2VZKB

Structure of the acyl-enzyme complex of an n-terminal nucleophile (ntn) hydrolase, oat2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
213
structure length
213
Chain Sequence
TLLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGEVDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPKARGDQADDALRAAVAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNSEYTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE N-ACETYLTRANSFERASE 2 ALPHA CHAIN
publication title Anatomy of a Simple Acyl Intermediate in Enzyme Catalysis: Combined Biophysical and Modeling Studies on Ornithine Acetyl Transferase.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
total genus 77
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.35: Glutamate N-acetyltransferase.
pdb deposition date 2008-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.340 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2vzkB02
3.30.2330.10 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein suprefamily 2vzkB01
2YEPB 2YEPF 1VRAB 2V4IB 1VZ7A 1VZ8A 3IT6B 1VZ6A 2VZKB 2VZKD 3IT4B
chains in the Genus database with same CATH superfamily
4HCPB 2V4IB 1GNUA 1WZ3A 3ZRFA 2MJ3A 1NENB 4W9JA 2A4ZA 2RDBC 4ANVA 4MM3A 4HK2A 4KDIC 1WGYA 2WQYB 3FKYA 1FM0D 2ZJDA 1WGRA 2AQ3B 2GBJA 1TT5B 3SDLC 4PS3A 3N9YC 2IGHA 1HTQA 2CHWA 1C4AA 2WX0A 3VTWA 4HKZE 3CF6E 5KHOA 1L7YA 4XDCA 4RF0A 1FPYA 3LDZE 3M63B 3NOBA 2QILA 1DOIA 2REXA 4CYEA 1P98A 1RLFA 1K51A 2DZKA 3CSTA 3GE3C 3U30A 2YLMA 3HK0A 2JYTA 3W1SA 1RM6C 1VJKA 2PLPA 2R2OA 3ALBA 1JQ4A 1UZXB 5CHWA 3H7SA 4ZYNA 4BFRA 4ZYSA 4LDTB 2NVUI 1HXYD 4MSQB 4TUUA 4E3CA 3MJWA 4O1NA 3BYYB 4MM3B 1XCTL 3RYTA 2ZVOA 4HRSA 5JXVA 2KDEB 1SSNA 3BIID 1ISNA 2KN4A 4KKIA 1WY8A 3ZJUA 1EM7A 2LUEA 4NJ6A 5C23A 4CHKA 4PYZA 2KJ6A 3DBRB 5BMHA 1KTKA 2FCSA 2N9LA 3APDA 3PT2B 3B9JA 4ICUA 3W5VB 1XLQA 3AE9B 1WRIA 2KAJA 2IY1B 3A9JA 2IGGA 2CU3A 4KGTA 1ZXIA 2W3SA 2Y5BB 2BVCA 2WMHA 2I1KA 3R66C 4GIVA 3QA8A 5CTRC 2D3AA 5D94A 4KKJA 4W9CA 5EE9A 2MBHA 3VVWB 1ZDVA 4I6NB 2KJHB 3AEBB 2HJ1A 1C3TA 2QCZA 1JWBD 1V1PB 2G3QB 2KACA 3R7RA 2KVRA 2INPE 2W3RA 2KFJA 4FXCA 1SE3A 4WAFA 2KK8A 5DPSA 1WGGA 2QC8A 3UF8A 2DZJA 2QHOA 2MSED 3RNCC 2PVGC 1ZXHA 4HPLB 1V8CA 1I4QA 1V5TA 1IGCA 3UIPB 3JW0X 4XZ4A 3BYTB 2N9EB 2KYWA 1C78A 2KN5A 1E8XA 4WQMA 1VZ8A 5AZGA 2XN9C 3ZVVA 2KNBA 5TSSA 3U8ZA 3L54A 4W9FA 1P1AA 1SE9A 3HRDD 1WX7A 4WWOA 3DBLB 2M4NA 4JLCA 1EF5A 3A9JB 3TJPA 4EKUA 2KC2A 3NVWA 4A55A 4QAYA 4N6EB 4JL9A 4BKSA 4AWJA 1E6EB 4YXDB 1HQRD 2ACZB 2JZZA 2JPHA 4EZKA 1LLQA 4EOYA 4WH4A 1F0ZA 1TGZB 1WXAA 2AL6A 2N7EA 1TS5A 1R7SA 3KYCD 2N7DA 2KDMA 4IDIA 1I4PA 2WDTB 5JHAA 1J0GA 2MBBB 4B95A 1WJ4A 3TL5A 3BVGA 2KWUB 1E5WA 1B1ZA 5CX3A 2JU6X 3QX1A 3AH7A 3UIOB 4NZLB 3PHXB 1O0SA 2OOBB 4MGIE 1PGBA 3P4QB 2Y3AA 1GAQB 2XEWA 4GOCA 1YMHE 2JSVX 2LXCA 3GB1A 2MQJA 1L0VB 3RI7C 1VD2A 1L6UA 4GDKB 4ANXA 4IWQA 1WMHA 3AE4B 4EUTA 2BS2B 2NTTA 4MEMA 4AP4C 5JZEB 2JWUA 4MT5A 2K5PA 1KH0A 4EE2A 2FBWB 2RD0A 3EC8A 2KLCA 3RNFC 4YSZB 1WR1A 1Y8RC 2V3PA 4DHZE 3I57A 3VHTC 2GBMA 2KFKB 5H8YE 2PPHA 2ZEQA 2DLBA 3RNGC 3QCAA 5JHBA 4BAXA 1T3QA 3MFGA 5IO9A 5GMVA 3GOEA 3M95A 2UYZB 2Q5WD 4A9AA 2ON8A 1ESFA 1AWDA 4A8XC 2KTFA 3KWLA 3RCZA 4JE3B 2LI5A 3N1XC 4A20A 5J17A 2K8BA 4ASWC 2MHJA 2ZPYA 1JROA 1TS3A 4MACA 4FHJA 1RRBA 3AM9A 2L8JA 1YX6B 4J3OD 1D5MC 1SE2A 3VDZA 3DBRI 2BW2A 4WAAA 1ZW7A 3OJ3A 2KOXA 1S1QB 4YSYB 1VCBA 1SXTA 1E8YA 4IM2A 4KSKC 3WAMA 1YNTE 1GC6A 2MW5A 1LQBA 4LJOB 3U7ZA 2LVOA 4FJYA 2KJRA 2D11A 2RPQA 3LJ3A 1FO4A 3C0RB 5EE3A 2JXXA 1UD7A 3VUWA 1FNWA 3DVGX 4YTMB 3NJTA 4WJPA 2ZCCA 1L4DB 1IBXB 4RGTA 3UI3A 3GS2A 2DZMA 1K8RB 3GP7A 4FJVB 3PVLA 4ZOHC 3DVGY 4DHJD 1G6JA 2NPTB 2LRWA 1IUEA 1WI0A 3IAM1 4IW0A 2IBIB 1HTOA 2EMSA 2PIAA 4D6DA 1JMLA 2XK5A 2FUHB 3LYYA 2ZW0A 1E8ZA 2WWZA 3KW5B 4RF1A 2IDYA 4GN1A 3PHWB 2AQ1B 3ONSA 1C4PA 2OEDA 2RSUA 4DHJB 2WU2B 3N1YC 5H92C 3DBLI 2V3SA 1F9JA 1V86A 5FKAC 3ZDMC 3H9DA 3BINA 4MH8A 2LRUA 1V97A 1V80A 3U52E 4RM9A 3H7PB 3AXCA 1SJED 3RNBC 3TUOA 2WDRB 4I6LB 4HVBA 3ZJVA 3RZWC 2VH2A 1RFAA 1L2NA 2JT4B 4IG7B 1ENFA 1WIAA 2DWQA 1MJDA 2N4FA 3A33B 2Z59B 4BKTA 3ZRCA 3OJ4B 1TYGB 2VRRB 1D5XC 2BGFA 3QIJA 2XK5B 4KX6B 1E10A 3V3XA 1XO3A 5G55A 5CHVC 1J7CA 3Q3NC 3AEFB 2NTSA 5D3IB 4URKA 3BVZA 4WJQA 4H2AA 3AEAB 3N30A 2KZRA 2AL3A 3P4PB 2K22A 4RGOS 1UGJA 1HA5A 1R4NB 1XD3B 2M19A 3A9KB 2INDC 4LJPB 1PGXA 1MG8A 1QILA 2KMAA 3Q8BA 1JALA 4UDUC 2KO3A 1V2YA 4RCOA 5BYQA 1L5PA 5HHDG 1GJZA 3DOWA 3DWGC 2HTME 1AN8A 2CJOA 3W2DA 4BBNC 3Q8EA 1YQBA 3WAOA 1ZGUB 3DDCB 1H4RA 2B3AA 2JXTA 1Z5SB 5LXIB 1OFFA 3RUIB 1YIWA 1STEA 5G5GA 2R61A 4S17A 4HWIB 4A3OA 4RFBA 4OHJA 1WXSA 4ARIA 5IAAC 2MA9B 4KZCA 1TTNA 1WXQA 1XEEA 4BKGA 2AEHA 2N9XA 3V05A 3TEXA 3Q6BA 2K8CA 1OGWA 2JZPA 1JWAD 3FILB 3BWUD 2FE8A 3WIMA 4RM8A 1IPGA 1N6ZA 2KWVB 3EFCA 1ZPSA 2GBNA 5FK9C 3ZYYX 4B0MA 3H1UA 1OTRB 4CQNA 2LGXA 1AW7A 2C5LC 2HJ8A 3ABVB 3B08A 2JF5A 4BVUC 2OJRA 3IBEA 1BMLC 3AV8A 1WZ0A 3PPAA 3DVNV 3AEGB 2BB6A 1NVID 2N7JA 3ZKJC 3KQ4A 2MEKA 1N5WA 1L0XB 2JWZA 2V0GA 1J7BA 3MJ5A 2JX5A 3Q3OC 2QDFA 2XNAC 1UNSA 2KX0A 2DZIA 3E56A 1FFUA 1V5OA 2G4SA 1P7EA 1YOVB 1GOZA 3BK1A 3C19A 4OZCA 2FIFA 4LLGM 1XCQL 3NG0A 4PS8A 2B76B 2C9WB 2FUG1 1EUVB 4GDLB 1LXDA 4PT5A 1MVKA 3DVNU 1R4MB 3FC4A 2MCNB 2Z8LA 4HJKA 1QOGA 5LXHA 1QOFA 2LHDA 2WLBA 2MBEA 5DPWA 2IZVB 2PE9A 3UQAA 3O65B 4PS7A 1KJTA 2JZ3B 1QT9A 1A5RA 2BYTA 4MH0E 1F2RI 3I63C 3HVZA 2KQ7A 3NHEB 1WJUA 4ARCA 1WGDA 3VH4B 1GB1A 2JRHA 1UWMA 4MJSB 4J6IA 2PW9A 3T8MA 1EWCA 4G3XB 1SBBB 1M94A 2Y5CA 4P1BC 3DHIC 2SEBD 3VRAB 4II2B 3Q3MC 2WXJA 5KHQA 4W9GA 4W9LA 1N63A 1V1PA 3PGEA 3NUHB 5D7GA 3N32A 1GG3A 1TS2A 2X8XX 1XF5L 2NBUA 3RD2A 2UU7A 4M02A 2MBOA 2BYFA 2BF8B 3PRMB 1XXGA 2M56B 2CHXA 5DPTA 4G0NB 5AUIA 4GXBA 4RNAA 1WXVA 1D3ZA 3DQVA 1DOXA 3ZTCA 1WE7A 2RMMA 3DBSA 2KTRB 1R4NI 2L83A 1N60A 3IVFA 1TKEA 5BYRA 1JRUA 4OZAA 1D4BA 3ML9A 1HEZE 3HM6X 2KWCA 1XQQA 3ZLZA 1NI2A 1XLPA 1Z2MA 4AJWA 3W9CB 1E7VA 2ZCBA 2LHEA 3PS6A 4JWUC 1QOBA 1C9FA 4D6JA 2D07B 2L05A 3EGRA 3KH0A 3V6CB 2RR9A 5HFYA 5T8IA 2PE6B 4ANUA 4JWSC 1WYWB 2M0AA 4RMAA 2MH7A 2MLBA 1FEHA 3ZNGC 3HIZA 3AE5B 3NZUA 2WMKA 1UWXA 2WMIB 2WYQA 2MJEA 3AE2B 2FNJB 3EFUA 1J7AA 4FLHA 2WXIA 1NDDA 2W82A 4XDDA 2WU5B 4GMVA 2L76A 2MBQA 2IJ0A 4TQ0A 2J0MA 3NS1A 3HUIA 1FNUA 3DBHB 4D6CA 2FCMA 2BTEA 5IP4D 1KOTA 4GDKA 4DXAB 1UBIA 1T0YA 2OHFA 3L4PA 1K50A 2DBYA 5E6JA 3S2AA 4EFOA 1KLVA 4IUMB 3RNEC 1PYWD 3BK2A 3T3OA 1YD8U 3RN9C 1U4AA 2WXGA 3NS8A 3RPFC 3U7DA 3PLUA 1T6BX 3A1QB 3QJZA 3PLVA 2KFKA 1B9RA 3VH3B 1E7PB 1SGHA 3APCA 5G5HA 3IG3A 2KX3A 2J42A 2WDVB 1ZE3D 2DYOA 2KKCA 3OG5A 3L16A 4C4VB 1WJNA 1IGDA 5C1ZA 1WX8A 3ZXVA 1HZ6A 1OQYA 3PZDA 3EECA 1OQQA 1R4MI 4N59A 1MI0A 5HG2A 1XLNA 3ZO5B 2WS3B 4Q2JA 4KZ0A 1M4VA 1SEBD 1QZEA 2O6VD 2KC1A 3L0WB 4NJCA 4X57B 3MC0B 2KVZA 1YN4A 1E8WA 4ZRIA 3JYUA 4NNJB 5FR6A 3E9SA 1TKGA 1I4HA 2KT7A 4BOSC 1T5XD 4FADA 4RH6A 2O6VB 4DDGD 3AU4A 3P4SB 3R2IA 2LGSA 2ZZPB 3NVVA 3WCQA 3WAPA 4ZDVA 2BWFA 1IBXA 3KWVA 3TSSA 1YQ4B 5JH5C 4F8CB 4ZHOA 4WJNA 4US9A 1F2RC 4DXFA 3R3MA 4CO7A 2IO2B 1VZ6A 3L10B 2NPTA 3TEZA 3MP9A 3TEYA 2A5UA 2WXHA 3V60A 1ACCA 1WYGA 3NZ3A 3IHPC 3Q8FA 2E3TA 3QHTA 3ZJTA 4US8A 5BO4B 1WJ6A 1AYFA 2BQQA 1EF1A 2G9HD 3SD5A 4C00A 5GXGB 3PRPB 1KLGD 2CHZA 4FA6A 3ML8A 3VQIA 5D2MB 3KUCB 3DHHC 2GLSA 2N9KA 1CQVA 3H7PA 2KDFB 2ZVNA 1WR6E 4GU2A 1T0SC 2W9NA 4KSLC 2GMIC 1TZ1A 4P7IA 3CSFA 3KLSX 5E6NA 1PUTA 3EUB2 2WXRA 2IYDB 4WJOA 1P0RA 4W9EA 4USAA 4LNFA 3KUZA 2EMTA 4AQ7A 4XX5A 2LXAA 2KHWB 3OAWA 2KQSA 1UGMA 2VH1A 1WM2A 2LMCA 1KFYB 4IKGA 3V61A 1VLBA 5D3DA 5C3JB 2J7QB 1ET6A 3T9LA 2PTLA 1P3QU 1WM3A 2AX5A 3UQBA 1ZDXA 3ENEA 4LCDE 3EHVA 2V4LA 3DBHI 3ZGZA 1EU4A 4DHZB 1TZOA 1K53A 2L7RA 2D10A 3SEBA 1WH3A 3A4SC 1JWSD 3NY5A 3BVMA 4K81A 3V6EB 4ACFA 4L2YA 1DYQA 2N0SB 3A9KA 4PK1A 2H88B 4KDLB 2IY0B 2IO3B 4I6PA 2E6XA 5E6PA 3AI5A 2LWPA 1YX5B 1RWSA 4F7ZA 1TY0A 1RYJA 2I2YA 2PJHA 1CK1A 4EZJA 2PMVA 1FMAD 4ZRQA 1MFWA 2Z0DB 4HPPA 4K7SA 2K1FA 2WXLA 2O2VB 4D71A 2LVPA 4KV2A 4MELA 2IO1B 3ZUNA 2GOWA 4A90A 4KIKA 4D6GA 3VTVA 4IC7B 4YTNB 1QF6A 4W9KA 2WXKA 4LNKA 2BKRB 3PZ8A 3KYDD 1FCCC 3SR6A 1J8CA 3FILA 2L0FA 2QSDA 3PO0A 1JWUD 1FXIA 1SE4A 5J18A 2I38A 3B1LX 5LNK1 2IGDA 3VFKA 1QQRA 4GLSC 2WP9B 2G4DB 5MPOA 2DENB 1NBFC 4IOIE 1FNVA 4OVUA 1MHHE 5HKHA 4XWTA 3QARA 2KDIA 4F1SA 3AE3B 4HLEA 3TCAA 1UBQA 3TIXA 3PSEB 2EKEC 4LNNA 3L13A 4DXGA 3R8BA 3A4RA 4AS1A 4KIKB 1MG4A 1Q1OA 1SB3C 3PREA 1F77A 4IM3A 2WXFA 1I7HA 1KLUD 2K6DB 1WXMA 2G1EA 2QMTA 2L52A 1KRHA 3SFEB 1C76A 1TS4A 4D6IA 3AE8B 1EU3A 4NAWA 4REZA 3U2SC 2KXJA 2M1MA 2K39A 4GDLA 3H8HA 3RNAC 4GB9A 3GZNB 4OW0A 4YL8A 2FIDA 1N61A 2BS4B 4RGNA 4B0EA 1ZOYB 3ZNID 1Q0WB 3C8YA 3QK0A 3QWZB 1RFKA 4MGZE 1CJEA 4DWFA 1CZPA 2AYOB 1OEYJ 4MGYE 4YTPB 2IPKD 2Z0EB 3NRZA 4AJYB 4BBNF 4JQWC 3JSVA 1WGKA 1MHXA 1QKZA 1F52A 3TMPB 4MJSA 1S3SG 3N20C 4II3B 2MWSB 2D3CA 5LLIA 1PGAA 2KWDA 1IP9A 1AARA 3UGBB 1I35A 4ZRKA 2BWES 3ZDTA 1V9JA 1X1MA 5IKCM 4IWOA 4NAWB 3AEDB 3CMMB 2GB1A 3M62B 2YEPB 4B6WA 1SJHD 2DHZA 2LGIA 2BYVE 1F1HA 2ZW1A 1T0QC 4KGRA 4LNIA 2DX5B 4W9DA 1WX9A 4BOZB 2WNMA 4LK0M 4HEA1 1I42A 2W54A 4MSMB 3ZXRA 4KVGB 1BXTA 2MJDA 1V6EA 2KD0A 4OZBA 2BB5A 2L00B 1ZP0B 4WURA 3ZIMA 2KTRA 4TSSA 1YN5A 3R7QA 2ICIA 3JSVB 2BT6A 3WA0A 4P16A 3HHMA 3Q3FA 1FXTB 3JVZX 3ZTDA 2WXOA 4HDQA 4NAMA 1ZUD2 2C7NB 2JYEA 3I9V1 1L4ZB 4C7ZA 5IOIA 2DAJA 4L1BA 4LDTD 4C7YA 4E71A 2BYEA 4P6VF 1WE6A 2D5GA 3AN1A 4P1CC 3HVDA 1T0RC 3RULA 3Q8CA 1SIJA 1WRDB 2L3ZA 2WDQB 1IYFA 2K3UA 4L23A 2WMIA 1OEYA 1KM7A 3RT3B 2XBBC 2LUMA 4TV3A 3CIRB 2LJIA 2FCQA 3BY4B 4M8NA 2KLGA 3PV1A 1CMXB 1UELA 4K3BA 1I4RA 3MTNB 4GSWA 1E90A 3B2FA 3AU5A 1FIQA 2FAZA 1LO5D 3Q14C 2UWQA 3NZSA 2WX1A 1VDVA 4HKQA 2ZPNA 2LGDA 4JIOU 4NPNA 4FN2A 2WMJA 2LD9A 3IFWB 4OVVA 3IT4B 1XT9B 3A1QA 1E9MA 1YN3A 4MDKE 4TKNA 3ZNZB 1VRAB 2EKIA 4XWWA 2LGYA 1C4CA 3P2BA 2D2QA 1GB4A 2J0JA 3P4RB 1JWMD 4DK5A 3LB8C 2D3GA 2K6QA 2D3BA 4C4VA 1EO6A 4E74A 3AE6B 1I4GA 2WXQA 3R2TA 4R3DA 3PZ7A 4GGQA 3Q2AC 5DCNA 2CKHB 3AMZA 4D6HA 3P42A 2DYBA 2CJNA 5CHFA 3FAHA 4A3PA 2GI9A 3GZNI 2INCC 2M8SA 3PRZA 4YSXB 2HDEA 1OQRA 3VR8B 3KVFB 1ZKHA 2NS5A 1L0YB 1N5XA 1E0ZA 1TY2A 2J4XA 2L32A 3W5UB 2H89B 1N62A 2M0XA 4FJZA 2K8HA 5BMGA 2RDGA 1NYRA 3DWMA 2IO0B 2V3NA 2KQ4X 4ZRJA 3P1MA 2O6VA 4WQOB 4HDOA 1JRPA 2LASA 2PKOA 1ET9A 4D6EA 4JPSA 5J2RA 4BZAA 2ONQA 4DDID 2BKFA 3RFZB 4XE0A 1TBEA 5EE1A 1YJIA 3K9PB 2JRIB 1RAXA 1QOAA 4XC2A 1WGHA 2K9XA 2MRPA 1V49A 3LXFA 4D6FA 3N3KB 4NQLB 3MHZA 2Y5PA 4D2KA 2JUOA 4BKSD 4WWNA 1V1OA 1YQ3B 3AE7B 3W1YA 4OVZA 2JQRB 4XGAB 2WMGA 1Y56A 1PFDA 5G2NA 1BUIC 2I1JA 3X0WA 1FRDA 2G45B 3I3TB 2N1WA 1K52A 2BBCA 4LNOA 4M00A 2YVCA 2NR2A 2C7MB 3MC9A 2LEKA 3Q8AA 3DHGC 3GE8C 5IA7A 2KANA 3D32A 3ECIA 4HXDA 1KF6B 2PEAA 3RZFA 5I4DA 4S0RA 1H8CA 1D6EC 5FR3A 3APFA 4ZRPA 1FRRA 3L17A 2V9HA 4FULA 2QEJC 2DNFA 2TSSA 3MHSD 4NJ7A 5AUKA 2QIEB 3VRBB 3MC8A 4TQ1A 2L0TA 2WXNA 4C56C 2CR5A 4B9KA 1DOYA 2ASQA 2WHIA 2SAKA 4WIPA 1SIFA 2KMMA 4K7UA 4W9HA 1JCKB 2QJLA 5BMIA 3Q3JA 3DCGA 4YWGG 5AZFA 1XLOA 4G50A 1WMHB 2GBRA 3AE1B 4MGKE 4K1RB 3IT6B 4WWPA 2AQ2B 3URYA 1JW9D 3PTFC 3SFDB 4HROA 2JY6A 4KGSA 4IM0A 2CS4A 2NBWB 2RPVA 1QLBB 1WWTA 4W9IA 1E7UA 1D5ZC 2GRIA 2K25A 2W55A 2J53A 3TEWA 1WF9A 1UUPA 2PVOD 4N58A 5L83A 1FD6A 1NI3A 2O2VA 2R2QA 3QQ8B 3HM3A 3VXWA 4NQKE 2DYMA 1PDXA 4FBJB 4JGHB 3KUDB 1Q10A 1MPEA 1WSPA 4C80A 1C77A 3K9OB 1FCLA 2BPSA 2CU1A 2NBVB 4PYUA 2KMCA 3OLMD 4JX1C 2JVCA 3VUYA 3SU8X 2AWTA 3B2GA 4WWMA 3I5JC 1C1YB 1YJ1A 1P7FA 3QAQA 3ZNHB 3OWEB 4IWPA 2N1VA 1VR9A 3WALA 2ZNVC 3AULA 3UINB 1HE8A 3X23A 4A6QA 1I4XA 1EWYC 4LTUA 1TKYA 1ROEA 4AOFA 1GC7A 3L08A 2DAFA 2N9PC 3DPDA 4D72A 2X38A 4AUQC 1GPXA 2MP2A 2J52A 3IXSA 4EEWA 1Q5WB 4HCNB 3H6NA 1L6VA 2WGSA 4K3CA 2J0KA 2HD5B 3AB5A 5L95C 1YJJA 5C2TB 2NCNA 1C79A 3CWIA 2RDHA 3U4EG 1LFDA 4RGMA 5EE0A 3SHQA 1A70A 2M17A 2LFIA 4HJGE 3NVYA 2C7HA 2VZKD 3TBLD 1FXAA 4TMAB 3QC8B 2BS3B 4NY0A 3B0AA 3NVZA 4N9F4 1UH6A 1V81A 5TR5A 2NMQA 5EDSA 4FHKA 2INNE 1HZ5A 3IAS1 2RGFA 5AZHA 3V62A 2VZKB 3RMKC 2WXMA 2LZ6A 2LJ5A 1SF0A 2FCNA 3M3JA 3T3NA 2MP2B 3VTUA 5AEKB 1J19A 3VUXA 4DBGA 3AEEB 4M0WA 1FFVA 1LGRA 2L1AA 2MX2A 2WMFA 3P63A 1NYQA 3J9CA 3ETRA 1DGJA 5D6JB 2ZNVB 1GUAB 2K0PA 3VR9B 2C60A 3BZDB 2EELA 2HTHA 1VZ7A 1NEKB 4HPMB 1WFYA 4ANWA 3EA6A 5DPRA 2YEPF 2GBKA 1BT0A 4YT0B 3N1ZC 4EZLA 5IN7A 1LM8B 3ZQ4A 3O13A 2HE7A 4XYCA 4ICVA 1PQSA 3WANA 3VAWA 2LVQA 1UF0A 3ZW3A 4ITKA 4DQOC 2KDBA 1TJEA 5BYSA 4M8MA 4M0WB 2V1YA 2OJWA 1P9DU 4K7WA 4ZHPA 1TIFA 3AECB 4M01A 5HI1A 3Q69A 4G11A 2WXPA 3W1SC 5E6OA
chains in the Genus database with same CATH topology
3V3XA 1XO3A 3TEZA 3MP9A 2V4IB 3TEYA 3AE6B 1I4GA 2WXQA 3R2TA 4R3DA 3PZ7A 2WXHA 1J7CA 1ACCA 1NENB 2MJ3A 1WYGA 3NZ3A 3AEFB 3Q8FA 2NTSA 5D3IB 2E3TA 3ZJTA 3BVZA 3AMZA 3P42A 4US8A 2CJNA 1AYFA 2WQYB 4H2AA 3AEAB 3FAHA 1FM0D 2G9HD 2GI9A 2AQ3B 3P4PB 5GXGB 4YSXB 2K22A 4RGOS 2HDEA 1OQRA 1KLGD 1UGJA 1HA5A 3VR8B 3N9YC 2IGHA 2M19A 1L0YB 1N5XA 3VQIA 1E0ZA 1TY2A 1C4AA 2J4XA 2N9KA 1CQVA 2L32A 4HKZE 3W5UB 4XDCA 1PGXA 2H89B 4RF0A 1N62A 1QILA 2QILA 3Q8BA 1JALA 4UDUC 5BMGA 2RDGA 1DOIA 1NYRA 3DWMA 5BYQA 4RCOA 1K51A 1L5PA 3KLSX 5HHDG 1PUTA 3EUB2 2V3NA 2WXRA 2KQ4X 3DWGC 2HTME 3P1MA 2JYTA 1AN8A 2CJOA 3W1SA 1RM6C 3W2DA 1VJKA 2PLPA 3Q8EA 1JQ4A 4USAA 1JRPA 2PKOA 1ET9A 4JPSA 2ONQA 4AQ7A 2JXTA 3RFZB 4XE0A 1OFFA 5EE1A 4ZYSA 1YJIA 1HXYD 2LMCA 1KFYB 1STEA 4IKGA 5G5GA 2R61A 1QOAA 4RFBA 1VLBA 2K9XA 5D3DA 4O1NA 4OHJA 4ARIA 3BYYB 5C3JB 3LXFA 4MM3B 1XCTL 3MHZA 1ET6A 4HRSA 5JXVA 2Y5PA 2PTLA 4D2KA 1SSNA 1WXQA 1XEEA 3BIID 3V05A 2KN4A 2AX5A 4KKIA 3TEXA 1ZDXA 3ZJUA 1EM7A 1V1OA 1YQ3B 3AE7B 2JZPA 1JWAD 3FILB 3BWUD 4OVZA 2FE8A 2JQRB 3ZGZA 1Y56A 1EU4A 1PFDA 1TZOA 1ZPSA 1K53A 1BUIC 5BMHA 5FK9C 1KTKA 3SEBA 2N9LA 1FRDA 3ZYYX 4B0MA 1K52A 2BBCA 4CQNA 1JWSD 1AW7A 3B9JA 3W5VB 1XLQA 3AE9B 1WRIA 2KAJA 3BVMA 2LEKA 4L2YA 1DYQA 2N0SB 3ABVB 2H88B 3Q8AA 2IGGA 2CU3A 1BMLC 4KGTA 3AV8A 1ZXIA 2W3SA 2E6XA 3AEGB 2BB6A 1NVID 2N7JA 1KF6B 5I4DA 1RWSA 4KKJA 3KQ4A 2MEKA 1N5WA 5EE9A 1D6EC 1L0XB 5FR3A 1ZDVA 1TY0A 1RYJA 3AEBB 2I2YA 1CK1A 4ZRPA 2V0GA 1J7BA 2JX5A 2PMVA 1FRRA 1FMAD 1JWBD 1V1PB 2KACA 3MJ5A 4ZRQA 2INPE 2W3RA 4FXCA 1SE3A 4WAFA 2QEJC 2XNAC 2WXLA 1UNSA 3E56A 1FFUA 2TSSA 2PVGC 5AUKA 1P7EA 1ZXHA 2QIEB 1GOZA 4TQ1A 3VRBB 3BK1A 2WXNA 4C56C 1V8CA 1I4QA 1IGCA 1DOYA 4OZCA 4A90A 4LLGM 1XCQL 3BYTB 2SAKA 4WIPA 1C78A 2KMMA 4YTNB 1QF6A 4WQMA 2B76B 1JCKB 2WXKA 1VZ8A 2XN9C 2FUG1 2QJLA 3PZ8A 5TSSA 4GDLB 4PT5A 5BMIA 1FCCC 1MVKA 3SR6A 3FC4A 3HRDD 3FILA 4YWGG 2Z8LA 2QSDA 1XLOA 3PO0A 1JWUD 1QOGA 1FXIA 1QOFA 2LHDA 1SE4A 2WLBA 3AE1B 2I38A 5LNK1 2IGDA 1QQRA 4GLSC 2WP9B 3IT6B 3NVWA 4A55A 5MPOA 2AQ2B 4N6EB 3URYA 1JW9D 1E6EB 4YXDB 1HQRD 1QT9A 4IOIE 2BYTA 1FNVA 2ACZB 1MHHE 4XWTA 3SFDB 1F2RI 4HROA 3HVZA 4WH4A 4KGSA 1F0ZA 3AE3B 4ARCA 2RPVA 1QLBB 1TS5A 1WWTA 1GB1A 1R7SA 1UWMA 2KDMA 1D5ZC 4IDIA 1I4PA 2PW9A 1EWCA 1SBBB 2Y5CA 2SEBD 3VRAB 2GRIA 2WXJA 4DXGA 1N63A 1V1PA 3R8BA 2W55A 4AS1A 3BVGA 2J53A 3TEWA 1UUPA 2PVOD 1B1ZA 1SB3C 3NUHB 5D7GA 1F77A 4N58A 2JU6X 2WXFA 1FD6A 3AH7A 1I7HA 1NI3A 4NZLB 1TS2A 1XF5L 1KLUD 1PGBA 2G1EA 2QMTA 2DYMA 3P4QB 2L52A 1KRHA 2Y3AA 1GAQB 1PDXA 3SFEB 1C76A 1TS4A 1XXGA 1Q10A 1YMHE 3AE8B 2M56B 1MPEA 1EU3A 1WSPA 1C77A 4REZA 2JSVX 3U2SC 4C80A 1FCLA 3GB1A 5AUIA 1L0VB 4RNAA 1L6UA 1DOXA 2RMMA 3H8HA 4OW0A 4GDKB 4JX1C 3B2GA 3AE4B 1N61A 2BS4B 2BS2B 2NTTA 4RGNA 4WWMA 2L83A 4B0EA 1ZOYB 1N60A 1TKEA 2JWUA 2K5PA 1KH0A 3C8YA 4MT5A 5BYRA 4EE2A 1P7FA 2FBWB 4OZAA 1D4BA 1HEZE 3OWEB 1RFKA 1CJEA 1VR9A 1CZPA 4YSZB 1XLPA 2V3PA 4YTPB 2IPKD 3NRZA 3W9CB 3I57A 5H8YE 1WGKA 2LHEA 4JWUC 4A6QA 1I4XA 1MHXA 1QOBA 1QKZA 2DLBA 1C9FA 1EWYC 1T3QA 3EGRA 4LTUA 3MFGA 1PGAA 2KWDA 1TKYA 1ROEA 5HFYA 5T8IA 2Q5WD 4JWSC 2M0AA 4A9AA 2MH7A 1ESFA 2ON8A 1AWDA 2X38A 1FEHA 3AEDB 4NAWB 4A8XC 3AE5B 3KWLA 1UWXA 1GPXA 2GB1A 2MJEA 4JE3B 2J52A 2YEPB 3AE2B 3IXSA 1J7AA 1SJHD 2LGIA 1JROA 1TS3A 2ZW1A 4MACA 2WXIA 1L6VA 2W82A 4KGRA 2WU5B 4XDDA 3AM9A 2IJ0A 2WNMA 1D5MC 1SE2A 3AB5A 4HEA1 4J3OD 4LK0M 1YJJA 4TQ0A 2W54A 5C2TB 3NS1A 3HUIA 2BW2A 1C79A 1FNUA 1BXTA 2MJDA 4OZBA 3CWIA 2RDHA 2BB5A 4YSYB 3U4EG 1SXTA 2BTEA 1ZP0B 4WURA 1YNTE 4RGMA 5EE0A 2OHFA 3L4PA 1K50A 2DBYA 5E6JA 1A70A 4TSSA 1YN5A 2LFIA 4HJGE 3NVYA 3U7ZA 2VZKD 2ICIA 1FXAA 4TMAB 1PYWD 2BS3B 2BT6A 3BK2A 1FO4A 3NVZA 3T3OA 4P16A 2WXGA 3RPFC 2NMQA 1T6BX 2WXOA 5EE3A 2INNE 1FNWA 1HZ5A 4NAMA 1ZUD2 2JYEA 4YTMB 3I9V1 3IAS1 1L4ZB 4C7ZA 1B9RA 1L4DB 1IBXB 2VZKB 4L1BA 2WXMA 1E7PB 4RGTA 4C7YA 3UI3A 3GS2A 1SF0A 5G5HA 4P6VF 3T3NA 2D5GA 3AN1A 3GP7A 2J42A 2WDVB 3HVDA 1ZE3D 2DYOA 4ZOHC 3AEEB 4M0WA 1IUEA 3IAM1 1FFVA 3Q8CA 1SIJA 2L1AA 1IGDA 2WDQB 2K3UA 4L23A 2PIAA 1JMLA 1HZ6A 3P63A 1NYQA 2LUMA 3J9CA 3LYYA 3ETRA 1DGJA 2ZW0A 3CIRB 2LJIA 4RF1A 2IDYA 2K0PA 2AQ1B 1OQQA 3VR9B 1C4PA 2OEDA 3BZDB 2EELA 1I4RA 4N59A 2WU2B 5H92C 3B2FA 1VZ7A 1NEKB 1FIQA 1MI0A 1LO5D 5FKAC 5HG2A 1XLNA 3EA6A 4MH8A 1VDVA 2YEPF 2WS3B 4Q2JA 4HKQA 1M4VA 1SEBD 1V97A 4NJCA 4YT0B 3U52E 3MC0B 1YN4A 1SJED 3TUOA 3ZQ4A 2WDRB 3O13A 3E9SA 1TKGA 3ZJVA 1I4HA 1T5XD 3IT4B 4ITKA 4RH6A 4DQOC 1E9MA 1ENFA 1YN3A 3P4SB 3R2IA 3NVVA 2DWQA 3WCQA 1TJEA 1VRAB 2EKIA 5BYSA 4XWWA 1IBXA 3KWVA 1C4CA 3TSSA 1YQ4B 1GB4A 4ZHOA 3P4RB 4ZHPA 1JWMD 3AECB 1TYGB 4US9A 1F2RC 4DXFA 5HI1A 1D5XC 3LB8C 4KX6B 1E10A 1VZ6A 3Q69A 2WXPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YEP B;  2YEP F;  1VRA B;  2V4I B;  1VZ7 A;  1VZ8 A;  3IT6 B;  1VZ6 A;  2VZK B;  2VZK D;  3IT4 B; 
#chains in the Genus database with same CATH topology
 4HCP B;  2V4I B;  1GNU A;  1WZ3 A;  3ZRF A;  2MJ3 A;  1NEN B;  4W9J A;  2A4Z A;  2RDB C;  4ANV A;  4MM3 A;  4HK2 A;  4KDI C;  1WGY A;  2WQY B;  3FKY A;  1FM0 D;  2ZJD A;  1WGR A;  2AQ3 B;  2GBJ A;  1TT5 B;  3SDL C;  4PS3 A;  3N9Y C;  2IGH A;  1HTQ A;  2CHW A;  1C4A A;  2WX0 A;  3VTW A;  4HKZ E;  3CF6 E;  5KHO A;  1L7Y A;  4XDC A;  4RF0 A;  1FPY A;  3LDZ E;  3M63 B;  3NOB A;  2QIL A;  1DOI A;  2REX A;  4CYE A;  1P98 A;  1RLF A;  1K51 A;  2DZK A;  3CST A;  3GE3 C;  3U30 A;  2YLM A;  3HK0 A;  2JYT A;  3W1S A;  1RM6 C;  1VJK A;  2PLP A;  2R2O A;  3ALB A;  1JQ4 A;  1UZX B;  5CHW A;  3H7S A;  4ZYN A;  4BFR A;  4ZYS A;  4LDT B;  2NVU I;  1HXY D;  4MSQ B;  4TUU A;  4E3C A;  3MJW A;  4O1N A;  3BYY B;  4MM3 B;  1XCT L;  3RYT A;  2ZVO A;  4HRS A;  5JXV A;  2KDE B;  1SSN A;  3BII D;  1ISN A;  2KN4 A;  4KKI A;  1WY8 A;  3ZJU A;  1EM7 A;  2LUE A;  4NJ6 A;  5C23 A;  4CHK A;  4PYZ A;  2KJ6 A;  3DBR B;  5BMH A;  1KTK A;  2FCS A;  2N9L A;  3APD A;  3PT2 B;  3B9J A;  4ICU A;  3W5V B;  1XLQ A;  3AE9 B;  1WRI A;  2KAJ A;  2IY1 B;  3A9J A;  2IGG A;  2CU3 A;  4KGT A;  1ZXI A;  2W3S A;  2Y5B B;  2BVC A;  2WMH A;  2I1K A;  3R66 C;  4GIV A;  3QA8 A;  5CTR C;  2D3A A;  5D94 A;  4KKJ A;  4W9C A;  5EE9 A;  2MBH A;  3VVW B;  1ZDV A;  4I6N B;  2KJH B;  3AEB B;  2HJ1 A;  1C3T A;  2QCZ A;  1JWB D;  1V1P B;  2G3Q B;  2KAC A;  3R7R A;  2KVR A;  2INP E;  2W3R A;  2KFJ A;  4FXC A;  1SE3 A;  4WAF A;  2KK8 A;  5DPS A;  1WGG A;  2QC8 A;  3UF8 A;  2DZJ A;  2QHO A;  2MSE D;  3RNC C;  2PVG C;  1ZXH A;  4HPL B;  1V8C A;  1I4Q A;  1V5T A;  1IGC A;  3UIP B;  3JW0 X;  4XZ4 A;  3BYT B;  2N9E B;  2KYW A;  1C78 A;  2KN5 A;  1E8X A;  4WQM A;  1VZ8 A;  5AZG A;  2XN9 C;  3ZVV A;  2KNB A;  5TSS A;  3U8Z A;  3L54 A;  4W9F A;  1P1A A;  1SE9 A;  3HRD D;  1WX7 A;  4WWO A;  3DBL B;  2M4N A;  4JLC A;  1EF5 A;  3A9J B;  3TJP A;  4EKU A;  2KC2 A;  3NVW A;  4A55 A;  4QAY A;  4N6E B;  4JL9 A;  4BKS A;  4AWJ A;  1E6E B;  4YXD B;  1HQR D;  2ACZ B;  2JZZ A;  2JPH A;  4EZK A;  1LLQ A;  4EOY A;  4WH4 A;  1F0Z A;  1TGZ B;  1WXA A;  2AL6 A;  2N7E A;  1TS5 A;  1R7S A;  3KYC D;  2N7D A;  2KDM A;  4IDI A;  1I4P A;  2WDT B;  5JHA A;  1J0G A;  2MBB B;  4B95 A;  1WJ4 A;  3TL5 A;  3BVG A;  2KWU B;  1E5W A;  1B1Z A;  5CX3 A;  2JU6 X;  3QX1 A;  3AH7 A;  3UIO B;  4NZL B;  3PHX B;  1O0S A;  2OOB B;  4MGI E;  1PGB A;  3P4Q B;  2Y3A A;  1GAQ B;  2XEW A;  4GOC A;  1YMH E;  2JSV X;  2LXC A;  3GB1 A;  2MQJ A;  1L0V B;  3RI7 C;  1VD2 A;  1L6U A;  4GDK B;  4ANX A;  4IWQ A;  1WMH A;  3AE4 B;  4EUT A;  2BS2 B;  2NTT A;  4MEM A;  4AP4 C;  5JZE B;  2JWU A;  4MT5 A;  2K5P A;  1KH0 A;  4EE2 A;  2FBW B;  2RD0 A;  3EC8 A;  2KLC A;  3RNF C;  4YSZ B;  1WR1 A;  1Y8R C;  2V3P A;  4DHZ E;  3I57 A;  3VHT C;  2GBM A;  2KFK B;  5H8Y E;  2PPH A;  2ZEQ A;  2DLB A;  3RNG C;  3QCA A;  5JHB A;  4BAX A;  1T3Q A;  3MFG A;  5IO9 A;  5GMV A;  3GOE A;  3M95 A;  2UYZ B;  2Q5W D;  4A9A A;  2ON8 A;  1ESF A;  1AWD A;  4A8X C;  2KTF A;  3KWL A;  3RCZ A;  4JE3 B;  2LI5 A;  3N1X C;  4A20 A;  5J17 A;  2K8B A;  4ASW C;  2MHJ A;  2ZPY A;  1JRO A;  1TS3 A;  4MAC A;  4FHJ A;  1RRB A;  3AM9 A;  2L8J A;  1YX6 B;  4J3O D;  1D5M C;  1SE2 A;  3VDZ A;  3DBR I;  2BW2 A;  4WAA A;  1ZW7 A;  3OJ3 A;  2KOX A;  1S1Q B;  4YSY B;  1VCB A;  1SXT A;  1E8Y A;  4IM2 A;  4KSK C;  3WAM A;  1YNT E;  1GC6 A;  2MW5 A;  1LQB A;  4LJO B;  3U7Z A;  2LVO A;  4FJY A;  2KJR A;  2D11 A;  2RPQ A;  3LJ3 A;  1FO4 A;  3C0R B;  5EE3 A;  2JXX A;  1UD7 A;  3VUW A;  1FNW A;  3DVG X;  4YTM B;  3NJT A;  4WJP A;  2ZCC A;  1L4D B;  1IBX B;  4RGT A;  3UI3 A;  3GS2 A;  2DZM A;  1K8R B;  3GP7 A;  4FJV B;  3PVL A;  4ZOH C;  3DVG Y;  4DHJ D;  1G6J A;  2NPT B;  2LRW A;  1IUE A;  1WI0 A;  3IAM 1;  4IW0 A;  2IBI B;  1HTO A;  2EMS A;  2PIA A;  4D6D A;  1JML A;  2XK5 A;  2FUH B;  3LYY A;  2ZW0 A;  1E8Z A;  2WWZ A;  3KW5 B;  4RF1 A;  2IDY A;  4GN1 A;  3PHW B;  2AQ1 B;  3ONS A;  1C4P A;  2OED A;  2RSU A;  4DHJ B;  2WU2 B;  3N1Y C;  5H92 C;  3DBL I;  2V3S A;  1F9J A;  1V86 A;  5FKA C;  3ZDM C;  3H9D A;  3BIN A;  4MH8 A;  2LRU A;  1V97 A;  1V80 A;  3U52 E;  4RM9 A;  3H7P B;  3AXC A;  1SJE D;  3RNB C;  3TUO A;  2WDR B;  4I6L B;  4HVB A;  3ZJV A;  3RZW C;  2VH2 A;  1RFA A;  1L2N A;  2JT4 B;  4IG7 B;  1ENF A;  1WIA A;  2DWQ A;  1MJD A;  2N4F A;  3A33 B;  2Z59 B;  4BKT A;  3ZRC A;  3OJ4 B;  1TYG B;  2VRR B;  1D5X C;  2BGF A;  3QIJ A;  2XK5 B;  4KX6 B;  1E10 A;  3V3X A;  1XO3 A;  5G55 A;  5CHV C;  1J7C A;  3Q3N C;  3AEF B;  2NTS A;  5D3I B;  4URK A;  3BVZ A;  4WJQ A;  4H2A A;  3AEA B;  3N30 A;  2KZR A;  2AL3 A;  3P4P B;  2K22 A;  4RGO S;  1UGJ A;  1HA5 A;  1R4N B;  1XD3 B;  2M19 A;  3A9K B;  2IND C;  4LJP B;  1PGX A;  1MG8 A;  1QIL A;  2KMA A;  3Q8B A;  1JAL A;  4UDU C;  2KO3 A;  1V2Y A;  4RCO A;  5BYQ A;  1L5P A;  5HHD G;  1GJZ A;  3DOW A;  3DWG C;  2HTM E;  1AN8 A;  2CJO A;  3W2D A;  4BBN C;  3Q8E A;  1YQB A;  3WAO A;  1ZGU B;  3DDC B;  1H4R A;  2B3A A;  2JXT A;  1Z5S B;  5LXI B;  1OFF A;  3RUI B;  1YIW A;  1STE A;  5G5G A;  2R61 A;  4S17 A;  4HWI B;  4A3O A;  4RFB A;  4OHJ A;  1WXS A;  4ARI A;  5IAA C;  2MA9 B;  4KZC A;  1TTN A;  1WXQ A;  1XEE A;  4BKG A;  2AEH A;  2N9X A;  3V05 A;  3TEX A;  3Q6B A;  2K8C A;  1OGW A;  2JZP A;  1JWA D;  3FIL B;  3BWU D;  2FE8 A;  3WIM A;  4RM8 A;  1IPG A;  1N6Z A;  2KWV B;  3EFC A;  1ZPS A;  2GBN A;  5FK9 C;  3ZYY X;  4B0M A;  3H1U A;  1OTR B;  4CQN A;  2LGX A;  1AW7 A;  2C5L C;  2HJ8 A;  3ABV B;  3B08 A;  2JF5 A;  4BVU C;  2OJR A;  3IBE A;  1BML C;  3AV8 A;  1WZ0 A;  3PPA A;  3DVN V;  3AEG B;  2BB6 A;  1NVI D;  2N7J A;  3ZKJ C;  3KQ4 A;  2MEK A;  1N5W A;  1L0X B;  2JWZ A;  2V0G A;  1J7B A;  3MJ5 A;  2JX5 A;  3Q3O C;  2QDF A;  2XNA C;  1UNS A;  2KX0 A;  2DZI A;  3E56 A;  1FFU A;  1V5O A;  2G4S A;  1P7E A;  1YOV B;  1GOZ A;  3BK1 A;  3C19 A;  4OZC A;  2FIF A;  4LLG M;  1XCQ L;  3NG0 A;  4PS8 A;  2B76 B;  2C9W B;  2FUG 1;  1EUV B;  4GDL B;  1LXD A;  4PT5 A;  1MVK A;  3DVN U;  1R4M B;  3FC4 A;  2MCN B;  2Z8L A;  4HJK A;  1QOG A;  5LXH A;  1QOF A;  2LHD A;  2WLB A;  2MBE A;  5DPW A;  2IZV B;  2PE9 A;  3UQA A;  3O65 B;  4PS7 A;  1KJT A;  2JZ3 B;  1QT9 A;  1A5R A;  2BYT A;  4MH0 E;  1F2R I;  3I63 C;  3HVZ A;  2KQ7 A;  3NHE B;  1WJU A;  4ARC A;  1WGD A;  3VH4 B;  1GB1 A;  2JRH A;  1UWM A;  4MJS B;  4J6I A;  2PW9 A;  3T8M A;  1EWC A;  4G3X B;  1SBB B;  1M94 A;  2Y5C A;  4P1B C;  3DHI C;  2SEB D;  3VRA B;  4II2 B;  3Q3M C;  2WXJ A;  5KHQ A;  4W9G A;  4W9L A;  1N63 A;  1V1P A;  3PGE A;  3NUH B;  5D7G A;  3N32 A;  1GG3 A;  1TS2 A;  2X8X X;  1XF5 L;  2NBU A;  3RD2 A;  2UU7 A;  4M02 A;  2MBO A;  2BYF A;  2BF8 B;  3PRM B;  1XXG A;  2M56 B;  2CHX A;  5DPT A;  4G0N B;  5AUI A;  4GXB A;  4RNA A;  1WXV A;  1D3Z A;  3DQV A;  1DOX A;  3ZTC A;  1WE7 A;  2RMM A;  3DBS A;  2KTR B;  1R4N I;  2L83 A;  1N60 A;  3IVF A;  1TKE A;  5BYR A;  1JRU A;  4OZA A;  1D4B A;  3ML9 A;  1HEZ E;  3HM6 X;  2KWC A;  1XQQ A;  3ZLZ A;  1NI2 A;  1XLP A;  1Z2M A;  4AJW A;  3W9C B;  1E7V A;  2ZCB A;  2LHE A;  3PS6 A;  4JWU C;  1QOB A;  1C9F A;  4D6J A;  2D07 B;  2L05 A;  3EGR A;  3KH0 A;  3V6C B;  2RR9 A;  5HFY A;  5T8I A;  2PE6 B;  4ANU A;  4JWS C;  1WYW B;  2M0A A;  4RMA A;  2MH7 A;  2MLB A;  1FEH A;  3ZNG C;  3HIZ A;  3AE5 B;  3NZU A;  2WMK A;  1UWX A;  2WMI B;  2WYQ A;  2MJE A;  3AE2 B;  2FNJ B;  3EFU A;  1J7A A;  4FLH A;  2WXI A;  1NDD A;  2W82 A;  4XDD A;  2WU5 B;  4GMV A;  2L76 A;  2MBQ A;  2IJ0 A;  4TQ0 A;  2J0M A;  3NS1 A;  3HUI A;  1FNU A;  3DBH B;  4D6C A;  2FCM A;  2BTE A;  5IP4 D;  1KOT A;  4GDK A;  4DXA B;  1UBI A;  1T0Y A;  2OHF A;  3L4P A;  1K50 A;  2DBY A;  5E6J A;  3S2A A;  4EFO A;  1KLV A;  4IUM B;  3RNE C;  1PYW D;  3BK2 A;  3T3O A;  1YD8 U;  3RN9 C;  1U4A A;  2WXG A;  3NS8 A;  3RPF C;  3U7D A;  3PLU A;  1T6B X;  3A1Q B;  3QJZ A;  3PLV A;  2KFK A;  1B9R A;  3VH3 B;  1E7P B;  1SGH A;  3APC A;  5G5H A;  3IG3 A;  2KX3 A;  2J42 A;  2WDV B;  1ZE3 D;  2DYO A;  2KKC A;  3OG5 A;  3L16 A;  4C4V B;  1WJN A;  1IGD A;  5C1Z A;  1WX8 A;  3ZXV A;  1HZ6 A;  1OQY A;  3PZD A;  3EEC A;  1OQQ A;  1R4M I;  4N59 A;  1MI0 A;  5HG2 A;  1XLN A;  3ZO5 B;  2WS3 B;  4Q2J A;  4KZ0 A;  1M4V A;  1SEB D;  1QZE A;  2O6V D;  2KC1 A;  3L0W B;  4NJC A;  4X57 B;  3MC0 B;  2KVZ A;  1YN4 A;  1E8W A;  4ZRI A;  3JYU A;  4NNJ B;  5FR6 A;  3E9S A;  1TKG A;  1I4H A;  2KT7 A;  4BOS C;  1T5X D;  4FAD A;  4RH6 A;  2O6V B;  4DDG D;  3AU4 A;  3P4S B;  3R2I A;  2LGS A;  2ZZP B;  3NVV A;  3WCQ A;  3WAP A;  4ZDV A;  2BWF A;  1IBX A;  3KWV A;  3TSS A;  1YQ4 B;  5JH5 C;  4F8C B;  4ZHO A;  4WJN A;  4US9 A;  1F2R C;  4DXF A;  3R3M A;  4CO7 A;  2IO2 B;  1VZ6 A;  3L10 B;  2NPT A;  3TEZ A;  3MP9 A;  3TEY A;  2A5U A;  2WXH A;  3V60 A;  1ACC A;  1WYG A;  3NZ3 A;  3IHP C;  3Q8F A;  2E3T A;  3QHT A;  3ZJT A;  4US8 A;  5BO4 B;  1WJ6 A;  1AYF A;  2BQQ A;  1EF1 A;  2G9H D;  3SD5 A;  4C00 A;  5GXG B;  3PRP B;  1KLG D;  2CHZ A;  4FA6 A;  3ML8 A;  3VQI A;  5D2M B;  3KUC B;  3DHH C;  2GLS A;  2N9K A;  1CQV A;  3H7P A;  2KDF B;  2ZVN A;  1WR6 E;  4GU2 A;  1T0S C;  2W9N A;  4KSL C;  2GMI C;  1TZ1 A;  4P7I A;  3CSF A;  3KLS X;  5E6N A;  1PUT A;  3EUB 2;  2WXR A;  2IYD B;  4WJO A;  1P0R A;  4W9E A;  4USA A;  4LNF A;  3KUZ A;  2EMT A;  4AQ7 A;  4XX5 A;  2LXA A;  2KHW B;  3OAW A;  2KQS A;  1UGM A;  2VH1 A;  1WM2 A;  2LMC A;  1KFY B;  4IKG A;  3V61 A;  1VLB A;  5D3D A;  5C3J B;  2J7Q B;  1ET6 A;  3T9L A;  2PTL A;  1P3Q U;  1WM3 A;  2AX5 A;  3UQB A;  1ZDX A;  3ENE A;  4LCD E;  3EHV A;  2V4L A;  3DBH I;  3ZGZ A;  1EU4 A;  4DHZ B;  1TZO A;  1K53 A;  2L7R A;  2D10 A;  3SEB A;  1WH3 A;  3A4S C;  1JWS D;  3NY5 A;  3BVM A;  4K81 A;  3V6E B;  4ACF A;  4L2Y A;  1DYQ A;  2N0S B;  3A9K A;  4PK1 A;  2H88 B;  4KDL B;  2IY0 B;  2IO3 B;  4I6P A;  2E6X A;  5E6P A;  3AI5 A;  2LWP A;  1YX5 B;  1RWS A;  4F7Z A;  1TY0 A;  1RYJ A;  2I2Y A;  2PJH A;  1CK1 A;  4EZJ A;  2PMV A;  1FMA D;  4ZRQ A;  1MFW A;  2Z0D B;  4HPP A;  4K7S A;  2K1F A;  2WXL A;  2O2V B;  4D71 A;  2LVP A;  4KV2 A;  4MEL A;  2IO1 B;  3ZUN A;  2GOW A;  4A90 A;  4KIK A;  4D6G A;  3VTV A;  4IC7 B;  4YTN B;  1QF6 A;  4W9K A;  2WXK A;  4LNK A;  2BKR B;  3PZ8 A;  3KYD D;  1FCC C;  3SR6 A;  1J8C A;  3FIL A;  2L0F A;  2QSD A;  3PO0 A;  1JWU D;  1FXI A;  1SE4 A;  5J18 A;  2I38 A;  3B1L X;  5LNK 1;  2IGD A;  3VFK A;  1QQR A;  4GLS C;  2WP9 B;  2G4D B;  5MPO A;  2DEN B;  1NBF C;  4IOI E;  1FNV A;  4OVU A;  1MHH E;  5HKH A;  4XWT A;  3QAR A;  2KDI A;  4F1S A;  3AE3 B;  4HLE A;  3TCA A;  1UBQ A;  3TIX A;  3PSE B;  2EKE C;  4LNN A;  3L13 A;  4DXG A;  3R8B A;  3A4R A;  4AS1 A;  4KIK B;  1MG4 A;  1Q1O A;  1SB3 C;  3PRE A;  1F77 A;  4IM3 A;  2WXF A;  1I7H A;  1KLU D;  2K6D B;  1WXM A;  2G1E A;  2QMT A;  2L52 A;  1KRH A;  3SFE B;  1C76 A;  1TS4 A;  4D6I A;  3AE8 B;  1EU3 A;  4NAW A;  4REZ A;  3U2S C;  2KXJ A;  2M1M A;  2K39 A;  4GDL A;  3H8H A;  3RNA C;  4GB9 A;  3GZN B;  4OW0 A;  4YL8 A;  2FID A;  1N61 A;  2BS4 B;  4RGN A;  4B0E A;  1ZOY B;  3ZNI D;  1Q0W B;  3C8Y A;  3QK0 A;  3QWZ B;  1RFK A;  4MGZ E;  1CJE A;  4DWF A;  1CZP A;  2AYO B;  1OEY J;  4MGY E;  4YTP B;  2IPK D;  2Z0E B;  3NRZ A;  4AJY B;  4BBN F;  4JQW C;  3JSV A;  1WGK A;  1MHX A;  1QKZ A;  1F52 A;  3TMP B;  4MJS A;  1S3S G;  3N20 C;  4II3 B;  2MWS B;  2D3C A;  5LLI A;  1PGA A;  2KWD A;  1IP9 A;  1AAR A;  3UGB B;  1I35 A;  4ZRK A;  2BWE S;  3ZDT A;  1V9J A;  1X1M A;  5IKC M;  4IWO A;  4NAW B;  3AED B;  3CMM B;  2GB1 A;  3M62 B;  2YEP B;  4B6W A;  1SJH D;  2DHZ A;  2LGI A;  2BYV E;  1F1H A;  2ZW1 A;  1T0Q C;  4KGR A;  4LNI A;  2DX5 B;  4W9D A;  1WX9 A;  4BOZ B;  2WNM A;  4LK0 M;  4HEA 1;  1I42 A;  2W54 A;  4MSM B;  3ZXR A;  4KVG B;  1BXT A;  2MJD A;  1V6E A;  2KD0 A;  4OZB A;  2BB5 A;  2L00 B;  1ZP0 B;  4WUR A;  3ZIM A;  2KTR A;  4TSS A;  1YN5 A;  3R7Q A;  2ICI A;  3JSV B;  2BT6 A;  3WA0 A;  4P16 A;  3HHM A;  3Q3F A;  1FXT B;  3JVZ X;  3ZTD A;  2WXO A;  4HDQ A;  4NAM A;  1ZUD 2;  2C7N B;  2JYE A;  3I9V 1;  1L4Z B;  4C7Z A;  5IOI A;  2DAJ A;  4L1B A;  4LDT D;  4C7Y A;  4E71 A;  2BYE A;  4P6V F;  1WE6 A;  2D5G A;  3AN1 A;  4P1C C;  3HVD A;  1T0R C;  3RUL A;  3Q8C A;  1SIJ A;  1WRD B;  2L3Z A;  2WDQ B;  1IYF A;  2K3U A;  4L23 A;  2WMI A;  1OEY A;  1KM7 A;  3RT3 B;  2XBB C;  2LUM A;  4TV3 A;  3CIR B;  2LJI A;  2FCQ A;  3BY4 B;  4M8N A;  2KLG A;  3PV1 A;  1CMX B;  1UEL A;  4K3B A;  1I4R A;  3MTN B;  4GSW A;  1E90 A;  3B2F A;  3AU5 A;  1FIQ A;  2FAZ A;  1LO5 D;  3Q14 C;  2UWQ A;  3NZS A;  2WX1 A;  1VDV A;  4HKQ A;  2ZPN A;  2LGD A;  4JIO U;  4NPN A;  4FN2 A;  2WMJ A;  2LD9 A;  3IFW B;  4OVV A;  3IT4 B;  1XT9 B;  3A1Q A;  1E9M A;  1YN3 A;  4MDK E;  4TKN A;  3ZNZ B;  1VRA B;  2EKI A;  4XWW A;  2LGY A;  1C4C A;  3P2B A;  2D2Q A;  1GB4 A;  2J0J A;  3P4R B;  1JWM D;  4DK5 A;  3LB8 C;  2D3G A;  2K6Q A;  2D3B A;  4C4V A;  1EO6 A;  4E74 A;  3AE6 B;  1I4G A;  2WXQ A;  3R2T A;  4R3D A;  3PZ7 A;  4GGQ A;  3Q2A C;  5DCN A;  2CKH B;  3AMZ A;  4D6H A;  3P42 A;  2DYB A;  2CJN A;  5CHF A;  3FAH A;  4A3P A;  2GI9 A;  3GZN I;  2INC C;  2M8S A;  3PRZ A;  4YSX B;  2HDE A;  1OQR A;  3VR8 B;  3KVF B;  1ZKH A;  2NS5 A;  1L0Y B;  1N5X A;  1E0Z A;  1TY2 A;  2J4X A;  2L32 A;  3W5U B;  2H89 B;  1N62 A;  2M0X A;  4FJZ A;  2K8H A;  5BMG A;  2RDG A;  1NYR A;  3DWM A;  2IO0 B;  2V3N A;  2KQ4 X;  4ZRJ A;  3P1M A;  2O6V A;  4WQO B;  4HDO A;  1JRP A;  2LAS A;  2PKO A;  1ET9 A;  4D6E A;  4JPS A;  5J2R A;  4BZA A;  2ONQ A;  4DDI D;  2BKF A;  3RFZ B;  4XE0 A;  1TBE A;  5EE1 A;  1YJI A;  3K9P B;  2JRI B;  1RAX A;  1QOA A;  4XC2 A;  1WGH A;  2K9X A;  2MRP A;  1V49 A;  3LXF A;  4D6F A;  3N3K B;  4NQL B;  3MHZ A;  2Y5P A;  4D2K A;  2JUO A;  4BKS D;  4WWN A;  1V1O A;  1YQ3 B;  3AE7 B;  3W1Y A;  4OVZ A;  2JQR B;  4XGA B;  2WMG A;  1Y56 A;  1PFD A;  5G2N A;  1BUI C;  2I1J A;  3X0W A;  1FRD A;  2G45 B;  3I3T B;  2N1W A;  1K52 A;  2BBC A;  4LNO A;  4M00 A;  2YVC A;  2NR2 A;  2C7M B;  3MC9 A;  2LEK A;  3Q8A A;  3DHG C;  3GE8 C;  5IA7 A;  2KAN A;  3D32 A;  3ECI A;  4HXD A;  1KF6 B;  2PEA A;  3RZF A;  5I4D A;  4S0R A;  1H8C A;  1D6E C;  5FR3 A;  3APF A;  4ZRP A;  1FRR A;  3L17 A;  2V9H A;  4FUL A;  2QEJ C;  2DNF A;  2TSS A;  3MHS D;  4NJ7 A;  5AUK A;  2QIE B;  3VRB B;  3MC8 A;  4TQ1 A;  2L0T A;  2WXN A;  4C56 C;  2CR5 A;  4B9K A;  1DOY A;  2ASQ A;  2WHI A;  2SAK A;  4WIP A;  1SIF A;  2KMM A;  4K7U A;  4W9H A;  1JCK B;  2QJL A;  5BMI A;  3Q3J A;  3DCG A;  4YWG G;  5AZF A;  1XLO A;  4G50 A;  1WMH B;  2GBR A;  3AE1 B;  4MGK E;  4K1R B;  3IT6 B;  4WWP A;  2AQ2 B;  3URY A;  1JW9 D;  3PTF C;  3SFD B;  4HRO A;  2JY6 A;  4KGS A;  4IM0 A;  2CS4 A;  2NBW B;  2RPV A;  1QLB B;  1WWT A;  4W9I A;  1E7U A;  1D5Z C;  2GRI A;  2K25 A;  2W55 A;  2J53 A;  3TEW A;  1WF9 A;  1UUP A;  2PVO D;  4N58 A;  5L83 A;  1FD6 A;  1NI3 A;  2O2V A;  2R2Q A;  3QQ8 B;  3HM3 A;  3VXW A;  4NQK E;  2DYM A;  1PDX A;  4FBJ B;  4JGH B;  3KUD B;  1Q10 A;  1MPE A;  1WSP A;  4C80 A;  1C77 A;  3K9O B;  1FCL A;  2BPS A;  2CU1 A;  2NBV B;  4PYU A;  2KMC A;  3OLM D;  4JX1 C;  2JVC A;  3VUY A;  3SU8 X;  2AWT A;  3B2G A;  4WWM A;  3I5J C;  1C1Y B;  1YJ1 A;  1P7F A;  3QAQ A;  3ZNH B;  3OWE B;  4IWP A;  2N1V A;  1VR9 A;  3WAL A;  2ZNV C;  3AUL A;  3UIN B;  1HE8 A;  3X23 A;  4A6Q A;  1I4X A;  1EWY C;  4LTU A;  1TKY A;  1ROE A;  4AOF A;  1GC7 A;  3L08 A;  2DAF A;  2N9P C;  3DPD A;  4D72 A;  2X38 A;  4AUQ C;  1GPX A;  2MP2 A;  2J52 A;  3IXS A;  4EEW A;  1Q5W B;  4HCN B;  3H6N A;  1L6V A;  2WGS A;  4K3C A;  2J0K A;  2HD5 B;  3AB5 A;  5L95 C;  1YJJ A;  5C2T B;  2NCN A;  1C79 A;  3CWI A;  2RDH A;  3U4E G;  1LFD A;  4RGM A;  5EE0 A;  3SHQ A;  1A70 A;  2M17 A;  2LFI A;  4HJG E;  3NVY A;  2C7H A;  2VZK D;  3TBL D;  1FXA A;  4TMA B;  3QC8 B;  2BS3 B;  4NY0 A;  3B0A A;  3NVZ A;  4N9F 4;  1UH6 A;  1V81 A;  5TR5 A;  2NMQ A;  5EDS A;  4FHK A;  2INN E;  1HZ5 A;  3IAS 1;  2RGF A;  5AZH A;  3V62 A;  2VZK B;  3RMK C;  2WXM A;  2LZ6 A;  2LJ5 A;  1SF0 A;  2FCN A;  3M3J A;  3T3N A;  2MP2 B;  3VTU A;  5AEK B;  1J19 A;  3VUX A;  4DBG A;  3AEE B;  4M0W A;  1FFV A;  1LGR A;  2L1A A;  2MX2 A;  2WMF A;  3P63 A;  1NYQ A;  3J9C A;  3ETR A;  1DGJ A;  5D6J B;  2ZNV B;  1GUA B;  2K0P A;  3VR9 B;  2C60 A;  3BZD B;  2EEL A;  2HTH A;  1VZ7 A;  1NEK B;  4HPM B;  1WFY A;  4ANW A;  3EA6 A;  5DPR A;  2YEP F;  2GBK A;  1BT0 A;  4YT0 B;  3N1Z C;  4EZL A;  5IN7 A;  1LM8 B;  3ZQ4 A;  3O13 A;  2HE7 A;  4XYC A;  4ICV A;  1PQS A;  3WAN A;  3VAW A;  2LVQ A;  1UF0 A;  3ZW3 A;  4ITK A;  4DQO C;  2KDB A;  1TJE A;  5BYS A;  4M8M A;  4M0W B;  2V1Y A;  2OJW A;  1P9D U;  4K7W A;  4ZHP A;  1TIF A;  3AEC B;  4M01 A;  5HI1 A;  3Q69 A;  4G11 A;  2WXP A;  3W1S C;  5E6O A; 
#chains in the Genus database with same CATH homology
 3V3X A;  1XO3 A;  3TEZ A;  3MP9 A;  2V4I B;  3TEY A;  3AE6 B;  1I4G A;  2WXQ A;  3R2T A;  4R3D A;  3PZ7 A;  2WXH A;  1J7C A;  1ACC A;  1NEN B;  2MJ3 A;  1WYG A;  3NZ3 A;  3AEF B;  3Q8F A;  2NTS A;  5D3I B;  2E3T A;  3ZJT A;  3BVZ A;  3AMZ A;  3P42 A;  4US8 A;  2CJN A;  1AYF A;  2WQY B;  4H2A A;  3AEA B;  3FAH A;  1FM0 D;  2G9H D;  2GI9 A;  2AQ3 B;  3P4P B;  5GXG B;  4YSX B;  2K22 A;  4RGO S;  2HDE A;  1OQR A;  1KLG D;  1UGJ A;  1HA5 A;  3VR8 B;  3N9Y C;  2IGH A;  2M19 A;  1L0Y B;  1N5X A;  3VQI A;  1E0Z A;  1TY2 A;  1C4A A;  2J4X A;  2N9K A;  1CQV A;  2L32 A;  4HKZ E;  3W5U B;  4XDC A;  1PGX A;  2H89 B;  4RF0 A;  1N62 A;  1QIL A;  2QIL A;  3Q8B A;  1JAL A;  4UDU C;  5BMG A;  2RDG A;  1DOI A;  1NYR A;  3DWM A;  5BYQ A;  4RCO A;  1K51 A;  1L5P A;  3KLS X;  5HHD G;  1PUT A;  3EUB 2;  2V3N A;  2WXR A;  2KQ4 X;  3DWG C;  2HTM E;  3P1M A;  2JYT A;  1AN8 A;  2CJO A;  3W1S A;  1RM6 C;  3W2D A;  1VJK A;  2PLP A;  3Q8E A;  1JQ4 A;  4USA A;  1JRP A;  2PKO A;  1ET9 A;  4JPS A;  2ONQ A;  4AQ7 A;  2JXT A;  3RFZ B;  4XE0 A;  1OFF A;  5EE1 A;  4ZYS A;  1YJI A;  1HXY D;  2LMC A;  1KFY B;  1STE A;  4IKG A;  5G5G A;  2R61 A;  1QOA A;  4RFB A;  1VLB A;  2K9X A;  5D3D A;  4O1N A;  4OHJ A;  4ARI A;  3BYY B;  5C3J B;  3LXF A;  4MM3 B;  1XCT L;  3MHZ A;  1ET6 A;  4HRS A;  5JXV A;  2Y5P A;  2PTL A;  4D2K A;  1SSN A;  1WXQ A;  1XEE A;  3BII D;  3V05 A;  2KN4 A;  2AX5 A;  4KKI A;  3TEX A;  1ZDX A;  3ZJU A;  1EM7 A;  1V1O A;  1YQ3 B;  3AE7 B;  2JZP A;  1JWA D;  3FIL B;  3BWU D;  4OVZ A;  2FE8 A;  2JQR B;  3ZGZ A;  1Y56 A;  1EU4 A;  1PFD A;  1TZO A;  1ZPS A;  1K53 A;  1BUI C;  5BMH A;  5FK9 C;  1KTK A;  3SEB A;  2N9L A;  1FRD A;  3ZYY X;  4B0M A;  1K52 A;  2BBC A;  4CQN A;  1JWS D;  1AW7 A;  3B9J A;  3W5V B;  1XLQ A;  3AE9 B;  1WRI A;  2KAJ A;  3BVM A;  2LEK A;  4L2Y A;  1DYQ A;  2N0S B;  3ABV B;  2H88 B;  3Q8A A;  2IGG A;  2CU3 A;  1BML C;  4KGT A;  3AV8 A;  1ZXI A;  2W3S A;  2E6X A;  3AEG B;  2BB6 A;  1NVI D;  2N7J A;  1KF6 B;  5I4D A;  1RWS A;  4KKJ A;  3KQ4 A;  2MEK A;  1N5W A;  5EE9 A;  1D6E C;  1L0X B;  5FR3 A;  1ZDV A;  1TY0 A;  1RYJ A;  3AEB B;  2I2Y A;  1CK1 A;  4ZRP A;  2V0G A;  1J7B A;  2JX5 A;  2PMV A;  1FRR A;  1FMA D;  1JWB D;  1V1P B;  2KAC A;  3MJ5 A;  4ZRQ A;  2INP E;  2W3R A;  4FXC A;  1SE3 A;  4WAF A;  2QEJ C;  2XNA C;  2WXL A;  1UNS A;  3E56 A;  1FFU A;  2TSS A;  2PVG C;  5AUK A;  1P7E A;  1ZXH A;  2QIE B;  1GOZ A;  4TQ1 A;  3VRB B;  3BK1 A;  2WXN A;  4C56 C;  1V8C A;  1I4Q A;  1IGC A;  1DOY A;  4OZC A;  4A90 A;  4LLG M;  1XCQ L;  3BYT B;  2SAK A;  4WIP A;  1C78 A;  2KMM A;  4YTN B;  1QF6 A;  4WQM A;  2B76 B;  1JCK B;  2WXK A;  1VZ8 A;  2XN9 C;  2FUG 1;  2QJL A;  3PZ8 A;  5TSS A;  4GDL B;  4PT5 A;  5BMI A;  1FCC C;  1MVK A;  3SR6 A;  3FC4 A;  3HRD D;  3FIL A;  4YWG G;  2Z8L A;  2QSD A;  1XLO A;  3PO0 A;  1JWU D;  1QOG A;  1FXI A;  1QOF A;  2LHD A;  1SE4 A;  2WLB A;  3AE1 B;  2I38 A;  5LNK 1;  2IGD A;  1QQR A;  4GLS C;  2WP9 B;  3IT6 B;  3NVW A;  4A55 A;  5MPO A;  2AQ2 B;  4N6E B;  3URY A;  1JW9 D;  1E6E B;  4YXD B;  1HQR D;  1QT9 A;  4IOI E;  2BYT A;  1FNV A;  2ACZ B;  1MHH E;  4XWT A;  3SFD B;  1F2R I;  4HRO A;  3HVZ A;  4WH4 A;  4KGS A;  1F0Z A;  3AE3 B;  4ARC A;  2RPV A;  1QLB B;  1TS5 A;  1WWT A;  1GB1 A;  1R7S A;  1UWM A;  2KDM A;  1D5Z C;  4IDI A;  1I4P A;  2PW9 A;  1EWC A;  1SBB B;  2Y5C A;  2SEB D;  3VRA B;  2GRI A;  2WXJ A;  4DXG A;  1N63 A;  1V1P A;  3R8B A;  2W55 A;  4AS1 A;  3BVG A;  2J53 A;  3TEW A;  1UUP A;  2PVO D;  1B1Z A;  1SB3 C;  3NUH B;  5D7G A;  1F77 A;  4N58 A;  2JU6 X;  2WXF A;  1FD6 A;  3AH7 A;  1I7H A;  1NI3 A;  4NZL B;  1TS2 A;  1XF5 L;  1KLU D;  1PGB A;  2G1E A;  2QMT A;  2DYM A;  3P4Q B;  2L52 A;  1KRH A;  2Y3A A;  1GAQ B;  1PDX A;  3SFE B;  1C76 A;  1TS4 A;  1XXG A;  1Q10 A;  1YMH E;  3AE8 B;  2M56 B;  1MPE A;  1EU3 A;  1WSP A;  1C77 A;  4REZ A;  2JSV X;  3U2S C;  4C80 A;  1FCL A;  3GB1 A;  5AUI A;  1L0V B;  4RNA A;  1L6U A;  1DOX A;  2RMM A;  3H8H A;  4OW0 A;  4GDK B;  4JX1 C;  3B2G A;  3AE4 B;  1N61 A;  2BS4 B;  2BS2 B;  2NTT A;  4RGN A;  4WWM A;  2L83 A;  4B0E A;  1ZOY B;  1N60 A;  1TKE A;  2JWU A;  2K5P A;  1KH0 A;  3C8Y A;  4MT5 A;  5BYR A;  4EE2 A;  1P7F A;  2FBW B;  4OZA A;  1D4B A;  1HEZ E;  3OWE B;  1RFK A;  1CJE A;  1VR9 A;  1CZP A;  4YSZ B;  1XLP A;  2V3P A;  4YTP B;  2IPK D;  3NRZ A;  3W9C B;  3I57 A;  5H8Y E;  1WGK A;  2LHE A;  4JWU C;  4A6Q A;  1I4X A;  1MHX A;  1QOB A;  1QKZ A;  2DLB A;  1C9F A;  1EWY C;  1T3Q A;  3EGR A;  4LTU A;  3MFG A;  1PGA A;  2KWD A;  1TKY A;  1ROE A;  5HFY A;  5T8I A;  2Q5W D;  4JWS C;  2M0A A;  4A9A A;  2MH7 A;  1ESF A;  2ON8 A;  1AWD A;  2X38 A;  1FEH A;  3AED B;  4NAW B;  4A8X C;  3AE5 B;  3KWL A;  1UWX A;  1GPX A;  2GB1 A;  2MJE A;  4JE3 B;  2J52 A;  2YEP B;  3AE2 B;  3IXS A;  1J7A A;  1SJH D;  2LGI A;  1JRO A;  1TS3 A;  2ZW1 A;  4MAC A;  2WXI A;  1L6V A;  2W82 A;  4KGR A;  2WU5 B;  4XDD A;  3AM9 A;  2IJ0 A;  2WNM A;  1D5M C;  1SE2 A;  3AB5 A;  4HEA 1;  4J3O D;  4LK0 M;  1YJJ A;  4TQ0 A;  2W54 A;  5C2T B;  3NS1 A;  3HUI A;  2BW2 A;  1C79 A;  1FNU A;  1BXT A;  2MJD A;  4OZB A;  3CWI A;  2RDH A;  2BB5 A;  4YSY B;  3U4E G;  1SXT A;  2BTE A;  1ZP0 B;  4WUR A;  1YNT E;  4RGM A;  5EE0 A;  2OHF A;  3L4P A;  1K50 A;  2DBY A;  5E6J A;  1A70 A;  4TSS A;  1YN5 A;  2LFI A;  4HJG E;  3NVY A;  3U7Z A;  2VZK D;  2ICI A;  1FXA A;  4TMA B;  1PYW D;  2BS3 B;  2BT6 A;  3BK2 A;  1FO4 A;  3NVZ A;  3T3O A;  4P16 A;  2WXG A;  3RPF C;  2NMQ A;  1T6B X;  2WXO A;  5EE3 A;  2INN E;  1FNW A;  1HZ5 A;  4NAM A;  1ZUD 2;  2JYE A;  4YTM B;  3I9V 1;  3IAS 1;  1L4Z B;  4C7Z A;  1B9R A;  1L4D B;  1IBX B;  2VZK B;  4L1B A;  2WXM A;  1E7P B;  4RGT A;  4C7Y A;  3UI3 A;  3GS2 A;  1SF0 A;  5G5H A;  4P6V F;  3T3N A;  2D5G A;  3AN1 A;  3GP7 A;  2J42 A;  2WDV B;  3HVD A;  1ZE3 D;  2DYO A;  4ZOH C;  3AEE B;  4M0W A;  1IUE A;  3IAM 1;  1FFV A;  3Q8C A;  1SIJ A;  2L1A A;  1IGD A;  2WDQ B;  2K3U A;  4L23 A;  2PIA A;  1JML A;  1HZ6 A;  3P63 A;  1NYQ A;  2LUM A;  3J9C A;  3LYY A;  3ETR A;  1DGJ A;  2ZW0 A;  3CIR B;  2LJI A;  4RF1 A;  2IDY A;  2K0P A;  2AQ1 B;  1OQQ A;  3VR9 B;  1C4P A;  2OED A;  3BZD B;  2EEL A;  1I4R A;  4N59 A;  2WU2 B;  5H92 C;  3B2F A;  1VZ7 A;  1NEK B;  1FIQ A;  1MI0 A;  1LO5 D;  5FKA C;  5HG2 A;  1XLN A;  3EA6 A;  4MH8 A;  1VDV A;  2YEP F;  2WS3 B;  4Q2J A;  4HKQ A;  1M4V A;  1SEB D;  1V97 A;  4NJC A;  4YT0 B;  3U52 E;  3MC0 B;  1YN4 A;  1SJE D;  3TUO A;  3ZQ4 A;  2WDR B;  3O13 A;  3E9S A;  1TKG A;  3ZJV A;  1I4H A;  1T5X D;  3IT4 B;  4ITK A;  4RH6 A;  4DQO C;  1E9M A;  1ENF A;  1YN3 A;  3P4S B;  3R2I A;  3NVV A;  2DWQ A;  3WCQ A;  1TJE A;  1VRA B;  2EKI A;  5BYS A;  4XWW A;  1IBX A;  3KWV A;  1C4C A;  3TSS A;  1YQ4 B;  1GB4 A;  4ZHO A;  3P4R B;  4ZHP A;  1JWM D;  3AEC B;  1TYG B;  4US9 A;  1F2R C;  4DXF A;  5HI1 A;  1D5X C;  3LB8 C;  4KX6 B;  1E10 A;  1VZ6 A;  3Q69 A;  2WXP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...