2VZLA

Ferredoxin-nadp reductase (mutations: t155g, a160t, l263p and y303s) complexed with nad by cocrystallization
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGPRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Protein Motifs Involved in Coenzyme Interaction and Enzymatic Efficiency in Anabaena Ferredoxin-Nadp+ Reductase.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
molecule keywords FERREDOXIN-NADP REDUCTASE
total genus 90
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2vzlA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2vzlA02
3AGPA 1BJKA 3W2FA 1B2RA 2C78A 3QFRA 1Q82D 1VQ9B 3WNBA 5DSZA 4YAWA 5H59A 2BSAA 2VYQA 1IB0A 3I56B 4MYUA 1Q7YD 2QEXB 1M1KD 4HE5A 1KTVA 3CPWB 1K9MD 2DERA 3CB4A 1EFUA 4M2LA 1KC8D 4C43A 4RD2A 1IJFA 3ZZUA 1N0UA 2J7KA 4YAOA 4M53A 3WNCA 1N0VC 1UMKA 4LBYA 4LC0A 3ZC3A 1GR1A 1VQNB 2B7BA 4ACBA 3P27A 1WDTA 2XNJA 1YJWB 1VQKB 1YIJB 1VQPB 1FDRA 4FWTA 4M1KA 2DETA 4FN5A 1GAQA 3FPKA 1U2RA 4Y7CA 3VO1A 1ZM9A 4ZCIA 5HXBA 2R6HA 4TN1A 2BGJA 1FRQA 3OJXA 3AVYA 4PGOA 2YWFA 1F60A 3QSYA 1VQ7B 4G1BA 1KK3A 1OGIA 1XB2A 5H5JA 2BN4A 1E64A 3CCQB 4EH1A 1DARA 1YJNB 3CCVB 2DEUA 1VQ6B 4B4DA 2PIAA 4UAJA 3VNUA 2BM0A 2VNJA 1B23P 1NDHA 4J0QA 3OJWA 4B47A 4RD4A 4Y9RA 4N3NA 3LVBA 4YALA 5THXA 5EMNA 4TMTA 4Y9UA 2RC6A 3PENA 1W35A 4RCZA 2D74A 1EFCA 3W2IA 2C77A 4YHBA 1R5BA 1YJ9B 4ACAA 3A1FA 1OGJA 4LBZA 1QFYA 5AN9A 2BPOA 4YAUA 1KD1D 2AHOA 3ZBTA 3MMPA 1QX4A 1KK1A 3CC2B 1GJRA 1F20A 1TVCA 2GPJA 1NJID 3AVVA 1YHQB 3CRZA 3WYAA 3G4SB 3WNDA 4TMWA 5GV8A 3AVUA 2EFGA 2QA4B 2VNIA 3I55B 4MYTA 1VQ8B 1S0UA 3U6BA 1K8AD 2YWGA 1FRNA 4R71A 3WXMA 4AC9A 1EP3B 1SM4A 2QTLA 4K1XA 2E1RA 1G7CA 3CCJB 4DQKA 5JBQA 3FJOA 2ZITA 3B82A 1ZUNB 5KSWB 3WBKA 3G6EB 2HCJB 4QHYA 1BQEA 1CNFA 4FK8A 2BF4A 1KRHA 1VQMB 4F7DA 1VQLB 2OK7A 4NBSA 1AMOA 3LRXA 3E20A 1TLLA 3QE2A 3AVXA 4RJLA 1G7SA 1G7RA 4TMXA 4BPRA 2QDXA 1FNDA 4YAFA 3CC7B 4B48A 1JA1A 4WQMA 4ZCMA 3SJZA 5TR9A 1GVHA 2RC5A 3CCUB 1K73D 1DDIA 3OZWA 3ZZTA 4TMZA 4ZGNB 3LO8A 1QUEA 3CC4B 4QFMA 1EP1B 4RD0A 1E62A 2OTLB 2VNKA 1QFJA 1OB5A 4B3XA 1AIPA 4PC6A 3E1YE 1VQ5B 3I1FA 1EP2B 2VNHA 1W2BB 2YWHA 1JNYA 1KJZA 2OTJB 5TY0A 4AF7A 1EWYA 3P26A 1GAWA 1EXMA 2FX3A 3WY9A 3CMAB 1SKQA 3CCMB 1QFZA 1QH0A 1QVGB 3W2GA 1A8PA 4U9UA 4C0SA 4RCYA 3CCEB 3AGQA 2OK8A 1J9ZA 1CQXA 3MCAA 5GV7A 2XEXA 2VZLA 3V76A 4B44A 1YI2B 1XE1A 4B43A 4P6VF 3VMFA 1GO2A 1YITB 3CCLB 3ES9A 4ZGQB 2BGIA 4PC7A 1QUFA 1R5OA 3QFSA 5TV2A 3WBJA 3VO2A 3OZUA 2BMWA 3ZZ0A 4RD3A 1BX1A 3VNVA 1ELOA 4NCNA 1IJEA 4M0LA 1FNBA 5FA6A 3JQQA 1W34A 2BM1A 1R5NA 2DCUA 4N3GA 1G7TA 1H42A 2HDNB 3W5HA 4IW3B 1QGAA 3JQRA 2BV3A 1JA0A 3OW2B 4LBWA 2BVNA 1KK0A 1E63A 3W5VA 3U2QA 1ZM2A 4RD1A 4TMVA 1D1NA 1TUIA 4AF6A 2XNCA 3QFCA 1I7PA 3JQPA 4HE6A 3LYUA 2CNDA 3CCRB 3B8HA 4RD6A 1KQSB 1D2EA 4ZCLA 3ZBUA 1DG1G 1QG0A 2NPFA 3B78A 3W2HA 1TTTA 3CD6B 2YWEA 1W87A 1KK2A 3QFTA 1Q86D 1FNMA 1OB2A 3CXCB 4DQLA 4G5GA 2GQFA 2B5OA 2B7CA 3J81k 1D8TA 4M4SA 3W2EA 4H9GA 1Q81D 1ZM3A 3U6KA 4PC2A 1ZM4A 2QTZA 4P3YA 3MHPA 2HMAA 3CMEB 2PLFA 1QGYA 1QVFB 2EIXA 1S72B 3W5UA 1N8RD 4PC1A 1M90D 1HA3A 3AVTA 1FNCA 2QMUA 1DDGA 4Q7JB 3G71B 1VQ4B 4PC3A 3OZVA 4LBVA 3CW2A 1BX0A 1VQOB 1QGZA 2DY1A 3CCSB 1JJ2B 1JB9A 1H85A 2PMDA 2QN6A 4G1VA 3AVWA 1EFTA 1CNEA 2X3UA 4ZV4A 2CRVA
chains in the Genus database with same CATH superfamily
4XJXA 4O4LB 2XWSA 3DNPA 1PSWA 3F3MA 4XOIA 2IITA 3UENA 5FYDA 1H0HA 4TGLA 4ETIA 3LX8A 3M6LA 2A4KA 1W29A 3IBYA 3G8YA 3QTLA 1RP1A 5LXTB 1M6NA 1U3GA 2HJHA 4AJKA 2R751 3LH5A 4OB6A 2DQZA 2V4UA 3KLOA 4UPVA 5EOVA 3IR7A 3I52A 2UDPA 1R00A 2R7AA 2V6FA 1ACMA 1Q7YD 1J2RA 2B4TO 2TECE 4OYHA 1PJ2A 4PCVA 3G5AA 2WHXA 1FZQA 1Y4UA 3O8DA 4BNLA 2V03A 3AEZA 4NQZA 5JFGA 2FRXA 3I5XA 2I7XA 4YCJA 2Y1OA 4LSWA 2GVDC 4TTAA 5AHWA 2FEWB 2W0SA 4M7PA 4L8GA 2DERA 1BOOA 3HVUA 4QDTA 5E2BA 4JELA 2IEYA 2OCKA 5IEBA 5JZBA 2FW0A 4LOAA 2IYOA 4FHEA 2V8OA 4TQGA 1P9WA 2W4IA 4NICA 1E7QA 1ZEJA 1CIPA 2QM0A 3IAM1 5DPMA 4J07A 5FEMA 4PLYA 2J7KA 5JY1A 1Q1NA 2H18A 3EN0A 1NIPA 2I7CA 3HB5X 1QIEA 3NYIA 4JUBA 3KYJB 3WB9A 2IYPA 4L8FA 4US0R 4PLWA 5K20A 4GC9A 3PK0A 4P0QB 3V00A 4JVSB 5ARDA 1IEXA 3ZLVA 1LKZA 2LUOA 3U7JA 2D59A 3HDJA 2X40A 4BNVA 2HFKA 4TL7A 2IYZA 5ECGC 4KMMA 3ONFA 2FFQA 4N8EA 3MTQA 2XOKA 4Y6PA 5JRDS 1VQKB 2XV1A 3FTEA 1UPFA 2XMPA 1X3LA 3VV2A 2Y27A 1F6BA 1FU4A 1FVHA 1G9XA 1RTTA 1XAHA 2B0JA 2I4IA 4GSYA 5LDGA 5TNXA 5EE1A 3TG2A 2Z83A 4QXMA 1O4WA 1JH9A 1BQ4A 1IBLB 4KR6A 2W6NA 2Z3VA 1IHMA 4FGZA 2IYXA 3S1LA 4XB6B 1PJ4A 2J46A 3ANNA 4HFMA 1VE3A 3DEIA 3L0PA 2P9ZA 1XDWA 4V3BA 4AP9A 1NXTA 1D7OA 2RGGA 2XGMA 1U2RA 1V9LA 4WUTA 5FFMA 3UWOA 1A9YA 1TYEB 2BUBA 3BICA 1ZM9A 4ZCIA 1PWZA 3PNBA 1ORIA 2DJIA 2ZPTX 1GCUA 1R8QA 4PRLA 1YVEI 4QGBA 4EECA 4D3SA 1YQEA 1D7AA 2HF2A 5KJFA 3C0KA 3U9LA 3RSGA 1DIOB 2TS1A 3ETJA 1DWOA 2BBWA 5D5QA 1BKYA 4IV8A 2VP0A 2WUWE 4LNAA 2QBYA 2R8OA 1W9MA 1UZUA 3NGXA 3ZU4A 5A71A 3AR8A 1U0HC 4PBRA 4NH4A 5CNKA 2EP5A 2WUFA 3QKWA 4YGYA 4CDMA 4DZTA 1RI5A 4EKGA 4QEZA 4R9VA 1E0KA 3FYCA 2XE6A 1VQ6B 2CL7X 4HQNA 1AN9A 3S40A 4CL8A 5A1TA 2AWOA 3ZK7A 3ZY3A 3QY0A 4EB3A 4DRXA 2QM7A 1QHHA 2FGJA 4L5IA 3EEFA 1KS2A 3KELA 3VNSA 4U7TB 5KYVA 4QUEA 3GFTA 3H86A 3DD1A 4W1SA 3WISA 2JEYA 2YZNA 1OBHA 5DISB 3A28A 2BW0A 1NVDA 4ZO4A 4PE5B 1V43A 1NF2A 3KQYA 3V4VB 3R9WA 1B42A 1M2OB 2FEOA 5DYIA 2PRIA 3CZQA 3NC1C 1XD8A 4P38A 5CG2A 1YUMA 1NKTA 3FMIA 4R2LA 1UFQA 3TOSA 3D43A 4BS9A 2O2YA 2NSLA 4EATA 3LK7A 3WLOA 4MVCA 4B71A 9ABPA 4Z4QA 4U7HA 1U2EA 4JYMA 3O3CA 3DV9A 3GT3A 4F45A 2NNWB 3MS4A 2QD5A 1N3YA 4RCZA 4QYXA 4HNQA 1C80A 3E9DA 1G8AA 3HGTA 3UXHA 4C7OB 3A7DA 2PYZA 1P0PA 1G2QA 2QRHA 3FLBA 5ES4B 1XCJA 2QT0A 3RTBA 2CXOA 1HQDA 3E9ZA 4L5BA 3EBPA 4GXQA 3GLIA 4KV7A 5HR5A 4LFAB 1T8RA 4JEHA 3CH4B 3PFKA 4LDQA 1E1RD 3N39C 3OKCA 2QRJA 2HZBA 2JJMA 2VF8A 2F43A 1L7PA 5G0SA 1ISPA 3O0TA 1LV8A 3A1FA 4YMVA 3ADDA 2UAGA 4K9DA 4XIYA 2K2QB 3ODPA 4BVKA 5L95A 3BK7A 3TUJC 3MRSA 2I7VA 3SU8A 5B7GA 1Z5OA 4OA5A 4XWOA 5FYQA 4MRVA 2JAXA 3C48A 4DA4A 3UO8B 4UZEA 1UAGA 2FPIB 3VJLA 1WUIS 3QX8A 4HK4A 2J0QA 4YY3B 5A9RA 1QMPA 4JQSA 1NHWA 4IUBS 4CQJA 1CRWG 4L9RA 5DBIA 2FR8A 3DT9A 4GM4A 2V4DA 3L43A 1ZOOA 4NENB 5HQ3A 1V5IA 1WXXA 3DUWA 1RQXA 3Q3CA 3BH4A 1FJGB 1G5FA 1IXRC 2AFIB 4OXKA 5JC1A 3QU5A 5JCZA 2H7YA 1I30A 4I4TA 4EYKA 3ON5A 2O3QA 2JFNA 3UAWA 3Q11A 1RJ9A 3S7ZA 4PLTA 1ZL0A 5I7HA 5LDDC 1EK6A 1EVQA 1K89A 3G89A 3N28A 4I2VA 3FR7A 3TLJA 3WAKA 5J4LA 5JVDA 1OC4A 1T29A 3U1BA 1WB5A 3AJDA 4RSRA 1OXVA 4CLDA 4PR0A 3BUSA 5IBRA 5I7AA 1TKAA 3T54A 3U16A 5JCJA 2QJOA 3G6EB 1H0RA 3G49A 3PC8A 3F73A 5A06A 5CDFE 1IY2A 1KBQA 1GYPA 2AG1A 2AF3C 4A26A 3PXDA 521PA 2AF4C 1W36B 3BEOA 1WMBA 5EP1A 2QW1A 4D25A 1QTRA 5CTAA 4L8JA 1N6LA 2H06A 1XCMA 4EHFA 1YE5A 3QE2A 5IZCA 1D4ZA 3FYUB 3UJDA 3BXFA 3OURA 1EHIA 2KBEA 4ZYVA 2ZWOA 1G8HA 4OHCA 1OROA 1UMCB 2D8MA 4OPVA 1JG2A 4LNHA 4G6ZA 4RQBA 1J2TA 1UZAA 4RH3A 2GYYA 3SQDA 4PNZA 2X23A 4KODA 5DV9A 5CFLA 4QJ5A 1ZU4A 1BJRE 2F2TA 2X3YA 2GBFA 5LWHA 2JIRA 5BQ5A 5EXDA 3HJCA 5FNZA 1ST3A 2CFSA 4TZ0A 1SBTA 3ROGA 2B4KA 3N6XA 2JLQA 2QRVA 3CPEA 5KBYA 2A2ZA 4BV8A 1Q3KA 2CDNA 2ZRQA 2X8JA 3ETEA 3N3AC 4YJFB 2IEZA 4B80A 5IMBA 4G01B 3SBDA 1AN0A 1KYXA 1COWA 2QD3A 3AEUA 1BPLA 3GYBA 3NKVA 4JX8A 5HPYB 1GUBA 1XU9A 3GMDA 1A71A 1MB2A 3GRRA 3RFUA 4BIIA 3N2GB 4C01A 4IAOA 1NVFA 3G5TA 1SBHA 2OTLB 4KGZA 3T5DA 2GHRA 1H8HA 1QFJA 1T9GR 4GXTA 3WGIA 3WIOA 2VJPA 4G0PA 1Q19A 1U9ZA 2NUPA 3AI1A 1BN6A 1L4KA 3NHSA 3OOJA 1HDGO 1FA9A 4OQZA 5BV2P 5JISA 2FPOA 1W5TA 2EQBA 3RYHA 3A58B 1UM8A 3DE4X 3C16C 4C4TA 1JB1A 2MSDB 1K86A 4OK6A 5A4FS 1M0EA 4HFRA 1E43A 1FLNA 4R7GA 2PH5A 3GRUA 5K4GA 2VCYA 3BHJA 3DFUA 4GXNA 1G60A 3KAPA 2VZ9A 4RF5A 3GCZA 2Y6VA 5C8XA 5F35A 5B64A 1NG1A 3EARA 5COAA 2RARA 2OD2A 2VKTA 2NX2A 2OTJB 2W8BA 4OQFA 3WR5A 4ZGWA 5CGZA 2RI0A 2WWIA 1ZIYA 2XB8A 2E55A 3RWMB 3D7LA 4URYR 5DSXA 4Z3DA 3RTDA 1B8VA 3MG9A 1MX3A 1C9EA 3KSMA 5EIOA 1YS4A 5FWYB 1Z6PA 4PHHA 1Y4ZA 3QVOA 1XPRA 1HV8A 3A2LA 4ES6A 4CV3A 5PGMA 1BFDA 2F3SA 4AIIA 4Q9AA 2XB9A 5F3DA 4CTJA 1C3OA 4KQKA 1RABA 1JVSA 4NMWA 5JAQA 3RH0A 1XJ5A 3VTKA 4LNUA 5FI0B 1ORRA 1QV6A 3U3JA 4E5MA 1YMUA 5KTTA 2D2XA 2V9ZA 3LUFA 1BXRB 1HVXA 1CE8B 3X1XA 3IXLA 3EXG2 3F9RA 3K6RA 3R3ZA 4DUGD 5ALRA 1Y8RB 3WZLA 2PUBA 4RM0A 2DOKA 4KFUA 5LXTF 1YI2B 2PX3A 3OJOA 4Q1BA 4Z99A 4TZKA 3VTZA 4AD8A 2X4DA 1FVOA 4HNHA 3FIUA 2NZXA 2ZE7A 4Q7QA 3D3EA 3LLCA 5TQ0A 1Y37A 1E4VA 1T2EA 2AR7A 4PSCA 3U3MA 5BUQA 1PEKE 2OORA 1E2EA 2MSNA 4CM5A 1XR3A 2F9LA 4ZGQB 2GH1A 2OHXA 2QAGA 4WCFC 3ZI0A 5K0SA 3ZV4A 2WAXA 3D8TA 1Z5NA 3HY4A 1P1IA 4Q3OA 4LFCB 3DLBA 5CHEA 2CL6X 4EI7A 1Y0YA 3DC2A 3A1VA 3Q4GA 3AU9A 1V4NA 3TFWA 4ZOLF 2R48A 1NNI1 3EGOA 2BCGY 5IULC 3QLVC 2EF1A 1IXKA 3A3PA 3F1KA 2I3AA 4REMA 3SIRA 3D6AA 3A14A 2PX0A 5IABA 4B2PA 1L7RA 4AF8A 4DS3A 4P1ZA 5GM2A 2VIIA 1Z38A 5C18A 2G82A 1CF9A 1F2DA 1K06A 1NPDA 2HHLA 5JV5A 3VNVA 4UBMA 3W4IA 2VHXA 4EP1A 2DXIA 1IONA 1M7BA 4KH1A 4YEDA 1N7GA 3QY9A 1IJEA 1XQ9A 2JBAA 3FZNA 4LE2A 1Z63A 1HDEA 4BC1A 3STWA 4CN8A 2HDHA 3C3JA 4Q66C 1H2HA 1DS6A 1U8YA 1JEEA 3HU5A 3K0CA 4Q6WA 3W6ZA 2CVQA 1UBEA 4FKMA 2AZDA 1RI2A 4XKJA 1U8UA 2B6HA 4H31A 3W0LB 2UUBB 3CUSA 1ZVQA 1LVHA 5B3AA 3RVBA 1E2JA 2VWPA 2D3WA 3CUUA 4YV1A 5DTIA 1LI5A 4GE3A 3BA6A 5A3JA 3V6MA 4G4SP 2J30A 1V39A 3A70A 3DPIA 3WLJA 5CVVA 4BFTA 5K9ZA 2CGEA 2P9EA 4IS3A 4JYPA 5AKGA 3V8VA 3GLTA 2FSFA 4D8UA 1DSSG 1QGAA 5UKDA 3VBEA 5IG2A 4OIMA 3WLMA 1VZ2A 3D3KA 1WUTA 2RMKA 1WSVA 1U2SA 2WTBA 3G0IA 3AI3A 3OHPA 3PQ4A 4U7GA 3JPYA 3CMCO 1FXSA 4LI0A 4OJYA 5F5NA 4IFTA 3K8ZA 2MSCB 1ECBA 4DM3A 5JEEA 2AK3A 1GGFA 5JXGA 4INZA 3IR6A 4JKYA 2G88A 2JD1A 1YO6A 2IXBA 3G9UA 1DLJA 3NC4A 2HZ7A 1E6LA 2W0MA 2O23A 4NBVA 1G6HA 4O2BA 1IEQA 2OO5C 2CCGA 3F9CA 3RIXA 1UKCA 3LG2A 4KO2S 2EJUA 3ETCA 3UICA 3QVLA 2XE8A 2GMWA 3VR0A 3VSCA 4KZKA 3NDIA 1HXHA 2G8NA 4HE6A 2CLEB 3DMDA 2W93A 4I81A 3VYWA 3K6KA 3NQ41 3MTAA 5SZHB 2ALJA 4UM9D 5GONB 1E0SA 3KAJA 2A57A 1G5RA 4J0JA 4XI9A 4DMHA 3E8MA 4G81A 2YY5A 2E89A 1VPLA 1PJQA 2AX4A 4MNTA 4OVKA 2RH4A 2SKDA 1UJBA 1X1BA 1HURA 1KDPA 2PL1A 4DXAA 4WZBA 1MO6A 1YNSA 1YR9A 2HXGA 3SKBA 2HN9A 3H1AA 5LZ5A 1NDUA 4I5EA 1Z06A 1I3NA 1NBME 2I9PA 4FR0A 5T67A 5JAUA 3O3NB 2NWQA 2IP1A 3M1AA 3TEMA 1FDUA 3WYCA 2ZPAA 1MOSA 3EY4A 3BDAA 4CR7A 2CE7A 2JAPA 2O3RA 1OXTA 3IGFA 1DOHA 2RGXA 1Q86D 1TADA 4GYWA 4HGPA 2V6BA 1CYEA 1SHKA 3L0BA 4TKMA 1XBTA 3V5NA 1IBMB 3CXCB 3TZLA 3CQ9A 2WYVA 1LVUA 4II7A 2F1HA 3KPJA 1DU4A 4BRWA 4R84A 3RK4A 1X87A 2Z56A 3AR9A 4RETA 3A10A 3NBFA 5I7RA 1YDMA 2PL9A 4O4JA 5I3CA 3LY8A 2XT6A 1DL5A 3LBIA 1LSOA 4G5SA 1UOOA 2I55A 2VYVD 3HJBA 3SBEA 5A1JA 4PC2A 1I4WA 2NO7A 3Q85A 4GPAA 4REQA 3WSVA 1VMKA 5DXFA 2JJYA 4UQOA 2AB0A 1C30B 3UKJA 3MJVA 2BH2A 1AGXA 1GNLA 3QX7A 5KZMB 2B1GA 2PU5A 5BV7A 2P2YA 2YDYA 2EIXA 4X60A 4OGFA 1SXJA 2JG3A 3GGCA 1QHIA 1XOIA 3ZIUA 1C7EA 1O94C 1M90D 3AUAA 2CJPA 1NXVA 3UFBA 3NM6B 4K88A 1U8ZA 1XZDA 2CJYA 4EPTA 1Q92A 1SBYA 4YB8A 3JQEA 5F7JA 3UJCA 4AKGA 4B6PA 1I7DA 3ZV7A 3OZVA 3ZIAA 2ZWIA 4EQ6B 2XAUA 2AEFA 1RXUA 1Z82A 3EIXA 2XXAB 2G1JA 3RD5A 2PR2A 2HLDD 2REBA 3F7MA 4M89A 2JLZA 4DDVA 1RI1A 1E5VA 3AY3A 4XM2A 3VYUB 3RVDA 5B57C 1IPEA 4RK1A 4M55A 4DUZB 4KPYA 4L4RA 2CZGA 1XD2A 4IV5A 4QYMA 2YOHA 3NX4A 3PPXA 4UZSA 3WWCA 3WWZA 1C5KA 4OM8A 3W7AA 1V8ZA 1U8EA 3UZUA 4NONA 1OGYA 4TV9F 5IYPA 5KAMA 3MFQA 4OQ4A 3KTAB 1Y6FA 2B92A 4QYTA 1RDFA 3INYA 1Q82D 1NUTA 3ABIA 4MQEA 4M7OA 4AI6A 4IJWA 3WNBA 3TB4A 2XD9A 5JJIA 1CZRA 4U7JA 3RU9A 2PKRA 3VR5A 5FD8A 1H3FA 3O8QA 2LGJA 4JR2A 5CMLA 4E21A 2ANCA 3EMKA 1WCYA 6NULA 3ERCA 3T12A 5GM1A 3EPRA 1MO2A 1U7DA 3CNBA 4RHFA 2OA0A 3ROQA 4HX2A 4NARA 3ZQKA 3NWJA 2VLIA 3VZQA 3TECE 1G98A 1MOZA 2L0XA 4JWTA 1KQ3A 3AY6A 3DFZA 5KB3A 1Y89A 3QUBA 1VPDA 2VRWA 3E9EA 1LLQA 5C37A 3GMSA 4WK4B 4RV5A 2XYRA 2EJVA 2ZUVA 3DP9A 1AU9A 4BO6A 5JNWA 4IH4A 5FBLB 4IQFA 2FJPA 3IR5A 4I4TB 3V7YA 3W8RA 4C4RA 4ZJPA 2PRKA 1RR6A 2ZP1A 3IO3A 3RG2A 2WTMA 1X9HA 5IAOA 3REQA 3LM8A 2NP7A 4XOPA 3OMXA 4D82A 1G41A 2R25B 3RVLA 3ZWNA 1LD3A 4ARSA 3K6JA 4URUR 4CKCB 1QDUA 2XCLA 1ZRMA 4N7JA 3TDNA 4BL5A 4OHKA 1S1CA 5I48A 1UMKA 1KEVA 3AHGA 4IZOA 4DPMA 3PLNA 1TK2A 1DQYA 4Y9DA 1DAOA 3CO0S 4E0FA 2Q5EA 2OFXA 4CMJA 1E1RA 2O06A 2C2WA 1MQ8B 1PR4A 5AM5A 1EX6A 3ZQ6A 3HPRA 4FLEA 5TS2A 4FMDF 3LLSA 5IXJA 1RWKA 1KP2A 1U6JA 2RFLA 4YBRA 1PJ5A 4J1TC 1Y0RA 3HFSA 3AC0A 1HDZA 5FQOA 1TZJA 1YIJB 4P3NA 1ULUA 2VHYA 1UJNA 1EFKA 1W581 2ENUA 4OL0A 2GZSA 3GRZA 4IGFA 5AK6A 1VF7A 2ZT5A 4X8IA 3UYLA 1WB9A 1X8KA 3KUDA 3IUQA 3O31A 1MPXA 5KYUB 5LL6P 2ZBRA 1PDVA 5BP7A 2QAJA 3UM9A 1KIAA 3E5NA 3MT8A 4CR8A 4DMFA 4RXMA 1WSWA 3OPXA 1ZKMA 3ICVA 4J75A 4UU0A 3TMAA 3ZS9A 4DG5A 4UOZA 3ZXSA 1H5QA 5IYZB 4HRYA 4AKTA 1DOZA 1GQRA 4R01A 4BNMA 3FPKA 1NVEA 1UC4B 3I32A 4U7DA 3KQNA 2GJRA 4HGQA 1TQ4A 4W7SA 3SXUB 2HA7A 3V34A 1JXQA 2G1KA 2DM6A 2R6HA 3H5NA 3HJAA 4EYEA 3N5CA 4UVGA 3JX9A 3BFXA 1DX4A 3NEPX 4C6TA 1EXWA 4J3JA 4ZYYA 5KMGB 1T6ZA 3KL2A 3KT6A 4IWXA 3PFHA 3W90A 2JGRA 1E1QD 3RUCA 3CX8A 3AHIA 3P7MA 2OE2A 3WFJA 4EHBA 1MJ5A 1HY3A 3S0JA 3OQNA 4TWAA 1J8YF 1YHYA 1P8AA 4TL6A 3V8BA 1S5PA 5BSWA 5HK9A 4YMTA 2ZXHA 5KDLA 4YXWA 4D43A 2OO7A 2O8FB 1K9VF 4AQ7A 5JXJA 1M1YA 1UEXC 4CV1A 1VKRA 2Y77A 5M3BA 4PSVA 3VNUA 4RA9B 2PE3A 3UXMA 2BM0A 4AJEA 1UWVA 2DECA 4MYCA 1KOLA 1MOPA 3ZGLA 4D8XA 4EPYA 2ZGVA 1V5GA 4B47A 1BCRB 4UXIA 4WX2B 3KVVA 3ZDCA 4FYKA 1OQAA 3QU4A 1GGVA 2HIGA 1KETA 1N1MA 2Z0MA 1JFVA 1R3DA 4NE7A 4XQEA 5CBKA 3I6MA 3TAXA 3MFYA 4J3FA 3NVKI 4BQEA 5IVHA 1G8KA 1YL5A 3A0RB 2GTPA 3C98A 4JU8A 3TDMA 4BWGA 1CR2A 1XTUA 2WHEA 4HUJA 4L4ZA 3TSCA 4B6EA 1QQAA 1R64A 5FOTA 1U7WA 2EJWA 4QDXA 1GPNA 4U3JA 5AO9A 2X1LA 1N78A 3HEMA 1NQOA 1C7FA 4PWYA 4OXQA 1X1QA 5EHGA 3NTVA 3HSKA 2Y1KA 5CXUA 4NAHA 4DLRA 1V16A 3EFHA 3UCFA 4ONEA 2D5BA 3R44A 5AM0A 4BGUA 1U6KA 3Q8WA 2GZMA 2ZREA 2ZR9A 4FOTA 5JC8A 2ZJ4A 1MJNA 4ID3A 5DNAA 4EHIA 5ERXA 4FOOA 1WPGA 2JJ2A 2XQIA 2PZGA 3QFFA 2IDKA 1Y6ZA 3K8YA 1ZGAA 1FMCA 1WXIA 2I4LA 3OAAD 4FS8A 4F92B 1S3FA 1T2UA 1NOIA 3F7TA 3Q72A 4CMAA 5C1DA 2AOTA 4X20A 1II0A 4H6VA 5G1PA 1JPUA 3KALA 4ZVQA 3VX4A 1SBZA 3KL4A 1EA7A 3ZD7A 1EFRA 1QX4A 1K3TA 2XUQA 1MTOA 2IV2X 1WW8A 2W6IA 1J06A 2C97A 5T3YA 2QMYA 1MAWA 2OQRA 2RKOA 2XSZD 3E5HA 3R0ZA 3WYAA 5LD2C 1RM4A 3G4SB 2J8ZA 5EYPB 4M1QA 2ZB7A 3SR3A 1MHTA 3U1TA 4PG4A 3MZ0A 1DV1A 1I6MA 1B1AA 2FW9A 3GP3A 1AXRA 1PV2A 1THZA 3IEXA 4E51A 3SHWA 3I6YA 3UMSA 2PZ8A 2JHFA 1HWYA 3FVTA 3R40A 4R71A 3LP8A 2A1IA 4MJLA 1ZD5A 4WDRA 4D5GA 4XIFA 3WMRA 4YRCA 2QTLA 3F8TA 2ZI4A 3UJ8A 1G7CA 2XJ4A 1JFSA 1NBOA 2ZJFA 3OZTA 5I7OA 3CEJA 4NAUA 1OIVA 5D5PA 4PFQA 4IHKA 3B82A 3QPCA 3S2YA 2AYZA 3V8NA 4C22A 1C3JA 1T5TA 1NUUA 4KMRA 2MIIA 1EWKA 4RHXA 2Q7DA 3OM8A 4L76A 2H3HA 5EHNA 2HFJA 1GNTA 3HN6A 5ALPA 1NN0A 3RSFA 3EHDA 3T8YA 4ZAVA 2WZBA 1SCDA 1BXKA 1S2GA 2GHQA 2OBNA 3H2ZA 1WG8A 3IJEB 3PXEA 4R98A 3I2YX 3WL4A 1UD8A 1BA2A 2OBYA 1WP4A 1E9BA 2P8JA 3PSAA 3OA2A 3CLSD 1BD3A 3I23A 3R0VA 4B7AA 2HX1A 3W04A 1RQ7A 4E5DA 4GL2A 5KYTA 1OX4A 3UHOA 4PINA 1EE9A 3H19A 2ZTMA 2UUPA 3HVIA 2HYDA 2QDXA 2WRZA 3G02A 1UZMA 2I87A 2RIRA 5CBPB 4BFWA 2OBTA 1M72A 2FPLA 1UODA 4WN3A 1RHUA 3SZMA 3UJ7A 4AWXA 4BVGA 3KKEA 5ADHA 2UVPA 4FNMA 2Y1EA 4MEJA 1U2GC 1JF8A 1X7WA 2VJOA 1M8JA 1U8FO 2XCOA 5FOVA 2B2XA 2XMCA 4P2BA 1GTG1 1XJ0A 5SYAA 4KXYA 3ZY6A 1NYLA 4G1EB 3F5MA 4HQRA 1UBKS 1UP6A 2JJ2D 2GEJA 4JXJA 4LA4A 2N0SA 3Q88A 1T34A 4MQ4A 1H6CA 2DYKA 2PUHA 4R6XA 4MITA 3IRUA 4DMCA 3QPDA 3VHXA 2WMOB 3M2TA 4DEXA 2REQA 1RMQA 2ZE8A 4HVAA 2QVCA 2IF0A 3JQ7B 2OGZA 4QDKA 4G0WA 4WEOA 1SZCA 3ONVA 4TYQA 1RU3A 1E9RA 1GA4A 4XLLA 1B43A 1JHQA 3KDPA 5BR4A 2YFQA 2PO7A 4H0FA 2C9BA 1A5ZA 3M3HA 3WK9A 5D1NA 1K5PA 4IIEA 1RHMA 1GNSA 4GHWA 4E33A 5EJEA 4MWTA 3EJWA 1YE3A 2JVKA 1ZOLA 3E1YE 3P97A 4O0MA 3ELUA 2JCGA 3CV3A 3PC7A 3Q0EA 1W8IA 2BZ1A 3L6BA 1MX5A 2ZRHA 3IDFA 3QE4A 1Z4OA 4MQLA 1T2CA 2GRAA 5TY0A 1RYYA 4M60A 4EUEA 3FWHA 4DSZA 1ETUA 5ICSA 5DT2A 1DKLA 5DNYB 3DZDA 2VVTA 2QQ0A 3OP1A 2FMUA 2W6JD 4PYRA 2JASA 4ZO6A 1S9DA 3JQFC 1H3EA 1I6WA 1KORA 1GNPA 1M6WA 4WE3A 4CQMD 2BGWA 4CODB 2C1EA 5ED0A 1H0KA 2VJQA 2O0KA 2R85A 2HBRA 2HRQA 2WNIA 3UHPA 4UPEA 3S8MA 4UMEA 2Q21A 3KU1A 2CT8A 4BV3A 4LRTB 3ROTA 1VDMA 4HY3A 3MCAA 3B20A 4LXUA 5JPIA 4YRSA 3O8BA 4EQ6A 2IUEA 3K0FA 3AEYA 5BVHB 4IIBA 2O2IA 3SFZA 4OGLA 4EY8A 3ZW8A 1J42A 3DV0B 4NH0A 3E3MA 4JVOA 2AN5A 3GJ0A 1JDZA 1NHGA 2EBWA 2VBFA 4CEJA 4UATA 5FCDA 2IHKA 4AJNA 1XTQA 1IXZA 5A02A 4CIAA 1XD2B 4XYGA 2GM4A 3NTRA 4P0TA 3JQGA 5CJ2A 5JRJA 5TJ9A 2V7PA 2DX7A 2GSWA 1XVVA 3GRYA 1W76A 3OZEA 3V1NA 4BLVA 3I04A 4EEXA 5IVPA 3LIPA 2DKNA 3PVDA 4L6AA 4ARAA 4BNIA 2ZXUA 1EUDB 4PONA 4YLYA 1PX2A 1NGSA 2Z1NA 2D2VA 4IVRA 4UE2A 4IOKA 3TM5A 3PUVA 2I8LA 4AG5A 1OU0A 1XHEA 1ZEMA 3N8IA 4P3KA 4CW7A 2GUWA 3ESCA 5C4GB 4Z51A 2XUZA 3FMVA 5KYGA 2Y0BA 2WG2A 1T9DA 3FKQA 3A04A 2CUZA 2IZ1A 4UZFA 1IMJA 1R9JA 7MHTA 1W5BA 5EZ6B 5GOZA 1C7IA 1WORA 1SCBA 1MJHA 4MRMB 2O8DA 3GJ7A 3HY3A 4DCNA 4UCWA 3FVVA 4FNGA 3FDIA 3IYLW 1XZCA 3KEMA 2WSYB 5ICMA 4J1TA 5ENZA 4RFSB 1EK0A 2QA5A 1S89A 3E2MA 4GZ5A 1BXZA 1OZGA 1RT9A 4JOSA 1XRRA 4YK7A 3T7JA 8ABPA 4X62B 1FFXA 1WHTA 2PRYA 1GQQA 1ZXBA 1NE2A 3DZKA 3CG4A 3FH0A 2IXAA 3HDTA 3JQ8A 4MW9A 5E0KB 1I14A 3VUEA 4D46A 4S04A 3GLFE 4GC5A 2ZSJA 2NACA 3DPUA 2PMFA 2AUMA 1P9RA 1NAIA 3CPXA 5FLKA 1KZYC 4WN9A 6Q21A 3LFHA 1ZH6A 4JLMA 4MVJE 4BX9A 3GFVA 5HUJA 5IKPA 1FL9A 2VTBA 2RE8A 3IT1A 4MZDA 1JIQA 1ZZGA 4HUQA 4RTSA 1PCXA 1UC5B 3RRMA 3TQIA 1E0AA 1SQGA 2D1TA 4CFZA 3GDFA 3K7EA 5CT4A 1OZHA 1SBIA 1SCNE 2R96A 1X7XA 3QI7A 4UTOA 2DHCA 3EGDB 1CRQA 3JD4A 4O4IA 3SJCA 3F97A 4HNVA 4RDLA 2ZUWA 1CR4A 2OVBA 4ZK6A 4OSEA 1U2DC 4R0NA 2J0EA 4EITA 4AF6A 3I73A 5GOTA 3TE6A 1S2LA 4RS4A 3N7UA 3EUWA 2M6LA 1RE1A 4OXIA 4GAEA 2XT0A 1IN6A 1NKVA 2BD0A 4GUAA 4I7EA 5HIJA 4OI4A 1Z9BA 4FMCB 3STVA 4BVAA 3I1IA 4NEHB 5K03A 4EZIA 4JZYA 1PL6A 1ZXXA 2B8JA 1KERA 4O8CA 1E4EA 5EN4A 3NHRA 4B3FX 3BZBA 5K2MA 1RFLA 3EUEA 3RU2A 4DVJA 3DLHA 1GQYA 3DCYA 5IYQA 1YU9A 3LC2O 4IX1A 3KYCA 3SXUA 4AMVA 2R1VB 5CFQA 4TKOB 3ASQA 4PZDA 3LSYA 1A82A 8LDHA 3VR6A 3DPSA 2JDIA 2JARA 2WABA 1YZUA 1CKEA 3DLAA 3GNSA 1NTOA 3V8MA 1QONA 1DDOA 4DFDA 2R1UA 1TM1E 2H1VA 3DQPA 4L75A 3RT9A 3ZZNA 3B1ZA 4QYIA 4CEIA 5JD5A 1WMFA 2PBZA 1YRAA 1TO6A 4LE1A 3F4LA 4XCQA 4DLTA 3L4EA 4DMRA 3O7MA 3BCRA 4U8HA 3OQOA 1Y3HA 1QZTA 4YCBA 4P1VA 4ZQEA 4V02A 2DWUA 3IQIX 2XWBF 4FE3A 1I0ZA 4NEQA 3G17A 3FTPA 3J81k 3K9GA 4D8VA 2IS4A 1UEJA 1FFEA 5F33A 1Z4MA 2HSGA 3JD0A 4NCJA 2AR9A 5HMMA 1E7YA 1J20A 1J8VA 1PEAA 2Y71A 1K66A 4M8IA 3UUWA 3V2IA 4GOJA 5CTJA 3H2IA 3U6KA 2JIDA 4PZLA 3U60B 2I78A 3FRIA 1OD6A 4KQIA 2QTZA 1SU7A 2CDBA 4BJ6A 2P9HA 2V7UA 1ETHA 1SKBA 2XUFA 3WL8A 5FKJA 1RYBA 3EA5A 4IDHA 4PG5A 2VNAA 1ADGA 3RNOA 1E99A 1Z3CA 3B36A 2CMKA 2ZXEA 2NVWA 5K0TA 3ESDA 1YOVA 2OC9A 1SOWA 4RTPA 4KPUA 2OAQ1 4PNPA 1KMNA 2C7GA 1YCGA 5EVJA 3M5WA 4L5AA 1THTA 2G28A 5JXWA 1P4AA 5SZKB 1B76A 2Y0CA 1NMYA 1IH8A 2P3QA 4J0IA 4U2FA 2Q9AA 3SY8A 3UWSA 1DPFA 2BM9A 1H85A 3DEJA 2C5FA 4BMCA 4P6YA 4I6GA 4X8LA 4D79A 2VO1A 2O5RA 4GSKA 1JHXA 5FA5A 5K0ZA 1ZUIA 4DMLA 4ZKDA 3R7AA 1QE3A 1B41A 3ZKWA 3ANLA 1DEOA 1M1ZA 3ELWA 4Q01A 2IYTA 4RV9A 1TFRA 4GIBA 5LCXA 4JL6A 3WMFA 4EABA 4EENA 2V7BA 5B7NA 2Y66A 4FU0A 2VATA 2AE1A 3MWEB 4F5ZA 1XRQA 4QBIA 3FOEC 3LCUA 4IWNA 1Q74A 4D41A 2V7WA 2AOWA 1QIMA 1HTTA 1NBHA 2N1MA 2PZEA 1N2GA 3OFKA 1BXGB 4INJA 1IB0A 3AIMA 1XEAA 4EKIA 1BHSA 1YQQA 1EFVB 3DMRA 2WMYA 2ZB2A 5DN6A 1T8YA 1Q1BA 2JFHA 5KQPA 1Z2DA 1V26A 3PNVA 4BO0A 1OC2A 1YQGA 3NO4A 2FLWA 2ZRDA 4W7HA 1XEWX 2I6UA 3HA3A 4GMFA 5G4KB 3DLTA 3H3JA 1U7TA 5C1BA 4JOQA 5KNCD 5LQJA 2RGRA 1ZNQO 3CKLA 4RPIA 1Q0UA 2V65A 4AYTA 1EFUA 1I8DA 1A98A 1TVMA 1KC8D 1P73A 1TQ2A 2DPXA 1EU1A 4BVLA 5JQWA 5ISMA 1NRKA 3FFBA 1U6IA 1PFQA 4IIXA 4R1NA 4DV3B 5HE8A 4B3MB 3QMWA 4M1WA 4Q9JA 1U9CA 1WMSA 2ZIUB 4M8NE 3MBOA 2YNMD 4EFKA 4ZHQA 3C5CA 4HDMA 3H5TA 2KYRA 2Z8YA 4IINA 2YV3A 3U62A 2C04A 2YUTA 4EUNA 2XI4A 1Q0ZA 3NYQA 2Z4TA 4AM8A 4K9KA 3GCWA 1ZK3A 4HHEA 3VVCA 3FW1A 2CC2A 5EQJB 4YWJA 3LPNA 1HL3A 3I9NA 3BULA 1ODJA 4JFRA 4OUKX 4P3OA 3A8JA 1FJ2A 5K3CA 2PTHA 4C06A 4QM6A 3R9XB 4Z9XA 3NBAA 4PVDA 1Z2OX 1S96A 1A1VA 3PXCX 5E4YA 3W77A 4AVYA 4GQBA 1U65A 1C9NA 2PUTA 4CCAA 1C8VB 4BDSA 1DO2A 3IILA 1ZGGA 5LMCA 3BTOA 1XZQA 1ONOA 3EZ9A 4EK9A 3RHFA 3AB3A 3AY7A 3NIDB 5CT9A 5AM3A 3AF4A 3C7CB 4QU8A 1F9AA 1CDDA 3DOOA 4HMPA 5D7NA 4BAUA 1I2DA 2WD9A 1E1NA 3GR6A 4Y9TA 3QG5A 1T9GS 1VJTA 3TL6A 4DBZA 4FR5A 3BSYA 2HJVA 3G79A 2PZLA 1Q1ZA 3SDBA 5I9IA 5I7EA 3RB8A 3ZE0B 1PFVA 4YX9A 1Z12A 4FGWA 5A5GA 1OASA 3TYXA 3IUMA 5ICFA 4Y2HA 1R0XA 3VTAA 4EHNA 2ODQA 4B40A 1GTZA 1TA4A 3LZCA 3QEAZ 4R7TA 4AURA 5C7LO 3A4VA 1T3HA 3I45A 4WZ6A 4ZPXA 3V2UA 3TK1A 3DL0A 3LUKA 2VH5R 4FBMA 3RODA 2BN4A 4QV2A 4MUHA 3G2HA 3VHXB 4ZC8A 4ARVA 3GG9A 2HK9A 5EE0A 2Z8XA 4IUCS 4C0KA 2JEZA 3NR2A 1FNNA 1NSTA 1QIGA 3SS7X 2PKEA 4UUBA 3RSCA 2KI5A 1ZD2P 3ZNQA 1BGVA 4WZAB 2PIAA 3O84A 5JU6A 2WQ6A 4CLHA 2DBRA 4OJKA 5M7EA 1Z45A 1QWSA 2B82A 3OY2A 3S2ZA 2A33A 3VSEA 4UMVA 2XOKD 2Y05A 4F72A 2A5GA 3AUFA 5JJBA 3VZRA 4Y9RA 3T5BA 2C7VA 4DF3A 4YFYA 4ECAA 1X13A 2JPDA 4E1AA 2BFNA 1S1MA 3G0CA 3E7XA 3Q8LA 3LUDA 4ZEXA 1H3NA 1EZZA 3W2TA 2I3BA 3GA5A 2DKFA 2DR2A 1XT6A 2AN3A 3N74A 3R6WA 1I18A 4NYMQ 3RRYA 2E9SA 4AMYA 2O2SA 1DINA 1K2VN 2BEVA 1T0JB 1Q44A 1P80A 1VE5A 2P2DA 1NW8A 4K9QA 4XPIB 2J09A 1KY3A 3F3SA 5M29A 3FYTA 1EFCA 1Y5NA 1D4FA 5DHPA 5PNTA 4GOND 2IFTA 1UKZA 2C77A 1Y3CE 2V8BA 5CURA 3MB5A 3NATA 4GMGA 1M6VB 5IAGA 3DBOB 3SZGA 5CYOA 1RAEA 3AEKA 3WP0A 4WPGA 2WJPA 4IICA 3G7NA 3CX7A 4QE3A 4I1RA 2OCLA 2E4AA 3HL0A 3G68A 1JWLA 3MYRA 1GSHA 4AP5A 2IGTA 2GCGA 3EXIB 2AMVA 4YT4A 1CTQA 1U8AA 3T06B 1L5NA 3PDJA 3NHBA 1QIDA 1E79A 3GN1A 3G2KA 1M7HA 1EJ0A 2WKQA 4FFRA 4XWYA 4TXMA 1L8LA 2YRFA 3FRJA 1QRDA 3A9UA 5A9SA 5L3SA 3VR1A 2XSZA 4C0HA 1QF6A 3K30A 3QVUA 4KNWA 3NAZA 2YXPX 4EA9A 4TVSA 4EHLA 4KLRA 4KI0A 3CC2B 1E7RA 2Q8NA 5L9AA 1R9NA 1G55A 1LW6E 1V8FA 3CA8A 1CUDA 2QGZA 2R6GA 4I4CA 5HS6A 1I36A 3OKAA 3A3KA 1K6IA 3QHQA 4GQIA 4MARA 5GTDA 1I7QB 1Q5PA 1TUGA 5LQMA 4JSRA 3BCDA 1YQXA 4CM1A 1ZJWA 4ZCSA 1G6OA 3C45A 3TLKA 3UAGA 4INPA 5KYKA 4CEHA 1GPJA 3E53A 1EFLA 2FCAA 1T36A 2QX7A 1Q22A 3LBYA 4WJZA 3RAJA 4KQ6A 1X15A 1JBKA 2W71A 1QCCA 3IS3A 1E5DA 1KQFA 1ADJA 1V96A 4XDGA 2QMQA 3BRWD 5DLQC 2XYGA 1R66A 1E61A 3GD5A 3SZLA 4QLBA 1ZUNB 3EAQA 5ALZA 4Z0NA 5FPQA 5G41A 5BN5A 3M6MD 1AMNA 4UMDA 1JZTA 3H1GA 1U5BB 3R2JA 5EJ9A 2QTFA 2FXIA 4YXWD 5JASA 3HNRA 1X7ZB 4QOGA 2JATA 4DDTA 4NBSA 3L06A 4LSZA 1FFXB 1QPBA 2BGUA 4LQLA 5DK4A 2I3ZA 2I2DA 1ACJA 2BFDB 1J0DA 3PQFA 3KQTA 3DOUA 4N0DA 5J4VA 5ALYA 1ZVMA 2R7KA 2IYUA 4V2IA 5E6RA 3TSYA 3WLEA 5AVSA 1B6TA 1DAGA 3ZQUA 1DTWA 1JTEA 4ENWA 4EW3A 1Z29A 2ZG6A 1KO1A 1U0LA 2GJ8A 3EEBA 2O5VA 3QE0A 4EJ6A 3LKDA 1FTSA 1PHRA 3VC2A 1XU4A 4JKOA 1GFZA 3PLRA 2IDZA 4KLZA 3EEIA 2R62A 5ABPA 3I4LA 4ZCMA 1DRJA 2RHBA 3EW9A 3NV7A 5ESDA 1RBYA 3ZLBA 2ZRKA 1NRWA 1T5LA 2FB9A 4OHVA 4R54A 3BF8A 4YPVA 1W0JD 3A27A 3ZDFA 4IUDS 4OD0A 3V48A 1ZRNA 4GX2A 5B1YA 4M87A 2BI4A 1U1GA 3OZWA 4UJ5A 4D74A 4TKUA 1P61B 3A2KA 3FBTA 3A1PA 4GZ6A 4MW7A 1XMVA 1HETA 4YVFA 4D8WA 1QHXA 5A4DA 3OOEA 3HN2A 2BBSA 4R5MA 1U1DA 2EW8A 4MUGA 3RS7A 4LVNA 2WZPP 3R20A 2BHNA 1QVRA 3EWAA 3WGJA 4F8JA 3PFIA 4DB2A 2XA2A 3VNBA 4V3CA 1ODFA 3NJ8A 3KYCB 3M6UA 4YMWA 4YAGA 2XKJE 3ABRB 4B3XA 4EIWA 1NUAA 2ERCA 3I83A 3ZY4A 4DEVA 3OKXA 2ZWAA 4OK5A 4ZYLA 2YVKA 1O94D 2WFZA 3N3BC 1B6RA 3L8EA 3D2AA 3P52A 1ZIXA 4KFRA 1XDZA 1DT3A 2GEBA 4R8RA 1WV0A 4Q9KA 2C1XA 3AEXA 5F98A 4O08A 2PVCA 3NKLA 5ED4A 1N7HA 1E2NA 3JQAD 2I8AA 3FA2A 4QVIA 1N7JA 4EG0A 3C14C 4CM9A 4ZDWA 1Z36A 3UWMA 5FLXA 4U0JA 1ORVA 1QH1B 5DM0A 1EWYA 5THQA 3ZWAA 2MHCA 2HT6A 1XAGA 3KLNA 4QUHA 4NYIQ 1JL3A 1GKLA 4W63A 3SS9X 4QGSA 4XLEA 1WMDA 5L4NA 1EWVA 2AJCA 2J41A 1A04A 2B6NA 3KOWA 3WA7A 2QRMA 3O2SB 3WY9A 1O87A 5DXJA 3LNNA 3BJMA 1FUEA 1VTKA 2YFYA 3MXOA 3JASA 4RAQA 1LJUA 1NOKA 3IEUA 2A84A 3AHHA 3PPWA 4OFBA 4DA6A 3U9TA 3AR7A 1XLVA 1SU8A 3UV6A 4Q4HB 4IDBA 3G5MA 3LVQE 1XKQA 1U7PA 5JADA 1YOVB 2X5KO 1CZOA 1LU9A 1UFVA 1NJFA 2EW2A 5KKAA 4EHHA 1MIHA 3V46A 4YR9A 1XQVA 1MIOA 3DTTA 4EL5A 2EXXA 5AW3A 1X1DA 1F51E 2WVAA 1WZIA 1E18A 2PO5A 2PGDA 4C4SA 5K0BA 3FDXA 4HQKA 3CVVA 1W2HA 1JJIA 1ICEA 2FWIA 1J5XA 4GXRA 2CB0A 1IZ0A 1Z5ZA 1AKRA 4CCSA 1E98A 5LVAA 4LHVA 3QH4A 1HDRA 4P31A 3U4HA 1K2WA 2FQQA 2IWHA 3GRAA 3VU9B 3IPLA 3DCJA 2HQ1A 4N12A 5B3LA 4XWKA 4OATA 1KOGA 3P0RA 2Y1CA 2RGYA 1CHDA 2Z58A 3W9BA 1A7UA 3MWEA 4UKDA 1EX9A 1PGOA 5CH3A 1N9GB 4RF2A 2HBQA 2ZJ0A 1UBJS 3FY4A 3DDOA 3N2ZB 4Q4JA 3T7SA 3AEQA 1J25A 1E66A 4OJQA 3E58A 3EXHB 3EC2A 1OI4A 1Y6GA 5DTEA 4H0NA 2LPMA 1G59A 3WP1B 2DZDA 3ZWVA 1GN8A 2BP7B 1TYAE 4H7IA 4CM9D 5A4JA 5AW4A 4XQFA 3FPBA 3LUCA 3OFND 4JLVA 1IOLA 3NHAA 4XUGB 5DNDA 4HAUA 4NCNA 1GPH1 1SZJG 2VTVA 3KE8A 4UUOA 5AI4A 5IKMA 1VRVA 3JQQA 2FR8C 1HO3A 1QGUB 3PQEA 2IOFK 3EW7A 2RG7A 3O4FA 1HQCA 1Y0BA 4N3GA 2J3DA 3P9NA 3GPIA 3VU0A 5J2TB 4L0MA 5E6UB 1FLVA 1U7UA 1G7TA 1E7SA 1XZHA 2BJWA 1H42A 3IMKA 1BO6A 1M67A 3OM1A 3P0FA 4PPQA 4F9TA 5CVTA 1Q0QA 5JWRA 1WZCA 3R3HA 2D13A 4OHPA 1Q7EA 3PQ6A 3A1WA 1L6IA 4LE0A 3T0IA 1U1FA 3S8YA 1I0IA 1RHJA 3E2PA 2XDQA 1XDDA 3BHMA 3DOIA 4JSYA 2I62A 4PLZA 4B6RA 1BDHA 1E2KA 4K3UA 2YN0A 1GLVA 3QVMA 1FUUA 1BWRA 3MPUA 1UD5A 4D4LA 2WUGA 2WSSA 3HYSA 5BV8A 2BVNA 1PQPA 1T1JA 3HGQA 4HVTA 4G5FA 1FSZA 3SLDA 3TL2A 4COOA 1QKJA 4C2TA 2RK4A 4XUCA 4KDFA 1XPUA 1HG0A 1C7JA 3MIZA 3HCWA 2A5FA 4P81A 2F59A 4QPPA 2CNLA 4E5NA 3ZDBA 3DBHB 1W5EA 1YDHA 1YS6A 2Q3BA 1T9AA 3LYAA 1TECE 3CW9A 3E15A 3EGWA 1DJLA 4N5DA 5DHSA 2RBGA 4OBBA 1WBJB 4RIIA 3LF2A 4AS2A 1QH8B 3KOZA 1O57A 1E77A 3SC2B 1H05A 3HCEA 4IEFB 1QGED 4BLOA 1H5UA 3AOEA 3TLCA 4A3SA 4IF6A 2B21A 3RJ5A 3ZV5A 3OQMA 5J35A 4YO8A 5GAJA 5TPZA 1R4MA 1W4ZA 2Q8QA 5D2CA 5CNJA 2BFCB 3CGGA 5WRFA 4HTAA 4GGMX 1D2EA 4KIGA 5HBRA 3D3WA 3V7UA 2R8XA 1BS1A 3QXJA 1I1QB 5JEDA 3OAAA 1XG5A 4JIMA 2GN9A 3AKYA 3CHYA 3PEYA 4ZAYA 4LIPD 2X6QA 4L7VA 1QO7A 5FPHA 1P74A 3NJRA 1SCJA 2QMEA 1PLKA 5L45A 2OXTA 4C05A 4JBGA 3WMWA 1HEUA 2FFBA 5JALA 4CDNA 1MORA 4I08A 3OBBA 1ZJZA 4Q03A 1LPMA 3UUGA 4AO6A 4ENUA 5HZBA 4PYQA 5TARA 5GINE 3IEMA 2Q4RA 2OHOA 4JLBA 4PABA 2F1OA 2IF2A 2HWKA 3GEHA 1EH5A 4U8GA 2GWHA 1WS6A 4N8DA 5IWCA 2OD9A 3A3OA 3V4ZA 1QTNA 5KJEA 4DCCA 4LRUA 3PD7A 4F97A 1XMPA 1LFAA 2XQFA 5A89A 2YHBA 1CQIA 1QKKA 3KT0A 3L1VA 1TRHA 2X9GA 3L6UA 4RK0A 5DNUA 4PNEA 4Z6KA 2EKPA 1N36B 3PC6A 1Q81D 1ZM3A 1C4KA 1GVNB 4V0NA 3C2QA 2CHUA 4UQPA 2GN4A 3H9BA 3KEQA 3MHPA 2PT9A 1QV7A 1N2JA 1I2CA 4OM7A 2IV3A 1DIHA 1MDFA 5F1YA 2V0NA 5TT1A 5CD1A 1H1LB 3IQDB 1Z28A 4FEAA 3TI7A 3V4SA 3FUVA 5KDDA 1LPNA 2VDJA 2ZIEA 1CP2A 1CQWA 1C9KA 4ZYXA 4FNOA 1IAVA 2YWBA 3SAJA 4CPDA 1BDIA 1PZEA 5JYDA 1C0KA 3NV9A 2QL7A 1ZN9A 3B1JA 2GPWA 1RAHA 2QRKA 1AZSC 1NB0A 1THGA 3CW2A 4M1SA 4N0EA 1S8OA 3T41A 1H8ED 1MB9A 4HLDA 2WKPA 2LBPA 1ZCBA 1TCAA 2H92A 2NYRA 2GEDA 3EVZA 3GU3A 5EKDA 2F9MA 4BGIA 4ZYWA 4KQ9A 3V3KA 1GV1A 1ZK4A 1A2QA 3BIXA 1WSDA 3H5WA 3KNZA 3VO8A 2OAP1 1O6FA 2GBCA 2JGFA 3M6AA 1KVTA 2J1LA 4MWDA 4HBZA 4QQRA 4N6GA 1EQAA 3WO1A 4H6XA 3RNLA 3RVRA 3WGUA 3RUHA 1EQUA 3IT2A 3QVKA 4F0JA 4JI7B 2WVJA 4ARBA 1JV2B 3SVLA 4TLAA 2MWMA 4YREA 2JKZA 2HM7A 3O4RA 1MABB 3SG0A 1W9XA 4P0PB 4YRAA 2GX6A 1ODKA 4X94A 3DLIA 5DVZA 4F85A 2GILA 5IF9A 3EDYA 2WF8A 1TI7A 3PA8A 2FPPB 5BSRA 1VHWA 1C41A 3R5HA 5IT5A 5IK2D 1Z7GA 4HAXA 1VJDA 5AQEA 3EYWA 4LX0A 2ZVPX 1UADA 1RCUA 4WCDA 3PHCA 1MFPA 3OF3A 3OEED 2EJBA 4BLUA 1ORWA 3W3AD 4C3VA 3QKRA 1LQTA 3ASYA 3DO5A 2ZBPA 2VUHB 4DNFA 3BY1A 4KIJA 1K9MD 1MG5A 3CB4A 2P4SA 1UF9A 4FGLA 4B35A 5LKAA 4C43A 4MR8A 1W5SA 4TWRA 1Z4PX 2WIKA 3ROPA 1UD3A 2G1PA 4QQFA 8AT1A 3DEKA 4CWAA 3GVPA 2PKXA 3C87A 1YB5A 3WYEA 2PZMA 4DLXA 5E9JA 2XZTA 4K1LA 1T36B 4WGGA 4YJ3B 4NBKA 3S81A 5EPEA 2VZ0A 5GGYA 5ESXA 5LMZA 1RTKA 2ONKA 1TAHA 4MVJH 2NUAB 1Y7PA 2AT1A 5A05A 1FB5A 3BMCA 5JD4A 3C8UA 1A9XA 4MV3A 5EJIA 1PJLA 2AZ4A 3NI2A 4KQHA 5FADA 3PZBA 3TCNA 1WMEA 3EC7A 1R8XA 2OZLA 3V4RA 3QXXA 4MB0A 3ZC3A 3U3KA 1IZ7A 1L4HA 2GLXA 1U5BA 2NZJA 4KQ2A 4ACBA 1Z25A 4Q7KA 1U0RA 4XGRA 3ZVKA 5BN1A 1MC5A 3HXLA 1KPGA 1Z4QA 3LQ2A 4LY9A 1EM8B 4BO7A 1CDEA 1UOPA 1WB6A 1MAAA 1AMUA 4CXMA 1X42A 3KWMA 3UK6A 1QAQA 1KWGA 4W9NA 4GVLA 2WOJA 4UAGA 2VT2A 5I8WA 1HNWB 1JFLA 2IPMA 3UA4A 4IIYA 2AGVA 2Q7OE 3WK6A 2ZSKA 2XVXA 2GK4A 4HATA 3OWXA 2IJGX 4IDGA 4V1CB 1U2PA 5JI3E 5CDTA 3ZE7A 1YMQA 5D3MB 5C8ZA 1SA0B 1NVMB 1RHQA 5KTNA 3AFHA 3TSAA 3UV3A 3JQBA 1Q2XA 3GRKA 1A8QA 5JARA 3I53A 5LJLA 5E1BA 4P12A 2H9IA 2QRLA 2C20A 3NIFB 1N6HA 1YI8A 3PNKA 4XR6A 5EJ4A 2GXAA 2VT7A 3H4TA 4UBJA 4QNMA 4IIDA 5JZSA 5IM5A 1L5KA 1BE8A 2BGJA 2ZANA 3OMWA 1U3CA 1FDVA 1MXFA 3AG6A 5THKA 3AONB 3E05A 2LKDA 4EGAA 1KK3A 4CT5A 1FEZA 1GT6A 2DLDA 3ZJTA 1CP3A 4FFLA 3WLPA 3B1FA 1WUYA 4IDFA 1NBAA 5BVGB 4H27A 2GM9A 4U63A 2C5LA 4RZSA 4DHWA 2OXEA 4EOGA 2D54A 3IE0A 2ASVA 3HK2A 1DARA 3ONYA 2IY7A 1WIWA 3CN9A 421PA 4R1UA 2UZ4A 3B60A 3RW9A 3I62A 1N2CB 1OZ0A 5JSZB 3I5YA 3USZA 4MYHA 2B4RO 2P3LA 4WESB 2OQVA 2XHZA 3Q7SA 4UUAA 1ODIA 1RJDA 3KXPA 4PAWA 4UOEA 5I4BA 3BF7A 3UIEA 4TMKA 1NDHA 1C7QA 2WT8A 1NJGA 3PHLA 3WWPA 1E59A 3RQIA 3HRIA 4C7XA 6CHYA 1QG2A 3JYOA 4ZTBA 5LQUA 3BH7A 1WOSA 2E18A 2C4UA 5BO5A 4A6EA 1ULBA 2CDAA 3AF1A 3WXBA 1ULAA 2J48A 3I09A 4BUJA 3AIOA 3IRVA 4OI2A 2HC9A 3TEFA 4BMYA 4D0SA 1HNNA 4R9UC 3AM3A 4M46A 3CZ4A 5I01A 1WQ3A 4NK5A 2IU0A 3CVUA 2ID7A 1ZHHA 2WZCA 3T7TA 2O05A 1MW8X 3PENA 3L49A 3INTA 1HOXA 4UD2A 1JHRA 3DZJA 1QXSA 2DAPA 3EQ6A 2Z08A 3I9KA 1FTNA 1YC5A 4GQAA 4I36A 4L57A 4P54A 2ZYWX 1OXSC 3L7DA 1KY2A 2HNKA 4PU0A 1QTQA 3S4YA 1F4PA 3W2IA 2A78A 3L02A 3PR3A 1KGSA 5JD6A 1JHVA 3ZN2A 1KZLA 1GAEO 4CLOA 1GG2A 3ZGNA 3UEOA 4AAYA 3K1AA 4Q4HA 1D3AA 3CSSA 4WOPA 1EQ2A 1RIIA 1TF5A 3A8TA 3GZNB 3UMRA 2HAEA 4UDXX 1PR3A 4AB1A 2O2CA 3FTNA 4MDHA 2EWWA 4WIAA 3T3HA 4LBZA 1TE2A 1N08A 1L5VA 2PBRA 3PHIA 3PXBA 4ZVLA 5BSGA 7ADHA 3Q10A 1VLMA 3P2MA 4J1NA 4GM1A 4U7PB 2DMRA 1H66A 2ZRBA 5FWDA 4ZDIA 1Q7RA 3D2CA 4ZVMA 2XMQA 2AHOA 3S7TA 1H6AA 2EOAA 2NPOA 3IVMA 3SF8A 4BWFB 2VDQB 5L7WA 3D5EA 2JF0A 1UOQA 1VPTA 2JH9A 3A9SA 2GK3A 4HGOA 3HUUA 4RKFA 4ZZ2A 2RCNA 5LOVF 1BHQ1 2NQTA 2A9FA 2QPTA 1XNJA 5DI3A 1PJTA 5BORA 2AVDA 1P1RA 3PVCA 2IZ6A 2PZFA 4HN4B 2BI8A 1NMSA 2YYZA 3GLGB 4TMWA 3NCHA 2EFGA 2QA4B 3AEQB 3W9YA 1TJPB 2CCKA 5FLYA 4CL0A 1TNDA 1UM9B 2HV9A 4KGDA 2XNHA 1KIMA 3IHKA 1K8AD 5KSPA 3VPAA 4GL4A 3HDVA 3TGPA 2CCJA 4NG5A 2ZB8A 4JC4A 2XVYA 5KYYA 4W9MC 3CJTA 2IDJA 1I1HA 1H0SA 4BV9A 1OYOA 2H4XA 4HDNA 1K6JA 3FJOA 1NQUA 3CRVA 2ZITA 3CWCA 2PZBA 3GGOA 1TTHA 5J5VA 2H1IA 3LWDA 4IDCA 4RDIA 3RWBA 2HCJB 4QHYA 3BGWA 2I4OA 3M89A 5C7OO 3FGNA 1YR1A 1WDWB 3BC1A 1D2RA 4JP1A 3BRWA 2OK7A 5FV7A 3TN7A 1G4HA 3ABZA 2JCYA 3UNXA 5BWLA 1TYDE 2FTKE 2AHRA 1SWVA 4UTVA 3BORA 4MIKA 1PSDA 3CVOA 1Z6ZA 4G89A 4MTCA 4M0DA 4DWJA 2B9VA 1CB7A 1T43A 1VMDA 3L8GA 3O5AA 4YJ2A 5K09A 4HB4A 1UEIA 3KTOA 5L40A 2HBZA 2X86A 1F0PA 4FUQA 4X95A 1DRWA 1FU8A 1Q20A 3RRJA 3IP8A 4NZNA 5CB4A 1I2MA 4Q3NA 1I51A 2CHEA 2HHCA 3IAS6 3QVVA 4L8WB 3P0HA 4LGCA 4N47A 1RRFA 4XOUA 4N3AA 4J0GA 4TL8A 5G02A 1SH7A 3GPDG 1G5HA 4I9UA 3HB9A 2XCQA 3DBHA 2E4YA 2Q6IA 1J0AA 3NTLA 1LQ2A 4TMFA 5CVCA 3EPHA 1RAAA 2WT4A 4EF4A 4R3WA 3WLLA 7REQA 1K73D 2GO7A 4EG5A 2XA1A 1FDIA 4RZIA 3WV4A 4S1VA 1P5ZB 2C31A 3BXHA 1E0JA 4HMQA 5IT4A 2C58A 1P0IA 4W7IA 2NU7A 5SICE 2G25A 4XGIA 3W6NA 1R4MB 3F90A 5ERGB 3A1UA 5F73A 1Y3DE 3VNRA 1N2EA 2LP4Y 2DF8A 3LQQA 3DEFA 5IAAA 4DIKA 4BNFA 5JBIA 1EAMA 1VE7A 1VKNA 2AJDA 3P9YA 4NV0A 1OAOA 2CLSA 3L8YA 1GAXA 1E3TA 1KJQA 5K8IA 2D7JA 2N42A 221PA 4EJSB 4RDXA 5L7YA 3PX3A 1UBMS 3GVLA 4LYDA 4MDEA 2XECA 3FVWA 1B7GO 4IX9A 4WNAB 3SKVA 1W25A 1JLMA 1MT3A 5JNVA 3TQQA 2VNHA 13PKA 2YWHA 3R23A 5CGQB 4Z4TA 1M2OA 3DO6A 2PRJA 3F0TA 3WSTA 3VPSA 3ZYCA 3IELA 4DZRA 2D0PB 1PJSA 5TMEA 1R1DA 4BECA 3IUPA 4X5OA 3O47A 4B0PA 2R6DA 5JI2E 2BMEA 1R0WA 2AIRA 3DMYA 1GAWA 2QZSA 4OHXA 5KCMA 2C84A 4OU5A 3VH2A 4DLLA 3M0EA 1OXXK 3N1UA 2ZYHA 4AKSA 4EW2A 5K1ZA 1XF9A 3E3LA 3LT2A 3QEMB 3B2QA 3OF2A 1E6WA 2X4IA 2XXBA 3CF2A 3CCMB 3I58A 1KIFA 3QEJA 3QRWA 5HE9A 2QZJA 4CI9A 2CYAA 3MD0A 2AXNA 3LPLA 4Q1DA 2BDTA 2V5AA 3KB2A 1H2AS 4MCJA 4R31A 2O20A 1JHAA 1A7JA 3QHPA 3VYSB 1QQ7A 3FRHA 2NNLD 1M9NA 2WMNB 3DDUA 3W5JA 1NWHA 1W1UA 3J7TA 1YS2X 1NQ5A 2YDXA 3AYXB 4GZ3A 4UVEA 1P1JA 3KE9A 1WZEA 1CR6A 4LV5B 4PIPA 1ZWLA 1R4ZA 1GU0A 5DRYA 3SJAA 3VISA 1USGA 4DQDA 1TD1A 3UPTA 1AKVA 1BDMA 2Q5QA 4E5SA 1SKMA 1YITB 1BE1A 3ME5A 1YOBA 3VM6A 4UOQA 1C8LA 4NNOA 4W5HA 1VI2A 3M7IA 3RS3A 4PWZA 4BZXA 4RVDA 4L85A 3WQZA 2FUCA 2HDOA 2YJ6A 3CLUC 2NU9A 4I8DA 1JQJC 2FG5A 2O7NA 3BE8A 4G07A 2G76A 5DWVA 2H51A 4PW0A 5E9AA 5JYEA 2O8BB 1M1NB 4BP3A 3R0IA 1XU7A 3DMNA 4BKRA 5JECA 5JZ9A 2YZ2A 4IDDA 1IUOA 1K9SA 2YHIA 3IPXA 1SVKA 4JB3A 5AICA 1IWBB 3PPVA 2P0YA 3HU1A 4UUPA 4CMEA 1QANA 3CSUA 4YCCA 1PYOA 1JR3E 4P7GA 4ALJA 5KNCH 4OQDA 1E1DA 3VO9A 2Q1UA 3ZHOA 3JQFA 3B6KA 1YBVA 3QKRB 2GI4A 4DR2B 1DXOA 4QOSA 3R9XA 3LKVA 1U04A 2CFOA 4QNNA 2F8MA 4A0HA 3OCZA 5EXSA 2IH2A 3MTGA 4YMGA 4K7JA 5G0VA 3FFWA 4P86A 1R0BA 1T2DA 5H4HA 3F78A 4PHCA 5DP1A 1ZHOA 2W2OA 4J0KA 1IY8A 3IP5A 2JFXA 3ZKAA 2VG8A 1OV4A 2FQYA 3B52X 3KJEA 3W6PA 2P9BA 1UMDB 2VJLA 4I4IA 1DQNA 2VCEA 1VHTA 3AB8A 3WLFA 2UUCB 1E2DA 5CIWA 1ZX1A 3W5HA 3NBUA 2UYQA 2RCYA 4IW3B 2BMAA 1G2PA 3MD9A 1RM3A 3NS7A 4B4WA 5AVTA 3IEIA 1TCUA 3KVOA 4M8KA 2OQ2A 1LC3A 1FYEA 2ACKA 3HYCA 1M1XB 1QYCA 3BGVA 3H17A 3IMCA 3PGVA 4QDOA 4AY3A 4CLEA 2XB6A 2FN8A 5BURA 4QDUA 3T1VA 5ER9A 4N5HX 2HSDA 2PMCA 1KYQA 2JGNA 3ZUPA 2XDAA 3GPCA 4JBWA 4Q9LA 4Y2GA 4B2LA 5FI3A 1F8FA 2A9PA 4OREX 3L7IA 3H42B 3MGAA 4JMLA 5AK3A 3MOSA 1ZGJA 1NR1A 1RWVA 3B6ZA 4INOA 2RJ3A 1ZUHA 2WPNA 3ESAA 4QLAA 3RRBA 4BTEA 3MAAC 3L6CA 4JT2A 1EG2A 2CNKA 2OFFA 3EMVA 3T0FA 3QUSA 5JCPA 3AEUB 3QPWA 1ISFA 4QBFA 2P90A 3B1YA 4KVZA 4CDGA 5JY6A 1N1EA 2W6MA 4HNGA 3COSA 3P9QA 3IAM6 3FHLA 2JLYA 4WGFA 2D1YA 4I3HA 5CM2Z 4A8HA 4HN9A 1R0ZA 3H1FA 5H82A 1KQSB 3N2GA 5BQOA 4PAQA 3IE1A 1QO0D 5DEOA 5LWQA 4HPJB 3TNFA 2IS1A 3Q41A 4QA9A 1DG1G 2KBFA 4C4YA 2WIGA 4NYJQ 4RDHA 3HI4A 3U17A 3DE6X 4GBJA 1Z7EA 2I54A 3GDOA 3OWHA 1JG7A 2MYUA 2V74B 3AJAA 3K9QO 3WV5A 1L7QA 3ICPA 1JQKA 3N58A 4L95C 5CH5A 1AKEA 1WPXA 2HMYB 4NMXB 4RACA 5IS2A 2JLXA 3EEYA 5JH7B 3TJRA 5JMOA 4M9XA 3BM5A 2FDXA 2P9CA 1VHDA 1PAUA 4W99A 2Q62A 3TGWA 5AW8A 4R40A 5BSXA 5J63A 1OTXA 3JAKB 5IUJC 4DQLA 1UMBA 1WU8A 4IXDA 1UBLS 2XBMA 1N2CA 1BG6A 3OIFA 1E2QA 1A8HA 3JSXA 1D8TA 1N5DA 1T4DA 1NBEA 4WESA 2NTEA 1G3UA 2GJ9A 1IXYA 4H9GA 4KMSA 4Z86A 2PLAA 1E2FA 4CUZA 2NO9A 3FKJA 1M3SA 4BLWA 4EBFA 2QG4A 4QUGA 3VOTA 4DWWA 3PXXA 5TGDA 1ZU5A 2RB5A 4I9HA 2VQ3A 2Z2JA 4I1YA 4ZT4A 1WOPA 1QGYA 2DR3A 3FNGA 3Q1LA 2QLNA 3I05A 4WAUA 5CEJA 2VP3A 1EGVB 3UFXB 2J67A 3FMPB 3F71A 5AT1A 5L6MB 1PF7E 1O6BA 1A4IA 1KSHA 4FKBA 1JRLA 1KH1A 2OXFA 4PFSA 2BMJA 3FUWA 3ONNA 3MTJA 4D0RA 2AW3A 4LBVA 4DRZA 1O0BA 3JD2A 3CCSB 1HYQA 2LCIA 4RHTA 1B26A 1MA0A 1A3CA 1ZJ5A 4WEQA 3G0DA 4F38A 1KPIA 2J0VA 4EHAA 2LKCA 3PQ5A 4JN6B 3KV1A 1GU7A 1I80A 1U99A 4FR2A 4M0PA 4QPDA 5E8JA 4AMBA 4BLRA 2Z30A 5HZKA 3U4IA 2V9PA 3HE3A 4L9WA 2QV7A 4HNUA 5B6JA 2QRUA 2ZIAA 5FAKA 1EMDA 5KNBA 4Y1FA 1V3VA 2PKYX 5F77A 4WZAE 1T1IA 4AWBA 1CUZA 2HXSA 2K4MA 5I9SA 3C8MA 5TPWB 2ZL7A 3CUVA 2OCYC 4MOWA 3TSOA 3JQBC 4C1BA 4YV7A 3OT1B 1Z7YA 3RVOA 1XE3A 1JILA 3K5PA 4WSOA 2I1LA 3FPSA 5KNDH 3EDRA 4MIOA 1KC1A 2A9RA 1XK6A 4ZKEA 5FUMA 1CS4C 3BAFA 1PT6A 3OUZA 3TKAA 1WW2A 2GNPA 2CSXA 4GT1A 5JFTA 1NW9B 4NQRA 5EXEA 2YMQA 3L82B 4RD2A 3GLGA 4CQNA 3GHYA 3PICA 2CF6A 3MC1A 4YMIA 3ZLUA 4IEEA 1P3DA 1QRAA 1Y8QA 3MTDA 4RJKA 4CTKA 1N0UA 1HF3A 5KYNA 2C5SA 3V9AA 1PK7A 1ZD8A 4R05A 1SOAA 2RAPA 4HLNA 4XTRA 1VGRA 3LDAA 1EBBA 3R7FA 5EUQB 4RL6A 2G3YA 3BX1A 5LQRA 3RF7A 3EXFA 1O97D 1CBUA 2DUMA 3GFFA 1TAQA 4KB5A 1RJGA 2ZRAA 4GVXA 3UPUA 5KQMA 5KTPA 3L9WA 4LC0A 3ZWPA 1IXSB 1OVMA 4B76A 2DFPA 2F48A 4KFTA 4ZO9A 4OKSA 3VPDA 2H4ZA 2J0UA 1JG3A 2NU6B 2X7XA 2KSQA 4J7AA 1R0KA 2GJAA 4KQFA 2WJVA 1EG7A 1WCXA 1X0VA 2ANBA 4MI1A 4MKHA 1GZ5A 5EMKA 4OH7A 3E9MA 3CCFA 3LLVA 1HSOA 5CPBA 2WHPA 4FSDA 4YDRA 1QYXA 4O2BB 5E3HA 2VXBA 3VJKA 1NNUA 2B8EA 3PNMA 5AYVA 1OILA 4OXXA 4R2XA 1U3TA 4PZEA 4HT3B 3OZGA 5LZ4A 1QK3A 5C1OA 3L7CA 4OMFG 2XOEA 3AM1A 2C5AA 3JD3A 1FCJA 1VJCA 2GFHA 2IYYA 2RHDA 3PYLA 5HF6A 4TX1A 5CB4B 4J0FA 4PRZA 1Q0LA 2FUG1 2ZBDA 1JYSA 3S2EA 3O4GA 3I9FA 1FQOA 4MS1B 4F12A 3NWOA 2WF6A 2AYXA 5FDFA 4NESA 1VBNA 3UOAB 4IYRA 2PPLA 2XQJA 3DJFA 4L4UA 3T35A 4EYSA 3A37A 1KI9A 3M49A 2WF7A 5ALHA 5CA0A 4EB8A 2FH5B 1OLXB 1PDWA 1MMFB 2CXSA 4OXYA 5T6MA 1I4TD 7REQB 1ZD9A 4PGOA 3OQ6A 5FR1A 1VGQA 1MJGM 2EGUA 4X06A 3CEHA 3TIGA 5FOQA 5KTKA 2VCHA 4KAJA 5ALGA 2O2XA 3DF9A 4II3A 3L1HA 2NU7B 3O6VA 4WVFA 2H5LA 5CCXA 3GFGA 3IB6A 2G5PA 5LM3A 4WUVA 4B3DA 1XL0A 1I13A 2M9MA 2IZ0A 2JLWA 4B3CA 4ARCA 3OU7A 4PYLA 1A9PA 3U1VA 2HY7A 1TYZA 4C7OA 1OBFO 5K5EA 1AE1A 3QE3A 1NV8A 4K6CA 3BERA 5EXTA 4RLZA 3AFMA 2P3MA 2C4KA 3CNHA 4I55B 4L3VA 3TSZA 4EUSA 4IXNA 4KUGA 4IJUA 4EJSA 2BDUA 5FBVB 1YZ3A 3H5LA 4GOKA 4WK0B 2J3EA 1CEXA 1I2AA 1M54A 3EH2A 3OVMA 4O2AB 2ZBUA 2Q3EA 4N5MA 3S29A 4AW9A 5K01A 4ZI2A 1CF4A 2X85A 5BOVA 1KAQA 3JZDA 3M6WA 1YSCA 1P75A 4A2PA 5IEJA 4BMNA 1I3MA 4MWEA 2W7TA 2GM5A 3M8KA 3PC2A 2WJZB 1SXJB 4FWBA 4HF7A 5IYZF 5T4EA 3VPFA 1GFWA 1U8CB 1KNXA 2VSQA 3GC6A 1G5TA 2XGJA 2I6FA 1FY2A 3R6GA 4YP9A 3UJHA 3TF5A 5DOZA 2HU2A 5EMNA 1X14A 3ZCVA 4DTIA 1M1UA 2D1RA 3TQCA 3DHYA 5BQ3A 2CBXA 3BKWA 2FPIA 1BGXT 3NASA 3WIEA 4E70A 1J00A 1M8KA 4ZJYA 2WYUA 1PJRA 5HWSA 5FB3A 4HZUA 5DKFA 1AQYA 3OM9A 3TUIC 3FPCA 4LJ6A 5A4IS 5ITZB 3AY0A 1A5TA 3LHDA 1MFZA 1Z08A 2VRBA 4URWR 3A32A 3FPHA 3F98A 1PFYA 3VGJA 1M1YE 4XDYA 1VKJA 3Q6RA 4I50B 4P84A 1YKFA 4TYYA 3BL6A 2E6KA 2VSOA 3K0EA 5F5LA 3BBPA 5IANA 3ANYB 4ZFNA 2XE4A 4TTPA 3LWNA 4RJ2A 3U44B 1MX9A 5EMJA 3RLFA 1JW9B 1WU7A 2I4RA 3AM4A 3HP7A 1KO4A 2GAAA 1KD1D 2UZ0A 1QHFA 1ST2A 1GPDG 4D9EA 3HRKA 2FMIA 2L82A 1WKBA 2ZVJA 1TMKA 2WSLA 5CVJA 5K3OA 3DC7A 4BFYA 5K0CA 2Q6VA 1VLOA 1QJ4A 2WINI 5D3QA 2XNDD 1AB6A 1BOFA 3IE2A 4CM3A 4D7AA 1YAHA 3BCHA 5CVUA 2YICA 5D51S 5A0FA 2ZFUA 4DW8A 4MS3A 5B53A 3TLXA 4YRZA 4TT8A 2JGAA 2JD2A 4K40A 2X0DA 1U9IA 3CKKA 4RPLA 5DIFA 2EDAA 2PLWA 1QIKA 3I55B 3NBYC 3DOFA 1F5NA 1XQWA 3R7WB 3T9BA 4ENSA 2Q2QA 4IOJA 1LLFA 3FTQA 1I7SB 3KSUA 1UMCA 3K72B 2JK1A 1YTUA 3NJ4A 4X8HA 2BEJA 2FW6A 3K4QA 1P1FA 4D99A 2H5EA 2F9FA 4XVHA 4Y2XA 1GWNA 3GLSA 1A9TA 1C3LA 1RKUA 3PWSA 1V7PC 4E03A 2NGRA 1DQRA 3QFHA 3K53A 5COQA 5DCLA 4V0LA 4EG1A 1R12A 2ZRFA 3BSWA 1W6RA 5EZYB 5L4LA 4UTPA 2PIDA 4PO9A 4ME6A 2Q99A 3EZNA 4XWGA 2QYHA 1RHKA 2BF4A 1L4EA 2QRVB 4FQ5A 3RJTA 4R2WA 4X6UA 3ZHQA 3HZHA 3GVXA 2XUOA 2XYVA 4FUTA 5B12A 2IU4A 2WJJA 1U7XA 3DEYX 1KMCA 2J3LA 1GLNA 2ZRMA 4LJAA 4Q21A 3RUFA 1KEKA 2Z6UA 2NXWA 4Z1OA 2B1RA 4AMUA 4EFNA 4LRWA 4M0FA 5C52B 3BMNB 3L77A 1JHUA 4MYRA 3GLQA 4S24A 4Y98A 1LBTA 1AX9A 3FFXA 3A6KA 5CHYA 2IKSA 3CP2A 1BYUA 3NKFA 1REQB 3OPNA 2JGKA 4Z8XA 4DLVA 4ZU6X 2V6GA 5DNCA 4IDAA 1CIJA 3M9LA 5FO1A 1RYZA 2UVQA 4MAAA 1WSAA 2NUPB 1AK2A 2IY8A 5B58C 5IDQA 4UJ3A 5GGXA 4E2YA 3T1OA 3L41A 3RYHB 1C9YA 3M6IA 4XW2A 3N53A 1ZJYA 2R6ZA 5JSYA 3I92A 3MN1A 1XF1A 5JVDF 4JJZA 3EPKA 1YR8A 3OO1A 2CXNA 2B36A 3U3ZA 1C1HA 2G63A 3ZW7A 1L4UA 1T9CA 3AKZA 1WBDA 4BUZA 3VJRA 1N5JA 1BTOA 1VG0B 3RTAA 5KMGA 4CIYA 1KZ1A 1TT7A 3R41A 3A1SA 1PD1A 1X7GA 4I4TF 1O9GA 3KT3A 1CU1A 3VSBA 2QE7D 3KRTA 1EVIA 5KNDA 2WZQA 3HXQA 2B4YA 4WLFA 4MHSA 1KARA 3GJ5A 3DE1X 2APJA 3H6HA 5BQXA 4UFOA 4F71A 2JCVA 1E62A 5LN1A 4LJKA 4R16A 1PV4A 3U4GA 1UBSB 2Y1GA 3N9IA 2H8KA 3EZFA 4X85A 4ZWNA 3S1AB 3WWEA 1EHYA 3AOGA 3ADKA 4JITA 1BU5A 1WF6A 3ZZMA 1Q83A 3UV7A 2CNOA 4RVCA 2C9YA 2I4NA 5E1MA 3ROXA 3OQVA 3X3HA 2H16A 1HEYA 2R65A 4U1RA 2AC4A 3N8NA 4C21A 4RA9A 2ZU0C 3EPLA 5HS4A 5L3VA 1VQ5B 3JQ6A 1C81A 2VKQA 3MINA 5L46A 4F56A 3F8SA 2NLOA 2I34A 1R0CA 2A9JA 2FR0A 3ZU3A 3PWKA 2M6RA 2DHRA 3EPJA 4HAVA 4C4XA 1Y8RA 1NPTO 3ELDA 1O0SA 3GYGA 4FFMA 3H9CA 1KKUA 2Z04A 1FMLA 1G5IA 1GZ7A 4AX8A 1G1AA 1II8B 1VE1A 1C29B 1ZCFA 1GZ3A 1PE0A 1UOEA 1EWQA 3I4FA 2LCFA 5TQ0B 2PSHA 1EWTA 1YH3A 2NZ8A 2W90A 3A4YA 3BRSA 3JU3A 2VK8A 3LT4A 3QU2A 4J9VA 2BAGA 1AUQA 2C83A 4TXNA 1UKVY 3ONEA 3RFCA 1E2MA 5KJCA 3F74A 1N6OA 3FB1A 1XXLA 1SKQA 2Z2ZA 1VLLA 4KNVA 1HE5A 4U3JB 4V0RA 4RVNA 3VKVA 2IU3A 3MSCA 3RU3A 3EGCA 4C0SA 1EK2A 1FYFA 1RC0A 3QKSB 1MD9A 2X7HA 3GF4A 1J21A 2PGJA 4QEDA 1U80A 2A7XA 3UFXA 1HGXA 5FUQA 1PS0A 1IBRA 2OD7A 3G05A 3WX0A 4KN6A 1J9ZA 2CUKA 1JR3A 2Q4OA 1A4XA 4PQFA 4R1QA 4EKEA 5DRTA 1JMVA 1N3BA 4A0GA 4LY0A 3ZY2A 3BGDA 4Z4EA 3TXAA 5L7TA 1NVVR 5DDIP 5JW6A 3R5TA 3VKFA 1K63A 5B55A 2GREA 4JLAA 2FWAA 1E92A 2QPOA 2QTNA 4MIYA 4Q19A 5AJWA 5JATA 2XR1A 4CV2A 4X20B 3GJXC 1SURA 4RTKA 1EHCA 1RPAA 5C3MA 3HB1A 4DCGA 1QIJA 3KQUA 1JG6A 1EESA 2DQYA 4I46A 4BASA 2P2SA 2C7OA 2COKA 2QNIA 1Z5GA 4EI9A 4D42A 3LJKA 3JQ9C 4PC7A 2H48A 2ZJ5A 1U8XX 3I2GA 4FFSA 1PUXA 3H2SA 3EYAA 1B93A 5CA1A 1A8UA 5TV2A 3OTWA 3PFNA 2B98A 4X63A 3U7EB 5J23A 2P6RA 4FWIB 4PO1A 4EAAA 2O52A 3MEQA 4DLWA 1XZJA 4X66B 3ZZ0A 3EZXA 4NG4A 5AI0A 1JA9A 4HDRA 3M4YA 5KKNB 4JI1B 5JS1A 1NXSA 3A4NA 3F6SA 3K5HA 4MKZA 4RD3A 2EATA 3OLXA 2ZR8A 4BY9E 3Q5GA 3F6CA 2QMOA 4FOPA 4UU7A 4D6PA 4Q82A 1QYIA 1Q7TA 2FUKA 4JLNA 4KLNA 4M0LA 1T4BA 4U5QA 5EG5A 5MN4A 5ESRA 1IJBA 2N75A 3WAGA 4GP6A 2IUSA 1R5NA 1LNZA 3LD9A 2WU1A 4L2IA 4QTTB 4TTJA 4Z4CA 3IQXA 5IJ0B 1QRTA 3W6UA 1T2V