2VZAA

Type iv secretion system effector protein bepa
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
TEIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPKAHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
molecule keywords CELL FILAMENTATION PROTEIN
source organism Bartonella henselae
molecule tags Cell adhesion
total genus 91
structure length 296
sequence length 296
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2vzaA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vzaA02
2VY3A 1Z47A 4L5TA 4U0SA 4QY7A 3HOWG 1K3RA 2IT1A 3W5OA 4B3TQ 4JOIA 2IHEA 4P74A 4PZ6A 4APVA 1NE3A 5M5YH 3CCSA 4HJAA 1V9PA 3S24A 1K73C 1S3OA 3HKZG 1IBKL 1YNXA 1W3SA 3CCQA 3TEHB 2K4KA 4GN5A 2NVTH 4WJ4A 2QA4A 1MKHA 2I5HA 1PH7A 2D0PA 2DUDA 4DR3L 4NPSA 4U04A 4RMFA 1EFWA 4DR1Q 3GTPH 4OWXB 2VQFQ 3S16H 2HIXA 2PMZE 4NXNL 4A93H 1KRSA 3MEFA 4IJLA 1N32L 4O0AA 1WOCA 1CKMA 4L5SA 1UEBA 2WB1G 2VUMH 5FJ8G 1TWHH 4KHZA 1FJGQ 3KF8B 3E0EA 5C3EG 1IXRA 3ULJA 4IOCA 3CP0A 5GADC 1SE8A 2EQSA 3HOWH 4DV6L 1XJVA 4LFCL 3WWVA 1UE5A 2CCZA 2NVYH 2XGTA 3DLLA 2NN6G 2VS1A 4A75A 4L5QA 2JEAI 1VQ5A 1LUZA 3M9BA 4A3BG 1PYBA 3KLWA 4P73A 3F2BA 1I5FA 4A3LG 2PQAA 3NEMA 1A63A 3U50C 1FGUA 4DK6C 4XTCS 2UUBQ 1SFOH 4A3JG 1M90C 3J7ZC 4UPAA 5IWAQ 1HNXL 4WGJA 4DV1Q 4LF5L 1T9HA 1VQ8A 4K0KQ 1AE2A 3JC66 3G4SA 4KHPL 5GROA 2N49A 4JI7L 1YITA 4LUZA 4UP9A 2CWPA 4IPGA 5FJ8H 1NMFA 2R7ZG 4GLXA 1VQKA 1N33L 1N32Q 4PMWA 5C3EH 4N67A 2JJQA 3PGZA 4QL5A 4OO1I 1P8LA 4MZ9A 2UXBL 3ULLA 1OXXK 1I94L 2ES2A 4QGUA 3CD6A 1CSQA 4GKKL 4DR5Q 1E7ZA 2HIVA 1K8AC 4B3SQ 4DAYB 1PYSB 1VQEA 1NY4A 1PH8A 4A3CH 4XIGS 4A3FG 2CWAA 3AYHB 2R6GA 4U07A 4DV6Q 4GOPB 1PH3A 1IBLQ 3S15H 4GS3A 4A3BH 1KAWA 4PY3A 4A3LH 1AE3A 3SGIA 5FLMG 4TVAB 4HJ9A 2VZAA 3T1YL 4JI4Q 1X65A 4UY8C 3GD7A 3M85A 3KJOA 2AMCB 3CXCA 4A3JH 1CKNB 2VW9A 4BXXG 3CQZH 5FLXc 4PZ8A 1YJNA 1VQDA 4JI1L 4GKJQ 4OONA 4GOPA 2IY5B 4LFAL 4X2EA 3K8AA 1XPUA 2R7ZH 4KHPQ 3RN5A 2N3SA 2K14A 2WAQG 5IP9G 1VQ4A 2OTJA 1I3QH 3CW2C 1QVCA 2LXJA 5C0XI 1V43A 2OCEA 1HJPA 2VL6A 1G291 2ZM6Q 4HIKA 1EWIA 3A5ZB 3KJPA 5JFFA 1N33Q 4X66Q 3PCOB 2MO1A 4HJ8A 2KCTA 2UXBQ 4AYBE 4A3FH 4DR6L 4GKKQ 3M4PA 2BH8A 3PF4A 4X6AH 1XMOQ 2GVBA 4B3MQ 4LU4A 2EXDA 2N78A 4KI0A 5FLMH 1QZHA 1KQSA 2ASBA 5HY6A 3J7A5 2IX1A 4LF4Q 4P75A 4JI2Q 2RHQB 4FDBA 2VQEL 4DV2Q 2YV5A 3I4NG 4BXXH 3I4OA 3ULPA 3SN9A 1IL2A 3G6EA 3ER0A 1Y1WH 1Q8KA 3W1BA 3IRBA 4A3KG 1N9WA 4IOAA 5E7NA 5IP9H 3LGJA 4DR7L 4DUZL 4UP8A 1U5KA 4LW1A 4LNQA 3PUYA 4JI5L 3K80C 4C2MH 1I50H 1HZBA 4MNOA 1XNQQ 3SE5A 4LF6L 2RF4A 2UU9Q 3CUCA 3B6YA 2K5NA 1IZ6A 3M7NA 3M3YH 1EUJA 1FL0A 5BR8L 3GTJH 3UDFA 2NVXH 2FXQA 3I7FA 3ZJYC 3GTQH 1OTCA 3S2HH 4JOIC 2AHOB 5JJ7A 2BA0A 3J81c 5LMNL 4X62L 3D0FA 1GD7A 1L2FA 1EIYB 4BA2I 2UXCL 4OX9L 4RG1A 3W1GA 3M4OH 2H5XA 1E22A 3GO5A 3PO3G 4R4IA 4A3KH 1GVPA 4ITRA 2JA5G 2UXDL 4ME3A 1SRUA 4LUVA 3U4ZA 2MNAA 5GAGC 4OWWB 2JE6I 1Q7YC 3UDXA 1YJ9A 4BY1G 3S1NH 2GVAA 3UDGA 2ALYB 1VQPA 1N8RC 4JI5Q 2NZOA 5ELNA 4HIOA 1JMCA 1HNXQ 1E1TA 1XMQQ 1OXSC 4BBSG 3I56A 1C0AA 5HGQA 4C3HH 2HHHL 3NENA 5M5WH 1D8LA 4P71A 4X64L 4POGA 2JA6G 4JI8L 1L1OA 2C35B 3JAMc 1LYLA 2AWOA 2F3IA 3G71A 1PH1A 3D31A 2E5LQ 3I2ZA 4LF7L 1NMGA 1OXUA 2F52A 4B3RL 2F6SA 2Y0SG 5ELOA 4JV5L 3L2PA 3K0XA 2PQAB 4YY3L 3BU2A 4JG2A 3RZDH 5IYCG 3RZOH 3GDEA 4LF9Q 4QJFA 4DV7Q 4IFDG 1J5EL 3PO3H 4A3DG 3EIVA 4X62Q 2K5VA 2VNUD 4J15A 2JA5H 1LM0A 2UXCQ 4BY7H 3DM3A 1VQ9A 3FP9A 4A3CG 1XTDA 2ID0A 4JYAL 4ALPA 2E2HH 5CGLA 3PIPA 3UE1A 4BY1H 1DGSA 4QQBX 1L0WA 3F2CA 1JJCB 1WYDA 3VDYA 1Q82C 3HOZH 2ZTCA 1IBKQ 4Y7NH 4YWKA 4LF8L 4BBSH 5DLQE 5LMUL 2K52A 4AIMA 1XPRA 2JA6H 4DR3Q 3CCVA 1MJCA 3HFZB 4R4CA 4JBWA 3OW2A 1TWFH 1KC8C 3CCMA 1EYGA 1C9OA 4OXPA 4YWMA 3RR5A 2E8GA 4NXNQ 1PHJA 2ZTEA 3S1RH 1VQGA 2JA7G 2OWOA 1K83H 4GN4B 4A76A 5IYCH 3GTMH 4JI3L 1PA6A 3RN2A 4YHHL 3AQQA 1TXYA 4A3DH 1MJEA 4YY3Q 4A3EG 3HKSA 1Y1VG 3FHWA 3ERSX 4H02A 1J5EQ 4AQYL 4GOPC 2UUAL 3TQYA 1YEZA 4X2CA 1S40A 4LFCQ 3HKZE 2MO0A 1X55A 3TS0A 3H3VI 1HNWL 3S14H 3ZC7A 3KF6A 2DGYA 1PH2A 4JYAQ 4DV3L 2G03A 4AH6A 4DUYL 4IFDJ 3CPFA 1HNZL 3J81i 3PUZA 4YCWA 3I4MG 1VQ7A 2HT1A 2ZJRA 4L5RC 4LWCA 4LF5Q 5IYBG 1Y1WG 4DR4L 2WB1E 2AKWB 1B7YB 1JJ2A 1GKHA 4JC0A 5IT9c 1EOVA 4JI7Q 2IHFA 4JBJA 2JA7H 5JJKA 2NZHA 3PSIA 3K81C 2Z0SA 4HJ5A 1KRTA 1J6QA 1D7QA 3LETA 2WFWA 2Q2TA 1H95A 3STBC 5IY0A 4A3EH 2KBNA 1YI2A 1K8GA 2LSSA 1Y1VH 2R93G 5K36G 2HQLA 4U0ZA 4YHHQ 1I94Q 1PH9A 4DV5L 1MIUA 1YBYA 3S6AA 2YYZA 3KDFA 3HOXG 2Q2UA 1QVFA 5IYDG 5EU0A 2B63G 4JI0L 3GTOH 1E1OA 4AQYQ 4IO9A 1X3GA 1PH4A 4U0UA 2Q2HA 3JAMi 3KFUA 1A0IA 5M5XH 5M3MG 1VQBA 4LUOA 1X6OA 3T1YQ 1EQQA 4A3GH 3I4MH 4R1JA 3T1HL 2CQOA 5IYBH 1WI5A 5CKLA 2MFIA 4OWTB 4OO1G 2A19A 1K0RA 3PIOA 1M1KC 4JI1Q 1N34L 2NVQH 1X9NA 3CMEA 1TWCH 4LFAQ 1YHAA 1PVOA 1YZ6A 2JK8A 2KENA 1Q86C 1WJJA 3PV0A 5GQOA 4JI6L 4Y52H 4PG3A 3STBD 5LMNW 1QUQB 1VQNA 2R93H 3CC7A 1Q1BA 2F4VL 1JB7A 3OTOL 3HOXH 4YCUA 3K7UC 4GLAC 2UUCL 5IYDH 2B63H 2A1AA 4DR6Q 1TWGH 2K5HA 3PF5A 4LFBL 2YTVA 4B3TL 3M4QA 2I5MX 4BBRG 5EAYA 4X65L 5M3MH 4EQ5A 4JI0Q 2JEBI 3RLFA 1QUQA 1NBWA 1HH2P 3SHGA 2Z6KA 3J80i 3ICEA 2VQEQ 5C0XG 2KHJA 3ZCBA 2OQKA 3AFPA 1PH5A 2NN6I 2OQ0A 4BY7G 1I6HH 2VQFL 3CPWA 1KXLA 1L1OC 1L1OB 3EBEA 1Z9FA 2K75A 1W2BA 4DKAC 3U58A 4DR7Q 4YCVA 4DUZQ 3FKIG 1G6PA 3H0GG 4DV4L 1PFSA 1ASYA 3H3VH 3HOZG 1KD1C 1VQJA 3S2DH 1QZGA 3UDIA 1C7YA 1FJGL 2EIFA 3RLOA 4HJ7A 5J3BA 3PUWA 4LF6Q 3CF5A 1IYJB 2Q2IA 3EN2A 4DV0L 4DR2L 4NXML 1YIJA 4NB3A 2PI2A 4X2DA 3OTOQ 5BR8Q 4BBRH 2CFMA 1OXVA 3I55A 2MQHA 1UE1A 4BA1I 3G48A 5JEAG 1K9MC 1A8VA 3CCEA 3CAMA 4X65Q 2RHSB 2WP8J 1OXTA 5LMNQ 3A5UA 2KCMA 5CMTA 2UUBL 2L15A 3E9HA 4A4IA 5IWAL 4DV1L 4OX9Q 3AEVA 4K0KL 1P16A 1YHQA 5AJ3L 2AWNA 4P72A 2UXDQ 1VQLA 3FKIH 3H0GH 3U4VA 5H1SE 3CMAA 5JFZA 1X56A 3CCJA 4A3IG 5C0XJ 5M3FH 1B8AA 4R4TA 2E2JH 2YU9H 2ATWA 2BH2A 1WFQA 1X3EA 4R4QA 4DV4Q 1JE5A 3TS2A 5JJLA 1XNRL 1X3FA 3MXNB 2XTIA 4DR5L 4GLVB 3A74A 4B3SL 2D62A 4DV0Q 4DR2Q 4X64Q 2HHHQ 4NXMQ 2GN5A 4JI8Q 3J80c 4JV5Q 3ZLMA 1QVGA 1IBLL 4IPDA 4LF7Q 2R7FA 1TWAH 5C4XG 3KF6B 1X54A 4B3RQ 2PI2E 4AYBG 1HZCA 3CCRA 4JBMA 4JI4L 1EQRA 5GAEC 3CCLA 1N36L 3HOVG 1VCIA 3AFQA 4LFBQ 1Y14B 4KLKA 3HOUG 3UE0A 1VQIA 4GKJL 2ZJPA 1Q81C 5JEAJ 1S72A 3K7AH 1UWVA 1FVIA 4A3IH 5C4JH 1HZAA 5AJ3Q 2D0OA 3L7ZC 2ZJQA 1AH9A 3S1MH 1VQFA 2ZM6L 4GNXC 4GNXB 3Q8DA 1VQ6A 3PUXA 4A3GG 4DAMA 1KIXA 2YTXA 5JJIA 1A62A 4X66L 1YVCA 1R9TH 4LF8Q 2JA8G 1G51A 3OYYA 3GTKH 1JT8A 4R4OA 5LMUQ 1HR0W 3PO2G 3CC2A 1IBML 2R92G 2Y0SE 3KDFB 4UP7A 2JQOA 4DPGA 4TQUS 4IPHA 3CC4A 1VQAA 1WCMG 1XNRQ 5C44G 1XMOL 4B3ML 5C4XH 2BA1A 3F2DA 1UE7A 1YHBA 2B3GA 4GNXA 3S17H 4C3IH 4DNIA 1KHIA 1XPOA 2PNHA 4LF4L 1GO3E 3HOVH 4C3JH 4DV2L 2I0QA 4JI2L 4JI3Q 1HR0L 2I5LX 4YWLA 2YTYA 1N36Q 3HOUH 1CUKA 4JCVE 3F8TA 1E24A 1RL2A 3H15A 1BVSA 2UUAQ 4XI8A 2V1CC 1B70B 4JBKA 1JJGA 4EX5A 1ASZA 1HNWQ 4DV3Q 1LTLA 1XNQL 1Q1EA 1E3PA 4DUYQ 2JA8H 1HNZQ 4DK3C 3PO2H 1CKNA 4M16A 2UU9L 2OTLA 4A3MG 2R92H 2B29A 3RLNA 1WCMH 2A8VA 3HOYG 5C44H 4DR4Q 1IBMQ 2K50A 1SROA 3BZKA 1NTGA 4HIMA 1Q12A 3RNUA 2JA9A 2KHIA 2RCNA 1BBUA 1Q46A 3J81j 1GM5A 2Z6KC 5IP7G 1SR3A 4QIWE 4IJHA 3PUVA 1HR0Q 3GTLH 1CSPA 3L0OA 1O7IA 4DV5Q 3BZCA 2E2IH 1SMXA 3E9IA 1BBWA 2IX0A 3KYHC 4MTNA 4IFDI 3NELA 1SLJA 4A3MH 1U0LA 5IE8A 3NBHB 2CKZB 1RIPA 5GAHC 2WAQE 2QEXA 3T1HQ 1XMQL 1NJIC 1SN8A 4DR1L 3HOYH 1HZ9A 1VQMA 3S1QH 4POFA 1BKBA 2ZTDA 1PH6A 1VQCA 3KOJA 1V1QA 1PV4A 1N34Q 2E5LL 3TRZA 4WJ3M 5JJ6A 1VQOA 4A93G 1EIFA 3BJUA 5IP7H 4JI6Q 5M3FG 4O2DA 2N8NA 1KL9A 3F1ZA 3CCUA 3N3UA 4GN3B 3TREA 2VUMG 2LXKA 4LF9L 3I4NH 1UE6A 4DV7L 3A0JA 4IPCA 1YJWA 2F4VQ 4HIDA 2R7DA 1VQHA 4PZ7A 2QGQA 2UUCQ 3GTGH 1CKOA 1VS0A
chains in the Genus database with same CATH superfamily
3HOWG 1HUNA 5KRUA 1K3RA 2IT1A 4LFBQ 1A6XA 4JOIA 1L0XB 2K5DA 4P74A 5M5YH 3CCSA 1C8CA 1QJOA 1FD7D 1K73C 1YNXA 1W3SA 2NVTH 1I6VC 2QA4A 2D0PA 3KBGA 1R4QB 4U04A 4RMFA 4OWXB 3FVQA 1AFPA 1KRSA 3MEFA 1F9RA 2CH4W 4IJLA 1WTPA 4M1UB 1GOZA 1HFGA 3QWNA 1NH1A 1V1OA 1O7YA 5I6WA 2MHVA 4JPBW 5FLXL 1MHWC 1ZXTA 5GADC 3HOWH 4DXGA 2QILA 2B2TC 1XJVA 2CCZA 1UE5A 2XRSD 2G9DA 3GTKB 4IUTA 3QJYA 3SR1A 1WTHA 4A3BG 4K6DA 1B1ZA 4P73A 2VXWA 3F2BA 4NP5A 3OMGA 2UUBQ 1SFOH 4A3JG 1M90C 4WGJA 1W6JA 4K0KQ 1Y1VB 4KHPL 5GROA 5J1ZA 1E2VA 2B2WA 4LUZA 2TSSA 5I6YA 1I4GA 1NMFA 2B39A 4G57A 4N67A 3T13A 4TRDA 5ELCA 1X32A 4OO1I 4CJ1B 1DZ1A 4QGUA 2B2UC 2CWAA 3G6JB 4RA8A 3S15H 4A3BH 2IL8A 4PY3A 1WCMB 5FLMG 4TVAB 5C44B 4HJ9A 3T1YL 2HCCA 2WIIB 4LJZC 1L0YB 3KJOA 4A3JH 1HTLD 1CKNB 4BXXG 3KLRA 5FLXc 1VQDA 4JI1L 5EKKA 4GKJQ 2AUJD 4LFAL 1NR4A 3DHQA 1QOHA 4XYQA 1I3QH 3EA6A 1ENFA 5C0XI 2ZM6Q 4HIKA 2OCEA 2VL6A 1EWIA 1NR2A 3KJPA 4U68A 4F88A 4PV1C 4AYBE 4DR6L 3M4PA 4OEMB 1S5CD 4X6AH 4B3MQ 2X69A 2EXDA 4ULLA 2N78A 5FLMH 3HOYB 2ASBA 3T51B 4HSVA 3I4NG 4BXXH 3I4OA 3ULPA 3H3VC 4HMJA 3KK7A 1PRTC 1Q8KA 4IUQA 2KECA 3W1BA 4KY5A 3IRBA 1N9WA 4DR7L 3LGJA 4DUZL 2LMCB 4LNQA 1LTTD 3NWTA 2K05A 1XNQQ 1HZBA 1TY0A 3A56A 3CUCA 2B2VA 1EY6A 5BR8L 3UDFA 4ZCKA 2MPMA 1U9RA 3BVMA 3M4YA 4XQJA 2AHOB 1XX8A 2BA0A 4MN3A 4IALA 4OX9L 2H5XA 3GO5A 2G5DA 4LUVA 2MNAA 3I91A 2JE6I 1HUMA 1NUCA 5D3IB 1DOLA 4KKTA 2ALYB 4HIOA 1V1PA 4N9TA 5NUCA 4QB4A 2HHHL 4X64L 1D8LA 4P71A 2JA6G 3I2ZA 1AP0A 5IGCA 1HCZA 3L2PA 5C4JB 4EGVA 5IYCG 2WB1B 1J5EL 3EIVA 1H9MA 1LM0A 1U4LA 5KNDA 5IT9L 3FP9A 4A3CG 2F0PA 4KHVA 3UE1A 1DGSA 1Q82C 2E76C 1LTID 3NE5B 1BBXC 2EYMA 5LMUL 2K52A 3KLSA 5IT9E 2JA6H 1GJXA 1KLGD 2SNSA 3CCMA 1EYGA 3VR3A 3MFYA 1PZKD 5IYCH 3RN2A 4YY3Q 3VYTA 3HKSA 4IUPA 3MZ5A 1DONA 2EYHA 1EYCA 3HKZE 4IQZA 1X55A 3H3VI 2ENBA 3S14H 2ZXPA 4DV3L 2G03A 1RF2D 4AH6A 2XIWA 4DUYL 2QDBA 2EJFC 1OO9B 1QWYA 4FXKC 2MUYA 1VQ7A 2HT1A 1F9PA 2ZJRA 4L5RC 4LWCA 3I90A 1Y1WG 3DUZA 2AKWB 5IGGA 5IT9c 1EOVA 3K6OA 2IHFA 2A68C 3AU7A 2NZHA 2PZUA 2RA4A 4HJ5A 2XWBB 1J6QA 3LETA 2WFWA 2Q2TA 1H95A 3STBC 2DNEA 5IY0A 5K36G 2EY1A 4YHHQ 4NMZA 3D3RA 4DV5L 1XTCD 3S6AA 1EY7A 3GTOH 5HGTA 1I4PA 5E4XA 4IO9A 1PTOC 3Q6SA 2Q2HA 1TR5A 5M5XH 1FR3A 3T1YQ 4A3GH 3T1HL 2ZT9C 1WI5A 2MFIA 4JI1Q 3NXWA 2IX3A 4G7OC 4LFAQ 4MIUA 3S1MB 1YHAA 3VA7A 1YZ6A 2KENA 1WJJA 4L6TB 2FMMA 1QUQB 5EQ0A 2PW5A 5LMNW 5K36H 2FFKB 1SNCA 2D9UA 1TQOA 1CHQD 4GLAC 1IW7C 3R93A 2A1AA 2XNAC 4DR6Q 4B3TL 2I5MX 4X65L 1F9QA 2OT2A 3GTPB 4JI0Q 1O7LA 3RLFA 3SHGA 3C1EA 3ND9A 1V1PB 2VUMB 2NUDA 1CM9A 5EPJA 3WDNA 3AFPA 2NN6I 2OQ0A 2VQFL 4DF7A 3CPWA 1KXLA 3DWPA 3WOFA 3PO3B 4DR7Q 4DUZQ 1HA6A 2BCOA 1WTRA 1MGSA 3H3VH 1QZGA 3UDIA 1FJGL 5J3BA 5JPMC 3CF5A 3EN2A 3FMCA 2PI2A 3OTOQ 1G6ZA 5BR8Q 3G48A 1K9MC 4KKUA 3D6CA 3CCEA 2RHSB 1TWFB 3HG9A 2CH4A 3BYYB 1SJED 2KJXA 2L15A 4A4IA 4OX9Q 4CDEC 3MAQA 1YHQA 4I7AA 4XT1B 1UEAB 3CMAA 4A3IG 1X56A 5C0XJ 1HQRD 2ATWA 4R4TA 4R4QA 1X3EA 4DV4Q 1JORA 5L37A 1H9KA 1X3FA 3MXNB 2XTIA 3W3AA 4DR5L 1D1IA 4GLVB 2HHHQ 4X64Q 3D6WA 1SYFA 4NXMQ 1QVGA 5KGUA 1IBLL 2EZVA 5C4XG 4X3KA 3QO2A 2PI2E 4JBMA 3VYRA 5D65A 1IYVA 1J8IA 3CCLA 1N36L 3HOVG 3K0YA 2XVSA 4Q0FA 3R8BA 3NQTA 3K5LA 1UWVA 1FVIA 4A3IH 1KDCA 1ENCA 3L7ZC 2A6HD 4GNXC 1VDZA 2YTXA 1R9TH 1JT8A 1BXTA 1DOMA 1EU3A 1RCVD 5LMUQ 1EIHA 3Q24A 2O5IC 1XNRQ 2JQOA 4TQUS 1C4QA 3I4MB 5C4XH 2PZTA 2F0NA 1S5DD 4GNXA 4LF4L 1EEID 1GO3E 3HOVH 4DV2L 2EOTA 2M00A 3LNNA 4JCVE 1RL2A 3GV6A 3H15A 1BVSA 1MI2A 1UAPA 2XN9C 2F0VA 3IFTA 1JJGA 1RD9D 2L9HA 3DWAA 3S2HB 4DV3Q 4DUYQ 3UI2A 2UU9L 2B29A 2K03A 3RLNA 2A8VA 4FNFA 4K2KA 1IBMQ 4H44C 4HIMA 1Q12A 4K2LA 3RNUA 4A3KB 1B50A 3V2TA 1PFNA 1TIID 1BBUA 1Q46A 3I72A 3R2TA 3D4RA 3NTKA 1A2UA 2PMZB 4DV5Q 1O7IA 2PCFB 2MJ8A 4KMUC 1EOTA 1SMXA 3SK6A 4R9WA 4IFDI 1G2SA 4DK0A 4RGMA 5IE8A 3T1HQ 1SN8A 5HURA 3U9SA 1BKBA 1PH6A 1VQCA 3TRZA 1HRJA 1STAA 1GHJA 3TP6A 2E5LL 5JJ6A 4BY7B 1EIFA 4O2DA 3TREA 2KCCA 4LF9L 4DV7L 3H0GB 2M2LA 4Y7NB 2TMPA 1VS0A 2VY3A 1K0SA 4B3TQ 1RODA 1NE3A 3HZXA 4H7BA 1H9RA 2RSOA 2H1EA 1V9PA 3RMHA 2R3ZA 1S3OA 4WJ4A 3TEHB 4GN5A 1K83B 2Z4IA 1TWAB 2I5HA 5IGEA 2DUDA 4A3DB 2LS01 1GXDC 1EFWA 3S16H 2VQFQ 2J4XA 1WOCA 4H13C 4L5SA 2NZ1D 1UEBA 5FJ8G 4J6HA 4H0LC 1TWHH 1FJGQ 5EJWA 4G4KA 3E6ZX 1RJTA 3ULJA 4ID6A 3ONAB 2F1MA 4LFCL 2XGTA 2L1BA 4A75A 1JWSD 5EKIA 1VQ5A 1LUZA 3KLWA 1GUOA 1I5FA 2DJFC 3NEMA 4C3JG 3U50C 4DK6C 2B2YC 4XTCS 4LF5L 4WJWA 2GA4B 1WTXA 3SK8A 1EY9A 1YNJC 4IPGA 5FJ8H 2R7ZG 4RGNA 1KNAA 4QL5A 4MZ9A 2AQ2B 3ULLA 4UDUC 1AZPA 3RD4A 2ES2A 4DR5Q 2ZXRA 4XIGS 3J7YW 3AYHB 3I73A 2R6GA 4U07A 5FO9B 4GOPB 4A3FG 4XT3B 1IBLQ 2R92B 2SEBD 5G3LF 2NVQB 1VMPA 2VZAA 4UY8C 3GD7A 3CXCA 4DNTB 2VW9A 3CQZH 3V96A 1CT1D 5JOBA 3EROA 3HOXB 3K8AA 3DEPA 2R7ZH 2K14A 4F7XA 3J81L 4KN4C 1HJPA 2J7ZA 3A5ZB 5TSSA 4HJ8A 2UXBQ 2EVBA 4A3FH 1ONLA 3N52A 3J81E 3PF4A 2GVBA 1E0BA 1KAAA 5EPLA 1JCKB 3S1QB 1B44D 1QCBD 4HEDA 2IJ0A 2PQEA 1IKLA 3J7A5 4LF4Q 5A2QL 2VQEL 4DV2Q 3T4AC 4FDBA 2ICEC 3SN9A 1RTOA 1WTOA 1LACA 1IL2A 3J7AV 4C3HG 1SAPA 3JAML 3E5SA 2QF7A 4EQPA 3MTSA 1U5KA 3GTGB 3PUYA 3K80C 3BDLA 3SE5A 4LF6L 2RF4A 2UU9Q 5M5YB 3JAME 3VR6A 1FL0A 3NK9A 4IUUA 2NVTB 2F0JA 3VA5A 5IIFA 3GTQH 1Y8OB 4JOIC 5C5LA 2EPBA 5JJ7A 3J81c 1B4OA 3VR4A 5LMNL 1GD7A 1F9SA 5M3FB 1EIYB 1EU4A 4RG1A 3M4OH 5LL6X 1E22A 4HN7A 2F0FA 4YIJA 2JA5G 2UXDL 4Z9CB 5GAGC 3J80L 3VYSA 5I2XA 1ILPA 4ZRZA 3Q0AA 5COYA 1N8RC 1JMCA 3NTIA 1E1TA 1OXSC 4BBSG 3I56A 4OIJA 3NENA 3J80E 1U4MA 4JI8L 3JAMc 3G71A 1PH1A 2E5LQ 3D31A 1SFOB 1OXUA 4FF2A 3SHLA 2Y0SG 4UHVA 4IUVA 3U9OA 4YY3L 4JG2A 2F0UA 3RZDH 5CV4A 4LF9Q 4QJFA 4DV7Q 2F0GA 3FEWX 2JA5H 2UXCQ 3TZDA 1CA5A 2B2WC 1S5BD 3SDZA 1GUWA 2E2HH 5CORA 1D1KA 3PIPA 4QQBX 1PXUA 2A6ED 3PIP3 1JJCB 3F2CA 3HOZH 2ZTCA 3QR8A 5CMDA 4BBSH 4LF8L 3S15B 4A3BB 3F2UA 1XPRA 3CCVA 4R4CA 3TSSA 1KC8C 1C9OA 4A3JB 4YWMA 1PYWD 2JA7G 1D2BA 5C3XA 3ERQA 4IUNA 4JI3L 4YHHL 3AQQA 1TXYA 5IGDA 4A3EG 2QEJC 2CVRA 1Y1VG 3FHWA 4LFCQ 1LTAD 1NCVA 3ZC7A 3KF6A 1RKNA 4IFDJ 4QIWB 3CPFA 1KNEA 4HTHA 3PUZA 1ZEQX 2IWHA 4ZLTF 1EY4A 3BDCA 4LF5Q 1CK1A 1B7YB 2WB1E 4LAAA 4JC0A 4JW0A 3GTLB 2ZXOA 5EPKA 2JA7H 4JBJA 2J0TD 3PSIA 1KRTA 2KOLA 2VB3X 2OF1A 2E2IB 5BN3A 4A3EH 1YI2A 4K8JA 2KBNA 1Y1VH 2WKDA 5ELFA 1PH9A 3M7GA 4A3MB 1MIUA 2BE5D 3KDFA 1QVFA 5EU0A 2B63G 4JI0L 1BUVT 5J39A 1X3GA 1AEXA 1ZYRC 5M3MG 3HP3A 2DY7A 5CR3A 2ICIA 4OWTB 2B2VC 4OO1G 3I4NB 1YNND 4OHJA 1SJHD 3PMFA 2K5WA 3CMEA 1TWCH 5G3LD 2JK8A 5ELDA 2EYLA 3BG3A 3E0JA 4PG3A 4Y52H 4XDXA 2NYZD 1VQNA 1DJRD 3CC7A 4FO2A 1JB7A 4QF4A 3OTOL 1SYGA 2OEOA 3A8JE 5KEEA 4OL7A 2B63H 1TWGH 1LT3D 2YTVA 3M4QA 4K5WA 5EAYA 5M3MH 4ABNA 1I4XA 1QUQA 4A93B 2VQEQ 5C0XG 4OO1H 5ELBA 3ZCBA 1PH5A 2HQEA 3NUCA 4RGTA 3NPPA 3U58A 1STNA 4DV4L 1ASYA 3A7AB 5EBDA 1C7YA 3S9WA 4LF6Q 4HMIA 2Q2IA 1F2YA 1EZ8A 4NXML 4NB3A 2PZWA 4X2DA 1HHVA 2MQHA 1EZ6A 1QNKA 2F0IA 1BCPD 1EY5A 2E75C 2EJGC 2JA6B 4KKSA 2WP8J 5C0XH 5LMNQ 1HXYD 5CMTA 2Q8IB 4HR7B 3K5NA 5IWAL 3AEVA 1GUGA 1NAPA 3NTHA 2G9HD 2KUMA 1DCZA 2UXDQ 3CRKC 4ODGA 5KNBA 5H1SE 5JFZA 3CKIB 2FMCA 2BH2A 1B8AA 1HQMC 3TS2A 3S14B 2NUNA 1XNRL 3MXPA 1TY2A 3A74A 4B3SL 4DV0Q 4K14A 4DR2Q 4KY6A 1J9OA 4JI8Q 4IPDA 5AFWA 3KF6B 1X54A 4C56C 4AYBG 2L0CA 3CCRA 4JI4L 1KABA 4KN7C 4C3IG 3OHXC 1IKMA 3MXNA 1QB5D 5D3DA 2JN4A 3BS1A 2ZJPA 5JEAJ 2BDNA 5JPNC 3K7AH 5C4JH 1HZAA 5AJ3Q 2ZJQA 1AH9A 1B3AA 1GUNA 3Q8DA 1VQ6A 1M4VA 1V8QA 4A3GG 3QIAA 4LF8Q 2JA8G 2QW7A 1HR0W 3MC0B 1IBML 1EY8A 3KDFB 4UP7A 3TZUA 4DPGA 3CC4A 1VQAA 2CHBD 1XMOL 2BA1A 3F2DA 3Q23A 1Y1WB 1VMCA 3S17H 4C3IH 1KHIA 1XPOA 2PNHA 2EDGA 4JI2L 4JI3Q 4YWLA 2EYPA 1SMYD 1CUKA 3F8TA 1BOSA 1EEFD 2F3VA 1MBYA 4WFN3 3D8GA 4RGOS 2Z1CA 4JBKA 2K6AA 4EX5A 3OIPA 1STHA 2NVXB 3MFGA 1FNVA 1STYA 5FOBB 1E3PA 2JA8H 3EVQA 1DM0B 3FDTA 4HCSA 2F0LA 4TSSA 5BN5A 5KYLA 3C3LA 1PRTF 1S5FD 1SROA 3E3XA 2JA9A 3EFXD 1CTMA 3P1HA 4KY7A 2KCNA 2F4IA 5IP7G 4ZUIA 2A69D 4IJHA 5ELEA 4DAPA 1CSPA 3S1NB 2PYKA 4MHEA 4CDCC 1PRTB 1HFNA 1BBWA 1TU2B 1PMRA 3KYHC 2CW0D 3A7LA 1RDPD 3VR2A 1U0LA 1M1KC 2WAQE 4N8FA 1HA5A 2QEXA 1NJIC 1K28A 2NTSA 4C1NI 2X6GA 4POFA 2IW3A 3BJUA 5IP7H 3F1ZA 1Q8IA 4GN3B 2VUMG 2LXKA 4S3SA 4BY1B 2QCPX 4HIDA 2R7DA 3H09A 3S1MH 4L5TA 4QY7A 2IHEA 3H6MA 4HJAA 4B08A 4RAUC 3S24A 5CC4A 4P2CB 3HKZG 3S1RB 1IBKL 1PH7A 3GTMB 4DR3L 4NPSA 1LLRD 2L5TA 4QUFA 3GTPH 2HIXA 2PMZE 3NP8A 4O0AA 1UUPA 1CKMA 2VUMH 1PZID 1QILA 4KHZA 4A3IB 5C3EG 1H9JA 1IXRA 3R2IA 4IOCA 3CP0A 4ZK9B 5DM63 2F0QA 2NVYH 3DLLA 2NN6G 1I4QA 2VS1A 4L5QA 3DEOA 4DK1A 5CBAE 2PQAA 3T16A 2K01A 1FGUA 5DEHA 3J7ZC 1I4RA 5IWAQ 5DM73 3HOVB 1AE2A 3JC66 3G4SA 2N49A 4DXFA 4JI7L 4UP9A 1WTVA 1R4PB 3A54A 2CWPA 3MHBA 3ZYYX 1VQKA 1N32Q 4PMWA 2Q8TA 5C3EH 3PGZA 2UXBL 1P8LA 2DNCA 1OXXK 4X3UA 1I94L 3TP5A 1CSQA 1G8ZD 2JP1A 1E7ZA 1K8AC 4B3SQ 1PYSB 2NN6H 1VQEA 1EL0A 1PH8A 1CQFA 3A8KE 4DV6Q 4KV6A 2D2CC 4O1NA 1KAWA 5FKAC 1AE3A 3QOLA 3SGIA 1BDOA 2K28A 2RDFA 4JI4Q 1X65A 2MGSA 2H4OA 2EYJA 1G2TA 2EYFA 2EY5A 1X3QA 2FJ2A 3D4WA 4OONA 4GOPA 2IY5B 5E3FA 2FHTA 3LX0A 3L3OC 5CBEE 1XPUA 3RN5A 2N3SA 2WAQG 1VQ4A 2OTJA 4E6IA 1QVCA 2LXJA 1V43A 3P7JA 5JFFA 1N33Q 2O5JC 3IAYA 5C5MA 4C1NK 1JC7A 1MSHA 1DXMA 2RQXA 4GKKQ 5CV8A 1XMOQ 1PFMA 3WOEA 4LU4A 1KQSA 1E2WA 1WD1A 5EBCA 2IX1A 1AZQA 4JI2Q 4XXEA 2YV5A 3HEJA 3LWUA 4KJOA 3S2DB 3ER0A 2EXZA 1JWUD 3K59A 4A3KG 3I4LA 4O42A 1SDFA 4LW1A 4C2MH 1I50H 4MNOA 1WVLA 1BNZA 4Q5VA 1PTOH 3B6YA 3FRPB 3M7NA 3M3YH 3GTJH 2FXQA 3I7FA 3ZJYC 2XWJB 3S2HH 5E4WC 2SDFA 2RCFA 2RDHA 3S16B 4QMGA 1F77A 1EY0A 1L2FA 4BA2I 2YU9B 2UXCL 2CQAA 1Q3LA 1PRTD 2LKVA 4R4IA 4A3KH 1GVPA 1TWHB 2E2DC 4OELB 4ME3A 5FK9C 1BO0A 1JOOA 3VR5A 1LV9A 1Q7YC 2GVAA 3UDGA 1VQPA 4JI5Q 2NZOA 4KJNA 2L55A 1C0AA 1A63A 5M5WH 4POGA 3DM1A 1L1OA 2C35B 4U673 2WACA 4JV5L 2F3IA 2DJGC 2F52A 4PMBA 5DAUA 4B3RL 4CJ2C 5F2DA 2F6SA 2PQAB 1HTPA 3BU2A 3RZOH 4IFDG 4A3DG 4OGQC 4X62Q 2K5VA 2VNUD 4R8IA 1I4HA 3MA2B 4BY7H 2HDMA 1EWHA 1RHPA 1SNQA 2ID0A 5CGLA 4XQQA 2VB2X 1O80A 1L0WA 1Z6HA 4NW2A 1GUSA 4Y7NH 1IBKQ 2QKIC 5DLQE 4AIMA 4C3JB 1NNXA 4ZAIA 1ZKOA 4DR3Q 1MJCA 3HFZB 3OW2A 3HOUB 3OOCA 3CQZB 1PHJA 3X3MA 1K83H 4GN4B 1PA6A 4IFDH 4A3DH 2R7ZB 1MJEA 1CZWA 3P20A 4H02A 2UUAL 1U4RA 2F0OA 2MO0A 1STEA 3MXGA 4JYAQ 4A3FB 4YCWA 4DU9A 4KD3A 4DR4L 2KHSA 5IYBG 1JJ2A 3W2DA 1EFID 1GKHA 2WINB 4JI7Q 1ET9A 5JJKA 3K81C 2KEEA 2F03A 2F0KA 2Z0SA 3OSOA 1D5ZC 2R93G 2HQLA 1S4ZA 1I94Q 1LT6D 3K58A 1YBYA 3HOXG 2Z4HA 2Q2UA 5IYDG 4HCEA 1STBA 1S5ED 1B53A 1E1OA 3SVMA 4AQYQ 4G7ZC 3K5OA 1PH4A 2HUGA 1A0IA 2F0EA 1VQBA 1X6OA 2CQOA 5IYBH 1K0RA 1F2LA 1W6KA 4X3TA 3PIOA 4HSPA 3PIO3 1N34L 2NVQH 1WTQA 2A68D 1X9NA 2RBMA 1UNSA 4C3HB 1BCPF 1DOKA 4JVZA 3M4OB 1PVOA 1C48A 5GQOA 1D5MC 3STBD 1KTKA 2R93H 1Q1BA 4B9XA 2F0HA 2KA7A 3HOXH 4YCUA 2NBFA 3K7UC 5IYDH 3PF5A 1PTOD 4BBRG 3NWSA 4JK1C 3MEHA 1BCPB 2Z6KA 3ICEA 4K6LA 2BDOA 1IHZA 4G7HC 4CBVA 1I6HH 1L1OB 3RZDB 1W2BA 1Z9FA 3HOWB 1KDAA 3FKIG 1LTSD 4CDFC 4CKCA 1PFSA 2JA5B 3HOZG 1KD1C 1VQJA 2EIFA 1SNMA 2LY7A 2HCIA 1E2ZA 3PUWA 1A15A 2PPBC 1IYJB 3T53B 4DV0L 1T5EA 2K33A 1IW7D 5M9OA 4DR2L 2E2HB 2O4XA 1YIJA 4BBRH 2F0WA 2CFMA 4BBSB 1UE1A 2LFNA 5ISRA 5JEAG 4RHSA 1A8VA 5LHY1 3CRLC 3A5UA 4FXDA 2KCMA 2Y0SB 5CV5A 1DYQA 3E9HA 3KBXA 4DV1L 5AJ3L 4P72A 4ZQ3A 5T1IA 3FKIH 1SYDA 3U4VA 5M3FH 2E2JH 2I46A 4F8MA 2A6HC 4ZKCB 5JJLA 2BOSA 3C1FA 2D62A 2GN5A 3J80c 5JEAH 4JV5Q 2C5CA 5IODA 2AQ3B 3OW7A 4B3RQ 1HZCA 1EQRA 3X3NA 2JA7B 5FLXE 3KF8A 3AFQA 1I3QB 1Y14B 4KLKA 1VQIA 3NHHA 4IURA 2B2TA 4A3EB 1S72A 1SNPA 2EJMA 2D0OA 5A35A 3FPPA 3DXJC 3PUXA 5JJIA 4DAMA 3P75A 1KIXA 4X66L 3GTKH 3OYYA 1ML0D 4R4OA 3CC2A 1K8OA 2A74C 4IPHA 1WCMG 5C44G 1UE7A 2B3GA 3TMEA 3AB9A 4DNIA 1LTBD 1TWCB 2YTYA 5EGTA 2B2UA 1E24A 5CV6A 2D5DA 4PMCA 2Z8LA 1SYEA 4DAYA 2UUAQ 3H94A 4XI8A 2V1CC 1B70B 1EQTA 1VF5C 1ASZA 5C3WA 1QNUA 2B63B 1TWGB 1LTLA 2A5HA 1Q1EA 1SEBD 4FP5D 3DMUA 4M16A 5M3MB 5KYIA 4A3MG 3KLSX 3OIQA 1WCMH 1KLUD 2DN8A 3BYTB 3SE0A 5C44H 3HOYG 4DR4Q 1NTGA 2HD3A 3H91A 4CKBA 2KHIA 3J81j 3I8ZA 4M8AA 2XSCA 1O7ZA 1PFBA 1XYIA 1HPCA 3EQLC 3PUVA 1HR0Q 3GTLH 4RKLA 1CQVA 4ME5A 2E2IH 3E9IA 4CKEA 2IX0A 3V05A 2F0SA 4MTNA 1AW7A 5I4DA 1QG7A 4L63B 5DNFA 4A3MH 5KIXA 4DGZA 1HNXL 2CKZB 1XMQL 3HOYH 4FF3A 3MWYW 3KUPA 3KOJA 1N34Q 1SBBB 4ZYSA 5CV7A 3SXHA 4A93G 1SNOA 2N8NA 1KL9A 3N3UA 3I4NH 3A0JA 1JICA 5FO8B 1YJWA 1VQHA 1A3TA 4PZ7A 2QGQA 5T1GA 1Z47A 1Y8PB 4U0SA 2EY6A 3W5OA 4PZ6A 4APVA 4DAVA 3OPOA 3K57A 1TS3A 3CCQA 2K7VA 2K4KA 1SE4A 1MKHA 2KVMA 4DR1Q 4NXNL 4A93H 4GZYC 1N32L 4N8X1 4DA2A 5CYUA 2WB1G 3IKJA 1ICFB 3K7AB 2P5ZX 3KF8B 3E0EA 5C4HA 1SE8A 2EQSA 4DV6L 3WWVA 2JEAI 3SK5A 3N6RA 5E1FA 3M9BA 1PYBA 1TS4A 4A3LG 2EE1A 4AYBB 2FINB 4WORA 4C3IB 3S17B 4UPAA 1F2MA 4DV1Q 1T9HA 1VQ8A 4DNRB 2F0DA 1LTRD 3PQIA 1YITA 1A3UA 2I07B 4PNYA 1B2TA 2NWGA 3GTOB 4GLXA 1N33L 2JJQA 5M5XB 3CD6A 4GKKL 1Z7TA 4A3GB 1JB3A 3GP7A 4CJ0B 5K5PA 2HIVA 4DAYB 2JA8B 1NY4A 4A3CH 1PH3A 1JOKA 4FF4A 1TKWB 4GS3A 1SXTA 4A3LH 4KK7A 2HDLA 3GQBA 4ILWA 3M85A 2AMCB 1O78A 2JXMB 4IN3A 2L12A 4K5XA 3GV3A 4PZ8A 1ESFA 1YJNA 2SOBA 5J22A 5IOCA 1ILQA 1YNJD 4X2EA 1FGBD 4XYOA 4KHPQ 5IP9G 3CW2C 2K32A 1G291 4KTAA 1B9MA 4X66Q 3PCOB 2X6LA 2MO1A 2KCTA 2NUCA 2F0MA 2BH8A 1SYCA 3IL8A 1B9NA 3HS0C 4KI0A 5C6AA 1QZHA 5HY6A 1JR0D 4P75A 2RHQB 5KNCA 1ET6A 3G6EA 3O13A 4NKLA 1Y1WH 1T5XD 4IOAA 5E7NA 5IP9H 3NQIA 1LT4D 3R3OA 4UP8A 1D5XC 1PZJD 2AQ1B 2B8GA 4JI5L 2K1BA 2K5NA 1IZ6A 1MSGA 3I3CA 1EUJA 3BVZA 2K5QA 2NVXH 1OTCA 2RSNA 3ITPA 4X62L 3D0FA 1EYAA 4EVOA 3W1GA 3PO3G 1JOQA 2L11A 2XRQD 4ITRA 2R61A 1SRUA 3U4ZA 4OWWB 5CGKA 1LO5D 3QB3A 3UDXA 1YJ9A 4BY1G 1SNDA 2A6EC 3S1NH 2NVYB 4BS9A 3BZDB 5ELNA 1SSOA 1HNXQ 3CHBD 1XMQQ 1II3A 4FF1A 3HKZB 4FVMA 5HGQA 1LYLA 2AWOA 1ENAA 4LF7L 1NMGA 4RCNA 5ELOA 3K0XA 1EYDA 1A3VA 3GDEA 3PO3H 4J15A 2B8FA 5C3EB 3DM3A 2Z9HA 1R9TB 4IZ8A 1VQ9A 2QDLA 1XTDA 4N9PA 4JYAL 3K5MA 4ALPA 4RHRA 1BR9A 1F2ZA 4BY1H 5C4XB 1WYDA 3VDYA 5FO7B 4YWKA 3TBIB 4PQXA 2RKSA 4JBWA 1CHPD 1TWFH 4ZUJA 4OXPA 3RR5A 2E8GA 4NXNQ 2ZTEA 3S1RH 1VQGA 3OWFA 2OWOA 1FNUA 4A76A 1CZGA 3GTMH 4QCLA 5JJZA 5I2YA 3ERSX 4DFAA 1J5EQ 4AQYL 4GOPC 3TQYA 2BE5C 1PLFA 1YEZA 4QUCA 4X2CA 1S40A 1GHKA 1H9SA 3TS0A 3C46A 1HNWL 1Y8NB 1LABA 2N88A 2DGYA 1PH2A 4V190 3BVGA 4TKOB 2MP1A 1HNZL 3J81i 3I4MG 1B3QA 1WD0A 2K04A 4I7ZC 1YNNC 1PTOF 5JAVA 4RFBA 1D7QA 3SEBA 2WAQB 1K8GA 3ND8A 1Q90A 2LSSA 4BWGB 2M9VA 4U0ZA 1K8MA 1BF4A 2YYZA 4RCOA 3VYUA 4C2MB 1I50B 1TT2A 2RDGA 1IYUA 1PTOB 4U0UA 2SNMA 4NDXA 3M3YB 3JAMi 3KFUA 3GTJB 4LUOA 1EQQA 3I4MH 4CGYB 4R1JA 4B9WA 5CKLA 2A19A 5JVH3 1CI3M 2V4DA 4UAIA 4FYDA 1Q86C 4JI6L 2JYOA 3PV0A 4ZKBB 2F4VL 4LMQD 2UUCL 3EJIA 2NB0A 3FPUB 2K5HA 4LFBL 1JQYD 1ZYRD 4DN4M 4EQ5A 2JEBI 1BCPC 5M5WB 1TS2A 1NBWA 1HH2P 3J80i 1TS5A 3BDOA 3NBIA 2JSOA 1IL8A 3LWEA 1TVXA 2KHJA 2OQKA 4BY7G 1EQVA 1L1OC 2C9OA 3RZOB 1STGA 3EBEA 1FNWA 2K75A 4DKAC 2IPKD 4YCVA 1G6PA 3G7LA 3H0GG 1A2TA 3S2DH 3HGBA 2PW7A 3RLOA 4HJ7A 1XWEA 3NBHA 5I9PA 4XQNA 3A8IE 3QG1A 3IFDA 4EQOA 3I55A 1OXVA 3L9AX 2O2LD 4J8QA 4BA1I 4KD4A 3CAMA 4X65Q 3MXUA 1OXTA 4X3SA 1K3BC 4WRDA 4F87A 2L4NA 3URYA 2UUBL 4LK1C 4RKBA 4RWSC 4K0KL 1P16A 2DY8A 2AWNA 3DWQA 1SE3A 4CHTB 1JWMD 1Y69U 1VQLA 1LT5D 3H0GH 3TP8A 5BN4A 1JE4A 2N55A 3CCJA 3J7AF 2AUKA 2A73B 2YU9H 5LL6S 1WFQA 1D6EC 1JE5A 2EYOA 4J1MA 3HRZC 1GUTA 3SK4A 1LTGD 5IGFA 1KDBA 1H9SB 3TP7A 3ZLMA 4LF7Q 2R7FA 1TWAH 1VF7A 1NSNS 3AMUA 2WV6D 2F0TA 5GAEC 4K8IA 1RTNA 4CDDC 1VCIA 2F3WA 1SMYC 3HOUG 3UE0A 1U4PA 3MVVA 4GKJL 1Q81C 1MD2D 3CU7A 2E74C 3I70A 1VQFA 1EIGA 2WKCA 2ZM6L 1CA6A 4GNXB 3C2PA 3QOJA 1A62A 1YVCA 1G51A 1AN8A 2B2YA 3PO2G 1X3PA 2R92G 2Y0SE 1EWCA 5C4ZA 4MTKA 4B3ML 3T56B 1YHBA 4C3JH 2I0QA 2PNRC 1HR0L 2I5LX 2OXPA 1N36Q 3HOUH 2A69C 1PDQA 4RH6A 1DD2A 2R93B 4K5VA 1HNWQ 3D4DA 1BQQT 3GTQB 4R8NA 1XNQL 1XXGA 2CW0C 1HNZQ 4DK3C 1ESRA 3PO2H 1CKNA 1FYCA 5EKLA 2OTLA 2R92H 1G91A 3PO2B 2EY2A 1M8AA 3TDQA 1QE6A 3RUZA 2K50A 3BZKA 2NTTA 2Q8RE 4HAEA 5I9OA 1SYBA 2RCNA 4I65A 1I6HB 1GM5A 2Z6KC 1SR3A 1WTWA 4QIWE 2KEDA 2KQ3A 5JVG3 4OIKA 3OWEB 3L0OA 3BZCA 5IGBA 3TN2A 3Q22A 1SE2A 5A2QE 3NELA 4FXGC 4BBRB 1CFMA 1SLJA 1ICWA 3NSWA 3NBHB 1RIPA 5GAHC 2PO4A 3S1QH 4DR1L 1HZ9A 1VQMA 3A55A 2ZTDA 1PV4A 1V1QA 4WJ3M 5CV9A 5D14A 4V0BA 1VQOA 4EQNA 4JI6Q 5M3FG 3CCUA 4L8JA 2Z6BA 3FKIB 1UE6A 3OMCA 4IPCA 2F4VQ 3HOZB 2RVLA 4C3HH 2E2JB 2UUCQ 3GTGH 1CKOA
chains in the Genus database with same CATH topology
2VY3A 1Z47A 4L5TA 4U0SA 4QY7A 3HOWG 1K3RA 2IT1A 3W5OA 4B3TQ 4JOIA 2IHEA 4P74A 4PZ6A 4APVA 1NE3A 5M5YH 3CCSA 4HJAA 1V9PA 3S24A 1K73C 1S3OA 3HKZG 1IBKL 1YNXA 1W3SA 3CCQA 3TEHB 2K4KA 4GN5A 2NVTH 4WJ4A 2QA4A 1MKHA 2I5HA 1PH7A 2D0PA 2DUDA 4DR3L 4NPSA 4U04A 4RMFA 1EFWA 4DR1Q 3GTPH 4OWXB 2VQFQ 3S16H 2HIXA 2PMZE 4NXNL 4A93H 1KRSA 3MEFA 4IJLA 1N32L 4O0AA 1WOCA 1CKMA 4L5SA 1UEBA 2WB1G 2VUMH 5FJ8G 1TWHH 4KHZA 1FJGQ 3KF8B 3E0EA 5C3EG 1IXRA 3ULJA 4IOCA 3CP0A 5GADC 1SE8A 2EQSA 3HOWH 4DV6L 1XJVA 4LFCL 3WWVA 1UE5A 2CCZA 2NVYH 2XGTA 3DLLA 2NN6G 2VS1A 4A75A 4L5QA 2JEAI 1VQ5A 1LUZA 3M9BA 4A3BG 1PYBA 3KLWA 4P73A 3F2BA 1I5FA 4A3LG 2PQAA 3NEMA 1A63A 3U50C 1FGUA 4DK6C 4XTCS 2UUBQ 1SFOH 4A3JG 1M90C 3J7ZC 4UPAA 5IWAQ 1HNXL 4WGJA 4DV1Q 4LF5L 1T9HA 1VQ8A 4K0KQ 1AE2A 3JC66 3G4SA 4KHPL 5GROA 2N49A 4JI7L 1YITA 4LUZA 4UP9A 2CWPA 4IPGA 5FJ8H 1NMFA 2R7ZG 4GLXA 1VQKA 1N33L 1N32Q 4PMWA 5C3EH 4N67A 2JJQA 3PGZA 4QL5A 4OO1I 1P8LA 4MZ9A 2UXBL 3ULLA 1OXXK 1I94L 2ES2A 4QGUA 3CD6A 1CSQA 4GKKL 4DR5Q 1E7ZA 2HIVA 1K8AC 4B3SQ 4DAYB 1PYSB 1VQEA 1NY4A 1PH8A 4A3CH 4XIGS 4A3FG 2CWAA 3AYHB 2R6GA 4U07A 4DV6Q 4GOPB 1PH3A 1IBLQ 3S15H 4GS3A 4A3BH 1KAWA 4PY3A 4A3LH 1AE3A 3SGIA 5FLMG 4TVAB 4HJ9A 2VZAA 3T1YL 4JI4Q 1X65A 4UY8C 3GD7A 3M85A 3KJOA 2AMCB 3CXCA 4A3JH 1CKNB 2VW9A 4BXXG 3CQZH 5FLXc 4PZ8A 1YJNA 1VQDA 4JI1L 4GKJQ 4OONA 4GOPA 2IY5B 4LFAL 4X2EA 3K8AA 1XPUA 2R7ZH 4KHPQ 3RN5A 2N3SA 2K14A 2WAQG 5IP9G 1VQ4A 2OTJA 1I3QH 3CW2C 1QVCA 2LXJA 5C0XI 1V43A 2OCEA 1HJPA 2VL6A 1G291 2ZM6Q 4HIKA 1EWIA 3A5ZB 3KJPA 5JFFA 1N33Q 4X66Q 3PCOB 2MO1A 4HJ8A 2KCTA 2UXBQ 4AYBE 4A3FH 4DR6L 4GKKQ 3M4PA 2BH8A 3PF4A 4X6AH 1XMOQ 2GVBA 4B3MQ 4LU4A 2EXDA 2N78A 4KI0A 5FLMH 1QZHA 1KQSA 2ASBA 5HY6A 3J7A5 2IX1A 4LF4Q 4P75A 4JI2Q 2RHQB 4FDBA 2VQEL 4DV2Q 2YV5A 3I4NG 4BXXH 3I4OA 3ULPA 3SN9A 1IL2A 3G6EA 3ER0A 1Y1WH 1Q8KA 3W1BA 3IRBA 4A3KG 1N9WA 4IOAA 5E7NA 5IP9H 3LGJA 4DR7L 4DUZL 4UP8A 1U5KA 4LW1A 4LNQA 3PUYA 4JI5L 3K80C 4C2MH 1I50H 1HZBA 4MNOA 1XNQQ 3SE5A 4LF6L 2RF4A 2UU9Q 3CUCA 3B6YA 2K5NA 1IZ6A 3M7NA 3M3YH 1EUJA 1FL0A 5BR8L 3GTJH 3UDFA 2NVXH 2FXQA 3I7FA 3ZJYC 3GTQH 1OTCA 3S2HH 4JOIC 2AHOB 5JJ7A 2BA0A 3J81c 5LMNL 4X62L 3D0FA 1GD7A 1L2FA 1EIYB 4BA2I 2UXCL 4OX9L 4RG1A 3W1GA 3M4OH 2H5XA 1E22A 3GO5A 3PO3G 4R4IA 4A3KH 1GVPA 4ITRA 2JA5G 2UXDL 4ME3A 1SRUA 4LUVA 3U4ZA 2MNAA 5GAGC 4OWWB 2JE6I 1Q7YC 3UDXA 1YJ9A 4BY1G 3S1NH 2GVAA 3UDGA 2ALYB 1VQPA 1N8RC 4JI5Q 2NZOA 5ELNA 4HIOA 1JMCA 1HNXQ 1E1TA 1XMQQ 1OXSC 4BBSG 3I56A 1C0AA 5HGQA 4C3HH 2HHHL 3NENA 5M5WH 1D8LA 4P71A 4X64L 4POGA 2JA6G 4JI8L 1L1OA 2C35B 3JAMc 1LYLA 2AWOA 2F3IA 3G71A 1PH1A 3D31A 2E5LQ 3I2ZA 4LF7L 1NMGA 1OXUA 2F52A 4B3RL 2F6SA 2Y0SG 5ELOA 4JV5L 3L2PA 3K0XA 2PQAB 4YY3L 3BU2A 4JG2A 3RZDH 5IYCG 3RZOH 3GDEA 4LF9Q 4QJFA 4DV7Q 4IFDG 1J5EL 3PO3H 4A3DG 3EIVA 4X62Q 2K5VA 2VNUD 4J15A 2JA5H 1LM0A 2UXCQ 4BY7H 3DM3A 1VQ9A 3FP9A 4A3CG 1XTDA 2ID0A 4JYAL 4ALPA 2E2HH 5CGLA 3PIPA 3UE1A 4BY1H 1DGSA 4QQBX 1L0WA 3F2CA 1JJCB 1WYDA 3VDYA 1Q82C 3HOZH 2ZTCA 1IBKQ 4Y7NH 4YWKA 4LF8L 4BBSH 5DLQE 5LMUL 2K52A 4AIMA 1XPRA 2JA6H 4DR3Q 3CCVA 1MJCA 3HFZB 4R4CA 4JBWA 3OW2A 1TWFH 1KC8C 3CCMA 1EYGA 1C9OA 4OXPA 4YWMA 3RR5A 2E8GA 4NXNQ 1PHJA 2ZTEA 3S1RH 1VQGA 2JA7G 2OWOA 1K83H 4GN4B 4A76A 5IYCH 3GTMH 4JI3L 1PA6A 3RN2A 4YHHL 3AQQA 1TXYA 4A3DH 1MJEA 4YY3Q 4A3EG 3HKSA 1Y1VG 3FHWA 3ERSX 4H02A 1J5EQ 4AQYL 4GOPC 2UUAL 3TQYA 1YEZA 4X2CA 1S40A 4LFCQ 3HKZE 2MO0A 1X55A 3TS0A 3H3VI 1HNWL 3S14H 3ZC7A 3KF6A 2DGYA 1PH2A 4JYAQ 4DV3L 2G03A 4AH6A 4DUYL 4IFDJ 3CPFA 1HNZL 3J81i 3PUZA 4YCWA 3I4MG 1VQ7A 2HT1A 2ZJRA 4L5RC 4LWCA 4LF5Q 5IYBG 1Y1WG 4DR4L 2WB1E 2AKWB 1B7YB 1JJ2A 1GKHA 4JC0A 5IT9c 1EOVA 4JI7Q 2IHFA 4JBJA 2JA7H 5JJKA 2NZHA 3PSIA 3K81C 2Z0SA 4HJ5A 1KRTA 1J6QA 1D7QA 3LETA 2WFWA 2Q2TA 1H95A 3STBC 5IY0A 4A3EH 2KBNA 1YI2A 1K8GA 2LSSA 1Y1VH 2R93G 5K36G 2HQLA 4U0ZA 4YHHQ 1I94Q 1PH9A 4DV5L 1MIUA 1YBYA 3S6AA 2YYZA 3KDFA 3HOXG 2Q2UA 1QVFA 5IYDG 5EU0A 2B63G 4JI0L 3GTOH 1E1OA 4AQYQ 4IO9A 1X3GA 1PH4A 4U0UA 2Q2HA 3JAMi 3KFUA 1A0IA 5M5XH 5M3MG 1VQBA 4LUOA 1X6OA 3T1YQ 1EQQA 4A3GH 3I4MH 4R1JA 3T1HL 2CQOA 5IYBH 1WI5A 5CKLA 2MFIA 4OWTB 4OO1G 2A19A 1K0RA 3PIOA 1M1KC 4JI1Q 1N34L 2NVQH 1X9NA 3CMEA 1TWCH 4LFAQ 1YHAA 1PVOA 1YZ6A 2JK8A 2KENA 1Q86C 1WJJA 3PV0A 5GQOA 4JI6L 4Y52H 4PG3A 3STBD 5LMNW 1QUQB 1VQNA 2R93H 3CC7A 1Q1BA 2F4VL 1JB7A 3OTOL 3HOXH 4YCUA 3K7UC 4GLAC 2UUCL 5IYDH 2B63H 2A1AA 4DR6Q 1TWGH 2K5HA 3PF5A 4LFBL 2YTVA 4B3TL 3M4QA 2I5MX 4BBRG 5EAYA 4X65L 5M3MH 4EQ5A 4JI0Q 2JEBI 3RLFA 1QUQA 1NBWA 1HH2P 3SHGA 2Z6KA 3J80i 3ICEA 2VQEQ 5C0XG 2KHJA 3ZCBA 2OQKA 3AFPA 1PH5A 2NN6I 2OQ0A 4BY7G 1I6HH 2VQFL 3CPWA 1KXLA 1L1OC 1L1OB 3EBEA 1Z9FA 2K75A 1W2BA 4DKAC 3U58A 4DR7Q 4YCVA 4DUZQ 3FKIG 1G6PA 3H0GG 4DV4L 1PFSA 1ASYA 3H3VH 3HOZG 1KD1C 1VQJA 3S2DH 1QZGA 3UDIA 1C7YA 1FJGL 2EIFA 3RLOA 4HJ7A 5J3BA 3PUWA 4LF6Q 3CF5A 1IYJB 2Q2IA 3EN2A 4DV0L 4DR2L 4NXML 1YIJA 4NB3A 2PI2A 4X2DA 3OTOQ 5BR8Q 4BBRH 2CFMA 1OXVA 3I55A 2MQHA 1UE1A 4BA1I 3G48A 5JEAG 1K9MC 1A8VA 3CCEA 3CAMA 4X65Q 2RHSB 2WP8J 1OXTA 5LMNQ 3A5UA 2KCMA 5CMTA 2UUBL 2L15A 3E9HA 4A4IA 5IWAL 4DV1L 4OX9Q 3AEVA 4K0KL 1P16A 1YHQA 5AJ3L 2AWNA 4P72A 2UXDQ 1VQLA 3FKIH 3H0GH 3U4VA 5H1SE 3CMAA 5JFZA 1X56A 3CCJA 4A3IG 5C0XJ 5M3FH 1B8AA 4R4TA 2E2JH 2YU9H 2ATWA 2BH2A 1WFQA 1X3EA 4R4QA 4DV4Q 1JE5A 3TS2A 5JJLA 1XNRL 1X3FA 3MXNB 2XTIA 4DR5L 4GLVB 3A74A 4B3SL 2D62A 4DV0Q 4DR2Q 4X64Q 2HHHQ 4NXMQ 2GN5A 4JI8Q 3J80c 4JV5Q 3ZLMA 1QVGA 1IBLL 4IPDA 4LF7Q 2R7FA 1TWAH 5C4XG 3KF6B 1X54A 4B3RQ 2PI2E 4AYBG 1HZCA 3CCRA 4JBMA 4JI4L 1EQRA 5GAEC 3CCLA 1N36L 3HOVG 1VCIA 3AFQA 4LFBQ 1Y14B 4KLKA 3HOUG 3UE0A 1VQIA 4GKJL 2ZJPA 1Q81C 5JEAJ 1S72A 3K7AH 1UWVA 1FVIA 4A3IH 5C4JH 1HZAA 5AJ3Q 2D0OA 3L7ZC 2ZJQA 1AH9A 3S1MH 1VQFA 2ZM6L 4GNXC 4GNXB 3Q8DA 1VQ6A 3PUXA 4A3GG 4DAMA 1KIXA 2YTXA 5JJIA 1A62A 4X66L 1YVCA 1R9TH 4LF8Q 2JA8G 1G51A 3OYYA 3GTKH 1JT8A 4R4OA 5LMUQ 1HR0W 3PO2G 3CC2A 1IBML 2R92G 2Y0SE 3KDFB 4UP7A 2JQOA 4DPGA 4TQUS 4IPHA 3CC4A 1VQAA 1WCMG 1XNRQ 5C44G 1XMOL 4B3ML 5C4XH 2BA1A 3F2DA 1UE7A 1YHBA 2B3GA 4GNXA 3S17H 4C3IH 4DNIA 1KHIA 1XPOA 2PNHA 4LF4L 1GO3E 3HOVH 4C3JH 4DV2L 2I0QA 4JI2L 4JI3Q 1HR0L 2I5LX 4YWLA 2YTYA 1N36Q 3HOUH 1CUKA 4JCVE 3F8TA 1E24A 1RL2A 3H15A 1BVSA 2UUAQ 4XI8A 2V1CC 1B70B 4JBKA 1JJGA 4EX5A 1ASZA 1HNWQ 4DV3Q 1LTLA 1XNQL 1Q1EA 1E3PA 4DUYQ 2JA8H 1HNZQ 4DK3C 3PO2H 1CKNA 4M16A 2UU9L 2OTLA 4A3MG 2R92H 2B29A 3RLNA 1WCMH 2A8VA 3HOYG 5C44H 4DR4Q 1IBMQ 2K50A 1SROA 3BZKA 1NTGA 4HIMA 1Q12A 3RNUA 2JA9A 2KHIA 2RCNA 1BBUA 1Q46A 3J81j 1GM5A 2Z6KC 5IP7G 1SR3A 4QIWE 4IJHA 3PUVA 1HR0Q 3GTLH 1CSPA 3L0OA 1O7IA 4DV5Q 3BZCA 2E2IH 1SMXA 3E9IA 1BBWA 2IX0A 3KYHC 4MTNA 4IFDI 3NELA 1SLJA 4A3MH 1U0LA 5IE8A 3NBHB 2CKZB 1RIPA 5GAHC 2WAQE 2QEXA 3T1HQ 1XMQL 1NJIC 1SN8A 4DR1L 3HOYH 1HZ9A 1VQMA 3S1QH 4POFA 1BKBA 2ZTDA 1PH6A 1VQCA 3KOJA 1V1QA 1PV4A 1N34Q 2E5LL 3TRZA 4WJ3M 5JJ6A 1VQOA 4A93G 1EIFA 3BJUA 5IP7H 4JI6Q 5M3FG 4O2DA 2N8NA 1KL9A 3F1ZA 3CCUA 3N3UA 4GN3B 3TREA 2VUMG 2LXKA 4LF9L 3I4NH 1UE6A 4DV7L 3A0JA 4IPCA 1YJWA 2F4VQ 4HIDA 2R7DA 1VQHA 4PZ7A 2QGQA 2UUCQ 3GTGH 1CKOA 1VS0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VY3 A;  1Z47 A;  4L5T A;  4U0S A;  4QY7 A;  3HOW G;  1K3R A;  2IT1 A;  3W5O A;  4B3T Q;  4JOI A;  2IHE A;  4P74 A;  4PZ6 A;  4APV A;  1NE3 A;  5M5Y H;  3CCS A;  4HJA A;  1V9P A;  3S24 A;  1K73 C;  1S3O A;  3HKZ G;  1IBK L;  1YNX A;  1W3S A;  3CCQ A;  3TEH B;  2K4K A;  4GN5 A;  2NVT H;  4WJ4 A;  2QA4 A;  1MKH A;  2I5H A;  1PH7 A;  2D0P A;  2DUD A;  4DR3 L;  4NPS A;  4U04 A;  4RMF A;  1EFW A;  4DR1 Q;  3GTP H;  4OWX B;  2VQF Q;  3S16 H;  2HIX A;  2PMZ E;  4NXN L;  4A93 H;  1KRS A;  3MEF A;  4IJL A;  1N32 L;  4O0A A;  1WOC A;  1CKM A;  4L5S A;  1UEB A;  2WB1 G;  2VUM H;  5FJ8 G;  1TWH H;  4KHZ A;  1FJG Q;  3KF8 B;  3E0E A;  5C3E G;  1IXR A;  3ULJ A;  4IOC A;  3CP0 A;  5GAD C;  1SE8 A;  2EQS A;  3HOW H;  4DV6 L;  1XJV A;  4LFC L;  3WWV A;  1UE5 A;  2CCZ A;  2NVY H;  2XGT A;  3DLL A;  2NN6 G;  2VS1 A;  4A75 A;  4L5Q A;  2JEA I;  1VQ5 A;  1LUZ A;  3M9B A;  4A3B G;  1PYB A;  3KLW A;  4P73 A;  3F2B A;  1I5F A;  4A3L G;  2PQA A;  3NEM A;  1A63 A;  3U50 C;  1FGU A;  4DK6 C;  4XTC S;  2UUB Q;  1SFO H;  4A3J G;  1M90 C;  3J7Z C;  4UPA A;  5IWA Q;  1HNX L;  4WGJ A;  4DV1 Q;  4LF5 L;  1T9H A;  1VQ8 A;  4K0K Q;  1AE2 A;  3JC6 6;  3G4S A;  4KHP L;  5GRO A;  2N49 A;  4JI7 L;  1YIT A;  4LUZ A;  4UP9 A;  2CWP A;  4IPG A;  5FJ8 H;  1NMF A;  2R7Z G;  4GLX A;  1VQK A;  1N33 L;  1N32 Q;  4PMW A;  5C3E H;  4N67 A;  2JJQ A;  3PGZ A;  4QL5 A;  4OO1 I;  1P8L A;  4MZ9 A;  2UXB L;  3ULL A;  1OXX K;  1I94 L;  2ES2 A;  4QGU A;  3CD6 A;  1CSQ A;  4GKK L;  4DR5 Q;  1E7Z A;  2HIV A;  1K8A C;  4B3S Q;  4DAY B;  1PYS B;  1VQE A;  1NY4 A;  1PH8 A;  4A3C H;  4XIG S;  4A3F G;  2CWA A;  3AYH B;  2R6G A;  4U07 A;  4DV6 Q;  4GOP B;  1PH3 A;  1IBL Q;  3S15 H;  4GS3 A;  4A3B H;  1KAW A;  4PY3 A;  4A3L H;  1AE3 A;  3SGI A;  5FLM G;  4TVA B;  4HJ9 A;  2VZA A;  3T1Y L;  4JI4 Q;  1X65 A;  4UY8 C;  3GD7 A;  3M85 A;  3KJO A;  2AMC B;  3CXC A;  4A3J H;  1CKN B;  2VW9 A;  4BXX G;  3CQZ H;  5FLX c;  4PZ8 A;  1YJN A;  1VQD A;  4JI1 L;  4GKJ Q;  4OON A;  4GOP A;  2IY5 B;  4LFA L;  4X2E A;  3K8A A;  1XPU A;  2R7Z H;  4KHP Q;  3RN5 A;  2N3S A;  2K14 A;  2WAQ G;  5IP9 G;  1VQ4 A;  2OTJ A;  1I3Q H;  3CW2 C;  1QVC A;  2LXJ A;  5C0X I;  1V43 A;  2OCE A;  1HJP A;  2VL6 A;  1G29 1;  2ZM6 Q;  4HIK A;  1EWI A;  3A5Z B;  3KJP A;  5JFF A;  1N33 Q;  4X66 Q;  3PCO B;  2MO1 A;  4HJ8 A;  2KCT A;  2UXB Q;  4AYB E;  4A3F H;  4DR6 L;  4GKK Q;  3M4P A;  2BH8 A;  3PF4 A;  4X6A H;  1XMO Q;  2GVB A;  4B3M Q;  4LU4 A;  2EXD A;  2N78 A;  4KI0 A;  5FLM H;  1QZH A;  1KQS A;  2ASB A;  5HY6 A;  3J7A 5;  2IX1 A;  4LF4 Q;  4P75 A;  4JI2 Q;  2RHQ B;  4FDB A;  2VQE L;  4DV2 Q;  2YV5 A;  3I4N G;  4BXX H;  3I4O A;  3ULP A;  3SN9 A;  1IL2 A;  3G6E A;  3ER0 A;  1Y1W H;  1Q8K A;  3W1B A;  3IRB A;  4A3K G;  1N9W A;  4IOA A;  5E7N A;  5IP9 H;  3LGJ A;  4DR7 L;  4DUZ L;  4UP8 A;  1U5K A;  4LW1 A;  4LNQ A;  3PUY A;  4JI5 L;  3K80 C;  4C2M H;  1I50 H;  1HZB A;  4MNO A;  1XNQ Q;  3SE5 A;  4LF6 L;  2RF4 A;  2UU9 Q;  3CUC A;  3B6Y A;  2K5N A;  1IZ6 A;  3M7N A;  3M3Y H;  1EUJ A;  1FL0 A;  5BR8 L;  3GTJ H;  3UDF A;  2NVX H;  2FXQ A;  3I7F A;  3ZJY C;  3GTQ H;  1OTC A;  3S2H H;  4JOI C;  2AHO B;  5JJ7 A;  2BA0 A;  3J81 c;  5LMN L;  4X62 L;  3D0F A;  1GD7 A;  1L2F A;  1EIY B;  4BA2 I;  2UXC L;  4OX9 L;  4RG1 A;  3W1G A;  3M4O H;  2H5X A;  1E22 A;  3GO5 A;  3PO3 G;  4R4I A;  4A3K H;  1GVP A;  4ITR A;  2JA5 G;  2UXD L;  4ME3 A;  1SRU A;  4LUV A;  3U4Z A;  2MNA A;  5GAG C;  4OWW B;  2JE6 I;  1Q7Y C;  3UDX A;  1YJ9 A;  4BY1 G;  3S1N H;  2GVA A;  3UDG A;  2ALY B;  1VQP A;  1N8R C;  4JI5 Q;  2NZO A;  5ELN A;  4HIO A;  1JMC A;  1HNX Q;  1E1T A;  1XMQ Q;  1OXS C;  4BBS G;  3I56 A;  1C0A A;  5HGQ A;  4C3H H;  2HHH L;  3NEN A;  5M5W H;  1D8L A;  4P71 A;  4X64 L;  4POG A;  2JA6 G;  4JI8 L;  1L1O A;  2C35 B;  3JAM c;  1LYL A;  2AWO A;  2F3I A;  3G71 A;  1PH1 A;  3D31 A;  2E5L Q;  3I2Z A;  4LF7 L;  1NMG A;  1OXU A;  2F52 A;  4B3R L;  2F6S A;  2Y0S G;  5ELO A;  4JV5 L;  3L2P A;  3K0X A;  2PQA B;  4YY3 L;  3BU2 A;  4JG2 A;  3RZD H;  5IYC G;  3RZO H;  3GDE A;  4LF9 Q;  4QJF A;  4DV7 Q;  4IFD G;  1J5E L;  3PO3 H;  4A3D G;  3EIV A;  4X62 Q;  2K5V A;  2VNU D;  4J15 A;  2JA5 H;  1LM0 A;  2UXC Q;  4BY7 H;  3DM3 A;  1VQ9 A;  3FP9 A;  4A3C G;  1XTD A;  2ID0 A;  4JYA L;  4ALP A;  2E2H H;  5CGL A;  3PIP A;  3UE1 A;  4BY1 H;  1DGS A;  4QQB X;  1L0W A;  3F2C A;  1JJC B;  1WYD A;  3VDY A;  1Q82 C;  3HOZ H;  2ZTC A;  1IBK Q;  4Y7N H;  4YWK A;  4LF8 L;  4BBS H;  5DLQ E;  5LMU L;  2K52 A;  4AIM A;  1XPR A;  2JA6 H;  4DR3 Q;  3CCV A;  1MJC A;  3HFZ B;  4R4C A;  4JBW A;  3OW2 A;  1TWF H;  1KC8 C;  3CCM A;  1EYG A;  1C9O A;  4OXP A;  4YWM A;  3RR5 A;  2E8G A;  4NXN Q;  1PHJ A;  2ZTE A;  3S1R H;  1VQG A;  2JA7 G;  2OWO A;  1K83 H;  4GN4 B;  4A76 A;  5IYC H;  3GTM H;  4JI3 L;  1PA6 A;  3RN2 A;  4YHH L;  3AQQ A;  1TXY A;  4A3D H;  1MJE A;  4YY3 Q;  4A3E G;  3HKS A;  1Y1V G;  3FHW A;  3ERS X;  4H02 A;  1J5E Q;  4AQY L;  4GOP C;  2UUA L;  3TQY A;  1YEZ A;  4X2C A;  1S40 A;  4LFC Q;  3HKZ E;  2MO0 A;  1X55 A;  3TS0 A;  3H3V I;  1HNW L;  3S14 H;  3ZC7 A;  3KF6 A;  2DGY A;  1PH2 A;  4JYA Q;  4DV3 L;  2G03 A;  4AH6 A;  4DUY L;  4IFD J;  3CPF A;  1HNZ L;  3J81 i;  3PUZ A;  4YCW A;  3I4M G;  1VQ7 A;  2HT1 A;  2ZJR A;  4L5R C;  4LWC A;  4LF5 Q;  5IYB G;  1Y1W G;  4DR4 L;  2WB1 E;  2AKW B;  1B7Y B;  1JJ2 A;  1GKH A;  4JC0 A;  5IT9 c;  1EOV A;  4JI7 Q;  2IHF A;  4JBJ A;  2JA7 H;  5JJK A;  2NZH A;  3PSI A;  3K81 C;  2Z0S A;  4HJ5 A;  1KRT A;  1J6Q A;  1D7Q A;  3LET A;  2WFW A;  2Q2T A;  1H95 A;  3STB C;  5IY0 A;  4A3E H;  2KBN A;  1YI2 A;  1K8G A;  2LSS A;  1Y1V H;  2R93 G;  5K36 G;  2HQL A;  4U0Z A;  4YHH Q;  1I94 Q;  1PH9 A;  4DV5 L;  1MIU A;  1YBY A;  3S6A A;  2YYZ A;  3KDF A;  3HOX G;  2Q2U A;  1QVF A;  5IYD G;  5EU0 A;  2B63 G;  4JI0 L;  3GTO H;  1E1O A;  4AQY Q;  4IO9 A;  1X3G A;  1PH4 A;  4U0U A;  2Q2H A;  3JAM i;  3KFU A;  1A0I A;  5M5X H;  5M3M G;  1VQB A;  4LUO A;  1X6O A;  3T1Y Q;  1EQQ A;  4A3G H;  3I4M H;  4R1J A;  3T1H L;  2CQO A;  5IYB H;  1WI5 A;  5CKL A;  2MFI A;  4OWT B;  4OO1 G;  2A19 A;  1K0R A;  3PIO A;  1M1K C;  4JI1 Q;  1N34 L;  2NVQ H;  1X9N A;  3CME A;  1TWC H;  4LFA Q;  1YHA A;  1PVO A;  1YZ6 A;  2JK8 A;  2KEN A;  1Q86 C;  1WJJ A;  3PV0 A;  5GQO A;  4JI6 L;  4Y52 H;  4PG3 A;  3STB D;  5LMN W;  1QUQ B;  1VQN A;  2R93 H;  3CC7 A;  1Q1B A;  2F4V L;  1JB7 A;  3OTO L;  3HOX H;  4YCU A;  3K7U C;  4GLA C;  2UUC L;  5IYD H;  2B63 H;  2A1A A;  4DR6 Q;  1TWG H;  2K5H A;  3PF5 A;  4LFB L;  2YTV A;  4B3T L;  3M4Q A;  2I5M X;  4BBR G;  5EAY A;  4X65 L;  5M3M H;  4EQ5 A;  4JI0 Q;  2JEB I;  3RLF A;  1QUQ A;  1NBW A;  1HH2 P;  3SHG A;  2Z6K A;  3J80 i;  3ICE A;  2VQE Q;  5C0X G;  2KHJ A;  3ZCB A;  2OQK A;  3AFP A;  1PH5 A;  2NN6 I;  2OQ0 A;  4BY7 G;  1I6H H;  2VQF L;  3CPW A;  1KXL A;  1L1O C;  1L1O B;  3EBE A;  1Z9F A;  2K75 A;  1W2B A;  4DKA C;  3U58 A;  4DR7 Q;  4YCV A;  4DUZ Q;  3FKI G;  1G6P A;  3H0G G;  4DV4 L;  1PFS A;  1ASY A;  3H3V H;  3HOZ G;  1KD1 C;  1VQJ A;  3S2D H;  1QZG A;  3UDI A;  1C7Y A;  1FJG L;  2EIF A;  3RLO A;  4HJ7 A;  5J3B A;  3PUW A;  4LF6 Q;  3CF5 A;  1IYJ B;  2Q2I A;  3EN2 A;  4DV0 L;  4DR2 L;  4NXM L;  1YIJ A;  4NB3 A;  2PI2 A;  4X2D A;  3OTO Q;  5BR8 Q;  4BBR H;  2CFM A;  1OXV A;  3I55 A;  2MQH A;  1UE1 A;  4BA1 I;  3G48 A;  5JEA G;  1K9M C;  1A8V A;  3CCE A;  3CAM A;  4X65 Q;  2RHS B;  2WP8 J;  1OXT A;  5LMN Q;  3A5U A;  2KCM A;  5CMT A;  2UUB L;  2L15 A;  3E9H A;  4A4I A;  5IWA L;  4DV1 L;  4OX9 Q;  3AEV A;  4K0K L;  1P16 A;  1YHQ A;  5AJ3 L;  2AWN A;  4P72 A;  2UXD Q;  1VQL A;  3FKI H;  3H0G H;  3U4V A;  5H1S E;  3CMA A;  5JFZ A;  1X56 A;  3CCJ A;  4A3I G;  5C0X J;  5M3F H;  1B8A A;  4R4T A;  2E2J H;  2YU9 H;  2ATW A;  2BH2 A;  1WFQ A;  1X3E A;  4R4Q A;  4DV4 Q;  1JE5 A;  3TS2 A;  5JJL A;  1XNR L;  1X3F A;  3MXN B;  2XTI A;  4DR5 L;  4GLV B;  3A74 A;  4B3S L;  2D62 A;  4DV0 Q;  4DR2 Q;  4X64 Q;  2HHH Q;  4NXM Q;  2GN5 A;  4JI8 Q;  3J80 c;  4JV5 Q;  3ZLM A;  1QVG A;  1IBL L;  4IPD A;  4LF7 Q;  2R7F A;  1TWA H;  5C4X G;  3KF6 B;  1X54 A;  4B3R Q;  2PI2 E;  4AYB G;  1HZC A;  3CCR A;  4JBM A;  4JI4 L;  1EQR A;  5GAE C;  3CCL A;  1N36 L;  3HOV G;  1VCI A;  3AFQ A;  4LFB Q;  1Y14 B;  4KLK A;  3HOU G;  3UE0 A;  1VQI A;  4GKJ L;  2ZJP A;  1Q81 C;  5JEA J;  1S72 A;  3K7A H;  1UWV A;  1FVI A;  4A3I H;  5C4J H;  1HZA A;  5AJ3 Q;  2D0O A;  3L7Z C;  2ZJQ A;  1AH9 A;  3S1M H;  1VQF A;  2ZM6 L;  4GNX C;  4GNX B;  3Q8D A;  1VQ6 A;  3PUX A;  4A3G G;  4DAM A;  1KIX A;  2YTX A;  5JJI A;  1A62 A;  4X66 L;  1YVC A;  1R9T H;  4LF8 Q;  2JA8 G;  1G51 A;  3OYY A;  3GTK H;  1JT8 A;  4R4O A;  5LMU Q;  1HR0 W;  3PO2 G;  3CC2 A;  1IBM L;  2R92 G;  2Y0S E;  3KDF B;  4UP7 A;  2JQO A;  4DPG A;  4TQU S;  4IPH A;  3CC4 A;  1VQA A;  1WCM G;  1XNR Q;  5C44 G;  1XMO L;  4B3M L;  5C4X H;  2BA1 A;  3F2D A;  1UE7 A;  1YHB A;  2B3G A;  4GNX A;  3S17 H;  4C3I H;  4DNI A;  1KHI A;  1XPO A;  2PNH A;  4LF4 L;  1GO3 E;  3HOV H;  4C3J H;  4DV2 L;  2I0Q A;  4JI2 L;  4JI3 Q;  1HR0 L;  2I5L X;  4YWL A;  2YTY A;  1N36 Q;  3HOU H;  1CUK A;  4JCV E;  3F8T A;  1E24 A;  1RL2 A;  3H15 A;  1BVS A;  2UUA Q;  4XI8 A;  2V1C C;  1B70 B;  4JBK A;  1JJG A;  4EX5 A;  1ASZ A;  1HNW Q;  4DV3 Q;  1LTL A;  1XNQ L;  1Q1E A;  1E3P A;  4DUY Q;  2JA8 H;  1HNZ Q;  4DK3 C;  3PO2 H;  1CKN A;  4M16 A;  2UU9 L;  2OTL A;  4A3M G;  2R92 H;  2B29 A;  3RLN A;  1WCM H;  2A8V A;  3HOY G;  5C44 H;  4DR4 Q;  1IBM Q;  2K50 A;  1SRO A;  3BZK A;  1NTG A;  4HIM A;  1Q12 A;  3RNU A;  2JA9 A;  2KHI A;  2RCN A;  1BBU A;  1Q46 A;  3J81 j;  1GM5 A;  2Z6K C;  5IP7 G;  1SR3 A;  4QIW E;  4IJH A;  3PUV A;  1HR0 Q;  3GTL H;  1CSP A;  3L0O A;  1O7I A;  4DV5 Q;  3BZC A;  2E2I H;  1SMX A;  3E9I A;  1BBW A;  2IX0 A;  3KYH C;  4MTN A;  4IFD I;  3NEL A;  1SLJ A;  4A3M H;  1U0L A;  5IE8 A;  3NBH B;  2CKZ B;  1RIP A;  5GAH C;  2WAQ E;  2QEX A;  3T1H Q;  1XMQ L;  1NJI C;  1SN8 A;  4DR1 L;  3HOY H;  1HZ9 A;  1VQM A;  3S1Q H;  4POF A;  1BKB A;  2ZTD A;  1PH6 A;  1VQC A;  3KOJ A;  1V1Q A;  1PV4 A;  1N34 Q;  2E5L L;  3TRZ A;  4WJ3 M;  5JJ6 A;  1VQO A;  4A93 G;  1EIF A;  3BJU A;  5IP7 H;  4JI6 Q;  5M3F G;  4O2D A;  2N8N A;  1KL9 A;  3F1Z A;  3CCU A;  3N3U A;  4GN3 B;  3TRE A;  2VUM G;  2LXK A;  4LF9 L;  3I4N H;  1UE6 A;  4DV7 L;  3A0J A;  4IPC A;  1YJW A;  2F4V Q;  4HID A;  2R7D A;  1VQH A;  4PZ7 A;  2QGQ A;  2UUC Q;  3GTG H;  1CKO A;  1VS0 A; 
#chains in the Genus database with same CATH topology
 3HOW G;  1HUN A;  5KRU A;  1K3R A;  2IT1 A;  4LFB Q;  1A6X A;  4JOI A;  1L0X B;  2K5D A;  4P74 A;  5M5Y H;  3CCS A;  1C8C A;  1QJO A;  1FD7 D;  1K73 C;  1YNX A;  1W3S A;  2NVT H;  1I6V C;  2QA4 A;  2D0P A;  3KBG A;  1R4Q B;  4U04 A;  4RMF A;  4OWX B;  3FVQ A;  1AFP A;  1KRS A;  3MEF A;  1F9R A;  2CH4 W;  4IJL A;  1WTP A;  4M1U B;  1GOZ A;  1HFG A;  3QWN A;  1NH1 A;  1V1O A;  1O7Y A;  5I6W A;  2MHV A;  4JPB W;  5FLX L;  1MHW C;  1ZXT A;  5GAD C;  3HOW H;  4DXG A;  2QIL A;  2B2T C;  1XJV A;  2CCZ A;  1UE5 A;  2XRS D;  2G9D A;  3GTK B;  4IUT A;  3QJY A;  3SR1 A;  1WTH A;  4A3B G;  4K6D A;  1B1Z A;  4P73 A;  2VXW A;  3F2B A;  4NP5 A;  3OMG A;  2UUB Q;  1SFO H;  4A3J G;  1M90 C;  4WGJ A;  1W6J A;  4K0K Q;  1Y1V B;  4KHP L;  5GRO A;  5J1Z A;  1E2V A;  2B2W A;  4LUZ A;  2TSS A;  5I6Y A;  1I4G A;  1NMF A;  2B39 A;  4G57 A;  4N67 A;  3T13 A;  4TRD A;  5ELC A;  1X32 A;  4OO1 I;  4CJ1 B;  1DZ1 A;  4QGU A;  2B2U C;  2CWA A;  3G6J B;  4RA8 A;  3S15 H;  4A3B H;  2IL8 A;  4PY3 A;  1WCM B;  5FLM G;  4TVA B;  5C44 B;  4HJ9 A;  3T1Y L;  2HCC A;  2WII B;  4LJZ C;  1L0Y B;  3KJO A;  4A3J H;  1HTL D;  1CKN B;  4BXX G;  3KLR A;  5FLX c;  1VQD A;  4JI1 L;  5EKK A;  4GKJ Q;  2AUJ D;  4LFA L;  1NR4 A;  3DHQ A;  1QOH A;  4XYQ A;  1I3Q H;  3EA6 A;  1ENF A;  5C0X I;  2ZM6 Q;  4HIK A;  2OCE A;  2VL6 A;  1EWI A;  1NR2 A;  3KJP A;  4U68 A;  4F88 A;  4PV1 C;  4AYB E;  4DR6 L;  3M4P A;  4OEM B;  1S5C D;  4X6A H;  4B3M Q;  2X69 A;  2EXD A;  4ULL A;  2N78 A;  5FLM H;  3HOY B;  2ASB A;  3T51 B;  4HSV A;  3I4N G;  4BXX H;  3I4O A;  3ULP A;  3H3V C;  4HMJ A;  3KK7 A;  1PRT C;  1Q8K A;  4IUQ A;  2KEC A;  3W1B A;  4KY5 A;  3IRB A;  1N9W A;  4DR7 L;  3LGJ A;  4DUZ L;  2LMC B;  4LNQ A;  1LTT D;  3NWT A;  2K05 A;  1XNQ Q;  1HZB A;  1TY0 A;  3A56 A;  3CUC A;  2B2V A;  1EY6 A;  5BR8 L;  3UDF A;  4ZCK A;  2MPM A;  1U9R A;  3BVM A;  3M4Y A;  4XQJ A;  2AHO B;  1XX8 A;  2BA0 A;  4MN3 A;  4IAL A;  4OX9 L;  2H5X A;  3GO5 A;  2G5D A;  4LUV A;  2MNA A;  3I91 A;  2JE6 I;  1HUM A;  1NUC A;  5D3I B;  1DOL A;  4KKT A;  2ALY B;  4HIO A;  1V1P A;  4N9T A;  5NUC A;  4QB4 A;  2HHH L;  4X64 L;  1D8L A;  4P71 A;  2JA6 G;  3I2Z A;  1AP0 A;  5IGC A;  1HCZ A;  3L2P A;  5C4J B;  4EGV A;  5IYC G;  2WB1 B;  1J5E L;  3EIV A;  1H9M A;  1LM0 A;  1U4L A;  5KND A;  5IT9 L;  3FP9 A;  4A3C G;  2F0P A;  4KHV A;  3UE1 A;  1DGS A;  1Q82 C;  2E76 C;  1LTI D;  3NE5 B;  1BBX C;  2EYM A;  5LMU L;  2K52 A;  3KLS A;  5IT9 E;  2JA6 H;  1GJX A;  1KLG D;  2SNS A;  3CCM A;  1EYG A;  3VR3 A;  3MFY A;  1PZK D;  5IYC H;  3RN2 A;  4YY3 Q;  3VYT A;  3HKS A;  4IUP A;  3MZ5 A;  1DON A;  2EYH A;  1EYC A;  3HKZ E;  4IQZ A;  1X55 A;  3H3V I;  2ENB A;  3S14 H;  2ZXP A;  4DV3 L;  2G03 A;  1RF2 D;  4AH6 A;  2XIW A;  4DUY L;  2QDB A;  2EJF C;  1OO9 B;  1QWY A;  4FXK C;  2MUY A;  1VQ7 A;  2HT1 A;  1F9P A;  2ZJR A;  4L5R C;  4LWC A;  3I90 A;  1Y1W G;  3DUZ A;  2AKW B;  5IGG A;  5IT9 c;  1EOV A;  3K6O A;  2IHF A;  2A68 C;  3AU7 A;  2NZH A;  2PZU A;  2RA4 A;  4HJ5 A;  2XWB B;  1J6Q A;  3LET A;  2WFW A;  2Q2T A;  1H95 A;  3STB C;  2DNE A;  5IY0 A;  5K36 G;  2EY1 A;  4YHH Q;  4NMZ A;  3D3R A;  4DV5 L;  1XTC D;  3S6A A;  1EY7 A;  3GTO H;  5HGT A;  1I4P A;  5E4X A;  4IO9 A;  1PTO C;  3Q6S A;  2Q2H A;  1TR5 A;  5M5X H;  1FR3 A;  3T1Y Q;  4A3G H;  3T1H L;  2ZT9 C;  1WI5 A;  2MFI A;  4JI1 Q;  3NXW A;  2IX3 A;  4G7O C;  4LFA Q;  4MIU A;  3S1M B;  1YHA A;  3VA7 A;  1YZ6 A;  2KEN A;  1WJJ A;  4L6T B;  2FMM A;  1QUQ B;  5EQ0 A;  2PW5 A;  5LMN W;  5K36 H;  2FFK B;  1SNC A;  2D9U A;  1TQO A;  1CHQ D;  4GLA C;  1IW7 C;  3R93 A;  2A1A A;  2XNA C;  4DR6 Q;  4B3T L;  2I5M X;  4X65 L;  1F9Q A;  2OT2 A;  3GTP B;  4JI0 Q;  1O7L A;  3RLF A;  3SHG A;  3C1E A;  3ND9 A;  1V1P B;  2VUM B;  2NUD A;  1CM9 A;  5EPJ A;  3WDN A;  3AFP A;  2NN6 I;  2OQ0 A;  2VQF L;  4DF7 A;  3CPW A;  1KXL A;  3DWP A;  3WOF A;  3PO3 B;  4DR7 Q;  4DUZ Q;  1HA6 A;  2BCO A;  1WTR A;  1MGS A;  3H3V H;  1QZG A;  3UDI A;  1FJG L;  5J3B A;  5JPM C;  3CF5 A;  3EN2 A;  3FMC A;  2PI2 A;  3OTO Q;  1G6Z A;  5BR8 Q;  3G48 A;  1K9M C;  4KKU A;  3D6C A;  3CCE A;  2RHS B;  1TWF B;  3HG9 A;  2CH4 A;  3BYY B;  1SJE D;  2KJX A;  2L15 A;  4A4I A;  4OX9 Q;  4CDE C;  3MAQ A;  1YHQ A;  4I7A A;  4XT1 B;  1UEA B;  3CMA A;  4A3I G;  1X56 A;  5C0X J;  1HQR D;  2ATW A;  4R4T A;  4R4Q A;  1X3E A;  4DV4 Q;  1JOR A;  5L37 A;  1H9K A;  1X3F A;  3MXN B;  2XTI A;  3W3A A;  4DR5 L;  1D1I A;  4GLV B;  2HHH Q;  4X64 Q;  3D6W A;  1SYF A;  4NXM Q;  1QVG A;  5KGU A;  1IBL L;  2EZV A;  5C4X G;  4X3K A;  3QO2 A;  2PI2 E;  4JBM A;  3VYR A;  5D65 A;  1IYV A;  1J8I A;  3CCL A;  1N36 L;  3HOV G;  3K0Y A;  2XVS A;  4Q0F A;  3R8B A;  3NQT A;  3K5L A;  1UWV A;  1FVI A;  4A3I H;  1KDC A;  1ENC A;  3L7Z C;  2A6H D;  4GNX C;  1VDZ A;  2YTX A;  1R9T H;  1JT8 A;  1BXT A;  1DOM A;  1EU3 A;  1RCV D;  5LMU Q;  1EIH A;  3Q24 A;  2O5I C;  1XNR Q;  2JQO A;  4TQU S;  1C4Q A;  3I4M B;  5C4X H;  2PZT A;  2F0N A;  1S5D D;  4GNX A;  4LF4 L;  1EEI D;  1GO3 E;  3HOV H;  4DV2 L;  2EOT A;  2M00 A;  3LNN A;  4JCV E;  1RL2 A;  3GV6 A;  3H15 A;  1BVS A;  1MI2 A;  1UAP A;  2XN9 C;  2F0V A;  3IFT A;  1JJG A;  1RD9 D;  2L9H A;  3DWA A;  3S2H B;  4DV3 Q;  4DUY Q;  3UI2 A;  2UU9 L;  2B29 A;  2K03 A;  3RLN A;  2A8V A;  4FNF A;  4K2K A;  1IBM Q;  4H44 C;  4HIM A;  1Q12 A;  4K2L A;  3RNU A;  4A3K B;  1B50 A;  3V2T A;  1PFN A;  1TII D;  1BBU A;  1Q46 A;  3I72 A;  3R2T A;  3D4R A;  3NTK A;  1A2U A;  2PMZ B;  4DV5 Q;  1O7I A;  2PCF B;  2MJ8 A;  4KMU C;  1EOT A;  1SMX A;  3SK6 A;  4R9W A;  4IFD I;  1G2S A;  4DK0 A;  4RGM A;  5IE8 A;  3T1H Q;  1SN8 A;  5HUR A;  3U9S A;  1BKB A;  1PH6 A;  1VQC A;  3TRZ A;  1HRJ A;  1STA A;  1GHJ A;  3TP6 A;  2E5L L;  5JJ6 A;  4BY7 B;  1EIF A;  4O2D A;  3TRE A;  2KCC A;  4LF9 L;  4DV7 L;  3H0G B;  2M2L A;  4Y7N B;  2TMP A;  1VS0 A;  2VY3 A;  1K0S A;  4B3T Q;  1ROD A;  1NE3 A;  3HZX A;  4H7B A;  1H9R A;  2RSO A;  2H1E A;  1V9P A;  3RMH A;  2R3Z A;  1S3O A;  4WJ4 A;  3TEH B;  4GN5 A;  1K83 B;  2Z4I A;  1TWA B;  2I5H A;  5IGE A;  2DUD A;  4A3D B;  2LS0 1;  1GXD C;  1EFW A;  3S16 H;  2VQF Q;  2J4X A;  1WOC A;  4H13 C;  4L5S A;  2NZ1 D;  1UEB A;  5FJ8 G;  4J6H A;  4H0L C;  1TWH H;  1FJG Q;  5EJW A;  4G4K A;  3E6Z X;  1RJT A;  3ULJ A;  4ID6 A;  3ONA B;  2F1M A;  4LFC L;  2XGT A;  2L1B A;  4A75 A;  1JWS D;  5EKI A;  1VQ5 A;  1LUZ A;  3KLW A;  1GUO A;  1I5F A;  2DJF C;  3NEM A;  4C3J G;  3U50 C;  4DK6 C;  2B2Y C;  4XTC S;  4LF5 L;  4WJW A;  2GA4 B;  1WTX A;  3SK8 A;  1EY9 A;  1YNJ C;  4IPG A;  5FJ8 H;  2R7Z G;  4RGN A;  1KNA A;  4QL5 A;  4MZ9 A;  2AQ2 B;  3ULL A;  4UDU C;  1AZP A;  3RD4 A;  2ES2 A;  4DR5 Q;  2ZXR A;  4XIG S;  3J7Y W;  3AYH B;  3I73 A;  2R6G A;  4U07 A;  5FO9 B;  4GOP B;  4A3F G;  4XT3 B;  1IBL Q;  2R92 B;  2SEB D;  5G3L F;  2NVQ B;  1VMP A;  2VZA A;  4UY8 C;  3GD7 A;  3CXC A;  4DNT B;  2VW9 A;  3CQZ H;  3V96 A;  1CT1 D;  5JOB A;  3ERO A;  3HOX B;  3K8A A;  3DEP A;  2R7Z H;  2K14 A;  4F7X A;  3J81 L;  4KN4 C;  1HJP A;  2J7Z A;  3A5Z B;  5TSS A;  4HJ8 A;  2UXB Q;  2EVB A;  4A3F H;  1ONL A;  3N52 A;  3J81 E;  3PF4 A;  2GVB A;  1E0B A;  1KAA A;  5EPL A;  1JCK B;  3S1Q B;  1B44 D;  1QCB D;  4HED A;  2IJ0 A;  2PQE A;  1IKL A;  3J7A 5;  4LF4 Q;  5A2Q L;  2VQE L;  4DV2 Q;  3T4A C;  4FDB A;  2ICE C;  3SN9 A;  1RTO A;  1WTO A;  1LAC A;  1IL2 A;  3J7A V;  4C3H G;  1SAP A;  3JAM L;  3E5S A;  2QF7 A;  4EQP A;  3MTS A;  1U5K A;  3GTG B;  3PUY A;  3K80 C;  3BDL A;  3SE5 A;  4LF6 L;  2RF4 A;  2UU9 Q;  5M5Y B;  3JAM E;  3VR6 A;  1FL0 A;  3NK9 A;  4IUU A;  2NVT B;  2F0J A;  3VA5 A;  5IIF A;  3GTQ H;  1Y8O B;  4JOI C;  5C5L A;  2EPB A;  5JJ7 A;  3J81 c;  1B4O A;  3VR4 A;  5LMN L;  1GD7 A;  1F9S A;  5M3F B;  1EIY B;  1EU4 A;  4RG1 A;  3M4O H;  5LL6 X;  1E22 A;  4HN7 A;  2F0F A;  4YIJ A;  2JA5 G;  2UXD L;  4Z9C B;  5GAG C;  3J80 L;  3VYS A;  5I2X A;  1ILP A;  4ZRZ A;  3Q0A A;  5COY A;  1N8R C;  1JMC A;  3NTI A;  1E1T A;  1OXS C;  4BBS G;  3I56 A;  4OIJ A;  3NEN A;  3J80 E;  1U4M A;  4JI8 L;  3JAM c;  3G71 A;  1PH1 A;  2E5L Q;  3D31 A;  1SFO B;  1OXU A;  4FF2 A;  3SHL A;  2Y0S G;  4UHV A;  4IUV A;  3U9O A;  4YY3 L;  4JG2 A;  2F0U A;  3RZD H;  5CV4 A;  4LF9 Q;  4QJF A;  4DV7 Q;  2F0G A;  3FEW X;  2JA5 H;  2UXC Q;  3TZD A;  1CA5 A;  2B2W C;  1S5B D;  3SDZ A;  1GUW A;  2E2H H;  5COR A;  1D1K A;  3PIP A;  4QQB X;  1PXU A;  2A6E D;  3PIP 3;  1JJC B;  3F2C A;  3HOZ H;  2ZTC A;  3QR8 A;  5CMD A;  4BBS H;  4LF8 L;  3S15 B;  4A3B B;  3F2U A;  1XPR A;  3CCV A;  4R4C A;  3TSS A;  1KC8 C;  1C9O A;  4A3J B;  4YWM A;  1PYW D;  2JA7 G;  1D2B A;  5C3X A;  3ERQ A;  4IUN A;  4JI3 L;  4YHH L;  3AQQ A;  1TXY A;  5IGD A;  4A3E G;  2QEJ C;  2CVR A;  1Y1V G;  3FHW A;  4LFC Q;  1LTA D;  1NCV A;  3ZC7 A;  3KF6 A;  1RKN A;  4IFD J;  4QIW B;  3CPF A;  1KNE A;  4HTH A;  3PUZ A;  1ZEQ X;  2IWH A;  4ZLT F;  1EY4 A;  3BDC A;  4LF5 Q;  1CK1 A;  1B7Y B;  2WB1 E;  4LAA A;  4JC0 A;  4JW0 A;  3GTL B;  2ZXO A;  5EPK A;  2JA7 H;  4JBJ A;  2J0T D;  3PSI A;  1KRT A;  2KOL A;  2VB3 X;  2OF1 A;  2E2I B;  5BN3 A;  4A3E H;  1YI2 A;  4K8J A;  2KBN A;  1Y1V H;  2WKD A;  5ELF A;  1PH9 A;  3M7G A;  4A3M B;  1MIU A;  2BE5 D;  3KDF A;  1QVF A;  5EU0 A;  2B63 G;  4JI0 L;  1BUV T;  5J39 A;  1X3G A;  1AEX A;  1ZYR C;  5M3M G;  3HP3 A;  2DY7 A;  5CR3 A;  2ICI A;  4OWT B;  2B2V C;  4OO1 G;  3I4N B;  1YNN D;  4OHJ A;  1SJH D;  3PMF A;  2K5W A;  3CME A;  1TWC H;  5G3L D;  2JK8 A;  5ELD A;  2EYL A;  3BG3 A;  3E0J A;  4PG3 A;  4Y52 H;  4XDX A;  2NYZ D;  1VQN A;  1DJR D;  3CC7 A;  4FO2 A;  1JB7 A;  4QF4 A;  3OTO L;  1SYG A;  2OEO A;  3A8J E;  5KEE A;  4OL7 A;  2B63 H;  1TWG H;  1LT3 D;  2YTV A;  3M4Q A;  4K5W A;  5EAY A;  5M3M H;  4ABN A;  1I4X A;  1QUQ A;  4A93 B;  2VQE Q;  5C0X G;  4OO1 H;  5ELB A;  3ZCB A;  1PH5 A;  2HQE A;  3NUC A;  4RGT A;  3NPP A;  3U58 A;  1STN A;  4DV4 L;  1ASY A;  3A7A B;  5EBD A;  1C7Y A;  3S9W A;  4LF6 Q;  4HMI A;  2Q2I A;  1F2Y A;  1EZ8 A;  4NXM L;  4NB3 A;  2PZW A;  4X2D A;  1HHV A;  2MQH A;  1EZ6 A;  1QNK A;  2F0I A;  1BCP D;  1EY5 A;  2E75 C;  2EJG C;  2JA6 B;  4KKS A;  2WP8 J;  5C0X H;  5LMN Q;  1HXY D;  5CMT A;  2Q8I B;  4HR7 B;  3K5N A;  5IWA L;  3AEV A;  1GUG A;  1NAP A;  3NTH A;  2G9H D;  2KUM A;  1DCZ A;  2UXD Q;  3CRK C;  4ODG A;  5KNB A;  5H1S E;  5JFZ A;  3CKI B;  2FMC A;  2BH2 A;  1B8A A;  1HQM C;  3TS2 A;  3S14 B;  2NUN A;  1XNR L;  3MXP A;  1TY2 A;  3A74 A;  4B3S L;  4DV0 Q;  4K14 A;  4DR2 Q;  4KY6 A;  1J9O A;  4JI8 Q;  4IPD A;  5AFW A;  3KF6 B;  1X54 A;  4C56 C;  4AYB G;  2L0C A;  3CCR A;  4JI4 L;  1KAB A;  4KN7 C;  4C3I G;  3OHX C;  1IKM A;  3MXN A;  1QB5 D;  5D3D A;  2JN4 A;  3BS1 A;  2ZJP A;  5JEA J;  2BDN A;  5JPN C;  3K7A H;  5C4J H;  1HZA A;  5AJ3 Q;  2ZJQ A;  1AH9 A;  1B3A A;  1GUN A;  3Q8D A;  1VQ6 A;  1M4V A;  1V8Q A;  4A3G G;  3QIA A;  4LF8 Q;  2JA8 G;  2QW7 A;  1HR0 W;  3MC0 B;  1IBM L;  1EY8 A;  3KDF B;  4UP7 A;  3TZU A;  4DPG A;  3CC4 A;  1VQA A;  2CHB D;  1XMO L;  2BA1 A;  3F2D A;  3Q23 A;  1Y1W B;  1VMC A;  3S17 H;  4C3I H;  1KHI A;  1XPO A;  2PNH A;  2EDG A;  4JI2 L;  4JI3 Q;  4YWL A;  2EYP A;  1SMY D;  1CUK A;  3F8T A;  1BOS A;  1EEF D;  2F3V A;  1MBY A;  4WFN 3;  3D8G A;  4RGO S;  2Z1C A;  4JBK A;  2K6A A;  4EX5 A;  3OIP A;  1STH A;  2NVX B;  3MFG A;  1FNV A;  1STY A;  5FOB B;  1E3P A;  2JA8 H;  3EVQ A;  1DM0 B;  3FDT A;  4HCS A;  2F0L A;  4TSS A;  5BN5 A;  5KYL A;  3C3L A;  1PRT F;  1S5F D;  1SRO A;  3E3X A;  2JA9 A;  3EFX D;  1CTM A;  3P1H A;  4KY7 A;  2KCN A;  2F4I A;  5IP7 G;  4ZUI A;  2A69 D;  4IJH A;  5ELE A;  4DAP A;  1CSP A;  3S1N B;  2PYK A;  4MHE A;  4CDC C;  1PRT B;  1HFN A;  1BBW A;  1TU2 B;  1PMR A;  3KYH C;  2CW0 D;  3A7L A;  1RDP D;  3VR2 A;  1U0L A;  1M1K C;  2WAQ E;  4N8F A;  1HA5 A;  2QEX A;  1NJI C;  1K28 A;  2NTS A;  4C1N I;  2X6G A;  4POF A;  2IW3 A;  3BJU A;  5IP7 H;  3F1Z A;  1Q8I A;  4GN3 B;  2VUM G;  2LXK A;  4S3S A;  4BY1 B;  2QCP X;  4HID A;  2R7D A;  3H09 A;  3S1M H;  4L5T A;  4QY7 A;  2IHE A;  3H6M A;  4HJA A;  4B08 A;  4RAU C;  3S24 A;  5CC4 A;  4P2C B;  3HKZ G;  3S1R B;  1IBK L;  1PH7 A;  3GTM B;  4DR3 L;  4NPS A;  1LLR D;  2L5T A;  4QUF A;  3GTP H;  2HIX A;  2PMZ E;  3NP8 A;  4O0A A;  1UUP A;  1CKM A;  2VUM H;  1PZI D;  1QIL A;  4KHZ A;  4A3I B;  5C3E G;  1H9J A;  1IXR A;  3R2I A;  4IOC A;  3CP0 A;  4ZK9 B;  5DM6 3;  2F0Q A;  2NVY H;  3DLL A;  2NN6 G;  1I4Q A;  2VS1 A;  4L5Q A;  3DEO A;  4DK1 A;  5CBA E;  2PQA A;  3T16 A;  2K01 A;  1FGU A;  5DEH A;  3J7Z C;  1I4R A;  5IWA Q;  5DM7 3;  3HOV B;  1AE2 A;  3JC6 6;  3G4S A;  2N49 A;  4DXF A;  4JI7 L;  4UP9 A;  1WTV A;  1R4P B;  3A54 A;  2CWP A;  3MHB A;  3ZYY X;  1VQK A;  1N32 Q;  4PMW A;  2Q8T A;  5C3E H;  3PGZ A;  2UXB L;  1P8L A;  2DNC A;  1OXX K;  4X3U A;  1I94 L;  3TP5 A;  1CSQ A;  1G8Z D;  2JP1 A;  1E7Z A;  1K8A C;  4B3S Q;  1PYS B;  2NN6 H;  1VQE A;  1EL0 A;  1PH8 A;  1CQF A;  3A8K E;  4DV6 Q;  4KV6 A;  2D2C C;  4O1N A;  1KAW A;  5FKA C;  1AE3 A;  3QOL A;  3SGI A;  1BDO A;  2K28 A;  2RDF A;  4JI4 Q;  1X65 A;  2MGS A;  2H4O A;  2EYJ A;  1G2T A;  2EYF A;  2EY5 A;  1X3Q A;  2FJ2 A;  3D4W A;  4OON A;  4GOP A;  2IY5 B;  5E3F A;  2FHT A;  3LX0 A;  3L3O C;  5CBE E;  1XPU A;  3RN5 A;  2N3S A;  2WAQ G;  1VQ4 A;  2OTJ A;  4E6I A;  1QVC A;  2LXJ A;  1V43 A;  3P7J A;  5JFF A;  1N33 Q;  2O5J C;  3IAY A;  5C5M A;  4C1N K;  1JC7 A;  1MSH A;  1DXM A;  2RQX A;  4GKK Q;  5CV8 A;  1XMO Q;  1PFM A;  3WOE A;  4LU4 A;  1KQS A;  1E2W A;  1WD1 A;  5EBC A;  2IX1 A;  1AZQ A;  4JI2 Q;  4XXE A;  2YV5 A;  3HEJ A;  3LWU A;  4KJO A;  3S2D B;  3ER0 A;  2EXZ A;  1JWU D;  3K59 A;  4A3K G;  3I4L A;  4O42 A;  1SDF A;  4LW1 A;  4C2M H;  1I50 H;  4MNO A;  1WVL A;  1BNZ A;  4Q5V A;  1PTO H;  3B6Y A;  3FRP B;  3M7N A;  3M3Y H;  3GTJ H;  2FXQ A;  3I7F A;  3ZJY C;  2XWJ B;  3S2H H;  5E4W C;  2SDF A;  2RCF A;  2RDH A;  3S16 B;  4QMG A;  1F77 A;  1EY0 A;  1L2F A;  4BA2 I;  2YU9 B;  2UXC L;  2CQA A;  1Q3L A;  1PRT D;  2LKV A;  4R4I A;  4A3K H;  1GVP A;  1TWH B;  2E2D C;  4OEL B;  4ME3 A;  5FK9 C;  1BO0 A;  1JOO A;  3VR5 A;  1LV9 A;  1Q7Y C;  2GVA A;  3UDG A;  1VQP A;  4JI5 Q;  2NZO A;  4KJN A;  2L55 A;  1C0A A;  1A63 A;  5M5W H;  4POG A;  3DM1 A;  1L1O A;  2C35 B;  4U67 3;  2WAC A;  4JV5 L;  2F3I A;  2DJG C;  2F52 A;  4PMB A;  5DAU A;  4B3R L;  4CJ2 C;  5F2D A;  2F6S A;  2PQA B;  1HTP A;  3BU2 A;  3RZO H;  4IFD G;  4A3D G;  4OGQ C;  4X62 Q;  2K5V A;  2VNU D;  4R8I A;  1I4H A;  3MA2 B;  4BY7 H;  2HDM A;  1EWH A;  1RHP A;  1SNQ A;  2ID0 A;  5CGL A;  4XQQ A;  2VB2 X;  1O80 A;  1L0W A;  1Z6H A;  4NW2 A;  1GUS A;  4Y7N H;  1IBK Q;  2QKI C;  5DLQ E;  4AIM A;  4C3J B;  1NNX A;  4ZAI A;  1ZKO A;  4DR3 Q;  1MJC A;  3HFZ B;  3OW2 A;  3HOU B;  3OOC A;  3CQZ B;  1PHJ A;  3X3M A;  1K83 H;  4GN4 B;  1PA6 A;  4IFD H;  4A3D H;  2R7Z B;  1MJE A;  1CZW A;  3P20 A;  4H02 A;  2UUA L;  1U4R A;  2F0O A;  2MO0 A;  1STE A;  3MXG A;  4JYA Q;  4A3F B;  4YCW A;  4DU9 A;  4KD3 A;  4DR4 L;  2KHS A;  5IYB G;  1JJ2 A;  3W2D A;  1EFI D;  1GKH A;  2WIN B;  4JI7 Q;  1ET9 A;  5JJK A;  3K81 C;  2KEE A;  2F03 A;  2F0K A;  2Z0S A;  3OSO A;  1D5Z C;  2R93 G;  2HQL A;  1S4Z A;  1I94 Q;  1LT6 D;  3K58 A;  1YBY A;  3HOX G;  2Z4H A;  2Q2U A;  5IYD G;  4HCE A;  1STB A;  1S5E D;  1B53 A;  1E1O A;  3SVM A;  4AQY Q;  4G7Z C;  3K5O A;  1PH4 A;  2HUG A;  1A0I A;  2F0E A;  1VQB A;  1X6O A;  2CQO A;  5IYB H;  1K0R A;  1F2L A;  1W6K A;  4X3T A;  3PIO A;  4HSP A;  3PIO 3;  1N34 L;  2NVQ H;  1WTQ A;  2A68 D;  1X9N A;  2RBM A;  1UNS A;  4C3H B;  1BCP F;  1DOK A;  4JVZ A;  3M4O B;  1PVO A;  1C48 A;  5GQO A;  1D5M C;  3STB D;  1KTK A;  2R93 H;  1Q1B A;  4B9X A;  2F0H A;  2KA7 A;  3HOX H;  4YCU A;  2NBF A;  3K7U C;  5IYD H;  3PF5 A;  1PTO D;  4BBR G;  3NWS A;  4JK1 C;  3MEH A;  1BCP B;  2Z6K A;  3ICE A;  4K6L A;  2BDO A;  1IHZ A;  4G7H C;  4CBV A;  1I6H H;  1L1O B;  3RZD B;  1W2B A;  1Z9F A;  3HOW B;  1KDA A;  3FKI G;  1LTS D;  4CDF C;  4CKC A;  1PFS A;  2JA5 B;  3HOZ G;  1KD1 C;  1VQJ A;  2EIF A;  1SNM A;  2LY7 A;  2HCI A;  1E2Z A;  3PUW A;  1A15 A;  2PPB C;  1IYJ B;  3T53 B;  4DV0 L;  1T5E A;  2K33 A;  1IW7 D;  5M9O A;  4DR2 L;  2E2H B;  2O4X A;  1YIJ A;  4BBR H;  2F0W A;  2CFM A;  4BBS B;  1UE1 A;  2LFN A;  5ISR A;  5JEA G;  4RHS A;  1A8V A;  5LHY 1;  3CRL C;  3A5U A;  4FXD A;  2KCM A;  2Y0S B;  5CV5 A;  1DYQ A;  3E9H A;  3KBX A;  4DV1 L;  5AJ3 L;  4P72 A;  4ZQ3 A;  5T1I A;  3FKI H;  1SYD A;  3U4V A;  5M3F H;  2E2J H;  2I46 A;  4F8M A;  2A6H C;  4ZKC B;  5JJL A;  2BOS A;  3C1F A;  2D62 A;  2GN5 A;  3J80 c;  5JEA H;  4JV5 Q;  2C5C A;  5IOD A;  2AQ3 B;  3OW7 A;  4B3R Q;  1HZC A;  1EQR A;  3X3N A;  2JA7 B;  5FLX E;  3KF8 A;  3AFQ A;  1I3Q B;  1Y14 B;  4KLK A;  1VQI A;  3NHH A;  4IUR A;  2B2T A;  4A3E B;  1S72 A;  1SNP A;  2EJM A;  2D0O A;  5A35 A;  3FPP A;  3DXJ C;  3PUX A;  5JJI A;  4DAM A;  3P75 A;  1KIX A;  4X66 L;  3GTK H;  3OYY A;  1ML0 D;  4R4O A;  3CC2 A;  1K8O A;  2A74 C;  4IPH A;  1WCM G;  5C44 G;  1UE7 A;  2B3G A;  3TME A;  3AB9 A;  4DNI A;  1LTB D;  1TWC B;  2YTY A;  5EGT A;  2B2U A;  1E24 A;  5CV6 A;  2D5D A;  4PMC A;  2Z8L A;  1SYE A;  4DAY A;  2UUA Q;  3H94 A;  4XI8 A;  2V1C C;  1B70 B;  1EQT A;  1VF5 C;  1ASZ A;  5C3W A;  1QNU A;  2B63 B;  1TWG B;  1LTL A;  2A5H A;  1Q1E A;  1SEB D;  4FP5 D;  3DMU A;  4M16 A;  5M3M B;  5KYI A;  4A3M G;  3KLS X;  3OIQ A;  1WCM H;  1KLU D;  2DN8 A;  3BYT B;  3SE0 A;  5C44 H;  3HOY G;  4DR4 Q;  1NTG A;  2HD3 A;  3H91 A;  4CKB A;  2KHI A;  3J81 j;  3I8Z A;  4M8A A;  2XSC A;  1O7Z A;  1PFB A;  1XYI A;  1HPC A;  3EQL C;  3PUV A;  1HR0 Q;  3GTL H;  4RKL A;  1CQV A;  4ME5 A;  2E2I H;  3E9I A;  4CKE A;  2IX0 A;  3V05 A;  2F0S A;  4MTN A;  1AW7 A;  5I4D A;  1QG7 A;  4L63 B;  5DNF A;  4A3M H;  5KIX A;  4DGZ A;  1HNX L;  2CKZ B;  1XMQ L;  3HOY H;  4FF3 A;  3MWY W;  3KUP A;  3KOJ A;  1N34 Q;  1SBB B;  4ZYS A;  5CV7 A;  3SXH A;  4A93 G;  1SNO A;  2N8N A;  1KL9 A;  3N3U A;  3I4N H;  3A0J A;  1JIC A;  5FO8 B;  1YJW A;  1VQH A;  1A3T A;  4PZ7 A;  2QGQ A;  5T1G A;  1Z47 A;  1Y8P B;  4U0S A;  2EY6 A;  3W5O A;  4PZ6 A;  4APV A;  4DAV A;  3OPO A;  3K57 A;  1TS3 A;  3CCQ A;  2K7V A;  2K4K A;  1SE4 A;  1MKH A;  2KVM A;  4DR1 Q;  4NXN L;  4A93 H;  4GZY C;  1N32 L;  4N8X 1;  4DA2 A;  5CYU A;  2WB1 G;  3IKJ A;  1ICF B;  3K7A B;  2P5Z X;  3KF8 B;  3E0E A;  5C4H A;  1SE8 A;  2EQS A;  4DV6 L;  3WWV A;  2JEA I;  3SK5 A;  3N6R A;  5E1F A;  3M9B A;  1PYB A;  1TS4 A;  4A3L G;  2EE1 A;  4AYB B;  2FIN B;  4WOR A;  4C3I B;  3S17 B;  4UPA A;  1F2M A;  4DV1 Q;  1T9H A;  1VQ8 A;  4DNR B;  2F0D A;  1LTR D;  3PQI A;  1YIT A;  1A3U A;  2I07 B;  4PNY A;  1B2T A;  2NWG A;  3GTO B;  4GLX A;  1N33 L;  2JJQ A;  5M5X B;  3CD6 A;  4GKK L;  1Z7T A;  4A3G B;  1JB3 A;  3GP7 A;  4CJ0 B;  5K5P A;  2HIV A;  4DAY B;  2JA8 B;  1NY4 A;  4A3C H;  1PH3 A;  1JOK A;  4FF4 A;  1TKW B;  4GS3 A;  1SXT A;  4A3L H;  4KK7 A;  2HDL A;  3GQB A;  4ILW A;  3M85 A;  2AMC B;  1O78 A;  2JXM B;  4IN3 A;  2L12 A;  4K5X A;  3GV3 A;  4PZ8 A;  1ESF A;  1YJN A;  2SOB A;  5J22 A;  5IOC A;  1ILQ A;  1YNJ D;  4X2E A;  1FGB D;  4XYO A;  4KHP Q;  5IP9 G;  3CW2 C;  2K32 A;  1G29 1;  4KTA A;  1B9M A;  4X66 Q;  3PCO B;  2X6L A;  2MO1 A;  2KCT A;  2NUC A;  2F0M A;  2BH8 A;  1SYC A;  3IL8 A;  1B9N A;  3HS0 C;  4KI0 A;  5C6A A;  1QZH A;  5HY6 A;  1JR0 D;  4P75 A;  2RHQ B;  5KNC A;  1ET6 A;  3G6E A;  3O13 A;  4NKL A;  1Y1W H;  1T5X D;  4IOA A;  5E7N A;  5IP9 H;  3NQI A;  1LT4 D;  3R3O A;  4UP8 A;  1D5X C;  1PZJ D;  2AQ1 B;  2B8G A;  4JI5 L;  2K1B A;  2K5N A;  1IZ6 A;  1MSG A;  3I3C A;  1EUJ A;  3BVZ A;  2K5Q A;  2NVX H;  1OTC A;  2RSN A;  3ITP A;  4X62 L;  3D0F A;  1EYA A;  4EVO A;  3W1G A;  3PO3 G;  1JOQ A;  2L11 A;  2XRQ D;  4ITR A;  2R61 A;  1SRU A;  3U4Z A;  4OWW B;  5CGK A;  1LO5 D;  3QB3 A;  3UDX A;  1YJ9 A;  4BY1 G;  1SND A;  2A6E C;  3S1N H;  2NVY B;  4BS9 A;  3BZD B;  5ELN A;  1SSO A;  1HNX Q;  3CHB D;  1XMQ Q;  1II3 A;  4FF1 A;  3HKZ B;  4FVM A;  5HGQ A;  1LYL A;  2AWO A;  1ENA A;  4LF7 L;  1NMG A;  4RCN A;  5ELO A;  3K0X A;  1EYD A;  1A3V A;  3GDE A;  3PO3 H;  4J15 A;  2B8F A;  5C3E B;  3DM3 A;  2Z9H A;  1R9T B;  4IZ8 A;  1VQ9 A;  2QDL A;  1XTD A;  4N9P A;  4JYA L;  3K5M A;  4ALP A;  4RHR A;  1BR9 A;  1F2Z A;  4BY1 H;  5C4X B;  1WYD A;  3VDY A;  5FO7 B;  4YWK A;  3TBI B;  4PQX A;  2RKS A;  4JBW A;  1CHP D;  1TWF H;  4ZUJ A;  4OXP A;  3RR5 A;  2E8G A;  4NXN Q;  2ZTE A;  3S1R H;  1VQG A;  3OWF A;  2OWO A;  1FNU A;  4A76 A;  1CZG A;  3GTM H;  4QCL A;  5JJZ A;  5I2Y A;  3ERS X;  4DFA A;  1J5E Q;  4AQY L;  4GOP C;  3TQY A;  2BE5 C;  1PLF A;  1YEZ A;  4QUC A;  4X2C A;  1S40 A;  1GHK A;  1H9S A;  3TS0 A;  3C46 A;  1HNW L;  1Y8N B;  1LAB A;  2N88 A;  2DGY A;  1PH2 A;  4V19 0;  3BVG A;  4TKO B;  2MP1 A;  1HNZ L;  3J81 i;  3I4M G;  1B3Q A;  1WD0 A;  2K04 A;  4I7Z C;  1YNN C;  1PTO F;  5JAV A;  4RFB A;  1D7Q A;  3SEB A;  2WAQ B;  1K8G A;  3ND8 A;  1Q90 A;  2LSS A;  4BWG B;  2M9V A;  4U0Z A;  1K8M A;  1BF4 A;  2YYZ A;  4RCO A;  3VYU A;  4C2M B;  1I50 B;  1TT2 A;  2RDG A;  1IYU A;  1PTO B;  4U0U A;  2SNM A;  4NDX A;  3M3Y B;  3JAM i;  3KFU A;  3GTJ B;  4LUO A;  1EQQ A;  3I4M H;  4CGY B;  4R1J A;  4B9W A;  5CKL A;  2A19 A;  5JVH 3;  1CI3 M;  2V4D A;  4UAI A;  4FYD A;  1Q86 C;  4JI6 L;  2JYO A;  3PV0 A;  4ZKB B;  2F4V L;  4LMQ D;  2UUC L;  3EJI A;  2NB0 A;  3FPU B;  2K5H A;  4LFB L;  1JQY D;  1ZYR D;  4DN4 M;  4EQ5 A;  2JEB I;  1BCP C;  5M5W B;  1TS2 A;  1NBW A;  1HH2 P;  3J80 i;  1TS5 A;  3BDO A;  3NBI A;  2JSO A;  1IL8 A;  3LWE A;  1TVX A;  2KHJ A;  2OQK A;  4BY7 G;  1EQV A;  1L1O C;  2C9O A;  3RZO B;  1STG A;  3EBE A;  1FNW A;  2K75 A;  4DKA C;  2IPK D;  4YCV A;  1G6P A;  3G7L A;  3H0G G;  1A2T A;  3S2D H;  3HGB A;  2PW7 A;  3RLO A;  4HJ7 A;  1XWE A;  3NBH A;  5I9P A;  4XQN A;  3A8I E;  3QG1 A;  3IFD A;  4EQO A;  3I55 A;  1OXV A;  3L9A X;  2O2L D;  4J8Q A;  4BA1 I;  4KD4 A;  3CAM A;  4X65 Q;  3MXU A;  1OXT A;  4X3S A;  1K3B C;  4WRD A;  4F87 A;  2L4N A;  3URY A;  2UUB L;  4LK1 C;  4RKB A;  4RWS C;  4K0K L;  1P16 A;  2DY8 A;  2AWN A;  3DWQ A;  1SE3 A;  4CHT B;  1JWM D;  1Y69 U;  1VQL A;  1LT5 D;  3H0G H;  3TP8 A;  5BN4 A;  1JE4 A;  2N55 A;  3CCJ A;  3J7A F;  2AUK A;  2A73 B;  2YU9 H;  5LL6 S;  1WFQ A;  1D6E C;  1JE5 A;  2EYO A;  4J1M A;  3HRZ C;  1GUT A;  3SK4 A;  1LTG D;  5IGF A;  1KDB A;  1H9S B;  3TP7 A;  3ZLM A;  4LF7 Q;  2R7F A;  1TWA H;  1VF7 A;  1NSN S;  3AMU A;  2WV6 D;  2F0T A;  5GAE C;  4K8I A;  1RTN A;  4CDD C;  1VCI A;  2F3W A;  1SMY C;  3HOU G;  3UE0 A;  1U4P A;  3MVV A;  4GKJ L;  1Q81 C;  1MD2 D;  3CU7 A;  2E74 C;  3I70 A;  1VQF A;  1EIG A;  2WKC A;  2ZM6 L;  1CA6 A;  4GNX B;  3C2P A;  3QOJ A;  1A62 A;  1YVC A;  1G51 A;  1AN8 A;  2B2Y A;  3PO2 G;  1X3P A;  2R92 G;  2Y0S E;  1EWC A;  5C4Z A;  4MTK A;  4B3M L;  3T56 B;  1YHB A;  4C3J H;  2I0Q A;  2PNR C;  1HR0 L;  2I5L X;  2OXP A;  1N36 Q;  3HOU H;  2A69 C;  1PDQ A;  4RH6 A;  1DD2 A;  2R93 B;  4K5V A;  1HNW Q;  3D4D A;  1BQQ T;  3GTQ B;  4R8N A;  1XNQ L;  1XXG A;  2CW0 C;  1HNZ Q;  4DK3 C;  1ESR A;  3PO2 H;  1CKN A;  1FYC A;  5EKL A;  2OTL A;  2R92 H;  1G91 A;  3PO2 B;  2EY2 A;  1M8A A;  3TDQ A;  1QE6 A;  3RUZ A;  2K50 A;  3BZK A;  2NTT A;  2Q8R E;  4HAE A;  5I9O A;  1SYB A;  2RCN A;  4I65 A;  1I6H B;  1GM5 A;  2Z6K C;  1SR3 A;  1WTW A;  4QIW E;  2KED A;  2KQ3 A;  5JVG 3;  4OIK A;  3OWE B;  3L0O A;  3BZC A;  5IGB A;  3TN2 A;  3Q22 A;  1SE2 A;  5A2Q E;  3NEL A;  4FXG C;  4BBR B;  1CFM A;  1SLJ A;  1ICW A;  3NSW A;  3NBH B;  1RIP A;  5GAH C;  2PO4 A;  3S1Q H;  4DR1 L;  1HZ9 A;  1VQM A;  3A55 A;  2ZTD A;  1PV4 A;  1V1Q A;  4WJ3 M;  5CV9 A;  5D14 A;  4V0B A;  1VQO A;  4EQN A;  4JI6 Q;  5M3F G;  3CCU A;  4L8J A;  2Z6B A;  3FKI B;  1UE6 A;  3OMC A;  4IPC A;  2F4V Q;  3HOZ B;  2RVL A;  4C3H H;  2E2J B;  2UUC Q;  3GTG H;  1CKO A; 
#chains in the Genus database with same CATH homology
 2VY3 A;  1Z47 A;  4L5T A;  4U0S A;  4QY7 A;  3HOW G;  1K3R A;  2IT1 A;  3W5O A;  4B3T Q;  4JOI A;  2IHE A;  4P74 A;  4PZ6 A;  4APV A;  1NE3 A;  5M5Y H;  3CCS A;  4HJA A;  1V9P A;  3S24 A;  1K73 C;  1S3O A;  3HKZ G;  1IBK L;  1YNX A;  1W3S A;  3CCQ A;  3TEH B;  2K4K A;  4GN5 A;  2NVT H;  4WJ4 A;  2QA4 A;  1MKH A;  2I5H A;  1PH7 A;  2D0P A;  2DUD A;  4DR3 L;  4NPS A;  4U04 A;  4RMF A;  1EFW A;  4DR1 Q;  3GTP H;  4OWX B;  2VQF Q;  3S16 H;  2HIX A;  2PMZ E;  4NXN L;  4A93 H;  1KRS A;  3MEF A;  4IJL A;  1N32 L;  4O0A A;  1WOC A;  1CKM A;  4L5S A;  1UEB A;  2WB1 G;  2VUM H;  5FJ8 G;  1TWH H;  4KHZ A;  1FJG Q;  3KF8 B;  3E0E A;  5C3E G;  1IXR A;  3ULJ A;  4IOC A;  3CP0 A;  5GAD C;  1SE8 A;  2EQS A;  3HOW H;  4DV6 L;  1XJV A;  4LFC L;  3WWV A;  1UE5 A;  2CCZ A;  2NVY H;  2XGT A;  3DLL A;  2NN6 G;  2VS1 A;  4A75 A;  4L5Q A;  2JEA I;  1VQ5 A;  1LUZ A;  3M9B A;  4A3B G;  1PYB A;  3KLW A;  4P73 A;  3F2B A;  1I5F A;  4A3L G;  2PQA A;  3NEM A;  1A63 A;  3U50 C;  1FGU A;  4DK6 C;  4XTC S;  2UUB Q;  1SFO H;  4A3J G;  1M90 C;  3J7Z C;  4UPA A;  5IWA Q;  1HNX L;  4WGJ A;  4DV1 Q;  4LF5 L;  1T9H A;  1VQ8 A;  4K0K Q;  1AE2 A;  3JC6 6;  3G4S A;  4KHP L;  5GRO A;  2N49 A;  4JI7 L;  1YIT A;  4LUZ A;  4UP9 A;  2CWP A;  4IPG A;  5FJ8 H;  1NMF A;  2R7Z G;  4GLX A;  1VQK A;  1N33 L;  1N32 Q;  4PMW A;  5C3E H;  4N67 A;  2JJQ A;  3PGZ A;  4QL5 A;  4OO1 I;  1P8L A;  4MZ9 A;  2UXB L;  3ULL A;  1OXX K;  1I94 L;  2ES2 A;  4QGU A;  3CD6 A;  1CSQ A;  4GKK L;  4DR5 Q;  1E7Z A;  2HIV A;  1K8A C;  4B3S Q;  4DAY B;  1PYS B;  1VQE A;  1NY4 A;  1PH8 A;  4A3C H;  4XIG S;  4A3F G;  2CWA A;  3AYH B;  2R6G A;  4U07 A;  4DV6 Q;  4GOP B;  1PH3 A;  1IBL Q;  3S15 H;  4GS3 A;  4A3B H;  1KAW A;  4PY3 A;  4A3L H;  1AE3 A;  3SGI A;  5FLM G;  4TVA B;  4HJ9 A;  2VZA A;  3T1Y L;  4JI4 Q;  1X65 A;  4UY8 C;  3GD7 A;  3M85 A;  3KJO A;  2AMC B;  3CXC A;  4A3J H;  1CKN B;  2VW9 A;  4BXX G;  3CQZ H;  5FLX c;  4PZ8 A;  1YJN A;  1VQD A;  4JI1 L;  4GKJ Q;  4OON A;  4GOP A;  2IY5 B;  4LFA L;  4X2E A;  3K8A A;  1XPU A;  2R7Z H;  4KHP Q;  3RN5 A;  2N3S A;  2K14 A;  2WAQ G;  5IP9 G;  1VQ4 A;  2OTJ A;  1I3Q H;  3CW2 C;  1QVC A;  2LXJ A;  5C0X I;  1V43 A;  2OCE A;  1HJP A;  2VL6 A;  1G29 1;  2ZM6 Q;  4HIK A;  1EWI A;  3A5Z B;  3KJP A;  5JFF A;  1N33 Q;  4X66 Q;  3PCO B;  2MO1 A;  4HJ8 A;  2KCT A;  2UXB Q;  4AYB E;  4A3F H;  4DR6 L;  4GKK Q;  3M4P A;  2BH8 A;  3PF4 A;  4X6A H;  1XMO Q;  2GVB A;  4B3M Q;  4LU4 A;  2EXD A;  2N78 A;  4KI0 A;  5FLM H;  1QZH A;  1KQS A;  2ASB A;  5HY6 A;  3J7A 5;  2IX1 A;  4LF4 Q;  4P75 A;  4JI2 Q;  2RHQ B;  4FDB A;  2VQE L;  4DV2 Q;  2YV5 A;  3I4N G;  4BXX H;  3I4O A;  3ULP A;  3SN9 A;  1IL2 A;  3G6E A;  3ER0 A;  1Y1W H;  1Q8K A;  3W1B A;  3IRB A;  4A3K G;  1N9W A;  4IOA A;  5E7N A;  5IP9 H;  3LGJ A;  4DR7 L;  4DUZ L;  4UP8 A;  1U5K A;  4LW1 A;  4LNQ A;  3PUY A;  4JI5 L;  3K80 C;  4C2M H;  1I50 H;  1HZB A;  4MNO A;  1XNQ Q;  3SE5 A;  4LF6 L;  2RF4 A;  2UU9 Q;  3CUC A;  3B6Y A;  2K5N A;  1IZ6 A;  3M7N A;  3M3Y H;  1EUJ A;  1FL0 A;  5BR8 L;  3GTJ H;  3UDF A;  2NVX H;  2FXQ A;  3I7F A;  3ZJY C;  3GTQ H;  1OTC A;  3S2H H;  4JOI C;  2AHO B;  5JJ7 A;  2BA0 A;  3J81 c;  5LMN L;  4X62 L;  3D0F A;  1GD7 A;  1L2F A;  1EIY B;  4BA2 I;  2UXC L;  4OX9 L;  4RG1 A;  3W1G A;  3M4O H;  2H5X A;  1E22 A;  3GO5 A;  3PO3 G;  4R4I A;  4A3K H;  1GVP A;  4ITR A;  2JA5 G;  2UXD L;  4ME3 A;  1SRU A;  4LUV A;  3U4Z A;  2MNA A;  5GAG C;  4OWW B;  2JE6 I;  1Q7Y C;  3UDX A;  1YJ9 A;  4BY1 G;  3S1N H;  2GVA A;  3UDG A;  2ALY B;  1VQP A;  1N8R C;  4JI5 Q;  2NZO A;  5ELN A;  4HIO A;  1JMC A;  1HNX Q;  1E1T A;  1XMQ Q;  1OXS C;  4BBS G;  3I56 A;  1C0A A;  5HGQ A;  4C3H H;  2HHH L;  3NEN A;  5M5W H;  1D8L A;  4P71 A;  4X64 L;  4POG A;  2JA6 G;  4JI8 L;  1L1O A;  2C35 B;  3JAM c;  1LYL A;  2AWO A;  2F3I A;  3G71 A;  1PH1 A;  3D31 A;  2E5L Q;  3I2Z A;  4LF7 L;  1NMG A;  1OXU A;  2F52 A;  4B3R L;  2F6S A;  2Y0S G;  5ELO A;  4JV5 L;  3L2P A;  3K0X A;  2PQA B;  4YY3 L;  3BU2 A;  4JG2 A;  3RZD H;  5IYC G;  3RZO H;  3GDE A;  4LF9 Q;  4QJF A;  4DV7 Q;  4IFD G;  1J5E L;  3PO3 H;  4A3D G;  3EIV A;  4X62 Q;  2K5V A;  2VNU D;  4J15 A;  2JA5 H;  1LM0 A;  2UXC Q;  4BY7 H;  3DM3 A;  1VQ9 A;  3FP9 A;  4A3C G;  1XTD A;  2ID0 A;  4JYA L;  4ALP A;  2E2H H;  5CGL A;  3PIP A;  3UE1 A;  4BY1 H;  1DGS A;  4QQB X;  1L0W A;  3F2C A;  1JJC B;  1WYD A;  3VDY A;  1Q82 C;  3HOZ H;  2ZTC A;  1IBK Q;  4Y7N H;  4YWK A;  4LF8 L;  4BBS H;  5DLQ E;  5LMU L;  2K52 A;  4AIM A;  1XPR A;  2JA6 H;  4DR3 Q;  3CCV A;  1MJC A;  3HFZ B;  4R4C A;  4JBW A;  3OW2 A;  1TWF H;  1KC8 C;  3CCM A;  1EYG A;  1C9O A;  4OXP A;  4YWM A;  3RR5 A;  2E8G A;  4NXN Q;  1PHJ A;  2ZTE A;  3S1R H;  1VQG A;  2JA7 G;  2OWO A;  1K83 H;  4GN4 B;  4A76 A;  5IYC H;  3GTM H;  4JI3 L;  1PA6 A;  3RN2 A;  4YHH L;  3AQQ A;  1TXY A;  4A3D H;  1MJE A;  4YY3 Q;  4A3E G;  3HKS A;  1Y1V G;  3FHW A;  3ERS X;  4H02 A;  1J5E Q;  4AQY L;  4GOP C;  2UUA L;  3TQY A;  1YEZ A;  4X2C A;  1S40 A;  4LFC Q;  3HKZ E;  2MO0 A;  1X55 A;  3TS0 A;  3H3V I;  1HNW L;  3S14 H;  3ZC7 A;  3KF6 A;  2DGY A;  1PH2 A;  4JYA Q;  4DV3 L;  2G03 A;  4AH6 A;  4DUY L;  4IFD J;  3CPF A;  1HNZ L;  3J81 i;  3PUZ A;  4YCW A;  3I4M G;  1VQ7 A;  2HT1 A;  2ZJR A;  4L5R C;  4LWC A;  4LF5 Q;  5IYB G;  1Y1W G;  4DR4 L;  2WB1 E;  2AKW B;  1B7Y B;  1JJ2 A;  1GKH A;  4JC0 A;  5IT9 c;  1EOV A;  4JI7 Q;  2IHF A;  4JBJ A;  2JA7 H;  5JJK A;  2NZH A;  3PSI A;  3K81 C;  2Z0S A;  4HJ5 A;  1KRT A;  1J6Q A;  1D7Q A;  3LET A;  2WFW A;  2Q2T A;  1H95 A;  3STB C;  5IY0 A;  4A3E H;  2KBN A;  1YI2 A;  1K8G A;  2LSS A;  1Y1V H;  2R93 G;  5K36 G;  2HQL A;  4U0Z A;  4YHH Q;  1I94 Q;  1PH9 A;  4DV5 L;  1MIU A;  1YBY A;  3S6A A;  2YYZ A;  3KDF A;  3HOX G;  2Q2U A;  1QVF A;  5IYD G;  5EU0 A;  2B63 G;  4JI0 L;  3GTO H;  1E1O A;  4AQY Q;  4IO9 A;  1X3G A;  1PH4 A;  4U0U A;  2Q2H A;  3JAM i;  3KFU A;  1A0I A;  5M5X H;  5M3M G;  1VQB A;  4LUO A;  1X6O A;  3T1Y Q;  1EQQ A;  4A3G H;  3I4M H;  4R1J A;  3T1H L;  2CQO A;  5IYB H;  1WI5 A;  5CKL A;  2MFI A;  4OWT B;  4OO1 G;  2A19 A;  1K0R A;  3PIO A;  1M1K C;  4JI1 Q;  1N34 L;  2NVQ H;  1X9N A;  3CME A;  1TWC H;  4LFA Q;  1YHA A;  1PVO A;  1YZ6 A;  2JK8 A;  2KEN A;  1Q86 C;  1WJJ A;  3PV0 A;  5GQO A;  4JI6 L;  4Y52 H;  4PG3 A;  3STB D;  5LMN W;  1QUQ B;  1VQN A;  2R93 H;  3CC7 A;  1Q1B A;  2F4V L;  1JB7 A;  3OTO L;  3HOX H;  4YCU A;  3K7U C;  4GLA C;  2UUC L;  5IYD H;  2B63 H;  2A1A A;  4DR6 Q;  1TWG H;  2K5H A;  3PF5 A;  4LFB L;  2YTV A;  4B3T L;  3M4Q A;  2I5M X;  4BBR G;  5EAY A;  4X65 L;  5M3M H;  4EQ5 A;  4JI0 Q;  2JEB I;  3RLF A;  1QUQ A;  1NBW A;  1HH2 P;  3SHG A;  2Z6K A;  3J80 i;  3ICE A;  2VQE Q;  5C0X G;  2KHJ A;  3ZCB A;  2OQK A;  3AFP A;  1PH5 A;  2NN6 I;  2OQ0 A;  4BY7 G;  1I6H H;  2VQF L;  3CPW A;  1KXL A;  1L1O C;  1L1O B;  3EBE A;  1Z9F A;  2K75 A;  1W2B A;  4DKA C;  3U58 A;  4DR7 Q;  4YCV A;  4DUZ Q;  3FKI G;  1G6P A;  3H0G G;  4DV4 L;  1PFS A;  1ASY A;  3H3V H;  3HOZ G;  1KD1 C;  1VQJ A;  3S2D H;  1QZG A;  3UDI A;  1C7Y A;  1FJG L;  2EIF A;  3RLO A;  4HJ7 A;  5J3B A;  3PUW A;  4LF6 Q;  3CF5 A;  1IYJ B;  2Q2I A;  3EN2 A;  4DV0 L;  4DR2 L;  4NXM L;  1YIJ A;  4NB3 A;  2PI2 A;  4X2D A;  3OTO Q;  5BR8 Q;  4BBR H;  2CFM A;  1OXV A;  3I55 A;  2MQH A;  1UE1 A;  4BA1 I;  3G48 A;  5JEA G;  1K9M C;  1A8V A;  3CCE A;  3CAM A;  4X65 Q;  2RHS B;  2WP8 J;  1OXT A;  5LMN Q;  3A5U A;  2KCM A;  5CMT A;  2UUB L;  2L15 A;  3E9H A;  4A4I A;  5IWA L;  4DV1 L;  4OX9 Q;  3AEV A;  4K0K L;  1P16 A;  1YHQ A;  5AJ3 L;  2AWN A;  4P72 A;  2UXD Q;  1VQL A;  3FKI H;  3H0G H;  3U4V A;  5H1S E;  3CMA A;  5JFZ A;  1X56 A;  3CCJ A;  4A3I G;  5C0X J;  5M3F H;  1B8A A;  4R4T A;  2E2J H;  2YU9 H;  2ATW A;  2BH2 A;  1WFQ A;  1X3E A;  4R4Q A;  4DV4 Q;  1JE5 A;  3TS2 A;  5JJL A;  1XNR L;  1X3F A;  3MXN B;  2XTI A;  4DR5 L;  4GLV B;  3A74 A;  4B3S L;  2D62 A;  4DV0 Q;  4DR2 Q;  4X64 Q;  2HHH Q;  4NXM Q;  2GN5 A;  4JI8 Q;  3J80 c;  4JV5 Q;  3ZLM A;  1QVG A;  1IBL L;  4IPD A;  4LF7 Q;  2R7F A;  1TWA H;  5C4X G;  3KF6 B;  1X54 A;  4B3R Q;  2PI2 E;  4AYB G;  1HZC A;  3CCR A;  4JBM A;  4JI4 L;  1EQR A;  5GAE C;  3CCL A;  1N36 L;  3HOV G;  1VCI A;  3AFQ A;  4LFB Q;  1Y14 B;  4KLK A;  3HOU G;  3UE0 A;  1VQI A;  4GKJ L;  2ZJP A;  1Q81 C;  5JEA J;  1S72 A;  3K7A H;  1UWV A;  1FVI A;  4A3I H;  5C4J H;  1HZA A;  5AJ3 Q;  2D0O A;  3L7Z C;  2ZJQ A;  1AH9 A;  3S1M H;  1VQF A;  2ZM6 L;  4GNX C;  4GNX B;  3Q8D A;  1VQ6 A;  3PUX A;  4A3G G;  4DAM A;  1KIX A;  2YTX A;  5JJI A;  1A62 A;  4X66 L;  1YVC A;  1R9T H;  4LF8 Q;  2JA8 G;  1G51 A;  3OYY A;  3GTK H;  1JT8 A;  4R4O A;  5LMU Q;  1HR0 W;  3PO2 G;  3CC2 A;  1IBM L;  2R92 G;  2Y0S E;  3KDF B;  4UP7 A;  2JQO A;  4DPG A;  4TQU S;  4IPH A;  3CC4 A;  1VQA A;  1WCM G;  1XNR Q;  5C44 G;  1XMO L;  4B3M L;  5C4X H;  2BA1 A;  3F2D A;  1UE7 A;  1YHB A;  2B3G A;  4GNX A;  3S17 H;  4C3I H;  4DNI A;  1KHI A;  1XPO A;  2PNH A;  4LF4 L;  1GO3 E;  3HOV H;  4C3J H;  4DV2 L;  2I0Q A;  4JI2 L;  4JI3 Q;  1HR0 L;  2I5L X;  4YWL A;  2YTY A;  1N36 Q;  3HOU H;  1CUK A;  4JCV E;  3F8T A;  1E24 A;  1RL2 A;  3H15 A;  1BVS A;  2UUA Q;  4XI8 A;  2V1C C;  1B70 B;  4JBK A;  1JJG A;  4EX5 A;  1ASZ A;  1HNW Q;  4DV3 Q;  1LTL A;  1XNQ L;  1Q1E A;  1E3P A;  4DUY Q;  2JA8 H;  1HNZ Q;  4DK3 C;  3PO2 H;  1CKN A;  4M16 A;  2UU9 L;  2OTL A;  4A3M G;  2R92 H;  2B29 A;  3RLN A;  1WCM H;  2A8V A;  3HOY G;  5C44 H;  4DR4 Q;  1IBM Q;  2K50 A;  1SRO A;  3BZK A;  1NTG A;  4HIM A;  1Q12 A;  3RNU A;  2JA9 A;  2KHI A;  2RCN A;  1BBU A;  1Q46 A;  3J81 j;  1GM5 A;  2Z6K C;  5IP7 G;  1SR3 A;  4QIW E;  4IJH A;  3PUV A;  1HR0 Q;  3GTL H;  1CSP A;  3L0O A;  1O7I A;  4DV5 Q;  3BZC A;  2E2I H;  1SMX A;  3E9I A;  1BBW A;  2IX0 A;  3KYH C;  4MTN A;  4IFD I;  3NEL A;  1SLJ A;  4A3M H;  1U0L A;  5IE8 A;  3NBH B;  2CKZ B;  1RIP A;  5GAH C;  2WAQ E;  2QEX A;  3T1H Q;  1XMQ L;  1NJI C;  1SN8 A;  4DR1 L;  3HOY H;  1HZ9 A;  1VQM A;  3S1Q H;  4POF A;  1BKB A;  2ZTD A;  1PH6 A;  1VQC A;  3KOJ A;  1V1Q A;  1PV4 A;  1N34 Q;  2E5L L;  3TRZ A;  4WJ3 M;  5JJ6 A;  1VQO A;  4A93 G;  1EIF A;  3BJU A;  5IP7 H;  4JI6 Q;  5M3F G;  4O2D A;  2N8N A;  1KL9 A;  3F1Z A;  3CCU A;  3N3U A;  4GN3 B;  3TRE A;  2VUM G;  2LXK A;  4LF9 L;  3I4N H;  1UE6 A;  4DV7 L;  3A0J A;  4IPC A;  1YJW A;  2F4V Q;  4HID A;  2R7D A;  1VQH A;  4PZ7 A;  2QGQ A;  2UUC Q;  3GTG H;  1CKO A;  1VS0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...