2VZAA

Type iv secretion system effector protein bepa
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
TEIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPKAHHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
source organism Bartonella henselae
molecule tags Cell adhesion
molecule keywords CELL FILAMENTATION PROTEIN
total genus 91
structure length 296
sequence length 296
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2vzaA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vzaA02
2F52A 3PIOA 1EQRA 4U0ZA 4GNXC 1VQ4A 1IBLQ 1QUQB 1E1OA 2JEBI 1L0WA 4A3JG 3GTOH 1VQGA 1UE5A 1Z9FA 4P71A 4X66L 5IYBG 2VW9A 3I4OA 1VQKA 4ITRA 5M5WH 1IL2A 4B3TL 4DV4Q 1K83H 4JBKA 2N3SA 4A3CH 4WGJA 1IZ6A 1YVCA 2UUCL 1YITA 5EAYA 4BXXG 2R7FA 4BBRG 3M4PA 4POFA 2Y0SE 4BY1H 3LGJA 3T1YQ 1IBMQ 4GOPC 3KYHC 2AHOB 3U4VA 4YCWA 1V43A 5GAEC 1HNWL 4LUVA 1G6PA 4UPAA 1V9PA 3HOYG 2ID0A 1S40A 4LF9Q 5M3FH 3PUVA 4KHPQ 1Q86C 3G71A 1B70B 4JBWA 1K9MC 4UP8A 1BBUA 3CC7A 2K50A 1PH2A 3DLLA 5C0XG 2ATWA 1IXRA 1YIJA 4JI1L 4JCVE 4DAYB 4DV7Q 1JJCB 3PUWA 1EOVA 1NTGA 1X6OA 1NE3A 2RHQB 4DR2Q 4Y7NH 1VQMA 4DR4Q 4DUYQ 1NMGA 4LFAQ 5M3MH 3CMAA 1XMOQ 4JBJA 5ELNA 3VDYA 4GNXB 1Q81C 2NVQH 3I2ZA 3TS0A 2VUMH 1FJGL 2JA8H 2CQOA 4BA2I 1YHBA 4DR3Q 2UXCL 5M5YH 1PV4A 2Y0SG 3F2BA 2OWOA 1KAWA 1VQHA 2BH8A 4X64L 1AH9A 2AWNA 2Z6KA 4R4IA 1XMQL 2JA5H 1BBWA 4GOPA 4C3HH 4DR5Q 3CP0A 3KDFB 3GTMH 4FDBA 1NBWA 3HKSA 1L2FA 4R4OA 2UUBL 2A8VA 3GDEA 1UEBA 4MTNA 3KOJA 4RMFA 2JEAI 2R7DA 1XPRA 4LUZA 2QA4A 3CW2C 2PMZE 4A75A 5FLMG 3G6EA 5ELOA 1CUKA 1GKHA 4C3JH 1Q46A 4NXNL 4DUZL 4P73A 1Q12A 4P75A 3CCVA 3HOUG 1VQCA 3HOUH 3J7A5 4DR5L 4GN5A 3ULJA 4LU4A 4A3MG 4A93G 3CCSA 4A3EH 1R9TH 4B3SQ 2JK8A 4B3ML 3KJPA 1BKBA 4B3MQ 5CMTA 3FHWA 3K80C 4A3CG 1UE1A 3KF6B 2ZTCA 3PIPA 4HIDA 1C0AA 3CPFA 4DK3C 5GAHC 4NXNQ 3PO2H 1PA6A 1QVCA 1N32Q 2MQHA 1JE5A 5C0XI 2XTIA 5HGQA 4B3RQ 4R4CA 3G48A 1OXSC 2KCMA 5IP9G 1SFOH 1I94L 1VQEA 4APVA 4DV7L 2PQAB 4DV1L 1OXVA 3G4SA 2RHSB 1N33L 2MFIA 1IBKQ 2KHIA 4QGUA 2PNHA 4KHPL 3PUYA 1AE2A 1XPOA 2Z6KC 1NJIC 1W3SA 1JJ2A 1ASZA 4POGA 1I94Q 1U5KA 1X3GA 3U50C 3L2PA 4EX5A 2VS1A 2L15A 3F2DA 2I5LX 4LF4Q 4MZ9A 1YNXA 4A4IA 3M85A 2JA6G 2VZAA 3L0OA 3RR5A 4IOAA 2GVBA 1VQPA 4A3GH 5M3MG 2UU9Q 1C7YA 1X3FA 3GTPH 4P74A 1B8AA 1CKNA 3L7ZC 5GQOA 4JI1Q 1PH7A 3CCLA 2B63G 2UXBQ 2GVAA 1VQ5A 3OW2A 3M4OH 3CCRA 1TWFH 2YU9H 2NVTH 2UXBL 4OWXB 4YWKA 1HZBA 1WFQA 3BJUA 3OTOL 3CCEA 4LF6Q 4NXMQ 2N78A 2UU9L 1A0IA 4YHHQ 1L1OC 4BY1G 3F1ZA 1N34Q 5C3EH 2JA7H 2ALYB 2D0PA 3CCUA 2CCZA 3BU2A 1E3PA 3I55A 4KI0A 3A0JA 2IY5B 2UUBQ 4JI3Q 4JOIA 2NN6I 4LF5Q 2DGYA 3HOYH 3NENA 1PH5A 2KCTA 2WP8J 1FGUA 2NZHA 2F3IA 4JOIC 3SGIA 3NBHB 2IHFA 3UE1A 4HJ5A 1Y1WH 1XMQQ 3FP9A 1X9NA 2R92G 4BY7H 4DR7L 2N8NA 3F8TA 5CGLA 4P72A 4PG3A 4AH6A 4IPGA 5C44H 2N49A 3J81i 2JA8G 1GO3E 4U04A 3H0GG 1O7IA 4DPGA 4AQYL 2UXCQ 3S1RH 2DUDA 1AE3A 4QIWE 2OTJA 3ZC7A 4DV2Q 3HOVG 1LUZA 3K7AH 4LF7Q 4LFCQ 4LNQA 3HOZH 1N32L 2ZJRA 3FKIH 5CKLA 1WOCA 1HJPA 4C3IH 3AFPA 4IPCA 4JI5Q 4LFBQ 1I50H 1TXYA 3I4MG 1HR0W 5JFZA 1Y1VG 4HIMA 2UUAQ 1I6HH 3S17H 4N67A 2E2HH 1D8LA 3SHGA 1QZGA 1EIFA 4RG1A 1QZHA 2GN5A 2H5XA 1VQOA 1WCMG 2BH2A 3D0FA 1HNZQ 1TWCH 1PH6A 1Q1EA 1N36Q 1IBLL 2WAQG 4A3BG 2WAQE 2UXDQ 5LMUQ 4A3FH 1IBML 4A3IH 3S1QH 3E9IA 4A3GG 3A5ZB 4X6AH 2PI2E 3GD7A 2XGTA 3HFZB 4GN4B 4Y52H 4BBSG 1A63A 3S16H 3PUXA 2E8GA 3M4QA 3I7FA 4OX9Q 3E0EA 2VQFQ 2ZTDA 4A3MH 3PGZA 2VNUD 4LUOA 3AQQA 5C4XG 1JT8A 5FLXc 1VQFA 1L1OA 2MO1A 3W1BA 4B3TQ 4A76A 3PO3H 3TRZA 1L1OB 4LW1A 1HH2P 1X54A 1H95A 5DLQE 3LETA 4U0UA 4YCUA 4AIMA 2ZM6Q 2I0QA 3I56A 2PI2A 2MNAA 1PYBA 1X55A 2CFMA 2CWPA 4GN3B 4IOCA 1KC8C 2QEXA 2LXJA 5IY0A 1PH8A 2NVXH 3BZCA 5IT9c 3PF4A 2OTLA 2WB1E 2E5LQ 3UDXA 4LF8Q 1E24A 4U0SA 1KL9A 4JG2A 3ER0A 1T9HA 1MKHA 2R6GA 1YBYA 4DV4L 3S14H 5IYCG 4LF8L 4DR7Q 2K14A 5EU0A 4OONA 3RLNA 3J81c 3TS2A 4U07A 3PSIA 3ZJYC 3S2DH 1RL2A 2K52A 3SN9A 4DR2L 4IFDI 4JI3L 3CXCA 3STBC 3T1YL 1TWAH 1PH3A 1A8VA 3FKIG 3T1HQ 1XJVA 3HOXG 5J3BA 3HOWH 3K0XA 4LFCL 2VUMG 2BA0A 2FXQA 3UDIA 4BBRH 4X2DA 1E7ZA 1OXXK 2D0OA 4JC0A 3TEHB 4JI2L 3S1NH 1SN8A 5IWAL 3CF5A 1SRUA 5LMNQ 3OYYA 1HNXQ 2HHHQ 1E22A 3M7NA 3CPWA 5FLMH 2UUAL 2VL6A 2IHEA 4GLXA 1G51A 1WYDA 3CCMA 3ZCBA 1MJCA 2JE6I 5IYBH 4DR6L 4KHZA 4IFDG 2WB1G 4XIGS 1XNRQ 1K0RA 4IPHA 3K8AA 4A3FG 5LMUL 1LTLA 4KLKA 3EN2A 4UY8C 3J7ZC 2YTVA 2RCNA 1X65A 2HIXA 3ERSX 3H0GH 1X56A 1HNZL 1NY4A 2A1AA 1UE6A 2AKWB 2EQSA 1GM5A 2IT1A 3GTLH 4MNOA 3ULPA 4OWWB 5BR8Q 3S1MH 3HKZG 4GOPB 3KJOA 4R1JA 4X62L 2VQEL 1IBKL 2VQFL 4IPDA 1HZ9A 1JMCA 4OX9L 3I4NG 4B3SL 3PO3G 5JJIA 3U4ZA 1XNQQ 3H15A 3HKZE 1PFSA 3F2CA 2ZTEA 4QY7A 4DR1Q 5M3FG 1MJEA 1SMXA 4PZ6A 2AWOA 1OTCA 1LYLA 4A3LH 3GO5A 3CCJA 3RZOH 4A3LG 1N36L 1VQIA 1M90C 1WCMH 4LF4L 2VY3A 3CQZH 1EQQA 1K3RA 4GLAC 2NZOA 4IFDJ 4PZ7A 1Y14B 1W2BA 2ZJPA 4ME3A 4DV5L 4HJ9A 2KBNA 3Q8DA 5IYCH 2E2IH 4ALPA 1QUQA 4DV1Q 4A3JH 3CCQA 2ZJQA 4BBSH 2F4VQ 1TWGH 4TQUS 4M16A 1VS0A 2K5NA 2BA1A 1YZ6A 1SE8A 4JI8L 1CSPA 1QVGA 2PQAA 1OXUA 2R7ZH 4DV2L 2K5VA 4YWLA 2JQOA 2YV5A 3ICEA 3WWVA 4YY3Q 4YHHL 1J5EQ 5JJLA 1N9WA 5AJ3Q 1PH1A 1PHJA 1K8AC 4JI7Q 1JJGA 4DV3Q 2Q2TA 3PF5A 2JA9A 1I3QH 1FVIA 1VQ7A 1VQBA 5C0XJ 5GROA 4JI0Q 4JI7L 4IJHA 4JV5Q 3RLFA 1DGSA 1NMFA 4DV0L 3KF6A 3AEVA 2RF4A 1HR0Q 4YY3L 2K4KA 4LF9L 5JFFA 4OO1I 2NN6G 2JA7G 1HNWQ 1Q8KA 1Y1WG 1KD1C 1UWVA 4LF7L 1YI2A 1UE7A 2WFWA 4O2DA 4LFAL 1C9OA 2K5HA 3JAMc 4DUYL 2AMCB 5IE8A 1N34L 1B7YB 3A5UA 4A3KG 3S2HH 1X3EA 2YYZA 4GS3A 2OQ0A 4DV0Q 1EWIA 1SLJA 3U58A 4GKKQ 4JV5L 3RZDH 3OTOQ 4LF6L 4NXML 3HOZG 4X2EA 4JI6Q 3D31A 1YHAA 5JJ7A 2EXDA 3DM3A 3GTGH 3N3UA 2IX1A 3KDFA 5BR8L 2B29A 1PYSB 5C44G 5C4JH 1S3OA 5JJ6A 5IWAQ 5LMNL 3I4MH 4GKKL 4DK6C 1YJNA 3B6YA 3EIVA 3S6AA 2R92H 1HZAA 3H3VH 5K36G 1CKOA 4WJ4A 1WJJA 4PY3A 3CUCA 4HIKA 3W1GA 4AQYQ 2NVYH 5FJ8H 4DR1L 3IRBA 1XNRL 2G03A 1VQLA 4AYBG 1HR0L 2F4VL 1CKNB 4K0KQ 1ASYA 1Q82C 1KXLA 1E1TA 3KLWA 4BA1I 3RLOA 4A3EG 2Q2IA 1GVPA 4X62Q 2VQEQ 1YHQA 3CMEA 3A74A 4X2CA 5IP7G 2KHJA 5IP7H 2C35B 3TREA 4GKJL 4XTCS 5E7NA 4DKAC 4X66Q 4B3RL 2LXKA 2F6SA 1VCIA 4DUZQ 3UDFA 2V1CC 1K73C 4A3BH 2ES2A 1G291 4PMWA 4HJ8A 3MXNB 3UE0A 2CKZB 1PH4A 4JI8Q 1KRSA 5GADC 3CC4A 4PZ8A 4WJ3M 3KF8B 3PCOB 1A62A 4L5SA 3JC66 2A19A 1XNQL 4BXXH 4A3DH 5C3EG 1PH9A 2UUCQ 1N33Q 1SR3A 1VQDA 2LSSA 3GTQH 1YJ9A 3PO2G 3J80i 2R93H 4J15A 4K0KL 2CWAA 4TVAB 3JAMi 4L5TA 3RN2A 4DV5Q 3PUZA 1J6QA 4DAMA 5IP9H 3RNUA 3SE5A 4BY7G 1QVFA 3M9BA 3J81j 4LWCA 3GTJH 1VQ9A 2JA6H 2Z0SA 2UXDL 4DR4L 2I5HA 1FL0A 4IJLA 2HIVA 4HJ7A 3K81C 4OXPA 1M1KC 1WI5A 1KIXA 2E2JH 4A3KH 4L5RC 3S15H 4R4QA 3CAMA 4O0AA 2ZM6L 4UP9A 3TQYA 3ULLA 2I5MX 4HJAA 4JI0L 4IO9A 1GD7A 1LM0A 1MIUA 4X64Q 3HOVH 3AFQA 2OCEA 2OQKA 3W5OA 4DV3L 2K75A 1K8GA 1CKMA 4AYBE 3HOXH 4JI6L 1I5FA 5AJ3L 3ZLMA 1J5EL 1YJWA 3NEMA 2E5LL 2Q2HA 1EYGA 4DR3L 2JA5G 1IYJB 1EFWA 5LMNW 4QL5A 1OXTA 1FJGQ 1TWHH 4HIOA 1Y1VH 2B63H 3M3YH 1XMOL 3CD6A 4JI4Q 4QQBX 3J80c 2D62A 2JJQA 2R7ZG 3HOWG 3GTKH 3NELA 4H02A 3RN5A 1RIPA 1XTDA 4DV6Q 3KFUA 5JJKA 4C2MH 4DR6Q 4YCVA 1Q1BA 1SROA 4X65Q 3EBEA 4GNXA 3S24A 3PV0A 1U0LA 5IYDG 1VQ8A 2EIFA 2HHHL 4A93H 5IYDH 4A3IG 2YTXA 4R4TA 1HNXL 3CC2A 1CSQA 1HZCA 1P8LA 2B3GA 3BZKA 3MEFA 1KRTA 5M5XH 1V1QA 3E9HA 1JB7A 2HT1A 3UDGA 4L5QA 2QGQA 4DV6L 1BVSA 4LF5L 4LFBL 1PVOA 1VQ6A 3T1HL 5H1SE 5GAGC 4OWTB 5C4XH 1EIYB 2IX0A 4NB3A 5JEAG 4JI4L 1Z47A 1EUJA 1VQAA 2MO0A 1Q7YC 4JYAL 4YWMA 4EQ5A 1S72A 4A3DG 4OO1G 4DNIA 4UP7A 4GKJQ 2R93G 3AYHB 3K7UC 5JEAJ 4JI2Q 3STBD 4XI8A 4X65L 1P16A 5FJ8G 1N8RC 3I4NH 1KQSA 2HQLA 5HY6A 4JYAQ 1VQJA 2Q2UA 4NPSA 4JBMA 1XPUA 1KHIA 4JI5L 2KENA 2YTYA 1D7QA 1YEZA 4QJFA 4GLVB 2ASBA 3H3VI 1VQNA
chains in the Genus database with same CATH superfamily
3NQIA 1EQRA 4K8JA 4C3JG 1VQ4A 3DM1A 1QUQB 4A3JG 1VQGA 1UE5A 4P71A 3MFGA 4CJ2C 2LKVA 1IL2A 1K83H 3QJYA 2RDFA 3P7JA 2R7FA 4XXEA 4POFA 2EY1A 2QCPX 3T1YQ 4OHJA 2K03A 4LK1C 4LUVA 1F9SA 1G6PA 4UPAA 1S40A 1MHWC 5M3FH 3PUVA 1B53A 1Q86C 1SNOA 1QILA 2PCFB 5C0XH 5C0XG 1S5CD 4DNTB 4JI1L 4DAYB 1JJCB 3OWEB 3PUWA 2I46A 1BO0A 1VQMA 2CW0C 5I4DA 1TKWB 1AW7A 2CQAA 1NMGA 3CU7A 4LFAQ 4CBVA 5M3MH 1XMOQ 2VUMH 2NVQH 3I2ZA 3TS0A 5CBAE 2K5QA 2A69C 1NR4A 3MHBA 3VR3A 1PV4A 3VR4A 3IKJA 4FF4A 3F2BA 3IFDA 2NVQB 5T1IA 4DR5Q 1IL8A 3C2PA 3NXWA 2UUBL 3GDEA 4MTNA 3VR2A 4LUZA 2HDMA 5M5XB 4DUZL 4NXNL 4HSPA 1Q12A 1G2TA 2FJ2A 3ZYYX 4G7HC 5EKKA 3KJPA 4B3MQ 1SBBB 1A2TA 3FHWA 3K80C 1CM9A 4HMJA 1TWAB 4KY6A 1N32Q 1QVCA 4K2KA 5I9OA 4ABNA 5C0XI 2A6HC 4B3RQ 2B2WA 4R4CA 2K32A 1LTTD 1LT5D 4IUQA 4APVA 4RKLA 3R2IA 3G4SA 1HHVA 2P5ZX 3PUYA 1XPOA 2Z6KC 3WOFA 2DNCA 1GXDC 1UAPA 1EFID 2NYZD 2SDFA 3U50C 1I94Q 2XWJB 3F2DA 1YNXA 2FMMA 4IOAA 2KHSA 1JR0D 2AQ3B 1PTOF 3OWFA 4RGOS 1EY6A 1PH7A 1WTVA 3BVZA 1VQ5A 2JSOA 4ZCKA 4DXGA 2D2CC 2QDLA 2SNSA 2UU9L 2MUYA 4KN7C 4DK1A 3H3VC 3BVGA 2JA7H 4FYDA 5ELDA 1CQVA 1E3PA 3I55A 2F0NA 2IY5B 2JYOA 2NN6I 3GV3A 4R9WA 4L63B 1I6VC 4LF5Q 2A73B 3NENA 1PH5A 2KCTA 4BY7G 5CYUA 1NAPA 3D6CA 4BY7H 1X9NA 5CBEE 4IUVA 5KNDA 3VA7A 3J81i 4U04A 3QR8A 1O7IA 5ELFA 1B3QA 3Q24A 2DUDA 2F03A 1AE3A 4QIWE 3ZC7A 1LUZA 3K7AB 4XQQA 1I4XA 5IGBA 1N32L 3FKIH 3GTGB 4FXKC 3HKZB 1PTOD 1F9RA 1TXYA 5FOBB 1HR0W 3DMUA 1II3A 3H91A 2L55A 1I6HH 2Q8TA 2E2HH 1D8LA 3DHQA 1QZHA 3TP5A 2E2JB 4C3HG 4HCEA 2BH2A 3NBHA 1OO9B 1J9OA 1IBML 4A3IH 1Z7TA 3S1QH 4XT3B 3HFZB 2XGTA 1SNMA 4BBSG 1F2LA 3M4QA 1D6EC 3I7FA 4OX9Q 1MD2D 5FLXc 1VQFA 2MO1A 4B3TQ 2LMCB 1SNCA 1HH2P 3J7YW 2C9OA 4NP5A 1KDCA 4AIMA 2ZM6Q 1SAPA 2I0QA 3I56A 2DNEA 4IOCA 1KC8C 2QEXA 2NVXB 2ZXOA 3OMCA 3S16B 3UDXA 4M1UB 4A3GB 1T9HA 3NUCA 1YBYA 1BR9A 1VF7A 5IYCG 3RZOB 3A7AB 4OONA 3RLNA 2EYLA 3PSIA 5BN4A 3P20A 1IKLA 4JI3L 1TWAH 5CGKA 5C3WA 3K0XA 4PQXA 1FNUA 2VUMG 2FXQA 1W6KA 4BBRH 1D2BA 4X2DA 1OXXK 5J22A 3CF5A 2HHHQ 1DD2A 2XWBB 2MJ8A 2UUAL 2F0UA 1WYDA 4I7AA 2C5CA 1XNRQ 1SYEA 2V4DA 2NUCA 4KV6A 1LTLA 4UDUC 3HGBA 3EVQA 2YTVA 5IODA 3J7ZC 2RCNA 3CHBD 2F0MA 1NY4A 2BCOA 2WB1B 4MNOA 2NUDA 4OWWB 3HKZG 4O1NA 1ENCA 2KVMA 3TDQA 4IZ8A 2A6ED 1XNQQ 5KYLA 4H0LC 3H15A 3F2CA 2XN9C 1KTKA 4A3LH 3A56A 4A3LG 3CRKC 3RZOH 1WCMH 4ZLTF 1EQQA 4G4KA 1LABA 5IGFA 1R4PB 2SNMA 3K5LA 2KBNA 4CDEC 3TZDA 4ALPA 2B2YA 3PIO3 1TWGH 4TQUS 2RVLA 1STGA 1S5BD 3PO3B 1OXUA 2R7ZH 4DAPA 4DV2L 2HUGA 3ICEA 4YY3Q 1VDZA 1TVXA 1VMPA 1DOKA 3D6WA 5AJ3Q 1PHJA 4JI7Q 4QB4A 3HZXA 2NB0A 1I3QH 1U4PA 1VQBA 5GROA 4JI7L 2B2VC 1DOMA 2ZXPA 1FYCA 1GUTA 1RTNA 3MTSA 1KD1C 1YI2A 1UE7A 2WFWA 4LFAL 2K5HA 4RWSC 4X3TA 1N34L 3A5UA 1KNEA 1QB5D 4A3IB 5T1GA 2E2HB 3U58A 1V1PA 4C1NK 1R4QB 4JI6Q 1GHKA 1WD0A 2EXDA 3DM3A 4WJWA 4NMZA 1F9QA 3KDFA 1PYSB 1S3OA 4GKKL 4DK6C 1B9MA 3OOCA 3S6AA 2F0GA 4IUNA 5G3LD 4WJ4A 4HTHA 1WJJA 1O7LA 1FR3A 1RDPD 5FJ8H 5IT9L 4DR1L 2O2LD 4K6LA 1HR0L 1EU3A 2JA8B 3KLWA 4BA1I 3RLOA 4A3EG 1HQRD 3CMEA 4X2CA 5EGTA 3VYRA 2HQEA 4FVMA 3X3NA 5E7NA 3EJIA 5E4XA 4V190 1K73C 4IUUA 4PMWA 3UE0A 1ZYRC 1O78A 1PH4A 1KRSA 3PCOB 4FF3A 1XNQL 4BXXH 3GTPB 2K28A 5M3MB 1N33Q 4FF2A 2R93H 5BN5A 4J15A 1PRTF 3SE0A 3SEBA 2X6LA 1GUNA 5CC4A 1J6QA 4DAMA 1F2MA 4RGNA 3SE5A 2BDOA 2F0QA 1D5ZC 1VQ9A 2Z0SA 4KD4A 1RKNA 2F0SA 1HTLD 3OW7A 4R4QA 4RGMA 2ZM6L 4UP9A 1U4LA 3TQYA 2KOLA 1BCPF 4JI0L 3BZDB 1EEFD 1GD7A 4X64Q 3HOVH 4IUTA 4JI6L 2RCFA 2B8FA 1YNJC 1J5EL 5CR3A 1NNXA 2Q2HA 2JA5G 1FJGQ 1TWHH 2B63H 1S5ED 3NTIA 3J80c 2D62A 2JJQA 2CVRA 3S17B 2PPBC 1RIPA 1XTDA 5JJKA 4C3IB 3DXJC 4C2MH 4YCVA 1SROA 4X65Q 1LT6D 3NSWA 1TWHB 2EIFA 5IYDH 1EY0A 4U68A 3BZKA 5M5XH 3MEFA 3UDGA 1HXYD 5H1SE 2NWGA 4OWTB 2IX0A 5C4ZA 2MO0A 1B9NA 2F4IA 2AUJD 4JYAL 3HOWB 3JAML 3A8KE 1QNUA 3AYHB 2JA7B 4C3IG 2VUMB 2HQLA 1DOLA 1VQJA 2Q2UA 4NPSA 4HEDA 4JBMA 3M4OB 1KHIA 2AQ2B 2L4NA 1YEZA 3MAQA 2F52A 4GNXC 1AEXA 3EROA 1LTGD 2JEBI 2F0TA 4X66L 3I3CA 4ITRA 1VQKA 4DV4Q 2L11A 1MSHA 1DZ1A 2N3SA 4A3CH 1IZ6A 1YVCA 1YITA 1EWCA 5ELBA 1H9SA 1IBMQ 4GOPC 3KYHC 2E74C 1SFOB 5C5MA 2ENBA 1B4OA 1JC7A 3GTOB 2KEEA 4JK1C 4CHTB 3G71A 4UP8A 2F0OA 3CC7A 1IXRA 1YIJA 2KUMA 3KBGA 1NTGA 2RHQB 2EYOA 4OEMB 4C3HB 5ELNA 5C4HA 2CQOA 1QE6A 4DR3Q 1Y69U 2OWOA 2IW3A 3NPPA 1KAWA 1HUNA 4X3UA 1BBWA 4GOPA 4C3HH 3GP7A 2F0JA 3GTMH 5E4WC 3SR1A 1NBWA 3HKSA 3FRPB 1UEBA 4O42A 4RMFA 1LTBD 2R7DA 1XPRA 2PMZE 4A75A 3A7LA 2RDHA 3TP6A 3RZDB 4P75A 4C2MB 3CCVA 1JWSD 1Q8IA 5FO9B 3K5MA 3CCSA 4A3EH 4B3SQ 2JK8A 4B3ML 1O7ZA 1BCPB 5I2XA 3BS1A 3MA2B 2ZTCA 4HR7B 4XT1B 3PIPA 2Y0SB 1C0AA 3J81L 3PO2H 1PA6A 1FD7D 3TSSA 1K3BC 1EOTA 1H9SB 2JP1A 5IP9G 1I94L 2HCCA 5FLXE 1AZPA 2PQAB 2B2WC 4DV1L 4RCOA 2XRQD 1JB3A 5E3FA 4WFN3 4POGA 1U5KA 1F2YA 4KJOA 2N55A 2VS1A 4EX5A 4LF4Q 4XYOA 4MZ9A 5J39A 1EYDA 4A4IA 1PFMA 4A3GH 5C3XA 2UU9Q 3GTPH 1LO5D 1I50B 2B63G 3PMFA 2GVAA 3CQZB 3T51B 1TWFH 2YU9H 2UXBL 1A3TA 3OTOL 3CCEA 4KJNA 2BDNA 2N78A 2GA4B 1L1OC 1PRTB 1PTOH 3F1ZA 4A3JB 2JXMB 3J7AV 3X3MA 2D0PA 1E2VA 3K0YA 2UUBQ 2K6AA 2WP8J 4DA2A 2R92H 2F3IA 4JOIC 1Y1WH 2IHFA 5CGLA 4PG3A 4IPGA 1ESRA 4KN4C 2N49A 5C44H 1GO3E 2OT2A 4AQYL 4EQOA 4KY7A 2OTJA 3HOVG 1U9RA 3EFXD 3HOZB 4J8QA 5CKLA 1WOCA 4IUPA 4C3IH 3A55A 4PNYA 1ILPA 1A3UA 3HOVB 1SSOA 2EYFA 1QZGA 4RG1A 1QOHA 4UAIA 1WCMG 4RAUC 5DEHA 1Q90A 1N36Q 4A3BG 1KLGD 2EPBA 3G7LA 4A3FH 1I4PA 3GD7A 1I4RA 4GN4B 3E3XA 5EKLA 1A63A 2WKDA 1JOOA 2F0EA 3PGZA 1SYCA 4LUOA 2R7ZB 2K1BA 3AQQA 1JT8A 1EY7A 2AQ1B 3TRZA 3P75A 4LW1A 5EKIA 3LETA 4U0UA 4YCUA 3SXHA 3GTQB 2NN6H 2MNAA 1BNZA 5L37A 1PYBA 1X55A 1ICFB 4ZQ3A 2LXJA 5IY0A 1PH8A 3BZCA 5IT9c 2KA7A 2OTLA 2E5LQ 5COYA 1E24A 3VR6A 1KL9A 2AUKA 1MKHA 4BBSB 1PRTD 4DV4L 3S14H 4RHSA 4DR7Q 1PYWD 2K14A 3K59A 3JAME 1STHA 2K52A 1TS2A 5D14A 3T1YL 3STBC 1PH3A 5IGEA 2K01A 3N52A 5J3BA 4C56C 4LFCL 2BA0A 2F0VA 3UDIA 2D0OA 1X3QA 4JI2L 3R3OA 3FPPA 3OYYA 3CRLC 1E22A 4A3FB 4DXFA 3M7NA 4KY5A 4IURA 5ELEA 2IHEA 2SOBA 4C3JB 1G51A 1HFGA 5KNBA 1MJCA 5IYBH 1WD1A 2R3ZA 4KHZA 4IFDG 1HUMA 2M2LA 4XIGS 5AFWA 1K0RA 2O5JC 4F87A 5LMUL 4KLKA 3I91A 3H0GH 2XSCA 1EWHA 1X56A 1HNZL 2IT1A 3GTLH 3F2UA 3VYTA 1EY8A 5KIXA 1FNVA 4X62L 1IBKL 2VQFL 1EQTA 5F2DA 1JMCA 1HZ9A 1TQOA 1XYIA 3PO3G 2B2YC 3U4ZA 1JORA 2TMPA 3HKZE 1PFSA 1LTAD 2ZTEA 4DR1Q 5M3FG 1SMXA 1OTCA 2AWOA 4EVOA 2QW7A 5DNFA 1JQYD 2HDLA 1SYGA 4LF4L 1H9MA 2EVBA 3CQZH 2NZOA 2SEBD 1Y14B 2ZJPA 4HJ9A 1PMRA 4MTKA 3LWEA 2CHBD 2XRSD 5CV4A 1TS5A 5IYCH 2E2IH 4DV1Q 1PTOB 4A3JH 2ICIA 4M16A 2N88A 3L3OC 1QVGA 5BN3A 4RKBA 2K5VA 2JQOA 2F0HA 3NBIA 4V0BA 5LL6S 3SDZA 4YHHL 5JJLA 1PH1A 5CV9A 4DV3Q 5CV5A 5CORA 1SXTA 3O13A 2EJMA 4JV5Q 3RLFA 1DGSA 3KF6A 2RF4A 1HR0Q 4YY3L 2K4KA 5JFFA 4OO1I 4H7BA 2UXDQ 1SYDA 1Q8KA 2NTSA 1CK1A 4WORA 1Y1WG 4LF7L 4A93B 1HNWQ 4Y52H 1C9OA 3JAMc 4DUYL 1SE4A 3S2HH 4A3KG 2YYZA 3H0GB 4DV0Q 4GKKQ 3RZDH 1BXTA 3OTOQ 2PZTA 5D3DA 4IALA 3K5NA 1IW7C 5C44G 1S5DD 2XNAC 5C4JH 5JJ6A 3I4MH 4PV1C 1YJNA 3E6ZX 1WTWA 3H3VH 3W1GA 4AQYQ 1HA5A 2RDGA 5IGDA 1K28A 1XNRL 4AYBG 1Y1WB 4K0KQ 1Q82C 3SK8A 1AZQA 1KXLA 2VQEQ 2L5TA 5IP7G 3HOXB 3KBXA 2C35B 3TREA 4GKJL 3BYYB 1TWGB 1HFNA 2ICEC 2IL8A 2LXKA 2F6SA 5JAVA 3UDFA 2V1CC 5LL6X 4A3BH 1JICA 3M7GA 4HJ8A 3MXNB 4WJ3M 4PZ8A 4L5SA 3JC66 4ME5A 2Q8IB 4OO1H 3QOLA 1PH9A 2A5HA 2WKCA 3J80i 2CWAA 3JAMi 4A3BB 5M9OA 3PUZA 3S1QB 1PTOC 3RNUA 3M9BA 2EY2A 4A3DB 1CT1D 2JA6H 4DR4L 1M1KC 4TKOB 4IJLA 1KIXA 2QKIC 3S1MB 4OGQC 1STBA 3S15H 4O0AA 5C4XB 1TR5A 3ULLA 3MWYW 3OSOA 2I5MX 4FF1A 2OCEA 2K05A 3I90A 1I5FA 3SK4A 5A35A 2FFKB 2CH4W 4QF4A 3NEMA 4G57A 1WTXA 1EYGA 1I4GA 3I4MB 3M3YH 1EY4A 2QF7A 2R7ZG 2E75C 1LT4D 5DM73 4H02A 4ODGA 2RKSA 1K0SA 1QWYA 1Q3LA 1T5XD 4GNXA 3A8JE 3I72A 3I4LA 3S24A 3PV0A 4A93H 1IYUA 1RTOA 2HHHL 4A3IG 1D5MC 4R4TA 3S1RB 4IN3A 1CSQA 1P8LA 2MP1A 2PZUA 2OF1A 4BY7B 1B2TA 4LF5L 1E2ZA 1VQ6A 5GAGC 1EIYB 2EE1A 1EUJA 1VQAA 4ZK9B 1S72A 2IJ0A 3GTLB 4A3DG 1J8IA 2LFNA 2R93G 4QJFA 1I3QB 3I4NH 1KQSA 1QNKA 3U9OA 5HY6A 2B63B 1HPCA 1AFPA 1V1PB 3H3VI 2ASBA 2CW0D 1X3PA 1VQNA 1QCBD 4U0ZA 1IBLQ 1L0WA 5IYBG 2VW9A 3I4OA 5M5WH 4B3TL 2A69D 2PW5A 2PNRC 5ELCA 3ND8A 5EAYA 4BXXG 4BBRG 5LHY1 4HSVA 3ERQA 4BY1H 4FP5D 1RF2D 3LGJA 1LACA 4ZRZA 2AHOB 2JN4A 4YCWA 5HURA 1TT2A 5GAEC 3ONAB 1HNWL 1V9PA 3HOYG 4LF9Q 5KNCA 5DM63 4KHPQ 4HCSA 1B70B 1K9MC 1BBUA 1SEBD 2K50A 3DLLA 2EYHA 1TWCB 2D9UA 2HCIA 1PH2A 4RA8A 1IYVA 1CA6A 2K5DA 4EQPA 2EY6A 4B08A 1NE3A 4ULLA 4Y7NH 4DR2Q 4DR4Q 1GUSA 3CMAA 4JBJA 3S2HB 3VDYA 1Q81C 4MHEA 2JA8H 1SDFA 3AMUA 5M5YH 2EXZA 3MXGA 5I6WA 2BH8A 4X64L 2AWNA 2Z6KA 3DWAA 4R4IA 1XMQL 2JA5H 3KDFB 5HGTA 4R4OA 4DF7A 3BVMA 2JEAI 5M5YB 3R8BA 4DNRB 3CW2C 3A54A 5FLMG 3G6EA 1I4QA 5ELOA 3KLRA 1VQCA 4ID6A 3J7A5 3NTKA 4S3SA 4DR5L 4KKUA 1BBXC 4LU4A 1A15A 1KDBA 2B2UA 4A3MG 1R9TH 1IKMA 4XQNA 1D1IA 3TP7A 5CMTA 4A3CG 2F1MA 4HIDA 4DK3C 5GAHC 4NXNQ 2F3WA 2FINB 2MQHA 3DUZA 1JE5A 2PZWA 4ZUJA 2XTIA 5HGQA 5C44B 1WTHA 2M9VA 1OXSC 2KCMA 4TRDA 1JE4A 1VQEA 2Z6BA 1K83B 1TY2A 1ZEQX 3C1FA 4BY1B 1N33L 1DYQA 1IBKQ 2I07B 2KHIA 3HG9A 4QGUA 1GUWA 5EBDA 3HRZC 1JJ2A 1X3GA 3L2PA 1EIHA 1X32A 4F88A 2JA6G 2KEDA 3RR5A 5D3IB 4P74A 5GQOA 4JI1Q 1SNDA 3CCLA 1KNAA 3CCRA 2NVTH 1WFQA 3AB9A 1H9JA 3KF8A 2QDBA 1A0IA 3TMEA 4YHHQ 3C3LA 1GJXA 1N34Q 5C3EH 3WDNA 2ALYB 2B39A 1R9TB 3CCUA 3BU2A 3A0JA 3DEPA 2WINB 2XIWA 1QG7A 1A3VA 3SGIA 3UE1A 4DR7L 1E0BA 3FP9A 1JJGA 4JPBW 3F8TA 5JVH3 5JEAH 4KHVA 2HD3A 3H0GG 4DPGA 4L6TB 4JVZA 5A2QE 3EA6A 4DV2Q 3K7AH 2L0CA 4LF7Q 4LFCQ 1KLUD 2ZJRA 3WOEA 4XQJA 3QO2A 4IPCA 4JI5Q 5EPLA 1I50H 4LFBQ 1EU4A 1Y1VG 1LLRD 4HIMA 5IT9E 3S17H 4N67A 2L12A 3D3RA 5J1ZA 1EIFA 4N8FA 2WACA 1VQOA 3Q23A 3NWSA 1TWCH 1PH6A 1Q1EA 1RJTA 4K5XA 1IBLL 2WAQG 3OPOA 3E9IA 4A3GG 1PDQA 2PI2E 1Z6HA 3S16H 4BBRB 5C6AA 2VQFQ 4OIJA 2B2TA 1EIGA 5C4XG 1BDOA 4OELB 2EYPA 1GHJA 2F0FA 3PO3H 2B2TC 4A76A 1EY9A 1F2ZA 2Z8LA 1X54A 5DLQE 1O80A 2R93B 2PI2A 3QB3A 4GN3B 1O7YA 5KYIA 2NVXH 1ILQA 2WB1E 4LF8Q 3ER0A 3T13A 3SHLA 2R6GA 1MGSA 4L8JA 4LF8L 3J81c 4K14A 4F8MA 3TS2A 2O5IC 2A6EC 3ND9A 4HMIA 3SN9A 1CI3M 1EQVA 1SE2A 3K58A 1EY5A 4IFDI 3OHXC 3T1HQ 2B2UC 2L1BA 1DM0B 1JWUD 3HOXG 3VR5A 3G6JB 1XTCD 1UEAB 1BCPC 4ZYSA 1V8QA 4JC0A 3TEHB 1SN8A 1XX8A 5IWAL 1L0XB 5LMNQ 1HNXQ 5FLMH 1ZXTA 4H44C 4DR6L 1ET6A 1NSNS 3MFYA 2WB1G 1LTRD 4FNFA 1LT3D 5DAUA 4A3FG 3EN2A 4UY8C 1BOSA 1XWEA 4PMBA 1X65A 2AKWB 2EQSA 1GM5A 1U4RA 4DK0A 2G5DA 1VMCA 1CZGA 3ULPA 3S1MH 3KJOA 5JJIA 2EY5A 4K2LA 1CFMA 1HA6A 1DJRD 1MJEA 1NH1A 1LYLA 1N36L 1M90C 1K3RA 4IFDJ 1W2BA 3LWUA 5IGGA 2JA6B 3Q8DA 4DGZA 2WIIB 1QUQA 3CCQA 4OL7A 2F4VQ 1ZKOA 2K5NA 5M5WB 1YZ6A 1SE8A 4JI8L 2PQAA 2YV5A 5D65A 1G91A 1B1ZA 1ZYRD 1WCMB 1PFNA 3GTMB 1TS3A 3BDOA 3PF5A 1RD9D 1VQ7A 4UHVA 1NMFA 4DV0L 3AEVA 4LF9L 4KD3A 2NN6G 2JA7G 4G7ZC 3IFTA 1SNPA 4O2DA 5FO7B 2K04A 5EPJA 1EL0A 3I4NB 1X3EA 2EDGA 2OQ0A 3H09A 1EWIA 1SLJA 4N9PA 4X2EA 1YHAA 5JJ7A 3N3UA 4RGTA 3BYTB 3ITPA 2B29A 5BR8L 1B50A 1EYCA 4CJ0B 5C4JB 3B6YA 3EQLC 5CV6A 2IWHA 1Y8PB 3CKIB 3CUCA 4HIKA 3K5OA 4P2CB 2KJXA 2NVYH 2DJGC 3IRBA 5EQ0A 2G03A 1VQLA 2F4VL 1CKNB 1PFBA 1STEA 1ASYA 3NHHA 3H94A 3FMCA 2NVYB 3GQBA 1YNJD 4FXGC 2KHJA 2EJFC 4AYBB 4X66Q 5FLXL 3V96A 5C3EB 1VCIA 2X69A 4B9WA 5KEEA 1Y1VB 1TWFB 1M8AA 2YU9B 3M4YA 3DWPA 5CV8A 2WV6D 3KF8B 1RCVD 2A19A 2F0WA 4A3DH 2H4OA 3IAYA 1VQDA 3PO2G 1HCZA 4TVAB 4LJZC 4DV5Q 4KK7A 5IP9H 1K8MA 1ONLA 2ZT9C 3OIQA 4ZAIA 4LAAA 2I5HA 1W6JA 2RBMA 1WI5A 3FPUB 4A3KH 3CAMA 1M4VA 2B2VA 3HS0C 4EQNA 3D4DA 1DCZA 5NUCA 5I2YA 3W5OA 1CKMA 2Z4HA 3HOXH 3ZLMA 4DR3L 1EFWA 4K5VA 4QL5A 1OXTA 5LMNW 2PW7A 1XMOL 5I6YA 4QQBX 1EEID 5K36H 3D4RA 3NELA 3RN5A 3KFUA 3T56B 5JVG3 1L0YB 4KMUC 1BQQT 1JCKB 2ZXRA 3J81E 5IYDG 2K7VA 1VQ8A 2YTXA 1HNXL 4J6HA 5CMDA 1QJOA 1KRTA 1GUOA 2HT1A 3S2DB 3KLSA 2A68D 4Q0FA 4L5QA 2QGQA 3HP3A 1BVSA 1YNND 2QILA 2JA5B 2XVSA 1HRJA 1Z47A 1FGBD 1WTRA 5EBCA 4OO1G 4DNIA 4UP7A 4GKJQ 3GTKB 1MSGA 4R8IA 5JEAJ 3STBD 4XI8A 3I73A 1P16A 4X65L 5FO8B 4F7XA 3M3YB 4BS9A 1RHPA 3FEWX 1MI2A 1STNA 2KCCA 2M00A 1B44D 3OMGA 2J7ZA 4U673 2MHVA 3PIOA 4MIUA 1E1OA 2VXWA 3GTOH 1Z9FA 4EGVA 2RA4A 3MVVA 1KDAA 4JBKA 2MGSA 1UNSA 4I7ZC 3SK6A 4WGJA 2UUCL 1BUVT 1G6ZA 1S5FD 4LMQD 2B8GA 3M4PA 3V2TA 1ENFA 2Y0SE 3C1EA 3C46A 2DY8A 3U4VA 1V43A 4QIWB 2ID0A 3V05A 1JWMD 4NW2A 3E5SA 1ET9A 4JBWA 4CDCC 2NTTA 2ATWA 1B3AA 4JCVE 4DV7Q 1EOVA 1X6OA 4N9TA 3HOUB 4DUYQ 2BE5D 2BOSA 3R93A 4GNXB 2CH4A 4BA2I 1FJGL 1YHBA 2UXCL 4N8X1 4GZYC 2BE5C 2Y0SG 3J7AF 1VQHA 1AH9A 1WTQA 1KABA 2RSOA 3CP0A 4CKCA 4FDBA 4DU9A 1L2FA 1PZJD 2A8VA 4RCNA 3T53B 3KOJA 3KLSX 2EYJA 3VA5A 2QA4A 3H6MA 1ENAA 1CUKA 1GKHA 4C3JH 1Q46A 4RHRA 1WTPA 4P73A 3HOUG 3HOUH 3R2TA 4IFDH 4GN5A 3ULJA 2EJGC 2RQXA 4A93G 3S1NB 1JOKA 1BKBA 1C4QA 1UE1A 3KF6B 4B9XA 4CKEA 4XYQA 3NWTA 3CPFA 2Z9HA 2IX3A 1F9PA 1SYFA 5TSSA 5IOCA 4ZKBB 3G48A 1SFOH 2KECA 3W3AA 4DV7L 1E2WA 3N6RA 1GUGA 1OXVA 2Q8RE 2RHSB 1SE3A 1LTSD 2MFIA 4ZKCB 2PNHA 1I4HA 3LNNA 1A2UA 4KHPL 2QEJC 1AE2A 1NJIC 1W3SA 1ASZA 1H9RA 4A3MB 3GTJB 2L15A 2I5LX 2EYMA 3M85A 2VZAA 3L0OA 5G3LF 2GVBA 1VQPA 1HTPA 5M3MG 1IW7D 2RSNA 1SJED 1NUCA 1C7YA 1X3FA 1B8AA 1CKNA 3BG3A 3L7ZC 2UXBQ 2H1EA 2K5WA 3OW2A 3M4OH 2PQEA 4OWXB 4YWKA 1HZBA 3BJUA 4LF6Q 4NXMQ 4X3SA 4BY1G 2O4XA 2MPMA 2CCZA 4NDXA 4KI0A 1YNNC 1CZWA 4JI3Q 4JOIA 2DGYA 1NCVA 3FDTA 3HOYH 1BF4A 1T5EA 1FGUA 2NZHA 4HJ5A 1XMQQ 3NBHB 2R92G 4J1MA 2N8NA 4P72A 4AH6A 2JA8G 1PRTC 3LX0A 2UXCQ 1RODA 3S1RH 2DY7A 3HOYB 4LNQA 3HOZH 1H9KA 2TSSA 1HJPA 1EZ8A 1JOQA 3AFPA 3TBIB 3I4MG 3Q6SA 5JFZA 2UUAQ 3SHGA 2FHTA 4K5WA 3FKIB 4FXDA 2GN5A 2H5XA 2L9HA 4DFAA 3D0FA 4DN4M 4HAEA 1HNZQ 2J4XA 2WAQE 5LMUQ 4M8AA 4X6AH 3NTHA 3A5ZB 1STYA 5C5LA 5JOBA 3PIP3 3PUXA 2E8GA 2EZVA 2NUNA 3E0EA 2ZTDA 4QMGA 4A3MH 2DN8A 2F0LA 2VNUD 3NE5B 4JW0A 2PO4A 5K5PA 5I9PA 1L1OA 3W1BA 5ISRA 4I65A 1L1OB 4HN7A 1ICWA 1H95A 4Y7NB 1LTID 1V1OA 4KTAA 1C48A 3E0JA 2CWPA 2CFMA 3MXNA 1C8CA 3KUPA 2Z4IA 3MEHA 4MN3A 3PF4A 2VB3X 1WTOA 4BWGB 5M3FB 4U0SA 4JG2A 4K8IA 4NKLA 2OXPA 4K6DA 5EU0A 4U07A 3ZJYC 3S2DH 1RL2A 3J80E 1CA5A 4DR2L 1CTMA 3CXCA 1D1KA 2E76C 3OIPA 1A8VA 3FKIG 1XJVA 3HOWH 3NQTA 1E7ZA 2VB2X 3S1NH 1NR2A 1PZKD 2LS01 1SRUA 4G7OC 4PMCA 1PXUA 4IQZA 5JPMC 2VL6A 3TZUA 3CPWA 3BDCA 3VYUA 3CCMA 2PYKA 3NP8A 4GLXA 1DONA 3ZCBA 1SYBA 2DJFC 2F0IA 2JE6I 2D5DA 4X3KA 1LV9A 4IPHA 3K8AA 4DAYA 2HIXA 3ERSX 4RFBA 2A1AA 1UE6A 1G2SA 5BR8Q 4GOPB 1HQMC 4R1JA 2VQEL 1G8ZD 4IPDA 4OX9L 3I4NG 4B3SL 4CDDC 3RUZA 1SMYC 2X6GA 3MXUA 4QY7A 1AN8A 1D5XC 1VF5C 4PZ6A 5CV7A 3GO5A 3CCJA 3S14B 1VQIA 3TN2A 2VY3A 2A6HD 1CQFA 1PLFA 4GLAC 4PZ7A 3RD4A 1DXMA 3I8ZA 4ME3A 5FKAC 3VYSA 4DV5L 2G9HD 4WRDA 2E2DC 4CKBA 5FK9C 5IIFA 2ZJQA 3GV6A 3URYA 4BBSH 1VS0A 2BA1A 4Q5VA 1CSPA 4ZUIA 3KK7A 4YWLA 3IL8A 3WWVA 4RH6A 1J5EQ 3Q22A 1KAAA 1N9WA 3FVQA 1K8AC 1TIID 3HEJA 2Q2TA 2JA9A 1FVIA 1ESFA 1CHQD 2J0TD 5C0XJ 4JI0Q 4IJHA 3PQIA 2F0KA 1UWVA 2AMCB 2F3VA 4KKTA 1B7YB 5IE8A 4A3EB 4GS3A 4JV5L 4LF6L 4NXML 3HOZG 3D31A 1UUPA 4ILWA 3SVMA 3TP8A 3GTGH 2IX1A 2Z1CA 2KCNA 4CJ1B 2NBFA 5EPKA 5IWAQ 3S9WA 5LMNL 1XXGA 3EIVA 3K57A 1HZAA 5K36G 1CKOA 1Y8NB 3Q0AA 4PY3A 3MZ5A 3S15B 1TS4A 2OEOA 1GOZA 2K33A 1E1TA 2Q2IA 1GVPA 2G9DA 4X62Q 1YHQA 3A74A 3W2DA 5IP7H 1WVLA 4XTCS 3P1HA 4DKAC 1PZID 4B3RL 4DUZQ 2R92B 2IPKD 1SNQA 5E1FA 1TU2B 2NZ1D 2ES2A 1G291 3T16A 3I70A 2NVTB 1F77A 1K8OA 2CKZB 4JI8Q 5GADC 3CC4A 4XDXA 1A62A 5JPNC 2F0PA 5C3EG 1ML0D 2UUCQ 1SJHD 4H13C 1SR3A 2LSSA 3MC0B 1YJ9A 3GTQH 4K0KL 3RN2A 4L5TA 4A3KB 4TSSA 2KQ3A 3DWQA 2PMZB 4QUFA 1QVFA 1STAA 3J81j 4LWCA 3GTJH 2UXDL 3UI2A 2FMCA 1FL0A 4CDFC 2HIVA 4HJ7A 3K81C 4OXPA 3J80L 3K6OA 5A2QL 2E2JH 4L5RC 1U4MA 3U9SA 4KKSA 1S4ZA 1CHPD 4HJAA 4IO9A 1LM0A 1MIUA 2WAQB 1I6HB 3AFQA 2A74C 4DV3L 2OQKA 1K8GA 2K75A 4AYBE 5AJ3L 3BDLA 4CGYB 1YJWA 4QUCA 2E5LL 1IYJB 5IGCA 3PO2B 4HIOA 3QIAA 1Y1VH 4FO2A 3CD6A 4JI4Q 3DEOA 3SK5A 5EJWA 1TY0A 3D4WA 3HOWG 3GTKH 2E2IB 4DV6Q 2A68C 1IHZA 4DR6Q 4Z9CB 1Q1BA 3L9AX 4R8NA 3EBEA 1A6XA 4E6IA 1U0LA 2F0DA 3QG1A 3CC2A 3QOJA 1HZCA 2B3GA 1EZ6A 1JB7A 1V1QA 3E9HA 3MXPA 4DV6L 1EYAA 4QCLA 1SMYD 4LFBL 1PVOA 4OIKA 1FNWA 3T1HL 4C1NI 5C4XH 4NB3A 1AP0A 5JEAG 3A8IE 4JI4L 5JJZA 1Q7YC 2R61A 3RMHA 1MBYA 3D8GA 4YWMA 4EQ5A 3NK9A 3QWNA 3AU7A 3K7UC 4JI2Q 1N8RC 5FJ8G 2EOTA 5KGUA 4DAVA 4JYAQ 1XPUA 1BCPD 4JI5L 2KENA 2LY7A 4YIJA 5KRUA 2YTYA 1D7QA 1Y8OB 4GLVB 3T4AC
chains in the Genus database with same CATH topology
2F52A 3PIOA 1EQRA 4U0ZA 4GNXC 1VQ4A 1IBLQ 1QUQB 1E1OA 2JEBI 1L0WA 4A3JG 3GTOH 1VQGA 1UE5A 1Z9FA 4P71A 4X66L 5IYBG 2VW9A 3I4OA 1VQKA 4ITRA 5M5WH 1IL2A 4B3TL 4DV4Q 1K83H 4JBKA 2N3SA 4A3CH 4WGJA 1IZ6A 1YVCA 2UUCL 1YITA 5EAYA 4BXXG 2R7FA 4BBRG 3M4PA 4POFA 2Y0SE 4BY1H 3LGJA 3T1YQ 1IBMQ 4GOPC 3KYHC 2AHOB 3U4VA 4YCWA 1V43A 5GAEC 1HNWL 4LUVA 1G6PA 4UPAA 1V9PA 3HOYG 2ID0A 1S40A 4LF9Q 5M3FH 3PUVA 4KHPQ 1Q86C 3G71A 1B70B 4JBWA 1K9MC 4UP8A 1BBUA 3CC7A 2K50A 1PH2A 3DLLA 5C0XG 2ATWA 1IXRA 1YIJA 4JI1L 4JCVE 4DAYB 4DV7Q 1JJCB 3PUWA 1EOVA 1NTGA 1X6OA 1NE3A 2RHQB 4DR2Q 4Y7NH 1VQMA 4DR4Q 4DUYQ 1NMGA 4LFAQ 5M3MH 3CMAA 1XMOQ 4JBJA 5ELNA 3VDYA 4GNXB 1Q81C 2NVQH 3I2ZA 3TS0A 2VUMH 1FJGL 2JA8H 2CQOA 4BA2I 1YHBA 4DR3Q 2UXCL 5M5YH 1PV4A 2Y0SG 3F2BA 2OWOA 1KAWA 1VQHA 2BH8A 4X64L 1AH9A 2AWNA 2Z6KA 4R4IA 1XMQL 2JA5H 1BBWA 4GOPA 4C3HH 4DR5Q 3CP0A 3KDFB 3GTMH 4FDBA 1NBWA 3HKSA 1L2FA 4R4OA 2UUBL 2A8VA 3GDEA 1UEBA 4MTNA 3KOJA 4RMFA 2JEAI 2R7DA 1XPRA 4LUZA 2QA4A 3CW2C 2PMZE 4A75A 5FLMG 3G6EA 5ELOA 1CUKA 1GKHA 4C3JH 1Q46A 4NXNL 4DUZL 4P73A 1Q12A 4P75A 3CCVA 3HOUG 1VQCA 3HOUH 3J7A5 4DR5L 4GN5A 3ULJA 4LU4A 4A3MG 4A93G 3CCSA 4A3EH 1R9TH 4B3SQ 2JK8A 4B3ML 3KJPA 1BKBA 4B3MQ 5CMTA 3FHWA 3K80C 4A3CG 1UE1A 3KF6B 2ZTCA 3PIPA 4HIDA 1C0AA 3CPFA 4DK3C 5GAHC 4NXNQ 3PO2H 1PA6A 1QVCA 1N32Q 2MQHA 1JE5A 5C0XI 2XTIA 5HGQA 4B3RQ 4R4CA 3G48A 1OXSC 2KCMA 5IP9G 1SFOH 1I94L 1VQEA 4APVA 4DV7L 2PQAB 4DV1L 1OXVA 3G4SA 2RHSB 1N33L 2MFIA 1IBKQ 2KHIA 4QGUA 2PNHA 4KHPL 3PUYA 1AE2A 1XPOA 2Z6KC 1NJIC 1W3SA 1JJ2A 1ASZA 4POGA 1I94Q 1U5KA 1X3GA 3U50C 3L2PA 4EX5A 2VS1A 2L15A 3F2DA 2I5LX 4LF4Q 4MZ9A 1YNXA 4A4IA 3M85A 2JA6G 2VZAA 3L0OA 3RR5A 4IOAA 2GVBA 1VQPA 4A3GH 5M3MG 2UU9Q 1C7YA 1X3FA 3GTPH 4P74A 1B8AA 1CKNA 3L7ZC 5GQOA 4JI1Q 1PH7A 3CCLA 2B63G 2UXBQ 2GVAA 1VQ5A 3OW2A 3M4OH 3CCRA 1TWFH 2YU9H 2NVTH 2UXBL 4OWXB 4YWKA 1HZBA 1WFQA 3BJUA 3OTOL 3CCEA 4LF6Q 4NXMQ 2N78A 2UU9L 1A0IA 4YHHQ 1L1OC 4BY1G 3F1ZA 1N34Q 5C3EH 2JA7H 2ALYB 2D0PA 3CCUA 2CCZA 3BU2A 1E3PA 3I55A 4KI0A 3A0JA 2IY5B 2UUBQ 4JI3Q 4JOIA 2NN6I 4LF5Q 2DGYA 3HOYH 3NENA 1PH5A 2KCTA 2WP8J 1FGUA 2NZHA 2F3IA 4JOIC 3SGIA 3NBHB 2IHFA 3UE1A 4HJ5A 1Y1WH 1XMQQ 3FP9A 1X9NA 2R92G 4BY7H 4DR7L 2N8NA 3F8TA 5CGLA 4P72A 4PG3A 4AH6A 4IPGA 5C44H 2N49A 3J81i 2JA8G 1GO3E 4U04A 3H0GG 1O7IA 4DPGA 4AQYL 2UXCQ 3S1RH 2DUDA 1AE3A 4QIWE 2OTJA 3ZC7A 4DV2Q 3HOVG 1LUZA 3K7AH 4LF7Q 4LFCQ 4LNQA 3HOZH 1N32L 2ZJRA 3FKIH 5CKLA 1WOCA 1HJPA 4C3IH 3AFPA 4IPCA 4JI5Q 4LFBQ 1I50H 1TXYA 3I4MG 1HR0W 5JFZA 1Y1VG 4HIMA 2UUAQ 1I6HH 3S17H 4N67A 2E2HH 1D8LA 3SHGA 1QZGA 1EIFA 4RG1A 1QZHA 2GN5A 2H5XA 1VQOA 1WCMG 2BH2A 3D0FA 1HNZQ 1TWCH 1PH6A 1Q1EA 1N36Q 1IBLL 2WAQG 4A3BG 2WAQE 2UXDQ 5LMUQ 4A3FH 1IBML 4A3IH 3S1QH 3E9IA 4A3GG 3A5ZB 4X6AH 2PI2E 3GD7A 2XGTA 3HFZB 4GN4B 4Y52H 4BBSG 1A63A 3S16H 3PUXA 2E8GA 3M4QA 3I7FA 4OX9Q 3E0EA 2VQFQ 2ZTDA 4A3MH 3PGZA 2VNUD 4LUOA 3AQQA 5C4XG 1JT8A 5FLXc 1VQFA 1L1OA 2MO1A 3W1BA 4B3TQ 4A76A 3PO3H 3TRZA 1L1OB 4LW1A 1HH2P 1X54A 1H95A 5DLQE 3LETA 4U0UA 4YCUA 4AIMA 2ZM6Q 2I0QA 3I56A 2PI2A 2MNAA 1PYBA 1X55A 2CFMA 2CWPA 4GN3B 4IOCA 1KC8C 2QEXA 2LXJA 5IY0A 1PH8A 2NVXH 3BZCA 5IT9c 3PF4A 2OTLA 2WB1E 2E5LQ 3UDXA 4LF8Q 1E24A 4U0SA 1KL9A 4JG2A 3ER0A 1T9HA 1MKHA 2R6GA 1YBYA 4DV4L 3S14H 5IYCG 4LF8L 4DR7Q 2K14A 5EU0A 4OONA 3RLNA 3J81c 3TS2A 4U07A 3PSIA 3ZJYC 3S2DH 1RL2A 2K52A 3SN9A 4DR2L 4IFDI 4JI3L 3CXCA 3STBC 3T1YL 1TWAH 1PH3A 1A8VA 3FKIG 3T1HQ 1XJVA 3HOXG 5J3BA 3HOWH 3K0XA 4LFCL 2VUMG 2BA0A 2FXQA 3UDIA 4BBRH 4X2DA 1E7ZA 1OXXK 2D0OA 4JC0A 3TEHB 4JI2L 3S1NH 1SN8A 5IWAL 3CF5A 1SRUA 5LMNQ 3OYYA 1HNXQ 2HHHQ 1E22A 3M7NA 3CPWA 5FLMH 2UUAL 2VL6A 2IHEA 4GLXA 1G51A 1WYDA 3CCMA 3ZCBA 1MJCA 2JE6I 5IYBH 4DR6L 4KHZA 4IFDG 2WB1G 4XIGS 1XNRQ 1K0RA 4IPHA 3K8AA 4A3FG 5LMUL 1LTLA 4KLKA 3EN2A 4UY8C 3J7ZC 2YTVA 2RCNA 1X65A 2HIXA 3ERSX 3H0GH 1X56A 1HNZL 1NY4A 2A1AA 1UE6A 2AKWB 2EQSA 1GM5A 2IT1A 3GTLH 4MNOA 3ULPA 4OWWB 5BR8Q 3S1MH 3HKZG 4GOPB 3KJOA 4R1JA 4X62L 2VQEL 1IBKL 2VQFL 4IPDA 1HZ9A 1JMCA 4OX9L 3I4NG 4B3SL 3PO3G 5JJIA 3U4ZA 1XNQQ 3H15A 3HKZE 1PFSA 3F2CA 2ZTEA 4QY7A 4DR1Q 5M3FG 1MJEA 1SMXA 4PZ6A 2AWOA 1OTCA 1LYLA 4A3LH 3GO5A 3CCJA 3RZOH 4A3LG 1N36L 1VQIA 1M90C 1WCMH 4LF4L 2VY3A 3CQZH 1EQQA 1K3RA 4GLAC 2NZOA 4IFDJ 4PZ7A 1Y14B 1W2BA 2ZJPA 4ME3A 4DV5L 4HJ9A 2KBNA 3Q8DA 5IYCH 2E2IH 4ALPA 1QUQA 4DV1Q 4A3JH 3CCQA 2ZJQA 4BBSH 2F4VQ 1TWGH 4TQUS 4M16A 1VS0A 2K5NA 2BA1A 1YZ6A 1SE8A 4JI8L 1CSPA 1QVGA 2PQAA 1OXUA 2R7ZH 4DV2L 2K5VA 4YWLA 2JQOA 2YV5A 3ICEA 3WWVA 4YY3Q 4YHHL 1J5EQ 5JJLA 1N9WA 5AJ3Q 1PH1A 1PHJA 1K8AC 4JI7Q 1JJGA 4DV3Q 2Q2TA 3PF5A 2JA9A 1I3QH 1FVIA 1VQ7A 1VQBA 5C0XJ 5GROA 4JI0Q 4JI7L 4IJHA 4JV5Q 3RLFA 1DGSA 1NMFA 4DV0L 3KF6A 3AEVA 2RF4A 1HR0Q 4YY3L 2K4KA 4LF9L 5JFFA 4OO1I 2NN6G 2JA7G 1HNWQ 1Q8KA 1Y1WG 1KD1C 1UWVA 4LF7L 1YI2A 1UE7A 2WFWA 4O2DA 4LFAL 1C9OA 2K5HA 3JAMc 4DUYL 2AMCB 5IE8A 1N34L 1B7YB 3A5UA 4A3KG 3S2HH 1X3EA 2YYZA 4GS3A 2OQ0A 4DV0Q 1EWIA 1SLJA 3U58A 4GKKQ 4JV5L 3RZDH 3OTOQ 4LF6L 4NXML 3HOZG 4X2EA 4JI6Q 3D31A 1YHAA 5JJ7A 2EXDA 3DM3A 3GTGH 3N3UA 2IX1A 3KDFA 5BR8L 2B29A 1PYSB 5C44G 5C4JH 1S3OA 5JJ6A 5IWAQ 5LMNL 3I4MH 4GKKL 4DK6C 1YJNA 3B6YA 3EIVA 3S6AA 2R92H 1HZAA 3H3VH 5K36G 1CKOA 4WJ4A 1WJJA 4PY3A 3CUCA 4HIKA 3W1GA 4AQYQ 2NVYH 5FJ8H 4DR1L 3IRBA 1XNRL 2G03A 1VQLA 4AYBG 1HR0L 2F4VL 1CKNB 4K0KQ 1ASYA 1Q82C 1KXLA 1E1TA 3KLWA 4BA1I 3RLOA 4A3EG 2Q2IA 1GVPA 4X62Q 2VQEQ 1YHQA 3CMEA 3A74A 4X2CA 5IP7G 2KHJA 5IP7H 2C35B 3TREA 4GKJL 4XTCS 5E7NA 4DKAC 4X66Q 4B3RL 2LXKA 2F6SA 1VCIA 4DUZQ 3UDFA 2V1CC 1K73C 4A3BH 2ES2A 1G291 4PMWA 4HJ8A 3MXNB 3UE0A 2CKZB 1PH4A 4JI8Q 1KRSA 5GADC 3CC4A 4PZ8A 4WJ3M 3KF8B 3PCOB 1A62A 4L5SA 3JC66 2A19A 1XNQL 4BXXH 4A3DH 5C3EG 1PH9A 2UUCQ 1N33Q 1SR3A 1VQDA 2LSSA 3GTQH 1YJ9A 3PO2G 3J80i 2R93H 4J15A 4K0KL 2CWAA 4TVAB 3JAMi 4L5TA 3RN2A 4DV5Q 3PUZA 1J6QA 4DAMA 5IP9H 3RNUA 3SE5A 4BY7G 1QVFA 3M9BA 3J81j 4LWCA 3GTJH 1VQ9A 2JA6H 2Z0SA 2UXDL 4DR4L 2I5HA 1FL0A 4IJLA 2HIVA 4HJ7A 3K81C 4OXPA 1M1KC 1WI5A 1KIXA 2E2JH 4A3KH 4L5RC 3S15H 4R4QA 3CAMA 4O0AA 2ZM6L 4UP9A 3TQYA 3ULLA 2I5MX 4HJAA 4JI0L 4IO9A 1GD7A 1LM0A 1MIUA 4X64Q 3HOVH 3AFQA 2OCEA 2OQKA 3W5OA 4DV3L 2K75A 1K8GA 1CKMA 4AYBE 3HOXH 4JI6L 1I5FA 5AJ3L 3ZLMA 1J5EL 1YJWA 3NEMA 2E5LL 2Q2HA 1EYGA 4DR3L 2JA5G 1IYJB 1EFWA 5LMNW 4QL5A 1OXTA 1FJGQ 1TWHH 4HIOA 1Y1VH 2B63H 3M3YH 1XMOL 3CD6A 4JI4Q 4QQBX 3J80c 2D62A 2JJQA 2R7ZG 3HOWG 3GTKH 3NELA 4H02A 3RN5A 1RIPA 1XTDA 4DV6Q 3KFUA 5JJKA 4C2MH 4DR6Q 4YCVA 1Q1BA 1SROA 4X65Q 3EBEA 4GNXA 3S24A 3PV0A 1U0LA 5IYDG 1VQ8A 2EIFA 2HHHL 4A93H 5IYDH 4A3IG 2YTXA 4R4TA 1HNXL 3CC2A 1CSQA 1HZCA 1P8LA 2B3GA 3BZKA 3MEFA 1KRTA 5M5XH 1V1QA 3E9HA 1JB7A 2HT1A 3UDGA 4L5QA 2QGQA 4DV6L 1BVSA 4LF5L 4LFBL 1PVOA 1VQ6A 3T1HL 5H1SE 5GAGC 4OWTB 5C4XH 1EIYB 2IX0A 4NB3A 5JEAG 4JI4L 1Z47A 1EUJA 1VQAA 2MO0A 1Q7YC 4JYAL 4YWMA 4EQ5A 1S72A 4A3DG 4OO1G 4DNIA 4UP7A 4GKJQ 2R93G 3AYHB 3K7UC 5JEAJ 4JI2Q 3STBD 4XI8A 4X65L 1P16A 5FJ8G 1N8RC 3I4NH 1KQSA 2HQLA 5HY6A 4JYAQ 1VQJA 2Q2UA 4NPSA 4JBMA 1XPUA 1KHIA 4JI5L 2KENA 2YTYA 1D7QA 1YEZA 4QJFA 4GLVB 2ASBA 3H3VI 1VQNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F52 A;  3PIO A;  1EQR A;  4U0Z A;  4GNX C;  1VQ4 A;  1IBL Q;  1QUQ B;  1E1O A;  2JEB I;  1L0W A;  4A3J G;  3GTO H;  1VQG A;  1UE5 A;  1Z9F A;  4P71 A;  4X66 L;  5IYB G;  2VW9 A;  3I4O A;  1VQK A;  4ITR A;  5M5W H;  1IL2 A;  4B3T L;  4DV4 Q;  1K83 H;  4JBK A;  2N3S A;  4A3C H;  4WGJ A;  1IZ6 A;  1YVC A;  2UUC L;  1YIT A;  5EAY A;  4BXX G;  2R7F A;  4BBR G;  3M4P A;  4POF A;  2Y0S E;  4BY1 H;  3LGJ A;  3T1Y Q;  1IBM Q;  4GOP C;  3KYH C;  2AHO B;  3U4V A;  4YCW A;  1V43 A;  5GAE C;  1HNW L;  4LUV A;  1G6P A;  4UPA A;  1V9P A;  3HOY G;  2ID0 A;  1S40 A;  4LF9 Q;  5M3F H;  3PUV A;  4KHP Q;  1Q86 C;  3G71 A;  1B70 B;  4JBW A;  1K9M C;  4UP8 A;  1BBU A;  3CC7 A;  2K50 A;  1PH2 A;  3DLL A;  5C0X G;  2ATW A;  1IXR A;  1YIJ A;  4JI1 L;  4JCV E;  4DAY B;  4DV7 Q;  1JJC B;  3PUW A;  1EOV A;  1NTG A;  1X6O A;  1NE3 A;  2RHQ B;  4DR2 Q;  4Y7N H;  1VQM A;  4DR4 Q;  4DUY Q;  1NMG A;  4LFA Q;  5M3M H;  3CMA A;  1XMO Q;  4JBJ A;  5ELN A;  3VDY A;  4GNX B;  1Q81 C;  2NVQ H;  3I2Z A;  3TS0 A;  2VUM H;  1FJG L;  2JA8 H;  2CQO A;  4BA2 I;  1YHB A;  4DR3 Q;  2UXC L;  5M5Y H;  1PV4 A;  2Y0S G;  3F2B A;  2OWO A;  1KAW A;  1VQH A;  2BH8 A;  4X64 L;  1AH9 A;  2AWN A;  2Z6K A;  4R4I A;  1XMQ L;  2JA5 H;  1BBW A;  4GOP A;  4C3H H;  4DR5 Q;  3CP0 A;  3KDF B;  3GTM H;  4FDB A;  1NBW A;  3HKS A;  1L2F A;  4R4O A;  2UUB L;  2A8V A;  3GDE A;  1UEB A;  4MTN A;  3KOJ A;  4RMF A;  2JEA I;  2R7D A;  1XPR A;  4LUZ A;  2QA4 A;  3CW2 C;  2PMZ E;  4A75 A;  5FLM G;  3G6E A;  5ELO A;  1CUK A;  1GKH A;  4C3J H;  1Q46 A;  4NXN L;  4DUZ L;  4P73 A;  1Q12 A;  4P75 A;  3CCV A;  3HOU G;  1VQC A;  3HOU H;  3J7A 5;  4DR5 L;  4GN5 A;  3ULJ A;  4LU4 A;  4A3M G;  4A93 G;  3CCS A;  4A3E H;  1R9T H;  4B3S Q;  2JK8 A;  4B3M L;  3KJP A;  1BKB A;  4B3M Q;  5CMT A;  3FHW A;  3K80 C;  4A3C G;  1UE1 A;  3KF6 B;  2ZTC A;  3PIP A;  4HID A;  1C0A A;  3CPF A;  4DK3 C;  5GAH C;  4NXN Q;  3PO2 H;  1PA6 A;  1QVC A;  1N32 Q;  2MQH A;  1JE5 A;  5C0X I;  2XTI A;  5HGQ A;  4B3R Q;  4R4C A;  3G48 A;  1OXS C;  2KCM A;  5IP9 G;  1SFO H;  1I94 L;  1VQE A;  4APV A;  4DV7 L;  2PQA B;  4DV1 L;  1OXV A;  3G4S A;  2RHS B;  1N33 L;  2MFI A;  1IBK Q;  2KHI A;  4QGU A;  2PNH A;  4KHP L;  3PUY A;  1AE2 A;  1XPO A;  2Z6K C;  1NJI C;  1W3S A;  1JJ2 A;  1ASZ A;  4POG A;  1I94 Q;  1U5K A;  1X3G A;  3U50 C;  3L2P A;  4EX5 A;  2VS1 A;  2L15 A;  3F2D A;  2I5L X;  4LF4 Q;  4MZ9 A;  1YNX A;  4A4I A;  3M85 A;  2JA6 G;  2VZA A;  3L0O A;  3RR5 A;  4IOA A;  2GVB A;  1VQP A;  4A3G H;  5M3M G;  2UU9 Q;  1C7Y A;  1X3F A;  3GTP H;  4P74 A;  1B8A A;  1CKN A;  3L7Z C;  5GQO A;  4JI1 Q;  1PH7 A;  3CCL A;  2B63 G;  2UXB Q;  2GVA A;  1VQ5 A;  3OW2 A;  3M4O H;  3CCR A;  1TWF H;  2YU9 H;  2NVT H;  2UXB L;  4OWX B;  4YWK A;  1HZB A;  1WFQ A;  3BJU A;  3OTO L;  3CCE A;  4LF6 Q;  4NXM Q;  2N78 A;  2UU9 L;  1A0I A;  4YHH Q;  1L1O C;  4BY1 G;  3F1Z A;  1N34 Q;  5C3E H;  2JA7 H;  2ALY B;  2D0P A;  3CCU A;  2CCZ A;  3BU2 A;  1E3P A;  3I55 A;  4KI0 A;  3A0J A;  2IY5 B;  2UUB Q;  4JI3 Q;  4JOI A;  2NN6 I;  4LF5 Q;  2DGY A;  3HOY H;  3NEN A;  1PH5 A;  2KCT A;  2WP8 J;  1FGU A;  2NZH A;  2F3I A;  4JOI C;  3SGI A;  3NBH B;  2IHF A;  3UE1 A;  4HJ5 A;  1Y1W H;  1XMQ Q;  3FP9 A;  1X9N A;  2R92 G;  4BY7 H;  4DR7 L;  2N8N A;  3F8T A;  5CGL A;  4P72 A;  4PG3 A;  4AH6 A;  4IPG A;  5C44 H;  2N49 A;  3J81 i;  2JA8 G;  1GO3 E;  4U04 A;  3H0G G;  1O7I A;  4DPG A;  4AQY L;  2UXC Q;  3S1R H;  2DUD A;  1AE3 A;  4QIW E;  2OTJ A;  3ZC7 A;  4DV2 Q;  3HOV G;  1LUZ A;  3K7A H;  4LF7 Q;  4LFC Q;  4LNQ A;  3HOZ H;  1N32 L;  2ZJR A;  3FKI H;  5CKL A;  1WOC A;  1HJP A;  4C3I H;  3AFP A;  4IPC A;  4JI5 Q;  4LFB Q;  1I50 H;  1TXY A;  3I4M G;  1HR0 W;  5JFZ A;  1Y1V G;  4HIM A;  2UUA Q;  1I6H H;  3S17 H;  4N67 A;  2E2H H;  1D8L A;  3SHG A;  1QZG A;  1EIF A;  4RG1 A;  1QZH A;  2GN5 A;  2H5X A;  1VQO A;  1WCM G;  2BH2 A;  3D0F A;  1HNZ Q;  1TWC H;  1PH6 A;  1Q1E A;  1N36 Q;  1IBL L;  2WAQ G;  4A3B G;  2WAQ E;  2UXD Q;  5LMU Q;  4A3F H;  1IBM L;  4A3I H;  3S1Q H;  3E9I A;  4A3G G;  3A5Z B;  4X6A H;  2PI2 E;  3GD7 A;  2XGT A;  3HFZ B;  4GN4 B;  4Y52 H;  4BBS G;  1A63 A;  3S16 H;  3PUX A;  2E8G A;  3M4Q A;  3I7F A;  4OX9 Q;  3E0E A;  2VQF Q;  2ZTD A;  4A3M H;  3PGZ A;  2VNU D;  4LUO A;  3AQQ A;  5C4X G;  1JT8 A;  5FLX c;  1VQF A;  1L1O A;  2MO1 A;  3W1B A;  4B3T Q;  4A76 A;  3PO3 H;  3TRZ A;  1L1O B;  4LW1 A;  1HH2 P;  1X54 A;  1H95 A;  5DLQ E;  3LET A;  4U0U A;  4YCU A;  4AIM A;  2ZM6 Q;  2I0Q A;  3I56 A;  2PI2 A;  2MNA A;  1PYB A;  1X55 A;  2CFM A;  2CWP A;  4GN3 B;  4IOC A;  1KC8 C;  2QEX A;  2LXJ A;  5IY0 A;  1PH8 A;  2NVX H;  3BZC A;  5IT9 c;  3PF4 A;  2OTL A;  2WB1 E;  2E5L Q;  3UDX A;  4LF8 Q;  1E24 A;  4U0S A;  1KL9 A;  4JG2 A;  3ER0 A;  1T9H A;  1MKH A;  2R6G A;  1YBY A;  4DV4 L;  3S14 H;  5IYC G;  4LF8 L;  4DR7 Q;  2K14 A;  5EU0 A;  4OON A;  3RLN A;  3J81 c;  3TS2 A;  4U07 A;  3PSI A;  3ZJY C;  3S2D H;  1RL2 A;  2K52 A;  3SN9 A;  4DR2 L;  4IFD I;  4JI3 L;  3CXC A;  3STB C;  3T1Y L;  1TWA H;  1PH3 A;  1A8V A;  3FKI G;  3T1H Q;  1XJV A;  3HOX G;  5J3B A;  3HOW H;  3K0X A;  4LFC L;  2VUM G;  2BA0 A;  2FXQ A;  3UDI A;  4BBR H;  4X2D A;  1E7Z A;  1OXX K;  2D0O A;  4JC0 A;  3TEH B;  4JI2 L;  3S1N H;  1SN8 A;  5IWA L;  3CF5 A;  1SRU A;  5LMN Q;  3OYY A;  1HNX Q;  2HHH Q;  1E22 A;  3M7N A;  3CPW A;  5FLM H;  2UUA L;  2VL6 A;  2IHE A;  4GLX A;  1G51 A;  1WYD A;  3CCM A;  3ZCB A;  1MJC A;  2JE6 I;  5IYB H;  4DR6 L;  4KHZ A;  4IFD G;  2WB1 G;  4XIG S;  1XNR Q;  1K0R A;  4IPH A;  3K8A A;  4A3F G;  5LMU L;  1LTL A;  4KLK A;  3EN2 A;  4UY8 C;  3J7Z C;  2YTV A;  2RCN A;  1X65 A;  2HIX A;  3ERS X;  3H0G H;  1X56 A;  1HNZ L;  1NY4 A;  2A1A A;  1UE6 A;  2AKW B;  2EQS A;  1GM5 A;  2IT1 A;  3GTL H;  4MNO A;  3ULP A;  4OWW B;  5BR8 Q;  3S1M H;  3HKZ G;  4GOP B;  3KJO A;  4R1J A;  4X62 L;  2VQE L;  1IBK L;  2VQF L;  4IPD A;  1HZ9 A;  1JMC A;  4OX9 L;  3I4N G;  4B3S L;  3PO3 G;  5JJI A;  3U4Z A;  1XNQ Q;  3H15 A;  3HKZ E;  1PFS A;  3F2C A;  2ZTE A;  4QY7 A;  4DR1 Q;  5M3F G;  1MJE A;  1SMX A;  4PZ6 A;  2AWO A;  1OTC A;  1LYL A;  4A3L H;  3GO5 A;  3CCJ A;  3RZO H;  4A3L G;  1N36 L;  1VQI A;  1M90 C;  1WCM H;  4LF4 L;  2VY3 A;  3CQZ H;  1EQQ A;  1K3R A;  4GLA C;  2NZO A;  4IFD J;  4PZ7 A;  1Y14 B;  1W2B A;  2ZJP A;  4ME3 A;  4DV5 L;  4HJ9 A;  2KBN A;  3Q8D A;  5IYC H;  2E2I H;  4ALP A;  1QUQ A;  4DV1 Q;  4A3J H;  3CCQ A;  2ZJQ A;  4BBS H;  2F4V Q;  1TWG H;  4TQU S;  4M16 A;  1VS0 A;  2K5N A;  2BA1 A;  1YZ6 A;  1SE8 A;  4JI8 L;  1CSP A;  1QVG A;  2PQA A;  1OXU A;  2R7Z H;  4DV2 L;  2K5V A;  4YWL A;  2JQO A;  2YV5 A;  3ICE A;  3WWV A;  4YY3 Q;  4YHH L;  1J5E Q;  5JJL A;  1N9W A;  5AJ3 Q;  1PH1 A;  1PHJ A;  1K8A C;  4JI7 Q;  1JJG A;  4DV3 Q;  2Q2T A;  3PF5 A;  2JA9 A;  1I3Q H;  1FVI A;  1VQ7 A;  1VQB A;  5C0X J;  5GRO A;  4JI0 Q;  4JI7 L;  4IJH A;  4JV5 Q;  3RLF A;  1DGS A;  1NMF A;  4DV0 L;  3KF6 A;  3AEV A;  2RF4 A;  1HR0 Q;  4YY3 L;  2K4K A;  4LF9 L;  5JFF A;  4OO1 I;  2NN6 G;  2JA7 G;  1HNW Q;  1Q8K A;  1Y1W G;  1KD1 C;  1UWV A;  4LF7 L;  1YI2 A;  1UE7 A;  2WFW A;  4O2D A;  4LFA L;  1C9O A;  2K5H A;  3JAM c;  4DUY L;  2AMC B;  5IE8 A;  1N34 L;  1B7Y B;  3A5U A;  4A3K G;  3S2H H;  1X3E A;  2YYZ A;  4GS3 A;  2OQ0 A;  4DV0 Q;  1EWI A;  1SLJ A;  3U58 A;  4GKK Q;  4JV5 L;  3RZD H;  3OTO Q;  4LF6 L;  4NXM L;  3HOZ G;  4X2E A;  4JI6 Q;  3D31 A;  1YHA A;  5JJ7 A;  2EXD A;  3DM3 A;  3GTG H;  3N3U A;  2IX1 A;  3KDF A;  5BR8 L;  2B29 A;  1PYS B;  5C44 G;  5C4J H;  1S3O A;  5JJ6 A;  5IWA Q;  5LMN L;  3I4M H;  4GKK L;  4DK6 C;  1YJN A;  3B6Y A;  3EIV A;  3S6A A;  2R92 H;  1HZA A;  3H3V H;  5K36 G;  1CKO A;  4WJ4 A;  1WJJ A;  4PY3 A;  3CUC A;  4HIK A;  3W1G A;  4AQY Q;  2NVY H;  5FJ8 H;  4DR1 L;  3IRB A;  1XNR L;  2G03 A;  1VQL A;  4AYB G;  1HR0 L;  2F4V L;  1CKN B;  4K0K Q;  1ASY A;  1Q82 C;  1KXL A;  1E1T A;  3KLW A;  4BA1 I;  3RLO A;  4A3E G;  2Q2I A;  1GVP A;  4X62 Q;  2VQE Q;  1YHQ A;  3CME A;  3A74 A;  4X2C A;  5IP7 G;  2KHJ A;  5IP7 H;  2C35 B;  3TRE A;  4GKJ L;  4XTC S;  5E7N A;  4DKA C;  4X66 Q;  4B3R L;  2LXK A;  2F6S A;  1VCI A;  4DUZ Q;  3UDF A;  2V1C C;  1K73 C;  4A3B H;  2ES2 A;  1G29 1;  4PMW A;  4HJ8 A;  3MXN B;  3UE0 A;  2CKZ B;  1PH4 A;  4JI8 Q;  1KRS A;  5GAD C;  3CC4 A;  4PZ8 A;  4WJ3 M;  3KF8 B;  3PCO B;  1A62 A;  4L5S A;  3JC6 6;  2A19 A;  1XNQ L;  4BXX H;  4A3D H;  5C3E G;  1PH9 A;  2UUC Q;  1N33 Q;  1SR3 A;  1VQD A;  2LSS A;  3GTQ H;  1YJ9 A;  3PO2 G;  3J80 i;  2R93 H;  4J15 A;  4K0K L;  2CWA A;  4TVA B;  3JAM i;  4L5T A;  3RN2 A;  4DV5 Q;  3PUZ A;  1J6Q A;  4DAM A;  5IP9 H;  3RNU A;  3SE5 A;  4BY7 G;  1QVF A;  3M9B A;  3J81 j;  4LWC A;  3GTJ H;  1VQ9 A;  2JA6 H;  2Z0S A;  2UXD L;  4DR4 L;  2I5H A;  1FL0 A;  4IJL A;  2HIV A;  4HJ7 A;  3K81 C;  4OXP A;  1M1K C;  1WI5 A;  1KIX A;  2E2J H;  4A3K H;  4L5R C;  3S15 H;  4R4Q A;  3CAM A;  4O0A A;  2ZM6 L;  4UP9 A;  3TQY A;  3ULL A;  2I5M X;  4HJA A;  4JI0 L;  4IO9 A;  1GD7 A;  1LM0 A;  1MIU A;  4X64 Q;  3HOV H;  3AFQ A;  2OCE A;  2OQK A;  3W5O A;  4DV3 L;  2K75 A;  1K8G A;  1CKM A;  4AYB E;  3HOX H;  4JI6 L;  1I5F A;  5AJ3 L;  3ZLM A;  1J5E L;  1YJW A;  3NEM A;  2E5L L;  2Q2H A;  1EYG A;  4DR3 L;  2JA5 G;  1IYJ B;  1EFW A;  5LMN W;  4QL5 A;  1OXT A;  1FJG Q;  1TWH H;  4HIO A;  1Y1V H;  2B63 H;  3M3Y H;  1XMO L;  3CD6 A;  4JI4 Q;  4QQB X;  3J80 c;  2D62 A;  2JJQ A;  2R7Z G;  3HOW G;  3GTK H;  3NEL A;  4H02 A;  3RN5 A;  1RIP A;  1XTD A;  4DV6 Q;  3KFU A;  5JJK A;  4C2M H;  4DR6 Q;  4YCV A;  1Q1B A;  1SRO A;  4X65 Q;  3EBE A;  4GNX A;  3S24 A;  3PV0 A;  1U0L A;  5IYD G;  1VQ8 A;  2EIF A;  2HHH L;  4A93 H;  5IYD H;  4A3I G;  2YTX A;  4R4T A;  1HNX L;  3CC2 A;  1CSQ A;  1HZC A;  1P8L A;  2B3G A;  3BZK A;  3MEF A;  1KRT A;  5M5X H;  1V1Q A;  3E9H A;  1JB7 A;  2HT1 A;  3UDG A;  4L5Q A;  2QGQ A;  4DV6 L;  1BVS A;  4LF5 L;  4LFB L;  1PVO A;  1VQ6 A;  3T1H L;  5H1S E;  5GAG C;  4OWT B;  5C4X H;  1EIY B;  2IX0 A;  4NB3 A;  5JEA G;  4JI4 L;  1Z47 A;  1EUJ A;  1VQA A;  2MO0 A;  1Q7Y C;  4JYA L;  4YWM A;  4EQ5 A;  1S72 A;  4A3D G;  4OO1 G;  4DNI A;  4UP7 A;  4GKJ Q;  2R93 G;  3AYH B;  3K7U C;  5JEA J;  4JI2 Q;  3STB D;  4XI8 A;  4X65 L;  1P16 A;  5FJ8 G;  1N8R C;  3I4N H;  1KQS A;  2HQL A;  5HY6 A;  4JYA Q;  1VQJ A;  2Q2U A;  4NPS A;  4JBM A;  1XPU A;  1KHI A;  4JI5 L;  2KEN A;  2YTY A;  1D7Q A;  1YEZ A;  4QJF A;  4GLV B;  2ASB A;  3H3V I;  1VQN A; 
#chains in the Genus database with same CATH topology
 3NQI A;  1EQR A;  4K8J A;  4C3J G;  1VQ4 A;  3DM1 A;  1QUQ B;  4A3J G;  1VQG A;  1UE5 A;  4P71 A;  3MFG A;  4CJ2 C;  2LKV A;  1IL2 A;  1K83 H;  3QJY A;  2RDF A;  3P7J A;  2R7F A;  4XXE A;  4POF A;  2EY1 A;  2QCP X;  3T1Y Q;  4OHJ A;  2K03 A;  4LK1 C;  4LUV A;  1F9S A;  1G6P A;  4UPA A;  1S40 A;  1MHW C;  5M3F H;  3PUV A;  1B53 A;  1Q86 C;  1SNO A;  1QIL A;  2PCF B;  5C0X H;  5C0X G;  1S5C D;  4DNT B;  4JI1 L;  4DAY B;  1JJC B;  3OWE B;  3PUW A;  2I46 A;  1BO0 A;  1VQM A;  2CW0 C;  5I4D A;  1TKW B;  1AW7 A;  2CQA A;  1NMG A;  3CU7 A;  4LFA Q;  4CBV A;  5M3M H;  1XMO Q;  2VUM H;  2NVQ H;  3I2Z A;  3TS0 A;  5CBA E;  2K5Q A;  2A69 C;  1NR4 A;  3MHB A;  3VR3 A;  1PV4 A;  3VR4 A;  3IKJ A;  4FF4 A;  3F2B A;  3IFD A;  2NVQ B;  5T1I A;  4DR5 Q;  1IL8 A;  3C2P A;  3NXW A;  2UUB L;  3GDE A;  4MTN A;  3VR2 A;  4LUZ A;  2HDM A;  5M5X B;  4DUZ L;  4NXN L;  4HSP A;  1Q12 A;  1G2T A;  2FJ2 A;  3ZYY X;  4G7H C;  5EKK A;  3KJP A;  4B3M Q;  1SBB B;  1A2T A;  3FHW A;  3K80 C;  1CM9 A;  4HMJ A;  1TWA B;  4KY6 A;  1N32 Q;  1QVC A;  4K2K A;  5I9O A;  4ABN A;  5C0X I;  2A6H C;  4B3R Q;  2B2W A;  4R4C A;  2K32 A;  1LTT D;  1LT5 D;  4IUQ A;  4APV A;  4RKL A;  3R2I A;  3G4S A;  1HHV A;  2P5Z X;  3PUY A;  1XPO A;  2Z6K C;  3WOF A;  2DNC A;  1GXD C;  1UAP A;  1EFI D;  2NYZ D;  2SDF A;  3U50 C;  1I94 Q;  2XWJ B;  3F2D A;  1YNX A;  2FMM A;  4IOA A;  2KHS A;  1JR0 D;  2AQ3 B;  1PTO F;  3OWF A;  4RGO S;  1EY6 A;  1PH7 A;  1WTV A;  3BVZ A;  1VQ5 A;  2JSO A;  4ZCK A;  4DXG A;  2D2C C;  2QDL A;  2SNS A;  2UU9 L;  2MUY A;  4KN7 C;  4DK1 A;  3H3V C;  3BVG A;  2JA7 H;  4FYD A;  5ELD A;  1CQV A;  1E3P A;  3I55 A;  2F0N A;  2IY5 B;  2JYO A;  2NN6 I;  3GV3 A;  4R9W A;  4L63 B;  1I6V C;  4LF5 Q;  2A73 B;  3NEN A;  1PH5 A;  2KCT A;  4BY7 G;  5CYU A;  1NAP A;  3D6C A;  4BY7 H;  1X9N A;  5CBE E;  4IUV A;  5KND A;  3VA7 A;  3J81 i;  4U04 A;  3QR8 A;  1O7I A;  5ELF A;  1B3Q A;  3Q24 A;  2DUD A;  2F03 A;  1AE3 A;  4QIW E;  3ZC7 A;  1LUZ A;  3K7A B;  4XQQ A;  1I4X A;  5IGB A;  1N32 L;  3FKI H;  3GTG B;  4FXK C;  3HKZ B;  1PTO D;  1F9R A;  1TXY A;  5FOB B;  1HR0 W;  3DMU A;  1II3 A;  3H91 A;  2L55 A;  1I6H H;  2Q8T A;  2E2H H;  1D8L A;  3DHQ A;  1QZH A;  3TP5 A;  2E2J B;  4C3H G;  4HCE A;  2BH2 A;  3NBH A;  1OO9 B;  1J9O A;  1IBM L;  4A3I H;  1Z7T A;  3S1Q H;  4XT3 B;  3HFZ B;  2XGT A;  1SNM A;  4BBS G;  1F2L A;  3M4Q A;  1D6E C;  3I7F A;  4OX9 Q;  1MD2 D;  5FLX c;  1VQF A;  2MO1 A;  4B3T Q;  2LMC B;  1SNC A;  1HH2 P;  3J7Y W;  2C9O A;  4NP5 A;  1KDC A;  4AIM A;  2ZM6 Q;  1SAP A;  2I0Q A;  3I56 A;  2DNE A;  4IOC A;  1KC8 C;  2QEX A;  2NVX B;  2ZXO A;  3OMC A;  3S16 B;  3UDX A;  4M1U B;  4A3G B;  1T9H A;  3NUC A;  1YBY A;  1BR9 A;  1VF7 A;  5IYC G;  3RZO B;  3A7A B;  4OON A;  3RLN A;  2EYL A;  3PSI A;  5BN4 A;  3P20 A;  1IKL A;  4JI3 L;  1TWA H;  5CGK A;  5C3W A;  3K0X A;  4PQX A;  1FNU A;  2VUM G;  2FXQ A;  1W6K A;  4BBR H;  1D2B A;  4X2D A;  1OXX K;  5J22 A;  3CF5 A;  2HHH Q;  1DD2 A;  2XWB B;  2MJ8 A;  2UUA L;  2F0U A;  1WYD A;  4I7A A;  2C5C A;  1XNR Q;  1SYE A;  2V4D A;  2NUC A;  4KV6 A;  1LTL A;  4UDU C;  3HGB A;  3EVQ A;  2YTV A;  5IOD A;  3J7Z C;  2RCN A;  3CHB D;  2F0M A;  1NY4 A;  2BCO A;  2WB1 B;  4MNO A;  2NUD A;  4OWW B;  3HKZ G;  4O1N A;  1ENC A;  2KVM A;  3TDQ A;  4IZ8 A;  2A6E D;  1XNQ Q;  5KYL A;  4H0L C;  3H15 A;  3F2C A;  2XN9 C;  1KTK A;  4A3L H;  3A56 A;  4A3L G;  3CRK C;  3RZO H;  1WCM H;  4ZLT F;  1EQQ A;  4G4K A;  1LAB A;  5IGF A;  1R4P B;  2SNM A;  3K5L A;  2KBN A;  4CDE C;  3TZD A;  4ALP A;  2B2Y A;  3PIO 3;  1TWG H;  4TQU S;  2RVL A;  1STG A;  1S5B D;  3PO3 B;  1OXU A;  2R7Z H;  4DAP A;  4DV2 L;  2HUG A;  3ICE A;  4YY3 Q;  1VDZ A;  1TVX A;  1VMP A;  1DOK A;  3D6W A;  5AJ3 Q;  1PHJ A;  4JI7 Q;  4QB4 A;  3HZX A;  2NB0 A;  1I3Q H;  1U4P A;  1VQB A;  5GRO A;  4JI7 L;  2B2V C;  1DOM A;  2ZXP A;  1FYC A;  1GUT A;  1RTN A;  3MTS A;  1KD1 C;  1YI2 A;  1UE7 A;  2WFW A;  4LFA L;  2K5H A;  4RWS C;  4X3T A;  1N34 L;  3A5U A;  1KNE A;  1QB5 D;  4A3I B;  5T1G A;  2E2H B;  3U58 A;  1V1P A;  4C1N K;  1R4Q B;  4JI6 Q;  1GHK A;  1WD0 A;  2EXD A;  3DM3 A;  4WJW A;  4NMZ A;  1F9Q A;  3KDF A;  1PYS B;  1S3O A;  4GKK L;  4DK6 C;  1B9M A;  3OOC A;  3S6A A;  2F0G A;  4IUN A;  5G3L D;  4WJ4 A;  4HTH A;  1WJJ A;  1O7L A;  1FR3 A;  1RDP D;  5FJ8 H;  5IT9 L;  4DR1 L;  2O2L D;  4K6L A;  1HR0 L;  1EU3 A;  2JA8 B;  3KLW A;  4BA1 I;  3RLO A;  4A3E G;  1HQR D;  3CME A;  4X2C A;  5EGT A;  3VYR A;  2HQE A;  4FVM A;  3X3N A;  5E7N A;  3EJI A;  5E4X A;  4V19 0;  1K73 C;  4IUU A;  4PMW A;  3UE0 A;  1ZYR C;  1O78 A;  1PH4 A;  1KRS A;  3PCO B;  4FF3 A;  1XNQ L;  4BXX H;  3GTP B;  2K28 A;  5M3M B;  1N33 Q;  4FF2 A;  2R93 H;  5BN5 A;  4J15 A;  1PRT F;  3SE0 A;  3SEB A;  2X6L A;  1GUN A;  5CC4 A;  1J6Q A;  4DAM A;  1F2M A;  4RGN A;  3SE5 A;  2BDO A;  2F0Q A;  1D5Z C;  1VQ9 A;  2Z0S A;  4KD4 A;  1RKN A;  2F0S A;  1HTL D;  3OW7 A;  4R4Q A;  4RGM A;  2ZM6 L;  4UP9 A;  1U4L A;  3TQY A;  2KOL A;  1BCP F;  4JI0 L;  3BZD B;  1EEF D;  1GD7 A;  4X64 Q;  3HOV H;  4IUT A;  4JI6 L;  2RCF A;  2B8F A;  1YNJ C;  1J5E L;  5CR3 A;  1NNX A;  2Q2H A;  2JA5 G;  1FJG Q;  1TWH H;  2B63 H;  1S5E D;  3NTI A;  3J80 c;  2D62 A;  2JJQ A;  2CVR A;  3S17 B;  2PPB C;  1RIP A;  1XTD A;  5JJK A;  4C3I B;  3DXJ C;  4C2M H;  4YCV A;  1SRO A;  4X65 Q;  1LT6 D;  3NSW A;  1TWH B;  2EIF A;  5IYD H;  1EY0 A;  4U68 A;  3BZK A;  5M5X H;  3MEF A;  3UDG A;  1HXY D;  5H1S E;  2NWG A;  4OWT B;  2IX0 A;  5C4Z A;  2MO0 A;  1B9N A;  2F4I A;  2AUJ D;  4JYA L;  3HOW B;  3JAM L;  3A8K E;  1QNU A;  3AYH B;  2JA7 B;  4C3I G;  2VUM B;  2HQL A;  1DOL A;  1VQJ A;  2Q2U A;  4NPS A;  4HED A;  4JBM A;  3M4O B;  1KHI A;  2AQ2 B;  2L4N A;  1YEZ A;  3MAQ A;  2F52 A;  4GNX C;  1AEX A;  3ERO A;  1LTG D;  2JEB I;  2F0T A;  4X66 L;  3I3C A;  4ITR A;  1VQK A;  4DV4 Q;  2L11 A;  1MSH A;  1DZ1 A;  2N3S A;  4A3C H;  1IZ6 A;  1YVC A;  1YIT A;  1EWC A;  5ELB A;  1H9S A;  1IBM Q;  4GOP C;  3KYH C;  2E74 C;  1SFO B;  5C5M A;  2ENB A;  1B4O A;  1JC7 A;  3GTO B;  2KEE A;  4JK1 C;  4CHT B;  3G71 A;  4UP8 A;  2F0O A;  3CC7 A;  1IXR A;  1YIJ A;  2KUM A;  3KBG A;  1NTG A;  2RHQ B;  2EYO A;  4OEM B;  4C3H B;  5ELN A;  5C4H A;  2CQO A;  1QE6 A;  4DR3 Q;  1Y69 U;  2OWO A;  2IW3 A;  3NPP A;  1KAW A;  1HUN A;  4X3U A;  1BBW A;  4GOP A;  4C3H H;  3GP7 A;  2F0J A;  3GTM H;  5E4W C;  3SR1 A;  1NBW A;  3HKS A;  3FRP B;  1UEB A;  4O42 A;  4RMF A;  1LTB D;  2R7D A;  1XPR A;  2PMZ E;  4A75 A;  3A7L A;  2RDH A;  3TP6 A;  3RZD B;  4P75 A;  4C2M B;  3CCV A;  1JWS D;  1Q8I A;  5FO9 B;  3K5M A;  3CCS A;  4A3E H;  4B3S Q;  2JK8 A;  4B3M L;  1O7Z A;  1BCP B;  5I2X A;  3BS1 A;  3MA2 B;  2ZTC A;  4HR7 B;  4XT1 B;  3PIP A;  2Y0S B;  1C0A A;  3J81 L;  3PO2 H;  1PA6 A;  1FD7 D;  3TSS A;  1K3B C;  1EOT A;  1H9S B;  2JP1 A;  5IP9 G;  1I94 L;  2HCC A;  5FLX E;  1AZP A;  2PQA B;  2B2W C;  4DV1 L;  4RCO A;  2XRQ D;  1JB3 A;  5E3F A;  4WFN 3;  4POG A;  1U5K A;  1F2Y A;  4KJO A;  2N55 A;  2VS1 A;  4EX5 A;  4LF4 Q;  4XYO A;  4MZ9 A;  5J39 A;  1EYD A;  4A4I A;  1PFM A;  4A3G H;  5C3X A;  2UU9 Q;  3GTP H;  1LO5 D;  1I50 B;  2B63 G;  3PMF A;  2GVA A;  3CQZ B;  3T51 B;  1TWF H;  2YU9 H;  2UXB L;  1A3T A;  3OTO L;  3CCE A;  4KJN A;  2BDN A;  2N78 A;  2GA4 B;  1L1O C;  1PRT B;  1PTO H;  3F1Z A;  4A3J B;  2JXM B;  3J7A V;  3X3M A;  2D0P A;  1E2V A;  3K0Y A;  2UUB Q;  2K6A A;  2WP8 J;  4DA2 A;  2R92 H;  2F3I A;  4JOI C;  1Y1W H;  2IHF A;  5CGL A;  4PG3 A;  4IPG A;  1ESR A;  4KN4 C;  2N49 A;  5C44 H;  1GO3 E;  2OT2 A;  4AQY L;  4EQO A;  4KY7 A;  2OTJ A;  3HOV G;  1U9R A;  3EFX D;  3HOZ B;  4J8Q A;  5CKL A;  1WOC A;  4IUP A;  4C3I H;  3A55 A;  4PNY A;  1ILP A;  1A3U A;  3HOV B;  1SSO A;  2EYF A;  1QZG A;  4RG1 A;  1QOH A;  4UAI A;  1WCM G;  4RAU C;  5DEH A;  1Q90 A;  1N36 Q;  4A3B G;  1KLG D;  2EPB A;  3G7L A;  4A3F H;  1I4P A;  3GD7 A;  1I4R A;  4GN4 B;  3E3X A;  5EKL A;  1A63 A;  2WKD A;  1JOO A;  2F0E A;  3PGZ A;  1SYC A;  4LUO A;  2R7Z B;  2K1B A;  3AQQ A;  1JT8 A;  1EY7 A;  2AQ1 B;  3TRZ A;  3P75 A;  4LW1 A;  5EKI A;  3LET A;  4U0U A;  4YCU A;  3SXH A;  3GTQ B;  2NN6 H;  2MNA A;  1BNZ A;  5L37 A;  1PYB A;  1X55 A;  1ICF B;  4ZQ3 A;  2LXJ A;  5IY0 A;  1PH8 A;  3BZC A;  5IT9 c;  2KA7 A;  2OTL A;  2E5L Q;  5COY A;  1E24 A;  3VR6 A;  1KL9 A;  2AUK A;  1MKH A;  4BBS B;  1PRT D;  4DV4 L;  3S14 H;  4RHS A;  4DR7 Q;  1PYW D;  2K14 A;  3K59 A;  3JAM E;  1STH A;  2K52 A;  1TS2 A;  5D14 A;  3T1Y L;  3STB C;  1PH3 A;  5IGE A;  2K01 A;  3N52 A;  5J3B A;  4C56 C;  4LFC L;  2BA0 A;  2F0V A;  3UDI A;  2D0O A;  1X3Q A;  4JI2 L;  3R3O A;  3FPP A;  3OYY A;  3CRL C;  1E22 A;  4A3F B;  4DXF A;  3M7N A;  4KY5 A;  4IUR A;  5ELE A;  2IHE A;  2SOB A;  4C3J B;  1G51 A;  1HFG A;  5KNB A;  1MJC A;  5IYB H;  1WD1 A;  2R3Z A;  4KHZ A;  4IFD G;  1HUM A;  2M2L A;  4XIG S;  5AFW A;  1K0R A;  2O5J C;  4F87 A;  5LMU L;  4KLK A;  3I91 A;  3H0G H;  2XSC A;  1EWH A;  1X56 A;  1HNZ L;  2IT1 A;  3GTL H;  3F2U A;  3VYT A;  1EY8 A;  5KIX A;  1FNV A;  4X62 L;  1IBK L;  2VQF L;  1EQT A;  5F2D A;  1JMC A;  1HZ9 A;  1TQO A;  1XYI A;  3PO3 G;  2B2Y C;  3U4Z A;  1JOR A;  2TMP A;  3HKZ E;  1PFS A;  1LTA D;  2ZTE A;  4DR1 Q;  5M3F G;  1SMX A;  1OTC A;  2AWO A;  4EVO A;  2QW7 A;  5DNF A;  1JQY D;  2HDL A;  1SYG A;  4LF4 L;  1H9M A;  2EVB A;  3CQZ H;  2NZO A;  2SEB D;  1Y14 B;  2ZJP A;  4HJ9 A;  1PMR A;  4MTK A;  3LWE A;  2CHB D;  2XRS D;  5CV4 A;  1TS5 A;  5IYC H;  2E2I H;  4DV1 Q;  1PTO B;  4A3J H;  2ICI A;  4M16 A;  2N88 A;  3L3O C;  1QVG A;  5BN3 A;  4RKB A;  2K5V A;  2JQO A;  2F0H A;  3NBI A;  4V0B A;  5LL6 S;  3SDZ A;  4YHH L;  5JJL A;  1PH1 A;  5CV9 A;  4DV3 Q;  5CV5 A;  5COR A;  1SXT A;  3O13 A;  2EJM A;  4JV5 Q;  3RLF A;  1DGS A;  3KF6 A;  2RF4 A;  1HR0 Q;  4YY3 L;  2K4K A;  5JFF A;  4OO1 I;  4H7B A;  2UXD Q;  1SYD A;  1Q8K A;  2NTS A;  1CK1 A;  4WOR A;  1Y1W G;  4LF7 L;  4A93 B;  1HNW Q;  4Y52 H;  1C9O A;  3JAM c;  4DUY L;  1SE4 A;  3S2H H;  4A3K G;  2YYZ A;  3H0G B;  4DV0 Q;  4GKK Q;  3RZD H;  1BXT A;  3OTO Q;  2PZT A;  5D3D A;  4IAL A;  3K5N A;  1IW7 C;  5C44 G;  1S5D D;  2XNA C;  5C4J H;  5JJ6 A;  3I4M H;  4PV1 C;  1YJN A;  3E6Z X;  1WTW A;  3H3V H;  3W1G A;  4AQY Q;  1HA5 A;  2RDG A;  5IGD A;  1K28 A;  1XNR L;  4AYB G;  1Y1W B;  4K0K Q;  1Q82 C;  3SK8 A;  1AZQ A;  1KXL A;  2VQE Q;  2L5T A;  5IP7 G;  3HOX B;  3KBX A;  2C35 B;  3TRE A;  4GKJ L;  3BYY B;  1TWG B;  1HFN A;  2ICE C;  2IL8 A;  2LXK A;  2F6S A;  5JAV A;  3UDF A;  2V1C C;  5LL6 X;  4A3B H;  1JIC A;  3M7G A;  4HJ8 A;  3MXN B;  4WJ3 M;  4PZ8 A;  4L5S A;  3JC6 6;  4ME5 A;  2Q8I B;  4OO1 H;  3QOL A;  1PH9 A;  2A5H A;  2WKC A;  3J80 i;  2CWA A;  3JAM i;  4A3B B;  5M9O A;  3PUZ A;  3S1Q B;  1PTO C;  3RNU A;  3M9B A;  2EY2 A;  4A3D B;  1CT1 D;  2JA6 H;  4DR4 L;  1M1K C;  4TKO B;  4IJL A;  1KIX A;  2QKI C;  3S1M B;  4OGQ C;  1STB A;  3S15 H;  4O0A A;  5C4X B;  1TR5 A;  3ULL A;  3MWY W;  3OSO A;  2I5M X;  4FF1 A;  2OCE A;  2K05 A;  3I90 A;  1I5F A;  3SK4 A;  5A35 A;  2FFK B;  2CH4 W;  4QF4 A;  3NEM A;  4G57 A;  1WTX A;  1EYG A;  1I4G A;  3I4M B;  3M3Y H;  1EY4 A;  2QF7 A;  2R7Z G;  2E75 C;  1LT4 D;  5DM7 3;  4H02 A;  4ODG A;  2RKS A;  1K0S A;  1QWY A;  1Q3L A;  1T5X D;  4GNX A;  3A8J E;  3I72 A;  3I4L A;  3S24 A;  3PV0 A;  4A93 H;  1IYU A;  1RTO A;  2HHH L;  4A3I G;  1D5M C;  4R4T A;  3S1R B;  4IN3 A;  1CSQ A;  1P8L A;  2MP1 A;  2PZU A;  2OF1 A;  4BY7 B;  1B2T A;  4LF5 L;  1E2Z A;  1VQ6 A;  5GAG C;  1EIY B;  2EE1 A;  1EUJ A;  1VQA A;  4ZK9 B;  1S72 A;  2IJ0 A;  3GTL B;  4A3D G;  1J8I A;  2LFN A;  2R93 G;  4QJF A;  1I3Q B;  3I4N H;  1KQS A;  1QNK A;  3U9O A;  5HY6 A;  2B63 B;  1HPC A;  1AFP A;  1V1P B;  3H3V I;  2ASB A;  2CW0 D;  1X3P A;  1VQN A;  1QCB D;  4U0Z A;  1IBL Q;  1L0W A;  5IYB G;  2VW9 A;  3I4O A;  5M5W H;  4B3T L;  2A69 D;  2PW5 A;  2PNR C;  5ELC A;  3ND8 A;  5EAY A;  4BXX G;  4BBR G;  5LHY 1;  4HSV A;  3ERQ A;  4BY1 H;  4FP5 D;  1RF2 D;  3LGJ A;  1LAC A;  4ZRZ A;  2AHO B;  2JN4 A;  4YCW A;  5HUR A;  1TT2 A;  5GAE C;  3ONA B;  1HNW L;  1V9P A;  3HOY G;  4LF9 Q;  5KNC A;  5DM6 3;  4KHP Q;  4HCS A;  1B70 B;  1K9M C;  1BBU A;  1SEB D;  2K50 A;  3DLL A;  2EYH A;  1TWC B;  2D9U A;  2HCI A;  1PH2 A;  4RA8 A;  1IYV A;  1CA6 A;  2K5D A;  4EQP A;  2EY6 A;  4B08 A;  1NE3 A;  4ULL A;  4Y7N H;  4DR2 Q;  4DR4 Q;  1GUS A;  3CMA A;  4JBJ A;  3S2H B;  3VDY A;  1Q81 C;  4MHE A;  2JA8 H;  1SDF A;  3AMU A;  5M5Y H;  2EXZ A;  3MXG A;  5I6W A;  2BH8 A;  4X64 L;  2AWN A;  2Z6K A;  3DWA A;  4R4I A;  1XMQ L;  2JA5 H;  3KDF B;  5HGT A;  4R4O A;  4DF7 A;  3BVM A;  2JEA I;  5M5Y B;  3R8B A;  4DNR B;  3CW2 C;  3A54 A;  5FLM G;  3G6E A;  1I4Q A;  5ELO A;  3KLR A;  1VQC A;  4ID6 A;  3J7A 5;  3NTK A;  4S3S A;  4DR5 L;  4KKU A;  1BBX C;  4LU4 A;  1A15 A;  1KDB A;  2B2U A;  4A3M G;  1R9T H;  1IKM A;  4XQN A;  1D1I A;  3TP7 A;  5CMT A;  4A3C G;  2F1M A;  4HID A;  4DK3 C;  5GAH C;  4NXN Q;  2F3W A;  2FIN B;  2MQH A;  3DUZ A;  1JE5 A;  2PZW A;  4ZUJ A;  2XTI A;  5HGQ A;  5C44 B;  1WTH A;  2M9V A;  1OXS C;  2KCM A;  4TRD A;  1JE4 A;  1VQE A;  2Z6B A;  1K83 B;  1TY2 A;  1ZEQ X;  3C1F A;  4BY1 B;  1N33 L;  1DYQ A;  1IBK Q;  2I07 B;  2KHI A;  3HG9 A;  4QGU A;  1GUW A;  5EBD A;  3HRZ C;  1JJ2 A;  1X3G A;  3L2P A;  1EIH A;  1X32 A;  4F88 A;  2JA6 G;  2KED A;  3RR5 A;  5D3I B;  4P74 A;  5GQO A;  4JI1 Q;  1SND A;  3CCL A;  1KNA A;  3CCR A;  2NVT H;  1WFQ A;  3AB9 A;  1H9J A;  3KF8 A;  2QDB A;  1A0I A;  3TME A;  4YHH Q;  3C3L A;  1GJX A;  1N34 Q;  5C3E H;  3WDN A;  2ALY B;  2B39 A;  1R9T B;  3CCU A;  3BU2 A;  3A0J A;  3DEP A;  2WIN B;  2XIW A;  1QG7 A;  1A3V A;  3SGI A;  3UE1 A;  4DR7 L;  1E0B A;  3FP9 A;  1JJG A;  4JPB W;  3F8T A;  5JVH 3;  5JEA H;  4KHV A;  2HD3 A;  3H0G G;  4DPG A;  4L6T B;  4JVZ A;  5A2Q E;  3EA6 A;  4DV2 Q;  3K7A H;  2L0C A;  4LF7 Q;  4LFC Q;  1KLU D;  2ZJR A;  3WOE A;  4XQJ A;  3QO2 A;  4IPC A;  4JI5 Q;  5EPL A;  1I50 H;  4LFB Q;  1EU4 A;  1Y1V G;  1LLR D;  4HIM A;  5IT9 E;  3S17 H;  4N67 A;  2L12 A;  3D3R A;  5J1Z A;  1EIF A;  4N8F A;  2WAC A;  1VQO A;  3Q23 A;  3NWS A;  1TWC H;  1PH6 A;  1Q1E A;  1RJT A;  4K5X A;  1IBL L;  2WAQ G;  3OPO A;  3E9I A;  4A3G G;  1PDQ A;  2PI2 E;  1Z6H A;  3S16 H;  4BBR B;  5C6A A;  2VQF Q;  4OIJ A;  2B2T A;  1EIG A;  5C4X G;  1BDO A;  4OEL B;  2EYP A;  1GHJ A;  2F0F A;  3PO3 H;  2B2T C;  4A76 A;  1EY9 A;  1F2Z A;  2Z8L A;  1X54 A;  5DLQ E;  1O80 A;  2R93 B;  2PI2 A;  3QB3 A;  4GN3 B;  1O7Y A;  5KYI A;  2NVX H;  1ILQ A;  2WB1 E;  4LF8 Q;  3ER0 A;  3T13 A;  3SHL A;  2R6G A;  1MGS A;  4L8J A;  4LF8 L;  3J81 c;  4K14 A;  4F8M A;  3TS2 A;  2O5I C;  2A6E C;  3ND9 A;  4HMI A;  3SN9 A;  1CI3 M;  1EQV A;  1SE2 A;  3K58 A;  1EY5 A;  4IFD I;  3OHX C;  3T1H Q;  2B2U C;  2L1B A;  1DM0 B;  1JWU D;  3HOX G;  3VR5 A;  3G6J B;  1XTC D;  1UEA B;  1BCP C;  4ZYS A;  1V8Q A;  4JC0 A;  3TEH B;  1SN8 A;  1XX8 A;  5IWA L;  1L0X B;  5LMN Q;  1HNX Q;  5FLM H;  1ZXT A;  4H44 C;  4DR6 L;  1ET6 A;  1NSN S;  3MFY A;  2WB1 G;  1LTR D;  4FNF A;  1LT3 D;  5DAU A;  4A3F G;  3EN2 A;  4UY8 C;  1BOS A;  1XWE A;  4PMB A;  1X65 A;  2AKW B;  2EQS A;  1GM5 A;  1U4R A;  4DK0 A;  2G5D A;  1VMC A;  1CZG A;  3ULP A;  3S1M H;  3KJO A;  5JJI A;  2EY5 A;  4K2L A;  1CFM A;  1HA6 A;  1DJR D;  1MJE A;  1NH1 A;  1LYL A;  1N36 L;  1M90 C;  1K3R A;  4IFD J;  1W2B A;  3LWU A;  5IGG A;  2JA6 B;  3Q8D A;  4DGZ A;  2WII B;  1QUQ A;  3CCQ A;  4OL7 A;  2F4V Q;  1ZKO A;  2K5N A;  5M5W B;  1YZ6 A;  1SE8 A;  4JI8 L;  2PQA A;  2YV5 A;  5D65 A;  1G91 A;  1B1Z A;  1ZYR D;  1WCM B;  1PFN A;  3GTM B;  1TS3 A;  3BDO A;  3PF5 A;  1RD9 D;  1VQ7 A;  4UHV A;  1NMF A;  4DV0 L;  3AEV A;  4LF9 L;  4KD3 A;  2NN6 G;  2JA7 G;  4G7Z C;  3IFT A;  1SNP A;  4O2D A;  5FO7 B;  2K04 A;  5EPJ A;  1EL0 A;  3I4N B;  1X3E A;  2EDG A;  2OQ0 A;  3H09 A;  1EWI A;  1SLJ A;  4N9P A;  4X2E A;  1YHA A;  5JJ7 A;  3N3U A;  4RGT A;  3BYT B;  3ITP A;  2B29 A;  5BR8 L;  1B50 A;  1EYC A;  4CJ0 B;  5C4J B;  3B6Y A;  3EQL C;  5CV6 A;  2IWH A;  1Y8P B;  3CKI B;  3CUC A;  4HIK A;  3K5O A;  4P2C B;  2KJX A;  2NVY H;  2DJG C;  3IRB A;  5EQ0 A;  2G03 A;  1VQL A;  2F4V L;  1CKN B;  1PFB A;  1STE A;  1ASY A;  3NHH A;  3H94 A;  3FMC A;  2NVY B;  3GQB A;  1YNJ D;  4FXG C;  2KHJ A;  2EJF C;  4AYB B;  4X66 Q;  5FLX L;  3V96 A;  5C3E B;  1VCI A;  2X69 A;  4B9W A;  5KEE A;  1Y1V B;  1TWF B;  1M8A A;  2YU9 B;  3M4Y A;  3DWP A;  5CV8 A;  2WV6 D;  3KF8 B;  1RCV D;  2A19 A;  2F0W A;  4A3D H;  2H4O A;  3IAY A;  1VQD A;  3PO2 G;  1HCZ A;  4TVA B;  4LJZ C;  4DV5 Q;  4KK7 A;  5IP9 H;  1K8M A;  1ONL A;  2ZT9 C;  3OIQ A;  4ZAI A;  4LAA A;  2I5H A;  1W6J A;  2RBM A;  1WI5 A;  3FPU B;  4A3K H;  3CAM A;  1M4V A;  2B2V A;  3HS0 C;  4EQN A;  3D4D A;  1DCZ A;  5NUC A;  5I2Y A;  3W5O A;  1CKM A;  2Z4H A;  3HOX H;  3ZLM A;  4DR3 L;  1EFW A;  4K5V A;  4QL5 A;  1OXT A;  5LMN W;  2PW7 A;  1XMO L;  5I6Y A;  4QQB X;  1EEI D;  5K36 H;  3D4R A;  3NEL A;  3RN5 A;  3KFU A;  3T56 B;  5JVG 3;  1L0Y B;  4KMU C;  1BQQ T;  1JCK B;  2ZXR A;  3J81 E;  5IYD G;  2K7V A;  1VQ8 A;  2YTX A;  1HNX L;  4J6H A;  5CMD A;  1QJO A;  1KRT A;  1GUO A;  2HT1 A;  3S2D B;  3KLS A;  2A68 D;  4Q0F A;  4L5Q A;  2QGQ A;  3HP3 A;  1BVS A;  1YNN D;  2QIL A;  2JA5 B;  2XVS A;  1HRJ A;  1Z47 A;  1FGB D;  1WTR A;  5EBC A;  4OO1 G;  4DNI A;  4UP7 A;  4GKJ Q;  3GTK B;  1MSG A;  4R8I A;  5JEA J;  3STB D;  4XI8 A;  3I73 A;  1P16 A;  4X65 L;  5FO8 B;  4F7X A;  3M3Y B;  4BS9 A;  1RHP A;  3FEW X;  1MI2 A;  1STN A;  2KCC A;  2M00 A;  1B44 D;  3OMG A;  2J7Z A;  4U67 3;  2MHV A;  3PIO A;  4MIU A;  1E1O A;  2VXW A;  3GTO H;  1Z9F A;  4EGV A;  2RA4 A;  3MVV A;  1KDA A;  4JBK A;  2MGS A;  1UNS A;  4I7Z C;  3SK6 A;  4WGJ A;  2UUC L;  1BUV T;  1G6Z A;  1S5F D;  4LMQ D;  2B8G A;  3M4P A;  3V2T A;  1ENF A;  2Y0S E;  3C1E A;  3C46 A;  2DY8 A;  3U4V A;  1V43 A;  4QIW B;  2ID0 A;  3V05 A;  1JWM D;  4NW2 A;  3E5S A;  1ET9 A;  4JBW A;  4CDC C;  2NTT A;  2ATW A;  1B3A A;  4JCV E;  4DV7 Q;  1EOV A;  1X6O A;  4N9T A;  3HOU B;  4DUY Q;  2BE5 D;  2BOS A;  3R93 A;  4GNX B;  2CH4 A;  4BA2 I;  1FJG L;  1YHB A;  2UXC L;  4N8X 1;  4GZY C;  2BE5 C;  2Y0S G;  3J7A F;  1VQH A;  1AH9 A;  1WTQ A;  1KAB A;  2RSO A;  3CP0 A;  4CKC A;  4FDB A;  4DU9 A;  1L2F A;  1PZJ D;  2A8V A;  4RCN A;  3T53 B;  3KOJ A;  3KLS X;  2EYJ A;  3VA5 A;  2QA4 A;  3H6M A;  1ENA A;  1CUK A;  1GKH A;  4C3J H;  1Q46 A;  4RHR A;  1WTP A;  4P73 A;  3HOU G;  3HOU H;  3R2T A;  4IFD H;  4GN5 A;  3ULJ A;  2EJG C;  2RQX A;  4A93 G;  3S1N B;  1JOK A;  1BKB A;  1C4Q A;  1UE1 A;  3KF6 B;  4B9X A;  4CKE A;  4XYQ A;  3NWT A;  3CPF A;  2Z9H A;  2IX3 A;  1F9P A;  1SYF A;  5TSS A;  5IOC A;  4ZKB B;  3G48 A;  1SFO H;  2KEC A;  3W3A A;  4DV7 L;  1E2W A;  3N6R A;  1GUG A;  1OXV A;  2Q8R E;  2RHS B;  1SE3 A;  1LTS D;  2MFI A;  4ZKC B;  2PNH A;  1I4H A;  3LNN A;  1A2U A;  4KHP L;  2QEJ C;  1AE2 A;  1NJI C;  1W3S A;  1ASZ A;  1H9R A;  4A3M B;  3GTJ B;  2L15 A;  2I5L X;  2EYM A;  3M85 A;  2VZA A;  3L0O A;  5G3L F;  2GVB A;  1VQP A;  1HTP A;  5M3M G;  1IW7 D;  2RSN A;  1SJE D;  1NUC A;  1C7Y A;  1X3F A;  1B8A A;  1CKN A;  3BG3 A;  3L7Z C;  2UXB Q;  2H1E A;  2K5W A;  3OW2 A;  3M4O H;  2PQE A;  4OWX B;  4YWK A;  1HZB A;  3BJU A;  4LF6 Q;  4NXM Q;  4X3S A;  4BY1 G;  2O4X A;  2MPM A;  2CCZ A;  4NDX A;  4KI0 A;  1YNN C;  1CZW A;  4JI3 Q;  4JOI A;  2DGY A;  1NCV A;  3FDT A;  3HOY H;  1BF4 A;  1T5E A;  1FGU A;  2NZH A;  4HJ5 A;  1XMQ Q;  3NBH B;  2R92 G;  4J1M A;  2N8N A;  4P72 A;  4AH6 A;  2JA8 G;  1PRT C;  3LX0 A;  2UXC Q;  1ROD A;  3S1R H;  2DY7 A;  3HOY B;  4LNQ A;  3HOZ H;  1H9K A;  2TSS A;  1HJP A;  1EZ8 A;  1JOQ A;  3AFP A;  3TBI B;  3I4M G;  3Q6S A;  5JFZ A;  2UUA Q;  3SHG A;  2FHT A;  4K5W A;  3FKI B;  4FXD A;  2GN5 A;  2H5X A;  2L9H A;  4DFA A;  3D0F A;  4DN4 M;  4HAE A;  1HNZ Q;  2J4X A;  2WAQ E;  5LMU Q;  4M8A A;  4X6A H;  3NTH A;  3A5Z B;  1STY A;  5C5L A;  5JOB A;  3PIP 3;  3PUX A;  2E8G A;  2EZV A;  2NUN A;  3E0E A;  2ZTD A;  4QMG A;  4A3M H;  2DN8 A;  2F0L A;  2VNU D;  3NE5 B;  4JW0 A;  2PO4 A;  5K5P A;  5I9P A;  1L1O A;  3W1B A;  5ISR A;  4I65 A;  1L1O B;  4HN7 A;  1ICW A;  1H95 A;  4Y7N B;  1LTI D;  1V1O A;  4KTA A;  1C48 A;  3E0J A;  2CWP A;  2CFM A;  3MXN A;  1C8C A;  3KUP A;  2Z4I A;  3MEH A;  4MN3 A;  3PF4 A;  2VB3 X;  1WTO A;  4BWG B;  5M3F B;  4U0S A;  4JG2 A;  4K8I A;  4NKL A;  2OXP A;  4K6D A;  5EU0 A;  4U07 A;  3ZJY C;  3S2D H;  1RL2 A;  3J80 E;  1CA5 A;  4DR2 L;  1CTM A;  3CXC A;  1D1K A;  2E76 C;  3OIP A;  1A8V A;  3FKI G;  1XJV A;  3HOW H;  3NQT A;  1E7Z A;  2VB2 X;  3S1N H;  1NR2 A;  1PZK D;  2LS0 1;  1SRU A;  4G7O C;  4PMC A;  1PXU A;  4IQZ A;  5JPM C;  2VL6 A;  3TZU A;  3CPW A;  3BDC A;  3VYU A;  3CCM A;  2PYK A;  3NP8 A;  4GLX A;  1DON A;  3ZCB A;  1SYB A;  2DJF C;  2F0I A;  2JE6 I;  2D5D A;  4X3K A;  1LV9 A;  4IPH A;  3K8A A;  4DAY A;  2HIX A;  3ERS X;  4RFB A;  2A1A A;  1UE6 A;  1G2S A;  5BR8 Q;  4GOP B;  1HQM C;  4R1J A;  2VQE L;  1G8Z D;  4IPD A;  4OX9 L;  3I4N G;  4B3S L;  4CDD C;  3RUZ A;  1SMY C;  2X6G A;  3MXU A;  4QY7 A;  1AN8 A;  1D5X C;  1VF5 C;  4PZ6 A;  5CV7 A;  3GO5 A;  3CCJ A;  3S14 B;  1VQI A;  3TN2 A;  2VY3 A;  2A6H D;  1CQF A;  1PLF A;  4GLA C;  4PZ7 A;  3RD4 A;  1DXM A;  3I8Z A;  4ME3 A;  5FKA C;  3VYS A;  4DV5 L;  2G9H D;  4WRD A;  2E2D C;  4CKB A;  5FK9 C;  5IIF A;  2ZJQ A;  3GV6 A;  3URY A;  4BBS H;  1VS0 A;  2BA1 A;  4Q5V A;  1CSP A;  4ZUI A;  3KK7 A;  4YWL A;  3IL8 A;  3WWV A;  4RH6 A;  1J5E Q;  3Q22 A;  1KAA A;  1N9W A;  3FVQ A;  1K8A C;  1TII D;  3HEJ A;  2Q2T A;  2JA9 A;  1FVI A;  1ESF A;  1CHQ D;  2J0T D;  5C0X J;  4JI0 Q;  4IJH A;  3PQI A;  2F0K A;  1UWV A;  2AMC B;  2F3V A;  4KKT A;  1B7Y B;  5IE8 A;  4A3E B;  4GS3 A;  4JV5 L;  4LF6 L;  4NXM L;  3HOZ G;  3D31 A;  1UUP A;  4ILW A;  3SVM A;  3TP8 A;  3GTG H;  2IX1 A;  2Z1C A;  2KCN A;  4CJ1 B;  2NBF A;  5EPK A;  5IWA Q;  3S9W A;  5LMN L;  1XXG A;  3EIV A;  3K57 A;  1HZA A;  5K36 G;  1CKO A;  1Y8N B;  3Q0A A;  4PY3 A;  3MZ5 A;  3S15 B;  1TS4 A;  2OEO A;  1GOZ A;  2K33 A;  1E1T A;  2Q2I A;  1GVP A;  2G9D A;  4X62 Q;  1YHQ A;  3A74 A;  3W2D A;  5IP7 H;  1WVL A;  4XTC S;  3P1H A;  4DKA C;  1PZI D;  4B3R L;  4DUZ Q;  2R92 B;  2IPK D;  1SNQ A;  5E1F A;  1TU2 B;  2NZ1 D;  2ES2 A;  1G29 1;  3T16 A;  3I70 A;  2NVT B;  1F77 A;  1K8O A;  2CKZ B;  4JI8 Q;  5GAD C;  3CC4 A;  4XDX A;  1A62 A;  5JPN C;  2F0P A;  5C3E G;  1ML0 D;  2UUC Q;  1SJH D;  4H13 C;  1SR3 A;  2LSS A;  3MC0 B;  1YJ9 A;  3GTQ H;  4K0K L;  3RN2 A;  4L5T A;  4A3K B;  4TSS A;  2KQ3 A;  3DWQ A;  2PMZ B;  4QUF A;  1QVF A;  1STA A;  3J81 j;  4LWC A;  3GTJ H;  2UXD L;  3UI2 A;  2FMC A;  1FL0 A;  4CDF C;  2HIV A;  4HJ7 A;  3K81 C;  4OXP A;  3J80 L;  3K6O A;  5A2Q L;  2E2J H;  4L5R C;  1U4M A;  3U9S A;  4KKS A;  1S4Z A;  1CHP D;  4HJA A;  4IO9 A;  1LM0 A;  1MIU A;  2WAQ B;  1I6H B;  3AFQ A;  2A74 C;  4DV3 L;  2OQK A;  1K8G A;  2K75 A;  4AYB E;  5AJ3 L;  3BDL A;  4CGY B;  1YJW A;  4QUC A;  2E5L L;  1IYJ B;  5IGC A;  3PO2 B;  4HIO A;  3QIA A;  1Y1V H;  4FO2 A;  3CD6 A;  4JI4 Q;  3DEO A;  3SK5 A;  5EJW A;  1TY0 A;  3D4W A;  3HOW G;  3GTK H;  2E2I B;  4DV6 Q;  2A68 C;  1IHZ A;  4DR6 Q;  4Z9C B;  1Q1B A;  3L9A X;  4R8N A;  3EBE A;  1A6X A;  4E6I A;  1U0L A;  2F0D A;  3QG1 A;  3CC2 A;  3QOJ A;  1HZC A;  2B3G A;  1EZ6 A;  1JB7 A;  1V1Q A;  3E9H A;  3MXP A;  4DV6 L;  1EYA A;  4QCL A;  1SMY D;  4LFB L;  1PVO A;  4OIK A;  1FNW A;  3T1H L;  4C1N I;  5C4X H;  4NB3 A;  1AP0 A;  5JEA G;  3A8I E;  4JI4 L;  5JJZ A;  1Q7Y C;  2R61 A;  3RMH A;  1MBY A;  3D8G A;  4YWM A;  4EQ5 A;  3NK9 A;  3QWN A;  3AU7 A;  3K7U C;  4JI2 Q;  1N8R C;  5FJ8 G;  2EOT A;  5KGU A;  4DAV A;  4JYA Q;  1XPU A;  1BCP D;  4JI5 L;  2KEN A;  2LY7 A;  4YIJ A;  5KRU A;  2YTY A;  1D7Q A;  1Y8O B;  4GLV B;  3T4A C; 
#chains in the Genus database with same CATH homology
 2F52 A;  3PIO A;  1EQR A;  4U0Z A;  4GNX C;  1VQ4 A;  1IBL Q;  1QUQ B;  1E1O A;  2JEB I;  1L0W A;  4A3J G;  3GTO H;  1VQG A;  1UE5 A;  1Z9F A;  4P71 A;  4X66 L;  5IYB G;  2VW9 A;  3I4O A;  1VQK A;  4ITR A;  5M5W H;  1IL2 A;  4B3T L;  4DV4 Q;  1K83 H;  4JBK A;  2N3S A;  4A3C H;  4WGJ A;  1IZ6 A;  1YVC A;  2UUC L;  1YIT A;  5EAY A;  4BXX G;  2R7F A;  4BBR G;  3M4P A;  4POF A;  2Y0S E;  4BY1 H;  3LGJ A;  3T1Y Q;  1IBM Q;  4GOP C;  3KYH C;  2AHO B;  3U4V A;  4YCW A;  1V43 A;  5GAE C;  1HNW L;  4LUV A;  1G6P A;  4UPA A;  1V9P A;  3HOY G;  2ID0 A;  1S40 A;  4LF9 Q;  5M3F H;  3PUV A;  4KHP Q;  1Q86 C;  3G71 A;  1B70 B;  4JBW A;  1K9M C;  4UP8 A;  1BBU A;  3CC7 A;  2K50 A;  1PH2 A;  3DLL A;  5C0X G;  2ATW A;  1IXR A;  1YIJ A;  4JI1 L;  4JCV E;  4DAY B;  4DV7 Q;  1JJC B;  3PUW A;  1EOV A;  1NTG A;  1X6O A;  1NE3 A;  2RHQ B;  4DR2 Q;  4Y7N H;  1VQM A;  4DR4 Q;  4DUY Q;  1NMG A;  4LFA Q;  5M3M H;  3CMA A;  1XMO Q;  4JBJ A;  5ELN A;  3VDY A;  4GNX B;  1Q81 C;  2NVQ H;  3I2Z A;  3TS0 A;  2VUM H;  1FJG L;  2JA8 H;  2CQO A;  4BA2 I;  1YHB A;  4DR3 Q;  2UXC L;  5M5Y H;  1PV4 A;  2Y0S G;  3F2B A;  2OWO A;  1KAW A;  1VQH A;  2BH8 A;  4X64 L;  1AH9 A;  2AWN A;  2Z6K A;  4R4I A;  1XMQ L;  2JA5 H;  1BBW A;  4GOP A;  4C3H H;  4DR5 Q;  3CP0 A;  3KDF B;  3GTM H;  4FDB A;  1NBW A;  3HKS A;  1L2F A;  4R4O A;  2UUB L;  2A8V A;  3GDE A;  1UEB A;  4MTN A;  3KOJ A;  4RMF A;  2JEA I;  2R7D A;  1XPR A;  4LUZ A;  2QA4 A;  3CW2 C;  2PMZ E;  4A75 A;  5FLM G;  3G6E A;  5ELO A;  1CUK A;  1GKH A;  4C3J H;  1Q46 A;  4NXN L;  4DUZ L;  4P73 A;  1Q12 A;  4P75 A;  3CCV A;  3HOU G;  1VQC A;  3HOU H;  3J7A 5;  4DR5 L;  4GN5 A;  3ULJ A;  4LU4 A;  4A3M G;  4A93 G;  3CCS A;  4A3E H;  1R9T H;  4B3S Q;  2JK8 A;  4B3M L;  3KJP A;  1BKB A;  4B3M Q;  5CMT A;  3FHW A;  3K80 C;  4A3C G;  1UE1 A;  3KF6 B;  2ZTC A;  3PIP A;  4HID A;  1C0A A;  3CPF A;  4DK3 C;  5GAH C;  4NXN Q;  3PO2 H;  1PA6 A;  1QVC A;  1N32 Q;  2MQH A;  1JE5 A;  5C0X I;  2XTI A;  5HGQ A;  4B3R Q;  4R4C A;  3G48 A;  1OXS C;  2KCM A;  5IP9 G;  1SFO H;  1I94 L;  1VQE A;  4APV A;  4DV7 L;  2PQA B;  4DV1 L;  1OXV A;  3G4S A;  2RHS B;  1N33 L;  2MFI A;  1IBK Q;  2KHI A;  4QGU A;  2PNH A;  4KHP L;  3PUY A;  1AE2 A;  1XPO A;  2Z6K C;  1NJI C;  1W3S A;  1JJ2 A;  1ASZ A;  4POG A;  1I94 Q;  1U5K A;  1X3G A;  3U50 C;  3L2P A;  4EX5 A;  2VS1 A;  2L15 A;  3F2D A;  2I5L X;  4LF4 Q;  4MZ9 A;  1YNX A;  4A4I A;  3M85 A;  2JA6 G;  2VZA A;  3L0O A;  3RR5 A;  4IOA A;  2GVB A;  1VQP A;  4A3G H;  5M3M G;  2UU9 Q;  1C7Y A;  1X3F A;  3GTP H;  4P74 A;  1B8A A;  1CKN A;  3L7Z C;  5GQO A;  4JI1 Q;  1PH7 A;  3CCL A;  2B63 G;  2UXB Q;  2GVA A;  1VQ5 A;  3OW2 A;  3M4O H;  3CCR A;  1TWF H;  2YU9 H;  2NVT H;  2UXB L;  4OWX B;  4YWK A;  1HZB A;  1WFQ A;  3BJU A;  3OTO L;  3CCE A;  4LF6 Q;  4NXM Q;  2N78 A;  2UU9 L;  1A0I A;  4YHH Q;  1L1O C;  4BY1 G;  3F1Z A;  1N34 Q;  5C3E H;  2JA7 H;  2ALY B;  2D0P A;  3CCU A;  2CCZ A;  3BU2 A;  1E3P A;  3I55 A;  4KI0 A;  3A0J A;  2IY5 B;  2UUB Q;  4JI3 Q;  4JOI A;  2NN6 I;  4LF5 Q;  2DGY A;  3HOY H;  3NEN A;  1PH5 A;  2KCT A;  2WP8 J;  1FGU A;  2NZH A;  2F3I A;  4JOI C;  3SGI A;  3NBH B;  2IHF A;  3UE1 A;  4HJ5 A;  1Y1W H;  1XMQ Q;  3FP9 A;  1X9N A;  2R92 G;  4BY7 H;  4DR7 L;  2N8N A;  3F8T A;  5CGL A;  4P72 A;  4PG3 A;  4AH6 A;  4IPG A;  5C44 H;  2N49 A;  3J81 i;  2JA8 G;  1GO3 E;  4U04 A;  3H0G G;  1O7I A;  4DPG A;  4AQY L;  2UXC Q;  3S1R H;  2DUD A;  1AE3 A;  4QIW E;  2OTJ A;  3ZC7 A;  4DV2 Q;  3HOV G;  1LUZ A;  3K7A H;  4LF7 Q;  4LFC Q;  4LNQ A;  3HOZ H;  1N32 L;  2ZJR A;  3FKI H;  5CKL A;  1WOC A;  1HJP A;  4C3I H;  3AFP A;  4IPC A;  4JI5 Q;  4LFB Q;  1I50 H;  1TXY A;  3I4M G;  1HR0 W;  5JFZ A;  1Y1V G;  4HIM A;  2UUA Q;  1I6H H;  3S17 H;  4N67 A;  2E2H H;  1D8L A;  3SHG A;  1QZG A;  1EIF A;  4RG1 A;  1QZH A;  2GN5 A;  2H5X A;  1VQO A;  1WCM G;  2BH2 A;  3D0F A;  1HNZ Q;  1TWC H;  1PH6 A;  1Q1E A;  1N36 Q;  1IBL L;  2WAQ G;  4A3B G;  2WAQ E;  2UXD Q;  5LMU Q;  4A3F H;  1IBM L;  4A3I H;  3S1Q H;  3E9I A;  4A3G G;  3A5Z B;  4X6A H;  2PI2 E;  3GD7 A;  2XGT A;  3HFZ B;  4GN4 B;  4Y52 H;  4BBS G;  1A63 A;  3S16 H;  3PUX A;  2E8G A;  3M4Q A;  3I7F A;  4OX9 Q;  3E0E A;  2VQF Q;  2ZTD A;  4A3M H;  3PGZ A;  2VNU D;  4LUO A;  3AQQ A;  5C4X G;  1JT8 A;  5FLX c;  1VQF A;  1L1O A;  2MO1 A;  3W1B A;  4B3T Q;  4A76 A;  3PO3 H;  3TRZ A;  1L1O B;  4LW1 A;  1HH2 P;  1X54 A;  1H95 A;  5DLQ E;  3LET A;  4U0U A;  4YCU A;  4AIM A;  2ZM6 Q;  2I0Q A;  3I56 A;  2PI2 A;  2MNA A;  1PYB A;  1X55 A;  2CFM A;  2CWP A;  4GN3 B;  4IOC A;  1KC8 C;  2QEX A;  2LXJ A;  5IY0 A;  1PH8 A;  2NVX H;  3BZC A;  5IT9 c;  3PF4 A;  2OTL A;  2WB1 E;  2E5L Q;  3UDX A;  4LF8 Q;  1E24 A;  4U0S A;  1KL9 A;  4JG2 A;  3ER0 A;  1T9H A;  1MKH A;  2R6G A;  1YBY A;  4DV4 L;  3S14 H;  5IYC G;  4LF8 L;  4DR7 Q;  2K14 A;  5EU0 A;  4OON A;  3RLN A;  3J81 c;  3TS2 A;  4U07 A;  3PSI A;  3ZJY C;  3S2D H;  1RL2 A;  2K52 A;  3SN9 A;  4DR2 L;  4IFD I;  4JI3 L;  3CXC A;  3STB C;  3T1Y L;  1TWA H;  1PH3 A;  1A8V A;  3FKI G;  3T1H Q;  1XJV A;  3HOX G;  5J3B A;  3HOW H;  3K0X A;  4LFC L;  2VUM G;  2BA0 A;  2FXQ A;  3UDI A;  4BBR H;  4X2D A;  1E7Z A;  1OXX K;  2D0O A;  4JC0 A;  3TEH B;  4JI2 L;  3S1N H;  1SN8 A;  5IWA L;  3CF5 A;  1SRU A;  5LMN Q;  3OYY A;  1HNX Q;  2HHH Q;  1E22 A;  3M7N A;  3CPW A;  5FLM H;  2UUA L;  2VL6 A;  2IHE A;  4GLX A;  1G51 A;  1WYD A;  3CCM A;  3ZCB A;  1MJC A;  2JE6 I;  5IYB H;  4DR6 L;  4KHZ A;  4IFD G;  2WB1 G;  4XIG S;  1XNR Q;  1K0R A;  4IPH A;  3K8A A;  4A3F G;  5LMU L;  1LTL A;  4KLK A;  3EN2 A;  4UY8 C;  3J7Z C;  2YTV A;  2RCN A;  1X65 A;  2HIX A;  3ERS X;  3H0G H;  1X56 A;  1HNZ L;  1NY4 A;  2A1A A;  1UE6 A;  2AKW B;  2EQS A;  1GM5 A;  2IT1 A;  3GTL H;  4MNO A;  3ULP A;  4OWW B;  5BR8 Q;  3S1M H;  3HKZ G;  4GOP B;  3KJO A;  4R1J A;  4X62 L;  2VQE L;  1IBK L;  2VQF L;  4IPD A;  1HZ9 A;  1JMC A;  4OX9 L;  3I4N G;  4B3S L;  3PO3 G;  5JJI A;  3U4Z A;  1XNQ Q;  3H15 A;  3HKZ E;  1PFS A;  3F2C A;  2ZTE A;  4QY7 A;  4DR1 Q;  5M3F G;  1MJE A;  1SMX A;  4PZ6 A;  2AWO A;  1OTC A;  1LYL A;  4A3L H;  3GO5 A;  3CCJ A;  3RZO H;  4A3L G;  1N36 L;  1VQI A;  1M90 C;  1WCM H;  4LF4 L;  2VY3 A;  3CQZ H;  1EQQ A;  1K3R A;  4GLA C;  2NZO A;  4IFD J;  4PZ7 A;  1Y14 B;  1W2B A;  2ZJP A;  4ME3 A;  4DV5 L;  4HJ9 A;  2KBN A;  3Q8D A;  5IYC H;  2E2I H;  4ALP A;  1QUQ A;  4DV1 Q;  4A3J H;  3CCQ A;  2ZJQ A;  4BBS H;  2F4V Q;  1TWG H;  4TQU S;  4M16 A;  1VS0 A;  2K5N A;  2BA1 A;  1YZ6 A;  1SE8 A;  4JI8 L;  1CSP A;  1QVG A;  2PQA A;  1OXU A;  2R7Z H;  4DV2 L;  2K5V A;  4YWL A;  2JQO A;  2YV5 A;  3ICE A;  3WWV A;  4YY3 Q;  4YHH L;  1J5E Q;  5JJL A;  1N9W A;  5AJ3 Q;  1PH1 A;  1PHJ A;  1K8A C;  4JI7 Q;  1JJG A;  4DV3 Q;  2Q2T A;  3PF5 A;  2JA9 A;  1I3Q H;  1FVI A;  1VQ7 A;  1VQB A;  5C0X J;  5GRO A;  4JI0 Q;  4JI7 L;  4IJH A;  4JV5 Q;  3RLF A;  1DGS A;  1NMF A;  4DV0 L;  3KF6 A;  3AEV A;  2RF4 A;  1HR0 Q;  4YY3 L;  2K4K A;  4LF9 L;  5JFF A;  4OO1 I;  2NN6 G;  2JA7 G;  1HNW Q;  1Q8K A;  1Y1W G;  1KD1 C;  1UWV A;  4LF7 L;  1YI2 A;  1UE7 A;  2WFW A;  4O2D A;  4LFA L;  1C9O A;  2K5H A;  3JAM c;  4DUY L;  2AMC B;  5IE8 A;  1N34 L;  1B7Y B;  3A5U A;  4A3K G;  3S2H H;  1X3E A;  2YYZ A;  4GS3 A;  2OQ0 A;  4DV0 Q;  1EWI A;  1SLJ A;  3U58 A;  4GKK Q;  4JV5 L;  3RZD H;  3OTO Q;  4LF6 L;  4NXM L;  3HOZ G;  4X2E A;  4JI6 Q;  3D31 A;  1YHA A;  5JJ7 A;  2EXD A;  3DM3 A;  3GTG H;  3N3U A;  2IX1 A;  3KDF A;  5BR8 L;  2B29 A;  1PYS B;  5C44 G;  5C4J H;  1S3O A;  5JJ6 A;  5IWA Q;  5LMN L;  3I4M H;  4GKK L;  4DK6 C;  1YJN A;  3B6Y A;  3EIV A;  3S6A A;  2R92 H;  1HZA A;  3H3V H;  5K36 G;  1CKO A;  4WJ4 A;  1WJJ A;  4PY3 A;  3CUC A;  4HIK A;  3W1G A;  4AQY Q;  2NVY H;  5FJ8 H;  4DR1 L;  3IRB A;  1XNR L;  2G03 A;  1VQL A;  4AYB G;  1HR0 L;  2F4V L;  1CKN B;  4K0K Q;  1ASY A;  1Q82 C;  1KXL A;  1E1T A;  3KLW A;  4BA1 I;  3RLO A;  4A3E G;  2Q2I A;  1GVP A;  4X62 Q;  2VQE Q;  1YHQ A;  3CME A;  3A74 A;  4X2C A;  5IP7 G;  2KHJ A;  5IP7 H;  2C35 B;  3TRE A;  4GKJ L;  4XTC S;  5E7N A;  4DKA C;  4X66 Q;  4B3R L;  2LXK A;  2F6S A;  1VCI A;  4DUZ Q;  3UDF A;  2V1C C;  1K73 C;  4A3B H;  2ES2 A;  1G29 1;  4PMW A;  4HJ8 A;  3MXN B;  3UE0 A;  2CKZ B;  1PH4 A;  4JI8 Q;  1KRS A;  5GAD C;  3CC4 A;  4PZ8 A;  4WJ3 M;  3KF8 B;  3PCO B;  1A62 A;  4L5S A;  3JC6 6;  2A19 A;  1XNQ L;  4BXX H;  4A3D H;  5C3E G;  1PH9 A;  2UUC Q;  1N33 Q;  1SR3 A;  1VQD A;  2LSS A;  3GTQ H;  1YJ9 A;  3PO2 G;  3J80 i;  2R93 H;  4J15 A;  4K0K L;  2CWA A;  4TVA B;  3JAM i;  4L5T A;  3RN2 A;  4DV5 Q;  3PUZ A;  1J6Q A;  4DAM A;  5IP9 H;  3RNU A;  3SE5 A;  4BY7 G;  1QVF A;  3M9B A;  3J81 j;  4LWC A;  3GTJ H;  1VQ9 A;  2JA6 H;  2Z0S A;  2UXD L;  4DR4 L;  2I5H A;  1FL0 A;  4IJL A;  2HIV A;  4HJ7 A;  3K81 C;  4OXP A;  1M1K C;  1WI5 A;  1KIX A;  2E2J H;  4A3K H;  4L5R C;  3S15 H;  4R4Q A;  3CAM A;  4O0A A;  2ZM6 L;  4UP9 A;  3TQY A;  3ULL A;  2I5M X;  4HJA A;  4JI0 L;  4IO9 A;  1GD7 A;  1LM0 A;  1MIU A;  4X64 Q;  3HOV H;  3AFQ A;  2OCE A;  2OQK A;  3W5O A;  4DV3 L;  2K75 A;  1K8G A;  1CKM A;  4AYB E;  3HOX H;  4JI6 L;  1I5F A;  5AJ3 L;  3ZLM A;  1J5E L;  1YJW A;  3NEM A;  2E5L L;  2Q2H A;  1EYG A;  4DR3 L;  2JA5 G;  1IYJ B;  1EFW A;  5LMN W;  4QL5 A;  1OXT A;  1FJG Q;  1TWH H;  4HIO A;  1Y1V H;  2B63 H;  3M3Y H;  1XMO L;  3CD6 A;  4JI4 Q;  4QQB X;  3J80 c;  2D62 A;  2JJQ A;  2R7Z G;  3HOW G;  3GTK H;  3NEL A;  4H02 A;  3RN5 A;  1RIP A;  1XTD A;  4DV6 Q;  3KFU A;  5JJK A;  4C2M H;  4DR6 Q;  4YCV A;  1Q1B A;  1SRO A;  4X65 Q;  3EBE A;  4GNX A;  3S24 A;  3PV0 A;  1U0L A;  5IYD G;  1VQ8 A;  2EIF A;  2HHH L;  4A93 H;  5IYD H;  4A3I G;  2YTX A;  4R4T A;  1HNX L;  3CC2 A;  1CSQ A;  1HZC A;  1P8L A;  2B3G A;  3BZK A;  3MEF A;  1KRT A;  5M5X H;  1V1Q A;  3E9H A;  1JB7 A;  2HT1 A;  3UDG A;  4L5Q A;  2QGQ A;  4DV6 L;  1BVS A;  4LF5 L;  4LFB L;  1PVO A;  1VQ6 A;  3T1H L;  5H1S E;  5GAG C;  4OWT B;  5C4X H;  1EIY B;  2IX0 A;  4NB3 A;  5JEA G;  4JI4 L;  1Z47 A;  1EUJ A;  1VQA A;  2MO0 A;  1Q7Y C;  4JYA L;  4YWM A;  4EQ5 A;  1S72 A;  4A3D G;  4OO1 G;  4DNI A;  4UP7 A;  4GKJ Q;  2R93 G;  3AYH B;  3K7U C;  5JEA J;  4JI2 Q;  3STB D;  4XI8 A;  4X65 L;  1P16 A;  5FJ8 G;  1N8R C;  3I4N H;  1KQS A;  2HQL A;  5HY6 A;  4JYA Q;  1VQJ A;  2Q2U A;  4NPS A;  4JBM A;  1XPU A;  1KHI A;  4JI5 L;  2KEN A;  2YTY A;  1D7Q A;  1YEZ A;  4QJF A;  4GLV B;  2ASB A;  3H3V I;  1VQN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...