2VZLA

Ferredoxin-nadp reductase (mutations: t155g, a160t, l263p and y303s) complexed with nad by cocrystallization
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
295
Chain Sequence
b'DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGPRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
molecule tags Oxidoreductase
source organism Nostoc sp.
publication title Protein Motifs Involved in Coenzyme Interaction and Enzymatic Efficiency in Anabaena Ferredoxin-Nadp+ Reductase.
pubmed doi rcsb
total genus 90
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2vzlA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2vzlA02
1KJZA 1N0VC 5FA6A 3CW2A 4RD2A 2YWFA 2QEXB 4M0LA 3CRZA 3CMEB 4UAJA 1QVFB 2PMDA 4TMZA 1YIJB 1K8AD 1W35A 2B7CA 3MCAA 1TTTA 3PENA 4DQLA 4YAOA 3WY9A 1JNYA 3CB4A 4H9GA 1D2EA 3CD6B 1E62A 4IW3B 2OTJB 4RD3A 2PLFA 2XEXA 4ZCMA 2D74A 1E63A 1K9MD 4HE5A 1Q7YD 4J0QA 1W87A 3ZZTA 3VNUA 1FNBA 4B43A 3AVXA 3ZC3A 4RD1A 3B82A 1N8RD 2C77A 3U6BA 1IB0A 4ACAA 3I56B 1KD1D 5KSWB 4BPRA 4F7DA 3OZVA 1IJEA 1KC8D 1JA0A 5DSZA 2CNDA 1DDGA 2HMAA 1VQ6B 1R5OA 3CC7B 1KK1A 1ZM3A 4RD4A 2R6HA 4YHBA 1OB2A 1ELOA 2BF4A 3OJWA 1E64A 2BVNA 4B44A 1XB2A 1VQ8B 3V76A 4M4SA 1BJKA 2RC6A 4YALA 1Q81D 2BV3A 3E1YE 3VO1A 1FDRA 1HA3A 1XE1A 4QFMA 4B48A 4B4DA 1F20A 3W5VA 3WBJA 1H42A 3E20A 5HXBA 3AVWA 4Y9UA 1SKQA 1WDTA 3SJZA 4LBVA 3WNDA 1CNFA 4RCYA 1VQ9B 2XNCA 3WNCA 3W2GA 3QFCA 1KQSB 4M1KA 1YITB 1QFZA 1BX0A 2DEUA 3LRXA 2PIAA 1FNDA 3QFRA 2B7BA 1QGZA 1QFJA 3ZBTA 4P3YA 3AGQA 2B5OA 4AC9A 3B8HA 5TV2A 1OGIA 2BM0A 4YAFA 1VQLB 1VQ7B 1NDHA 4RD6A 4R71A 3G71B 3QFTA 1U2RA 1W2BB 1BQEA 5JBQA 5GV7A 3JQPA 2QA4B 1FRNA 3MMPA 4K1XA 3CC2B 1JA1A 1FRQA 2BGIA 5H5JA 1VQMB 1FNCA 3W2IA 4ACBA 2QMUA 3MHPA 1GAWA 3OJXA 3FJOA 1YJNB 1UMKA 1GVHA 2YWEA 1DARA 2X3UA 1KRHA 1J9ZA 3LVBA 2OK8A 2QTLA 1D1NA 3AGPA 5H59A 1R5BA 1VQ5B 1ZM2A 3QE2A 3CCJB 2BGJA 4ZGNB 3CPWB 2CRVA 2GQFA 4M2LA 4LBWA 4ZCLA 2EIXA 2ZITA 1VQKB 1N0UA 3CC4B 4QHYA 4TN1A 2C78A 2DERA 4WQMA 4PC7A 4P6VF 4TMWA 2DETA 2VNIA 1CNEA 3OZWA 5TY0A 3AVVA 1NJID 1EWYA 4G1VA 1GJRA 3OW2B 4PC2A 4Y7CA 1ZM9A 3B78A 1OB5A 3W2HA 1CQXA 1D8TA 4FWTA 3AVYA 3WYAA 1EP1B 1TVCA 1H85A 4HE6A 1JJ2B 2VZLA 4ZGQB 1SM4A 2XNJA 4N3GA 3QSYA 1Q82D 1JB9A 2EFGA 1ZUNB 3W2FA 3FPKA 1QUFA 1I7PA 4RJLA 1VQNB 2VNJA 3U6KA 4RCZA 3CCVB 2BPOA 1W34A 1YJWB 4M53A 1G7SA 1VQPB 3QFSA 3W5HA 1YJ9B 1QUEA 1G7TA 3LO8A 3ZZUA 4ZV4A 3CCUB 4DQKA 3VNVA 4B47A 2OTLB 1VQOB 1OGJA 1KK2A 1QG0A 1KTVA 2GPJA 3P26A 4G5GA 3U2QA 1QX4A 3CCQB 1YHQB 4PC6A 1YI2B 4ZCIA 1A8PA 4RD0A 4FN5A 4EH1A 2E1RA 2RC5A 3P27A 1TUIA 1QVGB 4YAUA 5GV8A 2VYQA 1IJFA 4LC0A 4NBSA 1DG1G 1AMOA 2QDXA 3G6EB 3VO2A 3WNBA 4TMXA 4MYTA 3AVTA 5EMNA 1B23P 2FX3A 1AIPA 3AVUA 2YWGA 3ZBUA 1QFYA 3CCSB 4Y9RA 2AHOA 2DY1A 1EXMA 3CCRB 5TR9A 4C0SA 2BMWA 1EFTA 3CCEB 3WXMA 1ZM4A 2DCUA 3G4SB 2BM1A 3W5UA 1M90D 1TLLA 4TMVA 1QGAA 3A1FA 1FNMA 2VNKA 1GO2A 3JQQA 5THXA 2NPFA 3CMAB 1GR1A 4TMTA 3W2EA 1EP3B 1F60A 1KK0A 3I55B 4B3XA 2OK7A 3CXCB 2QN6A 2YWHA 3VMFA 4YAWA 3I1FA 1DDIA 4NCNA 5AN9A 4G1BA 2BN4A 4PGOA 1BX1A 1Q86D 4PC1A 1K73D 3CCMB 3ZZ0A 2J7KA 2BSAA 1S0UA 2QTZA 3WBKA 1G7CA 3ES9A 4N3NA 4FK8A 4Q7JB 3J81k 1EP2B 1VQ4B 1KK3A 2HCJB 1EFCA 1R5NA 4LBZA 4MYUA 3JQRA 1QH0A 3OZUA 2HDNB 1S72B 4C43A 4PC3A 4AF7A 4LBYA 4U9UA 1B2RA 3LYUA 1G7RA 3CCLB 1QGYA 1EFUA 4AF6A 2VNHA 1GAQA 1M1KD
chains in the Genus database with same CATH superfamily
1S9HA 2YL2A 2I1VB 3KB2A 1E9EA 4Q02A 1OREA 2RG1A 3DQPA 3AERB 2QLNA 2ZRBA 3AZPA 1THGA 2Y1CA 1EVZA 4EY7A 1Y98A 1RQNA 4LXTA 4W5NA 1PFVA 1CWUA 3A3GA 3R77A 4YUXA 2J0UB 2QEXB 4F0JA 3E8MA 2GFQA 3G13A 3M1IA 5JASA 4R9VA 1I5RA 2D1TA 3EGDA 1JDJA 5IG2A 1GKYA 5LOVA 4RTSA 5IT5A 3M9LA 3UT0A 3OEYA 2E3JA 1ZO8A 2Z1NA 3NZEA 1SURA 1XSEA 4YJFB 3WRXC 1ZMXA 1F17A 2XZOA 3F3KA 1QZXA 1EJ6A 4KIGA 4O2BF 5BV1A 2CE2X 4ZVNA 2Z8YA 3B9QA 4M0EA 4ASUD 4DMFA 5KHLB 5KJFA 1KEKA 4I46A 2IIBA 4YRZA 5LQAA 2XZLA 1K06A 4IIJA 3KQUA 2JK0A 4L57A 1RWNA 4FFRA 3PBKA 5BN3B 3AEXA 2XZTA 4GZ6A 2AN5A 5FWXB 3VKGA 1BX3A 4BB5A 5DBOA 4X8IA 3E7PA 4DLBA 2PY6A 4JCOA 1BSVA 1N5OX 1ZHHA 3QE4A 1GSAA 4HF7A 3NHZA 2E55A 2ZE6A 3BRWD 2ODTX 2VSQA 1GV0A 3PGKA 2ZB4A 5EPOA 2JGNA 5EQJB 2ZSJA 4LWOA 3LRTA 3WFZA 1TPYA 4EPWA 5HKLA 3PK0A 3VZCA 3MJSA 3D81A 3JAKA 2EX0A 1K6MA 3ZZ1A 1T8YA 2AWNA 2HH9A 4DCUA 5J4KA 3ADCA 1MIOB 1W87A 4DJTA 4K9MA 4GG1A 1RI5A 1H2BA 2XW6A 3LWBA 1SZPA 3MGCA 1UC8A 1AKWA 1U0RA 1CQPA 2H8GA 5IYQA 821PA 4IH1A 3L9WA 3BQJA 4RHUA 3IJPA 1N8RD 1Z12A 4KCGA 3QOYA 2OHVA 3T15A 5LQCA 2LPMA 3OZTA 1CBUA 2J9FA 3OE7D 2EFEB 4NL4H 3V34A 4EY4A 1XQYA 1JIUA 2V7PA 2ODBA 2XR1A 1M1NA 2QVXX 3OPNA 3R3UA 4G1EB 2Q0SA 5GP1A 4WCDA 4GU5A 4TTQA 2ATIA 5DCYA 5LIPA 4I9NA 3DE1X 2WHPA 4ATNA 1OC4A 2PGXA 2FUG6 2PPVA 3QQ5A 1SULA 3D1LA 1JA0A 3IQEA 1MDFA 3KTFA 3M89A 4MDYA 5TPZA 5CA1A 3BH6A 5JYEA 1COWD 3HWRA 3HSYA 4DFDA 5C18A 1G1AA 3OY2A 3PRYA 3EUEA 1XZEA 3IA2A 3NRBA 4UXJA 1WCV1 1T5TA 1XO1A 2A1UB 4ZXPA 3QW4B 3CF0A 4BS9A 2HA0A 1LUAA 3O94A 1T5HX 1ECGA 2TMYA 1FDSA 4F7WA 4ZK6A 3ZXIA 3IVGA 4HWTA 3R7LA 2YS7A 1TEVA 1AC5A 1HY3A 3WZ2A 3TNLA 4HX2A 5EIXA 4EG1A 3QITA 4WNAB 2BDTA 1DJLA 2BHNA 1SHTX 1U31A 3A4NA 3RTDA 3WE7A 4YUZA 1H2HA 1IBRA 2O57A 4ZO9A 4F2WA 4P4TA 3IMGA 1M2VB 4BMXA 2FW7A 3DYIA 4ZCPA 4RKQA 1MH1A 5K01A 3P2JA 5KOHB 2FMXA 4TS1A 1HLPA 1D2NA 2JJ1D 4YELA 1BKDR 3GDGA 3FPBA 3N58A 3NVMB 4ARBA 2M5SA 1SEPA 5LBUA 3K16A 3T52A 3MWLA 3ZG6A 4CKYA 1K5DA 2QVCA 3D64A 4CYMA 3LUBA 2FCRA 3MUOA 2Q0HA 2A1TS 3FUUA 4IZHA 4Z9YA 2CD9A 4AQDA 5EUCA 3PL5A 1QTNA 5MGNA 3VH4A 3WL4A 4IDOA 3ASQA 4O33A 1Y8RB 1R18A 2WIBA 3WB0A 3RFTA 3QEAZ 1YR6A 2X4IA 4HO1X 3JZAA 3N07A 1K6IA 1QV9A 4YT5A 4YBZA 2FZKA 1ODCA 4YJHA 5HA5A 4AURA 3QNMA 1QK4A 4BASA 2IZ1A 3WWCA 3D2AA 3RW9A 3PSHA 4FW8A 3W2TA 1NG1A 1SBHA 3QFCA 1TU0A 1Y5NA 2L19A 3BH7A 1ZD4A 4HTAA 5AM0A 3UMBA 4YRKA 2OMEA 2OORA 2QLJA 2B8EA 1O94C 2AG6A 2QZ9A 4M9XA 3IEUA 1SC6A 4LGMA 1EVIA 1JHMA 2C1EA 1S2NA 1YNOA 2TRSB 2ZCUA 1UOQA 2Y0DA 3BWEA 3LRPA 3PUJA 1UMBB 1Y4DE 3QW2A 2UZ3A 4OXQA 2X6YA 3L8GA 5AI4A 3TNFA 3COWA 2C3OA 4ERXA 3W6NA 3L8HA 3OZDA 1KU6A 3BGSA 3TLKA 3USES 2XWPA 2GD2A 1EMDA 1AXRA 1JYEA 1UBKS 3C87A 3GMTA 4JDUA 1U7OA 2BM8A 1EE9A 4AC9A 5HRAA 1JQKA 1NT2A 5DTEA 3AW8A 2GETA 1U3FA 4OSEA 1OGIA 4I4TF 1VQ7B 3VNRA 1FCJA 5GWXA 2PIDA 3NTVA 5AKKA 5EEHA 5J43A 1YQDA 4HEJA 4CODB 5C5CA 1G0OA 4IIYA 5JAMA 2WNIA 2I6UA 4KPGA 4KNYA 2WOJA 1X7XA 1GFZA 2A1TR 3B53X 4KSBA 5AKXA 3ECSA 2C4KA 5J23A 4REMA 4JI5B 3VO8A 1RRKA 2IF2A 3FNBA 3LDAA 2FETA 2VHZA 2QN9A 2WSIA 3F7NA 3FRIA 3ZVMA 1GR0A 1SHJA 4K6OA 2CFCA 3KD3A 4REOA 3RF6A 4FYYA 2E82A 2W6PA 4JNKA 2EP5A 4UU0A 5C31A 3JPYA 1VRVA 3OSUA 1UFQA 1P7YA 1Y6JA 3JQGB 4EA7A 4EF6A 4J3JA 4EI2A 3NU1A 3PTZA 2KW5A 4ACBA 2CUTA 2YFKA 4PZAA 5KUTA 2JH8A 2PXXA 5EHGA 4DNRB 1TW2A 2I65A 2GEFA 1JAXA 4FFOA 3KPYA 3SZOA 2P67A 3WNZA 4B35A 2JLYA 3PFWO 1DARA 3NV7A 4NOKA 3H8SA 2YV2A 1TFRA 4RTRA 3K0SA 3MK31 5K51A 1J4AA 2RGWA 5C2JB 1H4VB 5JCJD 4H3HB 2GXUA 1FTQA 3VOTA 2J09A 5AICA 1X7YB 3AG6A 4LG1A 1ULAA 2GCNA 1VXOA 2PH1A 4GRAA 4KV9A 5D1NA 4C0JA 1R5BA 1B6SA 1ULUA 3A2MA 1AUXA 3EHEA 5F12A 1PL7A 3U7RA 4E88A 2EU8A 4U9IS 3ROFA 1PZHA 1NDQA 1CE8A 1X94A 4XEUA 2B8NA 4XM3A 1M1ZA 4TWAA 1YB6A 4E21A 4MEAA 4L4UA 4NFSA 2Z04A 3RASA 2XUJA 5AWFC 3NXKA 2J0SA 1UMBA 5J3OA 2DPYA 3R20A 2BKVA 4YEJA 1O6BA 5WRFA 3TVYA 3SLRA 2ORWA 1CR4A 5ERGB 1HE8B 5ALXA 3FTCA 3VYSB 1E1CB 1RWWA 2AZDA 3DV0A 1EGMB 1L0BA 1DFGA 1ZNXA 2ABWA 4JX9A 3TUIC 3HYTA 2VJMB 4P3OA 1H3FA 3M34A 1M72A 2QD5A 4WKPA 4YJHB 5FTJA 4X84A 4BE7B 5BWLA 2VP5A 3U9LA 2WINI 3BIWA 2C99A 5DP2A 1KAMA 3JQFA 4I1UA 4JT2A 3IQZA 3ESZA 2ZBPA 3K70B 5KU7A 2C07A 2EKBA 4NEHB 4HFNA 5LNK6 1WCIA 1A98A 1MN6A 4B5KA 4PLCA 3HBLA 4NENA 1Y37A 5I4IA 3KSBC 1WKVA 3IE1A 1NBMD 1P1KA 2B3TA 1I2AA 4G4IA 3HYNA 2M6LA 3B78A 4EYGA 1YS4A 1UOOA 4GP9A 2HF7A 2BC9A 2NG1A 4R6WA 4TMKA 3SHFA 4YRIA 1XEXB 3RC9A 1VCNA 3EFOA 2F3PA 3FGPA 3IAS1 2NZUG 5LBTA 4ADSG 3WAJA 4NMXB 1M2VA 4FT2A 1Q9SA 1P0FA 2AFIA 2E6UX 4ND3A 2FF5A 1NJ6A 1J97A 1PR0A 4AVZA 3QVGB 1U94A 3QSYA 4DJAA 2FZEA 4Q9LA 2AFIB 1DAEA 3HN6A 3NYQA 4E13A 4OYRA 2VKQA 2WYVA 2VRCA 3AVOA 1Y9EA 2BGMA 1R74A 3MLAA 4PG5A 3UT5B 2BBSA 4AKSA 4EOGA 3V46A 1PEAA 2P9HA 5EP2A 1T4CA 1GSOA 5IM4A 1E3EA 1XAIA 3OQMA 2P0EA 3KT3A 1KDVA 1NI5A 1XA3A 4BQSA 2DFKB 1UZLA 3HO6A 4I2VA 4NABA 2DLCX 4TZKA 3KHUA 3I76A 1RRVA 5EP3A 1QHNA 4BLTA 4P2GA 3ZGVA 3OQ1A 3AR9A 1F14A 1Z74A 2C42A 1N05A 3FKQA 1Z28A 3LP6A 4YJ2B 4BMCA 2ZVQX 4G5YA 1HNNA 3FMFA 2IGTA 2ZRIA 3EEQA 2JCSA 4BZXA 4KIUA 4WUVA 9ABPA 2R7AA 3ME5A 2QY9A 4FQ8A 1YJWB 3H4TA 4C88A 1YZQA 3AY3A 2OV3A 3GMIA 1VQPB 4QQNA 2XUKA 3TCKA 3F8WA 3GCZA 3LWDA 2NVBA 1XDZA 3GFOA 3VZBA 1YIAA 4L6AA 3CP8A 3E81A 3HCFA 4HWGA 5CB0A 3B1ZA 2ZETA 2YCLA 4A6XA 3BERA 4N5DA 3X1JA 5KYXA 1HL3A 4XGNA 3GD7A 3GWGA 3TQQA 4J7AA 1Z6ZA 1PUIA 4HGRA 3CIOA 4YT2A 4RL4A 3BGVA 1NN0A 1RABA 1Z4NA 1DT5A 3OIYA 1YQWA 1VQOB 4G5FA 4JA2A 4US1R 4IV5A 5FUXA 1Z38A 4CKWB 2WAAA 4HFRA 1CQZA 4BGDA 1MC8A 3MT0A 2BISA 1XE3A 3T8YA 5T4EA 2OB2A 4YMGA 3EE6A 4QU0A 3N8NA 2HCRA 4MMZB 3T7TA 3CCQB 2RAFA 2MMCA 4HWSA 1KDPA 1QGDA 1L4KA 1SHKA 2KVOA 3NCTA 4CM7A 1GL7A 3GUCA 4DDWA 1CJVC 3EOAI 1LJ8A 4LHSA 1YB4A 2FQQA 1GGEA 2PBFA 2VL7A 3IE0A 2C95A 1V1RA 5JSHA 5D01A 1Z06A 2ESRA 2H1RA 4OXIA 3G2OA 1YB5A 5DRYA 3ICQB 4FEGA 1LPSA 3HZHA 1JQBA 1KO8A 2F64A 5C32A 4ZXFA 2O8CA 4XQ0A 4CWAA 4UEWA 3L46A 3EGDB 4JI4B 2FZVA 4EAAA 3NT4A 3WGZA 4OAPA 4LZJA 2C31A 2XMGA 3MFYA 4D79A 3FCOA 3P2MA 2GQ0A 2HKIA 3H0EA 4ND2A 4XFJA 1J0XO 1SVUA 3D6HA 3RRBA 1D0SA 3F98A 1SVKA 4QDXA 1R0LA 1V5WA 4HAOA 3FAZA 2QNIA 4OL9A 4YWJA 2ZEJA 1LF0A 2JA1A 2AQKA 3B51X 2QDXA 3ZE9A 2AXPA 1Z2AA 2PX4A 4LMPA 5B3KA 5AW1A 3I9OA 2XWSA 1FDWA 4ZVKA 4QTXA 1ODJA 2GEUA 4I5FA 3BC9A 3IQIX 5CA0B 3T7JA 4JI8B 3MSCA 1XNQB 4MWZA 1U1EA 1NA5A 1B23P 4DR7B 1N6KA 3NTLA 2PWYA 2H51A 4S1TA 4KQ2A 2Q4RA 4LGVA 3D6MA 4O59O 3FTNA 3FMIA 2RH8A 4PYMA 5C8VA 3A6HA 1P4HA 2IT1A 1MOQA 1M1UA 1RXVA 2IU0A 2CBZA 3C39A 3SWWA 3NHMA 1XLUA 4W9NA 4UAGA 4C08A 1SUWA 4DY6A 2YHUA 3FHOA 2I76A 3UPTA 1R4NB 3DYBA 5ALMA 1BCRA 1I14A 1EFTA 4NEGA 5IH7A 1J23A 2IZ0A 1V8OA 2E5FA 1E5VA 4JLUA 5FWXA 4H17A 3DFUA 1POWA 4TZ0A 2JGRA 1JQLB 1Z5ZA 2ZTLA 3UBMA 3FMGA 4PBRA 1GPBA 2YXEA 1R4AA 4J16A 4MYRA 1I32A 1Y3AA 1Y33E 3EDRA 5AKZA 3CJRA 5AKEA 3K15A 4HSEA 1RBMA 2SKCA 5UKDA 3OUZA 1KZHA 5FWYA 1USUA 3R8CA 3ANNA 4BUJA 1JFLA 3UGTA 3ELUA 1CJTC 4JCCA 1NRXA 3N2GB 4O4IF 3W2EA 2HWUA 1QBGA 2Z83A 4DLPA 2IYWA 4FI3C 4QYWA 4TLMB 4XVUA 3DWEX 4PO1A 2WNSA 3V7WA 2OCXA 3BVPA 2C61A 4P58A 3ICOA 2AOXA 3PA1A 3C3EA 4KE6A 4LE1A 4DCVA 2DB3A 2G0NA 3IJEB 4HWPA 1PJBA 1OAAA 1UBJS 5T3UA 4YUYA 4NICA 3QBTA 4Y9DA 1IAQA 2HREA 2P9BA 3GAAA 2QTZA 1WMDA 2QJOA 3NBFA 1L7XA 1B26A 3NEJA 2A0YA 1D2AA 4RV5A 2YRFA 1QNFA 4QU5A 4NQRA 3SXPA 1ABFA 1OR8A 4ITUA 1N2BA 5A4MS 2I6TA 2POCA 3NHFA 1LTQA 2Q9CA 4DGQA 1THMA 2NTNA 3V3TA 1L8QA 2PWBA 4WJLA 4EI9A 5A2QA 1QO7A 1T3ZA 4N41A 2LKCA 1R6DA 3PR3A 3QX7A 1R5NA 1X8XA 1RHRA 2HIHA 1EB9A 2Z5LA 5LP6F 6LDHA 2Q7DA 4XONA 1X7ZA 4WY2A 3B6ZA 1A82A 4MWBA 1TAUA 2YASA 3SF0A 4Q9DA 2IC5A 3V1KA 2ZJBA 4BVEA 5FFFA 2APJA 1B6TA 4L0CA 2JJMA 5EEGA 3BXFA 3K31A 5FB3A 1A69A 1K8ZB 2A9PA 4V39A 4BV9A 4KPYA 3CCFA 4ZYTA 5D87A 3SZUA 1TQ4A 1A2BA 1MLDA 1G7RA 1HRKA 3EPPA 3FSJX 3RU9A 1QGYA 3FSGD 1CG6A 3FWNA 4OSOA 3N2IA 4NXNB 4YY3B 3F8SA 1E1DA 2FHPA 3I92A 1E2KA 4NENB 2GJ9A 2WJHA 3D0OA 2BCEA 3MT9A 3THSA 5KTNA 3ZOKA 1P7PA 3DR5A 3EC2A 2P9ZA 1KVQA 2FI1A 3PC6A 5K3EA 2WJVA 1SBTA 3BGDA 2GJKA 1XTJA 4ZHQB 4N6OA 2GERA 4W1PA 1LI4A 2H63A 2WABA 1P39A 5IS2A 3GLGA 4JU8A 4ZCRA 1MAVA 3BB4A 2ZT6A 5KPJA 1N6PA 5CB4F 2AKEA 3P96A 2N46A 2W90A 2YFYA 3GMDA 4HJXA 1JHAA 2NUTB 5G0SA 3VR3A 2O8BB 3V48A 2CUKA 2FZ5A 2QMOA 3ANXA 3H4VA 1UD8A 3K20A 3LZCA 3GGCA 3GT3A 4ROSA 4I55A 3CBGA 1XJCA 4JUCA 2OZVA 1IG0A 2CXNA 1IXZA 1E1YA 1MIOA 2V5AA 2X77A 3VMMA 3U16A 3S2SA 5IVHA 4DZTA 4B3RB 1NWHA 4EFKA 3HYLA 2PGAA 3JYNA 4N0DA 4M0UA 4ZZ2A 3U49A 1KI7A 1RM0A 3K5HA 3ZH9B 5BSKA 1QPGA 2W6CX 2EG5A 1KI4A 1A9YA 1LBIA 4OXRA 3FNIA 5TC4A 2ASVA 4PCAA 1FK8A 2YIDA 3NHSA 3PL1A 1OLSB 4GOMD 1JH8A 4K7JA 5HTKA 3ZHOA 1UFKA 1TMYA 2O7NA 4RZ2A 4YROA 3HVRA 1VC2A 3IBCA 3D5TA 5I5GA 5LUBA 2Q3CA 1WORA 1NUHA 3WMXA 3CWZA 4YA6A 3GOQA 2VWQA 2QLBA 5D3MB 5I4BA 3PEUA 4LEIA 4G41A 3Q85A 4UE3S 5IP5A 3UJ6A 4BJ1A 3GHHA 3AO0B 4JI0B 4NNJA 1RXUA 3FWPA 3QKSB 1GVNB 1E5QA 1M34A 2W2KA 4PQGA 5TRTA 3H11B 1E89A 1AZWA 3A8IA 1WPQA 3QA3E 1S6YA 2HLPA 2XAAA 5LBIA 3ZS8A 3QLVA 4OMFG 4O4HB 2BFPA 1UFOA 4DUGD 4E0BA 4QLAA 1QO9A 5CBPA 2VQSA 5T67A 1QPBA 2E4VA 4FFWA 2H0QA 2J5QA 4LI3X 4N49A 3UFBA 3BY1A 2DH5A 5KNCA 1ZH6A 4KB5A 3VZQA 3CEPB 1QF6A 2W98A 3HJAA 4EPTA 1PK8A 4R41A 2LKDA 3CSUA 3WSVA 1C1XA 1PNOA 5K8LA 4V0MA 1HDOA 5EHXA 3M1YA 3MQ4A 2QENA 5L45A 1MX5A 1R0CA 3ZGLA 1K7XB 2GNAA 4QGGA 2P3QA 4H31A 1YXMA 4MYCA 4KHPB 1MB0A 3FE2A 5DLYA 4GMGA 3R8XA 1DKRA 4E1BA 3QMMA 4M1TA 4BKQA 3AP3A 3S5UA 1ABEA 3D8RA 2GH1A 4C06A 3MMSA 4Q7LA 2R3SA 1J90A 5ALUA 5IC6A 3ZD9A 1RWXA 3STVA 4DLNA 4YT8A 5AVXA 4B32A 2O2XA 1T5OA 1DOZA 2BVNA 1KJNA 3P52A 2XMCA 4G5QA 2P9QA 1HRDA 4L4XA 5DNUA 3FI0A 2QVLA 4YALA 16PKA 2R8XA 3FJYA 1ECCA 4NSNA 1YRWA 5ER9A 1R0ZA 2ZSDA 3ITEA 4FDMA 1U0FA 1YFZA 4BJ3A 4N8EA 1QORA 2X15A 1P1FA 2C88A 4FHDA 1WZ2A 1AO0A 1CDDA 3GJ3A 2VAXA 1DUVG 4CQMB 1XLTC 4X3OA 3DDWA 4XN3A 4ZC1A 3EEYA 1VG9B 3CUYA 3K6RA 2JLQA 2HHHB 2ZZKA 4NDAA 2HPVA 4FBMA 3ZDFA 4HWKA 4G0UA 1JG1A 1PL6A 4W1QA 5KVQA 3LLUA 5DCLA 3SDBA 4EW1A 4IXTA 2W71A 4WIAA 3RS7A 1FC0A 2GNOA 1S2OA 2G36A 3OHSX 4HGOA 4IO0A 4X7BA 4ZU1X 5LLDA 1MVNA 5D86A 5EWMB 1G21E 1K2WA 2LRHA 3JAWB 2ILVA 4HDQB 3ZUPA 5CD9A 3KQKA 2O07A 3ETEA 1JEDA 2WD8A 2XNCA 2OESA 4F3CA 2NUAA 4KVZA 4BFSA 5KWEA 4NF2A 5CEJA 1V7PC 2K6GA 3D3WA 2IQIA 1L4HA 3PNPA 2FRDA 5ADWA 1AZTA 4AS1A 1LC0A 1Z6XA 4H7FA 1T5BA 3ROKA 1XBTA 2ZZFA 3GARA 2FMTA 4YRBA 4MR9A 1E79D 1XALA 2XVYA 3AIIA 5JPDA 3ISXA 2FPMA 3LQKA 3WL7A 4ARUA 2GA8A 1ZR2A 1W25A 4LYHA 2VJKA 3JU3A 3ADPA 3JVVA 4HSGA 1JEQB 1QONA 1M1YA 1TD1A 2PD4A 3A1UA 3G02A 3ZWYA 4FM9A 1JZSA 2NN3C 1HDRA 1MBZA 3P9ZA 3PPXA 5ALHA 4BO7A 1OASA 1EYZA 3IIMA 4CGYA 1DX9A 4LOLA 2BCJQ 1YFJA 1QFXA 1TQ2A 4ISCA 1B0AA 5EE9A 3NDBB 4CLEA 3LU1A 4FC7A 4MTLA 5EHIA 3RTAA 4LJ4A 5L4NA 5HUJA 1VB5A 1JR4A 1KSGA 4MI9A 3QV2A 1J8YF 4CMIB 3KPJA 3DD1A 2BOVA 4O3MA 3LH5A 5D1HA 4XIFA 4HB4A 3A9TA 1JXMA 4JQCA 3KKOA 4B3TB 3ASTA 3JQPA 1ZVKA 1ZD3A 2CHGA 2ETVA 3TW8A 3SF8A 2QA4B 1S3FA 3RRXA 3UJ9A 3PS9A 4JZKA 4XLAA 1HG1A 3NGLA 5DE3A 1YJXA 1JBEA 1MRNA 2V0NA 2KLBA 4C76A 2JZCA 4FGUA 4LYEA 1NN5A 5EMJA 1TJ4A 1U9IC 4A0FA 5A6SA 3LC1O 2WSYB 4CU5A 4DLVA 1H66A 4UE2A 3CR7A 4UCWA 3W2IA 4C2AA 3C24A 1KY4A 2AFIE 1T2VA 3LWNA 3WK8A 2X4DA 2BFFA 1HT3A 1UKBA 1WBJB 2B8JA 3OU6A 2E2WA 4X8MA 4C0AC 3PKJA 3EGVA 1L5NA 3PEVA 4IS3A 1UC4B 5JD6A 2FR8C 4GRIA 1MJHA 2ZZGA 2O0JA 2RK3A 5CJ2A 4H7EA 3CURA 3VYTB 5AUPB 3L92A 3GUHA 3GUZA 4Q48A 3ZU6A 4IUDS 5KHOC 1URPA 1IHMA 3HHEA 4ZZIA 2QN2A 2J5BA 2ZIAA 1ZSYA 3ZKWB 2AJBA 2VDVE 1ESEA 4IH9A 3X3HA 4DCCA 1MJFA 4X3PA 5A3JA 5HFAA 1MG0A 2WYOA 4S35A 3OMLA 1S3SA 4CU2A 4QO7A 2DCMA 1THZA 4K8OA 2QM7A 1LSUA 4MW0A 1D5WA 5IH3A 2DXIA 5G0UA 1GL3A 4K6GA 3BSWA 4I6JA 2QYOA 2VHWA 3IDZA 3K1ZA 2GQFA 2REOA 1E5XA 1U11A 1M8FA 1WMSA 4FGSA 1ZCBA 2C7QA 1Y0BA 3PLRA 1ONBA 3MTGA 3ASPA 3I2KA 3W9YA 5L3VA 4HBZA 3CC4B 2CNKA 4J91A 2V3VA 5DNAA 1NWCA 2DJ5A 5FUBA 5HVNA 3C7DB 4XORA 4O2AF 3OJ0A 2NV4A 1KPGA 3E0QA 2DERA 2VQEB 3OPQA 4KJZA 3CN9A 3O90A 3ZHVA 1NLMA 2X5JO 3IUMA 3DEAA 4J16C 3S1SA 4PYQA 1JSCA 3QLTA 1S3GA 3QF7A 4LDQA 5T5QA 5B1YA 3W0LB 3DOUA 3O4JA 4U6SA 4WD3A 2MSLA 1CY6A 1WMEA 3LQ2A 1QRAA 1TKCA 1T8RA 2RJOA 4M8KA 2FCAA 4X60A 5I3CA 5CIYA 2BTQA 4AXBA 4XVHA 4Q1AA 2CVFA 4M9CA 3RYFA 2ODWA 2AG0A 3DHEA 3JQ9C 3KTAB 3UJ7A 4JBIA 4PU0A 3H18A 5LZ8A 1TUBA 2FSSA 5FBKA 3E9RA 2YHAA 4PGAA 1DVRA 4QQRA 1L5LA 2PRZA 4BVBA 3BTSA 5K0CA 1SCDA 2FMFA 1N3IA 4PNZA 3W2HA 4M76B 5IK2A 5IWAB 1Z08A 1ECLA 1H4SA 4W9RA 2AZMA 2YRXA 1SQ5A 1P0QA 1XMSA 2CZQA 2NWQA 2DUUA 2H1WA 4WGFA 4R4JA 4XOUA 5F21A 1AQYA 3JRXA 1UKEA 4GVXA 4CTJA 3NGXA 1RZVA 2D5IA 4NYIQ 5F98A 1UPTA 4ZGQB 1SM4A 1RQPA 2AC4A 4H7KA 2W2LD 5BWNA 3QMWA 5KVVA 1E7MA 3AR8A 2HMSA 4LNUB 3DAHA 2AZ4A 1JVNA 1WBBA 4OLHA 2YHIB 2PQ2A 1B8VA 4X1KB 3U17A 4QJIA 4WE3A 4KFSA 1QKIA 1W36B 3CJTA 2O19A 1Y8QB 4NG4A 2WJJA 4WOPA 1MIHA 4DQDA 5ESXA 1L7OA 3HLTA 3FBWA 1RJ9A 1GL9B 4H35A 3ZWWA 1NXWA 4UU8A 1KVRA 2CFOA 1L5OA 1T2DA 2XODA 3FNGA 5HZGA 2VJIA 1RC1A 2XUPA 4G07A 1RQ2A 3DO5A 2KM1A 4OQYA 4OYYA 5TQVA 1R6BX 2H6EA 1HT0A 2QT1A 2GYUA 1IHDA 4JI1B 2W6MA 5LZ9A 4OHXA 1WOMA 4ZPJA 4N0QA 1K98A 3WGVA 3MG9A 1XMXA 3RVMA 1R88A 1VE7A 4GM1A 3HRKA 4BLWA 5TARA 4YRAA 5BUQA 3VC2A 1YE5A 1EZ1A 1JHQA 3F6RA 3JALA 5IC5A 1KEPA 1OV4A 2X8LA 3TNJA 1RMTA 2CV1A 1UPBA 1X1CA 4ZOLF 2AHRA 2Q5QA 4RPCA 2O59A 2QD4A 2B2CA 4ER5A 4MWDA 1TJ3A 1T1EA 3DNMA 2PUHA 2VDJA 4O2AB 4X94A 2VHUA 5KDOA 3O2NA 2Y1LA 4Q0MA 1ODFA 1KO7A 3W7VA 1WZIA 2PKWA 3VI4B 3NOQA 3ON5A 4GLLA 1XVIA 5CH3A 2VP0A 4G9BA 1NC1A 1DC8A 3QBVA 1SCIA 2FR0A 2Q21A 4KGXA 1GLVA 1GG2A 1PWHA 2J08A 5LQNA 1LBHA 1K6XA 2H17A 2AT1A 5FL3A 4FGJA 1E4EB 1E6LA 1W73A 4CL0A 4NATA 2IV3A 4UNRA 4WJKB 1E32A 1KWKA 3WHKA 4JKOA 2C7OA 4X7FA 3WYBA 4F72A 1U0HC 4GX1A 4N82A 2C9OA 5IJXA 5J2TF 2JA2A 4YH1A 3C3DA 4CMEC 5KYUB 3IL2A 4D45A 1OFIA 3GZTB 5BT9A 3PJRA 2AIRA 4C2TA 3DMGA 1NXXA 1UM9A 5BN5A 1GUAA 4JSRA 3BDVA 2DR2A 1UBTS 2QJRA 4PG6A 3LMKA 1YD7A 1I51A 2YZNA 3NAZA 1W88B 4OJQA 1ISMA 4KXWA 4TV9A 5HK9A 1SOUA 3RSGA 1VYVA 3KELA 4RTJA 3FCYA 2A94A 1E0SA 5KWJA 5DI3A 4IDFA 3R75A 4CKCA 1F7VA 2YY7A 5JPIA 4BFCA 4HQNA 4NAVA 1KO4A 5THQA 5IXSA 2A59A 4MA5A 4C0QC 2V97A 4KU4A 2FJPA 4B79A 4F3RA 3MELA 4WKBA 4Q3NA 3AR4A 1RKVA 1YDEA 4Q82A 1XCGB 3ASVA 2PBZA 5JADA 1IOWA 2FX3A 4E46A 4NAHA 2Y67A 4I4TA 4RTNA 4GWKA 1BHO1 1AH2A 3UJNA 2NT4A 5EKDA 1ZQ9A 4KQHA 4OQZA 5DM1A 1BXGB 4ZQEA 3S1AB 1EFLA 4A3SA 4NBTA 2XT6A 2P9FA 4MLPA 5JSZA 2YJGA 9LDBA 4O1IA 1RBQA 1QOZA 1BCSB 1Q7EA 1KARA 3UEOA 4NWIA 2NGRA 4QBTA 3WI7A 4PS1A 3PXBA 4XKJA 1NBME 3RG8A 4DUGA 4HQKA 1AMUA 5KKAA 3FCSB 1GLGA 2O1XA 2Z6BD 3UYKA 5JJLA 5I9IA 4FNGA 1BEEA 2IDZA 2N1MA 4WDRA 1VL5A 3HU3A 3I6MA 1F2TB 4U8HA 1DFHA 1CT9A 3T4XA 2WMDA 3P9CA 1IRIA 1POXA 4PPFA 3U3JA 2XE6A 3GVXA 4HDKB 4BX9A 4DN6A 2HZBA 2HDHA 1UBMS 3FUVA 1RM3A 3UHJA 3FSRA 1MC1A 3WFIA 3FNQA 1EUYA 3GVLA 3F73A 2VWPA 1TO6A 1K8XB 1U2PA 1SQ0A 2IPOA 2GI4A 1FFAA 4TMTA 3R09A 2H52A 5E9JA 1U63A 3L3BA 1IHPA 1O3YA 1YFKA 3PEEA 3DGFC 1PEDA 2O4UX 1ZGGA 4G0PA 1I4EB 2H0AA 3N28A 4JBNA 1EHYA 4Y2YA 3I1FA 2AYYA 2IZ7A 3EARA 1P7CA 5KO2A 2WZNA 1XQWA 1NYLA 2QYHA 2BFWA 3PE4A 3N5KA 2PO5A 3RJMA 1UJNA 1VGVA 3AUAA 2H4XA 3ZHRA 2IBMA 5EIBD 5B6IA 2JD2A 1EHIA 5B5SA 2X2FA 4HNVA 5IT9A 5LD2B 1X92A 1XEAA 4OA5A 3WIUA 3V8EA 4IFIA 1GN9A 2WRZA 3GPBA 4W8OA 5IKOA 1D1QA 1WKCA 2W2TA 2EYUA 2YYAA 3DBRB 4JLNA 2WU0A 4KYVA 5ALQA 3RS2A 4LBZA 4MRMB 5H4HA 1DQNA 3KHTA 4XD7A 1CZLA 3D5QA 4QLBA 5BWCA 2IYYA 1ZISA 5FX2A 4FYMA 4CI9A 1QHSA 1HPLA 3FZYA 1OWPA 2UAGA 2YCBA 1RZ3A 4YFYA 1TC2A 2OENG 3PC8C 4EGCB 4FMDB 4L7VA 2EKPA 3NBZC 3PWZA 1B2RA 4UPEA 1WPCA 4HB0A 1HL7A 1QIJA 1MU0A 1Y9JA 1V7ZA 2HSZA 3KR0A 3TMKA 4X24A 3K1AA 3RCBA 2XRMA 4B6OA 4LY3A 1PJ3A 5I7WA 2AWOA 3OT1A 1XIVA 4WCVA 1DRVA 2I2AA 3UMCA 4D02A 2XF2A 5E3IA 3H1PA 4IHAA 3IDAA 2PX0A 3MRVA 5B1EA 1Q77A 1WCYA 3VYRB 4BOYA 1WCWA 1VBKA 5F4OA 5IEBA 4AJKA 2V5UA 3I30X 3A32A 4X7EA 4CMEA 5JECA 3M5DA 3QE9Y 5D3KA 1UBCA 2XTNA 1RT9A 2XJ4A 1D9ZA 2XDAA 1CZNA 1V43A 4O29A 2AS0A 4IDBA 5TVGA 1JJVA 1XXHE 5AR1A 3HO1A 2D7CA 3FZNA 4OHMA 2OA0A 5JJIA 4PQEA 2JEZA 4G86A 4YFVA 4E2YA 4Q18A 1VPEA 2VF8A 1K8QA 1PGOA 3RANA 2B1GA 4ZMSA 3VR6A 1ZJ6A 4A36A 4ZEVA 3V5NA 2LGJA 1PT6A 4JASB 1JKXA 3JTMA 3OY7A 1N33B 4K6HA 1Q92A 4RAQA 4KIWA 2HQOA 3D3NA 2Q1XA 2YXBA 1KYTA 4YQFA 3TUJC 2HADA 5BSEA 1G5QA 2PLAA 2UZ1B 4HY3A 4INJA 4L4YA 1G8YA 1F0KA 3HNOA 4M1SA 3F1LA 4IHKA 1CSEE 2GVZC 4G5RA 4Q4HA 4RDIA 3OE4A 1PV1A 5JAZA 4PVCA 5JHGB 3CLTD 4GOJA 1HK7A 1VLVA 5CPFA 4EMBA 4ZDIA 5H3LA 3M6XA 2PLFA 2BFCB 4M8SA 2ZJZA 1R0RE 2D74A 2BZGA 4PYJA 4INOA 4K8RB 1E63A 1J70A 2BFCA 1NW6A 3O83A 1JNXX 1PNQA 5EIEA 3I45A 3MINA 2Z56A 3H1TA 1J22A 1ORVA 4WOCA 1FRZA 5ECGC 3HXMA 3EY9A 4Y6RA 4HC4A 4CLXA 4EKGA 2CKDA 3KQVA 5A3QA 3GZNA 3BS4A 1GZ5A 2XNDA 4PX9A 3E5HA 1FDVA 4RLZA 1G3IA 1NYTA 2JGLA 1UUFA 3H2SA 3DWFA 4JROA 4U7GA 3R76A 4CKEB 4LFAB 2B9EA 4CF3A 3FLBA 4TRNA 1PEYA 4DSOA 3QMVA 1TYCA 5DWDA 3G8AA 1X9GA 3WLLA 1ZJWA 1P5RA 1OUMA 1RDFA 1C9KA 2IUSA 4ZVSA 4B9AA 1IB0A 2G7MC 1V26A 2ZOSA 5LKRA 2WZDA 5LP6B 1ZI9A 3KQLA 1Z56C 3IV9A 3TLJA 4C6SA 2BEUB 4IIBA 3V1YA 3X44A 4D44A 1VLOA 2A5YB 1Z22A 1OBOA 3DBLB 3IVMA 1H69A 5FO1A 2X14A 1BW9B 1E3XA 1C1DA 4XDYA 3T3EA 4IDQA 3VO9A 4RWEA 5TF4A 3PFCA 5F7XA 1TT5A 3BJRA 3B3JA 3DF7A 4ZT7A 1B41A 1HZZC 3HDVA 4MHOA 3TIGA 1OQAA 4OA8A 4MGKR 4NR0A 4K3VA 1SHUX 3DNPA 2A84A 3F90A 2OY0A 2XECA 2ZBUA 1OCEA 2IPLA 3C1OA 1BVYF 3EWIA 1SVIA 2ET6A 1K5HA 4L4RA 5DLQC 3ELBA 1THTA 1TYBE 3MJCA 3GU3A 4IIEA 4J7CA 2JK1A 4HDRA 3LWZA 3AI2A 4O4IB 4PTYA 1L5WA 5K0EA 1LX7A 5K0FA 3T3MB 1LLFA 3BB1A 4V03A 1BMQA 1QF7A 4DIFA 4W8GA 1AV7A 2OBLA 2X0IA 4EECA 4ZMBA 3BTUA 3RODA 2IYOA 4Q00A 4BP1A 1O0CA 2JI4A 4E08A 1SB9A 1Q81D 3F6EX 1ZN9A 1CFZA 3EXG1 4YREA 2EAUA 3EZ7A 4B46A 1E3MA 3Q8KA 1ORDA 1CETA 4P92A 2R7NA 4JN6B 1RFLA 4B4DA 3M6VA 3JARB 4EHIA 7ABPA 1IBKB 1H4TA 3H05A 1IHYA 4B85A 1V9SA 5MDHA 4JJ7A 3NIDB 5A7GA 4E3ZA 4Z4EA 3LFTA 2PCJA 2QW8A 4JJ6A 3KB1A 1IB6A 1NJFA 4OG2A 5CDFE 4WA7A 4KQ9A 4F71A 4MV6A 4P83A 4J0EA 3OCXA 4WXEA 1U2ZA 2ID8A 1YHNA 4HAIA 4F93B 1TCVA 3BD6A 4MV1A 4WZLA 1G5TA 4J49A 1V37A 2EXXA 3SIWA 2WU3A 3LT1A 2O4CA 4ZOBA 1HORA 2NXJA 3BXEA 1E4VA 4I9GA 1CUVA 1CNFA 4RCYA 1Q1ZA 2PT9A 3IRUA 3VAZA 4P12A 4HQFA 3B60A 3MTDA 2WUVA 5JVDB 5E1DA 2GZAA 3B5IA 3HI4A 2GT1A 2P9TA 3IDSA 3WYEA 1EE1A 4CJXA 1G6OA 3KVYA 3TR6A 3RKSA 3P94A 5D5QA 3CZ4A 2REXB 1HVXA 3MQ2A 3ESBA 1EH5A 2YOGA 4M1MA 2R5NA 4RF4A 2PIAA 5DBGA 3RLIA 1W47A 1FMLA 3CUEF 4K0KB 3EVNA 3LX5A 3QEMA 4XQEA 5T4HA 1C50A 3QFRA 4DK0A 1UDCA 2XITA 3E9EA 2OP0A 3GY0A 5EIBC 3L8YA 5K1ZA 1QHIA 3UHPA 1P4MA 3QJGA 4PANA 4KN9S 4QRIA 4B0PA 1HBJA 1JJAA 1QAMA 1H2WA 3WG9A 4Z1MD 3AHJA 4CI0B 2CN1A 4F60A 4CIAA 4H1UA 1B0UA 3CPSA 1C8VB 3OZRA 4FMDF 3ETNA 4G26A 5DWVA 3SHWA 4QFBA 3SJUA 3ZEAA 4EGQA 1N32B 3OCWA 3U44B 1IK4A 3J81A 3CT6A 3BF7A 5ALZA 4QU8A 4R0MA 4XKWA 2HK9A 2Y1KA 1ONOA 2ZIXA 3UKOA 3ABIA 3B70A 4YMVA 5BT8A 1LSJA 3QFTA 2NZ8A 4FQ5A 4UTPA 3KSRA 4JUAA 2JIMA 4MS3B 5EKSA 1BQEA 1CP2A 3SC3A 1AHPA 1QMGA 1UDWA 1TYAE 4TT3A 3QVLA 3NE5B 2DLDA 4FYXA 3OCYA 1RXYA 2RE8A 1P3Y1 3PGJA 1BEUB 3UWOA 1QVRA 1IIBA 2PZ8A 1XROA 2QV7A 2F3RA 4MRNA 2B1QA 4V0LA 1MB9A 4PCVA 5DYNA 4C14A 5I47A 1VQMB 3U09A 1JKMA 1X2BA 3U5TA 2BLNA 3A0RB 1I4OA 3LY5A 3MA0A 4UVGA 1WWKA 1VLLA 1XC7A 2KS6A 5E1BA 4QULA 2F43A 3W34A 5ADVA 1Z83A 1FLDA 5KAMA 5IT4A 1YL7A 2XNDD 5CYGA 1JG3A 4UTRA 3PWTA 3UAVA 3MS2A 2OBSA 2AK2A 3WDSA 3OP1A 5A62A 1KRHA 4CQJA 3G5UA 1X8KA 4JJAA 4QXAA 4F21A 3LDHA 1G5FA 2OXFA 3MCZA 5HILA 3TVTA 2HF2A 4DPKA 1U8FO 2JAPA 4B7ZA 4JYZA 2EKLA 4DBZA 3MIIA 3HL0A 2W6IA 1YQEA 4XZ3A 4Z99A 2X8JB 4X0CA 3MW8A 3ENZA 5EE0A 2D54A 4OYHA 4Q4JA 3CNLA 4WLEA 3RSFA 3V8VA 4DC0A 5JDCC 3KXDA 4F6CA 5B2ZA 1GA1A 4GFDA 4LOIA 5IXYA 4I4CA 4PR0A 4TGLA 1TAGA 3U4GA 2A78A 3DKRA 1ZJ4A 5DNYB 3G23A 1VFPA 1SIWA 2JIBA 3QX9A 1LJLA 2XEDA 4MV5A 4C4XA 4M2LA 2WC1A 1DPFA 2YRWA 4L78A 2Q9UA 5BOSB 4PLGA 2YHSA 4A2PA 3TTTA 1YBFA 3VU8A 5BWOA 1BMFD 3C4JA 2VJAA 2IP2A 2G28A 2N9UA 4UHFA 3ZV3A 1UBUS 2WU1A 5K3AA 2ZS8A 3G8BA 1IY9A 4EZBA 3FUTA 1XUOA 3L40A 5LZ7A 3GDWA 1JFVA 3VI3B 1RI1A 1AA9A 4UCQA 3PWKA 3G49A 3PRKE 2OT3B 4WZKA 4RABA 2VNIA 3HBAA 1DO0A 5ALWA 1M6YA 4BNNA 4D0LB 1DLIA 1T1JA 5DXAA 1CZKA 4BTEA 2NXCA 2ZRDA 1N6RA 2J3DA 3B12A 4XGIA 1ZDMA 3DZCA 3G2KA 1OFGA 3VH2A 5BNZA 3UJBA 3OCZA 2GJSA 4Q9HA 4UD2A 3SBXA 4H77A 3E82A 4Z3OA 1KU0A 2D13A 1LDNA 2WKPA 4FUTA 4PGHA 5HP4A 4KXMA 4DJ5X 4CQMA 1ID1A 2XMQA 4QXMA 4UMFA 3T9AA 4F3KA 3HJTA 2PJDA 4WESA 4B6FA 2B4AA 5I48A 2DT8A 3WYAA 4H15A 3DL2A 1DAIA 3BREA 4XB2A 1H93A 3MGBA 2O3SA 3GRRA 4DHWA 1JJ2B 5HFNA 1H1DA 1FRFS 4NH0A 1CZUA 2DF8A 2IK8A 1BDJA 3IQFA 4HDRB 4IL5A 4DWJA 2J41A 1RZRD 1D8AA 1A7KA 1JR2A 1W6RA 4Q19A 5DHQA 4YNBA 4H0CA 3HXPA 4AJJA 3FGZA 3QLUA 1TA0A 2ZIWB 3BILA 1REQA 3OIGA 5HKOA 2JJ2A 1EWKA 4PFSA 1RVV1 2ZJFA 4GPAA 1TRKA 4F4FA 3DFZA 4ZI7B 4DYHA 4FGWA 4BN4A 2ZSEA 4OP7A 3DBVO 5K0SA 4P1ZA 2CC2A 3RRYA 3AFNA 1NXTA 4QJ5A 3PNOA 2P1ZA 4LVOA 3AF4A 4IMRA 5GVRA 1AXEA 4AU1A 3UH0A 3A9RA 3QG1A 1GGMA 4BFYA 1ICIA 1NOKA 2M6RA 2LIVA 2A1IA 1PR9A 4IIDA 2YNMD 1RM4A 2FZCA 5M5BA 1OKKA 4I7EA 2P77A 1E5LA 3EBLA 3GEHA 3HE3A 4OIMA 3NBMA 1UM8A 3WLQA 2C7GA 3LDGA 2FPPA 4HDSB 1VSTA 4LXIA 4LHXA 3JASA 3GFRA 4WN9B 1OE0A 5FUYA 3SYTA 1CUDA 1OZ0A 1Q3HA 1ZL0A 1EK5A 3LUGA 3M5CA 3QNUA 5F3DA 2C96A 4MZXA 3NIGB 2D2FA 1G20A 1P80A 2ZL5A 1R10A 3PB3A 4HTFB 4JL5A 4XDGA 5CVCA 2WT8A 4E4RA 2BUBA 3GROA 2BEKA 3RVLA 3O2QB 4LQDA 1L7QA 1OILA 5JNVA 2X9NA 4XJSA 5DX8A 1R0KA 4LF4B 3HPRA 1T9ZA 1V8BA 1SCQA 2EEZA 3EVBA 3E9MA 4L8WB 4LPSA 1F3LA 4LWZA 2MINB 4OQQA 4UTXA 1RPNA 5DYTA 1MF7A 3IB3A 4CM9D 5A04A 5CU7A 2A9KA 1GGKA 4Q7KA 4MUAA 3THYA 3DVSX 4DCSA 2XGSA 1NSFA 2R751 2Q49A 1QVGB 2X3FA 5HYVA 5GV8A 2Q28A 2BHLA 1LI5A 1WP9A 4CMHA 2YX1A 4LECA 2VJQA 3L18A 1FB5A 4MUNA 4OY3A 5FTWA 2ZIZA 1YQTA 2HIGA 3QPCA 3LG2A 1NBAA 5E6RB 3WLKX 3U4QA 3KG2A 4O5OA 3T94A 2C59A 5FCDA 3TDMA 3ZTWA 1DG1G 2XGJA 4E31A 5EGSA 3RK1A 3IXQA 4G24A 1QV7A 4WHMA 1W5EA 1Q44A 1DBVO 2CK3D 3WB1A 1A9XA 2CJFA 1PGNA 3E6AA 2XQVA 1PTKA 3DDUA 5ALGA 4DAOA 4ENTA 2W11A 4XYEA 1Z2PX 4ZAXA 4UFPA 1OIVA 2JFFA 4DG8A 4LSZA 1X13A 5KTPA 1B00A 3U3KA 3CG4A 3HLYA 1L7NA 4DR1B 4DQUA 1QYVA 5FOVA 2DPGA 3ILVA 1M75A 3FF1A 1IBCA 5T6MA 2HQSA 1YDFA 4D26A 1Z3CA 4CT4B 3PFGA 3L8DA 4CUKA 2ZWOA 4HGQA 5AIBA 5JXWA 3S1LA 2BFAA 5AKIA 5LUAA 3GOHA 2VBGA 3TTXA 2JJYA 3F3YA 3KUKA 3LUPA 4JH0A 1BHJA 2Z5GA 1QAOA 2H4JA 4Y2UA 4HTFA 3T3PB 2C2XA 3CCRB 4FOLA 3D6FA 2OR3A 4QVGA 3SN6A 2HJHA 4KR2A 2YQZA 3B2EA 2IX9A 2ZL6A 2V6MA 1MAWA 2ODPA 3OZIA 4KFTA 1T2FA 5F7JA 1EEHA 1NE2A 1YASA 2EF1A 1KEVA 2NQ2C 4OU5A 3NAMA 3K2BA 1M90D 4GXRA 1QGAA 2YY6A 3M6WA 3DZGA 2ZJ0A 2D0PB 3R6LA 2IWHA 4B6RA 1O95C 4CHTA 3WLOA 1DC6A 5SICE 4KAJA 5A5GA 2Q5CA 4ENPA 2UZAA 4MB6A 1HOTA 1PS0A 4YAEA 1D5CA 3I4CA 2SKEA 3GEPA 1H0HA 1XJQA 2V98A 3L6OO 4X66B 3GRPA 1SUFA 2FSPA 1EP3B 1F60A 1MABB 3HCAA 4L4ZA 5BVHA 3CVUA 1P9LA 4G0QA 3PTLA 2WLTA 1WLSA 2WMYA 2HBRA 3VKFA 5A05A 1V8PA 4L6IA 2E9SA 2MSKA 5CB4B 3D8SA 1B8PA 1JMYA 3Q8WA 5JO0A 1CTQA 1D2RA 3KLBA 5E4JA 1OFVA 3PUXA 4GMHA 1L2TA 2JCVA 3OWOA 4R05A 3PHLA 4KG7A 1JI0A 4MIKA 3UCEA 1OWOA 4F46A 3EPKA 1UP4A 1TVEA 4Q9AA 4TXJA 2ZVPX 3U3RA 2GZMA 1T6ZA 2R79A 3KQTA 3X2FA 1PF7E 5JG7A 3KKMA 1A88A 1XV5A 2IYXA 2Q3DA 3P2OA 3IAXA 1PJQA 4GEGA 1FYVA 5DGDA 1PTJC 5AVUA 1JQ5A 4FCWA 4GE0A 5K4AA 1EFCA 4C4OA 1M0TA 1OTHA 3VSBA 4NHOA 2FXIA 1JDZA 2QGZA 3J7TA 1WMAA 3JQCA 4B3CA 2WUDA 3H04A 4ZGWA 1VI5A 2NPIA 3Q9SA 4C4PA 2WTXA 1W8IA 1P1BA 1NU8A 5JNLA 1OU4A 2VCEA 4XVRA 4AF7A 2NP6A 1IOVA 4WESB 1GAJA 1ZRSA 2FSFA 2AFRA 2OAP1 2PVSA 3EDOA 3EQZA 3LYUA 4I4TB 3ANLA 4KDRA 4R2JA 3KJZA 5C8YB 1USIA 4AWBA 1SQFA 3HKDB 1S8OA 1K3TA 4IY1A 3Q10A 2J4FA 1NRIA 2C1XA 3GFSA 1FPQA 1V11B 1CR2A 3HJCA 1J0EA 2PFGA 2PTHA 1TMGE 2XI4A 3D7SA 4G8DA 1Y7PA 4M3NA 3ENNA 3C45A 4TV8A 3HGTA 4K9PA 1A5ZA 3EDQA 3O5AA 1VJRA 5KW9A 3G8YA 4C7BA 4V1CI 3B85A 4IHQA 4QL3A 1C80A 2LCQA 4IG4A 1TYDE 2VOEA 3NGMA 4G9GA 4LZZA 4UMVA 3QYPA 4C6RA 5IULC 1G20E 4U7DA 5F2EA 1AHNA 3RFCA 1XTIA 5B3AA 1KPIA 2Q45A 2PYDA 4ZI5A 4ENQA 4KMOA 2DQZA 1FTGA 2OUKA 3OHPA 4JJ8A 4XGRA 2IY8A 5G1NA 2CNWA 1CJSA 2RH9B 4UAJA 1L5ZA 3W79A 5ALIA 1K4MA 2Q6OA 2QRGA 3BCUA 4HYTA 3ZK9A 3GIWA 4WLNA 2V1UA 4LX0A 4CKEA 1I9GA 2CNBA 3ZTTA 5DVZA 1OB0A 2QZZA 3ZGXA 1FW6A 1PZNA 5GMOA 3TTSA 5BN4A 1KI6B 2HK7A 4IJ6A 3H83A 4JAVC 3INTA 4O2BA 3IAM6 3SX0A 1OAKA 3DOEA 1XZDA 5KHAA 1ZCAA 4M0MA 4H9GA 4MDEA 1C7RA 1RXEA 1VFNA 1W52X 1GADO 1ODIA 3WWYA 4CF6A 1DSSG 2IYFA 3FPAA 5FBZA 3B5EA 2C2MA 1HDEA 3EUWA 2EL7A 3RHTA 1MAUA 3S99A 1EUDA 2H18A 1DKNA 3UY4A 1FMCA 1TOAA 1VB3A 1GYRA 1LWNA 2ZRMA 1AHHA 1A9QA 2VA8A 1ZK2A 3MF4A 2X7HA 2IYRA 1ANKA 4MJ7A 2KBEA 4CT0A 3CINA 3ZZTA 1JKIA 3PHBE 5T8KA 5C1OA 3L43A 4AP9A 1SG0A 5BYKA 4U5QA 4AQYB 3OOSA 1PJLA 3ECAA 3ZDQA 4KKUA 4LRTB 1MAHA 2GCIA 2R4TA 3CH7A 2BGTA 4DCJA 4A2QA 2XV1A 4YP0A 1I3LA 1VKHA 2AMFA 4GI2A 1QDEA 2ZK7A 3HBFA 3IPCA 4JYBA 4KQMA 2LUOA 4OB7A 5EWMA 3S6JA 1A7UA 2OILA 3IQGX 5HMLA 5FA8A 3HJUA 1K7YA 3RGWS 1JL3A 4F2DA 4I1SA 3KQYA 2C7VA 4C4ZA 4YYZA 2I78A 3BDAA 521PA 2WF7A 2XIJA 1KVUA 2BGLA 1WNTA 2ZPAA 1JYFA 2IS1A 3T7KA 3IHKA 2PWAA 2GHIA 3O8LA 5LR6A 1R64A 1TI7A 3T1HB 1ODKA 4XIYA 1Q91A 2ZYTX 1N8TA 1YU6A 1XTTA 3O95A 4G84A 2CNDA 3H94A 2QN8A 2XUHA 3HVUA 4MVJG 2YBEA 3DWGA 1BTOA 3VR2A 2JCGA 1OVMA 1GT91 1ADBA 1R5OA 1IZ8A 2ERXA 5TRDA 4D98A 1AQNA 2OO5A 4MIYA 4CEHA 1V5GA 1T6NA 2JAXA 4GKKB 2FV8A 3DLBA 1LS6A 4D92A 1M2WA 2ZQ5A 1U5AA 4IYRA 1E64A 2FGJA 4KXUA 2ZUUA 3OTHA 3UGQA 3REQA 4F85A 1QR2A 1JDTA 3QXXA 2H1OA 2ZJ6A 4OJMX 4RGVA 3GCGA 4D6YA 1VLHA 3PC8A 1G8MA 3BMOA 1QIKA 5HQ3B 1T9AA 1OVGA 4TV9F 3TE6A 3CONA 1RC0A 3EZYA 3AYXB 1XZIA 5D51S 4PG7A 3MCWA 2BE7A 2JKYA 3QWBA 3W6PA 3TCXB 4DYDA 4BNHA 3HU2A 1I94B 3QLUC 1WY5A 1U3UA 2ZBEA 1BHQ1 1ZICA 4X44A 4BNDA 2YVQA 1H3EA 2V4DA 2BTQB 3R0JA 1E2QA 4AFNA 3GJ4A 2WM8A 3L41A 2ZFUA 4OOSA 1G21A 1NVDA 2X7JA 1Z16A 1ATZA 1G16A 2HD4A 2FWBA 1TM1E 1MRSA 1QB8A 2G76A 4KXLA 3EIFA 4JJZA 3HVJA 4N7RA 2VYCA 3HB4X 5K3CA 4BHTA 2NUPB 1DS6A 4TLBA 4QEKA 4LTMA 3DL0A 3K5IA 4ZN6A 3KKPA 1UBFA 1TF5A 2DFPA 2QR3A 1KO1A 5GADl 2FEPA 4EF4A 4Y6GB 1DBPA 4TQGA 4X1IA 2F00A 2OD9A 4XWYA 3M82A 5DF1A 1CS4C 2PKQO 2WWIA 1KYVA 3VVLA 4YR9A 3HNPA 2GPBA 1NU6A 2JGFA 5AUOB 1J9GA 3ZW9A 1GAEO 2ADFA 3I1YA 5EJFA 4BQEA 2ZTHA 4DXDA 1QFJA 2F9LA 2GKOA 4XTCS 5LJIA 5BSXA 1KP3A 2FWJA 3ORYA 4KUHA 4E1AA 4P3YA 3RS4A 4PRLA 4BNZA 1S96A 2NYRA 3F6BX 3AGQA 5GOTA 5EUQB 3FWYA 3BRCA 2XUAA 1AQIA 2PD6A 3PG5A 5J1TB 3RS3A 4LXXA 3RIHA 4CKBB 4PHGA 3C6QA 2QSUA 3Q88A 4BNFA 3NBYC 4YAFA 1E61A 3FCUB 5DJ5A 4EJ0A 2IU3A 2X5NA 2IS6A 4DXHA 2WDPA 2JFXA 2PU7A 4E51A 1F5NA 3U9SA 5F4BA 5JBQA 5G53C 1Q6YA 5FNVB 1UDBA 2PUGA 4BMYA 5F23A 1B6GA 2XADA 4JEHA 4RVGA 2X8AA 2XCUA 5G1PA 3S2YA 1N2OA 3OJCA 4L08A 1R0SA 1AMNA 2OUIA 1L8LA 1YI0A 3IC5A 4RORA 1U0JA 4WEQA 1Q50A 2OKGA 3CX6A 3OOHA 4TRJA 4BJ6A 2H06A 3L07A 3IQHX 3QV1A 3I9MA 4RX1A 3ZI0A 1IQPA 2VZ9A 5BN5B 5TXGA 2XVXA 3GRUA 3SR3A 4H4DA 3OJFA 4LKOA 3FJOA 5CLIA 3MAGA 3CVWA 4LDZA 5K09A 2FVGA 1AG9A 3SKXA 1DPGA 1P2TA 3N59A 1FXUA 4FNAA 4EFDA 1EDDA 4LOKA 4CM4A 3DZ8A 1B93A 1YKFA 1KI2A 3EWSA 3CUTA 2CZGA 3OLQA 3QKSA 4NFLA 4OKIA 1XZQA 3JCZA 1OZFA 3FMOB 4TKVA 2PE3A 3MINB 5F1PA 1YUMA 1VL1A 3T35A 4XIJA 3GCXA 5G40A 1Y7IA 1F8GA 1X7ZB 3LVQE 4ZEXA 2JBWA 5B7NA 2QZ4A 1NI3A 2PUDA 2EX1A 2HRBA 3FUWA 5H0IA 2IYSA 1FUIA 1IATA 4AL4A 3MJDA 3H9NA 1EVLA 1YIDA 4FYVA 1OPRA 2CRVA 5J2UA 2ONYA 4MIEA 4LBWA 4F6RA 3C5HA 1XU4A 3GA5A 3AEKA 4ZOLB 4RTQA 1I6LA 2ZITA 3LNTA 2XKJE 4QC2A 4HATA 2QSZA 3F7OA 2Y1GA 4P35A 3D7RA 4QHYA 3OUTA 1WJGA 4UHBA 3SQMA 1G4UR 2ECKA 4G25A 1J0BA 1U3TA 3FM9A 3HY6A 4XOTA 3I6IA 4BPBA 4GPTA 4FLMA 4BNTA 4PC7A 3V4OA 3ORQA 4M1EA 3LGAA 2B99A 2QD2A 2W8BB 5AVYA 1XTBA 2FSIA 4E7OA 1SOVA 1JWAB 1X15A 3PUNA 3AHEA 3T3IA 4CMBA 3PLNA 3J7AC 2RGXA 1YS7A 1EWQA 1OGYA 4S24A 1YDHA 2MIIA 2WAMA 3K96A 1J49A 4K87A 2PKYX 4MUMA 5D7NA 3THXA 1J24A 1I2ZA 1JWLA 4FBLA 3PZBA 5HQTA 4O63O 4QUJA 3ADDA 1GJRA 1C41A 2VYNA 3ZE8A 1NBOA 4Y7CA 1X1BA 3MJHA 5DIZA 1OJ7A 3IUSA 4QDKA 1F1JA 3TRIA 5L53A 1G98A 1J42A 4WA8A 3UC5A 3UWKA 1U0GA 2GBPA 1E0JA 1PW7A 5FO0A 3PT5A 4MINA 1ATIA 5HX7A 3AVYA 1DEKA 4EUNA 4I8DA 5ALLA 1DKLA 1D07A 3DXYA 3VSAA 2YVAA 5EWLA 2AMVA 5CVEA 1SOAA 1TXGA 2J9ZB 4NEQA 3UW1A 4CUZA 3GRKA 5BXQC 4F1WA 3RSHA 2NZXA 3OBIA 4D4GA 2YN0A 5GIOE 1PFQA 3MJRA 3K05A 4C5BA 3L1UA 3W5IA 3ZWOA 1CUZA 1V47A 1I5OA 4JB0A 4M9SA 1B8UA 1RBYA 3N8HA 4CTNA 2V65A 5K0ZA 3HACA 2ZXHA 4LYDA 4MI3A 4RM3A 4MCJA 1M6VA 1HDZA 4TLEA 2RHOA 2QQ0A 3VSEA 4WI1A 2W4MA 1MZPA 2DYKA 4JJKA 1ZESA 4NBVA 2N3ZA 3IDQA 5JCJA 1JZQA 2IZ5A 3L6BA 4BO6A 3R7SA 3RFVA 3QK7A 4FQ7A 3DMFA 1NURA 3EGCA 3TB6A 3HVIA 4QZVA 2WWYA 5KYGA 2HHLA 1GYPA 2C5LA 4D42A 3CCVB 2NO7A 1JDSA 4G1CA 3SC6A 1SUIA 4B4KA 1SEVA 4DSAA 3X0DA 4YN3A 4UHHA 4JXXA 1H1LB 1Z4OA 2R4UA 5CXQA 4J2OA 4DUYB 3UMFA 1DIBA 4AJHA 4HAXA 1M1YE 1CQJA 1CUSA 3AUTA 4ED9A 3FNHA 4GKVA 3IAHA 3DCJA 4HYYA 4E11A 2W2PA 1F6DA 3M5PA 3OCCA 4D3DA 1RCTE 4E5SA 3O9MA 3OTOB 2Q4TA 4MS4B 3LHDA 4F92B 1ZCFA 4Q21A 3V7AA 4DPLA 5EWJA 1Q21A 2RHTA 2IXDA 1JXQA 2H00A 1TTQB 5BOVA 2DUNA 4CBVA 1NVTA 4O6VA 2XRYA 5SZIA 4CKXA 3GH3A 2XT0A 3C6BA 5H9WA 4TVKA 3VKWA 1Z75A 1XVVA 3S7ZA 1Y5RA 1BXGA 4YCDA 1QQ5A 3KT8A 4ZANA 3HCRA 4S1NA 2C4MA 1XP5A 1UQTA 2V3WA 2CXTA 4PYRA 4RBNA 4ZC8A 5B3JA 3HYRA 2P9YA 5CVDA 2F8TA 1OXUA 1N8KA 2Q9BA 2H7VA 2IEYA 1JE1A 2I3AA 3GK3A 5DGIA 2P7IA 1BWPA 3GYBA 3TBFA 3TTYA 1M2NA 5A5EA 1E1NA 4PFQA 4OBXA 2JLVA 1L7AA 2RGEA 3L77A 1WQ4A 2JLRA 3IPRA 1I0LA 1KZ4A 2Z08A 1KJWA 5FR1A 4EHKA 1ULSA 2IP4A 4A1OA 1JILA 1MXHA 4URXR 4WWHA 2AEEA 3JY6A 3NOVA 2TS1A 7GPBA 3MOGA 2PKEA 2ZUSA 3JVDA 4PAOA 1KMNA 1BS2A 3B52X 4TKLA 5EXXA 1Z15A 5K8CA 4MUFA 4DNFA 2QTGA 5CDTA 4IFEA 3IUPA 2PXAA 2RI1A 4K3UA 4EI7A 4GQAA 4OHKA 3VR5H 1T5EA 5JO9A 1NVAA 2C3UA 1PJ5A 5JXGA 3VO2A 2Z3WA 2NVOA 4P32A 2WKRA 1KVSA 1O87A 4N6GA 4NHEA 2EFJA 3INYA 2ISQA 5INTA 4S12A 5LQDA 2VCYA 4GDFA 3ONYA 2ZRJA 3PQ3A 2X0DA 4AO8A 2BHSA 1AIPA 2CDNA 3R1IA 1FVFA 4FWIB 3CCSB 4G0MA 1BS9A 4X97A 1QQAA 3R0IA 2ZYWX 4Z3DA 1OH6A 2UVPB 4Y6PA 2QRNA 4MW2A 3RS5A 5KYTA 4Y2TA 1ZFNA 1CR1A 2R6ZA 1K6JA 2OVBA 4M8LA 4RHTA 4LDNA 3T12A 2AHOA 5IW8A 3RBVA 4PN3A 1C9JA 4NU6A 5JXIA 1Q15A 2J87A 5IVDA 3GXBA 1F9EA 3QM1A 5AK3A 4BGUA 4CPDA 1H65A 1WLYA 3TSYA 5TR9A 5F5NA 1JT2A 4R16A 1P3DA 2BMWA 1RC8A 3PDCA 1NQUA 1J2YA 3C1UA 3T0GA 3KL9A 4CKWA 4DM4A 3QELB 1BDBA 3F4LA 4EJ2A 4FNOA 1N9GB 4E94A 4YRTA 2BM1A 3L6RA 1YOBA 1QHYA 2WIJA 3HA5A 2VNKA 5I9LA 2W6QA 1EM8A 4PV7A 4Y0VA 4LKRA 1RYFA 3I6ZA 5AOVA 3AVQA 4OPSA 1V1JA 1NF2A 1VIVA 5JARA 5THXA 3I5MA 1Z6TA 4RQUA 1W29A 1GZUA 4DREA 3IKTA 4J1QA 5EXPA 5LZ5A 4CDMA 4KX3A 3VV2A 3BT7A 5DTMA 1G55A 2OKCA 4V3BA 1IEVA 4Q9IA 4BO9A 1D6NA 1DQYA 1XJ0A 2NADA 1U8TA 3N2GA 3O2JA 3DE3X 2HHAA 4PPYA 5CNKA 3ZWAA 2HGZA 2W6OA 5LVAA 4F2PA 4C78A 1WU8A 1MX3A 1ZRNA 2FWAA 2H1VA 2OD2A 5BQPA 2F8LA 1YBMA 3WL8A 1J25A 2FGKA 3FOCA 3FR8A 1V0EA 3GNSA 5FRDA 4BNXA 1I4WA 2Z8ZA 4QGFA 4P84A 1Y8QA 3UH1A 1UXHA 1MV8A 1X1TA 2IHNA 3X2SA 3GRCA 1D4OA 3D1JA 2AB0A 2R7KA 2ZIEA 4DNXA 1PDVA 3DEYX 2HCJB 2CNWD 1UJ4A 5DNVA 3MMNA 2IUEA 4D9KA 2PUEA 3G9ZA 1IM8A 1NZJA 5DI9A 3RHZA 3OZGA 4H1WA 4BRWA 2B34A 3R7BA 2XA1A 4Q3EA 2ZB7A 2G4VA 2OG1A 4Q7MB 1A3CA 3CLTC 3SJPA 1D4ZA 2VN8A 2PUWA 1RKQA 3EAGA 1U7WA 1E7WA 2PQ6A 5KYNA 5LDDC 1E94E 3OSZA 4RMNA 5TJ9A 3V2UA 1R27A 4TT3D 1DL5A 3L01A 2VTEA 3D6UA 1ISSA 3DZJA 4WK2B 3UMMA 2OB1A 2AN4A 4HVTA 4P4SB 5CA0A 1H05A 4PHFA 2GESA 2C5AA 3TFOA 2OCLA 4PZLA 3WLPA 2PXHA 1ESZA 4M1WA 1BDIA 4J43A 3WGHA 3SBEA 1U5CA 2PS1A 4FW9A 2BELA 4PYLA 2WQ6A 3JD4A 4L5JA 4R1TA 2WHRA 2HOQA 1XK7A 3RSSA 2GPSA 3PJEA 1E59A 3SYKA 2VHEA 1JHUA 5BSMA 3VRHA 4DPMA 4BXOA 4ARCA 1Y42X 3CTPA 1GZDA 5ESRA 3SXJA 1NMZA 1UEIA 4LZLA 1Y1SA 3SEFA 1Z0AA 1O2DA 1YJBA 2BR3A 2XMDA 1Y1LA 3HA2A 4TMFA 3DONA 2QMYA 3S4YA 1ZX1A 4OLBA 1WVMA 1K2VN 2EZ9A 3N8GA 1Z4IA 4HDCA 2MCFA 3SP1A 3WISA 4AS3A 5KINB 5H68A 1NXSA 1S2DA 2V96A 1QRDA 3UXYA 3JU4A 2CLEB 2D7JA 2I6FA 2IHJA 4E5VA 3ASZA 3S44A 4YMLA 1W94A 4CFSA 3IP8A 1OTXA 3N3BC 5C51B 2RB4A 4YCNA 1GEGA 1GUYA 2VBVA 5DKFA 1NMSA 2F67A 1KMMA 3EXEA 1VG8A 1ZWKA 4GBGA 4MYDA 4WMLA 3RRZA 3VHRA 4B6GA 3FA2A 4AO6A 2XEXA 3K0KA 5AVZA 1SU4A 4FR0A 4NBLA 4AG3A 2OHHA 2PANA 1JEOA 3N7AA 1UPUA 3CESA 2G1UA 4Z8YA 3V1MA 4HE5A 2Z4RA 1XTVA 1N1DA 5I9TA 3T06B 3EXEB 4JBYA 3C74A 4OHZA 2G80A 1YVPA 4P33A 4IRXA 2JBHA 2O7VA 1TU4A 4BE4A 3LIPA 4UHDA 1GPH1 3ZC3A 1U7UA 2BMDA 4BQFA 4ND1A 4CV0A 1IHOA 3AYZB 5JZMA 5F77A 4Y1RA 5JT1A 1HSOA 1N1EA 2Y05A 1JLSA 2D8AA 4WXMA 4AUMA 1CERA 3ZY2A 5H3HA 1HI9A 1M9NA 4MB2A 3QF4B 2WLSA 2B82A 4I66A 2Q2WA 1U81A 2W58A 1GA4A 4Q24A 3UQZA 2N1BA 2HSJA 2BEVA 1UOEA 2YZKA 3IVCA 3JD3A 4L8LA 3RNOA 3AB7A 1YJQA 1ZGCA 3OD1A 2ZATA 3W6ZA 3WQSB 1EU1A 2CLLB 2ERYA 2Q29A 2QWXA 2EFYA 4UCFA 2P1RA 1BQ3A 2OQIA 1CJUC 4ZVOA 5K45A 1ORTA 2HMAA 3DVAB 3PQ4A 3BOSA 4X8LA 5DN6D 1ACMA 1WDWB 4XTRA 1EVQA 1M6VB 3TOSA 1U8ZA 4P34A 4XYBA 3M4XA 4EA9A 1ZM3A 3F5DA 4N9WA 4WKGA 4Y0NA 2R60A 3ZWVA 1FYWA 1JMVA 5A4FS 4I50A 2A0FA 2YNMC 1ISHA 2JH3A 1TDJA 1XB2A 3IMFA 3R3ZA 4ABYA 5TIIA 4JXZA 2VZEA 1XFAA 2EC5A 2IHVA 3LHIA 4F91B 3K4PA 2FMIA 4KGDA 3KOWA 4MRSA 3WKCA 4DIUA 3VO1A 3WIEA 3H4IA 2EWWA 2XT9A 2PZJA 4PAGA 1Z0JA 1MENA 2C29D 3ABRB 3OTIA 1PZEA 4HQLA 4LDAA 4DRZA 4EB8A 2YHBA 3AJEA 5JJCA 3H42B 2GWHA 3MUEA 5IT0A 2JH9A 3KPWA 3NJRA 5EERA 1YS1X 4TXLA 5MF6A 2Z9DA 1X14A 3UCFA 3UHOA 4Q15A 4HT3B 3JQBA 1P5ZB 4R2IA 3IKLA 3LQYA 5TT0A 1SUSA 4LZOA 1VLQA 1Q3KA 2CWDA 1L3IA 4RPGA 3HYCA 3D3JA 1US8A 1BKSB 4YB8A 2H4FA 4DARA 3Q3AA 1IEXA 2HO4A 4V0NA 3K3PA 5E2BA 3GB9A 2Y4NA 1MHPA 2WFZA 4Z0PA 2FSUA 1FE8A 4GR5A 4BMZA 3TSAA 4G8BA 1CY1A 3KAQA 1VQ9B 1DOAA 3GJ8A 4NV1A 3DMTC 5FXMA 3FYHA 5FWYB 4EIWA 3OHMA 3RWMB 4HKTA 1B0ZA 1QHEA 4NIMA 4DBLC 3DV0B 4H3VA 4F84A 2P41A 3R7WA 2XMBA 3T51B 2H4HA 1M2EA 3F5QA 5I8WA 3FROA 3DO6A 4S04A 5CFQA 3PGXA 3RFUA 5E6SB 5C52B 4EG0A 4MV8A 3FFBA 1LPAB 2IKSA 3K9NA 3KX2A 4GUDA 2WK1A 1PR3A 2VS1A 1U1GA 1XKQA 4PHCA 4X45A 3VR6D 5F5XA 5A9SA 1KOGA 2NACA 3IVRA 1U4SA 1G64A 3TZLA 5L7TA 5D6NA 1ZNZA 2RK4A 2P9JA 3PNLA 4QQ8A 5CDYA 4YQEA 2IS4A 3CN7A 2B5OA 1P2UA 1R16A 4URUR 3H5RA 3NTRA 2NO4A 2HC9A 1PJ2A 4RK4A 4CDNA 4RHCA 2HM7A 5C37A 2CJYA 3KV1A 4JLDA 1VQLB 4D96A 4Z0NA 5JQWA 4O4HF 3SKYA 3V1NA 4B33A 3DKPA 1DDOA 1K97A 2QG6A 3CXRA 4HDMA 4RD6A 2QUZA 2VVTA 4CIWA 2H2WA 3TTWA 4R54A 1UD3A 3MYRA 1V4NA 2A1UA 4CNQA 1U2SA 4KDFA 2VBSA 4Y2PA 3P9KA 1HDYA 1XZLA 2FPSA 1GPLA 1GGHA 2Q5OA 1ISGA 2GILA 5CLGA 3WJ1A 4OQXA 4NLLA 2FJUA 3ILHA 5GZ6A 1ZK4A 2NMVA 3CC2B 2R1ZA 1C3LA 4TVBA 4IXWA 4WBNB 4GKAA 4Q9KA 2OBFA 3IAM1 5KJ6A 1SB8A 5J5AA 1V5FA 3JD1A 2ZXEA 4HPXB 3KE8A 2CCKA 4L9WA 3RVNA 2H2AA 1S5PA 2HBQA 1UCFA 2HNAA 4IYJA 1GVHA 4DA0A 4J9VA 4YRLA 4PSCA 3SGLA 2I1QA 1M2FA 2OPBA 4XDZA 4D3FA 4D82A 4CQMD 4L1KA 4IJWA 4JVSB 5LB2A 4OGKA 3ZDXB 1R4ZA 2O2JA 2WF8A 4KQJA 1D03A 4FYPA 4GZ3A 1NVMB 4IKOA 4PR3A 3T5DA 1E18A 5JH7F 1RSZA 3TO5A 1GZSA 1EFHA 1P9RA 4WNYA 4EL0A 1AKRA 3HCOA 4HDAA 2IW3A 2R25B 3IXMA 4H2DA 3A1VA 3PEFA 5JC1A 2NTVA 3PA8A 2CDRA 2VKTA 3FOBA 1ZM2A 2RGCA 3LHKA 2AF3C 4EG8A 5KWIA 3UUEA 2K7FA 3K9LA 4U39A 3ULKA 4PTZA 4DB2A 3A37A 3HEMA 3PWSA 1CEEA 3M6IA 1DCMA 3Q72A 3ZHSA 3TBKA 1ZU4A 4X6YA 3PX3A 4TTRA 5I9NA 4LF6B 2QP4A 2IJGX 1WVIA 5EJAA 3BCHA 4Z1MA 1A4UA 2O06A 3IS3A 3O0TA 5EVJA 5J3JA 1Y1TA 4ZOQI 1Y8CA 5MFZA 3PIRA 4NC9A 3NHBA 2ZR9A 3Q9NA 1UBOS 5HGXA 4QXOA 3GG9A 4JC0A 2XOKA 4LYAA 5IJWA 1R8SA 3AB8A 4UZSA 4OHRA 3LLVA 3WGOA 2M2IA 5TY0A 4CG1A 3K92A 4BXOB 2Y93A 4BFVA 3CR3C 3K9FC 1T1IA 2FW1A 4HLDA 1U8UA 4MVJE 4HR7A 3A1SA 3OQBA 4URVR 3LT0A 2BI4A 2H4YA 4I1RA 4MKHA 5JBIA 3CUSA 4F1KA 4ZJPA 2WB2A 1ZYUA 1TJ5A 1MOPA 1WG8A 2K87A 1XZFA 3EB9A 1X7XB 4N39A 1FFGA 4PNPA 3O73A 1OLXB 1SQSA 5GGXA 3IT1A 4N0EA 2GF2A 2VDQB 1OIWA 2QIPA 3CFYA 3G8DA 2VTVA 2ZKIA 4A4DA 1Z6GA 1KYIA 1QVZA 2O50A 4M99A 4UM5A 2OC4A 1S1CA 1GSHA 4UC0A 5BW6B 1LSOA 3TIFA 3ETHA 1I24A 4PAMA 1Y3CE 3L7YA 3DEFA 2WR8A 1LD3A 4TTSA 5BR8B 1KETA 1PJ7A 1NP7A 1U28A 2XA9A 5JIBA 4G0VA 1VJDA 1HYQA 1SNYA 4NULA 4V38A 4F5ZA 3LF1A 3CW9A 3NYWA 2IDMA 4JEMA 5H70A 3N8DA 1NQVA 1WHTA 4AN1A 3ZZMA 1A7AA 3Q41A 3G2PA 4IDEA 1ZUNB 3UB4A 3VVCA 3SYRA 1KPHA 4G5HA 1DTEA 3DOJA 3LCMA 5J4LA 1XD2A 1C7FA 2A92A 3N8KA 4ROTA 4EB6A 2O9JA 4AJIA 3HXTA 1MQ8B 2XXBA 3VPXA 1U2EA 1W9XA 1AKQA 1SKMA 1V95A 5AK6A 5IFKA 1GCUA 3HY3A 3UAGA 2HR1A 3OW7A 4P1VA 4MEBA 4F04A 1TMOA 2QUAA 1Y7LA 3ESDA 2VBCA 1AQUA 1XI2A 4B74A 1HOXA 6YASA 4NKRA 4DNTB 1VHTA 4DL9A 5DHFA 3X43A 3ZHYA 2VUUA 4ZVMA 1ULZA 1EX7A 3HM2A 4OJYA 3EPHA 5DGHA 4BNWA 1G7SA 5AUQA 4LCBA 5KYWA 2FKAA 5JOQA 4MKRA 1XYGA 3JV7A 4FS8A 1Q7TA 4FSXA 4LZPA 3NIFB 5TPWA 4B3BA 5DHAA 5IX8A 5F9MA 4QDJA 2ZAOA 3NBQA 3PCTA 4W7SA 2OEPA 2KI5A 5TQ2A 2QBYA 1IN1A 2BZ0A 1QIFA 2I34A 3RRFA 1ML3A 2E4YA 3DE6X 4JB3A 1WF6A 1RWKA 4ENUA 1NI4B 2Q07A 1CUFA 3NX4A 1U98A 3L6EA 3PT9A 4M49A 4BNUA 4EEZA 3PI6A 2OBTA 1T1SA 3WDKA 4LY9A 2MSDB 1YVUA 3E4CA 4AUEA 2VF2A 1DBWA 2B94A 5IDYA 3ZKAA 5KOHA 1J0CA 1K7SN 3RREA 3GLIB 3AM3A 4DQXA 2OLEA 1LX6A 1RQ7A 2QGNA 4KRXA 2PT7A 3PNQA 1E9CA 3Q5EA 1O9HA 3QH4A 4QGBA 2OZKA 4TWJA 4WK0B 3W9UA 3CRW1 1P0MA 1P1JA 5ECYA 1U9JA 4BP9A 3H8WA 4I9HA 4V2UA 4XLZA 1AF7A 2QORA 4IRUB 3EH2A 4TROA 1L7PA 5C5DA 4YRGA 1SR8A 3MYYA 4RDLA 2VP6A 4JB8A 1OYWA 5CYPA 3BKXA 4FLFA 4UDNA 1N8SA 5CTAA 1B3RA 1DHRA 4O0MA 4N5MA 4YJFA 4CM4B 1G5IA 3VU1A 5J2TA 2W2VA 1ZH2A 2CHUA 1P0PA 2C7RA 4M7RA 3SQNA 1LDYA 2ZTUA 2YC4C 3L0CA 3L7BA 4ZO4A 2JIDA 3RY8A 3RAFC 1KO5A 1WNFA 1IJFA 2UUPA 3E1SA 2X6WA 1C4KA 1RVDA 2WMOB 3RQIA 2GVDC 4B3SB 5L9AA 2WEKA 2AFHB 3AERA 4C04A 4E4TA 1H2RS 3LJKA 2HJ9A 4G1MB 5KDLA 2RI0A 5C4IA 1Q57A 4TMXA 1ULBA 1CX9B 5EZYF 1XZPA 2BMVA 3BRQA 4XUEA 3SSAA 2OPHA 4Q7EA 4LXYA 2B92A 2VDMB 4NU8X 3OEWA 1JEEA 5I9BA 4PZEA 4I3GA 4XVCA 1DEHA 3B1FA 5F7OA 1XNRB 4N5NA 4RFLA 4ZT2A 4TZTA 1SBZA 2CLKB 2DPMA 3GLTA 4YAKA 2AX4A 3B48A 3T1TA 1V4VA 2YYZA 1R0XA 1BXZA 1L8XA 3R41A 1RU3A 4G5SA 5ULLA 3V6MA 3WIVA 2C9CA 1VE6A 5ELXA 2RGAA 2E0IA 2QEQA 5KOJA 4ZHSA