2VZAA

Type iv secretion system effector protein bepa
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
296
structure length
296
Chain Sequence
b'TEIISPHHYVYPNTTTLKNKYGIKNLNAFLEKCSHDTAKAMINLREESLPEYFDTAYLCHIHQQLFKNTFEWAGYLRHIPFTFADGTTAAMPEMKRTGWKNAFAIGDEIQEGLQRLDQTLAEKNNLQGLTREEFNSEAIELFNSLNQLHPFREGNGRTQRLFFENLAKAAGHQLNFSLITKERMMVASVAVAENGDLEPMQHLFEDISNPEKIRLLKEFMHTMKNTGRNVNDRPVMVAKEGETYTGTYRGAGLEGFALNVKGAYIIGNIDHLPPEQLKILKPGDKITFTAPKAHHH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CELL FILAMENTATION PROTEIN
molecule tags Cell adhesion
source organism Bartonella henselae
publication title Fic Domain Catalyzed Adenylylation: Insight Provided by the Structural Analysis of the Type Iv Secretion System Effector Bepa.
pubmed doi rcsb
total genus 91
structure length 296
sequence length 296
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature ec 2.7.7.n1: Protein adenylyltransferase.
pdb deposition date 2008-07-31

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02661 Fic Fic/DOC family
A PF18543 ID Intracellular delivery domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.3290.10 Mainly Alpha Orthogonal Bundle Fic-like fold Fido-like domain 2vzaA01
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 2vzaA02
5DLQE 3SE5A 4GKJQ 4LU4A 1VQEA 5JJ7A 1N8RC 1E1TA 1JMCA 5C0XI 1XPUA 1PH4A 1OXUA 4PZ6A 5K36G 3STBC 4LF5Q 4OXPA 4BY1H 4B3TL 4AQYL 4WJ4A 3JAMi 1AH9A 5IWAL 3ULJA 2JA8H 1HJPA 2N3SA 1OXXK 2ATWA 5IP9G 3J7ZC 2D62A 2NN6I 4JOIA 4GNXC 4DR6Q 2LSSA 4A3LH 1GM5A 2Z6KA 4DV1Q 4P72A 4JI6Q 1LTLA 3M7NA 5ELOA 1X3FA 2YTVA 3F2DA 4IOCA 4GKKQ 1Q1EA 5JJ6A 4C3JH 3A0JA 4DR4Q 1GD7A 1TWGH 2R93G 1D7QA 3PIOA 3I2ZA 1VS0A 2ALYB 2JQOA 3DM3A 5IWAQ 1M1KC 4UP9A 4DV4L 2OTLA 2YYZA 2HHHL 5M3MH 1I5FA 4A3FG 4B3ML 2EQSA 1PA6A 4YCWA 1VQIA 4QJFA 3CAMA 5EU0A 3PSIA 5FLMH 1K8GA 5IYBH 4AYBG 1IBML 3N3UA 1PH7A 2VQEL 2YV5A 3PO3H 5ELNA 2OTJA 3MEFA 2CWPA 3HOUG 1JJGA 4LFAL 3S16H 3RLOA 3UE0A 4DV6L 4LF7L 4JI5Q 5C0XJ 3HOVH 3S14H 3KDFA 1ASZA 2HT1A 1UE5A 4DK6C 2KBNA 3S24A 1HZCA 4JI5L 3UE1A 2PQAA 1A62A 3U50C 3D31A 5GAGC 3I4OA 2JA9A 1PV4A 5AJ3Q 4A3IG 5GADC 1OXVA 3GTLH 2JE6I 3PO2H 4Y52H 2F6SA 1Q8KA 4A3BG 3FHWA 4DR7L 1LUZA 5LMNW 1Q7YC 2R7DA 1YZ6A 1Z9FA 4NXNL 4DV6Q 4A3MG 1HNWQ 4GOPA 3NENA 1UEBA 3PUXA 5GQOA 2E2IH 3M9BA 1SROA 4QIWE 1VQMA 1QZHA 1QUQB 2Z0SA 3PO3G 2UUCL 2Q2IA 2OWOA 1FJGQ 4L5SA 4R4QA 4DV1L 2LXJA 2F4VL 1X3GA 3FKIH 4JG2A 1VQHA 4LW1A 2I0QA 3L0OA 2QGQA 3RLFA 1N32L 5C44G 5IYBG 1E3PA 2ZJRA 3ULLA 3TEHB 1O7IA 1QVFA 3PO2G 2E5LQ 1VQOA 1X65A 4O0AA 3KJPA 4X6AH 3BZKA 2A1AA 4R4TA 1X3EA 2I5HA 1L1OB 4X66L 1N34L 1EIYB 3L7ZC 1KRTA 5IYCH 3KFUA 2LXKA 1R9TH 2RHQB 3J81c 4PY3A 1VQFA 3W1BA 1E24A 2CWAA 4GOPC 1XNQQ 2IHFA 2NVQH 2IY5B 2VQEQ 4LF8L 1QZGA 4KHPL 1KL9A 1S72A 2XTIA 3PGZA 4B3TQ 1EIFA 3GDEA 1CKMA 3Q8DA 2Q2TA 2K52A 4UP8A 1Y1VG 4JI7Q 1J6QA 1B8AA 3AYHB 5C3EH 4P71A 4DUZL 1BVSA 4JI3Q 4RMFA 4GN3B 4P74A 4HIMA 3HOVG 2L15A 1VQ6A 4R4IA 3S6AA 4LUZA 3F2CA 2JEAI 3TS0A 4GKKL 3M85A 4BBRH 2AWNA 1KAWA 1YHBA 4LF5L 4DR3Q 4JI0Q 4NXML 2JEBI 1HH2P 4AIMA 3EN2A 1N36L 1EOVA 3ERSX 3CQZH 4FDBA 4ALPA 4BY7H 4DV5Q 4P73A 3U4VA 3GD7A 4DV0L 2MFIA 1IBLQ 4JBWA 3BJUA 1K73C 1PH2A 4A3JH 1MKHA 3CC4A 3PV0A 2I5MX 3T1HL 1UE1A 1JB7A 3KOJA 4X64L 4UP7A 2BH8A 3AFQA 2A19A 2ZM6Q 4NXNQ 4BBSH 2PNHA 1Y1VH 4ITRA 2IHEA 4APVA 4XI8A 2UUBQ 4LF9Q 4B3SQ 1NBWA 2PI2A 4DV4Q 1XPRA 1OXSC 2HHHQ 3AEVA 4A75A 4A3EH 3H0GH 3E9HA 2JA5H 2Y0SG 2ZTEA 2K5HA 4DUYL 4BBRG 1XNRQ 2JA8G 3GTJH 1Q82C 1G6PA 3CCVA 4C3IH 4HJ7A 1N34Q 1AE2A 3LETA 4X65Q 4OO1I 1HNZL 2G03A 2JK8A 4WGJA 4IPHA 1E7ZA 4DAMA 1K9MC 3F1ZA 2XGTA 1N33L 4JI8Q 1V1QA 4A3CH 1HR0L 4JYAL 1CKNB 4YCUA 4DV0Q 1IBKL 4JI6L 3CC7A 3KF6A 4DR6L 3CUCA 4MTNA 1EQRA 2K5NA 2VS1A 3CCEA 3I7FA 2BA0A 4X65L 1XMQQ 4LWCA 1Q46A 4A3LG 5JJIA 3D0FA 4DV3L 4JC0A 2VQFL 1YJWA 1J5EQ 4AQYQ 2ID0A 3GTOH 2MNAA 3I56A 3AQQA 4DR1L 2R7FA 3H15A 4PMWA 1VQNA 4LF4Q 1X55A 2WFWA 4A3KG 3CCMA 4JBMA 2K50A 5FJ8G 3CW2C 1KHIA 3SHGA 1VQ4A 2R92G 4A3FH 5LMUL 4UPAA 1S3OA 1X6OA 1VQDA 3H0GG 1MJCA 5BR8Q 1IYJB 4L5RC 4JI1L 4Y7NH 2NVYH 4A4IA 2B63G 1CKNA 3CCRA 1N36Q 4L5TA 4A93G 3S2HH 3HOUH 2KCTA 2UXBQ 1NE3A 1IBKQ 3S1NH 2BA1A 2YTYA 2QEXA 1PH9A 1YJ9A 3W5OA 2AKWB 4AH6A 1Z47A 3OW2A 1A63A 5JFFA 1TWHH 1SR3A 5CGLA 2HQLA 2HIXA 3ZLMA 4KI0A 4DV7Q 1M90C 3S1QH 2EIFA 1E1OA 4LUVA 4GLVB 4XIGS 3HKSA 1L2FA 4GLXA 1YNXA 2BH2A 2WB1E 4KLKA 3GTQH 1I6HH 4JI4L 5FJ8H 4LF6L 2R7ZG 4OX9L 3CCLA 4GOPB 3HOWH 2MQHA 1RL2A 1NY4A 1NMFA 3U58A 1IBLL 1QUQA 4IJLA 5C4XG 1XMOL 1KRSA 3EIVA 1KQSA 4DR5L 1PH8A 3STBD 2FXQA 1EYGA 4OO1G 1HZBA 5C3EG 4A3KH 1X9NA 1NJIC 3I4NG 4JI1Q 1ASYA 4JCVE 4OWWB 5IT9c 4MNOA 1KXLA 5IYCG 1SLJA 3W1GA 1NMGA 1VQKA 4U04A 2UXDQ 2E5LL 1Q1BA 3J80i 3I55A 3GO5A 3M4QA 1IL2A 4LFBQ 4BY1G 3T1YL 1HZAA 3A5ZB 3U4ZA 4DV5L 4K0KL 2GVBA 2YU9H 1V9PA 3L2PA 4X2EA 2D0OA 3NELA 2B63H 1EFWA 1YHAA 1FJGL 1LM0A 1CUKA 1KC8C 4DR5Q 1HNZQ 4H02A 3F8TA 1Y14B 5C4JH 2YTXA 4TQUS 1VQ8A 3PUVA 2CFMA 1HR0W 1Y1WH 3RN2A 3B6YA 2UU9Q 2UUAL 3DLLA 1PH1A 2R93H 4X2DA 5JFZA 3KDFB 4BBSG 1S40A 3J81j 5LMNQ 1XPOA 3J7A5 3RN5A 4EX5A 3ZC7A 1WI5A 1AE3A 2PQAB 3I4NH 4QY7A 5IP7G 4N67A 4RG1A 3HOWG 4JBKA 3CCQA 3G6EA 3G4SA 1L0WA 4QL5A 1XNQL 5GAHC 4BXXG 4LFCL 4DR4L 1VQ7A 3H3VI 4DV3Q 3HOZH 3TREA 3A74A 4U0ZA 2PMZE 4JV5L 1G291 2KHIA 1QVCA 4GN5A 5E7NA 2GN5A 3CCJA 4GLAC 4A3DH 3TQYA 5IY0A 5M5XH 1X54A 2VZAA 4NB3A 2Q2UA 3ZCBA 1G51A 2K75A 5EAYA 1IBMQ 4U0UA 1QVGA 1VQ9A 3TS2A 4X2CA 2F3IA 1SMXA 4TVAB 2VNUD 1Q86C 1HNWL 2UUBL 3CPWA 4HIKA 3KYHC 4X62L 1HNXQ 2OCEA 5JJLA 1D8LA 2ZTDA 4O2DA 1VQGA 3PCOB 1VQBA 4DKAC 1N9WA 4POFA 1VQJA 4C3HH 1MJEA 2UXCL 4JI2Q 5H1SE 2MO0A 3OTOQ 4DUYQ 3PF4A 4DV7L 1KD1C 3HOXG 1VQ5A 1V43A 3E9IA 3M4OH 1L1OA 4IPCA 1Q12A 2DGYA 5C0XG 1VCIA 1FL0A 3JAMc 1EQQA 1XJVA 2E8GA 4DR7Q 3FP9A 4IO9A 5BR8L 1OXTA 1YI2A 3FKIG 2JJQA 3RNUA 2R6GA 1BKBA 2C35B 2RF4A 3T1YQ 1HR0Q 3HOYH 3WWVA 1EUJA 4LUOA 1A8VA 4PZ7A 2I5LX 3S17H 3RZOH 1FVIA 2VUMG 3ER0A 1Y1WG 4HJ9A 4IFDG 1YJNA 1YHQA 4LF9L 5M3FH 4BA1I 4QQBX 1TWCH 4YHHQ 1C7YA 4DR3L 4JI0L 4NXMQ 2VQFQ 3K8AA 3KF8B 1C9OA 4HJ8A 2UU9L 4DK3C 2R92H 1P8LA 3CCUA 2D0PA 4A3DG 5IP7H 1SE8A 3HOXH 4HIDA 2IT1A 3BZCA 4C2MH 1YIJA 1A0IA 2EXDA 1WCMH 4OX9Q 3I4MG 4NPSA 5GAEC 5FLXc 2IX0A 4GN4B 4JI3L 4B3RQ 4MZ9A 3K81C 3HOZG 4IPDA 3ZJYC 2R7ZH 3J80c 3OYYA 1FGUA 4YY3Q 1PVOA 3HOYG 1SFOH 1PH3A 4POGA 5CMTA 1X56A 3IRBA 4EQ5A 1L1OC 2OQ0A 3K80C 4DV2Q 4GNXB 2ZJQA 4AYBE 4LF8Q 2UXDL 3MXNB 1C0AA 1UE6A 4OWTB 4DPGA 4U07A 3UDFA 5C4XH 3S1MH 2UXBL 1YVCA 3NBHB 4DAYB 3K7AH 5LMNL 3CF5A 2KHJA 1MIUA 4X66Q 5IYDH 2NVTH 4K0KQ 1XMOQ 1I3QH 4JBJA 2F52A 4J15A 4YCVA 2E2JH 4A93H 2MO1A 4DR2Q 1K83H 5IE8A 1J5EL 1VQCA 1BBUA 2Z6KC 3CMEA 3PUYA 1WCMG 4X62Q 1HNXL 4LNQA 2K5VA 3CP0A 4LF4L 4A3GG 4JI7L 3ULPA 2K4KA 5CKLA 2NN6G 2WP8J 2B29A 4YWLA 1K0RA 5M3FG 1JJ2A 2UUAQ 4B3MQ 1PHJA 3OTOL 3NEMA 2CCZA 5AJ3L 4X64Q 4YWMA 2V1CC 4A76A 3PUZA 2UUCQ 3TRZA 1JT8A 2HIVA 3SGIA 3S15H 1I50H 3KF6B 1PH5A 1UE7A 2WB1G 3CPFA 3E0EA 5FLMG 3H3VH 1CSPA 4IFDJ 3VDYA 1GO3E 4LFAQ 4GKJL 5IYDG 4A3JG 3PF5A 1PYBA 4DNIA 4OONA 3UDGA 2WAQE 2ASBA 1XNRL 1PFSA 1WYDA 3K7UC 4IOAA 3CD6A 2VW9A 5JEAG 5M5WH 3SN9A 1GKHA 4GS3A 1T9HA 5HY6A 2NVXH 3I4MH 2KENA 1W3SA 4P75A 2IX1A 1P16A 1B7YB 3HKZG 2GVAA 4A3BH 4DR1Q 3KLWA 2N49A 2JA7H 1B70B 4A3MH 1XMQL 4U0SA 3AFPA 1VQAA 3PUWA 4A3GH 4A3CG 4PZ8A 1BBWA 2CKZB 2Q2HA 5J3BA 4LF7Q 4LFCQ 4WJ3M 3GTMH 4R4CA 2CQOA 4DR2L 3K0XA 2ZJPA 3LGJA 4LFBL 4ME3A 2AWOA 2QA4A 4HIOA 4A3IH 2B3GA 1N33Q 4JYAQ 4UY8C 1N32Q 2K14A 4R4OA 3CCSA 1VQPA 1Q81C 3RR5A 4DUZQ 2RHSB 4OWXB 2A8VA 1HZ9A 5HGQA 2JA6G 4KHZA 1IXRA 1SN8A 1WFQA 4B3RL 1I94Q 3CXCA 4JOIC 4GNXA 3KJOA 4KHPQ 5LMUQ 1U5KA 2KCMA 1IZ6A 2N8NA 4IPGA 3UDIA 1YITA 4YHHL 4JI4Q 4M16A 4BXXH 2NZOA 1W2BA 4B3SL 3CMAA 1WJJA 5JJKA 3RZDH 2E2HH 1E22A 2Y0SE 1JE5A 5GROA 3GTGH 4R1JA 5C44H 3T1HQ 1CKOA 1YBYA 5IP9H 2DUDA 1LYLA 2WAQG 4XTCS 1I94L 2H5XA 3S1RH 3HFZB 3UDXA 4LF6Q 3CC2A 1PYSB 2PI2E 4HJ5A 4JV5Q 1UWVA 2N78A 1PH6A 2JA6H 2VUMH 2VY3A 1K8AC 3S2DH 4L5QA 4DV2L 3M3YH 1EWIA 4JI8L 2ES2A 3BU2A 2RCNA 1U0LA 4HJAA 4YWKA 2VL6A 1KIXA 5JEAJ 1DGSA 4JI2L 3PIPA 3HKZE 1K3RA 1SRUA 2ZTCA 4QGUA 1YEZA 4YY3L 3A5UA 3G71A 4BY7G 5M3MG 2AHOB 1XTDA 1NTGA 4IJHA 2F4VQ 2JA7G 1JJCB 3EBEA 3GTKH 1TWFH 4IFDI 2ZM6L 4A3EG 3M4PA 5M5YH 3RLNA 2JA5G 2NZHA 1H95A 3G48A 1VQLA 1CSQA 1RIPA 3GTPH 1TXYA 1OTCA 3J81i 4BA2I 1WOCA 2UXCQ 1GVPA 2AMCB 3JC66 3F2BA 3ICEA 4PG3A 2OQKA 1TWAH
chains in the Genus database with same CATH superfamily
5DLQE 5JJ7A 1N8RC 1HFGA 1SE3A 3IL8A 4XYOA 1J9OA 4LF5Q 2WAQB 1GUSA 4B3TL 3JAMi 1AH9A 1CI3M 1HJPA 3ND8A 4FNFA 3I90A 2D62A 4CJ2C 3Q24A 4GNXC 2X6GA 4A3EB 4IURA 4DV1Q 3H3VC 3FMCA 4IOCA 4GKKQ 3V96A 1STNA 1I4QA 2R93G 2ALYB 4CJ0B 1QNUA 3BYYB 1I5FA 1WTQA 4B3ML 3AMUA 1VQIA 3CAMA 3PSIA 5FLMH 4ZAIA 2R61A 1U9RA 3OPOA 1JOOA 3D4RA 2EYLA 2IJ0A 3I4MB 3MEFA 2CWPA 5FOBB 3S16H 3HRZC 3S14H 4A3JB 2HT1A 3V05A 1UE5A 4DK6C 1DCZA 2KBNA 4V190 1YNJC 1A62A 4J1MA 4C56C 2VUMB 2F6SA 1LT3D 3FHWA 1LUZA 2HD3A 3URYA 5LMNW 1Q7YC 4A3MG 4PV1C 1UEBA 1LV9A 1SROA 2F0NA 1KABA 1CFMA 1EIHA 5C3EB 2UUCL 1HA6A 2PW7A 2VXWA 4L5SA 1TS5A 1D5MC 4ID6A 4FO2A 2G5DA 1EY9A 1BCPB 1X3QA 3OMGA 2E5LQ 1VQOA 1H9SB 1X65A 1N34L 3GTOB 3KFUA 3D3RA 2IHFA 3J80L 2D9UA 1O7LA 2K52A 4UP8A 1Y1VG 4JI7Q 2B2WA 3VR5A 3C3LA 2BDOA 1FNWA 2Q8TA 3SK6A 3MHBA 2BOSA 3S6AA 2JEAI 4RH6A 3M85A 3KBGA 5FO7B 2MPMA 3KLSA 3TZUA 3DHQA 3ERSX 1O7ZA 4ZUJA 1N36L 4BY7H 1JWMD 1K73C 1PH2A 3A55A 5CV7A 1MI2A 4X64L 3AFQA 2KA7A 2F0TA 4BBSH 4APVA 2IHEA 2K05A 4B3SQ 1NBWA 3D6CA 4DV4Q 3NXWA 2PW5A 4A3EH 4O42A 2K5HA 1PFBA 3GTJH 1QOHA 4X65Q 3LETA 3KK7A 3K5MA 2JK8A 4WGJA 1HTLD 4FF1A 2BE5C 2XGTA 3BG3A 4A3CH 4JYAL 4G7OC 4YCUA 4DV0Q 1EEID 5C4JB 1IBKL 4JI6L 2DNCA 1SNMA 1TU2B 1G2TA 3CUCA 2QEJC 2K5NA 3S9WA 5EKIA 1Q46A 3UI2A 3S16B 2MGSA 4A3LG 2E76C 2CVRA 4WORA 3S14B 1ET9A 5FLXE 4R8NA 3EVQA 4IFDH 2R7FA 2NTTA 4PMWA 3HOYB 3KLSX 4LK1C 5KNBA 4M8AA 1IKLA 4A3FH 4UPAA 1DJRD 2F0UA 2PMZB 5J22A 2G9DA 1A3TA 3H0GG 1IYJB 2B63G 2NVYH 3GQBA 5I6WA 5JPNC 2UXBQ 1IBKQ 3S1NH 5IT9E 1IW7C 2F0LA 1Z47A 1PLFA 4DV7Q 2HIXA 3SK5A 3S1QH 1E1OA 3M7GA 2XRQD 4RWSC 3PIP3 1I6HH 3NTIA 2R7ZG 5CV9A 1OO9B 4NDXA 4KTAA 2K28A 3HOWH 2HUGA 1RL2A 3FPUB 3QB3A 5JVG3 3U58A 2B8FA 1GHKA 2F0KA 5C4XG 1D6EC 2FXQA 2EZVA 1DZ1A 1KLUD 5ELBA 5IYCG 4U04A 1FGBD 3OW7A 2QCPX 4BY1G 3T1YL 3HOUB 2DJGC 4K0KL 4DV5L 5C3WA 3RD4A 5C3XA 1D1KA 4N9TA 1EFWA 1W6JA 5NUCA 1HNZQ 4DR5Q 4H02A 3F8TA 1I4XA 2YTXA 1YNND 1SNCA 2CFMA 5D65A 2EJMA 2LY7A 3J7AF 2R93H 1S40A 3J81j 3RN5A 1E2ZA 4EX5A 1WI5A 1PTOD 2RQXA 2CW0D 2K6AA 5IP7G 4BBSB 4G4KA 5KIXA 2B2UA 2F0PA 3G4SA 4QL5A 1XNQL 2F0QA 3SDZA 4U0ZA 4RFBA 4B9WA 4HEDA 3I72A 2K32A 5C5LA 1GUGA 1PZID 3Q6SA 3BVMA 3NQIA 5M5XH 1IKMA 2VZAA 1IBMQ 1IYVA 1SMXA 4A3DB 1C48A 5IODA 1HNXQ 4XT1B 2AQ2B 3OIQA 1EWCA 2WB1B 2MO0A 3PF4A 4G7HC 5ISRA 1ESFA 2KHSA 1EQQA 2EY5A 3K5OA 3ITPA 4KN7C 3OMCA 1YI2A 3DWPA 2E2DC 2RF4A 3RNUA 1HR0Q 3HOYH 4K2KA 1EUJA 1A3UA 3PIO3 5A2QL 2I5LX 4NMZA 4BWGB 2KEEA 4J8QA 5M3FH 4BA1I 2DY7A 3QJYA 4RGNA 2Z9HA 3K8AA 3R8BA 1P8LA 1I4PA 2D0PA 3FEWX 4OX9Q 2EXDA 1WCMH 2B2UC 4NPSA 2F0GA 2SOBA 3K57A 5FLXc 1AEXA 2Q8IB 1PZKD 1NSNS 4MZ9A 1W6KA 2B2YC 4IPDA 4ZYSA 1FGUA 2K01A 2RKSA 1AZQA 3NWSA 1TWFB 3CHBD 3K80C 4DV2Q 1SJED 2UXDL 3S1MH 4CHTB 4U07A 5EKKA 5ELDA 3HOWB 4DAYB 1ZYRC 4OO1H 3CF5A 4U68A 3MXPA 1VF7A 2NVTH 1XMOQ 4A93H 2MO1A 5IE8A 1J5EL 1VQCA 3IFDA 3KF8A 3H6MA 4OIJA 5JEAH 2SNSA 1B3AA 3CMEA 1PTOB 1WCMG 3EQLC 5D3IB 2MUYA 1KAAA 4JI7L 5CKLA 1S5CD 4C2MB 3EJIA 3OTOL 2CCZA 5AJ3L 1DD2A 4YWMA 1VDZA 4QUCA 3PUZA 1KNAA 1JT8A 4RCNA 3SGIA 2KOLA 1I50H 3KF6B 3U9SA 3S2DB 1UE7A 1MBYA 2DNEA 4KKSA 3H3VH 1HPCA 1CSPA 4LFAQ 2UXDQ 5ELFA 1PYBA 4DNIA 4OONA 1UAPA 1PFSA 2K5DA 1ZYRD 4OHJA 5JEAG 3SN9A 1F9SA 1NCVA 5HY6A 2KENA 4ZCKA 1P16A 3DXJC 3RZOB 4DXFA 2WINB 3HOVB 2L12A 2GVAA 4A3BH 5EBCA 4DR1Q 3KLWA 3LWEA 5LL6S 1B70B 1H9KA 5F2DA 3GTGB 4U0SA 3PUWA 4A3GH 5IGCA 4A3CG 5DM63 1BBWA 3P75A 3GTMH 4R4CA 3K0XA 2ZJPA 4HIOA 2B3GA 3TDQA 2IPKD 2K03A 4BXXH 1VQPA 1AW7A 3RR5A 2F0HA 1EYCA 2JA6G 4KHZA 1IXRA 5JJZA 1R4QB 4ZLTF 1VMPA 4L63B 4Z9CB 4GNXA 2Z8LA 4KHPQ 3GTKB 1PXUA 2N8NA 2CH4A 2NUNA 1EY6A 4YHHL 2KJXA 3TN2A 3CMAA 3PO3B 2Y0SE 3LX0A 3X3MA 1SAPA 5CV6A 4R1JA 1BO0A 5CYUA 1CKOA 5IP9H 1E2WA 1SYGA 4XTCS 1X32A 2H5XA 1F2ZA 3HFZB 3UDXA 3M3YB 3CC2A 2PI2E 1B4OA 2OT2A 4HJ5A 4JV5Q 1PH6A 2JA6H 2VY3A 3PO2B 2L55A 1JE4A 1EWIA 4ZRZA 4HJAA 4OIKA 3JAME 5JEAJ 1DGSA 3PIPA 3HKZE 1K3RA 2WKCA 4YY3L 3A5UA 2AHOB 2WKDA 1JJCB 1TWFH 5M5YH 1CA5A 2NZHA 1VQLA 3J81i 4BA2I 2QILA 1JOKA 3F2BA 4PG3A 4AYBB 3SE5A 1JMCA 1OXUA 4OL7A 1STAA 3STBC 4BY1H 4WJ4A 1PTOH 2RSNA 1FR3A 1LTRD 3J7ZC 3MZ5A 1BUVT 2NN6I 4DR6Q 2LSSA 4A3LH 1KNEA 1GM5A 3M7NA 1LTLA 5ELOA 2YTVA 1Q1EA 4C3JH 4X3TA 1TWGH 1B53A 3K5NA 4RHSA 3I2ZA 2JQOA 2OTLA 5IWAQ 3DM3A 1M1KC 2YYZA 3FRPB 2NZ1D 2EQSA 3CKIB 4CGYB 4QJFA 2KVMA 1BF4A 4RGTA 3K58A 1DOLA 4AYBG 2FINB 1IBML 2VQEL 5EKLA 3RZDB 5LL6X 3C46A 2OTJA 1JJGA 3RLOA 4DV6L 3HOVH 2IWHA 2O5IC 3S24A 1RHPA 4JI5L 2L5TA 2PQAA 1LT5D 4JK1C 2FFKB 3D31A 1PV4A 4A3IG 1OXVA 3GTLH 2JE6I 1BNZA 4Y52H 5TSSA 3GTMB 2R7DA 1YZ6A 1Z9FA 4NXNL 5IGEA 2E2IH 3TP8A 2E74C 5KEEA 2QW7A 2OWOA 2V4DA 1LTBD 4DV1L 2LXJA 1X3GA 1YNNC 2NB0A 3FKIH 1F2MA 3D8GA 1VQHA 1KLGD 3K6OA 4RGMA 2NTSA 3E0JA 5C44G 2ZJRA 3OWEB 1PZJD 1R9TB 4O0AA 2PPBC 3BZKA 1WTRA 1EIYB 1CQVA 2JYOA 1KRTA 3WDNA 2LXKA 4XQQA 4PY3A 2IY5B 3QOJA 1E24A 2CWAA 2NVQH 2L1BA 5D3DA 3PQIA 3OHXC 4RKBA 1R4PB 1H9RA 3H0GB 1TVXA 4E6IA 4GN3B 4P74A 5IOCA 4BBRH 2AWNA 2D2CC 5DNFA 3DWAA 4X3KA 2J4XA 4KY6A 3D4WA 4FDBA 2X69A 4ALPA 4KY5A 4A3JH 1MKHA 3CC4A 1II3A 3T1HL 3KOJA 1JQYD 1SYCA 4UP7A 4BY1B 4NXNQ 1SSOA 1Y1VH 3A8JE 1MD2D 1S5ED 1EZ8A 1XWEA 2UUBQ 4LF9Q 2HHHQ 5IGGA 3E9HA 5EPLA 1N34Q 4C3IH 4HJ7A 4IZ8A 1HNZL 4IUQA 1E7ZA 1K9MC 1H9JA 1I6VC 3F1ZA 4RAUC 4JI8Q 1HR0L 4ODGA 2F0FA 1QB5D 2TSSA 1WD0A 1D2BA 4C3HB 4RGOS 2BE5D 1EQRA 1EEFD 3QG1A 3CCEA 4X65L 1XMQQ 2R3ZA 2K7VA 4RCOA 1UNSA 4QIWB 3D0FA 4AQYQ 4FYDA 3GTOH 5CV8A 2MNAA 3AQQA 4DR1L 2EXZA 1U4MA 3H15A 4LF4Q 3KUPA 4JBMA 2K50A 5FJ8G 3SHGA 1O7YA 2IW3A 1S3OA 1X6OA 2F1MA 2RCFA 3A8IE 1EU3A 4Y7NH 1D5XC 3CCRA 1N36Q 4K8IA 4L5TA 4A93G 3S2HH 1GUNA 4RA8A 1PH9A 2EDGA 2AKWB 4ZUIA 1V1PA 4AH6A 5LHY1 3OW2A 2P5ZX 3ND9A 5CGLA 4BY7B 2Z1CA 5M9OA 5KYLA 1YNXA 5KRUA 3S1QB 4OX9L 3E5SA 3CCLA 4GOPB 5I2YA 2MQHA 3K7AB 4IN3A 2O2LD 4C1NK 1NMFA 1IBLL 3I4NB 1QUQA 2KCNA 1XMOL 4XQJA 1PH8A 3STBD 4OO1G 5C3EG 3IAYA 1X9NA 4MNOA 3W1GA 4EQPA 2B63B 4S3SA 1QILA 2K04A 2E5LL 3I55A 3TP6A 1WVLA 2F0WA 1XYIA 3A5ZB 1L0XB 1V9PA 2D0OA 1YHAA 5C4JH 4TQUS 1VQ8A 3G6JB 1Y1WH 3B6YA 1GUWA 1I4GA 1PFMA 2PCFB 2MP1A 3H94A 1XPOA 3J7A5 4QY7A 5DEHA 5C4XB 1X3PA 4RG1A 3HOWG 1Y1VB 3P7JA 4CKEA 4BXXG 4LFCL 4A3KB 1VQ7A 1BDOA 3VYUA 1Q8IA 2PMZE 2E2JB 1G291 2KHIA 2EJFC 3MFGA 1QVCA 1YNJD 4R9WA 5E7NA 5JAVA 4A3MB 2GN5A 4GLAC 1A2TA 1HXYD 3CRLC 3MAQA 3I4LA 1X54A 3ZCBA 1G51A 1CQFA 4U0UA 3TS2A 2F3IA 1HNWL 3F2UA 1QCBD 1T5EA 4K8JA 5JJLA 1D8LA 2HQEA 4O2DA 3PCOB 1VQBA 1N9WA 1VQJA 5KNDA 4C3HH 2UXCL 4JI2Q 5H1SE 4DUYQ 3HOXG 3EROA 1L1OA 2D5DA 1VCIA 1Y69U 1XJVA 1DM0B 4RHRA 2EYPA 3H91A 3FKIG 1S5BD 3T1YQ 1BKBA 2C35B 2E75C 3WWVA 4LUOA 3MXNA 5T1GA 1A8VA 4JW0A 1FVIA 2VUMG 3ER0A 1Y1WG 4CKCA 4QQBX 1TWCH 3TSSA 4YHHQ 1BCPF 2VQFQ 4FF2A 2R92H 1JC7A 4DK3C 4A3DG 3CCUA 2CQAA 5IP7H 5M3FB 3JAML 2QKIC 3BZDB 5GAEC 5C5MA 4XXEA 1S5DD 3K81C 3VR4A 1LTID 3OYYA 1HQRD 1PVOA 3HOYG 1SFOH 2AUJD 3IRBA 2ZJQA 4GNXB 3MXNB 1C0AA 4DPGA 2UXBL 2RSOA 2IX3A 3K7AH 2KHJA 4FF3A 1PTOF 5KYIA 2K5WA 3HZXA 1BBUA 2Z6KC 2RBMA 3PUYA 1HNXL 4LNQA 2JA8B 3HEJA 3QOLA 3ULPA 2K4KA 2WP8J 1F9PA 2UUAQ 5M3FG 4B3MQ 1PHJA 2V1CC 4NW2A 3S15H 4XDXA 3CPFA 5FLMG 3VDYA 4A3JG 3PF5A 1JORA 1XNRL 4P2CB 1F77A 1STHA 2A6HD 2G9HD 1DXMA 1JWUD 5M5WH 2NUCA 1HUMA 1GKHA 4GS3A 2NVXH 2IX1A 2XIWA 2N49A 4A3MH 1EWHA 1XMQL 4KY7A 3AFPA 5HGTA 3O13A 2H4OA 4PZ8A 4WJ3M 5COYA 4IUTA 4L6TB 2O5JC 2KEDA 4ME3A 2AWOA 4A3IH 4LFBL 4UY8C 4DAVA 2N55A 3CCSA 1Q81C 2ENBA 4OWXB 1HZ9A 3NP8A 1G6ZA 1SN8A 1WFQA 3TBIB 4MIUA 1CT1D 1I94Q 3CXCA 5IGBA 1TY2A 1PDQA 3NBHA 1G91A 4M16A 3HG9A 2NZOA 1E22A 2L11A 2JA7B 1JE5A 3S1RB 5GROA 3T16A 1TWAB 2KQ3A 5EJWA 1L0YB 5C44H 1NNXA 4FXDA 3SXHA 2DY8A 4PMCA 1V8QA 4LF6Q 2BCOA 1STBA 2XNAC 3X3NA 2CW0C 2F3WA 2A73B 4EQOA 3S2DH 1KDCA 3M3YH 2A69C 1EY4A 3SEBA 2RCNA 4KK7A 3MXUA 3BVZA 3ZYYX 3G71A 2ZTCA 1YEZA 4H44C 4BY7G 5M3MG 1ENCA 4IJHA 3NSWA 2F4VQ 4IFDI 3EBEA 2ZM6L 4A3EG 3QIAA 1CSQA 5CMDA 2HDMA 3OWFA 3GTPH 1WOCA 3WOFA 2E2HB 1B3QA 5FLXL 4GLVB 4IQZA 1VQEA 2XVSA 1XPUA 3DUZA 1E1TA 5J1ZA 5C0XI 1PH4A 3OSOA 4KKTA 2NN6H 4XT3B 1ONLA 3R93A 5K36G 2O4XA 2NWGA 4DU9A 1SNPA 1S4ZA 1GOZA 2JA8H 1FNUA 3D6WA 1LT4D 2ATWA 5IP9G 1JWSD 1M4VA 5T1IA 3A56A 2JA5B 2Z6KA 4JI6Q 3S15B 3OOCA 5M3MB 1FNVA 3A0JA 4B9XA 1WTWA 1VS0A 4UP9A 4DV4L 2HHHL 2B2WC 4C3JB 4N8FA 2A68D 4NKLA 4A3FG 1PA6A 2L0CA 1K8GA 4K5XA 5IYBH 3LNNA 4X3UA 3N3UA 2SDFA 2YV5A 3PO3H 2PQEA 1CA6A 1HTPA 3T53B 1B9NA 4LFAL 5C0XJ 3KDFA 1ASZA 2B39A 1HZCA 1EY8A 1SMYD 4K5WA 4I65A 5GAGC 2EE1A 3I4OA 5AJ3Q 3PO2H 1Q8KA 4A3BG 4DR7L 3NUCA 3DEOA 4DV6Q 4A3IB 1HNWQ 4GOPA 2WIIB 3NENA 5E4WC 3M9BA 1HQMC 1QZHA 5K36H 1QUQB 2PZUA 2SNMA 3PO3G 2Q2IA 1FJGQ 1DYQA 2F4VL 1SE4A 1JICA 4JG2A 4LW1A 2C9OA 1N32L 5IGFA 1ZKOA 5DAUA 5IT9L 3FKIB 3ULLA 2IL8A 3PO2G 4FXKC 3KJPA 1A6XA 4PMBA 4X6AH 4DXGA 4R4TA 2I5HA 2QDLA 3L7ZC 5K5PA 5IYCH 1R9TH 1LACA 3J81c 4GOPC 1VQFA 1EY0A 1XNQQ 4HSPA 5AFWA 2VQEQ 1KL9A 2XTIA 4H0LC 2F0JA 3PGZA 1TS2A 1EIFA 3VR3A 1CKMA 2Q2TA 1PRTD 3R3OA 2RDFA 1J6QA 1B8AA 3BDOA 3AYHB 5C3EH 2A6HC 4DUZL 4RMFA 3J81E 4HIMA 4HSVA 5E3FA 3HOVG 2L15A 1VQ6A 4R4IA 4LUZA 4DK0A 5IIFA 3TS0A 1ZEQX 4HMJA 3CQZB 4JVZA 3Q23A 5DM73 1KAWA 4DR3Q 3I70A 2EY6A 4KHVA 4NXML 1VMCA 4AIMA 4DV5Q 5CC4A 3U4VA 4DNRB 1TS4A 2MFIA 1IBLQ 3BJUA 4CKBA 1LLRD 3PV0A 2EYOA 4DNTB 2I5MX 1UE1A 1JB7A 4DF7A 3HGBA 1WTOA 4IUPA 3AB9A 2PI2A 1XPRA 1UEAB 1OXSC 3AEVA 2JA5H 2Y0SG 2ZTEA 3GV3A 3L3OC 4BBRG 1XNRQ 2F0MA 1Q82C 4KKUA 3G7LA 4N8X1 1AE2A 4OO1I 2G03A 4IPHA 3BYTB 4DAMA 4C3IB 1N33L 3HP3A 4KJOA 1CKNB 3S1NB 1B50A 3AU7A 5JVH3 3KF6A 2ZT9C 4L8JA 1LTGD 2PNRC 4MTNA 2XRSD 3I7FA 3SVMA 3M4OB 4C3HG 4JC0A 2VQFL 2K1BA 2ID0A 1ZXTA 3I56A 1V1OA 3DM1A 1SJHD 1VQNA 4KD3A 2WFWA 4A3KG 3CCMA 3EA6A 1KHIA 1VQ4A 1DOMA 4F88A 3S17B 4ZKCB 3HOZB 5LMUL 4K14A 4H7BA 1I4HA 2FJ2A 4FP5D 1MJCA 4A4IA 2ZXRA 5ELEA 4EGVA 2KCTA 3HOUH 3IFTA 1TQOA 2BA1A 4J6HA 4K6LA 2K33A 1A63A 5JFFA 1SE2A 1SR3A 1A2UA 1TWHH 2F0VA 2HQLA 5CV4A 1M90C 2EIFA 1B1ZA 3HKSA 1L2FA 1U4PA 2BH2A 3GTQH 4KLKA 4UDUC 5FJ8H 4LF6L 1EU4A 2EPBA 2J7ZA 1WTVA 1NY4A 1K28A 4K2LA 1O80A 1SYDA 1EQTA 3ONAB 1KRSA 1KQSA 1AP0A 4DR5L 3NK9A 2WACA 3D4DA 1KXLA 1VQKA 4KN4C 1IL2A 3CRKC 1HZAA 3U4ZA 2BDNA 1TKWB 1K8MA 3NELA 1BOSA 3A8KE 2B63H 1LM0A 1CUKA 1GJXA 3W2DA 4FXGC 1A15A 1I6HB 1HR0W 1A3VA 3TZDA 3RN2A 2A6EC 4V0BA 3C2PA 2RDHA 5JFZA 5C0XH 4EVOA 3K5LA 5LMNQ 1TIID 3ZC7A 1MSHA 4ULLA 2CHBD 2PQAB 4K6DA 2EJGC 4N67A 4JBKA 3CCQA 3G6EA 1L0WA 5GAHC 4DR4L 3TREA 2OXPA 4JV5L 2ICEC 1EQVA 1C8CA 1ICWA 2AUKA 1SEBD 1Q90A 4NB3A 2Q2UA 3S2HB 2K75A 5EAYA 4XQNA 1VQ9A 1WD1A 4TRDA 1Q86C 3NWTA 3KYHC 4X62L 1TT2A 2ZTDA 4DKAC 2B2YA 2EYMA 1MJEA 3M4YA 1H9SA 3EFXD 1KD1C 1Q3LA 1V43A 3M4OH 4IPCA 3J7YW 1FL0A 5D14A 2E8GA 2A6ED 4DR7Q 3FP9A 1EL0A 5BR8L 2XSCA 1BCPD 2JJQA 3S17H 2NVTB 3PMFA 3TMEA 1ENAA 1HHVA 4IFDG 1YHQA 1GHJA 2L4NA 1C7YA 4DR3L 4NXMQ 4HJ8A 4TSSA 3U9OA 4HAEA 3HOXH 4HIDA 2R7ZB 2IT1A 4C2MH 2KCCA 3FVQA 1A0IA 1SNOA 1QJOA 2IX0A 2R92B 3T51B 4KD4A 3ZJYC 1MGSA 4QB4A 4YY3Q 3GTQB 3J81L 2MHVA 3GP7A 1K8OA 1L1OC 4HR7B 4OWTB 1JCKB 1I3QB 3UDFA 5C4XH 1SYBA 2A5HA 1YVCA 5LMNL 1K83B 2XN9C 5I2XA 1MIUA 1SYEA 5IYDH 4K0KQ 4JBJA 2E2JH 4NP5A 4DR2Q 4YIJA 1RKNA 4R8IA 3HKZB 1Z7TA 2NUDA 4LF4L 1JJ2A 2Z4HA 1WCMB 4HCSA 2UUCQ 4LAAA 3A54A 2A74C 1ET6A 4M1UB 3H09A 1STYA 1WTXA 1GXDC 4IFDJ 4GKJL 5IYDG 1NH1A 2M9VA 3Q0AA 5CBEE 1WYDA 3CD6A 5G3LF 1I4RA 1S5FD 2EYFA 3W3AA 2I07B 1T9HA 3IKJA 4I7ZC 1EFID 4P75A 1Y8OB 4ME5A 1B7YB 4CDCC 5I9OA 1TWCB 2B2TA 1VQAA 4WRDA 2K5QA 2Q2HA 4OELB 4LFCQ 2ICIA 2M00A 1CK1A 4DR2L 3LGJA 4KMUC 2JA6B 1N33Q 2OF1A 3MEHA 2CH4W 2PZWA 4XYQA 4B3RL 1U4RA 2F3VA 5LMUQ 5M5YB 3UDIA 1IZ6A 3FPPA 1PFNA 4DAYA 1O78A 1CM9A 4JI4Q 5JOBA 2F0SA 1W2BA 4B3SL 5JJKA 2ZXOA 3A7AB 1STEA 3GTGH 2VB3X 1YBYA 1U4LA 2DUDA 1LYLA 2WAQG 1M8AA 1I94L 3RMHA 3S1RH 5I9PA 4PQXA 1XTCD 2VUMH 2Z4IA 1K8AC 4L5QA 4DV2L 2SEBD 2ES2A 3BU2A 4DAPA 2VL6A 4JI2L 1SRUA 4G7ZC 1RD9D 5FO8B 1TWGB 3NTHA 3MWYW 2C5CA 3GTKH 3M4PA 3RLNA 2M2LA 1H95A 3G48A 4LJZC 1RIPA 4ZK9B 1TXYA 2F4IA 2NVXB 2J0TD 2AMCB 3JC66 1V1PB 4FVMA 2F0IA 4DA2A 3T13A 3GTPB 4LU4A 1NAPA 3T4AC 4PZ6A 1WTHA 1K0SA 4OXPA 4AQYL 2FMMA 1GUTA 5IWAL 3ULJA 4DFAA 2N3SA 1OXXK 4HCEA 3VR2A 2JP1A 1XXGA 1E0BA 4JOIA 2XWBB 1BCPC 4G57A 2JN4A 4P72A 2LKVA 3GTLB 1ICFB 1X3FA 3F2DA 4CDFC 5EPKA 5JJ6A 4DR4Q 1GD7A 1D7QA 1DONA 4EQNA 5BN3A 3PIOA 5M3MH 5EBDA 4CDDC 4HMIA 1EZ6A 3SHLA 4YCWA 1PRTB 5EU0A 5E1FA 4QF4A 1PH7A 3DEPA 5ELNA 1RTOA 3HOUG 1F9QA 3UE0A 1BQQT 4LF7L 4HTHA 5C44B 4JI5Q 1G8ZD 2FHTA 2N88A 2OEOA 3UE1A 1JB3A 2AQ3B 3U50C 4RKLA 3DWQA 2JA9A 2HDLA 1PTOC 1RCVD 5GADC 1EOTA 1WTPA 4KV6A 1CZGA 3I73A 1AFPA 5FK9C 3RUZA 1NR4A 2RA4A 3GTJB 5GQOA 3PUXA 5A35A 3MXGA 3HS0C 4QIWE 1VQMA 2Z0SA 5I4DA 4QMGA 1FYCA 4R4QA 1STGA 2I0QA 4C1NI 2B2VC 3L0OA 2QGQA 3RLFA 4U673 2EYJA 5IYBG 1E3PA 3KBXA 3J7AV 3I3CA 3TEHB 1O7IA 3DMUA 1LO5D 3BVGA 2A1AA 1X3EA 1L1OB 2XWJB 4X66L 3WOEA 2RHQB 5EQ0A 1CTMA 3W1BA 1BBXC 1QZGA 4LF8L 3E6ZX 4KHPL 1S72A 4O1NA 2X6LA 3SE0A 4B3TQ 3FDTA 3GDEA 3MA2B 3Q8DA 4MN3A 3I8ZA 3ERQA 1RTNA 2I46A 1CHQD 4P71A 1BVSA 4JI3Q 5KNCA 2YU9B 3F2CA 4WJWA 4B08A 3K59A 4GKKL 2Q8RE 1YHBA 4LF5L 4DGZA 4JI0Q 1HFNA 2JEBI 4DK1A 4F8MA 1HH2P 4QUFA 3EN2A 4GKJQ 1EOVA 3CQZH 1EY7A 1TS3A 4P73A 3GD7A 4DV0L 1VF5C 4JBWA 1B2TA 1EIGA 4TKOB 2RVLA 2BH8A 2NVQB 1LT6D 2ZM6Q 2A19A 1MSGA 5EPJA 2PNHA 4ITRA 4XI8A 1SNDA 2DN8A 1TR5A 2ZXPA 1E2VA 4Q0FA 2B2TC 4A75A 4PNYA 1ILPA 3H0GH 4FF4A 4DUYL 5CGKA 2JA8G 1SYFA 4MHEA 5A2QE 1G6PA 3CCVA 2VB2X 4BBRB 4F7XA 1V1QA 3MTSA 2QF7A 3P1HA 3N6RA 4UAIA 1EYAA 3CC7A 4DR6L 5HURA 4LMQD 2A69D 2VS1A 3QR8A 2BA0A 4LWCA 5JJIA 4DV3L 1YJWA 1J5EQ 3VYRA 1MHWC 4A3FB 1NR2A 2KECA 1X55A 3A7LA 1BXTA 3CW2C 2R92G 2NVYB 2LFNA 2F03A 2H1EA 2L9HA 1VQDA 5BR8Q 4L5RC 4JI1L 2B8GA 1CKNA 5C4ZA 1PRTF 5M5XB 4GZYC 1JOQA 1NE3A 2YTYA 2QEXA 1YJ9A 3W5OA 1JR0D 4CJ1B 3NE5B 3SK8A 4KI0A 1UUPA 5CBAE 3ZLMA 4LUVA 4XIGS 3QWNA 3QO2A 4GLXA 3SK4A 2WB1E 1HUNA 4JI4L 2JXMB 2HCIA 1CHPD 3GV6A 2AQ1B 2B2VA 5BN5A 4IJLA 2F0EA 3EIVA 2F0OA 1EYGA 4I7AA 1HZBA 1LABA 3C1FA 4A3KH 1NJIC 3I4NG 4JI1Q 1ASYA 4JCVE 4OWWB 5IT9c 4Y7NB 1SLJA 4OGQC 1NMGA 5L37A 1Q1BA 3J80i 4CDEC 3GO5A 3M4QA 4LFBQ 2GVBA 2YU9H 3L2PA 4X2EA 4CBVA 4IUVA 1FJGL 2EVBA 1KC8C 1Y14B 2R93B 3PUVA 2UU9Q 5JPMC 2UUAL 3DLLA 1PH1A 4X2DA 2QDBA 3KDFB 1HA5A 2F0DA 4BBSG 4QCLA 4IALA 1AE3A 1RDPD 1SBBB 3I4NH 1RODA 2JSOA 1QG7A 1SNQA 4KJNA 2PO4A 3SR1A 1EY5A 3H3VI 4DV3Q 3HOZH 1LTTD 1IW7D 3A74A 4C3IG 5J39A 4ZKBB 4GN5A 4ZQ3A 2LS01 4ILWA 3CCJA 4IUUA 4A3DH 3TQYA 5IY0A 3NPPA 5IGDA 3K0YA 2EY2A 1QVGA 3NQTA 4X2CA 4TVAB 2VNUD 1XX8A 2UUBL 3CPWA 4HIKA 1Y1WB 1TWHB 1F2YA 1IL8A 2OCEA 1I50B 1VQGA 1ENFA 4POFA 1RJTA 2KUMA 1SMYC 3OTOQ 5I6YA 4DV7L 3BDCA 4OEMB 1VQ5A 4IUNA 3E9IA 5E4XA 1Q12A 1T5XD 2DGYA 3T56B 5C0XG 1Y8NB 3JAMc 3MC0B 5FO9B 2Y0SB 4IO9A 3VA7A 1OXTA 5CR3A 1D1IA 3OIPA 5C6AA 2R6GA 4ABNA 1LTAD 1LTSD 1EYDA 4JPBW 1K3BC 4PZ7A 1QE6A 3LWUA 4UHVA 3RZOH 2TMPA 4HJ9A 1YJNA 2A68C 4LF9L 4DN4M 3VA5A 3VYTA 4JI0L 3KF8B 2UU9L 1C4QA 1C9OA 3V2TA 1SE8A 4A3GB 1NUCA 3BZCA 4X3SA 1YIJA 3I4MG 1D5ZC 1Y8PB 4B3RQ 4GN4B 4JI3L 2DJFC 2EYHA 3HOZG 3HOXB 2R7ZH 3J80c 3KLRA 4Q5VA 3S1MB 1BR9A 1PH3A 4POGA 5CMTA 1X56A 4EQ5A 4HN7A 2OQ0A 3MVVA 4AYBE 4LF8Q 1UE6A 4A93B 1QWYA 5ELCA 3NTKA 3NBHB 1KTKA 4X66Q 5CORA 5M5WB 3J80E 1I3QH 5C4HA 2F52A 4J15A 4YCVA 3I91A 1K83H 3L9AX 1J8IA 4X62Q 2K5VA 2RDGA 3CP0A 4A3GG 4C3JG 2NN6G 4YWLA 1F2LA 2B29A 1K0RA 1QVFA 3NEMA 2Z6BA 4X64Q 4A76A 3TRZA 5G3LD 2PZTA 2HIVA 1H9MA 1ESRA 1PH5A 1QNKA 2WB1G 3E0EA 1SFOB 1GO3E 1CZWA 3VYSA 3UDGA 2WAQE 2ASBA 4MTKA 3BS1A 3BDLA 3K7UC 4IOAA 4N9PA 1TY0A 2VW9A 1B9MA 1RF2D 3TP5A 1B44D 2NBFA 5KGUA 4A3BB 3I4MH 1W3SA 5CV5A 3HKZG 3CU7A 2JA7H 1FD7D 2GA4B 2HCCA 1AN8A 4WFN3 1KDBA 2PYKA 2EOTA 2CKZB 1F9RA 5J3BA 4LF7Q 1Z6HA 2CQOA 2QA4A 1N32Q 4JYAQ 1HRJA 2K14A 4R4OA 2EY1A 4DUZQ 2RHSB 2A8VA 1IHZA 5HGQA 1ILQA 3MFYA 3VR6A 2FMCA 3R2TA 1PRTC 2MJ8A 4F87A 4JOIC 3KJOA 1SXTA 1U5KA 2KCMA 4IPGA 1YITA 1GUOA 4K5VA 4BS9A 1WJJA 3RZDH 2E2HH 3R2IA 1ML0D 1SDFA 5EGTA 3T1HQ 1HCZA 1PMRA 3NBIA 3NHHA 1PYSB 5BN4A 2NYZD 1UWVA 2N78A 1IYUA 1AZPA 1DOKA 1PYWD 4JI8L 1U0LA 4YWKA 5FKAC 1KIXA 3E3XA 1G2SA 4QGUA 3Q22A 1KDAA 3TP7A 2E2IB 2LMCB 1XTDA 1NTGA 3P20A 2JA7G 2WV6D 2JA5G 3C1EA 1OTCA 2UXCQ 4H13C 1GVPA 3ICEA 3N52A 2OQKA 1TWAH
chains in the Genus database with same CATH topology
5DLQE 3SE5A 4GKJQ 4LU4A 1VQEA 5JJ7A 1N8RC 1E1TA 1JMCA 5C0XI 1XPUA 1PH4A 1OXUA 4PZ6A 5K36G 3STBC 4LF5Q 4OXPA 4BY1H 4B3TL 4AQYL 4WJ4A 3JAMi 1AH9A 5IWAL 3ULJA 2JA8H 1HJPA 2N3SA 1OXXK 2ATWA 5IP9G 3J7ZC 2D62A 2NN6I 4JOIA 4GNXC 4DR6Q 2LSSA 4A3LH 1GM5A 2Z6KA 4DV1Q 4P72A 4JI6Q 1LTLA 3M7NA 5ELOA 1X3FA 2YTVA 3F2DA 4IOCA 4GKKQ 1Q1EA 5JJ6A 4C3JH 3A0JA 4DR4Q 1GD7A 1TWGH 2R93G 1D7QA 3PIOA 3I2ZA 1VS0A 2ALYB 2JQOA 3DM3A 5IWAQ 1M1KC 4UP9A 4DV4L 2OTLA 2YYZA 2HHHL 5M3MH 1I5FA 4A3FG 4B3ML 2EQSA 1PA6A 4YCWA 1VQIA 4QJFA 3CAMA 5EU0A 3PSIA 5FLMH 1K8GA 5IYBH 4AYBG 1IBML 3N3UA 1PH7A 2VQEL 2YV5A 3PO3H 5ELNA 2OTJA 3MEFA 2CWPA 3HOUG 1JJGA 4LFAL 3S16H 3RLOA 3UE0A 4DV6L 4LF7L 4JI5Q 5C0XJ 3HOVH 3S14H 3KDFA 1ASZA 2HT1A 1UE5A 4DK6C 2KBNA 3S24A 1HZCA 4JI5L 3UE1A 2PQAA 1A62A 3U50C 3D31A 5GAGC 3I4OA 2JA9A 1PV4A 5AJ3Q 4A3IG 5GADC 1OXVA 3GTLH 2JE6I 3PO2H 4Y52H 2F6SA 1Q8KA 4A3BG 3FHWA 4DR7L 1LUZA 5LMNW 1Q7YC 2R7DA 1YZ6A 1Z9FA 4NXNL 4DV6Q 4A3MG 1HNWQ 4GOPA 3NENA 1UEBA 3PUXA 5GQOA 2E2IH 3M9BA 1SROA 4QIWE 1VQMA 1QZHA 1QUQB 2Z0SA 3PO3G 2UUCL 2Q2IA 2OWOA 1FJGQ 4L5SA 4R4QA 4DV1L 2LXJA 2F4VL 1X3GA 3FKIH 4JG2A 1VQHA 4LW1A 2I0QA 3L0OA 2QGQA 3RLFA 1N32L 5C44G 5IYBG 1E3PA 2ZJRA 3ULLA 3TEHB 1O7IA 1QVFA 3PO2G 2E5LQ 1VQOA 1X65A 4O0AA 3KJPA 4X6AH 3BZKA 2A1AA 4R4TA 1X3EA 2I5HA 1L1OB 4X66L 1N34L 1EIYB 3L7ZC 1KRTA 5IYCH 3KFUA 2LXKA 1R9TH 2RHQB 3J81c 4PY3A 1VQFA 3W1BA 1E24A 2CWAA 4GOPC 1XNQQ 2IHFA 2NVQH 2IY5B 2VQEQ 4LF8L 1QZGA 4KHPL 1KL9A 1S72A 2XTIA 3PGZA 4B3TQ 1EIFA 3GDEA 1CKMA 3Q8DA 2Q2TA 2K52A 4UP8A 1Y1VG 4JI7Q 1J6QA 1B8AA 3AYHB 5C3EH 4P71A 4DUZL 1BVSA 4JI3Q 4RMFA 4GN3B 4P74A 4HIMA 3HOVG 2L15A 1VQ6A 4R4IA 3S6AA 4LUZA 3F2CA 2JEAI 3TS0A 4GKKL 3M85A 4BBRH 2AWNA 1KAWA 1YHBA 4LF5L 4DR3Q 4JI0Q 4NXML 2JEBI 1HH2P 4AIMA 3EN2A 1N36L 1EOVA 3ERSX 3CQZH 4FDBA 4ALPA 4BY7H 4DV5Q 4P73A 3U4VA 3GD7A 4DV0L 2MFIA 1IBLQ 4JBWA 3BJUA 1K73C 1PH2A 4A3JH 1MKHA 3CC4A 3PV0A 2I5MX 3T1HL 1UE1A 1JB7A 3KOJA 4X64L 4UP7A 2BH8A 3AFQA 2A19A 2ZM6Q 4NXNQ 4BBSH 2PNHA 1Y1VH 4ITRA 2IHEA 4APVA 4XI8A 2UUBQ 4LF9Q 4B3SQ 1NBWA 2PI2A 4DV4Q 1XPRA 1OXSC 2HHHQ 3AEVA 4A75A 4A3EH 3H0GH 3E9HA 2JA5H 2Y0SG 2ZTEA 2K5HA 4DUYL 4BBRG 1XNRQ 2JA8G 3GTJH 1Q82C 1G6PA 3CCVA 4C3IH 4HJ7A 1N34Q 1AE2A 3LETA 4X65Q 4OO1I 1HNZL 2G03A 2JK8A 4WGJA 4IPHA 1E7ZA 4DAMA 1K9MC 3F1ZA 2XGTA 1N33L 4JI8Q 1V1QA 4A3CH 1HR0L 4JYAL 1CKNB 4YCUA 4DV0Q 1IBKL 4JI6L 3CC7A 3KF6A 4DR6L 3CUCA 4MTNA 1EQRA 2K5NA 2VS1A 3CCEA 3I7FA 2BA0A 4X65L 1XMQQ 4LWCA 1Q46A 4A3LG 5JJIA 3D0FA 4DV3L 4JC0A 2VQFL 1YJWA 1J5EQ 4AQYQ 2ID0A 3GTOH 2MNAA 3I56A 3AQQA 4DR1L 2R7FA 3H15A 4PMWA 1VQNA 4LF4Q 1X55A 2WFWA 4A3KG 3CCMA 4JBMA 2K50A 5FJ8G 3CW2C 1KHIA 3SHGA 1VQ4A 2R92G 4A3FH 5LMUL 4UPAA 1S3OA 1X6OA 1VQDA 3H0GG 1MJCA 5BR8Q 1IYJB 4L5RC 4JI1L 4Y7NH 2NVYH 4A4IA 2B63G 1CKNA 3CCRA 1N36Q 4L5TA 4A93G 3S2HH 3HOUH 2KCTA 2UXBQ 1NE3A 1IBKQ 3S1NH 2BA1A 2YTYA 2QEXA 1PH9A 1YJ9A 3W5OA 2AKWB 4AH6A 1Z47A 3OW2A 1A63A 5JFFA 1TWHH 1SR3A 5CGLA 2HQLA 2HIXA 3ZLMA 4KI0A 4DV7Q 1M90C 3S1QH 2EIFA 1E1OA 4LUVA 4GLVB 4XIGS 3HKSA 1L2FA 4GLXA 1YNXA 2BH2A 2WB1E 4KLKA 3GTQH 1I6HH 4JI4L 5FJ8H 4LF6L 2R7ZG 4OX9L 3CCLA 4GOPB 3HOWH 2MQHA 1RL2A 1NY4A 1NMFA 3U58A 1IBLL 1QUQA 4IJLA 5C4XG 1XMOL 1KRSA 3EIVA 1KQSA 4DR5L 1PH8A 3STBD 2FXQA 1EYGA 4OO1G 1HZBA 5C3EG 4A3KH 1X9NA 1NJIC 3I4NG 4JI1Q 1ASYA 4JCVE 4OWWB 5IT9c 4MNOA 1KXLA 5IYCG 1SLJA 3W1GA 1NMGA 1VQKA 4U04A 2UXDQ 2E5LL 1Q1BA 3J80i 3I55A 3GO5A 3M4QA 1IL2A 4LFBQ 4BY1G 3T1YL 1HZAA 3A5ZB 3U4ZA 4DV5L 4K0KL 2GVBA 2YU9H 1V9PA 3L2PA 4X2EA 2D0OA 3NELA 2B63H 1EFWA 1YHAA 1FJGL 1LM0A 1CUKA 1KC8C 4DR5Q 1HNZQ 4H02A 3F8TA 1Y14B 5C4JH 2YTXA 4TQUS 1VQ8A 3PUVA 2CFMA 1HR0W 1Y1WH 3RN2A 3B6YA 2UU9Q 2UUAL 3DLLA 1PH1A 2R93H 4X2DA 5JFZA 3KDFB 4BBSG 1S40A 3J81j 5LMNQ 1XPOA 3J7A5 3RN5A 4EX5A 3ZC7A 1WI5A 1AE3A 2PQAB 3I4NH 4QY7A 5IP7G 4N67A 4RG1A 3HOWG 4JBKA 3CCQA 3G6EA 3G4SA 1L0WA 4QL5A 1XNQL 5GAHC 4BXXG 4LFCL 4DR4L 1VQ7A 3H3VI 4DV3Q 3HOZH 3TREA 3A74A 4U0ZA 2PMZE 4JV5L 1G291 2KHIA 1QVCA 4GN5A 5E7NA 2GN5A 3CCJA 4GLAC 4A3DH 3TQYA 5IY0A 5M5XH 1X54A 2VZAA 4NB3A 2Q2UA 3ZCBA 1G51A 2K75A 5EAYA 1IBMQ 4U0UA 1QVGA 1VQ9A 3TS2A 4X2CA 2F3IA 1SMXA 4TVAB 2VNUD 1Q86C 1HNWL 2UUBL 3CPWA 4HIKA 3KYHC 4X62L 1HNXQ 2OCEA 5JJLA 1D8LA 2ZTDA 4O2DA 1VQGA 3PCOB 1VQBA 4DKAC 1N9WA 4POFA 1VQJA 4C3HH 1MJEA 2UXCL 4JI2Q 5H1SE 2MO0A 3OTOQ 4DUYQ 3PF4A 4DV7L 1KD1C 3HOXG 1VQ5A 1V43A 3E9IA 3M4OH 1L1OA 4IPCA 1Q12A 2DGYA 5C0XG 1VCIA 1FL0A 3JAMc 1EQQA 1XJVA 2E8GA 4DR7Q 3FP9A 4IO9A 5BR8L 1OXTA 1YI2A 3FKIG 2JJQA 3RNUA 2R6GA 1BKBA 2C35B 2RF4A 3T1YQ 1HR0Q 3HOYH 3WWVA 1EUJA 4LUOA 1A8VA 4PZ7A 2I5LX 3S17H 3RZOH 1FVIA 2VUMG 3ER0A 1Y1WG 4HJ9A 4IFDG 1YJNA 1YHQA 4LF9L 5M3FH 4BA1I 4QQBX 1TWCH 4YHHQ 1C7YA 4DR3L 4JI0L 4NXMQ 2VQFQ 3K8AA 3KF8B 1C9OA 4HJ8A 2UU9L 4DK3C 2R92H 1P8LA 3CCUA 2D0PA 4A3DG 5IP7H 1SE8A 3HOXH 4HIDA 2IT1A 3BZCA 4C2MH 1YIJA 1A0IA 2EXDA 1WCMH 4OX9Q 3I4MG 4NPSA 5GAEC 5FLXc 2IX0A 4GN4B 4JI3L 4B3RQ 4MZ9A 3K81C 3HOZG 4IPDA 3ZJYC 2R7ZH 3J80c 3OYYA 1FGUA 4YY3Q 1PVOA 3HOYG 1SFOH 1PH3A 4POGA 5CMTA 1X56A 3IRBA 4EQ5A 1L1OC 2OQ0A 3K80C 4DV2Q 4GNXB 2ZJQA 4AYBE 4LF8Q 2UXDL 3MXNB 1C0AA 1UE6A 4OWTB 4DPGA 4U07A 3UDFA 5C4XH 3S1MH 2UXBL 1YVCA 3NBHB 4DAYB 3K7AH 5LMNL 3CF5A 2KHJA 1MIUA 4X66Q 5IYDH 2NVTH 4K0KQ 1XMOQ 1I3QH 4JBJA 2F52A 4J15A 4YCVA 2E2JH 4A93H 2MO1A 4DR2Q 1K83H 5IE8A 1J5EL 1VQCA 1BBUA 2Z6KC 3CMEA 3PUYA 1WCMG 4X62Q 1HNXL 4LNQA 2K5VA 3CP0A 4LF4L 4A3GG 4JI7L 3ULPA 2K4KA 5CKLA 2NN6G 2WP8J 2B29A 4YWLA 1K0RA 5M3FG 1JJ2A 2UUAQ 4B3MQ 1PHJA 3OTOL 3NEMA 2CCZA 5AJ3L 4X64Q 4YWMA 2V1CC 4A76A 3PUZA 2UUCQ 3TRZA 1JT8A 2HIVA 3SGIA 3S15H 1I50H 3KF6B 1PH5A 1UE7A 2WB1G 3CPFA 3E0EA 5FLMG 3H3VH 1CSPA 4IFDJ 3VDYA 1GO3E 4LFAQ 4GKJL 5IYDG 4A3JG 3PF5A 1PYBA 4DNIA 4OONA 3UDGA 2WAQE 2ASBA 1XNRL 1PFSA 1WYDA 3K7UC 4IOAA 3CD6A 2VW9A 5JEAG 5M5WH 3SN9A 1GKHA 4GS3A 1T9HA 5HY6A 2NVXH 3I4MH 2KENA 1W3SA 4P75A 2IX1A 1P16A 1B7YB 3HKZG 2GVAA 4A3BH 4DR1Q 3KLWA 2N49A 2JA7H 1B70B 4A3MH 1XMQL 4U0SA 3AFPA 1VQAA 3PUWA 4A3GH 4A3CG 4PZ8A 1BBWA 2CKZB 2Q2HA 5J3BA 4LF7Q 4LFCQ 4WJ3M 3GTMH 4R4CA 2CQOA 4DR2L 3K0XA 2ZJPA 3LGJA 4LFBL 4ME3A 2AWOA 2QA4A 4HIOA 4A3IH 2B3GA 1N33Q 4JYAQ 4UY8C 1N32Q 2K14A 4R4OA 3CCSA 1VQPA 1Q81C 3RR5A 4DUZQ 2RHSB 4OWXB 2A8VA 1HZ9A 5HGQA 2JA6G 4KHZA 1IXRA 1SN8A 1WFQA 4B3RL 1I94Q 3CXCA 4JOIC 4GNXA 3KJOA 4KHPQ 5LMUQ 1U5KA 2KCMA 1IZ6A 2N8NA 4IPGA 3UDIA 1YITA 4YHHL 4JI4Q 4M16A 4BXXH 2NZOA 1W2BA 4B3SL 3CMAA 1WJJA 5JJKA 3RZDH 2E2HH 1E22A 2Y0SE 1JE5A 5GROA 3GTGH 4R1JA 5C44H 3T1HQ 1CKOA 1YBYA 5IP9H 2DUDA 1LYLA 2WAQG 4XTCS 1I94L 2H5XA 3S1RH 3HFZB 3UDXA 4LF6Q 3CC2A 1PYSB 2PI2E 4HJ5A 4JV5Q 1UWVA 2N78A 1PH6A 2JA6H 2VUMH 2VY3A 1K8AC 3S2DH 4L5QA 4DV2L 3M3YH 1EWIA 4JI8L 2ES2A 3BU2A 2RCNA 1U0LA 4HJAA 4YWKA 2VL6A 1KIXA 5JEAJ 1DGSA 4JI2L 3PIPA 3HKZE 1K3RA 1SRUA 2ZTCA 4QGUA 1YEZA 4YY3L 3A5UA 3G71A 4BY7G 5M3MG 2AHOB 1XTDA 1NTGA 4IJHA 2F4VQ 2JA7G 1JJCB 3EBEA 3GTKH 1TWFH 4IFDI 2ZM6L 4A3EG 3M4PA 5M5YH 3RLNA 2JA5G 2NZHA 1H95A 3G48A 1VQLA 1CSQA 1RIPA 3GTPH 1TXYA 1OTCA 3J81i 4BA2I 1WOCA 2UXCQ 1GVPA 2AMCB 3JC66 3F2BA 3ICEA 4PG3A 2OQKA 1TWAH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DLQ E;  3SE5 A;  4GKJ Q;  4LU4 A;  1VQE A;  5JJ7 A;  1N8R C;  1E1T A;  1JMC A;  5C0X I;  1XPU A;  1PH4 A;  1OXU A;  4PZ6 A;  5K36 G;  3STB C;  4LF5 Q;  4OXP A;  4BY1 H;  4B3T L;  4AQY L;  4WJ4 A;  3JAM i;  1AH9 A;  5IWA L;  3ULJ A;  2JA8 H;  1HJP A;  2N3S A;  1OXX K;  2ATW A;  5IP9 G;  3J7Z C;  2D62 A;  2NN6 I;  4JOI A;  4GNX C;  4DR6 Q;  2LSS A;  4A3L H;  1GM5 A;  2Z6K A;  4DV1 Q;  4P72 A;  4JI6 Q;  1LTL A;  3M7N A;  5ELO A;  1X3F A;  2YTV A;  3F2D A;  4IOC A;  4GKK Q;  1Q1E A;  5JJ6 A;  4C3J H;  3A0J A;  4DR4 Q;  1GD7 A;  1TWG H;  2R93 G;  1D7Q A;  3PIO A;  3I2Z A;  1VS0 A;  2ALY B;  2JQO A;  3DM3 A;  5IWA Q;  1M1K C;  4UP9 A;  4DV4 L;  2OTL A;  2YYZ A;  2HHH L;  5M3M H;  1I5F A;  4A3F G;  4B3M L;  2EQS A;  1PA6 A;  4YCW A;  1VQI A;  4QJF A;  3CAM A;  5EU0 A;  3PSI A;  5FLM H;  1K8G A;  5IYB H;  4AYB G;  1IBM L;  3N3U A;  1PH7 A;  2VQE L;  2YV5 A;  3PO3 H;  5ELN A;  2OTJ A;  3MEF A;  2CWP A;  3HOU G;  1JJG A;  4LFA L;  3S16 H;  3RLO A;  3UE0 A;  4DV6 L;  4LF7 L;  4JI5 Q;  5C0X J;  3HOV H;  3S14 H;  3KDF A;  1ASZ A;  2HT1 A;  1UE5 A;  4DK6 C;  2KBN A;  3S24 A;  1HZC A;  4JI5 L;  3UE1 A;  2PQA A;  1A62 A;  3U50 C;  3D31 A;  5GAG C;  3I4O A;  2JA9 A;  1PV4 A;  5AJ3 Q;  4A3I G;  5GAD C;  1OXV A;  3GTL H;  2JE6 I;  3PO2 H;  4Y52 H;  2F6S A;  1Q8K A;  4A3B G;  3FHW A;  4DR7 L;  1LUZ A;  5LMN W;  1Q7Y C;  2R7D A;  1YZ6 A;  1Z9F A;  4NXN L;  4DV6 Q;  4A3M G;  1HNW Q;  4GOP A;  3NEN A;  1UEB A;  3PUX A;  5GQO A;  2E2I H;  3M9B A;  1SRO A;  4QIW E;  1VQM A;  1QZH A;  1QUQ B;  2Z0S A;  3PO3 G;  2UUC L;  2Q2I A;  2OWO A;  1FJG Q;  4L5S A;  4R4Q A;  4DV1 L;  2LXJ A;  2F4V L;  1X3G A;  3FKI H;  4JG2 A;  1VQH A;  4LW1 A;  2I0Q A;  3L0O A;  2QGQ A;  3RLF A;  1N32 L;  5C44 G;  5IYB G;  1E3P A;  2ZJR A;  3ULL A;  3TEH B;  1O7I A;  1QVF A;  3PO2 G;  2E5L Q;  1VQO A;  1X65 A;  4O0A A;  3KJP A;  4X6A H;  3BZK A;  2A1A A;  4R4T A;  1X3E A;  2I5H A;  1L1O B;  4X66 L;  1N34 L;  1EIY B;  3L7Z C;  1KRT A;  5IYC H;  3KFU A;  2LXK A;  1R9T H;  2RHQ B;  3J81 c;  4PY3 A;  1VQF A;  3W1B A;  1E24 A;  2CWA A;  4GOP C;  1XNQ Q;  2IHF A;  2NVQ H;  2IY5 B;  2VQE Q;  4LF8 L;  1QZG A;  4KHP L;  1KL9 A;  1S72 A;  2XTI A;  3PGZ A;  4B3T Q;  1EIF A;  3GDE A;  1CKM A;  3Q8D A;  2Q2T A;  2K52 A;  4UP8 A;  1Y1V G;  4JI7 Q;  1J6Q A;  1B8A A;  3AYH B;  5C3E H;  4P71 A;  4DUZ L;  1BVS A;  4JI3 Q;  4RMF A;  4GN3 B;  4P74 A;  4HIM A;  3HOV G;  2L15 A;  1VQ6 A;  4R4I A;  3S6A A;  4LUZ A;  3F2C A;  2JEA I;  3TS0 A;  4GKK L;  3M85 A;  4BBR H;  2AWN A;  1KAW A;  1YHB A;  4LF5 L;  4DR3 Q;  4JI0 Q;  4NXM L;  2JEB I;  1HH2 P;  4AIM A;  3EN2 A;  1N36 L;  1EOV A;  3ERS X;  3CQZ H;  4FDB A;  4ALP A;  4BY7 H;  4DV5 Q;  4P73 A;  3U4V A;  3GD7 A;  4DV0 L;  2MFI A;  1IBL Q;  4JBW A;  3BJU A;  1K73 C;  1PH2 A;  4A3J H;  1MKH A;  3CC4 A;  3PV0 A;  2I5M X;  3T1H L;  1UE1 A;  1JB7 A;  3KOJ A;  4X64 L;  4UP7 A;  2BH8 A;  3AFQ A;  2A19 A;  2ZM6 Q;  4NXN Q;  4BBS H;  2PNH A;  1Y1V H;  4ITR A;  2IHE A;  4APV A;  4XI8 A;  2UUB Q;  4LF9 Q;  4B3S Q;  1NBW A;  2PI2 A;  4DV4 Q;  1XPR A;  1OXS C;  2HHH Q;  3AEV A;  4A75 A;  4A3E H;  3H0G H;  3E9H A;  2JA5 H;  2Y0S G;  2ZTE A;  2K5H A;  4DUY L;  4BBR G;  1XNR Q;  2JA8 G;  3GTJ H;  1Q82 C;  1G6P A;  3CCV A;  4C3I H;  4HJ7 A;  1N34 Q;  1AE2 A;  3LET A;  4X65 Q;  4OO1 I;  1HNZ L;  2G03 A;  2JK8 A;  4WGJ A;  4IPH A;  1E7Z A;  4DAM A;  1K9M C;  3F1Z A;  2XGT A;  1N33 L;  4JI8 Q;  1V1Q A;  4A3C H;  1HR0 L;  4JYA L;  1CKN B;  4YCU A;  4DV0 Q;  1IBK L;  4JI6 L;  3CC7 A;  3KF6 A;  4DR6 L;  3CUC A;  4MTN A;  1EQR A;  2K5N A;  2VS1 A;  3CCE A;  3I7F A;  2BA0 A;  4X65 L;  1XMQ Q;  4LWC A;  1Q46 A;  4A3L G;  5JJI A;  3D0F A;  4DV3 L;  4JC0 A;  2VQF L;  1YJW A;  1J5E Q;  4AQY Q;  2ID0 A;  3GTO H;  2MNA A;  3I56 A;  3AQQ A;  4DR1 L;  2R7F A;  3H15 A;  4PMW A;  1VQN A;  4LF4 Q;  1X55 A;  2WFW A;  4A3K G;  3CCM A;  4JBM A;  2K50 A;  5FJ8 G;  3CW2 C;  1KHI A;  3SHG A;  1VQ4 A;  2R92 G;  4A3F H;  5LMU L;  4UPA A;  1S3O A;  1X6O A;  1VQD A;  3H0G G;  1MJC A;  5BR8 Q;  1IYJ B;  4L5R C;  4JI1 L;  4Y7N H;  2NVY H;  4A4I A;  2B63 G;  1CKN A;  3CCR A;  1N36 Q;  4L5T A;  4A93 G;  3S2H H;  3HOU H;  2KCT A;  2UXB Q;  1NE3 A;  1IBK Q;  3S1N H;  2BA1 A;  2YTY A;  2QEX A;  1PH9 A;  1YJ9 A;  3W5O A;  2AKW B;  4AH6 A;  1Z47 A;  3OW2 A;  1A63 A;  5JFF A;  1TWH H;  1SR3 A;  5CGL A;  2HQL A;  2HIX A;  3ZLM A;  4KI0 A;  4DV7 Q;  1M90 C;  3S1Q H;  2EIF A;  1E1O A;  4LUV A;  4GLV B;  4XIG S;  3HKS A;  1L2F A;  4GLX A;  1YNX A;  2BH2 A;  2WB1 E;  4KLK A;  3GTQ H;  1I6H H;  4JI4 L;  5FJ8 H;  4LF6 L;  2R7Z G;  4OX9 L;  3CCL A;  4GOP B;  3HOW H;  2MQH A;  1RL2 A;  1NY4 A;  1NMF A;  3U58 A;  1IBL L;  1QUQ A;  4IJL A;  5C4X G;  1XMO L;  1KRS A;  3EIV A;  1KQS A;  4DR5 L;  1PH8 A;  3STB D;  2FXQ A;  1EYG A;  4OO1 G;  1HZB A;  5C3E G;  4A3K H;  1X9N A;  1NJI C;  3I4N G;  4JI1 Q;  1ASY A;  4JCV E;  4OWW B;  5IT9 c;  4MNO A;  1KXL A;  5IYC G;  1SLJ A;  3W1G A;  1NMG A;  1VQK A;  4U04 A;  2UXD Q;  2E5L L;  1Q1B A;  3J80 i;  3I55 A;  3GO5 A;  3M4Q A;  1IL2 A;  4LFB Q;  4BY1 G;  3T1Y L;  1HZA A;  3A5Z B;  3U4Z A;  4DV5 L;  4K0K L;  2GVB A;  2YU9 H;  1V9P A;  3L2P A;  4X2E A;  2D0O A;  3NEL A;  2B63 H;  1EFW A;  1YHA A;  1FJG L;  1LM0 A;  1CUK A;  1KC8 C;  4DR5 Q;  1HNZ Q;  4H02 A;  3F8T A;  1Y14 B;  5C4J H;  2YTX A;  4TQU S;  1VQ8 A;  3PUV A;  2CFM A;  1HR0 W;  1Y1W H;  3RN2 A;  3B6Y A;  2UU9 Q;  2UUA L;  3DLL A;  1PH1 A;  2R93 H;  4X2D A;  5JFZ A;  3KDF B;  4BBS G;  1S40 A;  3J81 j;  5LMN Q;  1XPO A;  3J7A 5;  3RN5 A;  4EX5 A;  3ZC7 A;  1WI5 A;  1AE3 A;  2PQA B;  3I4N H;  4QY7 A;  5IP7 G;  4N67 A;  4RG1 A;  3HOW G;  4JBK A;  3CCQ A;  3G6E A;  3G4S A;  1L0W A;  4QL5 A;  1XNQ L;  5GAH C;  4BXX G;  4LFC L;  4DR4 L;  1VQ7 A;  3H3V I;  4DV3 Q;  3HOZ H;  3TRE A;  3A74 A;  4U0Z A;  2PMZ E;  4JV5 L;  1G29 1;  2KHI A;  1QVC A;  4GN5 A;  5E7N A;  2GN5 A;  3CCJ A;  4GLA C;  4A3D H;  3TQY A;  5IY0 A;  5M5X H;  1X54 A;  2VZA A;  4NB3 A;  2Q2U A;  3ZCB A;  1G51 A;  2K75 A;  5EAY A;  1IBM Q;  4U0U A;  1QVG A;  1VQ9 A;  3TS2 A;  4X2C A;  2F3I A;  1SMX A;  4TVA B;  2VNU D;  1Q86 C;  1HNW L;  2UUB L;  3CPW A;  4HIK A;  3KYH C;  4X62 L;  1HNX Q;  2OCE A;  5JJL A;  1D8L A;  2ZTD A;  4O2D A;  1VQG A;  3PCO B;  1VQB A;  4DKA C;  1N9W A;  4POF A;  1VQJ A;  4C3H H;  1MJE A;  2UXC L;  4JI2 Q;  5H1S E;  2MO0 A;  3OTO Q;  4DUY Q;  3PF4 A;  4DV7 L;  1KD1 C;  3HOX G;  1VQ5 A;  1V43 A;  3E9I A;  3M4O H;  1L1O A;  4IPC A;  1Q12 A;  2DGY A;  5C0X G;  1VCI A;  1FL0 A;  3JAM c;  1EQQ A;  1XJV A;  2E8G A;  4DR7 Q;  3FP9 A;  4IO9 A;  5BR8 L;  1OXT A;  1YI2 A;  3FKI G;  2JJQ A;  3RNU A;  2R6G A;  1BKB A;  2C35 B;  2RF4 A;  3T1Y Q;  1HR0 Q;  3HOY H;  3WWV A;  1EUJ A;  4LUO A;  1A8V A;  4PZ7 A;  2I5L X;  3S17 H;  3RZO H;  1FVI A;  2VUM G;  3ER0 A;  1Y1W G;  4HJ9 A;  4IFD G;  1YJN A;  1YHQ A;  4LF9 L;  5M3F H;  4BA1 I;  4QQB X;  1TWC H;  4YHH Q;  1C7Y A;  4DR3 L;  4JI0 L;  4NXM Q;  2VQF Q;  3K8A A;  3KF8 B;  1C9O A;  4HJ8 A;  2UU9 L;  4DK3 C;  2R92 H;  1P8L A;  3CCU A;  2D0P A;  4A3D G;  5IP7 H;  1SE8 A;  3HOX H;  4HID A;  2IT1 A;  3BZC A;  4C2M H;  1YIJ A;  1A0I A;  2EXD A;  1WCM H;  4OX9 Q;  3I4M G;  4NPS A;  5GAE C;  5FLX c;  2IX0 A;  4GN4 B;  4JI3 L;  4B3R Q;  4MZ9 A;  3K81 C;  3HOZ G;  4IPD A;  3ZJY C;  2R7Z H;  3J80 c;  3OYY A;  1FGU A;  4YY3 Q;  1PVO A;  3HOY G;  1SFO H;  1PH3 A;  4POG A;  5CMT A;  1X56 A;  3IRB A;  4EQ5 A;  1L1O C;  2OQ0 A;  3K80 C;  4DV2 Q;  4GNX B;  2ZJQ A;  4AYB E;  4LF8 Q;  2UXD L;  3MXN B;  1C0A A;  1UE6 A;  4OWT B;  4DPG A;  4U07 A;  3UDF A;  5C4X H;  3S1M H;  2UXB L;  1YVC A;  3NBH B;  4DAY B;  3K7A H;  5LMN L;  3CF5 A;  2KHJ A;  1MIU A;  4X66 Q;  5IYD H;  2NVT H;  4K0K Q;  1XMO Q;  1I3Q H;  4JBJ A;  2F52 A;  4J15 A;  4YCV A;  2E2J H;  4A93 H;  2MO1 A;  4DR2 Q;  1K83 H;  5IE8 A;  1J5E L;  1VQC A;  1BBU A;  2Z6K C;  3CME A;  3PUY A;  1WCM G;  4X62 Q;  1HNX L;  4LNQ A;  2K5V A;  3CP0 A;  4LF4 L;  4A3G G;  4JI7 L;  3ULP A;  2K4K A;  5CKL A;  2NN6 G;  2WP8 J;  2B29 A;  4YWL A;  1K0R A;  5M3F G;  1JJ2 A;  2UUA Q;  4B3M Q;  1PHJ A;  3OTO L;  3NEM A;  2CCZ A;  5AJ3 L;  4X64 Q;  4YWM A;  2V1C C;  4A76 A;  3PUZ A;  2UUC Q;  3TRZ A;  1JT8 A;  2HIV A;  3SGI A;  3S15 H;  1I50 H;  3KF6 B;  1PH5 A;  1UE7 A;  2WB1 G;  3CPF A;  3E0E A;  5FLM G;  3H3V H;  1CSP A;  4IFD J;  3VDY A;  1GO3 E;  4LFA Q;  4GKJ L;  5IYD G;  4A3J G;  3PF5 A;  1PYB A;  4DNI A;  4OON A;  3UDG A;  2WAQ E;  2ASB A;  1XNR L;  1PFS A;  1WYD A;  3K7U C;  4IOA A;  3CD6 A;  2VW9 A;  5JEA G;  5M5W H;  3SN9 A;  1GKH A;  4GS3 A;  1T9H A;  5HY6 A;  2NVX H;  3I4M H;  2KEN A;  1W3S A;  4P75 A;  2IX1 A;  1P16 A;  1B7Y B;  3HKZ G;  2GVA A;  4A3B H;  4DR1 Q;  3KLW A;  2N49 A;  2JA7 H;  1B70 B;  4A3M H;  1XMQ L;  4U0S A;  3AFP A;  1VQA A;  3PUW A;  4A3G H;  4A3C G;  4PZ8 A;  1BBW A;  2CKZ B;  2Q2H A;  5J3B A;  4LF7 Q;  4LFC Q;  4WJ3 M;  3GTM H;  4R4C A;  2CQO A;  4DR2 L;  3K0X A;  2ZJP A;  3LGJ A;  4LFB L;  4ME3 A;  2AWO A;  2QA4 A;  4HIO A;  4A3I H;  2B3G A;  1N33 Q;  4JYA Q;  4UY8 C;  1N32 Q;  2K14 A;  4R4O A;  3CCS A;  1VQP A;  1Q81 C;  3RR5 A;  4DUZ Q;  2RHS B;  4OWX B;  2A8V A;  1HZ9 A;  5HGQ A;  2JA6 G;  4KHZ A;  1IXR A;  1SN8 A;  1WFQ A;  4B3R L;  1I94 Q;  3CXC A;  4JOI C;  4GNX A;  3KJO A;  4KHP Q;  5LMU Q;  1U5K A;  2KCM A;  1IZ6 A;  2N8N A;  4IPG A;  3UDI A;  1YIT A;  4YHH L;  4JI4 Q;  4M16 A;  4BXX H;  2NZO A;  1W2B A;  4B3S L;  3CMA A;  1WJJ A;  5JJK A;  3RZD H;  2E2H H;  1E22 A;  2Y0S E;  1JE5 A;  5GRO A;  3GTG H;  4R1J A;  5C44 H;  3T1H Q;  1CKO A;  1YBY A;  5IP9 H;  2DUD A;  1LYL A;  2WAQ G;  4XTC S;  1I94 L;  2H5X A;  3S1R H;  3HFZ B;  3UDX A;  4LF6 Q;  3CC2 A;  1PYS B;  2PI2 E;  4HJ5 A;  4JV5 Q;  1UWV A;  2N78 A;  1PH6 A;  2JA6 H;  2VUM H;  2VY3 A;  1K8A C;  3S2D H;  4L5Q A;  4DV2 L;  3M3Y H;  1EWI A;  4JI8 L;  2ES2 A;  3BU2 A;  2RCN A;  1U0L A;  4HJA A;  4YWK A;  2VL6 A;  1KIX A;  5JEA J;  1DGS A;  4JI2 L;  3PIP A;  3HKZ E;  1K3R A;  1SRU A;  2ZTC A;  4QGU A;  1YEZ A;  4YY3 L;  3A5U A;  3G71 A;  4BY7 G;  5M3M G;  2AHO B;  1XTD A;  1NTG A;  4IJH A;  2F4V Q;  2JA7 G;  1JJC B;  3EBE A;  3GTK H;  1TWF H;  4IFD I;  2ZM6 L;  4A3E G;  3M4P A;  5M5Y H;  3RLN A;  2JA5 G;  2NZH A;  1H95 A;  3G48 A;  1VQL A;  1CSQ A;  1RIP A;  3GTP H;  1TXY A;  1OTC A;  3J81 i;  4BA2 I;  1WOC A;  2UXC Q;  1GVP A;  2AMC B;  3JC6 6;  3F2B A;  3ICE A;  4PG3 A;  2OQK A;  1TWA H; 
#chains in the Genus database with same CATH topology
 5DLQ E;  5JJ7 A;  1N8R C;  1HFG A;  1SE3 A;  3IL8 A;  4XYO A;  1J9O A;  4LF5 Q;  2WAQ B;  1GUS A;  4B3T L;  3JAM i;  1AH9 A;  1CI3 M;  1HJP A;  3ND8 A;  4FNF A;  3I90 A;  2D62 A;  4CJ2 C;  3Q24 A;  4GNX C;  2X6G A;  4A3E B;  4IUR A;  4DV1 Q;  3H3V C;  3FMC A;  4IOC A;  4GKK Q;  3V96 A;  1STN A;  1I4Q A;  2R93 G;  2ALY B;  4CJ0 B;  1QNU A;  3BYY B;  1I5F A;  1WTQ A;  4B3M L;  3AMU A;  1VQI A;  3CAM A;  3PSI A;  5FLM H;  4ZAI A;  2R61 A;  1U9R A;  3OPO A;  1JOO A;  3D4R A;  2EYL A;  2IJ0 A;  3I4M B;  3MEF A;  2CWP A;  5FOB B;  3S16 H;  3HRZ C;  3S14 H;  4A3J B;  2HT1 A;  3V05 A;  1UE5 A;  4DK6 C;  1DCZ A;  2KBN A;  4V19 0;  1YNJ C;  1A62 A;  4J1M A;  4C56 C;  2VUM B;  2F6S A;  1LT3 D;  3FHW A;  1LUZ A;  2HD3 A;  3URY A;  5LMN W;  1Q7Y C;  4A3M G;  4PV1 C;  1UEB A;  1LV9 A;  1SRO A;  2F0N A;  1KAB A;  1CFM A;  1EIH A;  5C3E B;  2UUC L;  1HA6 A;  2PW7 A;  2VXW A;  4L5S A;  1TS5 A;  1D5M C;  4ID6 A;  4FO2 A;  2G5D A;  1EY9 A;  1BCP B;  1X3Q A;  3OMG A;  2E5L Q;  1VQO A;  1H9S B;  1X65 A;  1N34 L;  3GTO B;  3KFU A;  3D3R A;  2IHF A;  3J80 L;  2D9U A;  1O7L A;  2K52 A;  4UP8 A;  1Y1V G;  4JI7 Q;  2B2W A;  3VR5 A;  3C3L A;  2BDO A;  1FNW A;  2Q8T A;  3SK6 A;  3MHB A;  2BOS A;  3S6A A;  2JEA I;  4RH6 A;  3M85 A;  3KBG A;  5FO7 B;  2MPM A;  3KLS A;  3TZU A;  3DHQ A;  3ERS X;  1O7Z A;  4ZUJ A;  1N36 L;  4BY7 H;  1JWM D;  1K73 C;  1PH2 A;  3A55 A;  5CV7 A;  1MI2 A;  4X64 L;  3AFQ A;  2KA7 A;  2F0T A;  4BBS H;  4APV A;  2IHE A;  2K05 A;  4B3S Q;  1NBW A;  3D6C A;  4DV4 Q;  3NXW A;  2PW5 A;  4A3E H;  4O42 A;  2K5H A;  1PFB A;  3GTJ H;  1QOH A;  4X65 Q;  3LET A;  3KK7 A;  3K5M A;  2JK8 A;  4WGJ A;  1HTL D;  4FF1 A;  2BE5 C;  2XGT A;  3BG3 A;  4A3C H;  4JYA L;  4G7O C;  4YCU A;  4DV0 Q;  1EEI D;  5C4J B;  1IBK L;  4JI6 L;  2DNC A;  1SNM A;  1TU2 B;  1G2T A;  3CUC A;  2QEJ C;  2K5N A;  3S9W A;  5EKI A;  1Q46 A;  3UI2 A;  3S16 B;  2MGS A;  4A3L G;  2E76 C;  2CVR A;  4WOR A;  3S14 B;  1ET9 A;  5FLX E;  4R8N A;  3EVQ A;  4IFD H;  2R7F A;  2NTT A;  4PMW A;  3HOY B;  3KLS X;  4LK1 C;  5KNB A;  4M8A A;  1IKL A;  4A3F H;  4UPA A;  1DJR D;  2F0U A;  2PMZ B;  5J22 A;  2G9D A;  1A3T A;  3H0G G;  1IYJ B;  2B63 G;  2NVY H;  3GQB A;  5I6W A;  5JPN C;  2UXB Q;  1IBK Q;  3S1N H;  5IT9 E;  1IW7 C;  2F0L A;  1Z47 A;  1PLF A;  4DV7 Q;  2HIX A;  3SK5 A;  3S1Q H;  1E1O A;  3M7G A;  2XRQ D;  4RWS C;  3PIP 3;  1I6H H;  3NTI A;  2R7Z G;  5CV9 A;  1OO9 B;  4NDX A;  4KTA A;  2K28 A;  3HOW H;  2HUG A;  1RL2 A;  3FPU B;  3QB3 A;  5JVG 3;  3U58 A;  2B8F A;  1GHK A;  2F0K A;  5C4X G;  1D6E C;  2FXQ A;  2EZV A;  1DZ1 A;  1KLU D;  5ELB A;  5IYC G;  4U04 A;  1FGB D;  3OW7 A;  2QCP X;  4BY1 G;  3T1Y L;  3HOU B;  2DJG C;  4K0K L;  4DV5 L;  5C3W A;  3RD4 A;  5C3X A;  1D1K A;  4N9T A;  1EFW A;  1W6J A;  5NUC A;  1HNZ Q;  4DR5 Q;  4H02 A;  3F8T A;  1I4X A;  2YTX A;  1YNN D;  1SNC A;  2CFM A;  5D65 A;  2EJM A;  2LY7 A;  3J7A F;  2R93 H;  1S40 A;  3J81 j;  3RN5 A;  1E2Z A;  4EX5 A;  1WI5 A;  1PTO D;  2RQX A;  2CW0 D;  2K6A A;  5IP7 G;  4BBS B;  4G4K A;  5KIX A;  2B2U A;  2F0P A;  3G4S A;  4QL5 A;  1XNQ L;  2F0Q A;  3SDZ A;  4U0Z A;  4RFB A;  4B9W A;  4HED A;  3I72 A;  2K32 A;  5C5L A;  1GUG A;  1PZI D;  3Q6S A;  3BVM A;  3NQI A;  5M5X H;  1IKM A;  2VZA A;  1IBM Q;  1IYV A;  1SMX A;  4A3D B;  1C48 A;  5IOD A;  1HNX Q;  4XT1 B;  2AQ2 B;  3OIQ A;  1EWC A;  2WB1 B;  2MO0 A;  3PF4 A;  4G7H C;  5ISR A;  1ESF A;  2KHS A;  1EQQ A;  2EY5 A;  3K5O A;  3ITP A;  4KN7 C;  3OMC A;  1YI2 A;  3DWP A;  2E2D C;  2RF4 A;  3RNU A;  1HR0 Q;  3HOY H;  4K2K A;  1EUJ A;  1A3U A;  3PIO 3;  5A2Q L;  2I5L X;  4NMZ A;  4BWG B;  2KEE A;  4J8Q A;  5M3F H;  4BA1 I;  2DY7 A;  3QJY A;  4RGN A;  2Z9H A;  3K8A A;  3R8B A;  1P8L A;  1I4P A;  2D0P A;  3FEW X;  4OX9 Q;  2EXD A;  1WCM H;  2B2U C;  4NPS A;  2F0G A;  2SOB A;  3K57 A;  5FLX c;  1AEX A;  2Q8I B;  1PZK D;  1NSN S;  4MZ9 A;  1W6K A;  2B2Y C;  4IPD A;  4ZYS A;  1FGU A;  2K01 A;  2RKS A;  1AZQ A;  3NWS A;  1TWF B;  3CHB D;  3K80 C;  4DV2 Q;  1SJE D;  2UXD L;  3S1M H;  4CHT B;  4U07 A;  5EKK A;  5ELD A;  3HOW B;  4DAY B;  1ZYR C;  4OO1 H;  3CF5 A;  4U68 A;  3MXP A;  1VF7 A;  2NVT H;  1XMO Q;  4A93 H;  2MO1 A;  5IE8 A;  1J5E L;  1VQC A;  3IFD A;  3KF8 A;  3H6M A;  4OIJ A;  5JEA H;  2SNS A;  1B3A A;  3CME A;  1PTO B;  1WCM G;  3EQL C;  5D3I B;  2MUY A;  1KAA A;  4JI7 L;  5CKL A;  1S5C D;  4C2M B;  3EJI A;  3OTO L;  2CCZ A;  5AJ3 L;  1DD2 A;  4YWM A;  1VDZ A;  4QUC A;  3PUZ A;  1KNA A;  1JT8 A;  4RCN A;  3SGI A;  2KOL A;  1I50 H;  3KF6 B;  3U9S A;  3S2D B;  1UE7 A;  1MBY A;  2DNE A;  4KKS A;  3H3V H;  1HPC A;  1CSP A;  4LFA Q;  2UXD Q;  5ELF A;  1PYB A;  4DNI A;  4OON A;  1UAP A;  1PFS A;  2K5D A;  1ZYR D;  4OHJ A;  5JEA G;  3SN9 A;  1F9S A;  1NCV A;  5HY6 A;  2KEN A;  4ZCK A;  1P16 A;  3DXJ C;  3RZO B;  4DXF A;  2WIN B;  3HOV B;  2L12 A;  2GVA A;  4A3B H;  5EBC A;  4DR1 Q;  3KLW A;  3LWE A;  5LL6 S;  1B70 B;  1H9K A;  5F2D A;  3GTG B;  4U0S A;  3PUW A;  4A3G H;  5IGC A;  4A3C G;  5DM6 3;  1BBW A;  3P75 A;  3GTM H;  4R4C A;  3K0X A;  2ZJP A;  4HIO A;  2B3G A;  3TDQ A;  2IPK D;  2K03 A;  4BXX H;  1VQP A;  1AW7 A;  3RR5 A;  2F0H A;  1EYC A;  2JA6 G;  4KHZ A;  1IXR A;  5JJZ A;  1R4Q B;  4ZLT F;  1VMP A;  4L63 B;  4Z9C B;  4GNX A;  2Z8L A;  4KHP Q;  3GTK B;  1PXU A;  2N8N A;  2CH4 A;  2NUN A;  1EY6 A;  4YHH L;  2KJX A;  3TN2 A;  3CMA A;  3PO3 B;  2Y0S E;  3LX0 A;  3X3M A;  1SAP A;  5CV6 A;  4R1J A;  1BO0 A;  5CYU A;  1CKO A;  5IP9 H;  1E2W A;  1SYG A;  4XTC S;  1X32 A;  2H5X A;  1F2Z A;  3HFZ B;  3UDX A;  3M3Y B;  3CC2 A;  2PI2 E;  1B4O A;  2OT2 A;  4HJ5 A;  4JV5 Q;  1PH6 A;  2JA6 H;  2VY3 A;  3PO2 B;  2L55 A;  1JE4 A;  1EWI A;  4ZRZ A;  4HJA A;  4OIK A;  3JAM E;  5JEA J;  1DGS A;  3PIP A;  3HKZ E;  1K3R A;  2WKC A;  4YY3 L;  3A5U A;  2AHO B;  2WKD A;  1JJC B;  1TWF H;  5M5Y H;  1CA5 A;  2NZH A;  1VQL A;  3J81 i;  4BA2 I;  2QIL A;  1JOK A;  3F2B A;  4PG3 A;  4AYB B;  3SE5 A;  1JMC A;  1OXU A;  4OL7 A;  1STA A;  3STB C;  4BY1 H;  4WJ4 A;  1PTO H;  2RSN A;  1FR3 A;  1LTR D;  3J7Z C;  3MZ5 A;  1BUV T;  2NN6 I;  4DR6 Q;  2LSS A;  4A3L H;  1KNE A;  1GM5 A;  3M7N A;  1LTL A;  5ELO A;  2YTV A;  1Q1E A;  4C3J H;  4X3T A;  1TWG H;  1B53 A;  3K5N A;  4RHS A;  3I2Z A;  2JQO A;  2OTL A;  5IWA Q;  3DM3 A;  1M1K C;  2YYZ A;  3FRP B;  2NZ1 D;  2EQS A;  3CKI B;  4CGY B;  4QJF A;  2KVM A;  1BF4 A;  4RGT A;  3K58 A;  1DOL A;  4AYB G;  2FIN B;  1IBM L;  2VQE L;  5EKL A;  3RZD B;  5LL6 X;  3C46 A;  2OTJ A;  1JJG A;  3RLO A;  4DV6 L;  3HOV H;  2IWH A;  2O5I C;  3S24 A;  1RHP A;  4JI5 L;  2L5T A;  2PQA A;  1LT5 D;  4JK1 C;  2FFK B;  3D31 A;  1PV4 A;  4A3I G;  1OXV A;  3GTL H;  2JE6 I;  1BNZ A;  4Y52 H;  5TSS A;  3GTM B;  2R7D A;  1YZ6 A;  1Z9F A;  4NXN L;  5IGE A;  2E2I H;  3TP8 A;  2E74 C;  5KEE A;  2QW7 A;  2OWO A;  2V4D A;  1LTB D;  4DV1 L;  2LXJ A;  1X3G A;  1YNN C;  2NB0 A;  3FKI H;  1F2M A;  3D8G A;  1VQH A;  1KLG D;  3K6O A;  4RGM A;  2NTS A;  3E0J A;  5C44 G;  2ZJR A;  3OWE B;  1PZJ D;  1R9T B;  4O0A A;  2PPB C;  3BZK A;  1WTR A;  1EIY B;  1CQV A;  2JYO A;  1KRT A;  3WDN A;  2LXK A;  4XQQ A;  4PY3 A;  2IY5 B;  3QOJ A;  1E24 A;  2CWA A;  2NVQ H;  2L1B A;  5D3D A;  3PQI A;  3OHX C;  4RKB A;  1R4P B;  1H9R A;  3H0G B;  1TVX A;  4E6I A;  4GN3 B;  4P74 A;  5IOC A;  4BBR H;  2AWN A;  2D2C C;  5DNF A;  3DWA A;  4X3K A;  2J4X A;  4KY6 A;  3D4W A;  4FDB A;  2X69 A;  4ALP A;  4KY5 A;  4A3J H;  1MKH A;  3CC4 A;  1II3 A;  3T1H L;  3KOJ A;  1JQY D;  1SYC A;  4UP7 A;  4BY1 B;  4NXN Q;  1SSO A;  1Y1V H;  3A8J E;  1MD2 D;  1S5E D;  1EZ8 A;  1XWE A;  2UUB Q;  4LF9 Q;  2HHH Q;  5IGG A;  3E9H A;  5EPL A;  1N34 Q;  4C3I H;  4HJ7 A;  4IZ8 A;  1HNZ L;  4IUQ A;  1E7Z A;  1K9M C;  1H9J A;  1I6V C;  3F1Z A;  4RAU C;  4JI8 Q;  1HR0 L;  4ODG A;  2F0F A;  1QB5 D;  2TSS A;  1WD0 A;  1D2B A;  4C3H B;  4RGO S;  2BE5 D;  1EQR A;  1EEF D;  3QG1 A;  3CCE A;  4X65 L;  1XMQ Q;  2R3Z A;  2K7V A;  4RCO A;  1UNS A;  4QIW B;  3D0F A;  4AQY Q;  4FYD A;  3GTO H;  5CV8 A;  2MNA A;  3AQQ A;  4DR1 L;  2EXZ A;  1U4M A;  3H15 A;  4LF4 Q;  3KUP A;  4JBM A;  2K50 A;  5FJ8 G;  3SHG A;  1O7Y A;  2IW3 A;  1S3O A;  1X6O A;  2F1M A;  2RCF A;  3A8I E;  1EU3 A;  4Y7N H;  1D5X C;  3CCR A;  1N36 Q;  4K8I A;  4L5T A;  4A93 G;  3S2H H;  1GUN A;  4RA8 A;  1PH9 A;  2EDG A;  2AKW B;  4ZUI A;  1V1P A;  4AH6 A;  5LHY 1;  3OW2 A;  2P5Z X;  3ND9 A;  5CGL A;  4BY7 B;  2Z1C A;  5M9O A;  5KYL A;  1YNX A;  5KRU A;  3S1Q B;  4OX9 L;  3E5S A;  3CCL A;  4GOP B;  5I2Y A;  2MQH A;  3K7A B;  4IN3 A;  2O2L D;  4C1N K;  1NMF A;  1IBL L;  3I4N B;  1QUQ A;  2KCN A;  1XMO L;  4XQJ A;  1PH8 A;  3STB D;  4OO1 G;  5C3E G;  3IAY A;  1X9N A;  4MNO A;  3W1G A;  4EQP A;  2B63 B;  4S3S A;  1QIL A;  2K04 A;  2E5L L;  3I55 A;  3TP6 A;  1WVL A;  2F0W A;  1XYI A;  3A5Z B;  1L0X B;  1V9P A;  2D0O A;  1YHA A;  5C4J H;  4TQU S;  1VQ8 A;  3G6J B;  1Y1W H;  3B6Y A;  1GUW A;  1I4G A;  1PFM A;  2PCF B;  2MP1 A;  3H94 A;  1XPO A;  3J7A 5;  4QY7 A;  5DEH A;  5C4X B;  1X3P A;  4RG1 A;  3HOW G;  1Y1V B;  3P7J A;  4CKE A;  4BXX G;  4LFC L;  4A3K B;  1VQ7 A;  1BDO A;  3VYU A;  1Q8I A;  2PMZ E;  2E2J B;  1G29 1;  2KHI A;  2EJF C;  3MFG A;  1QVC A;  1YNJ D;  4R9W A;  5E7N A;  5JAV A;  4A3M B;  2GN5 A;  4GLA C;  1A2T A;  1HXY D;  3CRL C;  3MAQ A;  3I4L A;  1X54 A;  3ZCB A;  1G51 A;  1CQF A;  4U0U A;  3TS2 A;  2F3I A;  1HNW L;  3F2U A;  1QCB D;  1T5E A;  4K8J A;  5JJL A;  1D8L A;  2HQE A;  4O2D A;  3PCO B;  1VQB A;  1N9W A;  1VQJ A;  5KND A;  4C3H H;  2UXC L;  4JI2 Q;  5H1S E;  4DUY Q;  3HOX G;  3ERO A;  1L1O A;  2D5D A;  1VCI A;  1Y69 U;  1XJV A;  1DM0 B;  4RHR A;  2EYP A;  3H91 A;  3FKI G;  1S5B D;  3T1Y Q;  1BKB A;  2C35 B;  2E75 C;  3WWV A;  4LUO A;  3MXN A;  5T1G A;  1A8V A;  4JW0 A;  1FVI A;  2VUM G;  3ER0 A;  1Y1W G;  4CKC A;  4QQB X;  1TWC H;  3TSS A;  4YHH Q;  1BCP F;  2VQF Q;  4FF2 A;  2R92 H;  1JC7 A;  4DK3 C;  4A3D G;  3CCU A;  2CQA A;  5IP7 H;  5M3F B;  3JAM L;  2QKI C;  3BZD B;  5GAE C;  5C5M A;  4XXE A;  1S5D D;  3K81 C;  3VR4 A;  1LTI D;  3OYY A;  1HQR D;  1PVO A;  3HOY G;  1SFO H;  2AUJ D;  3IRB A;  2ZJQ A;  4GNX B;  3MXN B;  1C0A A;  4DPG A;  2UXB L;  2RSO A;  2IX3 A;  3K7A H;  2KHJ A;  4FF3 A;  1PTO F;  5KYI A;  2K5W A;  3HZX A;  1BBU A;  2Z6K C;  2RBM A;  3PUY A;  1HNX L;  4LNQ A;  2JA8 B;  3HEJ A;  3QOL A;  3ULP A;  2K4K A;  2WP8 J;  1F9P A;  2UUA Q;  5M3F G;  4B3M Q;  1PHJ A;  2V1C C;  4NW2 A;  3S15 H;  4XDX A;  3CPF A;  5FLM G;  3VDY A;  4A3J G;  3PF5 A;  1JOR A;  1XNR L;  4P2C B;  1F77 A;  1STH A;  2A6H D;  2G9H D;  1DXM A;  1JWU D;  5M5W H;  2NUC A;  1HUM A;  1GKH A;  4GS3 A;  2NVX H;  2IX1 A;  2XIW A;  2N49 A;  4A3M H;  1EWH A;  1XMQ L;  4KY7 A;  3AFP A;  5HGT A;  3O13 A;  2H4O A;  4PZ8 A;  4WJ3 M;  5COY A;  4IUT A;  4L6T B;  2O5J C;  2KED A;  4ME3 A;  2AWO A;  4A3I H;  4LFB L;  4UY8 C;  4DAV A;  2N55 A;  3CCS A;  1Q81 C;  2ENB A;  4OWX B;  1HZ9 A;  3NP8 A;  1G6Z A;  1SN8 A;  1WFQ A;  3TBI B;  4MIU A;  1CT1 D;  1I94 Q;  3CXC A;  5IGB A;  1TY2 A;  1PDQ A;  3NBH A;  1G91 A;  4M16 A;  3HG9 A;  2NZO A;  1E22 A;  2L11 A;  2JA7 B;  1JE5 A;  3S1R B;  5GRO A;  3T16 A;  1TWA B;  2KQ3 A;  5EJW A;  1L0Y B;  5C44 H;  1NNX A;  4FXD A;  3SXH A;  2DY8 A;  4PMC A;  1V8Q A;  4LF6 Q;  2BCO A;  1STB A;  2XNA C;  3X3N A;  2CW0 C;  2F3W A;  2A73 B;  4EQO A;  3S2D H;  1KDC A;  3M3Y H;  2A69 C;  1EY4 A;  3SEB A;  2RCN A;  4KK7 A;  3MXU A;  3BVZ A;  3ZYY X;  3G71 A;  2ZTC A;  1YEZ A;  4H44 C;  4BY7 G;  5M3M G;  1ENC A;  4IJH A;  3NSW A;  2F4V Q;  4IFD I;  3EBE A;  2ZM6 L;  4A3E G;  3QIA A;  1CSQ A;  5CMD A;  2HDM A;  3OWF A;  3GTP H;  1WOC A;  3WOF A;  2E2H B;  1B3Q A;  5FLX L;  4GLV B;  4IQZ A;  1VQE A;  2XVS A;  1XPU A;  3DUZ A;  1E1T A;  5J1Z A;  5C0X I;  1PH4 A;  3OSO A;  4KKT A;  2NN6 H;  4XT3 B;  1ONL A;  3R93 A;  5K36 G;  2O4X A;  2NWG A;  4DU9 A;  1SNP A;  1S4Z A;  1GOZ A;  2JA8 H;  1FNU A;  3D6W A;  1LT4 D;  2ATW A;  5IP9 G;  1JWS D;  1M4V A;  5T1I A;  3A56 A;  2JA5 B;  2Z6K A;  4JI6 Q;  3S15 B;  3OOC A;  5M3M B;  1FNV A;  3A0J A;  4B9X A;  1WTW A;  1VS0 A;  4UP9 A;  4DV4 L;  2HHH L;  2B2W C;  4C3J B;  4N8F A;  2A68 D;  4NKL A;  4A3F G;  1PA6 A;  2L0C A;  1K8G A;  4K5X A;  5IYB H;  3LNN A;  4X3U A;  3N3U A;  2SDF A;  2YV5 A;  3PO3 H;  2PQE A;  1CA6 A;  1HTP A;  3T53 B;  1B9N A;  4LFA L;  5C0X J;  3KDF A;  1ASZ A;  2B39 A;  1HZC A;  1EY8 A;  1SMY D;  4K5W A;  4I65 A;  5GAG C;  2EE1 A;  3I4O A;  5AJ3 Q;  3PO2 H;  1Q8K A;  4A3B G;  4DR7 L;  3NUC A;  3DEO A;  4DV6 Q;  4A3I B;  1HNW Q;  4GOP A;  2WII B;  3NEN A;  5E4W C;  3M9B A;  1HQM C;  1QZH A;  5K36 H;  1QUQ B;  2PZU A;  2SNM A;  3PO3 G;  2Q2I A;  1FJG Q;  1DYQ A;  2F4V L;  1SE4 A;  1JIC A;  4JG2 A;  4LW1 A;  2C9O A;  1N32 L;  5IGF A;  1ZKO A;  5DAU A;  5IT9 L;  3FKI B;  3ULL A;  2IL8 A;  3PO2 G;  4FXK C;  3KJP A;  1A6X A;  4PMB A;  4X6A H;  4DXG A;  4R4T A;  2I5H A;  2QDL A;  3L7Z C;  5K5P A;  5IYC H;  1R9T H;  1LAC A;  3J81 c;  4GOP C;  1VQF A;  1EY0 A;  1XNQ Q;  4HSP A;  5AFW A;  2VQE Q;  1KL9 A;  2XTI A;  4H0L C;  2F0J A;  3PGZ A;  1TS2 A;  1EIF A;  3VR3 A;  1CKM A;  2Q2T A;  1PRT D;  3R3O A;  2RDF A;  1J6Q A;  1B8A A;  3BDO A;  3AYH B;  5C3E H;  2A6H C;  4DUZ L;  4RMF A;  3J81 E;  4HIM A;  4HSV A;  5E3F A;  3HOV G;  2L15 A;  1VQ6 A;  4R4I A;  4LUZ A;  4DK0 A;  5IIF A;  3TS0 A;  1ZEQ X;  4HMJ A;  3CQZ B;  4JVZ A;  3Q23 A;  5DM7 3;  1KAW A;  4DR3 Q;  3I70 A;  2EY6 A;  4KHV A;  4NXM L;  1VMC A;  4AIM A;  4DV5 Q;  5CC4 A;  3U4V A;  4DNR B;  1TS4 A;  2MFI A;  1IBL Q;  3BJU A;  4CKB A;  1LLR D;  3PV0 A;  2EYO A;  4DNT B;  2I5M X;  1UE1 A;  1JB7 A;  4DF7 A;  3HGB A;  1WTO A;  4IUP A;  3AB9 A;  2PI2 A;  1XPR A;  1UEA B;  1OXS C;  3AEV A;  2JA5 H;  2Y0S G;  2ZTE A;  3GV3 A;  3L3O C;  4BBR G;  1XNR Q;  2F0M A;  1Q82 C;  4KKU A;  3G7L A;  4N8X 1;  1AE2 A;  4OO1 I;  2G03 A;  4IPH A;  3BYT B;  4DAM A;  4C3I B;  1N33 L;  3HP3 A;  4KJO A;  1CKN B;  3S1N B;  1B50 A;  3AU7 A;  5JVH 3;  3KF6 A;  2ZT9 C;  4L8J A;  1LTG D;  2PNR C;  4MTN A;  2XRS D;  3I7F A;  3SVM A;  3M4O B;  4C3H G;  4JC0 A;  2VQF L;  2K1B A;  2ID0 A;  1ZXT A;  3I56 A;  1V1O A;  3DM1 A;  1SJH D;  1VQN A;  4KD3 A;  2WFW A;  4A3K G;  3CCM A;  3EA6 A;  1KHI A;  1VQ4 A;  1DOM A;  4F88 A;  3S17 B;  4ZKC B;  3HOZ B;  5LMU L;  4K14 A;  4H7B A;  1I4H A;  2FJ2 A;  4FP5 D;  1MJC A;  4A4I A;  2ZXR A;  5ELE A;  4EGV A;  2KCT A;  3HOU H;  3IFT A;  1TQO A;  2BA1 A;  4J6H A;  4K6L A;  2K33 A;  1A63 A;  5JFF A;  1SE2 A;  1SR3 A;  1A2U A;  1TWH H;  2F0V A;  2HQL A;  5CV4 A;  1M90 C;  2EIF A;  1B1Z A;  3HKS A;  1L2F A;  1U4P A;  2BH2 A;  3GTQ H;  4KLK A;  4UDU C;  5FJ8 H;  4LF6 L;  1EU4 A;  2EPB A;  2J7Z A;  1WTV A;  1NY4 A;  1K28 A;  4K2L A;  1O80 A;  1SYD A;  1EQT A;  3ONA B;  1KRS A;  1KQS A;  1AP0 A;  4DR5 L;  3NK9 A;  2WAC A;  3D4D A;  1KXL A;  1VQK A;  4KN4 C;  1IL2 A;  3CRK C;  1HZA A;  3U4Z A;  2BDN A;  1TKW B;  1K8M A;  3NEL A;  1BOS A;  3A8K E;  2B63 H;  1LM0 A;  1CUK A;  1GJX A;  3W2D A;  4FXG C;  1A15 A;  1I6H B;  1HR0 W;  1A3V A;  3TZD A;  3RN2 A;  2A6E C;  4V0B A;  3C2P A;  2RDH A;  5JFZ A;  5C0X H;  4EVO A;  3K5L A;  5LMN Q;  1TII D;  3ZC7 A;  1MSH A;  4ULL A;  2CHB D;  2PQA B;  4K6D A;  2EJG C;  4N67 A;  4JBK A;  3CCQ A;  3G6E A;  1L0W A;  5GAH C;  4DR4 L;  3TRE A;  2OXP A;  4JV5 L;  2ICE C;  1EQV A;  1C8C A;  1ICW A;  2AUK A;  1SEB D;  1Q90 A;  4NB3 A;  2Q2U A;  3S2H B;  2K75 A;  5EAY A;  4XQN A;  1VQ9 A;  1WD1 A;  4TRD A;  1Q86 C;  3NWT A;  3KYH C;  4X62 L;  1TT2 A;  2ZTD A;  4DKA C;  2B2Y A;  2EYM A;  1MJE A;  3M4Y A;  1H9S A;  3EFX D;  1KD1 C;  1Q3L A;  1V43 A;  3M4O H;  4IPC A;  3J7Y W;  1FL0 A;  5D14 A;  2E8G A;  2A6E D;  4DR7 Q;  3FP9 A;  1EL0 A;  5BR8 L;  2XSC A;  1BCP D;  2JJQ A;  3S17 H;  2NVT B;  3PMF A;  3TME A;  1ENA A;  1HHV A;  4IFD G;  1YHQ A;  1GHJ A;  2L4N A;  1C7Y A;  4DR3 L;  4NXM Q;  4HJ8 A;  4TSS A;  3U9O A;  4HAE A;  3HOX H;  4HID A;  2R7Z B;  2IT1 A;  4C2M H;  2KCC A;  3FVQ A;  1A0I A;  1SNO A;  1QJO A;  2IX0 A;  2R92 B;  3T51 B;  4KD4 A;  3ZJY C;  1MGS A;  4QB4 A;  4YY3 Q;  3GTQ B;  3J81 L;  2MHV A;  3GP7 A;  1K8O A;  1L1O C;  4HR7 B;  4OWT B;  1JCK B;  1I3Q B;  3UDF A;  5C4X H;  1SYB A;  2A5H A;  1YVC A;  5LMN L;  1K83 B;  2XN9 C;  5I2X A;  1MIU A;  1SYE A;  5IYD H;  4K0K Q;  4JBJ A;  2E2J H;  4NP5 A;  4DR2 Q;  4YIJ A;  1RKN A;  4R8I A;  3HKZ B;  1Z7T A;  2NUD A;  4LF4 L;  1JJ2 A;  2Z4H A;  1WCM B;  4HCS A;  2UUC Q;  4LAA A;  3A54 A;  2A74 C;  1ET6 A;  4M1U B;  3H09 A;  1STY A;  1WTX A;  1GXD C;  4IFD J;  4GKJ L;  5IYD G;  1NH1 A;  2M9V A;  3Q0A A;  5CBE E;  1WYD A;  3CD6 A;  5G3L F;  1I4R A;  1S5F D;  2EYF A;  3W3A A;  2I07 B;  1T9H A;  3IKJ A;  4I7Z C;  1EFI D;  4P75 A;  1Y8O B;  4ME5 A;  1B7Y B;  4CDC C;  5I9O A;  1TWC B;  2B2T A;  1VQA A;  4WRD A;  2K5Q A;  2Q2H A;  4OEL B;  4LFC Q;  2ICI A;  2M00 A;  1CK1 A;  4DR2 L;  3LGJ A;  4KMU C;  2JA6 B;  1N33 Q;  2OF1 A;  3MEH A;  2CH4 W;  2PZW A;  4XYQ A;  4B3R L;  1U4R A;  2F3V A;  5LMU Q;  5M5Y B;  3UDI A;  1IZ6 A;  3FPP A;  1PFN A;  4DAY A;  1O78 A;  1CM9 A;  4JI4 Q;  5JOB A;  2F0S A;  1W2B A;  4B3S L;  5JJK A;  2ZXO A;  3A7A B;  1STE A;  3GTG H;  2VB3 X;  1YBY A;  1U4L A;  2DUD A;  1LYL A;  2WAQ G;  1M8A A;  1I94 L;  3RMH A;  3S1R H;  5I9P A;  4PQX A;  1XTC D;  2VUM H;  2Z4I A;  1K8A C;  4L5Q A;  4DV2 L;  2SEB D;  2ES2 A;  3BU2 A;  4DAP A;  2VL6 A;  4JI2 L;  1SRU A;  4G7Z C;  1RD9 D;  5FO8 B;  1TWG B;  3NTH A;  3MWY W;  2C5C A;  3GTK H;  3M4P A;  3RLN A;  2M2L A;  1H95 A;  3G48 A;  4LJZ C;  1RIP A;  4ZK9 B;  1TXY A;  2F4I A;  2NVX B;  2J0T D;  2AMC B;  3JC6 6;  1V1P B;  4FVM A;  2F0I A;  4DA2 A;  3T13 A;  3GTP B;  4LU4 A;  1NAP A;  3T4A C;  4PZ6 A;  1WTH A;  1K0S A;  4OXP A;  4AQY L;  2FMM A;  1GUT A;  5IWA L;  3ULJ A;  4DFA A;  2N3S A;  1OXX K;  4HCE A;  3VR2 A;  2JP1 A;  1XXG A;  1E0B A;  4JOI A;  2XWB B;  1BCP C;  4G57 A;  2JN4 A;  4P72 A;  2LKV A;  3GTL B;  1ICF B;  1X3F A;  3F2D A;  4CDF C;  5EPK A;  5JJ6 A;  4DR4 Q;  1GD7 A;  1D7Q A;  1DON A;  4EQN A;  5BN3 A;  3PIO A;  5M3M H;  5EBD A;  4CDD C;  4HMI A;  1EZ6 A;  3SHL A;  4YCW A;  1PRT B;  5EU0 A;  5E1F A;  4QF4 A;  1PH7 A;  3DEP A;  5ELN A;  1RTO A;  3HOU G;  1F9Q A;  3UE0 A;  1BQQ T;  4LF7 L;  4HTH A;  5C44 B;  4JI5 Q;  1G8Z D;  2FHT A;  2N88 A;  2OEO A;  3UE1 A;  1JB3 A;  2AQ3 B;  3U50 C;  4RKL A;  3DWQ A;  2JA9 A;  2HDL A;  1PTO C;  1RCV D;  5GAD C;  1EOT A;  1WTP A;  4KV6 A;  1CZG A;  3I73 A;  1AFP A;  5FK9 C;  3RUZ A;  1NR4 A;  2RA4 A;  3GTJ B;  5GQO A;  3PUX A;  5A35 A;  3MXG A;  3HS0 C;  4QIW E;  1VQM A;  2Z0S A;  5I4D A;  4QMG A;  1FYC A;  4R4Q A;  1STG A;  2I0Q A;  4C1N I;  2B2V C;  3L0O A;  2QGQ A;  3RLF A;  4U67 3;  2EYJ A;  5IYB G;  1E3P A;  3KBX A;  3J7A V;  3I3C A;  3TEH B;  1O7I A;  3DMU A;  1LO5 D;  3BVG A;  2A1A A;  1X3E A;  1L1O B;  2XWJ B;  4X66 L;  3WOE A;  2RHQ B;  5EQ0 A;  1CTM A;  3W1B A;  1BBX C;  1QZG A;  4LF8 L;  3E6Z X;  4KHP L;  1S72 A;  4O1N A;  2X6L A;  3SE0 A;  4B3T Q;  3FDT A;  3GDE A;  3MA2 B;  3Q8D A;  4MN3 A;  3I8Z A;  3ERQ A;  1RTN A;  2I46 A;  1CHQ D;  4P71 A;  1BVS A;  4JI3 Q;  5KNC A;  2YU9 B;  3F2C A;  4WJW A;  4B08 A;  3K59 A;  4GKK L;  2Q8R E;  1YHB A;  4LF5 L;  4DGZ A;  4JI0 Q;  1HFN A;  2JEB I;  4DK1 A;  4F8M A;  1HH2 P;  4QUF A;  3EN2 A;  4GKJ Q;  1EOV A;  3CQZ H;  1EY7 A;  1TS3 A;  4P73 A;  3GD7 A;  4DV0 L;  1VF5 C;  4JBW A;  1B2T A;  1EIG A;  4TKO B;  2RVL A;  2BH8 A;  2NVQ B;  1LT6 D;  2ZM6 Q;  2A19 A;  1MSG A;  5EPJ A;  2PNH A;  4ITR A;  4XI8 A;  1SND A;  2DN8 A;  1TR5 A;  2ZXP A;  1E2V A;  4Q0F A;  2B2T C;  4A75 A;  4PNY A;  1ILP A;  3H0G H;  4FF4 A;  4DUY L;  5CGK A;  2JA8 G;  1SYF A;  4MHE A;  5A2Q E;  1G6P A;  3CCV A;  2VB2 X;  4BBR B;  4F7X A;  1V1Q A;  3MTS A;  2QF7 A;  3P1H A;  3N6R A;  4UAI A;  1EYA A;  3CC7 A;  4DR6 L;  5HUR A;  4LMQ D;  2A69 D;  2VS1 A;  3QR8 A;  2BA0 A;  4LWC A;  5JJI A;  4DV3 L;  1YJW A;  1J5E Q;  3VYR A;  1MHW C;  4A3F B;  1NR2 A;  2KEC A;  1X55 A;  3A7L A;  1BXT A;  3CW2 C;  2R92 G;  2NVY B;  2LFN A;  2F03 A;  2H1E A;  2L9H A;  1VQD A;  5BR8 Q;  4L5R C;  4JI1 L;  2B8G A;  1CKN A;  5C4Z A;  1PRT F;  5M5X B;  4GZY C;  1JOQ A;  1NE3 A;  2YTY A;  2QEX A;  1YJ9 A;  3W5O A;  1JR0 D;  4CJ1 B;  3NE5 B;  3SK8 A;  4KI0 A;  1UUP A;  5CBA E;  3ZLM A;  4LUV A;  4XIG S;  3QWN A;  3QO2 A;  4GLX A;  3SK4 A;  2WB1 E;  1HUN A;  4JI4 L;  2JXM B;  2HCI A;  1CHP D;  3GV6 A;  2AQ1 B;  2B2V A;  5BN5 A;  4IJL A;  2F0E A;  3EIV A;  2F0O A;  1EYG A;  4I7A A;  1HZB A;  1LAB A;  3C1F A;  4A3K H;  1NJI C;  3I4N G;  4JI1 Q;  1ASY A;  4JCV E;  4OWW B;  5IT9 c;  4Y7N B;  1SLJ A;  4OGQ C;  1NMG A;  5L37 A;  1Q1B A;  3J80 i;  4CDE C;  3GO5 A;  3M4Q A;  4LFB Q;  2GVB A;  2YU9 H;  3L2P A;  4X2E A;  4CBV A;  4IUV A;  1FJG L;  2EVB A;  1KC8 C;  1Y14 B;  2R93 B;  3PUV A;  2UU9 Q;  5JPM C;  2UUA L;  3DLL A;  1PH1 A;  4X2D A;  2QDB A;  3KDF B;  1HA5 A;  2F0D A;  4BBS G;  4QCL A;  4IAL A;  1AE3 A;  1RDP D;  1SBB B;  3I4N H;  1ROD A;  2JSO A;  1QG7 A;  1SNQ A;  4KJN A;  2PO4 A;  3SR1 A;  1EY5 A;  3H3V I;  4DV3 Q;  3HOZ H;  1LTT D;  1IW7 D;  3A74 A;  4C3I G;  5J39 A;  4ZKB B;  4GN5 A;  4ZQ3 A;  2LS0 1;  4ILW A;  3CCJ A;  4IUU A;  4A3D H;  3TQY A;  5IY0 A;  3NPP A;  5IGD A;  3K0Y A;  2EY2 A;  1QVG A;  3NQT A;  4X2C A;  4TVA B;  2VNU D;  1XX8 A;  2UUB L;  3CPW A;  4HIK A;  1Y1W B;  1TWH B;  1F2Y A;  1IL8 A;  2OCE A;  1I50 B;  1VQG A;  1ENF A;  4POF A;  1RJT A;  2KUM A;  1SMY C;  3OTO Q;  5I6Y A;  4DV7 L;  3BDC A;  4OEM B;  1VQ5 A;  4IUN A;  3E9I A;  5E4X A;  1Q12 A;  1T5X D;  2DGY A;  3T56 B;  5C0X G;  1Y8N B;  3JAM c;  3MC0 B;  5FO9 B;  2Y0S B;  4IO9 A;  3VA7 A;  1OXT A;  5CR3 A;  1D1I A;  3OIP A;  5C6A A;  2R6G A;  4ABN A;  1LTA D;  1LTS D;  1EYD A;  4JPB W;  1K3B C;  4PZ7 A;  1QE6 A;  3LWU A;  4UHV A;  3RZO H;  2TMP A;  4HJ9 A;  1YJN A;  2A68 C;  4LF9 L;  4DN4 M;  3VA5 A;  3VYT A;  4JI0 L;  3KF8 B;  2UU9 L;  1C4Q A;  1C9O A;  3V2T A;  1SE8 A;  4A3G B;  1NUC A;  3BZC A;  4X3S A;  1YIJ A;  3I4M G;  1D5Z C;  1Y8P B;  4B3R Q;  4GN4 B;  4JI3 L;  2DJF C;  2EYH A;  3HOZ G;  3HOX B;  2R7Z H;  3J80 c;  3KLR A;  4Q5V A;  3S1M B;  1BR9 A;  1PH3 A;  4POG A;  5CMT A;  1X56 A;  4EQ5 A;  4HN7 A;  2OQ0 A;  3MVV A;  4AYB E;  4LF8 Q;  1UE6 A;  4A93 B;  1QWY A;  5ELC A;  3NTK A;  3NBH B;  1KTK A;  4X66 Q;  5COR A;  5M5W B;  3J80 E;  1I3Q H;  5C4H A;  2F52 A;  4J15 A;  4YCV A;  3I91 A;  1K83 H;  3L9A X;  1J8I A;  4X62 Q;  2K5V A;  2RDG A;  3CP0 A;  4A3G G;  4C3J G;  2NN6 G;  4YWL A;  1F2L A;  2B29 A;  1K0R A;  1QVF A;  3NEM A;  2Z6B A;  4X64 Q;  4A76 A;  3TRZ A;  5G3L D;  2PZT A;  2HIV A;  1H9M A;  1ESR A;  1PH5 A;  1QNK A;  2WB1 G;  3E0E A;  1SFO B;  1GO3 E;  1CZW A;  3VYS A;  3UDG A;  2WAQ E;  2ASB A;  4MTK A;  3BS1 A;  3BDL A;  3K7U C;  4IOA A;  4N9P A;  1TY0 A;  2VW9 A;  1B9M A;  1RF2 D;  3TP5 A;  1B44 D;  2NBF A;  5KGU A;  4A3B B;  3I4M H;  1W3S A;  5CV5 A;  3HKZ G;  3CU7 A;  2JA7 H;  1FD7 D;  2GA4 B;  2HCC A;  1AN8 A;  4WFN 3;  1KDB A;  2PYK A;  2EOT A;  2CKZ B;  1F9R A;  5J3B A;  4LF7 Q;  1Z6H A;  2CQO A;  2QA4 A;  1N32 Q;  4JYA Q;  1HRJ A;  2K14 A;  4R4O A;  2EY1 A;  4DUZ Q;  2RHS B;  2A8V A;  1IHZ A;  5HGQ A;  1ILQ A;  3MFY A;  3VR6 A;  2FMC A;  3R2T A;  1PRT C;  2MJ8 A;  4F87 A;  4JOI C;  3KJO A;  1SXT A;  1U5K A;  2KCM A;  4IPG A;  1YIT A;  1GUO A;  4K5V A;  4BS9 A;  1WJJ A;  3RZD H;  2E2H H;  3R2I A;  1ML0 D;  1SDF A;  5EGT A;  3T1H Q;  1HCZ A;  1PMR A;  3NBI A;  3NHH A;  1PYS B;  5BN4 A;  2NYZ D;  1UWV A;  2N78 A;  1IYU A;  1AZP A;  1DOK A;  1PYW D;  4JI8 L;  1U0L A;  4YWK A;  5FKA C;  1KIX A;  3E3X A;  1G2S A;  4QGU A;  3Q22 A;  1KDA A;  3TP7 A;  2E2I B;  2LMC B;  1XTD A;  1NTG A;  3P20 A;  2JA7 G;  2WV6 D;  2JA5 G;  3C1E A;  1OTC A;  2UXC Q;  4H13 C;  1GVP A;  3ICE A;  3N52 A;  2OQK A;  1TWA H; 
#chains in the Genus database with same CATH homology
 5DLQ E;  3SE5 A;  4GKJ Q;  4LU4 A;  1VQE A;  5JJ7 A;  1N8R C;  1E1T A;  1JMC A;  5C0X I;  1XPU A;  1PH4 A;  1OXU A;  4PZ6 A;  5K36 G;  3STB C;  4LF5 Q;  4OXP A;  4BY1 H;  4B3T L;  4AQY L;  4WJ4 A;  3JAM i;  1AH9 A;  5IWA L;  3ULJ A;  2JA8 H;  1HJP A;  2N3S A;  1OXX K;  2ATW A;  5IP9 G;  3J7Z C;  2D62 A;  2NN6 I;  4JOI A;  4GNX C;  4DR6 Q;  2LSS A;  4A3L H;  1GM5 A;  2Z6K A;  4DV1 Q;  4P72 A;  4JI6 Q;  1LTL A;  3M7N A;  5ELO A;  1X3F A;  2YTV A;  3F2D A;  4IOC A;  4GKK Q;  1Q1E A;  5JJ6 A;  4C3J H;  3A0J A;  4DR4 Q;  1GD7 A;  1TWG H;  2R93 G;  1D7Q A;  3PIO A;  3I2Z A;  1VS0 A;  2ALY B;  2JQO A;  3DM3 A;  5IWA Q;  1M1K C;  4UP9 A;  4DV4 L;  2OTL A;  2YYZ A;  2HHH L;  5M3M H;  1I5F A;  4A3F G;  4B3M L;  2EQS A;  1PA6 A;  4YCW A;  1VQI A;  4QJF A;  3CAM A;  5EU0 A;  3PSI A;  5FLM H;  1K8G A;  5IYB H;  4AYB G;  1IBM L;  3N3U A;  1PH7 A;  2VQE L;  2YV5 A;  3PO3 H;  5ELN A;  2OTJ A;  3MEF A;  2CWP A;  3HOU G;  1JJG A;  4LFA L;  3S16 H;  3RLO A;  3UE0 A;  4DV6 L;  4LF7 L;  4JI5 Q;  5C0X J;  3HOV H;  3S14 H;  3KDF A;  1ASZ A;  2HT1 A;  1UE5 A;  4DK6 C;  2KBN A;  3S24 A;  1HZC A;  4JI5 L;  3UE1 A;  2PQA A;  1A62 A;  3U50 C;  3D31 A;  5GAG C;  3I4O A;  2JA9 A;  1PV4 A;  5AJ3 Q;  4A3I G;  5GAD C;  1OXV A;  3GTL H;  2JE6 I;  3PO2 H;  4Y52 H;  2F6S A;  1Q8K A;  4A3B G;  3FHW A;  4DR7 L;  1LUZ A;  5LMN W;  1Q7Y C;  2R7D A;  1YZ6 A;  1Z9F A;  4NXN L;  4DV6 Q;  4A3M G;  1HNW Q;  4GOP A;  3NEN A;  1UEB A;  3PUX A;  5GQO A;  2E2I H;  3M9B A;  1SRO A;  4QIW E;  1VQM A;  1QZH A;  1QUQ B;  2Z0S A;  3PO3 G;  2UUC L;  2Q2I A;  2OWO A;  1FJG Q;  4L5S A;  4R4Q A;  4DV1 L;  2LXJ A;  2F4V L;  1X3G A;  3FKI H;  4JG2 A;  1VQH A;  4LW1 A;  2I0Q A;  3L0O A;  2QGQ A;  3RLF A;  1N32 L;  5C44 G;  5IYB G;  1E3P A;  2ZJR A;  3ULL A;  3TEH B;  1O7I A;  1QVF A;  3PO2 G;  2E5L Q;  1VQO A;  1X65 A;  4O0A A;  3KJP A;  4X6A H;  3BZK A;  2A1A A;  4R4T A;  1X3E A;  2I5H A;  1L1O B;  4X66 L;  1N34 L;  1EIY B;  3L7Z C;  1KRT A;  5IYC H;  3KFU A;  2LXK A;  1R9T H;  2RHQ B;  3J81 c;  4PY3 A;  1VQF A;  3W1B A;  1E24 A;  2CWA A;  4GOP C;  1XNQ Q;  2IHF A;  2NVQ H;  2IY5 B;  2VQE Q;  4LF8 L;  1QZG A;  4KHP L;  1KL9 A;  1S72 A;  2XTI A;  3PGZ A;  4B3T Q;  1EIF A;  3GDE A;  1CKM A;  3Q8D A;  2Q2T A;  2K52 A;  4UP8 A;  1Y1V G;  4JI7 Q;  1J6Q A;  1B8A A;  3AYH B;  5C3E H;  4P71 A;  4DUZ L;  1BVS A;  4JI3 Q;  4RMF A;  4GN3 B;  4P74 A;  4HIM A;  3HOV G;  2L15 A;  1VQ6 A;  4R4I A;  3S6A A;  4LUZ A;  3F2C A;  2JEA I;  3TS0 A;  4GKK L;  3M85 A;  4BBR H;  2AWN A;  1KAW A;  1YHB A;  4LF5 L;  4DR3 Q;  4JI0 Q;  4NXM L;  2JEB I;  1HH2 P;  4AIM A;  3EN2 A;  1N36 L;  1EOV A;  3ERS X;  3CQZ H;  4FDB A;  4ALP A;  4BY7 H;  4DV5 Q;  4P73 A;  3U4V A;  3GD7 A;  4DV0 L;  2MFI A;  1IBL Q;  4JBW A;  3BJU A;  1K73 C;  1PH2 A;  4A3J H;  1MKH A;  3CC4 A;  3PV0 A;  2I5M X;  3T1H L;  1UE1 A;  1JB7 A;  3KOJ A;  4X64 L;  4UP7 A;  2BH8 A;  3AFQ A;  2A19 A;  2ZM6 Q;  4NXN Q;  4BBS H;  2PNH A;  1Y1V H;  4ITR A;  2IHE A;  4APV A;  4XI8 A;  2UUB Q;  4LF9 Q;  4B3S Q;  1NBW A;  2PI2 A;  4DV4 Q;  1XPR A;  1OXS C;  2HHH Q;  3AEV A;  4A75 A;  4A3E H;  3H0G H;  3E9H A;  2JA5 H;  2Y0S G;  2ZTE A;  2K5H A;  4DUY L;  4BBR G;  1XNR Q;  2JA8 G;  3GTJ H;  1Q82 C;  1G6P A;  3CCV A;  4C3I H;  4HJ7 A;  1N34 Q;  1AE2 A;  3LET A;  4X65 Q;  4OO1 I;  1HNZ L;  2G03 A;  2JK8 A;  4WGJ A;  4IPH A;  1E7Z A;  4DAM A;  1K9M C;  3F1Z A;  2XGT A;  1N33 L;  4JI8 Q;  1V1Q A;  4A3C H;  1HR0 L;  4JYA L;  1CKN B;  4YCU A;  4DV0 Q;  1IBK L;  4JI6 L;  3CC7 A;  3KF6 A;  4DR6 L;  3CUC A;  4MTN A;  1EQR A;  2K5N A;  2VS1 A;  3CCE A;  3I7F A;  2BA0 A;  4X65 L;  1XMQ Q;  4LWC A;  1Q46 A;  4A3L G;  5JJI A;  3D0F A;  4DV3 L;  4JC0 A;  2VQF L;  1YJW A;  1J5E Q;  4AQY Q;  2ID0 A;  3GTO H;  2MNA A;  3I56 A;  3AQQ A;  4DR1 L;  2R7F A;  3H15 A;  4PMW A;  1VQN A;  4LF4 Q;  1X55 A;  2WFW A;  4A3K G;  3CCM A;  4JBM A;  2K50 A;  5FJ8 G;  3CW2 C;  1KHI A;  3SHG A;  1VQ4 A;  2R92 G;  4A3F H;  5LMU L;  4UPA A;  1S3O A;  1X6O A;  1VQD A;  3H0G G;  1MJC A;  5BR8 Q;  1IYJ B;  4L5R C;  4JI1 L;  4Y7N H;  2NVY H;  4A4I A;  2B63 G;  1CKN A;  3CCR A;  1N36 Q;  4L5T A;  4A93 G;  3S2H H;  3HOU H;  2KCT A;  2UXB Q;  1NE3 A;  1IBK Q;  3S1N H;  2BA1 A;  2YTY A;  2QEX A;  1PH9 A;  1YJ9 A;  3W5O A;  2AKW B;  4AH6 A;  1Z47 A;  3OW2 A;  1A63 A;  5JFF A;  1TWH H;  1SR3 A;  5CGL A;  2HQL A;  2HIX A;  3ZLM A;  4KI0 A;  4DV7 Q;  1M90 C;  3S1Q H;  2EIF A;  1E1O A;  4LUV A;  4GLV B;  4XIG S;  3HKS A;  1L2F A;  4GLX A;  1YNX A;  2BH2 A;  2WB1 E;  4KLK A;  3GTQ H;  1I6H H;  4JI4 L;  5FJ8 H;  4LF6 L;  2R7Z G;  4OX9 L;  3CCL A;  4GOP B;  3HOW H;  2MQH A;  1RL2 A;  1NY4 A;  1NMF A;  3U58 A;  1IBL L;  1QUQ A;  4IJL A;  5C4X G;  1XMO L;  1KRS A;  3EIV A;  1KQS A;  4DR5 L;  1PH8 A;  3STB D;  2FXQ A;  1EYG A;  4OO1 G;  1HZB A;  5C3E G;  4A3K H;  1X9N A;  1NJI C;  3I4N G;  4JI1 Q;  1ASY A;  4JCV E;  4OWW B;  5IT9 c;  4MNO A;  1KXL A;  5IYC G;  1SLJ A;  3W1G A;  1NMG A;  1VQK A;  4U04 A;  2UXD Q;  2E5L L;  1Q1B A;  3J80 i;  3I55 A;  3GO5 A;  3M4Q A;  1IL2 A;  4LFB Q;  4BY1 G;  3T1Y L;  1HZA A;  3A5Z B;  3U4Z A;  4DV5 L;  4K0K L;  2GVB A;  2YU9 H;  1V9P A;  3L2P A;  4X2E A;  2D0O A;  3NEL A;  2B63 H;  1EFW A;  1YHA A;  1FJG L;  1LM0 A;  1CUK A;  1KC8 C;  4DR5 Q;  1HNZ Q;  4H02 A;  3F8T A;  1Y14 B;  5C4J H;  2YTX A;  4TQU S;  1VQ8 A;  3PUV A;  2CFM A;  1HR0 W;  1Y1W H;  3RN2 A;  3B6Y A;  2UU9 Q;  2UUA L;  3DLL A;  1PH1 A;  2R93 H;  4X2D A;  5JFZ A;  3KDF B;  4BBS G;  1S40 A;  3J81 j;  5LMN Q;  1XPO A;  3J7A 5;  3RN5 A;  4EX5 A;  3ZC7 A;  1WI5 A;  1AE3 A;  2PQA B;  3I4N H;  4QY7 A;  5IP7 G;  4N67 A;  4RG1 A;  3HOW G;  4JBK A;  3CCQ A;  3G6E A;  3G4S A;  1L0W A;  4QL5 A;  1XNQ L;  5GAH C;  4BXX G;  4LFC L;  4DR4 L;  1VQ7 A;  3H3V I;  4DV3 Q;  3HOZ H;  3TRE A;  3A74 A;  4U0Z A;  2PMZ E;  4JV5 L;  1G29 1;  2KHI A;  1QVC A;  4GN5 A;  5E7N A;  2GN5 A;  3CCJ A;  4GLA C;  4A3D H;  3TQY A;  5IY0 A;  5M5X H;  1X54 A;  2VZA A;  4NB3 A;  2Q2U A;  3ZCB A;  1G51 A;  2K75 A;  5EAY A;  1IBM Q;  4U0U A;  1QVG A;  1VQ9 A;  3TS2 A;  4X2C A;  2F3I A;  1SMX A;  4TVA B;  2VNU D;  1Q86 C;  1HNW L;  2UUB L;  3CPW A;  4HIK A;  3KYH C;  4X62 L;  1HNX Q;  2OCE A;  5JJL A;  1D8L A;  2ZTD A;  4O2D A;  1VQG A;  3PCO B;  1VQB A;  4DKA C;  1N9W A;  4POF A;  1VQJ A;  4C3H H;  1MJE A;  2UXC L;  4JI2 Q;  5H1S E;  2MO0 A;  3OTO Q;  4DUY Q;  3PF4 A;  4DV7 L;  1KD1 C;  3HOX G;  1VQ5 A;  1V43 A;  3E9I A;  3M4O H;  1L1O A;  4IPC A;  1Q12 A;  2DGY A;  5C0X G;  1VCI A;  1FL0 A;  3JAM c;  1EQQ A;  1XJV A;  2E8G A;  4DR7 Q;  3FP9 A;  4IO9 A;  5BR8 L;  1OXT A;  1YI2 A;  3FKI G;  2JJQ A;  3RNU A;  2R6G A;  1BKB A;  2C35 B;  2RF4 A;  3T1Y Q;  1HR0 Q;  3HOY H;  3WWV A;  1EUJ A;  4LUO A;  1A8V A;  4PZ7 A;  2I5L X;  3S17 H;  3RZO H;  1FVI A;  2VUM G;  3ER0 A;  1Y1W G;  4HJ9 A;  4IFD G;  1YJN A;  1YHQ A;  4LF9 L;  5M3F H;  4BA1 I;  4QQB X;  1TWC H;  4YHH Q;  1C7Y A;  4DR3 L;  4JI0 L;  4NXM Q;  2VQF Q;  3K8A A;  3KF8 B;  1C9O A;  4HJ8 A;  2UU9 L;  4DK3 C;  2R92 H;  1P8L A;  3CCU A;  2D0P A;  4A3D G;  5IP7 H;  1SE8 A;  3HOX H;  4HID A;  2IT1 A;  3BZC A;  4C2M H;  1YIJ A;  1A0I A;  2EXD A;  1WCM H;  4OX9 Q;  3I4M G;  4NPS A;  5GAE C;  5FLX c;  2IX0 A;  4GN4 B;  4JI3 L;  4B3R Q;  4MZ9 A;  3K81 C;  3HOZ G;  4IPD A;  3ZJY C;  2R7Z H;  3J80 c;  3OYY A;  1FGU A;  4YY3 Q;  1PVO A;  3HOY G;  1SFO H;  1PH3 A;  4POG A;  5CMT A;  1X56 A;  3IRB A;  4EQ5 A;  1L1O C;  2OQ0 A;  3K80 C;  4DV2 Q;  4GNX B;  2ZJQ A;  4AYB E;  4LF8 Q;  2UXD L;  3MXN B;  1C0A A;  1UE6 A;  4OWT B;  4DPG A;  4U07 A;  3UDF A;  5C4X H;  3S1M H;  2UXB L;  1YVC A;  3NBH B;  4DAY B;  3K7A H;  5LMN L;  3CF5 A;  2KHJ A;  1MIU A;  4X66 Q;  5IYD H;  2NVT H;  4K0K Q;  1XMO Q;  1I3Q H;  4JBJ A;  2F52 A;  4J15 A;  4YCV A;  2E2J H;  4A93 H;  2MO1 A;  4DR2 Q;  1K83 H;  5IE8 A;  1J5E L;  1VQC A;  1BBU A;  2Z6K C;  3CME A;  3PUY A;  1WCM G;  4X62 Q;  1HNX L;  4LNQ A;  2K5V A;  3CP0 A;  4LF4 L;  4A3G G;  4JI7 L;  3ULP A;  2K4K A;  5CKL A;  2NN6 G;  2WP8 J;  2B29 A;  4YWL A;  1K0R A;  5M3F G;  1JJ2 A;  2UUA Q;  4B3M Q;  1PHJ A;  3OTO L;  3NEM A;  2CCZ A;  5AJ3 L;  4X64 Q;  4YWM A;  2V1C C;  4A76 A;  3PUZ A;  2UUC Q;  3TRZ A;  1JT8 A;  2HIV A;  3SGI A;  3S15 H;  1I50 H;  3KF6 B;  1PH5 A;  1UE7 A;  2WB1 G;  3CPF A;  3E0E A;  5FLM G;  3H3V H;  1CSP A;  4IFD J;  3VDY A;  1GO3 E;  4LFA Q;  4GKJ L;  5IYD G;  4A3J G;  3PF5 A;  1PYB A;  4DNI A;  4OON A;  3UDG A;  2WAQ E;  2ASB A;  1XNR L;  1PFS A;  1WYD A;  3K7U C;  4IOA A;  3CD6 A;  2VW9 A;  5JEA G;  5M5W H;  3SN9 A;  1GKH A;  4GS3 A;  1T9H A;  5HY6 A;  2NVX H;  3I4M H;  2KEN A;  1W3S A;  4P75 A;  2IX1 A;  1P16 A;  1B7Y B;  3HKZ G;  2GVA A;  4A3B H;  4DR1 Q;  3KLW A;  2N49 A;  2JA7 H;  1B70 B;  4A3M H;  1XMQ L;  4U0S A;  3AFP A;  1VQA A;  3PUW A;  4A3G H;  4A3C G;  4PZ8 A;  1BBW A;  2CKZ B;  2Q2H A;  5J3B A;  4LF7 Q;  4LFC Q;  4WJ3 M;  3GTM H;  4R4C A;  2CQO A;  4DR2 L;  3K0X A;  2ZJP A;  3LGJ A;  4LFB L;  4ME3 A;  2AWO A;  2QA4 A;  4HIO A;  4A3I H;  2B3G A;  1N33 Q;  4JYA Q;  4UY8 C;  1N32 Q;  2K14 A;  4R4O A;  3CCS A;  1VQP A;  1Q81 C;  3RR5 A;  4DUZ Q;  2RHS B;  4OWX B;  2A8V A;  1HZ9 A;  5HGQ A;  2JA6 G;  4KHZ A;  1IXR A;  1SN8 A;  1WFQ A;  4B3R L;  1I94 Q;  3CXC A;  4JOI C;  4GNX A;  3KJO A;  4KHP Q;  5LMU Q;  1U5K A;  2KCM A;  1IZ6 A;  2N8N A;  4IPG A;  3UDI A;  1YIT A;  4YHH L;  4JI4 Q;  4M16 A;  4BXX H;  2NZO A;  1W2B A;  4B3S L;  3CMA A;  1WJJ A;  5JJK A;  3RZD H;  2E2H H;  1E22 A;  2Y0S E;  1JE5 A;  5GRO A;  3GTG H;  4R1J A;  5C44 H;  3T1H Q;  1CKO A;  1YBY A;  5IP9 H;  2DUD A;  1LYL A;  2WAQ G;  4XTC S;  1I94 L;  2H5X A;  3S1R H;  3HFZ B;  3UDX A;  4LF6 Q;  3CC2 A;  1PYS B;  2PI2 E;  4HJ5 A;  4JV5 Q;  1UWV A;  2N78 A;  1PH6 A;  2JA6 H;  2VUM H;  2VY3 A;  1K8A C;  3S2D H;  4L5Q A;  4DV2 L;  3M3Y H;  1EWI A;  4JI8 L;  2ES2 A;  3BU2 A;  2RCN A;  1U0L A;  4HJA A;  4YWK A;  2VL6 A;  1KIX A;  5JEA J;  1DGS A;  4JI2 L;  3PIP A;  3HKZ E;  1K3R A;  1SRU A;  2ZTC A;  4QGU A;  1YEZ A;  4YY3 L;  3A5U A;  3G71 A;  4BY7 G;  5M3M G;  2AHO B;  1XTD A;  1NTG A;  4IJH A;  2F4V Q;  2JA7 G;  1JJC B;  3EBE A;  3GTK H;  1TWF H;  4IFD I;  2ZM6 L;  4A3E G;  3M4P A;  5M5Y H;  3RLN A;  2JA5 G;  2NZH A;  1H95 A;  3G48 A;  1VQL A;  1CSQ A;  1RIP A;  3GTP H;  1TXY A;  1OTC A;  3J81 i;  4BA2 I;  1WOC A;  2UXC Q;  1GVP A;  2AMC B;  3JC6 6;  3F2B A;  3ICE A;  4PG3 A;  2OQK A;  1TWA H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...