2VZKB

Structure of the acyl-enzyme complex of an n-terminal nucleophile (ntn) hydrolase, oat2
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
213
structure length
213
Chain Sequence
TLLTFFATDARLDPAEQDRLFRRVMDRTFNAVSIDTDTSTSDTAVLFANGLAGEVDAGEFEEALHTAALALVKDIASDGEGAAKLIEVQVTGARDDAQAKRVGKTVVNSPLVKTAVHGCDPNWGRVAMAIGKCSDDTDIDQERVTIRFGEVEVYPPKARGDQADDALRAAVAEHLRGDEVVIGIDLAIADGAFTVYGCDLTEGYVRLNSEYTT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anatomy of a Simple Acyl Intermediate in Enzyme Catalysis: Combined Biophysical and Modeling Studies on Ornithine Acetyl Transferase.
pubmed doi rcsb
source organism Streptomyces clavuligerus
molecule tags Transferase
molecule keywords GLUTAMATE N-ACETYLTRANSFERASE 2 ALPHA CHAIN
total genus 77
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.35: Glutamate N-acetyltransferase.
pdb deposition date 2008-08-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.340 Alpha Beta Roll Ubiquitin-like (UB roll) Ubiquitin-like (UB roll) 2vzkB02
3.30.2330.10 Alpha Beta 2-Layer Sandwich arginine biosynthesis bifunctional protein fold arginine biosynthesis bifunctional protein suprefamily 2vzkB01
1VZ8A 2YEPF 1VZ6A 1VZ7A 3IT6B 2YEPB 2VZKD 2V4IB 1VRAB 2VZKB 3IT4B
chains in the Genus database with same CATH superfamily
1VZ8A 3H7PA 1OEYJ 5GXGB 2K8HA 3V6EB 1FRRA 4JWUC 1YQ4B 3X23A 3TIXA 2IO1B 4TSSA 2JRIB 1N5WA 4N59A 5C2TB 4DHZB 2OHFA 3U7DA 1XT9B 3P63A 2KK8A 2MBBB 2R2QA 4ICVA 4GLSC 2RDHA 3TMPB 5BMGA 1I4GA 2BVCA 5DPRA 4MSMB 2XNAC 2J7QB 5G2NA 1SE9A 2CU1A 4MM3B 1WF9A 3SEBA 1FRDA 1R4NB 2JY6A 4M0WB 4NY0A 2L76A 3PZDA 3NZUA 3VUXA 3GE8C 1MHXA 2ZEQA 5EE0A 4GDLA 3ZXVA 4WWNA 1WIAA 4TQ0A 3DCGA 4L2YA 1WZ0A 1I4QA 3DQVA 4KVGB 3PREA 2ZPYA 4ARCA 2L8JA 2HJ8A 3WALA 4AJYB 1WY8A 1FXAA 2UWQA 4HCPB 3BWUD 3V05A 2LXCA 3QCAA 5G5HA 2UYZB 4IM2A 4K7WA 3I3TB 4ITKA 5JHAA 4I6NB 3URYA 4DWFA 1E6EB 1VZ7A 2IJ0A 2BS2B 5J17A 3SFDB 4AUQC 3AEDB 3RNBC 4B6WA 1RFKA 1L0VB 4O1NA 1L4DB 1EUVB 3KYCD 1R4NI 4RMAA 5GMVA 2K5PA 1Q0WB 1QKZA 3ZNZB 4PS7A 4AP4C 4ANXA 2D11A 4OZCA 4C4VB 2BWFA 4XE0A 2L3ZA 3JVZX 3QARA 3WAOA 2EKIA 1N60A 2L32A 2QJLA 4EE2A 1SSNA 4M02A 4YT0B 3CWIA 4W9FA 1KFYB 4WQMA 3W5UB 3AU4A 2EMSA 4WJQA 4WJPA 4YTMB 1VRAB 4WJNA 1LM8B 3AE6B 5BYSA 5H8YE 1VJKA 1XLQA 3HVDA 4FLHA 4ANWA 2MBOA 4XWTA 3VAWA 1ZOYB 1UBQA 2JZPA 4KKIA 1WYGA 1E8XA 2L7RA 2KTRB 1O0SA 2LVQA 4C4VA 4MM3A 3M63B 3BYYB 2MCNB 1FEHA 2LGXA 3UI3A 4P1BC 5BMHA 4HJKA 2K22A 3PZ8A 4W9EA 1QOBA 4NQLB 1SIFA 3Q3JA 1WJ6A 3AECB 4RFBA 2PLPA 3N9YC 4IOIE 1UH6A 5DCNA 3TSSA 3OLMD 2Z0EB 3ML8A 1MFWA 2I38A 2CU3A 1F1HA 1XD3B 3GE3C 4W9JA 4JGHB 2HDEA 1FO4A 4DHJB 1YN4A 3C8YA 4IUMB 1EF1A 3PZ7A 3A33B 1T0RC 3B9JA 2WDVB 2WWZA 2BYVE 3DVNV 3A1QB 2AL3A 2LUEA 2DZJA 3DBSA 4KX6B 1UNSA 3MJWA 3T9LA 2BF8B 1T0YA 4EUTA 1C4CA 3AEBB 3DOWA 1V80A 2D3BA 2QC8A 5E6JA 5C3JB 2ICIA 3PRZA 1SE3A 1BT0A 2WDRB 3MP9A 1CK1A 1TTNA 5D6JB 3PLVA 1NDDA 2QEJC 1FMAD 1XLOA 3ZTDA 2HTME 2WMIB 1FNVA 5D3DA 2MBQA 3T3OA 1C77A 4J6IA 2KVZA 2M0XA 3U52E 3PVLA 2R2OA 2KFKB 2W82A 1TKEA 4K3BA 1YD8U 2N9KA 2DYOA 1WXQA 3RI7C 3HK0A 2I2YA 2DWQA 3B0AA 4HDOA 1I4PA 1SBBB 3H7PB 4KIKA 2KN5A 3ZRCA 5AEKB 1MPEA 3DBLB 3ZUNA 3ZJVA 4YXDB 3VR9B 1GC7A 3Q8BA 3UIPB 3U30A 3ZJUA 4RF1A 3HRDD 4FADA 2J42A 3JW0X 1HZ6A 1GNUA 1FCCC 1JQ4A 3DHHC 3N30A 1DGJA 1D6EC 2LEKA 1ET9A 3BK2A 1LQBA 3SFEB 3KYDD 2MP2A 3RNFC 5IO9A 3R2TA 1WJUA 4G0NB 4FULA 4JIOU 1J0GA 2WNMA 2KWUB 2O6VD 2HD5B 2RMMA 3P4SB 2IGGA 2DHZA 2Q5WD 5E6NA 2MWSB 3P4RB 4JWSC 2L0FA 2XN9C 4EZJA 3QJZA 4MH0E 2BS3B 2L1AA 4KDLB 4OHJA 4RGOS 2WX0A 5IN7A 2HE7A 2GLSA 4NZLB 2D5GA 2KO3A 4AJWA 4W9IA 4WIPA 5D2MB 3A9KB 3N1ZC 2YVCA 2UU7A 5D7GA 4ARIA 2K3UA 1WGHA 4FJZA 4XZ4A 1JWAD 3QIJA 4MGYE 1UWMA 2ON8A 2I1JA 5IKCM 3W5VB 2CHZA 5FK9C 2J53A 2VH1A 2C7MB 4S17A 3VRAB 2WXPA 4WAFA 4M00A 1WMHB 2NTSA 3VTWA 1L5PA 2QDFA 2K25A 2JT4B 4KGRA 4DXAB 5E6PA 2KMCA 1AARA 2WGSA 4YTNB 2NMQA 4XYCA 2BPSA 2QCZA 1EWYC 1TS5A 3LYYA 2VZKD 2M1MA 2OEDA 3I63C 2BB5A 2DAJA 3C0RB 3P4QB 1J8CA 2INPE 2JYEA 2MHJA 2C9WB 3IFWB 1IPGA 3RN9C 2JYTA 2GI9A 2WXOA 3KVFB 4I6PA 3PS6A 4D6DA 4HPMB 1I4XA 2WMKA 2WXIA 2QSDA 4HCNB 1VR9A 3NS1A 1OFFA 4HROA 2M56B 2AYOB 3HVZA 5JXVA 4IM3A 3NVZA 2PE6B 1UWXA 2J52A 4TMAB 1OQQA 4AS1A 3PRMB 1YN3A 1SE4A 3NUHB 2CS4A 1C78A 4LJPB 2N7JA 4ZRKA 1SEBD 4D72A 1CJEA 5FR3A 1FIQA 3ZTCA 1WRDB 4W9CA 3RULA 1MVKA 2N9PC 4F1SA 4HPLB 2RGFA 4MT5A 3ECIA 4P1CC 1F9JA 4II3B 4TQ1A 1UUPA 1ZXHA 3NRZA 5J2RA 1DOIA 3BYTB 1JWSD 3R3MA 2FUG1 1WR6E 3N3KB 2V4LA 1PYWD 4GOCA 1GUAB 1UELA 3VXWA 4HLEA 3FAHA 1E0ZA 1EO6A 3ZKJC 1LGRA 1T0SC 1E9MA 1NI2A 4S0RA 5D3IB 1D3ZA 5BO4B 3BK1A 1SXTA 1QQRA 2H88B 1FXTB 3PV1A 3HHMA 1I42A 2Z0DB 2BQQA 2LGYA 4LDTD 3X0WA 3TL5A 3MFGA 3Q3OC 2HTHA 3NOBA 1IYFA 4GMVA 4YSZB 3AN1A 3GZNI 3HM6X 3FILB 1Z2MA 4FJYA 2LGIA 1JWBD 3QA8A 3LXFA 4HXDA 2JPHA 2LFIA 3PLUA 1PGBA 2BTEA 2KYWA 4RGMA 4OZBA 1TS2A 4GU2A 2L0TA 1ZE3D 3HM3A 1WE7A 3L13A 1D4BA 4HK2A 3W2DA 1OEYA 4LLGM 3OG5A 1GB4A 1MJDA 1SJED 5EE1A 3WCQA 4BOZB 5I4DA 2KDEB 2J4XA 2KJ6A 3N1YC 3WIMA 4L1BA 2PVOD 1HZ5A 2LJIA 1V81A 3UGBB 1N61A 2C5LC 2KFJA 1WE6A 1KH0A 4LDTB 3VVWB 2DLBA 1IP9A 1JWMD 4FA6A 4D6HA 3TEZA 4LK0M 2KDIA 1WZ3A 1NENB 3ZW3A 2D07B 2WXQA 2W3SA 3R66C 3A9KA 1BXTA 3ZNHB 4DXGA 1D5ZC 3RCZA 1FNWA 4PS8A 1GB1A 2A5UA 1HTQA 3NZ3A 2JUOA 2PPHA 3DVGX 2N9EB 2FIDA 2FBWB 1FFUA 4W9DA 4NAMA 2BW2A 4MACA 4RGTA 2JU6X 3ZDTA 2PMVA 2WU5B 1PGXA 4A3OA 3VH4B 3JSVB 4LNNA 1WGRA 1FFVA 2WDTB 2INDC 4JE3B 1HXYD 1WGGA 2IYDB 2LUMA 4W9HA 1ZUD2 4PYZA 1XLNA 3QK0A 1QLBB 2RDBC 1V97A 2MJDA 4EOYA 2LD9A 1WGYA 3K9PB 4JLCA 1KOTA 3Q3MC 3VH3B 2KNBA 1UGJA 1TT5B 1N62A 3T3NA 3MHZA 1BMLC 2QIEB 3A1QA 2KX3A 2WMFA 1XCQL 3DPDA 2BYEA 3VTVA 3ZNGC 4XDDA 4EZLA 3KUDB 2JSVX 2FIFA 5IA7A 3RFZB 3FC4A 4DQOC 3EA6A 5HG2A 3TBLD 4EFOA 1RRBA 2MLBA 1Q1OA 2GBNA 2N7DA 2H89B 1N6ZA 3ZRFA 1H8CA 3IVFA 2DZIA 4D6EA 4DHZE 2ZNVC 1IGCA 2J0JA 2JXTA 5LXIB 4W9LA 3A9JB 4G3XB 2RR9A 3RYTA 3P2BA 4A6QA 1TBEA 1L0YB 3SR6A 2NR2A 5AUKA 4BKGA 3N20C 2MX2A 2WU2B 3TEYA 2KLGA 1SE2A 1HE8A 2C60A 5JHBA 1LXDA 3TCAA 4G50A 2EMTA 1E7PB 5HFYA 3AM9A 3WA0A 2O6VB 2KAJA 5CHFA 2R61A 2WXNA 3ENEA 1WH3A 1L0XB 1C9FA 2DYMA 4LNKA 3I57A 4ZRPA 3OWEB 4OZAA 3U2SC 3DHGC 1E8WA 1K52A 1X1MA 1SGHA 4YWGG 5L83A 4GDKB 2LMCA 3VR8B 3TEWA 2YLMA 3Q2AC 3DBLI 2VRRB 2KTFA 2MP2B 4YL8A 1MG8A 2CHWA 4ACFA 1WX7A 3MTNB 1CMXB 1YJJA 2PW9A 3VHTC 5BYQA 4BFRA 2DAFA 4ANUA 1QF6A 2BWES 2KLCA 2XK5B 2V3SA 1IBXB 2FCNA 1YX6B 2BS4B 3APFA 1M4VA 4B0MA 4D6JA 3H7SA 4WWOA 4P7IA 4D71A 2KC2A 3RUIB 4RGNA 3J9CA 2X38A 4OVZA 2EKEC 2KANA 1WJNA 2BBCA 2N1WA 2L52A 4GIVA 2KVRA 4ZHOA 1SF0A 4MDKE 2OJWA 1IUEA 2KTRA 4HWIB 2MA9B 4A3PA 1RLFA 1WXVA 1I4HA 2KQ7A 3Q8FA 2MRPA 4MEMA 1IBXA 2D3AA 3ZJTA 1R4MB 2V0GA 4RF0A 1ZGUB 1V49A 2RPQA 2BKRB 2IO3B 4K81A 2VH2A 4WURA 3UQBA 2W3RA 3VUWA 4M8MA 1K8RB 1UZXB 4NAWB 2EELA 2ZVOA 2V9HA 1OQYA 2K6DB 4D6IA 2J0KA 3KWVA 4JL9A 1YQBA 2BYTA 3ZVVA 1BUIC 1QOFA 1TGZB 2IBIB 1V1PB 2W9NA 4FN2A 2KZRA 2Y5PA 1V8CA 3PT2B 1ENFA 4M01A 1TZOA 2K0PA 1GC6A 1STEA 1VD2A 4C7ZA 1PDXA 2AEHA 3HIZA 1YNTE 3ZYYX 2LGDA 3FKYA 5HHDG 3SU8X 3NZSA 2WMIA 4G11A 1NVID 1XO3A 1H4RA 1WXMA 3AEGB 4BOSC 1SIJA 2E6XA 2QHOA 4MJSA 4MSQB 1TY0A 2NPTA 3L4PA 3ZNID 2GBMA 2JZ3B 4NNJB 2N0SB 2WDQB 4FBJB 2N9LA 4YSXB 4RM8A 3IHPC 3TUOA 4FJVB 1TS4A 3DWMA 5FKAC 4NJ7A 3NG0A 1JWUD 1KF6B 2RD0A 3L10B 4X57B 1V1PA 2ZZPB 3IT6B 4IM0A 3QWZB 2G9HD 1OGWA 3D32A 2M0AA 1AYFA 3OAWA 3EECA 4C80A 2IZVB 1NEKB 4YSYB 2KHWB 4AQ7A 3KUCB 1VCBA 3AE1B 1ISNA 3PPAA 5JH5C 1PFDA 4JPSA 3JSVA 3RNGC 3RNAC 2CJNA 2J0MA 4BKSA 3EUB2 1FNUA 3L16A 1AW7A 1YJIA 4K7UA 2O2VB 2NPTB 1OTRB 3APDA 2JQRB 3CMMB 2N9XA 4AWJA 4D2KA 2JF5A 2WHIA 2ZW0A 4WH4A 4PYUA 2D3CA 1A5RA 1VDVA 3B2FA 3BIID 3U8ZA 1QZEA 2V3NA 3FILA 3QHTA 1AWDA 2AL6A 3EFCA 2IO2B 4CHKA 4RCOA 3C19A 3ABVB 2RSUA 1WM3A 1F2RC 2ZNVB 2WXKA 4B9KA 4CYEA 3AI5A 4LCDE 1ROEA 1UD7A 2WLBA 3V62A 3CF6E 2NBWB 1WGDA 4A55A 1Z5SB 4A8XC 4LNFA 2MSED 1T5XD 1ZDVA 3NHEB 2YEPB 1ZXIA 4P6VF 3PO0A 1ZW7A 4LJOB 2MJEA 4P16A 1WYWB 3AEEB 3BZDB 2DYBA 2LI5A 1GPXA 1DYQA 3UQAA 2IPKD 3TEXA 4GDKA 1A70A 3CIRB 4URKA 1DOXA 3IBEA 1TZ1A 5EE9A 2OJRA 4B95A 3NVWA 4UDUC 2KACA 1R7SA 1TY2A 1KTKA 1R4MI 3H1UA 2A4ZA 1V1OA 2GMIC 4US9A 4B0EA 5C23A 1JW9D 1WR1A 2CHXA 5AZFA 5LXHA 5CHVC 2IGHA 1WM2A 2XK5A 2WMHA 1YN5A 4R3DA 2WP9B 1HTOA 3CSFA 3GOEA 2WMJA 1YQ3B 4WWMA 1V5TA 1Y8RC 1NBFC 5C1ZA 4ZYNA 1XQQA 5IAAC 4AOFA 4DK5A 1P1AA 3L08A 1E7VA 2PEAA 4RH6A 2LASA 4DHJD 3AV8A 2K6QA 5L95C 2AQ1B 3Q14C 4IKGA 2KWDA 2BKFA 1FXIA 3KWLA 3ZDMC 3NJTA 4ICUA 4ZDVA 1RM6C 2IDYA 4Q2JA 4US8A 2IY0B 2IY1B 4OVVA 1XEEA 1E8ZA 4HEA1 4MGZE 5CTRC 1EWCA 4HVBA 3KW5B 5J18A 1ZKHA 3AEAB 2K9XA 2M17A 2B3AA 3ONSA 3DVGY 2XBBC 4N9F4 1FPYA 3H6NA 1WGKA 5E6OA 1RWSA 4W9GA 2QILA 4BBNC 3BINA 3RNEC 4TUUA 2WXHA 1KRHA 1E5WA 5EE3A 2V4IB 3W1YA 2G1EA 3AE4B 4F7ZA 1D5MC 5BMIA 4ZRIA 5T8IA 4D6CA 1S1QB 1ZPSA 1WJ4A 3GZNB 1V5OA 1YJ1A 5AUIA 3GS2A 3EC8A 4EKUA 1DOYA 1SB3C 5CX3A 3WAMA 5EDSA 3T8MA 2GBRA 2JWUA 2NBVB 1TYGB 4WAAA 3MC8A 4E71A 1QILA 1P98A 2ZJDA 3R2IA 3R7QA 2LHEA 3APCA 1WFYA 1V86A 1MI0A 3UIOB 1NYQA 2PIAA 5IOIA 4MH8A 4BAXA 4OVUA 2XEWA 3IT4B 3W9CB 2M19A 2Z59B 4H2AA 3O65B 1J19A 1E90A 3PHXB 4KSKC 1C79A 1GOZA 4NAWA 1CZPA 2G4DB 4BVUC 2AQ2B 4KV2A 3TJPA 3AE7B 3ZO5B 3AE8B 1F77A 2KJHB 2W55A 4MGKE 2E3TA 2NS5A 4MJSB 2N4FA 2G4SA 2ACZB 1GG3A 1M94A 3Q3NC 4PK1A 4MGIE 2FCSA 2MBEA 3LB8C 3DWGC 5AZGA 3DBHI 2KN4A 5DPSA 1PQSA 2ZPNA 1TKGA 1I35A 4CO7A 1WXAA 1WX9A 3V3XA 2RPVA 2W54A 2WXJA 3Q8AA 3R8BA 3P4PB 2WXMA 1MG4A 2GBKA 1N63A 1EU3A 4RNAA 2KDBA 2LJ5A 3VRBB 1WXSA 2N7EA 1WWTA 3BVZA 3W1SA 4A20A 3VFKA 1B1ZA 1T3QA 2KDMA 1K53A 1P9DU 1LFDA 2FCQA 4KZCA 4NPNA 4IWOA 4JQWC 2KD0A 4M8NA 3A4SC 3PSEB 4MELA 4IC7B 2JX5A 1J7AA 1VZ6A 1JCKB 1HA5A 3GP7A 3ZQ4A 3KLSX 3RZFA 1NI3A 2MW5A 3AU5A 2Y5CA 1TIFA 4ZYSA 4QAYA 2KOXA 2CJOA 1JRPA 2BT6A 1ESFA 3RZWC 3PTFC 1TKYA 2FE8A 2LZ6A 2WYQA 3Q8CA 4DBGA 3MC0B 2D10A 5CHWA 3ZXRA 1QOAA 2CKHB 2KWVB 3B1LX 5IP4D 1YOVB 1QT9A 3Q6BA 5KHOA 3I5JC 3A4RA 4IDIA 3ZLZA 4N58A 4C00A 5LNK1 4LTUA 3B08A 3M95A 2ZCBA 3DBRI 4GB9A 4XC2A 4WQOB 2B76B 1UGMA 2O2VA 2LWPA 4BKTA 1FCLA 4XWWA 4WWPA 3VTUA 2HJ1A 2KX0A 2Y3AA 3L17A 4IW0A 1NYRA 5AZHA 3QX1A 2DENB 4XGAB 3L54A 3SD5A 3O13A 3P42A 3ETRA 3DDCB 4HKQA 1C1YB 2DX5B 2LXAA 1L7YA 2K39A 3PGEA 4FHKA 1F0ZA 2O6VA 4NQKE 2KMMA 3AE2B 1QOGA 4J3OD 2M4NA 1ET6A 3V60A 2BYFA 1V2YA 1I7HA 4CQNA 3BY4B 1YIWA 2SAKA 1KJTA 2LHDA 2INNE 2ZVNA 1F2RI 2MH7A 2WXFA 4KKJA 3U4EG 2G45B 2LVOA 1KLUD 2JXXA 2MJ3A 4RM9A 1L6UA 2REXA 2V3PA 3IAS1 2ONQA 4M0WA 1FM0D 1WX8A 3MC9A 4HRSA 1Q10A 3BVMA 1GJZA 1JRUA 2L00B 2NVUI 1ZDXA 1C4AA 4NJ6A 3RMKC 1EF5A 3AULA 3L0WB 4N6EB 2BB6A 2C7NB 3EGRA 2L83A 3Q69A 3AEFB 1P7FA 5TR5A 1G6JA 2C7HA 1XXGA 1OQRA 1V9JA 1P3QU 2DZMA 3ZIMA 3CSTA 2ASQA 4PS3A 2DZKA 4XDCA 1UF0A 3AE9B 2AQ3B 1XLPA 4E3CA 3VQIA 3IG3A 4HPPA 4BBNF 1V6EA 3V6CB 2KWCA 1JMLA 3AB5A 4FHJA 1J7CA 1WMHA 3W1SC 2WXLA 3UINB 4K1RB 1KM7A 4GDLB 4D6FA 1AN8A 2D2QA 3BVGA 5TSSA 1U4AA 3HUIA 5KHQA 1WSPA 4IWQA 3RPFC 3RNCC 2SEBD 4GGQA 5H92C 2MEKA 3KH0A 3WANA 2WMGA 1IGDA 1HQRD 3WAPA 4L23A 2NBUA 3IXSA 2WXRA 5D94A 2YEPF 1L4ZB 4IG7B 3SHQA 5G55A 2MBHA 2TSSA 3H8HA 2LGSA 4ZRJA 2GRIA 4TKNA 2X8XX 3ALBA 1S3SG 2JWZA 3EFUA 1P0RA 1EM7A 1RFAA 2BGFA 4JX1C 4DDGD 3DVNU 2D3GA 4FXCA 3QAQA 4K7SA 5LLIA 2PJHA 1GAQB 1N5XA 1LO5D 1T0QC 4I6LB 1CQVA 4K3CA 3ML9A 1EU4A 4GSWA 1WRIA 4KDIC 3LDZE 1XF5L 3JYUA 4BZAA 2FUHB 5MPOA 4E74A 2KMAA 4TV3A 4YTPB 5BYRA 2DNFA 1SJHD 1TJEA 1VLBA 2JVCA 2LRWA 5DPTA 1TS3A 2DBYA 1YMHE 3RD2A 3H9DA 2Y5BB 1E7UA 3OJ3A 2JZZA 1E10A 4HJGE 2AWTA 1I4RA 2WX1A 2AX5A 2KQSA 1MHHE 4OW0A 1RAXA 3B2GA 4EZKA 2FAZA 3VUYA 1B9RA 3QQ8B 3R7RA 2QMTA 4IWPA 2PKOA 2K1FA 4WJOA 2CR5A 2I1KA 1JALA 2VZKB 2PVGC 3VDZA 2WS3B 3LJ3A 4ASWC 1T6BX 2ZW1A 3N1XC 3P1MA 2PE9A 3GB1A 4A90A 3DBRB 1FD6A 3NVYA 2LRUA 4A9AA 5HI1A 2K8BA 4ZRQA 3ZGZA 3NVVA 4ZOHC 4C7YA 2OOBB 1LLQA 4PT5A 3Q8EA 1P7EA 4BKSD 1UBIA 1K51A 3UF8A 4DDID 1Q5WB 3MHSD 5DPWA 3DBHB 4F8CB 1L2NA 4C56C 2KT7A 2MQJA 3AMZA 3E56A 1PGAA 3IAM1 1PUTA 3QC8B 1E8YA 1J7BA 2WQYB 1K50A 2L05A 4KZ0A 2ZCCA 3Q3FA 5FR6A 3PHWB 2GBJA 1YX5B 5G5GA 3A9JA 4GXBA 1L6VA 2JRHA 3M3JA 2GOWA 5JZEB 2KKCA 1C3TA 4HDQA 2IO0B 2KQ4X 4KGSA 4KIKB 4XX5A 2INCC 3KUZA 3SDLC 3OJ4B 2LVPA 2PTLA 4II2B 3AXCA 1RYJA 1JROA 2WXGA 2KFKA 2GB1A 3PRPB 3MJ5A 1XCTL 4W9KA 4EEWA 3M62B 3NS8A 1KLGD 5HKHA 2M8SA 4GN1A 2NCNA 4KGTA 3U7ZA 1HEZE 4NJCA 3NY5A 3S2AA 4ZHPA 1KLVA 2NTTA 2KXJA 3RT3B 4ANVA 2KDFB 3V61A 4USAA 3AE3B 1C76A 3KQ4A 4LNIA 1WI0A 2FCMA 2RDGA 1ACCA 1F52A 1D5XC 2Z8LA 4D6GA 1ZP0B 3I9V1 4REZA 3DHIC 2KC1A 4LNOA 3EHVA 1C4PA 1Y56A 2FNJB 4KSLC 2K8CA 3K9OB 2IGDA 2N1VA 3AH7A 2V1YA 2KJRA 2G3QB 3N32A 4DXFA 3AE5B 3E9SA 4HKZE
chains in the Genus database with same CATH topology
1VZ8A 2Y5PA 2WXIA 2QSDA 3Q8CA 5GXGB 1VR9A 1V8CA 1ENFA 3NS1A 1TZOA 2K0PA 1FRRA 1STEA 3MC0B 1OFFA 1PDXA 1YQ4B 4JWUC 4C7ZA 1QOAA 1YNTE 3ZYYX 4HROA 2M56B 5HHDG 4TSSA 1N5WA 4N59A 1QT9A 5C2TB 2OHFA 3HVZA 5JXVA 3P63A 1NVID 1XO3A 3NVZA 4GLSC 4IDIA 1UWXA 2J52A 2RDHA 3AEGB 4N58A 1SIJA 4TMAB 1OQQA 2E6XA 5LNK1 4LTUA 4AS1A 5BMGA 1TY0A 3L4PA 1I4GA 2N0SB 2WDQB 2N9LA 4YSXB 2XNAC 3TUOA 2B76B 1YN3A 1SE4A 3NUHB 1TS4A 1C78A 3DWMA 4MM3B 2N7JA 1FCLA 3SEBA 1FRDA 5FKAC 1SEBD 4XWWA 1JWUD 1KF6B 1CJEA 1V1PA 3IT6B 2G9HD 2Y3AA 5FR3A 1NYRA 1FIQA 2M0AA 1AYFA 1MHXA 5EE0A 1MVKA 3O13A 4C80A 3P42A 1NEKB 4MT5A 4YSYB 3ETRA 4TQ0A 4L2YA 4HKQA 1I4QA 4TQ1A 4AQ7A 1UUPA 1ZXHA 3AE1B 3NRZA 1DOIA 1PFDA 3BYTB 4JPSA 4ARCA 1JWSD 2CJNA 2FUG1 1F0ZA 1FXAA 3EUB2 1PYWD 1FNUA 3BWUD 1AW7A 3V05A 1YJIA 2KMMA 3FAHA 1E0ZA 5G5HA 3AE2B 1QOGA 4J3OD 1E9MA 1ET6A 4ITKA 3URYA 1I7HA 4CQNA 2JQRB 1E6EB 2SAKA 5D3IB 1VZ7A 2IJ0A 2BS2B 2LHDA 4D2KA 2INNE 3SFDB 2ZW0A 4WH4A 2MH7A 1F2RI 2WXFA 1VDVA 3AEDB 3BK1A 4KKJA 3B2FA 3U4EG 3BIID 1RFKA 1L0VB 1QQRA 1SXTA 4O1NA 1KLUD 1L4DB 2V3NA 2H88B 3FILA 2MJ3A 1AWDA 1L6UA 2K5PA 2V3PA 3IAS1 2ONQA 1QKZA 4M0WA 4RCOA 1FM0D 3MFGA 4HRSA 4OZCA 1Q10A 4XE0A 3BVMA 3ABVB 1F2RC 1ZDXA 2WXKA 2EKIA 4YSZB 1C4AA 3AN1A 1N60A 2L32A 3FILB 4N6EB 2BB6A 2QJLA 3EGRA 2L83A 2LGIA 3Q69A 1JWBD 4EE2A 1ROEA 1SSNA 3LXFA 2WLBA 3AEFB 3CWIA 2LFIA 1P7FA 4YT0B 1PGBA 1KFYB 4WQMA 4A55A 2BTEA 4RGMA 1XXGA 4A8XC 4OZBA 1OQRA 1TS2A 3W5UB 1T5XD 4YTMB 1ZDVA 2YEPB 1ZE3D 1ZXIA 4P6VF 1VRAB 3PO0A 1D4BA 3W2DA 4LLGM 4XDCA 1GB4A 3AE9B 2MJEA 1SJED 2AQ3B 5EE1A 4P16A 3AE6B 5BYSA 5H8YE 1VJKA 3WCQA 1XLQA 3HVDA 1XLPA 5I4DA 3AEEB 3BZDB 3VQIA 1GPXA 4XWTA 1DYQA 1JMLA 2IPKD 2J4XA 3TEXA 3AB5A 1A70A 1J7CA 1ZOYB 4L1BA 3CIRB 2JZPA 4KKIA 1DOXA 2PVOD 2WXLA 1HZ5A 2LJIA 5EE9A 1WYGA 4GDLB 1N61A 1AN8A 3BVGA 1KH0A 5TSSA 3NVWA 4UDUC 2KACA 3HUIA 1R7SA 2DLBA 1TY2A 1JWMD 1KTKA 1WSPA 3TEZA 4LK0M 3BYYB 3RPFC 1FEHA 1V1OA 2SEBD 4US9A 1NENB 5H92C 3UI3A 2MEKA 4B0EA 5BMHA 2K22A 3PZ8A 1IGDA 2WXQA 1HQRD 2W3SA 1JW9D 4L23A 1QOBA 3IXSA 2WXRA 1BXTA 2YEPF 4DXGA 1D5ZC 1L4ZB 2IGHA 1FNWA 3AECB 4RFBA 2PLPA 1GB1A 2TSSA 3H8HA 3N9YC 4IOIE 3NZ3A 1YN5A 3TSSA 2GRIA 4R3DA 2WP9B 1YQ3B 2I38A 4WWMA 2FBWB 1FFUA 1EM7A 4JX1C 2CU3A 4NAMA 2BW2A 4MACA 1FO4A 2HDEA 4FXCA 4RGTA 1YN4A 3C8YA 2JU6X 4RH6A 1GAQB 2PMVA 2WU5B 1N5XA 1PGXA 1LO5D 3PZ7A 3AV8A 1CQVA 3B9JA 2WDVB 1FFVA 2AQ1B 1EU4A 1WRIA 4IKGA 4JE3B 2KWDA 1HXYD 1FXIA 3KWLA 4KX6B 2LUMA 1UNSA 1XF5L 1ZUD2 1XLNA 1QLBB 5MPOA 1C4CA 1RM6C 2IDYA 3AEBB 4Q2JA 4US8A 5E6JA 1V97A 4YTPB 2MJDA 5BYRA 5C3JB 1XEEA 2ICIA 4HEA1 1SE3A 1EWCA 1SJHD 1TJEA 1UGJA 1VLBA 2WDRB 1N62A 3MP9A 1CK1A 3T3NA 3MHZA 1BMLC 2QIEB 3AEAB 1TS3A 2K9XA 1XCQL 2DBYA 1YMHE 2QEJC 1FMAD 1XLOA 2HTME 4XDDA 1FNVA 5D3DA 1E10A 4HJGE 3T3OA 1C77A 1I4RA 1WGKA 2JSVX 2AX5A 3U52E 1RWSA 3RFZB 3FC4A 4DQOC 2QILA 1MHHE 3EA6A 4OW0A 5HG2A 2W82A 3B2GA 1TKEA 2N9KA 1B9RA 2DYOA 1WXQA 2WXHA 1KRHA 2I2YA 2DWQA 2H89B 1I4PA 1SBBB 2V4IB 5EE3A 2QMTA 2G1EA 3AE4B 2PKOA 1D5MC 5BMIA 1JALA 5T8IA 1MPEA 2VZKB 1IGCA 1ZPSA 2PVGC 3ZJVA 5AUIA 2WS3B 2JXTA 3GS2A 4YXDB 3VR9B 1T6BX 2ZW1A 3Q8BA 1DOYA 1SB3C 4RF1A 3ZJUA 4A6QA 3HRDD 1L0YB 3P1MA 3SR6A 2J42A 2JWUA 5AUKA 1HZ6A 3GB1A 4A90A 1TYGB 2WU2B 1FCCC 3TEYA 1SE2A 1JQ4A 1FD6A 1QILA 3NVYA 3R2IA 1E7PB 4A9AA 5HFYA 5HI1A 1DGJA 2LHEA 1D6EC 2LEKA 3AM9A 4ZRQA 1ET9A 1MI0A 3BK2A 2KAJA 1NYQA 2PIAA 3NVVA 3SFEB 3ZGZA 2R61A 2WXNA 4ZOHC 4MH8A 4C7YA 3IT4B 3R2TA 3W9CB 1L0XB 2M19A 1C9FA 2DYMA 3I57A 4PT5A 3Q8EA 2WNMA 3OWEB 4H2AA 4OZAA 4ZRPA 3U2SC 1P7EA 1K52A 1C79A 1K51A 4YWGG 2RMMA 3P4SB 2IGGA 2Q5WD 4GDKB 2LMCA 1GOZA 3VR8B 3P4RB 3TEWA 4JWSC 4C56C 1CZPA 2XN9C 2AQ2B 3AMZA 3E56A 1PGAA 3IAM1 3AE7B 1PUTA 1YJJA 1J7BA 2PW9A 2WQYB 1K50A 3AE8B 5BYQA 2BS3B 1F77A 2L1AA 2W55A 1QF6A 2E3TA 4OHJA 4RGOS 1IBXB 5G5GA 4NZLB 2ACZB 2BS4B 2D5GA 1M4VA 4WIPA 4B0MA 1L6VA 3LB8C 3DWGC 2KN4A 2KQ4X 4KGSA 4RGNA 3J9CA 2X38A 5D7GA 4OVZA 4ARIA 1TKGA 2K3UA 2PTLA 3V3XA 2RPVA 2W54A 2WXJA 3Q8AA 3R8BA 2BBCA 3P4PB 1JWAD 1RYJA 2WXMA 1JROA 2WXGA 1N63A 1EU3A 1UWMA 2L52A 2ON8A 4RNAA 2GB1A 3MJ5A 4ZHOA 3W5VB 5FK9C 3VRBB 1XCTL 1SF0A 1WWTA 2J53A 1IUEA 3BVZA 3VRAB 3W1SA 2WXPA 4WAFA 1KLGD 1B1ZA 1T3QA 2KDMA 2NTSA 1I4HA 1K53A 4KGTA 3U7ZA 1HEZE 3Q8FA 4NJCA 1L5PA 1IBXA 4KGRA 3ZJTA 4ZHPA 2V0GA 4RF0A 2NTTA 4YTNB 2NMQA 4USAA 3AE3B 1C76A 3KQ4A 4WURA 2RDGA 2JX5A 1ACCA 1J7AA 1EWYC 1TS5A 2W3RA 1JCKB 1VZ6A 3LYYA 1D5XC 1HA5A 3GP7A 2VZKD 2OEDA 3KLSX 2Z8LA 3ZQ4A 1ZP0B 3I9V1 2BB5A 4NAWB 1NI3A 4REZA 3P4QB 2Y5CA 2EELA 4ZYSA 2INPE 2JYEA 1C4PA 1Y56A 2CJOA 3KWVA 1JRPA 2BT6A 2IGDA 2JYTA 1ESFA 2GI9A 2BYTA 2WXOA 3AH7A 1BUIC 1TKYA 1QOFA 2FE8A 1V1PB 1I4XA 4DXFA 3AE5B 3E9SA 4HKZE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VZ8 A;  2YEP F;  1VZ6 A;  1VZ7 A;  3IT6 B;  2YEP B;  2VZK D;  2V4I B;  1VRA B;  2VZK B;  3IT4 B; 
#chains in the Genus database with same CATH topology
 1VZ8 A;  3H7P A;  1OEY J;  5GXG B;  2K8H A;  3V6E B;  1FRR A;  4JWU C;  1YQ4 B;  3X23 A;  3TIX A;  2IO1 B;  4TSS A;  2JRI B;  1N5W A;  4N59 A;  5C2T B;  4DHZ B;  2OHF A;  3U7D A;  1XT9 B;  3P63 A;  2KK8 A;  2MBB B;  2R2Q A;  4ICV A;  4GLS C;  2RDH A;  3TMP B;  5BMG A;  1I4G A;  2BVC A;  5DPR A;  4MSM B;  2XNA C;  2J7Q B;  5G2N A;  1SE9 A;  2CU1 A;  4MM3 B;  1WF9 A;  3SEB A;  1FRD A;  1R4N B;  2JY6 A;  4M0W B;  4NY0 A;  2L76 A;  3PZD A;  3NZU A;  3VUX A;  3GE8 C;  1MHX A;  2ZEQ A;  5EE0 A;  4GDL A;  3ZXV A;  4WWN A;  1WIA A;  4TQ0 A;  3DCG A;  4L2Y A;  1WZ0 A;  1I4Q A;  3DQV A;  4KVG B;  3PRE A;  2ZPY A;  4ARC A;  2L8J A;  2HJ8 A;  3WAL A;  4AJY B;  1WY8 A;  1FXA A;  2UWQ A;  4HCP B;  3BWU D;  3V05 A;  2LXC A;  3QCA A;  5G5H A;  2UYZ B;  4IM2 A;  4K7W A;  3I3T B;  4ITK A;  5JHA A;  4I6N B;  3URY A;  4DWF A;  1E6E B;  1VZ7 A;  2IJ0 A;  2BS2 B;  5J17 A;  3SFD B;  4AUQ C;  3AED B;  3RNB C;  4B6W A;  1RFK A;  1L0V B;  4O1N A;  1L4D B;  1EUV B;  3KYC D;  1R4N I;  4RMA A;  5GMV A;  2K5P A;  1Q0W B;  1QKZ A;  3ZNZ B;  4PS7 A;  4AP4 C;  4ANX A;  2D11 A;  4OZC A;  4C4V B;  2BWF A;  4XE0 A;  2L3Z A;  3JVZ X;  3QAR A;  3WAO A;  2EKI A;  1N60 A;  2L32 A;  2QJL A;  4EE2 A;  1SSN A;  4M02 A;  4YT0 B;  3CWI A;  4W9F A;  1KFY B;  4WQM A;  3W5U B;  3AU4 A;  2EMS A;  4WJQ A;  4WJP A;  4YTM B;  1VRA B;  4WJN A;  1LM8 B;  3AE6 B;  5BYS A;  5H8Y E;  1VJK A;  1XLQ A;  3HVD A;  4FLH A;  4ANW A;  2MBO A;  4XWT A;  3VAW A;  1ZOY B;  1UBQ A;  2JZP A;  4KKI A;  1WYG A;  1E8X A;  2L7R A;  2KTR B;  1O0S A;  2LVQ A;  4C4V A;  4MM3 A;  3M63 B;  3BYY B;  2MCN B;  1FEH A;  2LGX A;  3UI3 A;  4P1B C;  5BMH A;  4HJK A;  2K22 A;  3PZ8 A;  4W9E A;  1QOB A;  4NQL B;  1SIF A;  3Q3J A;  1WJ6 A;  3AEC B;  4RFB A;  2PLP A;  3N9Y C;  4IOI E;  1UH6 A;  5DCN A;  3TSS A;  3OLM D;  2Z0E B;  3ML8 A;  1MFW A;  2I38 A;  2CU3 A;  1F1H A;  1XD3 B;  3GE3 C;  4W9J A;  4JGH B;  2HDE A;  1FO4 A;  4DHJ B;  1YN4 A;  3C8Y A;  4IUM B;  1EF1 A;  3PZ7 A;  3A33 B;  1T0R C;  3B9J A;  2WDV B;  2WWZ A;  2BYV E;  3DVN V;  3A1Q B;  2AL3 A;  2LUE A;  2DZJ A;  3DBS A;  4KX6 B;  1UNS A;  3MJW A;  3T9L A;  2BF8 B;  1T0Y A;  4EUT A;  1C4C A;  3AEB B;  3DOW A;  1V80 A;  2D3B A;  2QC8 A;  5E6J A;  5C3J B;  2ICI A;  3PRZ A;  1SE3 A;  1BT0 A;  2WDR B;  3MP9 A;  1CK1 A;  1TTN A;  5D6J B;  3PLV A;  1NDD A;  2QEJ C;  1FMA D;  1XLO A;  3ZTD A;  2HTM E;  2WMI B;  1FNV A;  5D3D A;  2MBQ A;  3T3O A;  1C77 A;  4J6I A;  2KVZ A;  2M0X A;  3U52 E;  3PVL A;  2R2O A;  2KFK B;  2W82 A;  1TKE A;  4K3B A;  1YD8 U;  2N9K A;  2DYO A;  1WXQ A;  3RI7 C;  3HK0 A;  2I2Y A;  2DWQ A;  3B0A A;  4HDO A;  1I4P A;  1SBB B;  3H7P B;  4KIK A;  2KN5 A;  3ZRC A;  5AEK B;  1MPE A;  3DBL B;  3ZUN A;  3ZJV A;  4YXD B;  3VR9 B;  1GC7 A;  3Q8B A;  3UIP B;  3U30 A;  3ZJU A;  4RF1 A;  3HRD D;  4FAD A;  2J42 A;  3JW0 X;  1HZ6 A;  1GNU A;  1FCC C;  1JQ4 A;  3DHH C;  3N30 A;  1DGJ A;  1D6E C;  2LEK A;  1ET9 A;  3BK2 A;  1LQB A;  3SFE B;  3KYD D;  2MP2 A;  3RNF C;  5IO9 A;  3R2T A;  1WJU A;  4G0N B;  4FUL A;  4JIO U;  1J0G A;  2WNM A;  2KWU B;  2O6V D;  2HD5 B;  2RMM A;  3P4S B;  2IGG A;  2DHZ A;  2Q5W D;  5E6N A;  2MWS B;  3P4R B;  4JWS C;  2L0F A;  2XN9 C;  4EZJ A;  3QJZ A;  4MH0 E;  2BS3 B;  2L1A A;  4KDL B;  4OHJ A;  4RGO S;  2WX0 A;  5IN7 A;  2HE7 A;  2GLS A;  4NZL B;  2D5G A;  2KO3 A;  4AJW A;  4W9I A;  4WIP A;  5D2M B;  3A9K B;  3N1Z C;  2YVC A;  2UU7 A;  5D7G A;  4ARI A;  2K3U A;  1WGH A;  4FJZ A;  4XZ4 A;  1JWA D;  3QIJ A;  4MGY E;  1UWM A;  2ON8 A;  2I1J A;  5IKC M;  3W5V B;  2CHZ A;  5FK9 C;  2J53 A;  2VH1 A;  2C7M B;  4S17 A;  3VRA B;  2WXP A;  4WAF A;  4M00 A;  1WMH B;  2NTS A;  3VTW A;  1L5P A;  2QDF A;  2K25 A;  2JT4 B;  4KGR A;  4DXA B;  5E6P A;  2KMC A;  1AAR A;  2WGS A;  4YTN B;  2NMQ A;  4XYC A;  2BPS A;  2QCZ A;  1EWY C;  1TS5 A;  3LYY A;  2VZK D;  2M1M A;  2OED A;  3I63 C;  2BB5 A;  2DAJ A;  3C0R B;  3P4Q B;  1J8C A;  2INP E;  2JYE A;  2MHJ A;  2C9W B;  3IFW B;  1IPG A;  3RN9 C;  2JYT A;  2GI9 A;  2WXO A;  3KVF B;  4I6P A;  3PS6 A;  4D6D A;  4HPM B;  1I4X A;  2WMK A;  2WXI A;  2QSD A;  4HCN B;  1VR9 A;  3NS1 A;  1OFF A;  4HRO A;  2M56 B;  2AYO B;  3HVZ A;  5JXV A;  4IM3 A;  3NVZ A;  2PE6 B;  1UWX A;  2J52 A;  4TMA B;  1OQQ A;  4AS1 A;  3PRM B;  1YN3 A;  1SE4 A;  3NUH B;  2CS4 A;  1C78 A;  4LJP B;  2N7J A;  4ZRK A;  1SEB D;  4D72 A;  1CJE A;  5FR3 A;  1FIQ A;  3ZTC A;  1WRD B;  4W9C A;  3RUL A;  1MVK A;  2N9P C;  4F1S A;  4HPL B;  2RGF A;  4MT5 A;  3ECI A;  4P1C C;  1F9J A;  4II3 B;  4TQ1 A;  1UUP A;  1ZXH A;  3NRZ A;  5J2R A;  1DOI A;  3BYT B;  1JWS D;  3R3M A;  2FUG 1;  1WR6 E;  3N3K B;  2V4L A;  1PYW D;  4GOC A;  1GUA B;  1UEL A;  3VXW A;  4HLE A;  3FAH A;  1E0Z A;  1EO6 A;  3ZKJ C;  1LGR A;  1T0S C;  1E9M A;  1NI2 A;  4S0R A;  5D3I B;  1D3Z A;  5BO4 B;  3BK1 A;  1SXT A;  1QQR A;  2H88 B;  1FXT B;  3PV1 A;  3HHM A;  1I42 A;  2Z0D B;  2BQQ A;  2LGY A;  4LDT D;  3X0W A;  3TL5 A;  3MFG A;  3Q3O C;  2HTH A;  3NOB A;  1IYF A;  4GMV A;  4YSZ B;  3AN1 A;  3GZN I;  3HM6 X;  3FIL B;  1Z2M A;  4FJY A;  2LGI A;  1JWB D;  3QA8 A;  3LXF A;  4HXD A;  2JPH A;  2LFI A;  3PLU A;  1PGB A;  2BTE A;  2KYW A;  4RGM A;  4OZB A;  1TS2 A;  4GU2 A;  2L0T A;  1ZE3 D;  3HM3 A;  1WE7 A;  3L13 A;  1D4B A;  4HK2 A;  3W2D A;  1OEY A;  4LLG M;  3OG5 A;  1GB4 A;  1MJD A;  1SJE D;  5EE1 A;  3WCQ A;  4BOZ B;  5I4D A;  2KDE B;  2J4X A;  2KJ6 A;  3N1Y C;  3WIM A;  4L1B A;  2PVO D;  1HZ5 A;  2LJI A;  1V81 A;  3UGB B;  1N61 A;  2C5L C;  2KFJ A;  1WE6 A;  1KH0 A;  4LDT B;  3VVW B;  2DLB A;  1IP9 A;  1JWM D;  4FA6 A;  4D6H A;  3TEZ A;  4LK0 M;  2KDI A;  1WZ3 A;  1NEN B;  3ZW3 A;  2D07 B;  2WXQ A;  2W3S A;  3R66 C;  3A9K A;  1BXT A;  3ZNH B;  4DXG A;  1D5Z C;  3RCZ A;  1FNW A;  4PS8 A;  1GB1 A;  2A5U A;  1HTQ A;  3NZ3 A;  2JUO A;  2PPH A;  3DVG X;  2N9E B;  2FID A;  2FBW B;  1FFU A;  4W9D A;  4NAM A;  2BW2 A;  4MAC A;  4RGT A;  2JU6 X;  3ZDT A;  2PMV A;  2WU5 B;  1PGX A;  4A3O A;  3VH4 B;  3JSV B;  4LNN A;  1WGR A;  1FFV A;  2WDT B;  2IND C;  4JE3 B;  1HXY D;  1WGG A;  2IYD B;  2LUM A;  4W9H A;  1ZUD 2;  4PYZ A;  1XLN A;  3QK0 A;  1QLB B;  2RDB C;  1V97 A;  2MJD A;  4EOY A;  2LD9 A;  1WGY A;  3K9P B;  4JLC A;  1KOT A;  3Q3M C;  3VH3 B;  2KNB A;  1UGJ A;  1TT5 B;  1N62 A;  3T3N A;  3MHZ A;  1BML C;  2QIE B;  3A1Q A;  2KX3 A;  2WMF A;  1XCQ L;  3DPD A;  2BYE A;  3VTV A;  3ZNG C;  4XDD A;  4EZL A;  3KUD B;  2JSV X;  2FIF A;  5IA7 A;  3RFZ B;  3FC4 A;  4DQO C;  3EA6 A;  5HG2 A;  3TBL D;  4EFO A;  1RRB A;  2MLB A;  1Q1O A;  2GBN A;  2N7D A;  2H89 B;  1N6Z A;  3ZRF A;  1H8C A;  3IVF A;  2DZI A;  4D6E A;  4DHZ E;  2ZNV C;  1IGC A;  2J0J A;  2JXT A;  5LXI B;  4W9L A;  3A9J B;  4G3X B;  2RR9 A;  3RYT A;  3P2B A;  4A6Q A;  1TBE A;  1L0Y B;  3SR6 A;  2NR2 A;  5AUK A;  4BKG A;  3N20 C;  2MX2 A;  2WU2 B;  3TEY A;  2KLG A;  1SE2 A;  1HE8 A;  2C60 A;  5JHB A;  1LXD A;  3TCA A;  4G50 A;  2EMT A;  1E7P B;  5HFY A;  3AM9 A;  3WA0 A;  2O6V B;  2KAJ A;  5CHF A;  2R61 A;  2WXN A;  3ENE A;  1WH3 A;  1L0X B;  1C9F A;  2DYM A;  4LNK A;  3I57 A;  4ZRP A;  3OWE B;  4OZA A;  3U2S C;  3DHG C;  1E8W A;  1K52 A;  1X1M A;  1SGH A;  4YWG G;  5L83 A;  4GDK B;  2LMC A;  3VR8 B;  3TEW A;  2YLM A;  3Q2A C;  3DBL I;  2VRR B;  2KTF A;  2MP2 B;  4YL8 A;  1MG8 A;  2CHW A;  4ACF A;  1WX7 A;  3MTN B;  1CMX B;  1YJJ A;  2PW9 A;  3VHT C;  5BYQ A;  4BFR A;  2DAF A;  4ANU A;  1QF6 A;  2BWE S;  2KLC A;  2XK5 B;  2V3S A;  1IBX B;  2FCN A;  1YX6 B;  2BS4 B;  3APF A;  1M4V A;  4B0M A;  4D6J A;  3H7S A;  4WWO A;  4P7I A;  4D71 A;  2KC2 A;  3RUI B;  4RGN A;  3J9C A;  2X38 A;  4OVZ A;  2EKE C;  2KAN A;  1WJN A;  2BBC A;  2N1W A;  2L52 A;  4GIV A;  2KVR A;  4ZHO A;  1SF0 A;  4MDK E;  2OJW A;  1IUE A;  2KTR A;  4HWI B;  2MA9 B;  4A3P A;  1RLF A;  1WXV A;  1I4H A;  2KQ7 A;  3Q8F A;  2MRP A;  4MEM A;  1IBX A;  2D3A A;  3ZJT A;  1R4M B;  2V0G A;  4RF0 A;  1ZGU B;  1V49 A;  2RPQ A;  2BKR B;  2IO3 B;  4K81 A;  2VH2 A;  4WUR A;  3UQB A;  2W3R A;  3VUW A;  4M8M A;  1K8R B;  1UZX B;  4NAW B;  2EEL A;  2ZVO A;  2V9H A;  1OQY A;  2K6D B;  4D6I A;  2J0K A;  3KWV A;  4JL9 A;  1YQB A;  2BYT A;  3ZVV A;  1BUI C;  1QOF A;  1TGZ B;  2IBI B;  1V1P B;  2W9N A;  4FN2 A;  2KZR A;  2Y5P A;  1V8C A;  3PT2 B;  1ENF A;  4M01 A;  1TZO A;  2K0P A;  1GC6 A;  1STE A;  1VD2 A;  4C7Z A;  1PDX A;  2AEH A;  3HIZ A;  1YNT E;  3ZYY X;  2LGD A;  3FKY A;  5HHD G;  3SU8 X;  3NZS A;  2WMI A;  4G11 A;  1NVI D;  1XO3 A;  1H4R A;  1WXM A;  3AEG B;  4BOS C;  1SIJ A;  2E6X A;  2QHO A;  4MJS A;  4MSQ B;  1TY0 A;  2NPT A;  3L4P A;  3ZNI D;  2GBM A;  2JZ3 B;  4NNJ B;  2N0S B;  2WDQ B;  4FBJ B;  2N9L A;  4YSX B;  4RM8 A;  3IHP C;  3TUO A;  4FJV B;  1TS4 A;  3DWM A;  5FKA C;  4NJ7 A;  3NG0 A;  1JWU D;  1KF6 B;  2RD0 A;  3L10 B;  4X57 B;  1V1P A;  2ZZP B;  3IT6 B;  4IM0 A;  3QWZ B;  2G9H D;  1OGW A;  3D32 A;  2M0A A;  1AYF A;  3OAW A;  3EEC A;  4C80 A;  2IZV B;  1NEK B;  4YSY B;  2KHW B;  4AQ7 A;  3KUC B;  1VCB A;  3AE1 B;  1ISN A;  3PPA A;  5JH5 C;  1PFD A;  4JPS A;  3JSV A;  3RNG C;  3RNA C;  2CJN A;  2J0M A;  4BKS A;  3EUB 2;  1FNU A;  3L16 A;  1AW7 A;  1YJI A;  4K7U A;  2O2V B;  2NPT B;  1OTR B;  3APD A;  2JQR B;  3CMM B;  2N9X A;  4AWJ A;  4D2K A;  2JF5 A;  2WHI A;  2ZW0 A;  4WH4 A;  4PYU A;  2D3C A;  1A5R A;  1VDV A;  3B2F A;  3BII D;  3U8Z A;  1QZE A;  2V3N A;  3FIL A;  3QHT A;  1AWD A;  2AL6 A;  3EFC A;  2IO2 B;  4CHK A;  4RCO A;  3C19 A;  3ABV B;  2RSU A;  1WM3 A;  1F2R C;  2ZNV B;  2WXK A;  4B9K A;  4CYE A;  3AI5 A;  4LCD E;  1ROE A;  1UD7 A;  2WLB A;  3V62 A;  3CF6 E;  2NBW B;  1WGD A;  4A55 A;  1Z5S B;  4A8X C;  4LNF A;  2MSE D;  1T5X D;  1ZDV A;  3NHE B;  2YEP B;  1ZXI A;  4P6V F;  3PO0 A;  1ZW7 A;  4LJO B;  2MJE A;  4P16 A;  1WYW B;  3AEE B;  3BZD B;  2DYB A;  2LI5 A;  1GPX A;  1DYQ A;  3UQA A;  2IPK D;  3TEX A;  4GDK A;  1A70 A;  3CIR B;  4URK A;  1DOX A;  3IBE A;  1TZ1 A;  5EE9 A;  2OJR A;  4B95 A;  3NVW A;  4UDU C;  2KAC A;  1R7S A;  1TY2 A;  1KTK A;  1R4M I;  3H1U A;  2A4Z A;  1V1O A;  2GMI C;  4US9 A;  4B0E A;  5C23 A;  1JW9 D;  1WR1 A;  2CHX A;  5AZF A;  5LXH A;  5CHV C;  2IGH A;  1WM2 A;  2XK5 A;  2WMH A;  1YN5 A;  4R3D A;  2WP9 B;  1HTO A;  3CSF A;  3GOE A;  2WMJ A;  1YQ3 B;  4WWM A;  1V5T A;  1Y8R C;  1NBF C;  5C1Z A;  4ZYN A;  1XQQ A;  5IAA C;  4AOF A;  4DK5 A;  1P1A A;  3L08 A;  1E7V A;  2PEA A;  4RH6 A;  2LAS A;  4DHJ D;  3AV8 A;  2K6Q A;  5L95 C;  2AQ1 B;  3Q14 C;  4IKG A;  2KWD A;  2BKF A;  1FXI A;  3KWL A;  3ZDM C;  3NJT A;  4ICU A;  4ZDV A;  1RM6 C;  2IDY A;  4Q2J A;  4US8 A;  2IY0 B;  2IY1 B;  4OVV A;  1XEE A;  1E8Z A;  4HEA 1;  4MGZ E;  5CTR C;  1EWC A;  4HVB A;  3KW5 B;  5J18 A;  1ZKH A;  3AEA B;  2K9X A;  2M17 A;  2B3A A;  3ONS A;  3DVG Y;  2XBB C;  4N9F 4;  1FPY A;  3H6N A;  1WGK A;  5E6O A;  1RWS A;  4W9G A;  2QIL A;  4BBN C;  3BIN A;  3RNE C;  4TUU A;  2WXH A;  1KRH A;  1E5W A;  5EE3 A;  2V4I B;  3W1Y A;  2G1E A;  3AE4 B;  4F7Z A;  1D5M C;  5BMI A;  4ZRI A;  5T8I A;  4D6C A;  1S1Q B;  1ZPS A;  1WJ4 A;  3GZN B;  1V5O A;  1YJ1 A;  5AUI A;  3GS2 A;  3EC8 A;  4EKU A;  1DOY A;  1SB3 C;  5CX3 A;  3WAM A;  5EDS A;  3T8M A;  2GBR A;  2JWU A;  2NBV B;  1TYG B;  4WAA A;  3MC8 A;  4E71 A;  1QIL A;  1P98 A;  2ZJD A;  3R2I A;  3R7Q A;  2LHE A;  3APC A;  1WFY A;  1V86 A;  1MI0 A;  3UIO B;  1NYQ A;  2PIA A;  5IOI A;  4MH8 A;  4BAX A;  4OVU A;  2XEW A;  3IT4 B;  3W9C B;  2M19 A;  2Z59 B;  4H2A A;  3O65 B;  1J19 A;  1E90 A;  3PHX B;  4KSK C;  1C79 A;  1GOZ A;  4NAW A;  1CZP A;  2G4D B;  4BVU C;  2AQ2 B;  4KV2 A;  3TJP A;  3AE7 B;  3ZO5 B;  3AE8 B;  1F77 A;  2KJH B;  2W55 A;  4MGK E;  2E3T A;  2NS5 A;  4MJS B;  2N4F A;  2G4S A;  2ACZ B;  1GG3 A;  1M94 A;  3Q3N C;  4PK1 A;  4MGI E;  2FCS A;  2MBE A;  3LB8 C;  3DWG C;  5AZG A;  3DBH I;  2KN4 A;  5DPS A;  1PQS A;  2ZPN A;  1TKG A;  1I35 A;  4CO7 A;  1WXA A;  1WX9 A;  3V3X A;  2RPV A;  2W54 A;  2WXJ A;  3Q8A A;  3R8B A;  3P4P B;  2WXM A;  1MG4 A;  2GBK A;  1N63 A;  1EU3 A;  4RNA A;  2KDB A;  2LJ5 A;  3VRB B;  1WXS A;  2N7E A;  1WWT A;  3BVZ A;  3W1S A;  4A20 A;  3VFK A;  1B1Z A;  1T3Q A;  2KDM A;  1K53 A;  1P9D U;  1LFD A;  2FCQ A;  4KZC A;  4NPN A;  4IWO A;  4JQW C;  2KD0 A;  4M8N A;  3A4S C;  3PSE B;  4MEL A;  4IC7 B;  2JX5 A;  1J7A A;  1VZ6 A;  1JCK B;  1HA5 A;  3GP7 A;  3ZQ4 A;  3KLS X;  3RZF A;  1NI3 A;  2MW5 A;  3AU5 A;  2Y5C A;  1TIF A;  4ZYS A;  4QAY A;  2KOX A;  2CJO A;  1JRP A;  2BT6 A;  1ESF A;  3RZW C;  3PTF C;  1TKY A;  2FE8 A;  2LZ6 A;  2WYQ A;  3Q8C A;  4DBG A;  3MC0 B;  2D10 A;  5CHW A;  3ZXR A;  1QOA A;  2CKH B;  2KWV B;  3B1L X;  5IP4 D;  1YOV B;  1QT9 A;  3Q6B A;  5KHO A;  3I5J C;  3A4R A;  4IDI A;  3ZLZ A;  4N58 A;  4C00 A;  5LNK 1;  4LTU A;  3B08 A;  3M95 A;  2ZCB A;  3DBR I;  4GB9 A;  4XC2 A;  4WQO B;  2B76 B;  1UGM A;  2O2V A;  2LWP A;  4BKT A;  1FCL A;  4XWW A;  4WWP A;  3VTU A;  2HJ1 A;  2KX0 A;  2Y3A A;  3L17 A;  4IW0 A;  1NYR A;  5AZH A;  3QX1 A;  2DEN B;  4XGA B;  3L54 A;  3SD5 A;  3O13 A;  3P42 A;  3ETR A;  3DDC B;  4HKQ A;  1C1Y B;  2DX5 B;  2LXA A;  1L7Y A;  2K39 A;  3PGE A;  4FHK A;  1F0Z A;  2O6V A;  4NQK E;  2KMM A;  3AE2 B;  1QOG A;  4J3O D;  2M4N A;  1ET6 A;  3V60 A;  2BYF A;  1V2Y A;  1I7H A;  4CQN A;  3BY4 B;  1YIW A;  2SAK A;  1KJT A;  2LHD A;  2INN E;  2ZVN A;  1F2R I;  2MH7 A;  2WXF A;  4KKJ A;  3U4E G;  2G45 B;  2LVO A;  1KLU D;  2JXX A;  2MJ3 A;  4RM9 A;  1L6U A;  2REX A;  2V3P A;  3IAS 1;  2ONQ A;  4M0W A;  1FM0 D;  1WX8 A;  3MC9 A;  4HRS A;  1Q10 A;  3BVM A;  1GJZ A;  1JRU A;  2L00 B;  2NVU I;  1ZDX A;  1C4A A;  4NJ6 A;  3RMK C;  1EF5 A;  3AUL A;  3L0W B;  4N6E B;  2BB6 A;  2C7N B;  3EGR A;  2L83 A;  3Q69 A;  3AEF B;  1P7F A;  5TR5 A;  1G6J A;  2C7H A;  1XXG A;  1OQR A;  1V9J A;  1P3Q U;  2DZM A;  3ZIM A;  3CST A;  2ASQ A;  4PS3 A;  2DZK A;  4XDC A;  1UF0 A;  3AE9 B;  2AQ3 B;  1XLP A;  4E3C A;  3VQI A;  3IG3 A;  4HPP A;  4BBN F;  1V6E A;  3V6C B;  2KWC A;  1JML A;  3AB5 A;  4FHJ A;  1J7C A;  1WMH A;  3W1S C;  2WXL A;  3UIN B;  4K1R B;  1KM7 A;  4GDL B;  4D6F A;  1AN8 A;  2D2Q A;  3BVG A;  5TSS A;  1U4A A;  3HUI A;  5KHQ A;  1WSP A;  4IWQ A;  3RPF C;  3RNC C;  2SEB D;  4GGQ A;  5H92 C;  2MEK A;  3KH0 A;  3WAN A;  2WMG A;  1IGD A;  1HQR D;  3WAP A;  4L23 A;  2NBU A;  3IXS A;  2WXR A;  5D94 A;  2YEP F;  1L4Z B;  4IG7 B;  3SHQ A;  5G55 A;  2MBH A;  2TSS A;  3H8H A;  2LGS A;  4ZRJ A;  2GRI A;  4TKN A;  2X8X X;  3ALB A;  1S3S G;  2JWZ A;  3EFU A;  1P0R A;  1EM7 A;  1RFA A;  2BGF A;  4JX1 C;  4DDG D;  3DVN U;  2D3G A;  4FXC A;  3QAQ A;  4K7S A;  5LLI A;  2PJH A;  1GAQ B;  1N5X A;  1LO5 D;  1T0Q C;  4I6L B;  1CQV A;  4K3C A;  3ML9 A;  1EU4 A;  4GSW A;  1WRI A;  4KDI C;  3LDZ E;  1XF5 L;  3JYU A;  4BZA A;  2FUH B;  5MPO A;  4E74 A;  2KMA A;  4TV3 A;  4YTP B;  5BYR A;  2DNF A;  1SJH D;  1TJE A;  1VLB A;  2JVC A;  2LRW A;  5DPT A;  1TS3 A;  2DBY A;  1YMH E;  3RD2 A;  3H9D A;  2Y5B B;  1E7U A;  3OJ3 A;  2JZZ A;  1E10 A;  4HJG E;  2AWT A;  1I4R A;  2WX1 A;  2AX5 A;  2KQS A;  1MHH E;  4OW0 A;  1RAX A;  3B2G A;  4EZK A;  2FAZ A;  3VUY A;  1B9R A;  3QQ8 B;  3R7R A;  2QMT A;  4IWP A;  2PKO A;  2K1F A;  4WJO A;  2CR5 A;  2I1K A;  1JAL A;  2VZK B;  2PVG C;  3VDZ A;  2WS3 B;  3LJ3 A;  4ASW C;  1T6B X;  2ZW1 A;  3N1X C;  3P1M A;  2PE9 A;  3GB1 A;  4A90 A;  3DBR B;  1FD6 A;  3NVY A;  2LRU A;  4A9A A;  5HI1 A;  2K8B A;  4ZRQ A;  3ZGZ A;  3NVV A;  4ZOH C;  4C7Y A;  2OOB B;  1LLQ A;  4PT5 A;  3Q8E A;  1P7E A;  4BKS D;  1UBI A;  1K51 A;  3UF8 A;  4DDI D;  1Q5W B;  3MHS D;  5DPW A;  3DBH B;  4F8C B;  1L2N A;  4C56 C;  2KT7 A;  2MQJ A;  3AMZ A;  3E56 A;  1PGA A;  3IAM 1;  1PUT A;  3QC8 B;  1E8Y A;  1J7B A;  2WQY B;  1K50 A;  2L05 A;  4KZ0 A;  2ZCC A;  3Q3F A;  5FR6 A;  3PHW B;  2GBJ A;  1YX5 B;  5G5G A;  3A9J A;  4GXB A;  1L6V A;  2JRH A;  3M3J A;  2GOW A;  5JZE B;  2KKC A;  1C3T A;  4HDQ A;  2IO0 B;  2KQ4 X;  4KGS A;  4KIK B;  4XX5 A;  2INC C;  3KUZ A;  3SDL C;  3OJ4 B;  2LVP A;  2PTL A;  4II2 B;  3AXC A;  1RYJ A;  1JRO A;  2WXG A;  2KFK A;  2GB1 A;  3PRP B;  3MJ5 A;  1XCT L;  4W9K A;  4EEW A;  3M62 B;  3NS8 A;  1KLG D;  5HKH A;  2M8S A;  4GN1 A;  2NCN A;  4KGT A;  3U7Z A;  1HEZ E;  4NJC A;  3NY5 A;  3S2A A;  4ZHP A;  1KLV A;  2NTT A;  2KXJ A;  3RT3 B;  4ANV A;  2KDF B;  3V61 A;  4USA A;  3AE3 B;  1C76 A;  3KQ4 A;  4LNI A;  1WI0 A;  2FCM A;  2RDG A;  1ACC A;  1F52 A;  1D5X C;  2Z8L A;  4D6G A;  1ZP0 B;  3I9V 1;  4REZ A;  3DHI C;  2KC1 A;  4LNO A;  3EHV A;  1C4P A;  1Y56 A;  2FNJ B;  4KSL C;  2K8C A;  3K9O B;  2IGD A;  2N1V A;  3AH7 A;  2V1Y A;  2KJR A;  2G3Q B;  3N32 A;  4DXF A;  3AE5 B;  3E9S A;  4HKZ E; 
#chains in the Genus database with same CATH homology
 1VZ8 A;  2Y5P A;  2WXI A;  2QSD A;  3Q8C A;  5GXG B;  1VR9 A;  1V8C A;  1ENF A;  3NS1 A;  1TZO A;  2K0P A;  1FRR A;  1STE A;  3MC0 B;  1OFF A;  1PDX A;  1YQ4 B;  4JWU C;  4C7Z A;  1QOA A;  1YNT E;  3ZYY X;  4HRO A;  2M56 B;  5HHD G;  4TSS A;  1N5W A;  4N59 A;  1QT9 A;  5C2T B;  2OHF A;  3HVZ A;  5JXV A;  3P63 A;  1NVI D;  1XO3 A;  3NVZ A;  4GLS C;  4IDI A;  1UWX A;  2J52 A;  2RDH A;  3AEG B;  4N58 A;  1SIJ A;  4TMA B;  1OQQ A;  2E6X A;  5LNK 1;  4LTU A;  4AS1 A;  5BMG A;  1TY0 A;  3L4P A;  1I4G A;  2N0S B;  2WDQ B;  2N9L A;  4YSX B;  2XNA C;  3TUO A;  2B76 B;  1YN3 A;  1SE4 A;  3NUH B;  1TS4 A;  1C78 A;  3DWM A;  4MM3 B;  2N7J A;  1FCL A;  3SEB A;  1FRD A;  5FKA C;  1SEB D;  4XWW A;  1JWU D;  1KF6 B;  1CJE A;  1V1P A;  3IT6 B;  2G9H D;  2Y3A A;  5FR3 A;  1NYR A;  1FIQ A;  2M0A A;  1AYF A;  1MHX A;  5EE0 A;  1MVK A;  3O13 A;  4C80 A;  3P42 A;  1NEK B;  4MT5 A;  4YSY B;  3ETR A;  4TQ0 A;  4L2Y A;  4HKQ A;  1I4Q A;  4TQ1 A;  4AQ7 A;  1UUP A;  1ZXH A;  3AE1 B;  3NRZ A;  1DOI A;  1PFD A;  3BYT B;  4JPS A;  4ARC A;  1JWS D;  2CJN A;  2FUG 1;  1F0Z A;  1FXA A;  3EUB 2;  1PYW D;  1FNU A;  3BWU D;  1AW7 A;  3V05 A;  1YJI A;  2KMM A;  3FAH A;  1E0Z A;  5G5H A;  3AE2 B;  1QOG A;  4J3O D;  1E9M A;  1ET6 A;  4ITK A;  3URY A;  1I7H A;  4CQN A;  2JQR B;  1E6E B;  2SAK A;  5D3I B;  1VZ7 A;  2IJ0 A;  2BS2 B;  2LHD A;  4D2K A;  2INN E;  3SFD B;  2ZW0 A;  4WH4 A;  2MH7 A;  1F2R I;  2WXF A;  1VDV A;  3AED B;  3BK1 A;  4KKJ A;  3B2F A;  3U4E G;  3BII D;  1RFK A;  1L0V B;  1QQR A;  1SXT A;  4O1N A;  1KLU D;  1L4D B;  2V3N A;  2H88 B;  3FIL A;  2MJ3 A;  1AWD A;  1L6U A;  2K5P A;  2V3P A;  3IAS 1;  2ONQ A;  1QKZ A;  4M0W A;  4RCO A;  1FM0 D;  3MFG A;  4HRS A;  4OZC A;  1Q10 A;  4XE0 A;  3BVM A;  3ABV B;  1F2R C;  1ZDX A;  2WXK A;  2EKI A;  4YSZ B;  1C4A A;  3AN1 A;  1N60 A;  2L32 A;  3FIL B;  4N6E B;  2BB6 A;  2QJL A;  3EGR A;  2L83 A;  2LGI A;  3Q69 A;  1JWB D;  4EE2 A;  1ROE A;  1SSN A;  3LXF A;  2WLB A;  3AEF B;  3CWI A;  2LFI A;  1P7F A;  4YT0 B;  1PGB A;  1KFY B;  4WQM A;  4A55 A;  2BTE A;  4RGM A;  1XXG A;  4A8X C;  4OZB A;  1OQR A;  1TS2 A;  3W5U B;  1T5X D;  4YTM B;  1ZDV A;  2YEP B;  1ZE3 D;  1ZXI A;  4P6V F;  1VRA B;  3PO0 A;  1D4B A;  3W2D A;  4LLG M;  4XDC A;  1GB4 A;  3AE9 B;  2MJE A;  1SJE D;  2AQ3 B;  5EE1 A;  4P16 A;  3AE6 B;  5BYS A;  5H8Y E;  1VJK A;  3WCQ A;  1XLQ A;  3HVD A;  1XLP A;  5I4D A;  3AEE B;  3BZD B;  3VQI A;  1GPX A;  4XWT A;  1DYQ A;  1JML A;  2IPK D;  2J4X A;  3TEX A;  3AB5 A;  1A70 A;  1J7C A;  1ZOY B;  4L1B A;  3CIR B;  2JZP A;  4KKI A;  1DOX A;  2PVO D;  2WXL A;  1HZ5 A;  2LJI A;  5EE9 A;  1WYG A;  4GDL B;  1N61 A;  1AN8 A;  3BVG A;  1KH0 A;  5TSS A;  3NVW A;  4UDU C;  2KAC A;  3HUI A;  1R7S A;  2DLB A;  1TY2 A;  1JWM D;  1KTK A;  1WSP A;  3TEZ A;  4LK0 M;  3BYY B;  3RPF C;  1FEH A;  1V1O A;  2SEB D;  4US9 A;  1NEN B;  5H92 C;  3UI3 A;  2MEK A;  4B0E A;  5BMH A;  2K22 A;  3PZ8 A;  1IGD A;  2WXQ A;  1HQR D;  2W3S A;  1JW9 D;  4L23 A;  1QOB A;  3IXS A;  2WXR A;  1BXT A;  2YEP F;  4DXG A;  1D5Z C;  1L4Z B;  2IGH A;  1FNW A;  3AEC B;  4RFB A;  2PLP A;  1GB1 A;  2TSS A;  3H8H A;  3N9Y C;  4IOI E;  3NZ3 A;  1YN5 A;  3TSS A;  2GRI A;  4R3D A;  2WP9 B;  1YQ3 B;  2I38 A;  4WWM A;  2FBW B;  1FFU A;  1EM7 A;  4JX1 C;  2CU3 A;  4NAM A;  2BW2 A;  4MAC A;  1FO4 A;  2HDE A;  4FXC A;  4RGT A;  1YN4 A;  3C8Y A;  2JU6 X;  4RH6 A;  1GAQ B;  2PMV A;  2WU5 B;  1N5X A;  1PGX A;  1LO5 D;  3PZ7 A;  3AV8 A;  1CQV A;  3B9J A;  2WDV B;  1FFV A;  2AQ1 B;  1EU4 A;  1WRI A;  4IKG A;  4JE3 B;  2KWD A;  1HXY D;  1FXI A;  3KWL A;  4KX6 B;  2LUM A;  1UNS A;  1XF5 L;  1ZUD 2;  1XLN A;  1QLB B;  5MPO A;  1C4C A;  1RM6 C;  2IDY A;  3AEB B;  4Q2J A;  4US8 A;  5E6J A;  1V97 A;  4YTP B;  2MJD A;  5BYR A;  5C3J B;  1XEE A;  2ICI A;  4HEA 1;  1SE3 A;  1EWC A;  1SJH D;  1TJE A;  1UGJ A;  1VLB A;  2WDR B;  1N62 A;  3MP9 A;  1CK1 A;  3T3N A;  3MHZ A;  1BML C;  2QIE B;  3AEA B;  1TS3 A;  2K9X A;  1XCQ L;  2DBY A;  1YMH E;  2QEJ C;  1FMA D;  1XLO A;  2HTM E;  4XDD A;  1FNV A;  5D3D A;  1E10 A;  4HJG E;  3T3O A;  1C77 A;  1I4R A;  1WGK A;  2JSV X;  2AX5 A;  3U52 E;  1RWS A;  3RFZ B;  3FC4 A;  4DQO C;  2QIL A;  1MHH E;  3EA6 A;  4OW0 A;  5HG2 A;  2W82 A;  3B2G A;  1TKE A;  2N9K A;  1B9R A;  2DYO A;  1WXQ A;  2WXH A;  1KRH A;  2I2Y A;  2DWQ A;  2H89 B;  1I4P A;  1SBB B;  2V4I B;  5EE3 A;  2QMT A;  2G1E A;  3AE4 B;  2PKO A;  1D5M C;  5BMI A;  1JAL A;  5T8I A;  1MPE A;  2VZK B;  1IGC A;  1ZPS A;  2PVG C;  3ZJV A;  5AUI A;  2WS3 B;  2JXT A;  3GS2 A;  4YXD B;  3VR9 B;  1T6B X;  2ZW1 A;  3Q8B A;  1DOY A;  1SB3 C;  4RF1 A;  3ZJU A;  4A6Q A;  3HRD D;  1L0Y B;  3P1M A;  3SR6 A;  2J42 A;  2JWU A;  5AUK A;  1HZ6 A;  3GB1 A;  4A90 A;  1TYG B;  2WU2 B;  1FCC C;  3TEY A;  1SE2 A;  1JQ4 A;  1FD6 A;  1QIL A;  3NVY A;  3R2I A;  1E7P B;  4A9A A;  5HFY A;  5HI1 A;  1DGJ A;  2LHE A;  1D6E C;  2LEK A;  3AM9 A;  4ZRQ A;  1ET9 A;  1MI0 A;  3BK2 A;  2KAJ A;  1NYQ A;  2PIA A;  3NVV A;  3SFE B;  3ZGZ A;  2R61 A;  2WXN A;  4ZOH C;  4MH8 A;  4C7Y A;  3IT4 B;  3R2T A;  3W9C B;  1L0X B;  2M19 A;  1C9F A;  2DYM A;  3I57 A;  4PT5 A;  3Q8E A;  2WNM A;  3OWE B;  4H2A A;  4OZA A;  4ZRP A;  3U2S C;  1P7E A;  1K52 A;  1C79 A;  1K51 A;  4YWG G;  2RMM A;  3P4S B;  2IGG A;  2Q5W D;  4GDK B;  2LMC A;  1GOZ A;  3VR8 B;  3P4R B;  3TEW A;  4JWS C;  4C56 C;  1CZP A;  2XN9 C;  2AQ2 B;  3AMZ A;  3E56 A;  1PGA A;  3IAM 1;  3AE7 B;  1PUT A;  1YJJ A;  1J7B A;  2PW9 A;  2WQY B;  1K50 A;  3AE8 B;  5BYQ A;  2BS3 B;  1F77 A;  2L1A A;  2W55 A;  1QF6 A;  2E3T A;  4OHJ A;  4RGO S;  1IBX B;  5G5G A;  4NZL B;  2ACZ B;  2BS4 B;  2D5G A;  1M4V A;  4WIP A;  4B0M A;  1L6V A;  3LB8 C;  3DWG C;  2KN4 A;  2KQ4 X;  4KGS A;  4RGN A;  3J9C A;  2X38 A;  5D7G A;  4OVZ A;  4ARI A;  1TKG A;  2K3U A;  2PTL A;  3V3X A;  2RPV A;  2W54 A;  2WXJ A;  3Q8A A;  3R8B A;  2BBC A;  3P4P B;  1JWA D;  1RYJ A;  2WXM A;  1JRO A;  2WXG A;  1N63 A;  1EU3 A;  1UWM A;  2L52 A;  2ON8 A;  4RNA A;  2GB1 A;  3MJ5 A;  4ZHO A;  3W5V B;  5FK9 C;  3VRB B;  1XCT L;  1SF0 A;  1WWT A;  2J53 A;  1IUE A;  3BVZ A;  3VRA B;  3W1S A;  2WXP A;  4WAF A;  1KLG D;  1B1Z A;  1T3Q A;  2KDM A;  2NTS A;  1I4H A;  1K53 A;  4KGT A;  3U7Z A;  1HEZ E;  3Q8F A;  4NJC A;  1L5P A;  1IBX A;  4KGR A;  3ZJT A;  4ZHP A;  2V0G A;  4RF0 A;  2NTT A;  4YTN B;  2NMQ A;  4USA A;  3AE3 B;  1C76 A;  3KQ4 A;  4WUR A;  2RDG A;  2JX5 A;  1ACC A;  1J7A A;  1EWY C;  1TS5 A;  2W3R A;  1JCK B;  1VZ6 A;  3LYY A;  1D5X C;  1HA5 A;  3GP7 A;  2VZK D;  2OED A;  3KLS X;  2Z8L A;  3ZQ4 A;  1ZP0 B;  3I9V 1;  2BB5 A;  4NAW B;  1NI3 A;  4REZ A;  3P4Q B;  2Y5C A;  2EEL A;  4ZYS A;  2INP E;  2JYE A;  1C4P A;  1Y56 A;  2CJO A;  3KWV A;  1JRP A;  2BT6 A;  2IGD A;  2JYT A;  1ESF A;  2GI9 A;  2BYT A;  2WXO A;  3AH7 A;  1BUI C;  1TKY A;  1QOF A;  2FE8 A;  1V1P B;  1I4X A;  4DXF A;  3AE5 B;  3E9S A;  4HKZ E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...