LFA Q;  4LFC Q;  1MIU A;  1PH4 A;  2VL6 A;  1NJI C;  1M1K C;  3M7N A;  2JE6 I;  2N3S A;  3S1N H;  1H95 A;  2PNH A;  1HNW L;  4X62 Q;  3GD7 A;  4GN4 B;  4BXX G;  2UXD Q;  3KDF A;  2LXJ A;  3KFU A;  1QUQ A;  1X6O A;  2RHQ B;  3PCO B;  4H02 A;  5BR8 Q;  4DV0 L;  3S17 H;  2UUB L;  3T1Y Q;  1N34 Q;  1UE1 A;  2K5V A;  4R4C A;  1BBW A;  3HOX G;  2EIF A;  1HZ9 A;  2WAQ E;  5M3M H;  1FJG Q;  2JA8 G;  5FLM G;  2BA0 A;  4GKK Q;  4QL5 A;  3HOU G;  1VQP A;  3B6Y A;  4NB3 A;  3HOW H;  3PIO A;  3CC2 A;  3GTJ H;  1YI2 A;  2NVY H;  1UWV A;  2HIV A;  5AJ3 L;  4RG1 A;  1QVF A;  4DR7 L;  4HJ8 A;  4B3M L;  4LUV A;  4GLV B;  4APV A;  4PY3 A;  4X65 L;  2R7D A;  1A63 A;  1BVS A;  1VQ5 A;  1WJJ A;  2HIX A;  1UE5 A;  2HT1 A;  3K7A H;  4IJL A;  2QA4 A;  2WB1 G;  4IOA A;  5FJ8 H;  2DGY A;  4JBJ A;  4JI1 L;  1JE5 A;  3MEF A;  3CCU A;  4TQU S;  4UPA A;  3PUW A;  2E2J H;  4JBM A;  4BY7 H;  1EYG A;  3PV0 A;  5DLQ E;  4JCV E;  4DR2 L;  4JI3 Q;  3JC6 6;  1HNX Q;  3LGJ A;  5IP9 H;  1HJP A;  2ZTE A;  4DV4 L;  4IFD I;  4A3C H;  1Z9F A;  4GLA C;  1E22 A;  1BBU A;  1PYB A;  1XMO Q;  4BXX H;  4DR3 Q;  1KQS A;  4YWL A;  3CC4 A;  4DV7 L;  4A3I G;  2DUD A;  1U5K A;  2VQF L;  4DR4 L;  4HJ5 A;  4LFB Q;  4LF8 Q;  2R7F A;  3CXC A;  1JJC B;  2BA1 A;  3I4M H;  1XMQ Q;  4JI0 Q;  1NBW A;  1X55 A;  4U0U A;  1SLJ A;  1HZC A;  4XIG S;  4YCW A;  4HIM A;  3S1Q H;  3L0O A;  3GO5 A;  2VQE Q;  1N33 Q;  1B70 B;  4UP7 A;  5GAH C;  4U0Z A;  1TXY A;  1JJ2 A;  2Q2T A;  1CSP A;  3AYH B;  1Q86 C;  3NEL A;  3RZO H;  3VDY A;  4BA2 I;  5M5X H;  2CFM A;  4DV5 Q;  2R93 G;  2KCT A;  2IY5 B;  1VQE A;  2I5H A;  2WFW A;  4PZ6 A;  1GD7 A;  2B29 A;  1L1O C;  5C4J H;  4A3F G;  2JA5 G;  4NXM L;  5C44 G;  2R92 G;  1CSQ A;  4BY1 G;  4DV1 L;  4IFD J;  4X6A H;  1SFO H;  1G6P A;  1NY4 A;  3T1H Q;  4DUY L;  1NMF A;  1FL0 A;  4DV3 L;  3CCL A;  1KIX A;  1VQO A;  3SHG A;  1HR0 W;  4LF6 L;  4JBW A;  3E0E A;  4LF7 Q;  4RMF A;  5M5Y H;  1T9H A;  1PH2 A;  1HNZ Q;  3L7Z C;  3TS0 A;  1XNQ Q;  3KJO A;  1KHI A;  1UE7 A;  4JI4 L;  1E7Z A;  4DV6 L;  4A3G G;  2FXQ A;  3FHW A;  1N8R C;  4EQ5 A;  5LMU Q;  1VQH A;  1X3E A;  3CCJ A;  2KHI A;  4PMW A;  4QY7 A;  1VQA A;  4B3R L;  5JJI A;  3HKS A;  2JJQ A;  3BJU A;  4AQY Q;  4DR1 L;  4NXN Q;  3M9B A;  3ZJY C;  3ICE A;  4GS3 A;  3U4Z A;  2NVT H;  2Z0S A;  4GNX A;  1OXV A;  4JI7 L;  1KRS A;  4GOP C;  1Q1B A;  1I6H H;  3CUC A;  1CKM A;  1K0R A;  1Y1V H;  1IBM Q;  5M3M G;  1YHA A;  1XTD A;  3TEH B;  2B63 H;  2VNU D;  2CWP A;  4R4O A;  4JI2 L;  2ZTC A;  3HOW G;  1EUJ A;  4MTN A;  1J5E L;  5M3F H;  4IPD A;  1I5F A;  3A0J A;  2UU9 L;  2IX0 A;  1O7I A;  3LET A;  2CQO A;  3TRE A;  3RLF A;  4DV7 Q;  3PSI A;  4A3E H;  2UUA L;  1Q1E A;  4LWC A;  2ZJR A;  1EQR A;  5EAY A;  3UDX A;  1HR0 L;  3AFQ A;  4A3K H;  4DV2 Q;  4JI8 Q;  4LUO A;  5IP7 H;  2I0Q A;  5IYB H;  4KI0 A;  3NEN A;  5ELO A;  1EFW A;  3KF6 A;  1WI5 A;  2XGT A;  2VW9 A;  2OCE A;  2JEB I;  1K8G A;  3K80 C;  2K5H A;  2ZM6 L;  4KHP Q;  2UXC Q;  1NMG A;  4P75 A;  4C3H H;  1OXS C;  4X66 Q;  5FJ8 G;  3CCQ A;  1AE3 A;  4A3D H;  4YY3 Q;  3HOY H;  3FP9 A;  4JI6 L;  2AWN A;  1S72 A;  2VUM H;  4A3B H;  2K75 A;  3SE5 A;  3PUX A;  3RR5 A;  4BY7 G;  4K0K L;  5IWA Q;  4IPH A;  3G71 A;  1X54 A;  4JG2 A;  1HZA A;  2ASB A;  1VQ9 A;  2K50 A;  4PZ8 A;  1B8A A;  3CME A;  2PMZ E;  3F1Z A;  1RIP A;  4M16 A;  3NEM A;  4DPG A;  5IP9 G;  3ULP A;  3PO3 G;  1XPR A;  3SN9 A;  4OX9 L;  4LF9 Q;  3TS2 A;  4QIW E;  1YNX A;  1CKN B;  4XTC S;  4A3C G;  4C3I H;  2A1A A;  5JJ7 A;  4KHZ A;  2OQK A;  1X65 A;  4A75 A;  1D8L A;  2EQS A;  3ER0 A;  3UE0 A;  1AE2 A;  1N36 L;  3S24 A;  4DAM A;  1I94 Q;  4DR6 Q;  4FDB A;  1KC8 C;  2CCZ A;  4LUZ A;  4X64 L;  2JQO A;  5E7N A;  1GM5 A;  4B3S L;  1IYJ B;  1GVP A;  4YHH L;  4MZ9 A;  3ERS X;  3I4M G;  1SR3 A;  3RNU A;  1PYS B;  3JAM i;  4PG3 A;  4DAY B;  4LF5 Q;  5K36 G;  4WGJ A;  4OO1 G;  1IBK Q;  3S6A A;  3GTO H;  1UEB A;  1N9W A;  2MFI A;  3OTO L;  1YZ6 A;  4R4Q A;  2YV5 A;  4HIO A;  1VQB A;  5JEA G;  2VY3 A;  2ID0 A;  4C2M H;  5GQO A;  3CPW A;  5LMN Q;  1K73 C;  4LU4 A;  3PO2 H;  2B3G A;  5CGL A;  4UP8 A;  2IX1 A;  2K5N A;  3J81 i;  4JI5 L;  4B3T Q;  2UXB Q;  3K7U C;  4OWX B;  1K3R A;  4A4I A;  1CUK A;  1QUQ B;  4JYA Q;  5H1S E;  1JB7 A;  4YCU A;  4BA1 I;  1YIJ A;  1VQF A;  1PH3 A;  4GKJ L;  3H3V H;  3I56 A;  4LFC L;  1QVG A;  4LFA L;  4R4I A;  4AIM A;  2YU9 H;  2G03 A;  4GN5 A;  1E24 A;  1L1O A;  4X62 L;  2UXD L;  3TQY A;  1ASZ A;  1LM0 A;  5BR8 L;  1VS0 A;  1W2B A;  2E2H H;  1E1T A;  3T1Y L;  1N34 L;  1GKH A;  4YWK A;  1FJG L;  4XI8 A;  2I5L X;  2WB1 E;  4OWT B;  1E1O A;  4GKK L;  3EN2 A;  3S14 H;  1U0L A;  3A5U A;  3I2Z A;  4KLK A;  4DV3 Q;  4LF4 Q;  2JA7 H;  1Y1V G;  3BZC A;  4AYB G;  4U07 A;  1SE8 A;  4GN3 B;  2B63 G;  5ELN A;  4DUZ Q;  4O0A A;  2OTJ A;  3HKZ G;  2CKZ B;  5GAE C;  1K9M C;  5M3F G;  1Q12 A;  1V1Q A;  1YEZ A;  3CCR A;  3HOZ G;  4A3E G;  1EIY B;  1VQG A;  1AH9 A;  3DLL A;  4IJH A;  2AKW B;  3STB D;  4DK6 C;  5CKL A;  2OQ0 A;  4NPS A;  1SN8 A;  3H0G G;  1SMX A;  1VCI A;  2Y0S G;  3FKI H;  4A3K G;  1XNR Q;  5IP7 G;  2F4V Q;  4OO1 I;  1IZ6 A;  5IYB G;  4O2D A;  5IYD H;  1V43 A;  4JV5 Q;  4GOP A;  4HJ9 A;  3IRB A;  3AFP A;  2AHO B;  4DK3 C;  2N8N A;  4AYB E;  3HOV H;  2HQL A;  4A76 A;  2ALY B;  4A3D G;  1Q82 C;  4OWW B;  1PVO A;  3HKZ E;  5C3E H;  4JI3 L;  3HOY G;  1HNX L;  1TWG H;  5JFF A;  2R7Z H;  1PH8 A;  2VUM G;  2KEN A;  2JA9 A;  4QGU A;  4A3B G;  3D0F A;  2EXD A;  3PUZ A;  2K14 A;  3I4N H;  2GN5 A;  3TRZ A;  4LNQ A;  4WJ3 M;  1XMO L;  4X2C A;  1X3F A;  3L2P A;  3DM3 A;  1P8L A;  4DR3 L;  1MJE A;  1VQK A;  2Y0S E;  3J81 j;  2PI2 A;  2MO0 A;  1G29 1;  4LFB L;  4LF8 L;  1WCM H;  4BBS H;  2D0O A;  2UUA Q;  4HJ7 A;  3UE1 A;  5M5W H;  1XMQ L;  4JI0 L;  1VQN A;  1KRT A;  2Q2H A;  3RLN A;  2E5L Q;  4DNI A;  2VQE L;  1N33 L;  1TWH H;  2RCN A;  1X9N A;  4L5T A;  2HHH Q;  1VQD A;  4Y7N H;  1YJN A;  3F2B A;  3N3U A;  4DV5 L;  2MNA A;  1LUZ A;  1PH6 A;  1IBL Q;  3S2D H;  1TWF H;  4JI6 Q;  2BH8 A;  3W5O A;  1VQM A;  2KCM A;  1OTC A;  1YJ9 A;  3D31 A;  4DR5 Q;  1X56 A;  2R6G A;  3T1H L;  1OXT A;  1KAW A;  1V9P A;  2ZJQ A;  3S1M H;  1X3G A;  2UUC Q;  4LF7 L;  4A93 H;  1EWI A;  1I3Q H;  4JC0 A;  1HNZ L;  4OXP A;  3PO2 G;  2PQA B;  1XNQ L;  1HNW Q;  4P74 A;  3STB C;  2IHF A;  3W1B A;  4DV0 Q;  5JJK A;  1PA6 A;  5C0X G;  4GNX B;  1NE3 A;  2UUB Q;  4B3S Q;  4LW1 A;  5LMU L;  5IE8 A;  4HID A;  3SGI A;  3BZK A;  2NVQ H;  1CKN A;  4AQY L;  4NXN L;  3PGZ A;  3OW2 A;  3RN2 A;  1TWA H;  2C35 B;  3E9I A;  1YIT A;  2JA5 H;  2N49 A;  5IY0 A;  1M90 C;  2JEA I;  2R92 H;  1QVC A;  3CAM A;  1QZH A;  1L0W A;  3S2H H;  1GO3 E;  5AJ3 Q;  3BU2 A;  3KOJ A;  1Q46 A;  2K4K A;  5FLX c;  4B3M Q;  3G48 A;  1IBM L;  2LXK A;  2QEX A;  4X65 Q;  1K83 H;  4P72 A;  2YTV A;  4BBR H;  1Q81 C;  5GRO A;  5GAD C;  2IT1 A;  1KL9 A;  2PI2 E;  2GVA A;  1Y1W H;  1LYL A;  2IHE A;  3CP0 A;  4MNO A;  4JI1 Q;  2NN6 G;  2JK8 A;  3CCM A;  5IYC H;  2KHJ A;  3RN5 A;  3ULJ A;  3UDI A;  4DV2 L;  1K8A C;  4U04 A;  4P71 A;  2ZTD A;  1PV4 A;  1Q7Y C;  1PH1 A;  3EBE A;  2JA6 H;  4IOC A;  3CPF A;  4L5R C;  2Q2I A;  3RLO A;  3M4P A;  1I50 H;  4DR2 Q;  4KHP L;  2UXC L;  2CWA A;  3FKI G;  4DV4 Q;  1YBY A;  5IYD G;  4A3L H;  4X66 L;  5CMT A;  1N32 Q;  1C9O A;  2F52 A;  2E2I H;  1MJC A;  5C4X H;  2F6S A;  4YY3 L;  5LMN W;  4GLX A;  1PH7 A;  3U4V A;  1SRU A;  3K81 C;  3KYH C;  1FGU A;  2VQF Q;  3CCS A;  4A3J H;  3KDF B;  3HOV G;  5IWA L;  4DR4 Q;  1VQ8 A;  4QQB X;  4R4T A;  3JAM c;  2YTY A;  4HIK A;  2BH2 A;  2H5X A;  5C3E G;  3GTM H;  3RZD H;  3PIP A;  2YTX A;  2NVX H;  2R7Z G;  1EOV A;  3PUY A;  5C0X I;  4LF9 L;  3I4O A;  1VQ4 A;  3GTG H;  3ULL A;  3I4N G;  3ZC7 A;  4IPG A;  1D7Q A;  1TWC H;  1NTG A;  3EIV A;  4DKA C;  4QJF A;  4DR6 L; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...