2VZKB

Structure of the acyl-enzyme complex of an n-terminal nucleophile (ntn) hydrolase, oat2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
213
structure length
213
Chain Sequence
TLLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGEVDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPKARGDQADDALRAAVAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNSEYTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GLUTAMATE N-ACETYLTRANSFERASE 2 ALPHA CHAIN
publication title Anatomy of a Simple Acyl Intermediate in Enzyme Catalysis: Combined Biophysical and Modeling Studies on Ornithine Acetyl Transferase.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
total genus 77
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.35: Glutamate N-acetyltransferase.
pdb deposition date 2008-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.340 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2vzkB02
3.30.2330.10 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein suprefamily 2vzkB01
1VZ7A 2VZKD 3IT4B 1VRAB 2YEPF 2VZKB 1VZ8A 2V4IB 3IT6B 1VZ6A 2YEPB
chains in the Genus database with same CATH superfamily
3S2AA 2ZVNA 4MJSA 3B0AA 4W9FA 4WWMA 4BKSD 2DLBA 4W9IA 2I2YA 1R4NI 3HM6X 4NNJB 2CU3A 3VUYA 4B0EA 3AE2B 1MG8A 3TUOA 3ETRA 3U7DA 1QOGA 1EU3A 1V81A 2W54A 3CWIA 4BOSC 2KFKB 3WAOA 2C5LC 2BB6A 2OJWA 3WIMA 4DXGA 2L83A 2ONQA 3B2FA 1T3QA 2MWSB 3UF8A 3P4QB 4OZBA 1U4AA 5KHOA 2G9HD 2EKEC 3NVYA 5AEKB 1OQQA 3ZVVA 1IBXA 2WXPA 4G0NB 1N60A 3ZJTA 1F52A 5E6PA 3PO0A 3NY5A 2K6DB 1RYJA 2L0TA 1V6EA 3RNEC 4AWJA 3V3XA 2XNAC 2N9KA 3JVZX 5LLIA 2ZVOA 2J0KA 4K3BA 4NJ6A 3MC9A 1Z2MA 4RFBA 2G4SA 2CHZA 4R3DA 4MM3B 2DZIA 2IBIB 1L5PA 4KIKA 4WWOA 2LD9A 3RNCC 4RM8A 3DBRB 2VH1A 4W9JA 2DBYA 2Z59B 3WA0A 3KYCD 1GG3A 2HTHA 1H4RA 3B2GA 2PIAA 2KLGA 1L6UA 2WQYB 2N7DA 3ZLZA 5G55A 3MJWA 4WAFA 5L83A 2L52A 3BK1A 3ZRCA 1F1HA 2ZW0A 3VAWA 1WX8A 1P98A 1R4NB 4ASWC 1SB3C 4S17A 4IW0A 2NR2A 2QHOA 5HG2A 2OEDA 4JIOU 5E6OA 3TJPA 2KYWA 4ZRPA 1I4QA 1FNWA 3DHIC 1UF0A 3R7RA 4WWPA 1SE9A 1DOXA 1K52A 2K39A 3I9V1 1ACCA 1WXVA 3BYYB 4W9LA 3RD2A 1XD3B 2PVOD 4BZAA 3UQBA 1EWCA 2KT7A 4ICUA 3PPAA 4HCNB 3D32A 2KDEB 5C2TB 2FIFA 3KQ4A 1I42A 2N9LA 1IUEA 4IWQA 1DGJA 4D72A 4GIVA 4ARCA 1EU4A 4I6NB 3ZTDA 3IG3A 1TS4A 3PRPB 2NBWB 3BK2A 3ZRFA 4W9EA 3SR6A 5E6JA 1UGJA 4D6JA 1VJKA 4GDKA 1UUPA 5TR5A 2L0FA 3WANA 3OJ4B 1S3SG 3BY4B 1NVID 2DNFA 3N30A 4RGOS 2WMIB 4K7SA 3R66C 1P1AA 3BINA 2J0JA 4ACFA 2DX5B 3AE8B 2M4NA 2KWDA 2O6VB 4I6PA 1CMXB 2XN9C 5J2RA 1C78A 2QEJC 3ZJUA 2L00B 2FUG1 4TV3A 4HWIB 4XC2A 2QCZA 1QQRA 2M19A 1BT0A 3CSTA 2Q5WD 4PS8A 4YSXB 1V8CA 2SEBD 5BMHA 1WSPA 2WU2B 2W82A 2ZJDA 5EE9A 4HPMB 1FXAA 3QC8B 4D6DA 2JY6A 4GLSC 4A55A 2CS4A 4JGHB 3NJTA 3AE3B 2N7JA 1J7CA 5IA7A 2BYTA 1WYWB 3PV1A 3LJ3A 4H2AA 4QAYA 3VXWA 4ANWA 2ON8A 2M0XA 1IYFA 2KANA 2CJOA 1ROEA 5D3IB 2KZRA 3ZUNA 3N9YC 3AH7A 1QT9A 3EA6A 2JVCA 3CMMB 2BT6A 2G3QB 4HDQA 1XF5L 2MH7A 2MW5A 4KKJA 3U52E 4IG7B 4C7ZA 3ZNHB 2RMMA 3TEYA 2LMCA 1JWSD 2WXJA 1WGYA 2ZW1A 1T0YA 3TMPB 1FFUA 1MPEA 4A90A 2KVRA 1SGHA 1SJED 4WURA 2J42A 4MGYE 2W3RA 4ZYNA 2W3SA 2ZCBA 4A3OA 4N6EB 4XYCA 1AARA 1YQBA 1S1QB 1HE8A 2JZ3B 4DHZB 2BKFA 4ZRIA 3AECB 2KFKA 2XK5B 1IBXB 3QHTA 3RFZB 2FCMA 1L4ZB 2IY1B 4OVUA 2WXIA 2G1EA 3Q3JA 3U7ZA 3MFGA 4E3CA 1ZE3D 1J7AA 1KJTA 2AQ3B 4TMAB 1N63A 4FJYA 4LK0M 1L2NA 2PE9A 3LDZE 3L16A 1SEBD 3AU5A 1KOTA 2C9WB 2B3AA 1NI3A 3AE9B 1G6JA 1QZEA 3ML8A 4KGRA 3HIZA 1N6ZA 1SIJA 2NPTB 2JWZA 2MJEA 2LFIA 4MM3A 2GBNA 3EECA 1NENB 4I6LB 4TQ0A 3AV8A 3HVDA 1TJEA 1C76A 2OHFA 1HEZE 1GB4A 2J0MA 4JWSC 4IM0A 5EDSA 1WR6E 2C60A 3MHZA 2PMVA 5AZGA 4P7IA 1PQSA 4IWPA 5DCNA 2N1WA 1TY2A 3WAPA 2MBBB 4YTMB 3RZWC 4NZLB 2L1AA 4F8CB 4RM9A 4IOIE 3PSEB 4HRSA 2CR5A 2GRIA 2FIDA 1GC7A 1UWMA 2W9NA 2LEKA 3DDCB 3SEBA 1QKZA 2D07B 3GP7A 3ZXVA 5IAAC 2JSVX 1WX9A 2LHDA 3PLVA 2KC2A 3DVGY 3PT2B 1JQ4A 2JYTA 5BYRA 3A9KB 4LTUA 4BOZB 4XGAB 1NDDA 3Q8BA 5CHVC 1V80A 3ZW3A 1TGZB 2E6XA 3TEXA 2NMQA 3A33B 4CO7A 3R3MA 4BBNC 1QOAA 1RWSA 3SFDB 5BO4B 3UGBB 3DVNV 1TIFA 2PTLA 2N1VA 4JQWC 3APCA 2IDYA 2WDRB 4KDIC 4KSLC 3W5UB 4JWUC 3H6NA 1XQQA 1PDXA 2BPSA 4MH8A 1E7UA 2AL6A 1KFYB 3RT3B 3NS8A 4HKQA 2KJHB 3Q8CA 4USAA 2WGSA 2MRPA 1YQ3B 1CZPA 1YJIA 2JF5A 4ITKA 2KC1A 3HUIA 4LCDE 2RDBC 4PYZA 1E6EB 1TS5A 2WMIA 2INDC 3I57A 1DOYA 3H9DA 4MSMB 4HLEA 2YVCA 1C79A 1WGDA 1YIWA 3VQIA 4BKTA 1JROA 1OQYA 3DPDA 3NOBA 3PZDA 3L4PA 3DVGX 1M4VA 4D6IA 4YT0B 2JU6X 3ZQ4A 2AQ2B 4GU2A 4TKNA 3APFA 3X0WA 2LXAA 3GS2A 4XE0A 3Q3OC 2MBHA 1WJUA 4DBGA 2K8CA 4HDOA 5GXGB 4ZRJA 3WAMA 1T0SC 2MCNB 4DDGD 3AN1A 1WXSA 1H8CA 1F77A 2MBOA 3N3KB 3NZSA 2KNBA 4D71A 1EF1A 4L2YA 1HXYD 2QJLA 4AS1A 3UIPB 5D3DA 2KQSA 2YEPB 2AWTA 5BMGA 3QARA 1RFKA 2RSUA 1YX5B 1AN8A 2REXA 1SJHD 2KDMA 1E8ZA 1I4RA 4K1RB 5FR6A 3E9SA 4OVZA 3AU4A 3PLUA 4ARIA 1YMHE 2LXCA 3RCZA 2V0GA 4BKSA 4TSSA 1YX6B 1FCCC 4II3B 2KMMA 2JUOA 3KVFB 4M0WB 3BZDB 1QF6A 3TEZA 3RNAC 1ZW7A 2TSSA 4TQ1A 5FKAC 4D2KA 5T8IA 1WGRA 2WNMA 4DHJD 2BW2A 3TCAA 5H92C 2WP9B 4ZHOA 3V05A 2KFJA 3AULA 3DBLB 2KWVB 4OZCA 1V5TA 1XLOA 3K9OB 3Q8FA 2HTME 4P6VF 4WJQA 2DAFA 2V9HA 2PW9A 3AM9A 4C80A 3ZKJC 2LUMA 4A9AA 2JZPA 2KLCA 5EE3A 3U30A 2WXNA 4PS3A 3ZNID 2XK5A 3CIRB 3DWMA 3MTNB 1VZ7A 3QCAA 2IPKD 2J7QB 1WX7A 1OEYJ 3NRZA 3AXCA 4B6WA 1FCLA 4WQMA 4W9CA 1I4GA 1MG4A 2K9XA 1WY8A 2BYVE 1D3ZA 3DWGC 4ZRQA 1V49A 5JZEB 5MPOA 5J17A 1ZDXA 1Z5SB 2NBUA 1KLUD 1JWAD 2Z8LA 2ZZPB 3PZ8A 2MJDA 1TKEA 2FNJB 4ZRKA 2JRIB 3ZJVA 2NPTA 3LYYA 2LRUA 1TKYA 2AYOB 1FFVA 3TIXA 1A5RA 3U8ZA 4DDID 1WFYA 1YQ4B 2I38A 4C7YA 1L0YB 1ZUD2 2LGDA 1CK1A 2Y5PA 3VH4B 1IPGA 1KM7A 1WI0A 4AOFA 1NI2A 1XCTL 4KDLB 5D94A 1R4MI 4AUQC 2IO3B 1FXTB 1GPXA 1ET9A 2MBQA 2J53A 1ISNA 3DVNU 3A1QA 3GB1A 1AYFA 2KQ4X 3KW5B 2KOXA 2JZZA 4YTPB 3DBHI 3R2IA 1E5WA 1QILA 4D6FA 2ACZB 1WJNA 1R7SA 2QILA 5LXIB 2WX1A 2X38A 4AP4C 1ZXHA 2RR9A 3PS6A 2KK8A 3A9KA 3HM3A 4FA6A 4CYEA 4AJYB 4HKZE 3N1ZC 3R7QA 4W9KA 4JPSA 4MEMA 1V1PB 1FNUA 2KVZA 4NJCA 4KSKC 2Y5CA 4PS7A 2WXMA 4WIPA 2KAJA 3R2TA 5DPSA 5IKCM 1IGCA 2BWES 3IHPC 1RFAA 3H7SA 3ZYYX 2KMCA 1F2RI 4C56C 1EM7A 2PEAA 2G4DB 1SE4A 2V1YA 4KKIA 2RPVA 2M17A 2I1KA 2PKOA 2Y3AA 3GE3C 5TSSA 2D2QA 4E74A 4LDTD 2KX0A 2D3CA 1YJJA 2BQQA 4YXDB 1EF5A 1R4MB 4IM2A 1QLBB 2D3GA 4P1BC 2XBBC 2WS3B 4RCOA 2ASQA 3MJ5A 1J0GA 5IOIA 3VRAB 4A3PA 4G50A 2LHEA 2PE6B 4GSWA 4MGKE 4W9DA 3MP9A 2AX5A 3OWEB 1N5XA 1CQVA 2EMTA 3AE7B 2PLPA 4PK1A 3JSVB 3IFWB 5E6NA 1FRDA 3W9CB 2NBVB 4W9HA 2K8HA 3ZXRA 3A4RA 5EE1A 1IP9A 1YN5A 1T6BX 5IP4D 3QK0A 5I4DA 3Q3MC 2JQRB 3NUHB 3ZDTA 4NJ7A 3M62B 2DENB 4PYUA 2L32A 4LNIA 2VZKB 2FCNA 3RMKC 3HK0A 2M8SA 2L3ZA 4GN1A 2IGGA 3AE6B 4FHJA 3W2DA 3AEEB 2NTSA 4M00A 1DOIA 1D5ZC 2R61A 3TSSA 2JT4B 2Z0EB 2MEKA 2D3AA 4DHJB 1UZXB 4LLGM 4LJPB 2GB1A 4J6IA 2DYOA 4B9KA 3ZDMC 3ZNGC 3J9CA 1UD7A 2DZMA 4YL8A 1XLQA 2IZVB 2HD5B 2KJ6A 1T0RC 2KN4A 3Q3FA 2A5UA 2IYDB 4ANVA 3X23A 3IT4B 1CJEA 4DK5A 4WQOB 1J7BA 1QOFA 1I4PA 4HPPA 2XEWA 4M0WA 4L1BA 1SE2A 1TZ1A 2SAKA 2D11A 3KUCB 2O2VA 1J19A 3N32A 3TBLD 4IKGA 3ENEA 4PT5A 4NQKE 3NVWA 1SBBB 4K81A 2BB5A 4ANXA 1WGGA 4CHKA 5DPTA 1I35A 2KXJA 3RNBC 1PGAA 3L10B 1V1OA 3KWLA 2FBWB 4M8MA 2BGFA 2LZ6A 1X1MA 1N61A 4F7ZA 2LVQA 3T3NA 2BKRB 4GOCA 3L08A 2OJRA 2IY0B 5BMIA 2INCC 3APDA 3E56A 1B9RA 1C77A 1SE3A 1MFWA 1OTRB 3ZNZB 1FPYA 2WYQA 2OOBB 5CHFA 1A70A 1YN3A 3ZIMA 4P16A 4N58A 2WXKA 1PFDA 2N9XA 4MT5A 4LNKA 1JRPA 2GOWA 1OQRA 3URYA 5JXVA 2Y5BB 3PZ7A 1E8YA 4WJPA 1VRAB 2MA9B 4LNFA 2JPHA 2JWUA 1QOBA 2R2OA 3VFKA 1SIFA 2BWFA 2RDHA 3VTWA 1Y56A 3A1QB 3Q3NC 5CTRC 1KLGD 4NY0A 1WXQA 2WDTB 4XX5A 2QSDA 1LFDA 1HQRD 1LLQA 1OFFA 1V86A 3O13A 2C7NB 2KJRA 3OJ3A 1L0XB 2ZPNA 3RUIB 1V97A 4WJNA 3SDLC 1RRBA 2HDEA 3Q8AA 4M01A 1C1YB 2KTRA 4GDLB 3Q69A 3KUDB 4HJKA 2WHIA 3K9PB 2N9PC 3FC4A 2I1JA 1OEYA 5CHWA 2J52A 2WX0A 4BBNF 4RMAA 1UH6A 2AL3A 3WCQA 3MHSD 3AE1B 4GGQA 2K3UA 1T0QC 1XXGA 2KO3A 2LVPA 3VRBB 4RNAA 1VR9A 1WJ4A 3MC8A 1E8WA 1V1PA 1Q10A 2INPE 3C8YA 1KRHA 2MBEA 3IAS1 1XCQL 4LDTB 4D6CA 3KYDD 2E3TA 3DOWA 3HRDD 5LXHA 4RF0A 2NCNA 2FCQA 2B76B 1VCBA 3KH0A 3IAM1 3AEAB 3M3JA 4XWTA 2D5GA 4EKUA 2K25A 2MX2A 1JWMD 4XWWA 3MC0B 4FN2A 3NVZA 1I7HA 3NZ3A 2LGXA 3O65B 1ZDVA 4N9F4 2JX5A 1GB1A 1JALA 4EFOA 2FUHB 2LJ5A 3JYUA 5C23A 4YSYB 2M56B 2ZNVB 4MDKE 1E8XA 1AWDA 4W9GA 2WXOA 3I5JC 3AMZA 2AEHA 5CX3A 1EUVB 2KKCA 2WXQA 5AUKA 3SD5A 3JSVA 2V4LA 2K6QA 3EUB2 1JWUD 3DBSA 3RPFC 4YWGG 1TTNA 4XDCA 2KTFA 2H89B 2O6VD 4BKGA 1FM0D 3V60A 3FILA 1VDVA 5HFYA 2VRRB 4HK2A 4OZAA 4BAXA 4KVGB 3QAQA 2LUEA 1C4PA 5H8YE 3PGEA 1XEEA 1TS3A 2QC8A 5LNK1 1BUIC 4NAWA 1ENFA 1NBFC 1D6EC 4FJVB 1FO4A 2WXRA 4P1CC 1VD2A 2VH2A 4HJGE 2V3NA 4JLCA 2BF8B 4RF1A 1FEHA 2WXGA 3T9LA 4AJWA 1E9MA 1WMHB 1LO5D 4NQLB 2GBKA 3ZO5B 3OG5A 5JHBA 1XT9B 1FD6A 1SF0A 3UINB 4EUTA 3NZUA 2ZPYA 1ZGUB 2O2VB 3DBRI 1E7PB 3LXFA 3V62A 2K1FA 2R2QA 2IGHA 2NVUI 2W55A 1P0RA 2DZKA 2MSED 3P4SB 3IVFA 4MGIE 1WGKA 4D6HA 2L76A 2EMSA 1V5OA 4XDDA 4EE2A 3V6EB 1TY0A 3B9JA 4HCPB 1OGWA 4A20A 1K50A 1P7EA 3LB8C 1L6VA 3U4EG 5C3JB 1TS2A 4A8XC 1HA5A 4D6GA 2WWZA 3H8HA 1RM6C 1M94A 1E10A 5G5HA 2ZEQA 5D2MB 3Q14C 2DAJA 2GLSA 1KTKA 3VR9B 2JXXA 1MJDA 2RGFA 3SHQA 2FAZA 3WALA 5D6JB 1EO6A 4LJOB 3DQVA 3PHXB 2KWUB 1C4CA 4IC7B 3ECIA 4E71A 1F2RC 2RD0A 5D7GA 4C4VA 2KQ7A 4FLHA 1KF6B 2K8BA 3AEFB 1YN4A 2KACA 2CHXA 1RAXA 1PYWD 4HXDA 1P9DU 1WE6A 2KMAA 4DHZE 2HE7A 3Q2AC 1UBQA 3VR8B 3U2SC 4HEA1 4GMVA 2IJ0A 4MGZE 4S0RA 5G5GA 1FNVA 2KTRB 2IGDA 4US9A 1BMLC 3M63B 3A9JB 3HHMA 1LXDA 3VUWA 1YJ1A 3I3TB 2D10A 5FK9C 2WMFA 2GBRA 1L4DB 2AQ1B 2MHJA 5J18A 4GDLA 3Q6BA 3PREA 1HTQA 2GMIC 1WE7A 4IDIA 3TL5A 2WDVB 3NS1A 4KV2A 4FULA 2WU5B 4MACA 4RH6A 2WLBA 5C1ZA 4IWOA 3T8MA 2IO1B 2JRHA 3IT6B 5AZFA 1GJZA 3VDZA 2LJIA 2QDFA 4HPLB 2KD0A 2DZJA 3ABVB 3H7PA 3AI5A 1GAQB 3PTFC 4NPNA 4WJOA 3GOEA 3RN9C 2PPHA 3BWUD 1TKGA 2CHWA 3C19A 1FXIA 2BBCA 2WXHA 2MLBA 1C3TA 1TT5B 3GE8C 2BTEA 1AW7A 1WH3A 3N20C 5IN7A 4JE3B 1GNUA 4ANUA 4EZJA 3P1MA 2UWQA 3HVZA 4ZOHC 2YLMA 1SSNA 4LNOA 1GUAB 3BVZA 3BIID 2BS2B 1F9JA 4K7UA 2PJHA 1JW9D 5DPRA 2KDIA 4ICVA 1ZKHA 2LVOA 3AEBB 4B0MA 1MHXA 1WZ3A 1GOZA 1T5XD 1LM8B 1NEKB 4EOYA 2BYFA 5HI1A 2QIEB 3L17A 3DBHB 2A4ZA 1WJ6A 1UWXA 2M1MA 3CSFA 2G45B 2QMTA 1E90A 1K51A 3AE4B 2KDBA 3N1XC 1Y8RC 3P4PB 1HZ5A 2NTTA 2MP2A 2PVGC 4N59A 3KLSX 4HROA 3N1YC 3AB5A 2WMKA 1GC6A 3W1YA 3FILB 1PGBA 4WH4A 1SXTA 1WWTA 5GMVA 2D3BA 1D5XC 2H88B 3Q8EA 4XZ4A 4LNNA 2N0SB 2LWPA 1D4BA 3ZTCA 4ZHPA 2JYEA 4NAWB 3C0RB 1HTOA 4FBJB 1FMAD 1Q5WB 3DHGC 2GBJA 4MSQB 2KX3A 4OW0A 3VH3B 4EZKA 3BVMA 4RGTA 4FADA 2WMJA 2V3SA 1JCKB 3UIOB 3P42A 3RI7C 1I4XA 4EEWA 3EFUA 2INNE 1WMHA 3ALBA 3QWZB 3EFCA 1LQBA 4F1SA 3M95A 1V2YA 3SFEB 3PRMB 5AUIA 1ZPSA 2KWCA 1WM2A 1VZ8A 2BS4B 1UBIA 1UELA 2N9EB 4MJSB 2BYEA 3H1UA 2K22A 1KLVA 1JRUA 1K8RB 2ZNVC 4CQNA 4JX1C 1WM3A 1C4AA 3AEDB 1B1ZA 4C00A 1MI0A 4IM3A 2JXTA 4OVVA 1FIQA 4DXFA 3TEWA 1E7VA 4K3CA 4G11A 1DYQA 1NYRA 1D5MC 5HHDG 4URKA 1XLNA 3RULA 1WR1A 1WYGA 2CKHB 2FE8A 2DWQA 3B1LX 3A4SC 1ZOYB 1ZXIA 2M0AA 4WWNA 2LGIA 1F0ZA 3QX1A 3V6CB 4G3XB 1YNTE 5G2NA 2MQJA 1WGHA 4M8NA 1PUTA 4MELA 4C4VB 1Q0WB 1MVKA 2YEPF 4IUMB 5AZHA 3B08A 4KIKB 1ZP0B 4D6EA 2IO2B 2V4IB 5KHQA 3OAWA 1E0ZA 2L7RA 1WIAA 4RGMA 3GZNI 3OLMD 3RNGC 4KZ0A 1YD8U 2FCSA 3AE5B 1ET6A 4JL9A 4X57B 1RLFA 3SU8X 4DQOC 3EHVA 2RPQA 4A6QA 1C9FA 1LGRA 1N62A 4O1NA 3V61A 1WXMA 5HKHA 5JHAA 3FAHA 3P4RB 3L54A 4REZA 1Q1OA 4HVBA 3NVVA 1JMLA 5BYQA 1KH0A 1VZ6A 3A9JA 3JW0X 3UI3A 2ICIA 2HJ8A 1STEA 1FRRA 1VLBA 2IO0B 3KWVA 4DXAB 2KN5A 2LASA 3CF6E 3R8BA 2L8JA 4KZCA 4ZYSA 2K0PA 4B95A 1UGMA 4BVUC 3H7PB 3W1SA 1UNSA 3IXSA 1BXTA 3L13A 2MJ3A 4RGNA 4K7WA 2HJ1A 3KUZA 5JH5C 1MHHE 1P7FA 2L05A 3QA8A 4KGSA 2NS5A 1O0SA 2V3PA 1WF9A 3PHWB 3VTUA 4YTNB 4OHJA 4DWFA 2DHZA 4GB9A 4GDKB 4WAAA 3QJZA 2UU7A 4FJZA 1WRDB 3GZNB 1XO3A 1K53A 1PGXA 2BS3B 1NYQA 2N7EA 3AEGB 4EZLA 3PVLA 1XLPA 2UYZB 5EE0A 2DYBA 1YOVB 2J4XA 1V9JA 2MP2B 5L95C 2C7HA 4YSZB 5DPWA 4BFRA 4FHKA 4AQ7A 3NHEB 3DCGA 3UQAA 2O6VA 2CJNA 2WXFA 2WMHA 3PRZA 4II2B 4KX6B 3DHHC 2GBMA 3DBLI 1TZOA 2LI5A 1J8CA 3BYTB 3P2BA 4ZDVA 3VVWB 2WDQB 3ZGZA 2WXLA 4UDUC 3RYTA 3L0WB 2LRWA 3IBEA 3W1SC 3QQ8B 1ESFA 1P3QU 3FKYA 2WMGA 2KDFB 3ML9A 4MH0E 2Z0DB 1N5WA 1IGDA 3NG0A 4NAMA 1HZ6A 2EELA 2X8XX 3W5VB 1TYGB 2K5PA 4J3OD 3VTVA 5BYSA 3QIJA 2EKIA 3RNFC 1L0VB 1WXAA 3P63A 1WRIA 3BVGA 2DYMA 2ZCCA 5FR3A 1I4HA 3ONSA 1JWBD 1EWYC 2LGYA 2BVCA 3RZFA 4KGTA 4GXBA 3I63C 2C7MB 4L23A 5IO9A 2N4FA 2VZKD 2RDGA 3EGRA 4FXCA 3VHTC 3T3OA 4TUUA 2LGSA 4US8A 1TBEA 1WZ0A 2GI9A 4Q2JA 2KHWB 3VUXA 2CU1A 3EC8A 4M02A 1L7YA
chains in the Genus database with same CATH topology
3BWUD 1TKGA 3W5UB 4JWUC 1FXIA 2BBCA 2WXHA 4WWMA 4IKGA 2DLBA 4PT5A 2I2YA 1PDXA 4B0EA 2CU3A 3NVWA 3AE2B 2BTEA 4MH8A 1SBBB 1AW7A 3TUOA 2BB5A 3ETRA 4JE3B 1KFYB 1QOGA 1EU3A 4HKQA 3P1MA 3Q8CA 2W54A 3CWIA 3HVZA 4USAA 4ZOHC 1PGAA 1YQ3B 2BB6A 1CZPA 1YJIA 4DXGA 4ITKA 1SSNA 1V1OA 3KWLA 2FBWB 2L83A 3HUIA 2ONQA 3B2FA 1T3QA 3BVZA 3BIID 2BS2B 1JW9D 3P4QB 4OZBA 2G9HD 1N61A 1E6EB 1TS5A 3NVYA 1OQQA 3T3NA 3AEBB 4B0MA 1IBXA 2WXPA 1MHXA 1N60A 1GOZA 1T5XD 3I57A 3ZJTA 1DOYA 1NEKB 3PO0A 5HI1A 2QIEB 5BMIA 3E56A 1UWXA 1B9RA 1RYJA 1C79A 1C77A 2QMTA 1K51A 3AE4B 1SE3A 3V3XA 2XNAC 3VQIA 2N9KA 3P4PB 1HZ5A 2NTTA 2PVGC 4N59A 1JROA 3KLSX 3L4PA 1A70A 4HROA 1YN3A 1M4VA 4P16A 4R3DA 4RFBA 4MM3B 4N58A 2WXKA 1PFDA 4YT0B 4MT5A 2JU6X 3ZQ4A 2AQ2B 3AB5A 1L5PA 1JRPA 3URYA 1OQRA 5JXVA 3PZ7A 3FILB 1PGBA 4WH4A 1VRAB 3GS2A 1SXTA 4XE0A 1WWTA 2JWUA 1QOBA 1D5XC 2H88B 2DBYA 3Q8EA 5GXGB 2RDHA 1Y56A 2N0SB 1KLGD 3B2GA 2PIAA 1D4BA 1WXQA 1L6UA 2WQYB 4ZHPA 2QSDA 3AN1A 1HQRD 2JYEA 4NAWB 4WAFA 1F77A 2L52A 3BK1A 1OFFA 1FMAD 2ZW0A 3O13A 4L2YA 1HXYD 2QJLA 1SB3C 1L0XB 4AS1A 1V97A 5D3DA 2YEPB 2HDEA 4OW0A 5BMGA 3Q8AA 5HG2A 2OEDA 3BVMA 4RGTA 1RFKA 4GDLB 3Q69A 3FC4A 4ZRPA 1AN8A 1I4QA 1FNWA 1JCKB 1SJHD 2KDMA 1I4RA 3P42A 3E9SA 2J52A 4OVZA 1DOXA 1K52A 1I4XA 4ARIA 1YMHE 2V0GA 2INNE 3I9V1 4TSSA 1FCCC 3WCQA 2KMMA 1ACCA 3AE1B 3BYYB 2K3UA 3BZDB 1QF6A 1XXGA 3TEZA 3SFEB 2PVOD 3VRBB 2TSSA 4RNAA 4TQ1A 1VR9A 1EWCA 5AUIA 5FKAC 4D2KA 1ZPSA 5T8IA 1V1PA 1VZ8A 2BS4B 2WNMA 1Q10A 2INPE 5C2TB 3C8YA 1KRHA 3KQ4A 3IAS1 2BW2A 5H92C 1XCQL 2K22A 2WP9B 4ZHOA 3V05A 2N9LA 1IUEA 1DGJA 4CQNA 2E3TA 4JX1C 4ARCA 4OZCA 3HRDD 1EU4A 1C4AA 3AEDB 4RF0A 1B1ZA 1TS4A 2B76B 1XLOA 1MI0A 2JXTA 1FIQA 3Q8FA 2HTME 3BK2A 4DXFA 3TEWA 4P6VF 3IAM1 3AEAB 5E6JA 3SR6A 1UGJA 1DYQA 1NYRA 2PW9A 4XWTA 3AM9A 1VJKA 4C80A 2LUMA 2D5GA 1D5MC 5HHDG 4A9AA 1XLNA 2JZPA 1UUPA 1JWMD 4XWWA 3MC0B 5EE3A 1WYGA 2WXNA 1NVID 3NVZA 1I7HA 3CIRB 3DWMA 2FE8A 2DWQA 4RGOS 1VZ7A 2IPKD 3NZ3A 1ZDVA 1ZOYB 3NRZA 1FCLA 1ZXIA 2JX5A 2M0AA 4WQMA 1GB1A 1I4GA 2LGIA 3AE8B 1F0ZA 1JALA 2K9XA 2KWDA 1YNTE 2XN9C 1PUTA 4YSYB 2M56B 1C78A 2QEJC 1AWDA 3ZJUA 3DWGC 2FUG1 4ZRQA 2WXOA 3AMZA 1MVKA 5MPOA 2YEPF 1QQRA 2M19A 1ZDXA 1KLUD 2Q5WD 2WXQA 1JWAD 5AUKA 2Z8LA 3PZ8A 4YSXB 2MJDA 1ZP0B 1V8CA 1TKEA 2SEBD 2V4IB 5BMHA 3ZJVA 1WSPA 2WU2B 1E0ZA 3LYYA 2W82A 1TKYA 5EE9A 3EUB2 1JWUD 1FFVA 4RGMA 1FXAA 3RPFC 4YWGG 1YQ4B 4XDCA 2I38A 4C7YA 4GLSC 2H89B 1L0YB 1FM0D 1ZUD2 3FILA 3AE5B 4A55A 1ET6A 1CK1A 2Y5PA 3AE3B 2N7JA 4DQOC 1J7CA 1VDVA 5HFYA 2BYTA 1XCTL 4A6QA 1C9FA 1N62A 4O1NA 1GPXA 4H2AA 1ET9A 4OZAA 3FAHA 2J53A 2ON8A 3P4RB 1C4PA 4REZA 5H8YE 3GB1A 1XEEA 1TS3A 1AYFA 5LNK1 2KQ4X 3NVVA 1BUIC 1JMLA 2CJOA 5BYQA 1ENFA 1ROEA 4YTPB 5D3IB 1D6EC 1KH0A 1VZ6A 3R2IA 3UI3A 2WXRA 1QILA 2ICIA 1FO4A 2ACZB 3N9YC 3AH7A 1QT9A 3EA6A 1STEA 4HJGE 1R7SA 2QILA 2V3NA 1FRRA 1VLBA 2BT6A 4RF1A 2X38A 1FEHA 3KWVA 2WXGA 1XF5L 2MH7A 4KKJA 3R8BA 1ZXHA 1E9MA 3U52E 1LO5D 4HKZE 4C7ZA 4ZYSA 2K0PA 1FD6A 2RMMA 1SF0A 3TEYA 2LMCA 4JPSA 1JWSD 3W1SA 1UNSA 3IXSA 1E7PB 2WXJA 1V1PB 2ZW1A 3LXFA 1BXTA 1FNUA 1FFUA 2MJ3A 1MPEA 4RGNA 4NJCA 2IGHA 4A90A 1MHHE 1P7FA 2W55A 2Y5CA 1SJED 4WURA 4KGSA 2WXMA 2J42A 4WIPA 2KAJA 3R2TA 2W3RA 1IGCA 3P4SB 2V3PA 4YTNB 2W3SA 1WGKA 4OHJA 4N6EB 3ZYYX 4XDDA 4EE2A 4GDKB 1F2RI 1TY0A 1EM7A 4C56C 3B9JA 1SE4A 4KKIA 2RPVA 1XO3A 1K50A 1P7EA 1K53A 1L6VA 3AECB 1PGXA 3LB8C 2PKOA 2Y3AA 3U4EG 5C3JB 1IBXB 3RFZB 5TSSA 1L4ZB 2BS3B 1NYQA 1TS2A 2G1EA 2WXIA 4A8XC 1HA5A 3U7ZA 3MFGA 1ZE3D 1J7AA 1YJJA 3AEGB 4YXDB 2AQ3B 3H8HA 4TMAB 1RM6C 1N63A 1E10A 1QLBB 1XLPA 5EE0A 4LK0M 5G5HA 2J4XA 4RCOA 2WS3B 3MJ5A 1KTKA 3VR9B 4YSZB 3VRAB 4AQ7A 1SEBD 2LHEA 3MP9A 2AX5A 3OWEB 1N5XA 1NI3A 1CQVA 3AE9B 2CJNA 2WXFA 3AE7B 4KGRA 1C4CA 2PLPA 4KX6B 1SIJA 1F2RC 5D7GA 2MJEA 2LFIA 1KF6B 3AEFB 1NENB 1TZOA 1FRDA 1YN4A 2KACA 3W9CB 4TQ0A 3BYTB 3AV8A 3HVDA 1TJEA 1C76A 2OHFA 1HEZE 1PYWD 2WDQB 2WXLA 3ZGZA 4UDUC 1GB4A 5EE1A 4JWSC 1YN5A 1T6BX 5I4DA 3MHZA 2JQRB 3NUHB 2PMVA 1ESFA 2L32A 3U2SC 4HEA1 3VR8B 2VZKB 1TY2A 1N5WA 2IJ0A 4YTMB 1IGDA 4NZLB 4NAMA 2L1AA 5G5GA 1FNVA 1HZ6A 2IGGA 3AE6B 2EELA 2IGDA 4IOIE 4US9A 3W2DA 4HRSA 3AEEB 1BMLC 3W5VB 1TYGB 2GRIA 1UWMA 2K5PA 2LEKA 4J3OD 5BYSA 2NTSA 1DOIA 1D5ZC 2EKIA 2R61A 3SEBA 1QKZA 3TSSA 3GP7A 1L0VB 5FK9C 2JSVX 3P63A 2MEKA 1L4DB 2AQ1B 2LHDA 1WRIA 3BVGA 2DYMA 5FR3A 1JQ4A 2JYTA 4LLGM 5BYRA 2GB1A 4LTUA 1I4HA 1JWBD 4IDIA 3Q8BA 1EWYC 2DYOA 4KGTA 2WDVB 3NS1A 2E6XA 3J9CA 3TEXA 4L23A 2NMQA 2WU5B 4MACA 4RH6A 2WLBA 2VZKD 2RDGA 1QOAA 3EGRA 1RWSA 4FXCA 1XLQA 3SFDB 3T3OA 3IT6B 2KN4A 2LJIA 3IT4B 1CJEA 4US8A 2GI9A 1J7BA 1QOFA 1I4PA 4Q2JA 2PTLA 4M0WA 4L1BA 3ABVB 1SE2A 2SAKA 1GAQB 2IDYA 2WDRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZ7 A;  2VZK D;  3IT4 B;  1VRA B;  2YEP F;  2VZK B;  1VZ8 A;  2V4I B;  3IT6 B;  1VZ6 A;  2YEP B; 
#chains in the Genus database with same CATH topology
 3S2A A;  2ZVN A;  4MJS A;  3B0A A;  4W9F A;  4WWM A;  4BKS D;  2DLB A;  4W9I A;  2I2Y A;  1R4N I;  3HM6 X;  4NNJ B;  2CU3 A;  3VUY A;  4B0E A;  3AE2 B;  1MG8 A;  3TUO A;  3ETR A;  3U7D A;  1QOG A;  1EU3 A;  1V81 A;  2W54 A;  3CWI A;  4BOS C;  2KFK B;  3WAO A;  2C5L C;  2BB6 A;  2OJW A;  3WIM A;  4DXG A;  2L83 A;  2ONQ A;  3B2F A;  1T3Q A;  2MWS B;  3UF8 A;  3P4Q B;  4OZB A;  1U4A A;  5KHO A;  2G9H D;  2EKE C;  3NVY A;  5AEK B;  1OQQ A;  3ZVV A;  1IBX A;  2WXP A;  4G0N B;  1N60 A;  3ZJT A;  1F52 A;  5E6P A;  3PO0 A;  3NY5 A;  2K6D B;  1RYJ A;  2L0T A;  1V6E A;  3RNE C;  4AWJ A;  3V3X A;  2XNA C;  2N9K A;  3JVZ X;  5LLI A;  2ZVO A;  2J0K A;  4K3B A;  4NJ6 A;  3MC9 A;  1Z2M A;  4RFB A;  2G4S A;  2CHZ A;  4R3D A;  4MM3 B;  2DZI A;  2IBI B;  1L5P A;  4KIK A;  4WWO A;  2LD9 A;  3RNC C;  4RM8 A;  3DBR B;  2VH1 A;  4W9J A;  2DBY A;  2Z59 B;  3WA0 A;  3KYC D;  1GG3 A;  2HTH A;  1H4R A;  3B2G A;  2PIA A;  2KLG A;  1L6U A;  2WQY B;  2N7D A;  3ZLZ A;  5G55 A;  3MJW A;  4WAF A;  5L83 A;  2L52 A;  3BK1 A;  3ZRC A;  1F1H A;  2ZW0 A;  3VAW A;  1WX8 A;  1P98 A;  1R4N B;  4ASW C;  1SB3 C;  4S17 A;  4IW0 A;  2NR2 A;  2QHO A;  5HG2 A;  2OED A;  4JIO U;  5E6O A;  3TJP A;  2KYW A;  4ZRP A;  1I4Q A;  1FNW A;  3DHI C;  1UF0 A;  3R7R A;  4WWP A;  1SE9 A;  1DOX A;  1K52 A;  2K39 A;  3I9V 1;  1ACC A;  1WXV A;  3BYY B;  4W9L A;  3RD2 A;  1XD3 B;  2PVO D;  4BZA A;  3UQB A;  1EWC A;  2KT7 A;  4ICU A;  3PPA A;  4HCN B;  3D32 A;  2KDE B;  5C2T B;  2FIF A;  3KQ4 A;  1I42 A;  2N9L A;  1IUE A;  4IWQ A;  1DGJ A;  4D72 A;  4GIV A;  4ARC A;  1EU4 A;  4I6N B;  3ZTD A;  3IG3 A;  1TS4 A;  3PRP B;  2NBW B;  3BK2 A;  3ZRF A;  4W9E A;  3SR6 A;  5E6J A;  1UGJ A;  4D6J A;  1VJK A;  4GDK A;  1UUP A;  5TR5 A;  2L0F A;  3WAN A;  3OJ4 B;  1S3S G;  3BY4 B;  1NVI D;  2DNF A;  3N30 A;  4RGO S;  2WMI B;  4K7S A;  3R66 C;  1P1A A;  3BIN A;  2J0J A;  4ACF A;  2DX5 B;  3AE8 B;  2M4N A;  2KWD A;  2O6V B;  4I6P A;  1CMX B;  2XN9 C;  5J2R A;  1C78 A;  2QEJ C;  3ZJU A;  2L00 B;  2FUG 1;  4TV3 A;  4HWI B;  4XC2 A;  2QCZ A;  1QQR A;  2M19 A;  1BT0 A;  3CST A;  2Q5W D;  4PS8 A;  4YSX B;  1V8C A;  2SEB D;  5BMH A;  1WSP A;  2WU2 B;  2W82 A;  2ZJD A;  5EE9 A;  4HPM B;  1FXA A;  3QC8 B;  4D6D A;  2JY6 A;  4GLS C;  4A55 A;  2CS4 A;  4JGH B;  3NJT A;  3AE3 B;  2N7J A;  1J7C A;  5IA7 A;  2BYT A;  1WYW B;  3PV1 A;  3LJ3 A;  4H2A A;  4QAY A;  3VXW A;  4ANW A;  2ON8 A;  2M0X A;  1IYF A;  2KAN A;  2CJO A;  1ROE A;  5D3I B;  2KZR A;  3ZUN A;  3N9Y C;  3AH7 A;  1QT9 A;  3EA6 A;  2JVC A;  3CMM B;  2BT6 A;  2G3Q B;  4HDQ A;  1XF5 L;  2MH7 A;  2MW5 A;  4KKJ A;  3U52 E;  4IG7 B;  4C7Z A;  3ZNH B;  2RMM A;  3TEY A;  2LMC A;  1JWS D;  2WXJ A;  1WGY A;  2ZW1 A;  1T0Y A;  3TMP B;  1FFU A;  1MPE A;  4A90 A;  2KVR A;  1SGH A;  1SJE D;  4WUR A;  2J42 A;  4MGY E;  2W3R A;  4ZYN A;  2W3S A;  2ZCB A;  4A3O A;  4N6E B;  4XYC A;  1AAR A;  1YQB A;  1S1Q B;  1HE8 A;  2JZ3 B;  4DHZ B;  2BKF A;  4ZRI A;  3AEC B;  2KFK A;  2XK5 B;  1IBX B;  3QHT A;  3RFZ B;  2FCM A;  1L4Z B;  2IY1 B;  4OVU A;  2WXI A;  2G1E A;  3Q3J A;  3U7Z A;  3MFG A;  4E3C A;  1ZE3 D;  1J7A A;  1KJT A;  2AQ3 B;  4TMA B;  1N63 A;  4FJY A;  4LK0 M;  1L2N A;  2PE9 A;  3LDZ E;  3L16 A;  1SEB D;  3AU5 A;  1KOT A;  2C9W B;  2B3A A;  1NI3 A;  3AE9 B;  1G6J A;  1QZE A;  3ML8 A;  4KGR A;  3HIZ A;  1N6Z A;  1SIJ A;  2NPT B;  2JWZ A;  2MJE A;  2LFI A;  4MM3 A;  2GBN A;  3EEC A;  1NEN B;  4I6L B;  4TQ0 A;  3AV8 A;  3HVD A;  1TJE A;  1C76 A;  2OHF A;  1HEZ E;  1GB4 A;  2J0M A;  4JWS C;  4IM0 A;  5EDS A;  1WR6 E;  2C60 A;  3MHZ A;  2PMV A;  5AZG A;  4P7I A;  1PQS A;  4IWP A;  5DCN A;  2N1W A;  1TY2 A;  3WAP A;  2MBB B;  4YTM B;  3RZW C;  4NZL B;  2L1A A;  4F8C B;  4RM9 A;  4IOI E;  3PSE B;  4HRS A;  2CR5 A;  2GRI A;  2FID A;  1GC7 A;  1UWM A;  2W9N A;  2LEK A;  3DDC B;  3SEB A;  1QKZ A;  2D07 B;  3GP7 A;  3ZXV A;  5IAA C;  2JSV X;  1WX9 A;  2LHD A;  3PLV A;  2KC2 A;  3DVG Y;  3PT2 B;  1JQ4 A;  2JYT A;  5BYR A;  3A9K B;  4LTU A;  4BOZ B;  4XGA B;  1NDD A;  3Q8B A;  5CHV C;  1V80 A;  3ZW3 A;  1TGZ B;  2E6X A;  3TEX A;  2NMQ A;  3A33 B;  4CO7 A;  3R3M A;  4BBN C;  1QOA A;  1RWS A;  3SFD B;  5BO4 B;  3UGB B;  3DVN V;  1TIF A;  2PTL A;  2N1V A;  4JQW C;  3APC A;  2IDY A;  2WDR B;  4KDI C;  4KSL C;  3W5U B;  4JWU C;  3H6N A;  1XQQ A;  1PDX A;  2BPS A;  4MH8 A;  1E7U A;  2AL6 A;  1KFY B;  3RT3 B;  3NS8 A;  4HKQ A;  2KJH B;  3Q8C A;  4USA A;  2WGS A;  2MRP A;  1YQ3 B;  1CZP A;  1YJI A;  2JF5 A;  4ITK A;  2KC1 A;  3HUI A;  4LCD E;  2RDB C;  4PYZ A;  1E6E B;  1TS5 A;  2WMI A;  2IND C;  3I57 A;  1DOY A;  3H9D A;  4MSM B;  4HLE A;  2YVC A;  1C79 A;  1WGD A;  1YIW A;  3VQI A;  4BKT A;  1JRO A;  1OQY A;  3DPD A;  3NOB A;  3PZD A;  3L4P A;  3DVG X;  1M4V A;  4D6I A;  4YT0 B;  2JU6 X;  3ZQ4 A;  2AQ2 B;  4GU2 A;  4TKN A;  3APF A;  3X0W A;  2LXA A;  3GS2 A;  4XE0 A;  3Q3O C;  2MBH A;  1WJU A;  4DBG A;  2K8C A;  4HDO A;  5GXG B;  4ZRJ A;  3WAM A;  1T0S C;  2MCN B;  4DDG D;  3AN1 A;  1WXS A;  1H8C A;  1F77 A;  2MBO A;  3N3K B;  3NZS A;  2KNB A;  4D71 A;  1EF1 A;  4L2Y A;  1HXY D;  2QJL A;  4AS1 A;  3UIP B;  5D3D A;  2KQS A;  2YEP B;  2AWT A;  5BMG A;  3QAR A;  1RFK A;  2RSU A;  1YX5 B;  1AN8 A;  2REX A;  1SJH D;  2KDM A;  1E8Z A;  1I4R A;  4K1R B;  5FR6 A;  3E9S A;  4OVZ A;  3AU4 A;  3PLU A;  4ARI A;  1YMH E;  2LXC A;  3RCZ A;  2V0G A;  4BKS A;  4TSS A;  1YX6 B;  1FCC C;  4II3 B;  2KMM A;  2JUO A;  3KVF B;  4M0W B;  3BZD B;  1QF6 A;  3TEZ A;  3RNA C;  1ZW7 A;  2TSS A;  4TQ1 A;  5FKA C;  4D2K A;  5T8I A;  1WGR A;  2WNM A;  4DHJ D;  2BW2 A;  3TCA A;  5H92 C;  2WP9 B;  4ZHO A;  3V05 A;  2KFJ A;  3AUL A;  3DBL B;  2KWV B;  4OZC A;  1V5T A;  1XLO A;  3K9O B;  3Q8F A;  2HTM E;  4P6V F;  4WJQ A;  2DAF A;  2V9H A;  2PW9 A;  3AM9 A;  4C80 A;  3ZKJ C;  2LUM A;  4A9A A;  2JZP A;  2KLC A;  5EE3 A;  3U30 A;  2WXN A;  4PS3 A;  3ZNI D;  2XK5 A;  3CIR B;  3DWM A;  3MTN B;  1VZ7 A;  3QCA A;  2IPK D;  2J7Q B;  1WX7 A;  1OEY J;  3NRZ A;  3AXC A;  4B6W A;  1FCL A;  4WQM A;  4W9C A;  1I4G A;  1MG4 A;  2K9X A;  1WY8 A;  2BYV E;  1D3Z A;  3DWG C;  4ZRQ A;  1V49 A;  5JZE B;  5MPO A;  5J17 A;  1ZDX A;  1Z5S B;  2NBU A;  1KLU D;  1JWA D;  2Z8L A;  2ZZP B;  3PZ8 A;  2MJD A;  1TKE A;  2FNJ B;  4ZRK A;  2JRI B;  3ZJV A;  2NPT A;  3LYY A;  2LRU A;  1TKY A;  2AYO B;  1FFV A;  3TIX A;  1A5R A;  3U8Z A;  4DDI D;  1WFY A;  1YQ4 B;  2I38 A;  4C7Y A;  1L0Y B;  1ZUD 2;  2LGD A;  1CK1 A;  2Y5P A;  3VH4 B;  1IPG A;  1KM7 A;  1WI0 A;  4AOF A;  1NI2 A;  1XCT L;  4KDL B;  5D94 A;  1R4M I;  4AUQ C;  2IO3 B;  1FXT B;  1GPX A;  1ET9 A;  2MBQ A;  2J53 A;  1ISN A;  3DVN U;  3A1Q A;  3GB1 A;  1AYF A;  2KQ4 X;  3KW5 B;  2KOX A;  2JZZ A;  4YTP B;  3DBH I;  3R2I A;  1E5W A;  1QIL A;  4D6F A;  2ACZ B;  1WJN A;  1R7S A;  2QIL A;  5LXI B;  2WX1 A;  2X38 A;  4AP4 C;  1ZXH A;  2RR9 A;  3PS6 A;  2KK8 A;  3A9K A;  3HM3 A;  4FA6 A;  4CYE A;  4AJY B;  4HKZ E;  3N1Z C;  3R7Q A;  4W9K A;  4JPS A;  4MEM A;  1V1P B;  1FNU A;  2KVZ A;  4NJC A;  4KSK C;  2Y5C A;  4PS7 A;  2WXM A;  4WIP A;  2KAJ A;  3R2T A;  5DPS A;  5IKC M;  1IGC A;  2BWE S;  3IHP C;  1RFA A;  3H7S A;  3ZYY X;  2KMC A;  1F2R I;  4C56 C;  1EM7 A;  2PEA A;  2G4D B;  1SE4 A;  2V1Y A;  4KKI A;  2RPV A;  2M17 A;  2I1K A;  2PKO A;  2Y3A A;  3GE3 C;  5TSS A;  2D2Q A;  4E74 A;  4LDT D;  2KX0 A;  2D3C A;  1YJJ A;  2BQQ A;  4YXD B;  1EF5 A;  1R4M B;  4IM2 A;  1QLB B;  2D3G A;  4P1B C;  2XBB C;  2WS3 B;  4RCO A;  2ASQ A;  3MJ5 A;  1J0G A;  5IOI A;  3VRA B;  4A3P A;  4G50 A;  2LHE A;  2PE6 B;  4GSW A;  4MGK E;  4W9D A;  3MP9 A;  2AX5 A;  3OWE B;  1N5X A;  1CQV A;  2EMT A;  3AE7 B;  2PLP A;  4PK1 A;  3JSV B;  3IFW B;  5E6N A;  1FRD A;  3W9C B;  2NBV B;  4W9H A;  2K8H A;  3ZXR A;  3A4R A;  5EE1 A;  1IP9 A;  1YN5 A;  1T6B X;  5IP4 D;  3QK0 A;  5I4D A;  3Q3M C;  2JQR B;  3NUH B;  3ZDT A;  4NJ7 A;  3M62 B;  2DEN B;  4PYU A;  2L32 A;  4LNI A;  2VZK B;  2FCN A;  3RMK C;  3HK0 A;  2M8S A;  2L3Z A;  4GN1 A;  2IGG A;  3AE6 B;  4FHJ A;  3W2D A;  3AEE B;  2NTS A;  4M00 A;  1DOI A;  1D5Z C;  2R61 A;  3TSS A;  2JT4 B;  2Z0E B;  2MEK A;  2D3A A;  4DHJ B;  1UZX B;  4LLG M;  4LJP B;  2GB1 A;  4J6I A;  2DYO A;  4B9K A;  3ZDM C;  3ZNG C;  3J9C A;  1UD7 A;  2DZM A;  4YL8 A;  1XLQ A;  2IZV B;  2HD5 B;  2KJ6 A;  1T0R C;  2KN4 A;  3Q3F A;  2A5U A;  2IYD B;  4ANV A;  3X23 A;  3IT4 B;  1CJE A;  4DK5 A;  4WQO B;  1J7B A;  1QOF A;  1I4P A;  4HPP A;  2XEW A;  4M0W A;  4L1B A;  1SE2 A;  1TZ1 A;  2SAK A;  2D11 A;  3KUC B;  2O2V A;  1J19 A;  3N32 A;  3TBL D;  4IKG A;  3ENE A;  4PT5 A;  4NQK E;  3NVW A;  1SBB B;  4K81 A;  2BB5 A;  4ANX A;  1WGG A;  4CHK A;  5DPT A;  1I35 A;  2KXJ A;  3RNB C;  1PGA A;  3L10 B;  1V1O A;  3KWL A;  2FBW B;  4M8M A;  2BGF A;  2LZ6 A;  1X1M A;  1N61 A;  4F7Z A;  2LVQ A;  3T3N A;  2BKR B;  4GOC A;  3L08 A;  2OJR A;  2IY0 B;  5BMI A;  2INC C;  3APD A;  3E56 A;  1B9R A;  1C77 A;  1SE3 A;  1MFW A;  1OTR B;  3ZNZ B;  1FPY A;  2WYQ A;  2OOB B;  5CHF A;  1A70 A;  1YN3 A;  3ZIM A;  4P16 A;  4N58 A;  2WXK A;  1PFD A;  2N9X A;  4MT5 A;  4LNK A;  1JRP A;  2GOW A;  1OQR A;  3URY A;  5JXV A;  2Y5B B;  3PZ7 A;  1E8Y A;  4WJP A;  1VRA B;  2MA9 B;  4LNF A;  2JPH A;  2JWU A;  1QOB A;  2R2O A;  3VFK A;  1SIF A;  2BWF A;  2RDH A;  3VTW A;  1Y56 A;  3A1Q B;  3Q3N C;  5CTR C;  1KLG D;  4NY0 A;  1WXQ A;  2WDT B;  4XX5 A;  2QSD A;  1LFD A;  1HQR D;  1LLQ A;  1OFF A;  1V86 A;  3O13 A;  2C7N B;  2KJR A;  3OJ3 A;  1L0X B;  2ZPN A;  3RUI B;  1V97 A;  4WJN A;  3SDL C;  1RRB A;  2HDE A;  3Q8A A;  4M01 A;  1C1Y B;  2KTR A;  4GDL B;  3Q69 A;  3KUD B;  4HJK A;  2WHI A;  3K9P B;  2N9P C;  3FC4 A;  2I1J A;  1OEY A;  5CHW A;  2J52 A;  2WX0 A;  4BBN F;  4RMA A;  1UH6 A;  2AL3 A;  3WCQ A;  3MHS D;  3AE1 B;  4GGQ A;  2K3U A;  1T0Q C;  1XXG A;  2KO3 A;  2LVP A;  3VRB B;  4RNA A;  1VR9 A;  1WJ4 A;  3MC8 A;  1E8W A;  1V1P A;  1Q10 A;  2INP E;  3C8Y A;  1KRH A;  2MBE A;  3IAS 1;  1XCQ L;  4LDT B;  4D6C A;  3KYD D;  2E3T A;  3DOW A;  3HRD D;  5LXH A;  4RF0 A;  2NCN A;  2FCQ A;  2B76 B;  1VCB A;  3KH0 A;  3IAM 1;  3AEA B;  3M3J A;  4XWT A;  2D5G A;  4EKU A;  2K25 A;  2MX2 A;  1JWM D;  4XWW A;  3MC0 B;  4FN2 A;  3NVZ A;  1I7H A;  3NZ3 A;  2LGX A;  3O65 B;  1ZDV A;  4N9F 4;  2JX5 A;  1GB1 A;  1JAL A;  4EFO A;  2FUH B;  2LJ5 A;  3JYU A;  5C23 A;  4YSY B;  2M56 B;  2ZNV B;  4MDK E;  1E8X A;  1AWD A;  4W9G A;  2WXO A;  3I5J C;  3AMZ A;  2AEH A;  5CX3 A;  1EUV B;  2KKC A;  2WXQ A;  5AUK A;  3SD5 A;  3JSV A;  2V4L A;  2K6Q A;  3EUB 2;  1JWU D;  3DBS A;  3RPF C;  4YWG G;  1TTN A;  4XDC A;  2KTF A;  2H89 B;  2O6V D;  4BKG A;  1FM0 D;  3V60 A;  3FIL A;  1VDV A;  5HFY A;  2VRR B;  4HK2 A;  4OZA A;  4BAX A;  4KVG B;  3QAQ A;  2LUE A;  1C4P A;  5H8Y E;  3PGE A;  1XEE A;  1TS3 A;  2QC8 A;  5LNK 1;  1BUI C;  4NAW A;  1ENF A;  1NBF C;  1D6E C;  4FJV B;  1FO4 A;  2WXR A;  4P1C C;  1VD2 A;  2VH2 A;  4HJG E;  2V3N A;  4JLC A;  2BF8 B;  4RF1 A;  1FEH A;  2WXG A;  3T9L A;  4AJW A;  1E9M A;  1WMH B;  1LO5 D;  4NQL B;  2GBK A;  3ZO5 B;  3OG5 A;  5JHB A;  1XT9 B;  1FD6 A;  1SF0 A;  3UIN B;  4EUT A;  3NZU A;  2ZPY A;  1ZGU B;  2O2V B;  3DBR I;  1E7P B;  3LXF A;  3V62 A;  2K1F A;  2R2Q A;  2IGH A;  2NVU I;  2W55 A;  1P0R A;  2DZK A;  2MSE D;  3P4S B;  3IVF A;  4MGI E;  1WGK A;  4D6H A;  2L76 A;  2EMS A;  1V5O A;  4XDD A;  4EE2 A;  3V6E B;  1TY0 A;  3B9J A;  4HCP B;  1OGW A;  4A20 A;  1K50 A;  1P7E A;  3LB8 C;  1L6V A;  3U4E G;  5C3J B;  1TS2 A;  4A8X C;  1HA5 A;  4D6G A;  2WWZ A;  3H8H A;  1RM6 C;  1M94 A;  1E10 A;  5G5H A;  2ZEQ A;  5D2M B;  3Q14 C;  2DAJ A;  2GLS A;  1KTK A;  3VR9 B;  2JXX A;  1MJD A;  2RGF A;  3SHQ A;  2FAZ A;  3WAL A;  5D6J B;  1EO6 A;  4LJO B;  3DQV A;  3PHX B;  2KWU B;  1C4C A;  4IC7 B;  3ECI A;  4E71 A;  1F2R C;  2RD0 A;  5D7G A;  4C4V A;  2KQ7 A;  4FLH A;  1KF6 B;  2K8B A;  3AEF B;  1YN4 A;  2KAC A;  2CHX A;  1RAX A;  1PYW D;  4HXD A;  1P9D U;  1WE6 A;  2KMA A;  4DHZ E;  2HE7 A;  3Q2A C;  1UBQ A;  3VR8 B;  3U2S C;  4HEA 1;  4GMV A;  2IJ0 A;  4MGZ E;  4S0R A;  5G5G A;  1FNV A;  2KTR B;  2IGD A;  4US9 A;  1BML C;  3M63 B;  3A9J B;  3HHM A;  1LXD A;  3VUW A;  1YJ1 A;  3I3T B;  2D10 A;  5FK9 C;  2WMF A;  2GBR A;  1L4D B;  2AQ1 B;  2MHJ A;  5J18 A;  4GDL A;  3Q6B A;  3PRE A;  1HTQ A;  2GMI C;  1WE7 A;  4IDI A;  3TL5 A;  2WDV B;  3NS1 A;  4KV2 A;  4FUL A;  2WU5 B;  4MAC A;  4RH6 A;  2WLB A;  5C1Z A;  4IWO A;  3T8M A;  2IO1 B;  2JRH A;  3IT6 B;  5AZF A;  1GJZ A;  3VDZ A;  2LJI A;  2QDF A;  4HPL B;  2KD0 A;  2DZJ A;  3ABV B;  3H7P A;  3AI5 A;  1GAQ B;  3PTF C;  4NPN A;  4WJO A;  3GOE A;  3RN9 C;  2PPH A;  3BWU D;  1TKG A;  2CHW A;  3C19 A;  1FXI A;  2BBC A;  2WXH A;  2MLB A;  1C3T A;  1TT5 B;  3GE8 C;  2BTE A;  1AW7 A;  1WH3 A;  3N20 C;  5IN7 A;  4JE3 B;  1GNU A;  4ANU A;  4EZJ A;  3P1M A;  2UWQ A;  3HVZ A;  4ZOH C;  2YLM A;  1SSN A;  4LNO A;  1GUA B;  3BVZ A;  3BII D;  2BS2 B;  1F9J A;  4K7U A;  2PJH A;  1JW9 D;  5DPR A;  2KDI A;  4ICV A;  1ZKH A;  2LVO A;  3AEB B;  4B0M A;  1MHX A;  1WZ3 A;  1GOZ A;  1T5X D;  1LM8 B;  1NEK B;  4EOY A;  2BYF A;  5HI1 A;  2QIE B;  3L17 A;  3DBH B;  2A4Z A;  1WJ6 A;  1UWX A;  2M1M A;  3CSF A;  2G45 B;  2QMT A;  1E90 A;  1K51 A;  3AE4 B;  2KDB A;  3N1X C;  1Y8R C;  3P4P B;  1HZ5 A;  2NTT A;  2MP2 A;  2PVG C;  4N59 A;  3KLS X;  4HRO A;  3N1Y C;  3AB5 A;  2WMK A;  1GC6 A;  3W1Y A;  3FIL B;  1PGB A;  4WH4 A;  1SXT A;  1WWT A;  5GMV A;  2D3B A;  1D5X C;  2H88 B;  3Q8E A;  4XZ4 A;  4LNN A;  2N0S B;  2LWP A;  1D4B A;  3ZTC A;  4ZHP A;  2JYE A;  4NAW B;  3C0R B;  1HTO A;  4FBJ B;  1FMA D;  1Q5W B;  3DHG C;  2GBJ A;  4MSQ B;  2KX3 A;  4OW0 A;  3VH3 B;  4EZK A;  3BVM A;  4RGT A;  4FAD A;  2WMJ A;  2V3S A;  1JCK B;  3UIO B;  3P42 A;  3RI7 C;  1I4X A;  4EEW A;  3EFU A;  2INN E;  1WMH A;  3ALB A;  3QWZ B;  3EFC A;  1LQB A;  4F1S A;  3M95 A;  1V2Y A;  3SFE B;  3PRM B;  5AUI A;  1ZPS A;  2KWC A;  1WM2 A;  1VZ8 A;  2BS4 B;  1UBI A;  1UEL A;  2N9E B;  4MJS B;  2BYE A;  3H1U A;  2K22 A;  1KLV A;  1JRU A;  1K8R B;  2ZNV C;  4CQN A;  4JX1 C;  1WM3 A;  1C4A A;  3AED B;  1B1Z A;  4C00 A;  1MI0 A;  4IM3 A;  2JXT A;  4OVV A;  1FIQ A;  4DXF A;  3TEW A;  1E7V A;  4K3C A;  4G11 A;  1DYQ A;  1NYR A;  1D5M C;  5HHD G;  4URK A;  1XLN A;  3RUL A;  1WR1 A;  1WYG A;  2CKH B;  2FE8 A;  2DWQ A;  3B1L X;  3A4S C;  1ZOY B;  1ZXI A;  2M0A A;  4WWN A;  2LGI A;  1F0Z A;  3QX1 A;  3V6C B;  4G3X B;  1YNT E;  5G2N A;  2MQJ A;  1WGH A;  4M8N A;  1PUT A;  4MEL A;  4C4V B;  1Q0W B;  1MVK A;  2YEP F;  4IUM B;  5AZH A;  3B08 A;  4KIK B;  1ZP0 B;  4D6E A;  2IO2 B;  2V4I B;  5KHQ A;  3OAW A;  1E0Z A;  2L7R A;  1WIA A;  4RGM A;  3GZN I;  3OLM D;  3RNG C;  4KZ0 A;  1YD8 U;  2FCS A;  3AE5 B;  1ET6 A;  4JL9 A;  4X57 B;  1RLF A;  3SU8 X;  4DQO C;  3EHV A;  2RPQ A;  4A6Q A;  1C9F A;  1LGR A;  1N62 A;  4O1N A;  3V61 A;  1WXM A;  5HKH A;  5JHA A;  3FAH A;  3P4R B;  3L54 A;  4REZ A;  1Q1O A;  4HVB A;  3NVV A;  1JML A;  5BYQ A;  1KH0 A;  1VZ6 A;  3A9J A;  3JW0 X;  3UI3 A;  2ICI A;  2HJ8 A;  1STE A;  1FRR A;  1VLB A;  2IO0 B;  3KWV A;  4DXA B;  2KN5 A;  2LAS A;  3CF6 E;  3R8B A;  2L8J A;  4KZC A;  4ZYS A;  2K0P A;  4B95 A;  1UGM A;  4BVU C;  3H7P B;  3W1S A;  1UNS A;  3IXS A;  1BXT A;  3L13 A;  2MJ3 A;  4RGN A;  4K7W A;  2HJ1 A;  3KUZ A;  5JH5 C;  1MHH E;  1P7F A;  2L05 A;  3QA8 A;  4KGS A;  2NS5 A;  1O0S A;  2V3P A;  1WF9 A;  3PHW B;  3VTU A;  4YTN B;  4OHJ A;  4DWF A;  2DHZ A;  4GB9 A;  4GDK B;  4WAA A;  3QJZ A;  2UU7 A;  4FJZ A;  1WRD B;  3GZN B;  1XO3 A;  1K53 A;  1PGX A;  2BS3 B;  1NYQ A;  2N7E A;  3AEG B;  4EZL A;  3PVL A;  1XLP A;  2UYZ B;  5EE0 A;  2DYB A;  1YOV B;  2J4X A;  1V9J A;  2MP2 B;  5L95 C;  2C7H A;  4YSZ B;  5DPW A;  4BFR A;  4FHK A;  4AQ7 A;  3NHE B;  3DCG A;  3UQA A;  2O6V A;  2CJN A;  2WXF A;  2WMH A;  3PRZ A;  4II2 B;  4KX6 B;  3DHH C;  2GBM A;  3DBL I;  1TZO A;  2LI5 A;  1J8C A;  3BYT B;  3P2B A;  4ZDV A;  3VVW B;  2WDQ B;  3ZGZ A;  2WXL A;  4UDU C;  3RYT A;  3L0W B;  2LRW A;  3IBE A;  3W1S C;  3QQ8 B;  1ESF A;  1P3Q U;  3FKY A;  2WMG A;  2KDF B;  3ML9 A;  4MH0 E;  2Z0D B;  1N5W A;  1IGD A;  3NG0 A;  4NAM A;  1HZ6 A;  2EEL A;  2X8X X;  3W5V B;  1TYG B;  2K5P A;  4J3O D;  3VTV A;  5BYS A;  3QIJ A;  2EKI A;  3RNF C;  1L0V B;  1WXA A;  3P63 A;  1WRI A;  3BVG A;  2DYM A;  2ZCC A;  5FR3 A;  1I4H A;  3ONS A;  1JWB D;  1EWY C;  2LGY A;  2BVC A;  3RZF A;  4KGT A;  4GXB A;  3I63 C;  2C7M B;  4L23 A;  5IO9 A;  2N4F A;  2VZK D;  2RDG A;  3EGR A;  4FXC A;  3VHT C;  3T3O A;  4TUU A;  2LGS A;  4US8 A;  1TBE A;  1WZ0 A;  2GI9 A;  4Q2J A;  2KHW B;  3VUX A;  2CU1 A;  3EC8 A;  4M02 A;  1L7Y A; 
#chains in the Genus database with same CATH homology
 3BWU D;  1TKG A;  3W5U B;  4JWU C;  1FXI A;  2BBC A;  2WXH A;  4WWM A;  4IKG A;  2DLB A;  4PT5 A;  2I2Y A;  1PDX A;  4B0E A;  2CU3 A;  3NVW A;  3AE2 B;  2BTE A;  4MH8 A;  1SBB B;  1AW7 A;  3TUO A;  2BB5 A;  3ETR A;  4JE3 B;  1KFY B;  1QOG A;  1EU3 A;  4HKQ A;  3P1M A;  3Q8C A;  2W54 A;  3CWI A;  3HVZ A;  4USA A;  4ZOH C;  1PGA A;  1YQ3 B;  2BB6 A;  1CZP A;  1YJI A;  4DXG A;  4ITK A;  1SSN A;  1V1O A;  3KWL A;  2FBW B;  2L83 A;  3HUI A;  2ONQ A;  3B2F A;  1T3Q A;  3BVZ A;  3BII D;  2BS2 B;  1JW9 D;  3P4Q B;  4OZB A;  2G9H D;  1N61 A;  1E6E B;  1TS5 A;  3NVY A;  1OQQ A;  3T3N A;  3AEB B;  4B0M A;  1IBX A;  2WXP A;  1MHX A;  1N60 A;  1GOZ A;  1T5X D;  3I57 A;  3ZJT A;  1DOY A;  1NEK B;  3PO0 A;  5HI1 A;  2QIE B;  5BMI A;  3E56 A;  1UWX A;  1B9R A;  1RYJ A;  1C79 A;  1C77 A;  2QMT A;  1K51 A;  3AE4 B;  1SE3 A;  3V3X A;  2XNA C;  3VQI A;  2N9K A;  3P4P B;  1HZ5 A;  2NTT A;  2PVG C;  4N59 A;  1JRO A;  3KLS X;  3L4P A;  1A70 A;  4HRO A;  1YN3 A;  1M4V A;  4P16 A;  4R3D A;  4RFB A;  4MM3 B;  4N58 A;  2WXK A;  1PFD A;  4YT0 B;  4MT5 A;  2JU6 X;  3ZQ4 A;  2AQ2 B;  3AB5 A;  1L5P A;  1JRP A;  3URY A;  1OQR A;  5JXV A;  3PZ7 A;  3FIL B;  1PGB A;  4WH4 A;  1VRA B;  3GS2 A;  1SXT A;  4XE0 A;  1WWT A;  2JWU A;  1QOB A;  1D5X C;  2H88 B;  2DBY A;  3Q8E A;  5GXG B;  2RDH A;  1Y56 A;  2N0S B;  1KLG D;  3B2G A;  2PIA A;  1D4B A;  1WXQ A;  1L6U A;  2WQY B;  4ZHP A;  2QSD A;  3AN1 A;  1HQR D;  2JYE A;  4NAW B;  4WAF A;  1F77 A;  2L52 A;  3BK1 A;  1OFF A;  1FMA D;  2ZW0 A;  3O13 A;  4L2Y A;  1HXY D;  2QJL A;  1SB3 C;  1L0X B;  4AS1 A;  1V97 A;  5D3D A;  2YEP B;  2HDE A;  4OW0 A;  5BMG A;  3Q8A A;  5HG2 A;  2OED A;  3BVM A;  4RGT A;  1RFK A;  4GDL B;  3Q69 A;  3FC4 A;  4ZRP A;  1AN8 A;  1I4Q A;  1FNW A;  1JCK B;  1SJH D;  2KDM A;  1I4R A;  3P42 A;  3E9S A;  2J52 A;  4OVZ A;  1DOX A;  1K52 A;  1I4X A;  4ARI A;  1YMH E;  2V0G A;  2INN E;  3I9V 1;  4TSS A;  1FCC C;  3WCQ A;  2KMM A;  1ACC A;  3AE1 B;  3BYY B;  2K3U A;  3BZD B;  1QF6 A;  1XXG A;  3TEZ A;  3SFE B;  2PVO D;  3VRB B;  2TSS A;  4RNA A;  4TQ1 A;  1VR9 A;  1EWC A;  5AUI A;  5FKA C;  4D2K A;  1ZPS A;  5T8I A;  1V1P A;  1VZ8 A;  2BS4 B;  2WNM A;  1Q10 A;  2INP E;  5C2T B;  3C8Y A;  1KRH A;  3KQ4 A;  3IAS 1;  2BW2 A;  5H92 C;  1XCQ L;  2K22 A;  2WP9 B;  4ZHO A;  3V05 A;  2N9L A;  1IUE A;  1DGJ A;  4CQN A;  2E3T A;  4JX1 C;  4ARC A;  4OZC A;  3HRD D;  1EU4 A;  1C4A A;  3AED B;  4RF0 A;  1B1Z A;  1TS4 A;  2B76 B;  1XLO A;  1MI0 A;  2JXT A;  1FIQ A;  3Q8F A;  2HTM E;  3BK2 A;  4DXF A;  3TEW A;  4P6V F;  3IAM 1;  3AEA B;  5E6J A;  3SR6 A;  1UGJ A;  1DYQ A;  1NYR A;  2PW9 A;  4XWT A;  3AM9 A;  1VJK A;  4C80 A;  2LUM A;  2D5G A;  1D5M C;  5HHD G;  4A9A A;  1XLN A;  2JZP A;  1UUP A;  1JWM D;  4XWW A;  3MC0 B;  5EE3 A;  1WYG A;  2WXN A;  1NVI D;  3NVZ A;  1I7H A;  3CIR B;  3DWM A;  2FE8 A;  2DWQ A;  4RGO S;  1VZ7 A;  2IPK D;  3NZ3 A;  1ZDV A;  1ZOY B;  3NRZ A;  1FCL A;  1ZXI A;  2JX5 A;  2M0A A;  4WQM A;  1GB1 A;  1I4G A;  2LGI A;  3AE8 B;  1F0Z A;  1JAL A;  2K9X A;  2KWD A;  1YNT E;  2XN9 C;  1PUT A;  4YSY B;  2M56 B;  1C78 A;  2QEJ C;  1AWD A;  3ZJU A;  3DWG C;  2FUG 1;  4ZRQ A;  2WXO A;  3AMZ A;  1MVK A;  5MPO A;  2YEP F;  1QQR A;  2M19 A;  1ZDX A;  1KLU D;  2Q5W D;  2WXQ A;  1JWA D;  5AUK A;  2Z8L A;  3PZ8 A;  4YSX B;  2MJD A;  1ZP0 B;  1V8C A;  1TKE A;  2SEB D;  2V4I B;  5BMH A;  3ZJV A;  1WSP A;  2WU2 B;  1E0Z A;  3LYY A;  2W82 A;  1TKY A;  5EE9 A;  3EUB 2;  1JWU D;  1FFV A;  4RGM A;  1FXA A;  3RPF C;  4YWG G;  1YQ4 B;  4XDC A;  2I38 A;  4C7Y A;  4GLS C;  2H89 B;  1L0Y B;  1FM0 D;  1ZUD 2;  3FIL A;  3AE5 B;  4A55 A;  1ET6 A;  1CK1 A;  2Y5P A;  3AE3 B;  2N7J A;  4DQO C;  1J7C A;  1VDV A;  5HFY A;  2BYT A;  1XCT L;  4A6Q A;  1C9F A;  1N62 A;  4O1N A;  1GPX A;  4H2A A;  1ET9 A;  4OZA A;  3FAH A;  2J53 A;  2ON8 A;  3P4R B;  1C4P A;  4REZ A;  5H8Y E;  3GB1 A;  1XEE A;  1TS3 A;  1AYF A;  5LNK 1;  2KQ4 X;  3NVV A;  1BUI C;  1JML A;  2CJO A;  5BYQ A;  1ENF A;  1ROE A;  4YTP B;  5D3I B;  1D6E C;  1KH0 A;  1VZ6 A;  3R2I A;  3UI3 A;  2WXR A;  1QIL A;  2ICI A;  1FO4 A;  2ACZ B;  3N9Y C;  3AH7 A;  1QT9 A;  3EA6 A;  1STE A;  4HJG E;  1R7S A;  2QIL A;  2V3N A;  1FRR A;  1VLB A;  2BT6 A;  4RF1 A;  2X38 A;  1FEH A;  3KWV A;  2WXG A;  1XF5 L;  2MH7 A;  4KKJ A;  3R8B A;  1ZXH A;  1E9M A;  3U52 E;  1LO5 D;  4HKZ E;  4C7Z A;  4ZYS A;  2K0P A;  1FD6 A;  2RMM A;  1SF0 A;  3TEY A;  2LMC A;  4JPS A;  1JWS D;  3W1S A;  1UNS A;  3IXS A;  1E7P B;  2WXJ A;  1V1P B;  2ZW1 A;  3LXF A;  1BXT A;  1FNU A;  1FFU A;  2MJ3 A;  1MPE A;  4RGN A;  4NJC A;  2IGH A;  4A90 A;  1MHH E;  1P7F A;  2W55 A;  2Y5C A;  1SJE D;  4WUR A;  4KGS A;  2WXM A;  2J42 A;  4WIP A;  2KAJ A;  3R2T A;  2W3R A;  1IGC A;  3P4S B;  2V3P A;  4YTN B;  2W3S A;  1WGK A;  4OHJ A;  4N6E B;  3ZYY X;  4XDD A;  4EE2 A;  4GDK B;  1F2R I;  1TY0 A;  1EM7 A;  4C56 C;  3B9J A;  1SE4 A;  4KKI A;  2RPV A;  1XO3 A;  1K50 A;  1P7E A;  1K53 A;  1L6V A;  3AEC B;  1PGX A;  3LB8 C;  2PKO A;  2Y3A A;  3U4E G;  5C3J B;  1IBX B;  3RFZ B;  5TSS A;  1L4Z B;  2BS3 B;  1NYQ A;  1TS2 A;  2G1E A;  2WXI A;  4A8X C;  1HA5 A;  3U7Z A;  3MFG A;  1ZE3 D;  1J7A A;  1YJJ A;  3AEG B;  4YXD B;  2AQ3 B;  3H8H A;  4TMA B;  1RM6 C;  1N63 A;  1E10 A;  1QLB B;  1XLP A;  5EE0 A;  4LK0 M;  5G5H A;  2J4X A;  4RCO A;  2WS3 B;  3MJ5 A;  1KTK A;  3VR9 B;  4YSZ B;  3VRA B;  4AQ7 A;  1SEB D;  2LHE A;  3MP9 A;  2AX5 A;  3OWE B;  1N5X A;  1NI3 A;  1CQV A;  3AE9 B;  2CJN A;  2WXF A;  3AE7 B;  4KGR A;  1C4C A;  2PLP A;  4KX6 B;  1SIJ A;  1F2R C;  5D7G A;  2MJE A;  2LFI A;  1KF6 B;  3AEF B;  1NEN B;  1TZO A;  1FRD A;  1YN4 A;  2KAC A;  3W9C B;  4TQ0 A;  3BYT B;  3AV8 A;  3HVD A;  1TJE A;  1C76 A;  2OHF A;  1HEZ E;  1PYW D;  2WDQ B;  2WXL A;  3ZGZ A;  4UDU C;  1GB4 A;  5EE1 A;  4JWS C;  1YN5 A;  1T6B X;  5I4D A;  3MHZ A;  2JQR B;  3NUH B;  2PMV A;  1ESF A;  2L32 A;  3U2S C;  4HEA 1;  3VR8 B;  2VZK B;  1TY2 A;  1N5W A;  2IJ0 A;  4YTM B;  1IGD A;  4NZL B;  4NAM A;  2L1A A;  5G5G A;  1FNV A;  1HZ6 A;  2IGG A;  3AE6 B;  2EEL A;  2IGD A;  4IOI E;  4US9 A;  3W2D A;  4HRS A;  3AEE B;  1BML C;  3W5V B;  1TYG B;  2GRI A;  1UWM A;  2K5P A;  2LEK A;  4J3O D;  5BYS A;  2NTS A;  1DOI A;  1D5Z C;  2EKI A;  2R61 A;  3SEB A;  1QKZ A;  3TSS A;  3GP7 A;  1L0V B;  5FK9 C;  2JSV X;  3P63 A;  2MEK A;  1L4D B;  2AQ1 B;  2LHD A;  1WRI A;  3BVG A;  2DYM A;  5FR3 A;  1JQ4 A;  2JYT A;  4LLG M;  5BYR A;  2GB1 A;  4LTU A;  1I4H A;  1JWB D;  4IDI A;  3Q8B A;  1EWY C;  2DYO A;  4KGT A;  2WDV B;  3NS1 A;  2E6X A;  3J9C A;  3TEX A;  4L23 A;  2NMQ A;  2WU5 B;  4MAC A;  4RH6 A;  2WLB A;  2VZK D;  2RDG A;  1QOA A;  3EGR A;  1RWS A;  4FXC A;  1XLQ A;  3SFD B;  3T3O A;  3IT6 B;  2KN4 A;  2LJI A;  3IT4 B;  1CJE A;  4US8 A;  2GI9 A;  1J7B A;  1QOF A;  1I4P A;  4Q2J A;  2PTL A;  4M0W A;  4L1B A;  3ABV B;  1SE2 A;  2SAK A;  1GAQ B;  2IDY A;  2WDR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...