2VZLA

Ferredoxin-nadp reductase (mutations: t155g, a160t, l263p and y303s) complexed with nad by cocrystallization
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLAGGTGITPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADELWQLIKNQKTHTYICGPRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVETS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FERREDOXIN-NADP REDUCTASE
publication title Protein Motifs Involved in Coenzyme Interaction and Enzymatic Efficiency in Anabaena Ferredoxin-Nadp+ Reductase.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
total genus 90
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 2008-07-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2vzlA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 2vzlA02
1FNCA 4M0LA 4YAWA 4G5GA 1QGAA 2ZITA 3CCQB 1F20A 2B7CA 4YAFA 4N3NA 4B47A 4R71A 1QUFA 4ACAA 1W87A 2QMUA 1I7PA 4YALA 2QA4B 1EP3B 2VNIA 1TLLA 3ZBUA 3I1FA 1NJID 3LYUA 1YHQB 5KSWB 1DG1G 3CMAB 2PIAA 1VQ4B 1FRQA 3U6KA 3QSYA 1CNEA 3QFCA 4LBWA 4DQLA 3QE2A 2XEXA 4HE6A 4RD0A 3VNVA 4LBVA 3OJXA 3W2GA 2B7BA 3V76A 3CCVB 1TUIA 1YITB 1VQPB 1GR1A 4M2LA 3PENA 3W2FA 1KK3A 1KK1A 1GVHA 1VQKB 3CRZA 1GAQA 5H59A 5TR9A 1VQ7B 1H85A 3CW2A 5HXBA 2BMWA 2E1RA 3OZUA 1EP1B 1D2EA 1VQMB 3JQPA 4MYUA 5AN9A 3G71B 3ZZ0A 1BX1A 5JBQA 3WY9A 3CC7B 1OB5A 1KTVA 3MCAA 1QVGB 4P6VF 2NPFA 4PC1A 4TMTA 2BF4A 1JB9A 1TVCA 3A1FA 1QUEA 1EFUA 3CC4B 1D8TA 2EIXA 2RC5A 2XNCA 4MYTA 3LO8A 1R5BA 2BM1A 5H5JA 3W5VA 4B43A 3OZVA 1B2RA 4AC9A 1EFCA 3CC2B 4FWTA 1FDRA 4RJLA 1WDTA 4RD6A 4Y7CA 3CB4A 3CCLB 1HA3A 1DDGA 3LVBA 4F7DA 1ZM4A 3CD6B 1GJRA 1KRHA 2VZLA 1N8RD 4FN5A 4AF6A 4M53A 1VQNB 4RD2A 1J9ZA 1EWYA 2HCJB 5GV7A 2DY1A 1E64A 4J0QA 1GO2A 4FK8A 1QFJA 4C0SA 2OK8A 1ZUNB 2C77A 1QVFB 4RCYA 2QN6A 3ZZUA 2DETA 1FNDA 2CRVA 3W5UA 4WQMA 4TMZA 3JQRA 4ZCLA 4B48A 2DEUA 3OJWA 2BN4A 2HDNB 2EFGA 1TTTA 4TMVA 3CMEB 1KC8D 2YWGA 3J81k 4NBSA 1R5NA 3FJOA 4ACBA 4N3GA 5TY0A 3VMFA 1DDIA 4BPRA 2YWEA 1EP2B 4H9GA 4ZGNB 1DARA 2QTLA 2XNJA 1Q81D 3ZZTA 4ZCIA 1QGZA 3OW2B 1D1NA 1VQLB 3CCEB 3WNCA 1QH0A 1QFZA 3AVVA 1AIPA 1EFTA 3JQQA 3W2IA 1S72B 3AGQA 2VNJA 4B4DA 2BV3A 1Q7YD 4K1XA 3I55B 1NDHA 4TMXA 3U6BA 1KK0A 4PC7A 3AVXA 3AVYA 2BSAA 3WNDA 3I56B 1XE1A 1EXMA 3W2HA 4B3XA 3G4SB 2QDXA 1IB0A 4YHBA 1XB2A 4RCZA 3AVWA 1U2RA 4G1VA 3AGPA 5FA6A 4AF7A 1CNFA 1BQEA 2QTZA 2X3UA 1OB2A 3ZC3A 2OTJB 1ZM3A 1W34A 3VO2A 3AVTA 3MHPA 2YWFA 1IJFA 1OGIA 1KJZA 4RD1A 1K9MD 2AHOA 4PC2A 1ZM9A 4Y9RA 2BVNA 3WBKA 3CCUB 1BJKA 3VO1A 1AMOA 4IW3B 4QFMA 4DQKA 3W2EA 3CCSB 1B23P 3AVUA 1CQXA 1JNYA 3P27A 3WBJA 4LBYA 2B5OA 2GQFA 3CCMB 2QEXB 1JA1A 1KD1D 2GPJA 1ELOA 2D74A 3WXMA 2BPOA 1FRNA 4QHYA 1YJWB 2VNKA 4ZCMA 5EMNA 4TN1A 1YJ9B 4PC3A 1N0VC 3OZWA 2OK7A 3SJZA 1QG0A 1VQ9B 1VQ5B 4LC0A 1SM4A 1R5OA 3CPWB 3LRXA 3CCRB 4YAUA 1YJNB 1FNBA 1G7CA 5DSZA 4EH1A 1JA0A 1G7TA 2BGJA 2FX3A 2J7KA 4Y9UA 1SKQA 2C78A 2YWHA 1F60A 1Q86D 3ES9A 3U2QA 3G6EB 1IJEA 3B78A 4Q7JB 2PLFA 2BM0A 1ZM2A 3E20A 1KK2A 4RD4A 5GV8A 1BX0A 2HMAA 1QFYA 2VYQA 1YI2B 1Q82D 1E62A 4HE5A 1VQOB 1A8PA 4TMWA 3ZBTA 2CNDA 1QGYA 1UMKA 4ZGQB 3CXCB 1E63A 1M90D 4PGOA 2PMDA 4B44A 5TV2A 1G7SA 3WYAA 1VQ6B 3VNUA 3WNBA 3CCJB 5THXA 3QFRA 1G7RA 2BGIA 4UAJA 1GAWA 1W35A 1K8AD 4YAOA 3E1YE 4P3YA 1K73D 1JJ2B 2R6HA 3P26A 1M1KD 3QFSA 4M1KA 1QX4A 2DERA 2OTLB 4NCNA 4PC6A 1W2BB 4M4SA 1VQ8B 4LBZA 4U9UA 4G1BA 4C43A 2VNHA 2RC6A 3W5HA 1YIJB 1N0UA 3B8HA 1S0UA 4ZV4A 3MMPA 3QFTA 3B82A 1OGJA 4RD3A 1FNMA 3FPKA 1KQSB 1H42A 2DCUA
chains in the Genus database with same CATH superfamily
1ZL0A 2CMFA 2R8ZA 4Y18A 2O8BB 3ONDA 5KX5B 4EK9A 1D7AA 3ANNA 1CUJA 3E3NA 4DY6A 1PFYA 3FF1A 3TW8A 4FYMA 1ADYA 3OC6A 1ISJA 1K8YB 1FRFS 5G1OA 3A9VA 1KF0A 1DKPA 3D2BA 1W5AA 2VFAA 3QWFA 4NE2A 4AJJA 2VPYA 1NSTA 4RTPA 1N0WA 4ETWA 1LQUA 4IIXA 5JWHA 5ADVA 1CRWG 4H15A 4HRVA 4UTRA 2JLUA 1JEYB 4P2NA 1PJCA 4MINA 2CDBA 3CG4A 5L95A 5LQNA 1B6GA 3GNLA 4FCCA 3N0TA 4C0LA 2I3ZA 3T3DA 3PGLA 2JCBA 3I1FA 5CXXA 2M1ZA 3FPEA 5EWLA 2J6HA 1KORA 1PN3A 1X9IA 3TFQA 2ZYHA 3SLGA 3UMRA 4B2YA 1Z2NX 1PR4A 3H42B 4WNAA 2JIPA 3ICOA 5IBPA 1FRQA 4IV0A 4BFXA 3JD4A 2EOAA 2PJZA 3P8ZA 4ILEA 4U6SA 5U4XA 2WWGA 1RYMA 2ZREA 4RNDB 4DSAA 4LRUA 3LBNA 2UZ3A 5EHZA 1QB7A 3KOWA 4G2NA 1GARA 4CLXA 2BZGA 4HDSA 1PL0A 1RXYA 5TT1A 2C82A 1WUIS 4TTAA 1KMMA 1DI0A 3N07A 3RC1A 3F3SA 1KR5A 2NLOA 5JD3A 2EV9A 4F71A 1TW3A 1TJYA 1ODSA 4PICA 4ZAGA 2C2YA 3GFSA 5IT4A 2V7BA 2OBBA 4RD0A 2F8MA 3LGSA 3I01A 4BCDA 1KJNA 1U2SA 4AJ1A 1XK6A 2FPKA 2RI1A 3JZIA 4P08A 5BV7A 3T8YA 2GPSA 5C7IO 2IZ5A 2JAUA 3GCGA 4MUIA 4QDKA 2OCKA 2ZTGA 3HBJA 2A7XA 5FULA 2ZI7A 3HFJA 4GQBA 3WGVA 5JCOA 1XTRA 1O03A 1RHMA 2CLLB 2L82A 3UOGA 3SIWA 2XJ9A 3V46A 2JLWA 4KI0A 4BBAA 3Q12A 4PWZA 1EA7A 1IBCA 1Z3IX 5CBPB 2P9YA 4D0RA 4JP8A 3AEKA 1R27A 5KBYA 2FETA 4GXQA 4DSZA 3K2BA 1GT6A 4DMGA 2B69A 2RGXA 3C7CB 5AH0A 2PKWA 4D1YA 3K0EA 4QGBA 1BE0A 4YRFA 1XWWA 3BCHA 5KS2A 3L4SO 4WN3A 1XD9A 3L06A 1Z8HA 4V0NA 3L77A 2H85A 1TZJA 2SKCA 5FF9A 1YDGA 2IRWA 4WWVA 2JAXA 2OV3A 3WB2A 3VC1A 3OE4A 2N46A 2QW0X 3UPUA 1U9IA 2DKOA 3ZEIA 5B2FA 1QVGB 4EARA 5I7AA 4D9EA 3FGOA 4K9OA 2UKDA 1PFKA 3H2JA 2ODPA 1XMOB 5KC8A 3OETA 3N58A 4FDUA 5C5DA 1TM1E 3GLFE 3GRCA 3O6VA 1SA0A 3SQOA 2EIXA 1Y9DA 1VJDA 5BW6B 4OXXA 1XTVA 5DYGA 1D4AA 3T0IA 3FH0A 1SPBS 1Z5ZA 2QN7A 4M88A 3U0BA 4FYHA 2JI7A 4WXYB 3JQAB 1JTVA 4DDVA 4F3KA 2BGLA 1PZGA 3K70C 1U0TA 3GRVA 4HL6A 2HK6A 2CE2X 4RIHA 5TIIA 2EAUA 4Z3DA 3GOQA 5K0FA 3A6PC 4CUJA 1E1QD 4B43A 1E4YA 1UK7A 4U2GA 2Q6OA 2VHJA 3L6UA 4OHCA 3KBBA 1XJCA 1LBHA 1OF1A 2EBUA 4TM7A 4C1NA 1F5NA 1NVVR 3MPUA 3LECA 4FDTA 4RJ2A 5FXMA 1PF7E 4KN8A 5H8WA 2YY5A 3HB1A 5I9LA 4UQPA 5INTA 3SBEA 4TZ6A 2R00C 3HCDA 4H6WA 2WICA 1F4PA 3TRHA 5DHQA 4DA0A 2JA1A 4PIVA 4GZLA 1EWTA 1FP7A 5IKEA 4JJFA 5AKJA 3WK6A 1XQXA 3SLRA 2W4IA 2JFXA 2P2DA 4S12A 1X9HA 1GEEA 3IT2A 5CXSA 3HP1A 3NHWA 2Q8QA 3BEOA 5HOQA 4DV3B 4B3GA 3ONVA 4ER7A 3I1IA 3PHHA 1BQ4A 5H68A 4EFDA 4DF3A 2R1TB 1J9ZA 3O91A 1PNRA 2YIDA 1RSZA 5ALOA 4UVEA 4D44A 3LCMA 4CWAA 1G3RA 3PDUA 4DZTA 4DUGA 5BY2A 4KNVA 3T1HB 1SKMA 5K0JA 3LDHA 3INTA 1E64A 4FFNA 2VA9A 5E95A 5HJ7A 4MB6A 1KI6B 4FK8A 1XA0A 3WR5A 1KVTA 5BNTA 2PGAA 3C3YA 3DBHB 3HAGA 3BAZA 3HVJA 1GPDG 4PSCA 3OZFA 4PRKA 1SUCA 2D59A 2DWOA 2NP6A 3AF1A 1I10A 3HCCA 1MC4A 2OHOA 3GFRA 3KQPA 3E4CA 3EZFA 3F7MA 4G0YA 4IJKA 4ZKDA 1N2BA 4KLZA 2I6SA 1H5NA 4J75A 4YYEA 4ER3A 1PNQA 2IODA 2I1LA 2FPGB 3M6IA 2FAXA 4TMZA 1GP2A 2WPDA 2XWQA 2DPGA 2YYSA 3BMXA 3E2PA 4OCZA 5DEOA 4UNRA 3BCDA 3DFIA 3HC7A 5BSXA 4M9QA 5FPQA 3HKBB 1M73E 1VE6A 1U2DA 3F5QA 4ME6A 3Q9NA 5I7HA 5JJ5A 3ZCQA 4HH3C 1MFPA 2CXTA 3HJUA 4CLOA 2C5LA 4DQ0A 1KAQA 4PX9A 2X7JA 5CHEA 5B1IA 2WJAA 4CYMA 1P6QA 4FFBB 4MA0A 1L5KA 1KRWA 1G55A 5EFOA 1N06A 3Q6MA 3H04A 3T9AA 3PPYA 2IS1A 1OKKD 1ORTA 1M8PA 5EG5A 3SQWA 4N8SA 1MO4A 1KQPA 1U8YA 2J08A 1PS9A 2Q0XA 2V03A 3CFYA 3EXAA 5TY0A 4FGLA 1SC4A 4NBLA 3VHRA 3VMFA 2IEZA 721PA 1AA6A 3T7TA 2J6IA 2IS6A 2NSHA 1YKSA 4J03A 4F9EA 1XDUA 3IP1A 3X3HA 4P86A 1TT5B 5J2UA 2QAJA 1EFVA 3RYCA 4JB0A 3RTCA 1IBRA 1X80A 4ZO6A 1A69A 1P4JA 1QKIA 2AC2A 3BWXA 4WDRA 2PUFA 2CEKA 4QNRA 1JHOA 1SC9A 5AFSA 3DT6A 3ZD9A 4MARA 3RD5A 1E2JA 1YS4A 1I3KA 2BJHA 2W4MA 4YLEA 3CCEB 3ORQA 2A1TS 1GSIA 5NLLA 4YO7A 1SXHA 3I4LA 3U0VA 4YAIA 4XX0A 1FMTA 4Y9SA 2G82A 1E1MA 4PU0A 4JGIA 4OHRA 1SB8A 1EHIA 2C5FA 4C9BA 2O7RA 2QLJA 1VRWA 5IAAA 2VF5X 5J2UB 1LLDA 4YJGB 1M8FA 4DA9A 4LGVA 5HEKA 3I76A 5FADA 3UJAA 1B74A 3B12A 2H08A 4FI3C 4PF1A 1IQPA 4DR5B 4PYQA 5JU6A 3NWPA 4B4OA 4IV5A 1XN1A 4B7AA 5F3DA 2XUDA 4J4BA 1QHXA 3RRBA 4EJMA 4LFAB 5EHXA 1GLGA 4ETMA 3EQ6A 1FLDA 5FA5A 1GLNA 3PC3A 4MRNA 3ZUPA 1FLVA 4TMXA 3A1PA 4KPGA 1H6BA 2GSWA 1W0JD 5ERXA 4D3ZA 1E1YA 5J3JA 1C0PA 4IWXA 1OWOA 4ODIA 3G5UA 5BSTA 3AVYA 1DL5A 1OUMA 1HDOA 3BKXA 4XLZA 1XYVA 1N6KA 2P2GA 2O8NA 1CQJA 2Z3VA 5JJIA 1RWPA 1BXRA 4OK5A 3AI1A 4UQLA 4M9ZA 2FQ1A 4XCXA 4LMPA 2NTEA 1IB0A 1JIKA 3N3AC 2R65A 1HDGO 1JKIA 1PGJA 1GGMA 3N7TA 4Y2XA 1Z4KA 4J0GA 3UQZA 3RAEC 5DXJA 1JE1A 4OFZA 2CLFB 4UCXA 1R2QA 2KBFA 1FRVA 5DRTA 1Y8ZA 2VAWA 1PQPA 3BWYA 1SBYA 5BT9A 1I24A 2G08A 4MWTA 4OI1A 1HNWB 3ZE1B 3NHFA 3IEUA 1Q0TA 3LM8A 4FFVA 4ISBA 1PJ8A 1OLUA 4ND2A 3RIEA 4B3SB 2ZZQA 2X8LA 1NL3A 2PL3A 4ZTUB 1UBFA 2CZCA 4Q82A 3WZLA 3JQ9C 1P62B 2V59A 4I55B 3U61B 4PLFA 2C7VA 4ZIRB 4YAGA 3CYFA 3TLGA 2QQ0A 3O9ZA 1X8LA 4P2BA 4EYEA 1ZLXA 5KNBA 2VSXA 4F93B 1MGOA 2QSYA 1KJJA 3S40A 4RA6A 2YC4C 3AEXA 4DJJA 2NQ8A 3RTGA 1P9NA 1QDUA 5EIFA 4NZYA 3VYUB 3WAKA 1RMTA 1YE5A 1N5MA 1CP3A 4IKOA 5E4TA 1QIEA 3BFJA 3HN2A 1F14A 2EFYA 2N47A 3W4KA 4WXEA 4ZVSA 1XA3A 1UDWA 4KIWA 1B23P 5MN4A 3ADBA 3V8MA 2OAP1 2J0EA 3ESQA 2MINA 1NTRA 3PUNA 4RDKA 1OU0A 4MX8A 3TIFA 3UC5A 5IJWA 4C0JA 1ZGZA 3QKIA 1E7YA 1NVBA 2F7SA 2DHCA 4LAFA 4EGFA 3CO5A 3KUKA 4UHCA 3TLJA 4XCQA 1RKBA 1QU3A 3DL0A 3EXG1 1LQTA 1XNGA 2Q4DA 4NU5A 3W8RA 5CB8A 4K03A 1PJLA 1W25A 1FFYA 1JJFA 1ULAA 7ABPA 2W6IA 1M6VB 3KALA 1XAIA 3QLUA 1VL0A 1A9RA 2CBGA 2BAGA 2FTKE 3LQQA 3ZH2A 2NSJA 2PSFA 3VBCA 1UD3A 3E5HA 2QT1A 3UFXA 2DPYA 5HZHA 3AP2A 3G9XA 3X1DA 4D98A 3VPAA 4CL0A 1XRLA 4Y2HA 4DCCA 3UTDA 2XF8A 4KJZA 4JAVC 5C1IA 2NU6B 4YFYA 5L3RA 4MW5A 3T3GA 3G0IA 1P7YA 3LJKA 1SCBA 1FQKA 1MJ5A 5KQPA 1JFTA 3U1BA 3CPWB 1XKLA 2XNDA 1PFUA 3GLHA 1XMQB 2JD2A 1H4QA 2QNBA 2EW2A 2OORA 2P5YA 4Q16A 1WW8A 1DO8A 3IUSA 5A62A 1PT6A 1C4XA 1W49A 4DIFA 5DSZA 5FORA 2DR2A 3EZXA 1YS7A 3LPMA 2O8DA 2ACKA 3TTTA 1CY8A 1QH8A 5ITWA 1PVVA 2ZS8A 5KTOA 1T6NA 1YZLA 2FX3A 3X2EA 4X3CA 3RC2A 1JXQA 1V1MA 2JN9A 1II8A 2NV2B 3IEPA 2OYCA 4YMTA 3J7TA 4W99A 3GLTA 1VE1A 1X1RA 1IRXA 3MILA 2O0LA 2OBMA 3IKTA 2DOGA 1M6WA 2ZXHA 2D1TA 2J7PA 3BL6A 2V8OA 3E4DA 4ZP1A 4BTLA 1WABA 3N6RA 4TOIA 3OY2A 4N03A 5K45A 1U0GA 4YROA 5B55A 3LFTA 1WOMA 2H54A 3JYOA 5EVJA 1WOOA 3PVZA 4N0DA 2GDZA 4LE1A 4DBLE 3SE7A 3TXAA 4Q48A 3PGJA 1M6NA 1G8SA 1RQPA 3OQPA 3D7LA 5FB3A 4L4YA 4A4DA 2LXNA 2OGZA 4XJSA 3EIOA 4EFMA 3HM9A 2EBFX 1DJPA 3D3NA 4FIZA 2NO7A 1KZYC 4MQ6A 2OZKA 3W5CA 1D2RA 1YE8A 2VR1A 3TKYA 4QELA 4M0MA 4C07A 2FPWA 2PFGA 3R5SA 5G0VA 5ER9A 1IHPA 4CLHA 1GGHA 2DQZA 1Y6ZA 1H9AA 3ORSA 4CM4B 4UBJA 4AVYA 1X1AA 3MK31 4E13A 1Q7RA 2YYYA 4N5LA 4B44A 3R0JA 1V2HE 3HKCA 2I6UA 3BZWA 5FPPA 2H1LA 3O1LA 3PQ4A 2UUPA 4EJ6A 3FOBA 3GDOA 4LC9A 2GR9A 3KC2A 5LYYA 1WMAA 2P2CA 4J76A 1Y5RA 5T3UA 4L9RA 1GAWA 3KUCA 4YAOA 3KQOA 3CUVA 4ZYZA 1WXIA 1RE0A 2A5YB 2PXHA 3FDXA 4Q9DA 1QHSA 4U39A 1ZHHA 4UEJA 4Q3BA 5KQRA 2FK7A 4RMHA 2Q3LA 2QUJA 3MS2A 4DIDA 3QFSA 1P2FA 3TPCA 1QX4A 1SCDA 2BUAA 1LS6A 3K5WA 4NS4A 1OX6A 3KCQA 1Y0BA 2F1MA 1C8VB 2W6OA 3B3AA 4MI9A 4URZR 3H75A 4ZYYA 5JY6A 3VOTA 3O8QA 2VQEB 1LVHA 4R16A 5E2IA 4UPEA 5J4KA 4FI3F 1YHZA 3B3QA 4DRZA 2BI7A 1FMFA 3HLKA 5JNUA 4LHEA 2XTAA 5ES3A 8MHTA 5CA0B 3PR3A 4AJEA 5DWDA 1UOEA 3K8OE 1FFDA 4TLAA 3RFXA 4WOJA 3TEFA 1YJAA 3UJBA 4BQQA 5CCBA 1B3BA 4U1RA 5CU7A 4QVJA 1RBZA 1OAOA 1ZXXA 3L0SA 1LSSA 3ZPXA 4HNAB 2GZ2A 4ZCSA 3BXEA 2AD1A 2H1RA 1X38A 4UM5A 1Q7BA 4DRXB 2I1WA 3EDQA 2JFPA 1SPXA 2PPVA 3VR2D 2P6NA 1CXZA 4JMLA 5T8KC 3JATB 5BWOA 4G0UA 4PSAA 4WK4B 4YS6A 3WYFA 2P77A 5KTTA 2AQKA 1YBFA 3DC7A 1JHUA 3B9QA 4YJ3B 2QMYA 5CITA 4HFJA 1LD3A 4YWJA 1G59A 2OHIA 4DLVA 3PXGA 2GPYA 4WKOA 3U44B 4CEHA 4DNOA 4TLEA 3E7DA 1W87A 1GQOA 2A30A 3HWRA 4IFBA 4Y1FA 1R10A 2ZRPA 4LXYA 4MEBA 1SXGA 4CDMA 1D0VA 3MWYW 4ZMRA 5IZCA 4NWIA 1V6SA 3LW8A 4U0KA 1W9XA 2OGWA 2VWGA 1J0CA 4M1TA 2P75A 3BBPA 3DP9A 4RE6A 5BQXA 4K1LA 3K9NA 3V4SA 4MV4A 2I66A 2O0MA 4MIEA 3QXCA 4GGPA 3ELUA 3O03A 4P7BA 1UXIA 1V35A 1DQRA 1GPMA 2AMLA 2F1KA 1AXGA 2EZ4A 1GZ3A 4FEGA 4JBLA 2GVZC 3SY8A 3UK2A 1GKUB 4RABA 3LPDA 1O94A 1I5EA 1XZGA 2QYHA 5A6SB 4O1HA 3B2NA 1P7VA 2CZQA 2X6RA 3CMAB 5TF4A 2XMRA 4JI4B 1H4TA 2DFLA 2CVOA 1ZW1A 1YI0A 1BD4A 1E8MA 1QG4A 3LKBA 1TO2E 1EDDA 2WTEA 1Y42X 3KZVA 5AM4A 4BKRA 4E08A 3OTGA 2XMBA 2F9MA 3DKVA 1JDPA 4RTQA 2AMYA 1X8XA 1V6CA 4MVJA 1I51A 2I87A 1G6OA 1X14A 3NTXA 4QJBA 3F0TA 3FJYA 2GAJA 4FR2A 1UMCB 3ADKA 4BN4A 2I4RA 2D9RA 1OV4A 2VTDA 4FE4A 4FD3A 2CUTA 2D7JA 2IEGA 5EMKA 2P1RA 5FJIA 4LZPA 4K9RA 5FBVB 1MC8A 1LS1A 1Y8CA 2JDIA 1UBRS 2YXBA 5IASA 3CF4G 4G84A 4KKSA 2Y99A 4P0PB 1H05A 1P18A 3J7AC 3VAAA 5JEEA 4BOYA 2GQ0A 2PUGA 4HFRA 1BMDA 2GPWA 2UUOA 3OPYA 5JZSA 2DTDA 1YZUA 2IUEA 4FGSA 4U7WA 2X53S 2OYRA 3TLAA 3UB3A 2JATA 1KH2A 4P1ZA 2WABA 1H2YA 4L9WA 4YLGA 4PTZA 3KXLA 3ZE8A 4EX6A 1H6DA 2E1PA 3QBVA 4ZCPA 3UAZA 3KZNA 4TQGA 4ZI7F 3RVNA 3CNHA 4JASB 2H07A 2PZAA 4AKTA 4LYJA 1UJBA 1HTWA 5BMVA 2BY4A 4C22A 4FSHA 3B7GA 2EWVA 3QX8A 3WMRA 4AUNA 3H5VA 3D3WB 1PLLA 3PSAA 4OUDB 4X00A 1NBMD 4F3NA 2F4NA 4OHZA 1D2EA 4MYUA 3NTVA 1CEXA 5AN9A 1FBNA 3G71B 2IOQA 2VLBA 2VPXA 2YVKA 3P20A 2R2GA 4BP3A 2H1WA 1Y48E 1MAAA 3A36A 4MWGA 1KDRA 1NXWA 4ZO7A 4NX2A 1H9BA 3HR4A 4DLZA 2W2KB 3FPSA 4F6CA 3MGKA 4TWZA 5EJAA 3TMAA 2BE9A 4URYR 4OATA 5KWVA 1EX6A 2P7HA 3BJIC 2Q5EA 4PRZA 3WRWA 2CF4A 1RCTE 3IVRA 5IC6A 1RKXA 1GUYA 2BGTA 3AF2A 3LG2A 4I4TB 1QRAA 5FBKA 2GI4A 5FOSA 4D6PA 5HIMA 2H7XA 1C4OA 2EGUA 2ZBFA 1XTZA 4N39A 3TNDA 3TOZA 3ZDEA 4RDXA 1SMKA 3ROZA 3SJUA 2UUAB 1TVCA 1VQ1A 2GZ3A 4EYKA 3ZWPA 1DCTA 1IQ0A 5CPBA 4KFCA 2QORA 3H3JA 4ZEXA 3DPSA 4G0OA 4OQNA 2C84A 1ZVJA 4A6PA 1QYRA 1E6EA 1IMOA 2XY4A 2HCBA 2ORVA 1HO3A 1T5EA 4QTTB 5EUBA 4ZCQA 3TUIC 4XTCS 4EY6A 2BGRA 5DASA 3IT1A 3Q3JB 3KEWA 4GYKA 4MJ3A 1RTTA 2R86A 3TLKA 1E79D 4JI2B 3DPIA 3GVPA 2BR4A 4AU1A 3EG9B 1ZOOA 1U0NA 4QHTA 3WRXA 4CMAA 2JVJA 2G1PA 3PC8A 1XFAA 5I9MA 2PZEA 3D8SA 3GZJA 3OX1A 4ND8A 9MHTA 1NBEA 3WA6A 2PUHA 3DR3A 5D5HA 2ISQA 4O5AA 4AC9A 3HZHA 1Q74A 4Q03A 4QQNA 5IXYA 2PKQO 4MVCA 4PSKA 3KQUA 4BTEA 4RD6A 5M7EA 2OO3A 4ZALA 4DB4A 2BSXA 3JWHA 4LOJA 3TRJA 4CUZA 1HA3A 2JFOA 4JS0A 4OREX 2QY6A 2CHFA 3V8VA 3Q3AA 2AFIA 4G36A 2P30A 2Y4NA 3AF5A 1P6UA 4G89A 2VZLA 3O95A 2IZOA 1ISSA 3H9BA 3LHKA 3CTAA 4C6TA 3KUXA 2CVZA 2V5UA 3NCHA 5TNXA 4JXZA 4GEGA 2IK8A 3THXA 5EYPA 2JKZA 3D8NA 1GADO 4KRYA 1XF9A 3WGZA 1FFBA 4XYLA 1FYWA 4TV9B 1Q0RA 3GF4A 3N0RA 4M7WA 4PYNA 3CP2A 4TWAA 5FWAA 1W8IA 4HEA1 3ZLVA 1EWYA 1WO8A 2ZJ1A 5J5CA 4KVZA 1MA3A 4QUKA 4RQTA 4ZO8A 5LBUA 1NRKA 1K6IA 1CERA 1E7SA 4GR4A 1GAEO 6LDHA 2FMFA 4LJKA 1QP7A 4DC0A 1X0XA 3DMNA 4GI5A 1VMKA 1CUDA 2I1VB 4DIMA 1E2BA 1U7WA 3HYRA 4RDLA 3OPOA 1L5QA 1ZNZA 4K8OA 4D02A 1NM5A 2Z2JA 5K3FA 1SXIA 2V6IA 3KP1A 4ZT5A 5GM1A 3FYUC 4EHFA 1P2SA 2H0QA 1UM9B 2AG5A 3ICPA 2AE1A 1U0HC 3CF6R 4LV6A 4U9IS 3W34A 2JK1A 1ZOPA 5F9FA 3EFOB 4JBYA 3GLIB 3IUYA 4RPHA 3AEUA 4GE3A 2IZ7A 5CHYA 4TTJA 1WY7A 4KSBA 3C6KA 5JNTA 2Z2XA 2WD9A 1CUHA 4GO1A 3W78A 4BYMA 1JSCA 1QRUA 2X1VA 5HK8A 3SXJA 3LX4A 3PNBA 3SS8A 4N7JA 2WVAA 1MJGA 4YCAA 1TVEA 3G2LA 4OHPA 3SIRA 3JAMA 2RI0A 3PKIA 3IKJA 1WD7A 4B8WA 1IG3A 4DUZB 3MCWA 4D4IA 3ZI7A 3KOOA 5H4GA 5EKXA 1XZIA 2R48A 4K28A 3IP6A 5CYOA 2IBTA 3JQBC 1JLLB 2H1CA 4FC7A 3GSIA 3S5JA 3GG2A 2WIDA 4UBIA 5BYKA 4ARVA 2O14A 3TSWA 3WFZA 1N9ZA 4O2BB 4BN0A 2YWEA 1UPFA 2NVUB 3BERA 4O3FA 2HMTA 1Z36A 3AFHA 2XH8A 1UUFA 3OF2A 2A0XA 4DBVO 4KWIA 1BS2A 2C07A 2C8JA 4C4YA 4J3NA 4PQFA 1RRCA 3UCXA 3R3WA 4BJ5A 3JD0A 4DCOA 5KOYA 1LDNA 3GA5A 3K2IA 1I4WA 2B35A 2CVFA 2X1LA 3GLUA 3K8QA 3GFGA 3GL9A 3S0JA 3WNCA 3T5CA 1KIMA 3FNBA 1LK7A 3D59A 2C0QA 4UU0A 3BXZA 1FTQA 5F1PA 3ROGA 3JQQA 5JLJA 2AEFA 1XPJA 1W0KD 1N8NA 2WF6A 3A04A 1QGED 2AWNA 4EFNA 3LZDA 2QL6A 3EVFA 3D5EA 4BNFA 5JS1A 1V4BA 3ESZA 4Q9NA 5L3QB 1Q7YD 1MZPA 2YUTA 2EZ8A 2ZYVX 1DDOA 3UM9A 4CLDA 2XCQA 4ZMSA 2P4QA 1AKNA 4GDFA 4WBNB 2OAGA 1D1SA 4FOSA 5F7ZA 1NBIA 2H2IA 4Z9XA 4JVMA 1GZSA 2YVAA 4E2ZA 4XAQA 1VLLA 3ZBPA 4EDHA 3BMNA 5GVSA 1TDJA 1ZUHA 4ND7A 1EQUA 2F59A 3DMPA 1E8DA 1H2AS 2EQAA 2QRHA 1E77A 3EXHC 3D8RA 1OFUX 1VFNA 2UV8A 3FLEA 2I2CA 1XVAA 1S5PA 2GCOA 2I0FA 2ONKA 2Z5VA 1XE1A 2GVDC 4OK3A 5DGXA 3T3HA 1P73A 5J59A 1KNQA 4FGKA 3I9NA 1CIJA 1YR9A 4YJKA 3ZGXA 1A72A 3MJHA 3W5DA 3QM1A 5D7BA 2DWPA 3IAM6 3REFA 2GCGA 1IZ9A 5EUMA 4H0FA 4D2IA 2FGKA 3T3MB 4CMIB 3FVVA 1EUDB 2IBSA 4Z8XA 3JWPA 3RG2A 4DLTA 2D4AA 5CFZA 2GBFA 4ZCRA 3FRHA 4XNFA 1BRMA 3DD5A 4BB0A 4S05A 1KS2A 2QTZA 3GBPA 5IYPA 1KFCB 3DHWC 3DNPA 4GIBA 4FHDA 4GYWA 3VYSB 1O95A 5BURA 3PEYA 1F8FA 1MD9A 1MAWA 4HX2A 2WIBA 3EC7A 3RS8A 3DS8A 4TXHA 3AVTA 2VHQA 2JLRA 4C4ZA 1C5KA 2E48A 5CJPA 1IJFA 5LYJB 1QMGA 2VTVA 3A35A 3VVMA 3DVQX 3ZGLA 1A82A 4GVXA 4HX9A 4RZ2A 4BB6A 1D04A 4X07A 2WILA 4MUFA 4BE7B 1UBEA 5J5AA 4EYSA 4MTLA 2A0YA 3OFND 5L4LA 1CRPA 4Z4HA 2OL4A 2NZUG 4A10A 4DEXA 3LA6A 3WBKA 1NUHA 3M1IA 3HHPA 3OA0A 1GYQA 2NNWB 4FPXA 1F2DA 2A2ZA 3BE4A 3G0BA 2FEWB 1I30A 2CMHA 3NVMB 2WWWA 3RS0A 2F1HA 3TAHA 4CM7A 2X8KA 1TJNA 4DLNA 5H70A 4NXMB 3UENA 4MYRA 1FFCA 4RJKA 4K6GA 1AHPA 3QWHA 1EUCB 3W6OA 1IBLB 1G20A 1IU9A 1OFIA 2JFZA 1JA1A 4K9PA 2J9FA 3VTKA 2B83A 3P2JA 4O25A 3QVGB 4P58A 4TRMA 2OESA 3O94A 4TWRA 5EWJB 4AECA 4AZVA 4DARA 5LP6B 3LDAA 5KKCA 1ZSNA 1WMBA 4G0NA 1GZUA 3KB1A 3K09C 3LC7O 5DIZA 3OU2A 4C4AA 1N78A 1XFOA 3QY0A 2DQYA 3EGOA 3ASTA 3PS9A 1JDBC 1HL3A 4IHJA 1NLMA 1IIBA 4RVHA 3SZ3A 1N6HA 5C8XA 4RA9A 4MYHA 5D3ZA 5DNUA 1JMVA 2H6EA 4CU2A 4BO0A 4YQFA 2Y9PB 3A9SA 4PNZA 3K2EA 1DAFA 3V9PA 3PUHA 2WIGA 1JJBA 1YQDA 3A1EA 4G1EB 1QH1A 2E0IA 3PFGA 2H4WA 5AXCA 3D3EA 1KMCA 2Q62A 3W0LB 3EF0A 5K0TA 1K63A 3CNBA 5LA6B 3I0NA 1AHIA 3C3DA 5D51S 3KKQA 3QLVA 1YQTA 4FMCF 5FCDA 1N7IA 4D9HA 1LDMA 2JEZA 2HIGA 4F12A 1CETA 1UODA 2E37A 3ROPA 5B5SA 2YFHA 1U0LA 2XZOA 4ZRNA 3WLOA 3Q38A 1MBZA 2QVCA 1FNBA 1IHXA 3OJLA 3PJEA 2IUUA 5J2TB 1Y4UA 4G7XA 3FY4A 2AYXA 3KYCA 2OV4A 3I5AA 5DRYA 3U7EB 2BTEA 1IL0A 1T5SA 1YQGA 3EQZA 1GNPA 4NFLA 4R1PA 1ZNQO 4XOPA 1CULC 3LT4A 1C41A 1ENOA 5FFFA 1PNOA 2FCAA 2HFKA 2OSVA 1UAYA 3MJSA 4RF2A 4BCCA 1CE8A 3C7DB 5CLJA 4D0SA 1P0FA 3NTUA 2XUOA 4OGWA 1KZLA 5CNKA 3D26A 1HF3A 1KO8A 3H1PA 3NPMA 1HT3A 4YXWD 3NHJA 1RR6A 5H9VA 3TSZA 4BO3A 1GCUA 1HK7A 5K6RA 1WM1A 3Q85A 3DMDA 2PGLA 4E30A 1KKMA 3BHNA 3GQBA 4KXQA 4NULA 2HXSA 2Y68A 2BM0A 4BL5A 1ZGGA 2H9AA 1URPA 3NJ8A 4XX1A 5IJXA 2H9IA 2WY2D 3T94A 4HDRB 3EEFA 4ZEVA 2HJHA 4O2AF 5A4DA 1XRSB 2PV7A 1XPUA 4RHXA 2DZDA 4TUYF 5BV2P 5IK2D 1QG6A 5LLTA 3ASYA 4Q1FA 5ADWA 2WHPA 1WSVA 5JVDA 1YVUA 3E61A 3VAYA 5HQ3A 2NXEA 3FDFA 4XB2A 4OBXA 5FEUA 3WSWA 3FAKA 3VR6D 4X8MA 2ZYWX 1EJ0A 2J4DA 4CGYA 3FYCA 5ALYA 1U5BB 3KJFA 5C3MA 3BF8A 3ZQKA 3DV0A 3B48A 3K0CA 1NKTA 4RY0A 4TT8A 1CLUA 2AG6A 3QW4B 4N9WA 4D4KA 3A6DA 2PCLA 5HIIA 4ZAFA 3LWNA 2B94A 1DWUA 1OZGA 2LUOA 2ODQA 4WOCA 5AOBA 1A3CA 4CMEA 2RKOA 3QFRA 3WICA 2HW8A 3TD2A 4A8JB 3TQFA 3V6LA 4IH4A 2E6UX 2JJ8A 5EJIA 3SN6A 1XU4A 3H8SA 3B6MA 4CN9A 4O4LA 2CWWA 3H9JA 2QENA 1K73D 4OPSA 4PZEA 4JI1B 5AOAA 3I12A 5ITZA 2FEAA 3H05A 4LKOA 5A89A 1MIOA 4B4KA 2J32A 2NADA 4D9IA 4YP1A 2HQBA 2OBXA 2PZBA 3BXHA 4KQIA 4C3VA 3I62A 1OBFO 3FSRA 4KREA 1N2HA 1H2WA 5F2KA 2WUDA 1SQFA 2WVJA 1CPYA 4XQ0A 3WB9A 5K8VA 3AOEA 2FVXA 1B73A 1E1DA 4GICA 4BMCA 4ENSA 2J5QA 1CUZA 1SVMA 2Y71A 3DTYA 1VDMA 3TW0A 3TYXA 1P33A 2WMDA 4QPZA 1NNUA 4DT1B 1B15A 1F38A 1DCKA 1TK2A 2W93A 2BFAA 2WM3A 3MQ4A 3FCEA 1V5WA 4B3TB 2IXBA 4G8DA 4KYVA 5LQMA 2BFFB 1CUUA 2F64A 2JHCA 3BMQB 3E35A 1G21A 3EXFB 3M82A 2FWBA 4JVNA 4R81A 3ESRA 2ZUDA 3FLAA 3H87A 4BFYA 1DQZA 2E21A 3NDRA 2PUTA 1U31A 4XIYA 4E32A 1KVQA 4HAZA 3SC6A 3ZWQA 4ZV4A 2APJA 2C3OA 3OU6A 5BQFA 2YYAA 1FUKA 4NPAA 3RHSA 3W6NA 4XLAA 5L46A 2Y0DA 1VPWA 2ZM6B 4UXJA 3V00A 4H7JA 2TS1A 5KNCH 3FDIA 2H4ZA 2E6KA 1O57A 4Q1EA 1KE2A 5KWIA 1FU8A 3BM5A 3OEEA 4IDAA 1XEWY 2QTTA 4O1IA 5JOQA 3M4NA 3OKFA 5A3SA 5K8LA 4WK6A 1P2DA 2AN9A 3N76A 2BTQB 4PCVA 6ADHA 2V7QD 4NS1A 1Q1QA 3IQZA 1P44A 3A2LA 4V0LA 3UCEA 4ARBA 1QUFA 4HB3A 2EC5A 1OWPA 5GONA 3UMSA 2GASA 5BPFA 2GF0A 1I7PA 4FS3A 5FBRB 1VOTA 1ZI8A 2C00A 2ZBPA 2FN3A 4M9CA 5EKUA 1HQYE 1KXZA 3U7RA 3ZHYA 1JDZA 3QUTA 4BUZA 3HNRA 4YFVA 5EERA 1RKVA 5AKLA 1TJPB 4ZFNA 2NU9B 4BLUA 1RWKA 2DH6A 1ZCAA 1FTWA 1KYZA 1OWLA 1T4MA 1U94A 1GA1A 1X19A 3DH0A 1OIWA 3P9XA 1FSGA 3LHDA 1NJID 3IPRA 5FI1B 2HF8A 3LQ2A 4QM6A 1DC3A 5E9AA 4JXJA 4UD6A 4IVNA 4BE9A 1NUUA 3CC8A 5FI0B 1ZH2A 1B41A 1KMIY 1N5DA 1KI7A 1NF2A 3HPQA 1UD8A 1NATA 4KVAA 5HF9A 3HABA 2DWUA 2RDMA 2Y1EA 2XRYA 3T15A 4MV1A 2A5LA 2QUIA 1E2DA 1PFVA 3GRUA 4AZ3A 1N1MA 4D9KA 5LN1A 1Z8FA 1XRRA 3HCOA 3P9YA 3PZRA 3FLBA 3MCUA 3WYCA 5COQA 3A9RA 3RSFA 4EAAA 2BHLA 3D43A 1WPQA 1II9A 3L8ZA 3WJAA 2FP4B 1QLWA 1ZIYA 3EVGA 2ZUWA 3K4QA 3IURA 2Q6LA 3FCXA 3MJCA 5EL0A 5G3YA 3CLRC 2XEXA 1E1LA 2GTPA 4LJ4A 4N65A 3PI7A 4G5XA 3E82A 4XYGA 3VNVA 1M76A 4K9DA 4RK1A 3AHFA 5TQJA 4CZ2A 3BJEA 1WXXA 4KR9A 1DOZA 1E66A 1NF8A 2YL2A 3Q5GA 5EIOA 2JNWA 1A4IA 4GHWA 1JKFA 1DLJA 3T5DA 1WULS 2EEPA 2BZ1A 3EGCA 4J43A 1NXXA 1JE0A 4NIMA 4XGIA 1PSWA 1JYFA 3WK5A 4EA7A 4CMBA 3LWZA 3A0UA 4RQBA 1KK1A 2CUNA 4MV7A 4O4JF 2XMCA 3NOOA 5LJLA 1Y3IA 3OQIB 2CE7A 5JXHA 3HPRA 1G41A 2Y4OA 5H59A 2NAFA 4G0QA 1KJ8A 4YJ2F 4CQMD 2ZTHA 2QN1A 3GJTA 4N5HX 5ALHA 3VKVA 4AZ0B 5C9ZA 1C0LA 1DOAA 1NHGA 4R1TA 3FOAA 1VSQA 4PYLA 3TSYA 1TPZA 1DIOB 1M2VB 1UINA 4YCJA 2AOUB 4NESA 3FWHA 3V1KA 3E1KA 2D8MA 4EW2A 5JS2A 1A9OA 1XNHA 4X62B 3SS9X 2VTBA 4LIPD 3I6QA 1NNEA 1TZMA 2BI4A 2R8EA 4R8SA 4ZZ3A 1HNZB 5LDDC 1MX9A 1TEXA 2QBYB 4M8KA 2EHJA 5KEIA 2EZTA 1Z6ZA 4RVNA 1PYGA 1TYZA 1A98A 2JIZD 2QRJA 5H4HA 1NPDA 1TKBA 2AMFA 2JCYA 1N33B 4GPD1 1ARZA 2Z57A 4HH0A 4W1SA 1GY8A 4V0QA 3W1EA 4E21A 5EXXA 3GYBA 4MOWA 4FINA 3TIIA 3DLCA 3WHIA 3ZXSA 2YQ4A 4FW8A 1XNQB 3AL2A 3C3BA 3ZXUB 2E4UA 2DUUA 4X1YA 1DWOA 3R7WA 3L4KA 4RJIA 2XMDA 1EK2A 4L7QA 4OGFA 3K72B 2GXQA 2KE5A 4MAFA 1XCMA 4HGYA 3CGWA 1ZK4A 1SXJB 1H5UA 2AN1A 4HVTA 3FGZA 4PFQA 2AR0A 3ROTA 2IBMA 4TLCA 2QE6A 4FDLA 5JYCA 5LKAA 4G1FA 2CF5A 2UYGA 3UA3A 1KRXA 1EK1A 1QO7A 4JYAB 4INOA 1W9HA 2C5AA 1TEHA 1UBKS 3ET4A 3HWX1 4UTXA 3RQIA 3WWCA 4AS1A 4Q9KA 3ZHZA 1TYEB 3LX5A 3ETGA 3NTLA 1B2RA 3VR4D 4M0UA 4FWTA 2GD0A 2EARA 3PT9A 3RVJA 4HRXA 3VV3A 1G38A 1RYHA 2KX7A 2X58A 1PT9A 4IGKA 3A4VA 3F5SA 3LSTA 4YRLA 4I2NA 3BULA 2Z3ZA 2P9EA 3RIMA 2A1TR 3EVAA 3AB8A 1CU1A 1QZTA 4NF2A 4IXMA 4M1MA 1KRHA 2OT3B 5EOVA 5A9SA 2ZYIA 3WHLA 3CLTC 3ZDQA 1YUNA 1L5VA 3G8BA 5I7RA 4HP8A 4AJPA 2NU7B 4L78A 1Y3HA 2OBTA 4CPDA 3EDMA 3A9TA 5CM8B 3K6SB 1D1PA 4DYHA 3RRJA 1KR2A 4YWHA 4LYDA 2DWQA 1KYWA 3HO8A 3ZJYA 5FO0A 1PWZA 3QH4A 5KOJB 4LI0A 2FRVA 2I2DA 2ZZKA 3GOHA 2WPNA 5EMMA 2HCJB 4G6IA 2QMZA 3TO5A 1SWWA 1WRBA 1AB5A 1CWUA 5ESXA 5B64A 4B6EA 2ZM5A 2W4QA 1QQAA 421PA 1M34B 2OE2A 3D8UA 2V1XA 3L7CA 4IIJB 5HKOA 3GPCA 3Q11A 5CVVA 3MSCA 2V7GA 5IYWA 1V4VA 4AI6A 3EZYA 5AW7A 4WY8A 3BH4A 3T9FA 3SZUA 1O9GA 2A5FA 5G4KB 1S3GA 4F9FA 4P53A 1OI3A 3OD1A 5BN3B 1M6HA 2CXHA 5FDFA 1X7WA 3PUMA 1RRMA 3ETLA 1H1DA 1DRWA 2NO0A 5TGDA 3WQRA 3ZIUA 5EHNA 2WZNA 1KEPA 3SHVA 2WRZA 5D5QA 2CDRA 1Q1EA 2J9GA 4BNVA 4CMKA 2Z6UA 5IC5A 2OBNA 1GGVA 2AYZA 4OLJA 4DN6A 4PPQA 1I2AA 2WZBA 3HYTA 4E1AA 4CQNA 1OLSA 3L8GA 1U5CA 2HC9A 4G4GA 1D09A 1A8HA 3NUQA 3WQQA 1GRRA 4XJXA 2DH5A 1YB7A 3H4TA 4BFSA 5JAZA 2IYVA 1AK2A 1L9KA 2R1VB 1KH1A 4X7CA 1I4EB 1N2CB 2I99A 5A04A 4Z7JA 3A05A 2WNHA 4OD0A 4HWOA 3RH0A 4H7HA 3QTTA 3L9WA 2DT5A 3OHSX 3HU2A 5C31A 2HGZA 1MEJA 3OIUA 1N4DA 2PH5A 5DM60 3ESAA 4IUCS 5AJVB 3UUGA 3MD0A 4MWSA 5FI3A 3DKKA 4JODA 3IPCA 2AOWA 3CURA 1JSZA 3DQZA 4MR8B 4U9HS 1EMDA 1RRVA 2YMLA 3CUUA 5F4BA 3KLNA 1Q81D 1UEIA 4MQUA 3TQIA 1KS9A 1P81A 3ACDA 4NENB 4AY4A 2WD7A 3U31A 3DDNA 2FPPB 1T6ZA 3OW2B 3NR2A 4J90A 4PO1A 4REMA 3LUGA 4KODA 4XZ3A 3IMGA 1VMDA 1J9EA 2C97A 3QVJA 1GG2A 4CFZA 1V5IA 3M0EA 1IPHA 3WGTA 2BBWA 3OIDA 3GLGB 2ILTA 3MTJA 4XYMA 5C5CA 1P17A 3OHPA 4QBHA 5BV8A 1Z17A 3F3YA 4TPKA 3G2IA 3KVNA 4IIEA 2ILVA 3L5KA 3CLUD 1NNI1 4G5QA 5KDDA 3QGMA 4MMYB 2IV3A 2JB9A 3AZPA 3U4DA 4BZWA 3AM5A 2JFGA 4CCAA 5C35A 3Q2KA 5CEFA 1EYZA 2CCKA 3C97A 5EUCA 3VZSA 4HBGA 1KMQA 3D8BA 5LMNB 1X7ZB 3VA7A 4K2HA 4OOVA 4II7A 2ZU6A 3VTAA 3I55B 2GFIA 5CFPA 3J80A 3THWB 3DZCA 2YCBA 4LTDA 1RZVA 1OPRA 2NN3C 1TUBA 5IFKA 1A9TA 1B0UA 1ODFA 4DNQA 4DZRA 1NVWQ 3KSAC 4QYMA 4X7MA 3D5TA 4B80A 1BROA 1GCGA 2PVCA 1ATZA 5FFNA 4Z9FA 3OZIA 4J9VA 3S8EA 4RTOA 1RRFA 1SCUA 1E1CB 2H2DA 2OILA 2UVQA 3B38A 3D6NB 4M87A 4BNZA 5JCOC 3D2AA 4YHBA 1SQSA 4RCZA 2ODAA 3EH1A 3X1JA 4H08A 3GGSA 5EIBC 2JGIA 1LFAA 1G8KA 4J4TA 4DNXA 3MWFA 3ZK7A 4CT4B 2PGIA 2AN4A 1ZAKA 1QP4A 2GARA 2CBZA 4PZYA 3FOEC 3S27A 2CCJA 2Z04A 1XTTA 2A4MA 2JFQA 2OCBA 3SJ7A 2R3SA 2B8EA 1F06A 2H1HA 1TCBA 2WTAA 1JVNA 3DQPA 2W6PA 2X3UA 1E20A 5GGXA 1IULA 1BCRA 3HL4A 3ECSA 2JPDA 4PPFA 5FTWA 1HG1A 1GZ5A 4C87A 3ZZMA 3PHCA 4KO3S 2BFBA 2MDTA 2X42A 1U9IC 4WUTA 5K3DA 1SKUA 1ABEA 2QX8A 4D96A 2IVZA 1EINA 2XTMA 3CZ4A 3MC1A 3QF4A 4I1RA 3EISA 3FSGD 3OVMA 1PJ5A 1BTOA 1ICIA 1K5DA 2AHOA 2YWJA 2ZYTX 4GMKA 1SBCA 5BSMA 3U5ZB 5IYZA 2L42A 5AKZA 3P96A 4HZUB 1IJBA 3KXIA 1JG7A 3JWJA 4K3VA 1K06A 3SF0A 1YUMA 1EFHA 1EDZA 4IW3B 4PZLA 4Z1OA 3PLNA 5T64A 4QFMA 1JDTA 1XCOA 5AIAA 5IN4A 2OTCA 4G81A 5THKA 1GGEA 4KUGA 3FNHA 3LY9A 1VF7A 1VRVA 3O21A 5J43A 1N6RA 3DAOA 3MWGA 4D42A 1WXQA 2P1ZA 1Z7EA 1L5RA 2CGEA 2HHCA 2O2ZA 1NJ2A 1PFQA 4GU5A 4M1YA 3AF0A 3QZUA 4YECA 4B34A 3I01M 5EE1A 3H11B 1U1IA 3T0GA 2ZDGA 2IH5A 5HGJA 3VX4A 3WXMA 2QVXX 3IC5A 3CX7A 4CTKA 1NFRA 1NW5A 4J7XA 4GKVA 1FW8A 3MHTA 4BNTA 3HCWA 3C48A 4R8MA 1NHWA 4ZQEA 4L8WB 2O3TA 3DE7X 1T9GS 3SQNA 3ZCUA 5LUAA 3WO1A 2GM5A 2OK7A 1DT5A 3FZGA 1ODLA 1PQ4A 4XGQA 3VAZA 3PCTA 2FN7A 4HN9A 5JECA 4L57A 1GTG1 2WHXA 1U3UA 5DHUA 1BFDA 4G5OA 3LFUA 3ZV6A 4BZPA 5FHQA 1NX6A 3ROMA 2V74B 1PJBA 3B5JA 1EXNA 1NASA 5HF8A 5CCEA 2F67A 3K9WA 4HAVA 4J07A 5HCNA 3RIHA 3OQNA 3NDBB 4INJA 2Q2QA 1AF4A 3EGWA 2H3EA 2VRWA 3L8EA 1BWRA 4ZDKA 2GJRA 4UJ3A 4E0FA 3M81A 4BGEA 4RLSA 2H2GA 4NPCA 4E1BA 2L69A 5DHTA 3WTBA 3U81A 4TLMB 1YR6A 1NFFA 4N1AA 3JAKB 1USKA 4LTMA 1XMIA 1Z2CA 3A10A 3PXUA 2BF7A 2IHZA 1VCNA 2VBGA 1GXSB 1F60A 1RI5A 3CH6A 5FBZA 1VBNA 3EUWA 3RC3A 3ZU3A 2JGRA 1FXWF 2A67A 3O90A 5G0TA 4LDNA 5F98A 1DUIA 1NPYA 1P0IA 1BWPA 2X1MA 2X5OA 1LDGA 3JX9A 3P2EA 3Q1KA 4JGGA 3RSHA 5ALLA 3SJBA 2BFEB 5EE0A 2C5EA 2IYYA 2VBCA 2YRWA 4H3SA 2CXQA 1NBOA 1R6XA 1VE5A 1VJ0A 2X5KO 3C6YA 3GDHA 1DJLA 4GVPA 5AK5A 1UKEA 3RRYA 1LC3A 3S8MA 4FGZA 2L18A 3WKDA 2CJXA 3BB3A 3SC4A 5A3QA 1Y7PA 3WDLA 3KJEA 2XGSA 1TZCA 1HE2A 4C1BA 2YR0A 3PBKA 2AOTB 3F73A 2BH2A 3FHOA 1D5CA 3DGFC 4EB3A 2D13A 4H6PA 1T8YA 3SYNA 4D8UA 3ZHCA 3LBYA 1QGYA 1XDDA 1Y1SA 2FQQA 1LBSA 3DF9A 3GJYA 4HFMA 1CS4C 1RXIA 1TF5A 2IYWA 4HDCA 5JE8A 1XMVA 1GQ2A 1XJQA 4KQEA 4QXRA 4B9EA 3S1SA 4Q3OA 1JT9A 3S1AB 1U3FA 5BNZA 4KX5A 2PQMA 3CX8A 3MW8A 1F2TA 3JQFC 3IPAA 5K4GA 3BMOB 5I7WA 3N59A 2H11A 1MFZA 4R1NA 2W2XA 1RJ9A 1D4ZA 1HEUA 4WH0A 3SEAA 3NPAA 4DS3A 2QN9A 1JDSA 1IATA 1R8QA 3FRIA 1UJCA 5FWXA 1SAYA 5HM8A 1H2HA 1BEZA 1XRJA 3SDSA 6YASA 4N0MA 4BQPA 4TMKA 2Y9MB 2VDNB 4EO7A 5JMPA 2PUAA 2IQ5A 1Z5OA 5F2NA 1E2IA 3OZDA 1IEQA 1KEEB 3SIXA 1JHMA 2PA3A 3QJYA 4HAXA 1TYAE 2ZSFA 3NHUA 2A4KA 1FSZA 1IWOA 4RELA 2YIJA 2QRPA 2XXAA 3GJ0A 1YC5A 2AQ8A 4HB0A 5JYEA 1QHHA 4Q7LA 5I9SA 3OFJA 3MJFA 1XMPA 1F4LA 2WSLA 4YCMA 1X1SA 1VYUA 5JD5A 4MYCA 3CVVA 1GZ4A 4KKXB 5A0FA 3ZQUA 3IS3A 1ZGHA 3N2KA 5FNVB 4TL8A 5C8YB 1AS3A 1WWKA 3PVSA 1T8UA 1KP3A 1VBFA 4P4GA 2ZTVA 2PZKA 3B9PA 5F51A 4ONEA 1ZC4A 2HWKA 4BN5A 1Y3AA 4KNYA 2FI1A 1SCQA 3GQVA 4RIFA 3OCJA 2DR0A 3WOVA 1YZ3A 4JQCA 3W5HA 2FN4A 4QVGA 3WFJA 2IYLD 2PRJA 1L3CA 1XMXA 5JMTA 4GSYA 2FW8A 5LZ5A 3WC4A 2UVPA 4UHDA 4KL8S 4XDHA 1UJNA 1RPTA 3VH2A 1Y7IA 5ALRA 1OGJA 3ASZA 2OCAA 5K0NA 5AVYA 1NQUA 1VHWA 4J2OA 1H42A 4K5QA 4NJMA 4DQXA 2QLLA 2D6FA 4I9HA 4RZIA 9LDBA 3IGFA 3VU8A 2K6GA 4FVTA 3Q7TA 5J23A 3PK0A 5SY6A 4DT1A 3JRXA 3QBTA 4IXNA 1L4YA 5K05A 3DLBA 1OFUA 2B5VA 1CUAA 4BFTA 3PNMA 3IULA 4PYKA 4BVJA 1WORA 4QG7A 2YZGA 1E98A 1KO4A 3IBYA 5TDHA 3PNOA 4CM1A 3B2EA 2QP3A 1Q3HA 1X15A 1OYVA 3GGPA 1YNSA 5EP4A 2VNIA 2H29A 3IMFA 3ZNQA 4DOMA 1MB9A 3NEAA 1Y6GA 1IXRC 5LWQA 1U6JA 4Y9DA 4L4UA 5C8ZA 4ZYUA 1XD8A 2QD1A 1FP4B 1WSWA 3KJXA 4RACA 2IWHA 2BCEA 3LLVA 3LCUA 3ZBUA 4QU9A 1N6NA 4NOLA 2QLNA 1JG1A 2XAAA 1I4TD 1DG1G 5TGZA 2GERA 4KRFA 3QEKA 3AOGA 3FTPA 1USUA 3MAGA 2D0OB 3TSOA 4Y2TA 5LZ7A 5BSYA 4BVAA 3F49S 5HWSA 1SRRA 5AUPB 1R8JA 1YOVB 2OD7A 1LBEA 2GBIA 2P3SA 1OAKA 3DOEA 1NY6A 4WW0A 5GINE 4EX7A 4HLUA 3H2HA 2GHTA 4S1TA 3QE0A 5GADl 5AJTA 1EX7A 1KY4A 3A14A 1C30B 4U2KA 1BDJA 5ECYA 1G3IA 2XNSA 4H1HA 1HQDA 1SOMA 4EITA 5KOHB 1IC6A 1NKVA 1QZZA 3U40A 3ZJVA 3CUTA 1XCJA 1N77A 2F1IA 5K0GA 3EIUA 4V0KA 2QVYX 3MPOA 3NXSA 3C39A 1GEGA 4FBMA 3W2GA 4Q9HA 3O8NA 1KERA 1Z6AA 4GECA 4MP6A 3WIBA 1KA9H 4B5KA 1FDSA 4UTVA 1YITB 4MRMB 1QRRA 2V9ZA 2BC9A 3UBTA 2VPQA 4BNDA 1L4HA 2OCXA 2ZETA 1HMYA 3TTSA 4XI9A 2CLOB 3PENA 2EGHA 2Q1SA 3ZY5A 3QLUC 4QOEA 1PW7A 1R74A 3HRIA 1KK3A 5A0TA 1U5AA 2FQYA 2FE1A 1KWKA 4TTSA 4YCBA 4F21A 2XIQA 3PQDA 1JEQB 3CRZA 1MQAA 2QZZA 3HVIA 5L53A 4P92A 2B6HA 2XGJA 3AT1A 5G0SA 4ZZ0A 3RABA 1SZPA 4CF3A 2QE7A 3L0YA 5CEEA 2ZIAA 4UZSA 4DV1B 2E1RA 3IAHA 4OJTA 4X60A 3PFFA 1Y8QB 4MH0R 4FW9A 4U02A 5JTTA 2OORC 2CWDA 2ZRAA 2QAIA 3JQPA 2IOFA 1YZFA 4LZNA 5HZBA 4DBLC 4EJFA 2HU7A 3KXDA 3ZZ0A 3L1KA 4E15A 3PFNA 2OXCA 4MQ4A 2JLVA 1JTEA 3L7YA 4MULA 4AUKA 4AKIA 4GSLA 3RT1A 4HO1X 5AKYA 2C8VA 4QDXA 1J8QA 1HYHA 3FCOA 4GPEA 4ER5A 2Q21A 4RJTA 1MUUA 1S2LA 1U7OA 4K81B 1M1NA 2WFLA 4J1QA 5ALDA 1IM8A 3CBQA 5HW0A 4YP6A 2JZCA 1FK8A 2XECA 1DQNA 1IY9A 3CE6A 2R8XA 2HBZA 2ORYA 3CH7A 3V48A 1CVIA 3RFUA 3R0VA 3BX1A 4OHWA 2PKRA 4OOEA 2GO7A 4OLFA 3RBZA 2GXSA 1QO9A 3W9UA 1I2DA 3IQXA 4Y3UA 5I4IA 5JSFA 1VKRA 4QVKA 3ZWCA 3E03A 1E18A 3IYLW 4HWSA 4YH1A 5EIBD 3VPFA 3LRPA 3FCUB 3CF2A 4MYTA 3VNSA 2CLKB 4P3NA 5ILGA 1J0XO 3C5VA 1EEHA 3HNOA 3KKPA 3ND5A 4KE8A 3RAGA 4R31A 3AK4A 5CX1B 2QRZA 1B76A 2XBLA 2YFKA 3N3BC 2F1JA 1N2CE 2FZ5A 3ENWA 4IIUA 4R2LA 3RKRA 4YUVA 3T34A 1J2TA 5BOSB 1C2TA 1T3SA 3GGGA 2YHAA 1UIRA 3OLWA 3LOPA 5CNIA 2NUTB 1FDRA 2QU8A 3N39C 4GZ5A 3A1VA 2KM1A 5DLQC 4OBBA 1E9EA 2LTAA 4PCLA 2PU5A 4BDTA 3W90A 2YW2A 3R4VA 3LU1A 4Q19A 4DIKA 5E6TA 2W5UA 1ZWLA 1MHTA 4IH9A 4AKHA 3HEMA 3D6TB 4QECA 3AY7A 4W5JA 1NVVQ 3CD6B 2F2TA 2YN4A 1JG3A 4E0BA 3GFFA 2Z4RA 4RVFA 1CLEA 3LP6A 2P9CA 1R1DA 1EGVB 4ITUA 1NVDA 2DFKB 1D2HA 2JFYA 1W4BA 1XA4A 1NG1A 3VVLA 4INAA 2F9FA 5LQJA 1PG0A 1JQBA 2X9QA 2XLCA 2ZRLA 5REQB 1AKWA 3ABQB 4MYSA 2HIHA 1OYYA 2PEYA 4EQ6A 2XI4A 4BXOB 1A9YA 1DG9A 1JR3E 5AI9A 2ZATA 2FU5C 1WKBA 3NX4A 2NXWA 3FCAA 4UMFA 5JADA 1QFJA 1JW9B 4F7WA 4ARAA 3FPPA 1XI2A 3GZ4A 4N6NA 3F46A 3WLAA 5BSEA 4CFSA 1EM8A 1SD5A 3U1TA 2ZRGA 3GD7A 5HRCA 3DYIA 4ZMBA 1I7SB 5TVGA 2HNKA 2KSQA 3WKBA 3P9CA 1VKJA 4AS3A 4CEJA 3BYZA 3BC9A 1OAOC 5MN5A 3ID6C 1ZVQA 1W5BA 4L3WA 4LJ5A 5BR7A 5HTOA 3O8BA 3CUYA 3HTXA 4H7KA 4CDGA 1VJ5A 4QGFA 3KTFA 3KB6A 3OWOA 4WQMA 2ZE8A 4IP0A 2VL7A 1T8SA 3D3KA 3TE6A 2WOOA 1EXDA 4BGUA 3FZNA 1Z08A 3GU3A 4EB8A 3QWAA 4YV1A 4B48A 2RB5A 3KFXA 4UE3S 4BY9E 2XMZA 2JANA 2ZCVA 4NFSA 4YR9A 4ZQFA 4B3DA 2QPTA 4H6VA 4W7SA 5KX5A 2EFGA 1PGOA 4LRTB 2XT9A 4L75A 1CR1A 1RCUA 3KOYA 4LZLA 2JCVA 2YWGA 5AW2A 3JZDA 2C8KA 3PIDA 1HKHA 1PU2A 3B1KA 2QP9X 2M6SA 3NASA 4KQCA 2VSFA 3S3TA 3TNFA 2IYZA 4DUGD 1GU0A 2W0MA 2OENG 1QV9A 3IDZA 3BXOA 2Z1MA 4JJEA 4MROA 3G1UA 3ZCVA 5B36A 3FIUA 1OJLA 1B8UA 1HKUA 3R1IA 4JMPA 4MUJA 3VPGA 2CLMB 4K0RA 4F11A 4L0MA 1FNNA 1UXGA 1NLUA 1PG5A 2XCIA 1C50A 4KIUA 1XXHE 4GT1A 2NSYA 4GBED 4B75A 3RLIA 3JASA 2L2QA 3QPCA 3DTTA 1O94C 3EVZA 3HY3A 4EI9A 2HAEA 4CN8A 1RD4A 3OLZA 4CDNA 1X42A 4DNRB 3DV2A 3SI7A 1RWXA 2NZ8A 3QUCA 1O9HA 2WPDD 1XZPA 5DI9A 3ISXA 3AZQA 1JQEA 3BK2A 4DM4A 1U0RA 1DBSA 2H2HA 1MW8X 1JL3A 2ADMA 3M33A 4JU9A 1EM6A 1EFDN 4B3RB 3W3AA 3EMKA 2V54A 3LDFA 1T0JB 3ICEA 1H8ED 3AYXB 1RJGA 1PV2A 2HJRA 4XD2A 4C3ZA 2XGGA 3WFIA 3M4YA 1RTKA 1KJWA 1ZCBA 1GV1A 3N0XA 3F5DA 2I4NA 3I4CA 1GKKA 5IHXA 1VC2A 2WVHA 5GOTA 1KOGA 3MTAA 1A5TA 4LRYA 1FUEA 1OPXA 4H0CA 1N4AA 3E2IA 4H7FA 4LDAA 4AMUA 1XYYA 4TV8A 4NKRA 3V2GA 1E5QA 1THMA 2X4GA 1YJ8A 1JU4A 4BNHA 1QX3A 1RIIA 1YR8A 3HXPA 1XYGA 3HJBA 7MDHA 3RYIA 3OURA 4BVKA 3BH7A 4ED9A 4F38A 3NAZA 4O08A 3DONA 2XVZA 3WBFA 2QDXA 4UEQA 3AHJA 1Z0IA 3L84A 1C1DA 1T25A 2QQGA 3H1EA 1ZH8A 3PYLA 4TZTA 1L4LA 3G2NA 2XMPA 1ZKMA 4WFIA 4ESOA 2D1SA 3DCJA 4PCUA 4LVOA 4WK0B 1JJIA 3W7VA 4CODB 8ABPA 5AOVA 4DDTA 5LIRA 2JLZA 1SHJA 4J0DA 4X1KB 3UWKA 1UBGA 1PV1A 4MNTA 4X0CA 1BQEA 4R8RA 2IGBA 3TZCA 2ZWOA 2XCTB 4F5EA 4Q4LA 2FRXA 3K73O 4LDJA 1ECFA 1STOA 4U3JA 3BXPA 4H6XA 1AUXA 1EWKA 3L7OA 1BN6A 1WEKA 5FBLB 4WADA 3T7AA 4NBUA 4RVSA 1AUVA 3HLYA 4KGXA 5AKXA 1YBAA 2X0RA 1KPGA 4KN6A 1QVVA 3RFCA 3DZDA 1DHTA 1B1CA 1P2TA 2VRNA 5CH8A 2EP7A 4WNIA 1Y33E 4GMHA 3EIQA 3OM0A 3V1TC 3RIYA 4C0BA 4Y9RA 4RH1A 1YDHA 3OBIA 5EI5A 4EKEA 5P21A 3FW1A 3CCUB 3EY4A 4BEVA 4DV5B 5CYFA 4S1VA 4WLNA 2GWHA 4RK4A 2RGNA 4PQRA 3PHJA 2QLTA 1OHHA 2I8CA 1L8QA 3VR6H 2WSYB 2HJGA 3ZS9A 2V7VA 3H94A 3PYMA 5DGIA 5DI3A 3TZBA 4DM3A 2OQVA 2AK2A 3VSCA 5JLAA 4DYVA 4PYIA 3JQAA 2FUG1 4M1OA 5DCYA 2B5OA 3D6UA 1F6BA 2YDXA 4QARA 5HKAA 2CLIB 5T4EA 4JOQA 4A0GA 4WZZA 1JKXA 1M72A 1HVXA 2P9FA 1ELOA 3KOMA 4UDXX 3WRXC 3CCCA 1O6CA 3PC8C 5EQDA 3SVLA 2B4RO 4NBTA 2ZPAA 4KDEA 4P0QB 2Y1FA 5TRDA 2AXEA 3R3YA 4UBNA 3ZR4B 1KYTA 3ONNA 2YFYA 1RPAA 1ONPA 1NJFA 2YOFA 4YVFA 5DNAA 2GEDA 3PPWA 1JDJA 2FFQA 5KNBD 2B8WA 2DHQA 1BGVA 3DEAA 4BLOA 2P3OA 5E7MA 1KZHA 3DSRA 1SM4A 2G09A 3ZK9A 3AU8A 3K70B 3GHHA 4M86A 3CLSD 1PJ6A 3WQBA 4RULA 2XOEA 3BTSA 1ADCA 2P0AA 3Q6IA 5E0OA 1WZNA 1DWPA 2RHBA 3I1YA 4OKNA 3T38A 2TMYA 4YAUA 4R7GA 1AKUA 2JBHA 2C3MA 3VDRA 4CG3A 3CZPA 1YRHA 2HTFA 2R1TA 3IMEA 4PX2A 3NAQA 1R0ZA 3DP7A 2C3UA 1FDTA 3O3NB 4WZ6A 1GITA 2H7VA 3FPHA 3L8FA 4YMHA 1NOKA 3ZWXA 1GYRA 1KE1A 4B81A 4EOGA 2J7KA 1KI6A 3DAFA 3AILA 4EI7A 3KPWA 4RAOA 3V9AA 4WOPA 4Z4QA 2ZE7A 3ICWA 1CDOA 1PBTA 1OGYA 2HBRA 2J3QA 4JBNA 1TECE 2WAAA 3S81A 1NM5C 1YB4A 1MN6A 2P69A 1QZ3A 4W5HA 1K9VF 1V11A 2QNRA 1EVKA 1KK2A 1U63A 3VYTB 3RS4A 5GV8A 2BEUB 2JLCA 3QSGA 1OLOA 2IU4A 3GCXA 4F2HA 3ZU6A 5IJZA 2GKSA 2C58A 1W52X 3HMKA 4PAQA 2XB4A 1EVYA 5KJ1A 4JLUA 1RWBA 3H5RA 4L95C 4KO8A 2RHJA 4CL8A 2V45A 1MRZA 2OVFA 1VQOB 5EJ8A 5KYWB 3HKBA 3R8FA 3L43A 3ZBTA 4YNBA 4IQ4A 2XNDD 3F1KA 4HWTA 5CT5A 5ALWA 3I9V6 4AL4A 5BNWA 1R0WA 2IUYA 4PFSA 2EATA 1SN7A 4LWOA 5CX4A 3ZHOA 5HKBA 3MCZA 5KTNA 4PGOA 3OTIA 1P0CA 2OOSA 3I2KA 3KKNA 1M7GA 1T4GA 3O2SB 3SGLA 3HI4A 4OAQA 5U9CA 3IP5A 2A9KA 1E1QA 3M1AA 2X0IA 4CJXA 4F3TA 1RPNA 3ESDA 4FYKA 2OPHA 5HRUA 4RM0A 1OXSC 4I4NA 3TGLA 3BH6A 3L1IA 1IRIA 1OZAA 1K8AD 1TT5A 1DBWA 3IUJA 4KWEA 2O9JA 3PQ7A 4X45A 5AT1A 1T4CA 4DMMA 5J4YA 3OX3A 2LP4Y 5BPHA 4HDNB 3KQKA 3GP5A 5HYVA 4NU6A 3SD7A 3QX7A 3ZWMA 4AJLA 4PR0A 3T1NA 1AKEA 3CEPB 3L6RA 1M1KD 7MHTA 4GFDA 3DCYA 1BXGB 4MQEB 1NXOA 5H02A 4Q9IA 5KW9A 5KKNB 3GUCA 3X44A 3ZI4A 4ENUA 3QUBA 4MJLA 5DBFA 4Z2YA 3DJFA 4PLCA 4WCDA 2I65A 3TG2A 4CLRA 3JQ8A 3HV0A 3U48A 2FZLA 3EEYA 3I1JA 3V1MA 1EZ4A 3ACBA 3QMVA 3R74A 2VH5R 2O50A 2WJ3A 2Z1DA 5IDVA 5ADUS 4YJGA 2HF2A 3FFXA 5IM4F 4H59A 4IEFB 4CKCB 3MJEA 5EGSA 4K6MA 3JD1A 5K01A 2PAFA 1Z82A 4R6WA 1QONA 1WHTB 5DWVA 2OCDA 3SICE 5AMXA 3ZVLA 2IYNA 3EEBA 3H5TA 4EVQA 2V4DA 1EVEA 3F5FA 1YIJB 3KAPA 3OESA 4WVFA 1ZI9A 3KWLA 1L4MA 4CTJA 4TMYA 2WZPP 4HGOA 1L5WA 1T4BA 2IYEA 4TYNA 1Z4LA 4LJAA 1V48A 4P12A 5IBRA 3QU4A 1Z7YA 3F78A 2YZMA 4MB2A 4DA7A 4EB0A 2I9KA 1JWLA 1N2OA 2XVXA 4UE6A 4A0HA 4XSHA 1JLKA 3HP7A 1A5BB 1NWHA 4P38A 1E9FA 3ABIA 4A3SA 4G5GA 1QGAA 3CCQB 1CJKC 3B9RA 4R71A 3D8HA 5DHRA 4YYZA 3E5MA 3PUWA 4TKUB 5BSKA 1U7ZA 3COYA 4TWBA 4V38A 3BXFA 4AF8A 2I4LA 4PRLA 4PFJA 3FPGA 4RMGA 1XTSA 4P5PA 4XVCA 1JAHA 3GVIA 1AHNA 1DLIA 5LMZA 3NHRA 3OKAA 4CM9A 1YIAA 4KOEC 3ZLUA 1EP3B 1ZJ6A 3B1XA 3SHOA 1OKKA 2R79A 2ZB3A 3AONB 1B8OA 3UT5A 2ORWA 3EVBA 4C5AA 1L4KA 3KT6A 3STTA 3OE1A 1PR9A 5DEIA 2B0JA 3JD2A 1P8JA 1J06A 3NV9A 3PR1A 5AW1A 4IX1A 2C0CA 4P25A 3I39X 3CW8X 4I8DA 4LMRA 5IKPA 3REQB 3HVHA 2XRMA 5JAHA 4WNCA 3WGLA 3ANMA 2X6XA 2PBRA 4JJGA 3WP0A 1PJTA 2ZSKA 3AM4A 1VL2A 3IKMB 4RK5A 3R6DA 1A76A 5IYNA 2YXEA 3C43A 4IRXA 4MR9B 5MGBA 1OR8A 3RYHA 1YSCA 3CJQA 3G1TA 4KQ2A 3QSYA 1ZOSA 4F85A 1JECA 4U8GA 4EFLA 1RLOA 2OGTA 3U4AA 3WV5A 4Y0AA 3I3OA 3CX6A 1MDBA 3QRWA 4Q4CA 3TH5A 5HJ5A 3G88A 5IKOA 1VL6A 2E55A 4F2DA 2VNAA 1XN4A 1CKEA 4RLQA 2ZT7A 1GGJA 4R9VA 4HE6A 2DUWA 3VR4H 5EQTA 4LBVA 3V3KA 2VYVA 3DHVA 1JHYA 3DE1X 2H5JA 4P34A 2W2TA 1ABFA 1QHNA 2H4FA 3C5HA 1H66A 2XAUA 3ED1A 3Q2IA 1KPHA 3A4LA 4ZDIA 5BWMA 5FTKA 1KVRA 4MRPA 3U4HA 4KH0A 4QAJA 1TMOA 2ATEA 5ICFA 4BJ3A 4YCCA 1AKVA 4AJ9A 1A95A 1E4OA 1HFJA 4EB6B 1MC1A 5HA5A 2DFPA 3U39A 3O84A 5KCMA 5AWFC 3CR7A 4CF6A 2ZPTX 3CN9A 1DFGA 2W22A 3DFKA 2I67A 3H5NA 2PBFA 2V0NA 1U0JA 4B74A 3NWOA 1T3HA 1T2DA 4MYDA 4EBBA 4X7DA 5J35A 4G97A 4MCHA 1FNSA 3AEYA 5CFNA 1OH6A 4JYZA 3FNIA 1KSGA 3GUZA 4KACA 5BP7A 1A88A 1ULHA 4MIYA 1I36A 2VHUA 3ASSA 1CZNA 4MVJD 1V45E 2YKGA 4RPBA 2H2AA 3GPDG 4HDMB 1J23A 2W48A 4JBWA 2PAAA 4KUHA 2CD7A 3N8KA 2G9VA 3VDQA 2IY8A 5KQMA 4BX9A 3EWAA 3HBFA 1L7OA 1V7CA 3DD1A 4BBJA 4C3UA 3MCTA 3S7ZA 1NUSA 5CAEB 1ZMTA 3PUIA 1YVDA 1ZW6A 3BCSA 4ZI7B 4NK4A 3U26A 5EKTA 4QVAA 4QDTA 4E2XA 4FYJA 5B3LA 1OB0A 4LYGA 2FJUA 1U9ZA 3DE0X 2Q49A 4NOMA 3R9IA 3KYDB 4R2IA 4C08A 1ZYUA 1YOBA 3CMCO 3B1VA 2WWTA 3G8CA 1QLHA 3M4XA 4ALKA 4DL9A 2Q1TA 3C1TA 3PC2A 5BQOA 2WWYA 1UKVY 3AWIA 2IPAB 4QULA 2DBZA 2OV8A 1FP6A 4M55A 4ZT2A 2NVWA 5TVKA 1L4NA 4C6HA 4JYPA 4JN6B 1TRHA 5AI6A 4YDQA 2XVMA 4TSFD 4URFA 4XJVA 1IQUA 4M6WB 4RL6A 2PZJA 1CUIA 3LQRA 3Q3VA 4GBGA 6PFKA 1UK8A 3LO8A 1DBQA 3B85A 4JJ8A 3HA2A 4N7RA 4CM4A 1RQXA 3IE1A 1XDGA 3B53X 3K0CC 5G4LA 1X7YA 5K5EA 1RAEA 1O4WA 3M5WA 1OBHA 4U7HA 3WOHA 4ABYA 3HBLA 5ARBA 1HSZA 3R8CA 4KXFB 1FZQA 2HF9A 4IM7A 5KQGA 5K4AA 5CDTA 2Q2OA 3AUFA 4LNUA 5AW0A 3VPCA 3L1VA 4BLWA 5CFOA 4XXHA 1Z6GA 1G2IA 1U0EA 1TAGA 3VGJA 3VPSA 4CM5A 5KU7A 1B7GO 1PSZA 2GJ4A 4L6CA 1GT91 2COKA 3ZDZB 1I1HA 2WNIA 2FW0A 3U7IA 4ECEA 1XD2A 1RYNA 1VPVA 4XL9A 1XVUA 1VI5A 1D6NA 4M53A 3C6MA 4Q00A 1K6EA 2JGEA 2R6GA 5DULA 3ANSA 2JH8A 3FWKA 1AA9A 1SQ5A 4CKWB 2ET6A 3MFYA 5IP5A 3TGWA 5LJIA 4NCXA 4F96A 1QTIA 3NUZA 3AOEC 4NAHA 3CCBA 1A1VA 3EVCA 2WU0A 4AG6A 4NICA 2JCXA 3U4IA 4RH0A 2YN0A 2JIDA 1QPGA 3K1AB 2O1WA 5CB0A 2XSZA 4OA5A 1VKOA 1UZLA 1TM5E 2GJPA 1USGA 1JS1X 1PLJA 4MCJA 4MVJG 5TQ2A 2AFHE 2SNIE 4KC0A 4F04A 5JQWA 5JV5A 5KHLB 3LDUA 1KQFA 5CA0A 4JI0B 1JTFA 1J0BA 2QWXA 4MCIA 3VZDA 4ALLA 1LSUA 5CFMA 4US0R 1NQ5A 5KI6A 5B1HA 1ZINA 2C77A 4ZGGA 3VYWA 4WACA 4QRIA 5FUBA 2B30A 1GNVA 1A27A 3QG5A 5DSXA 2EBHX 1G60A 2IZZA 2LBPA 4H27A 4FZJA 5H82A 4DJFC 1F6DA 1X7XA 3JQRA 2CYAA 4JEMA 5D8DA 1CQIB 4FMDF 3LHIA 4JY7A 5C0OE 1H6CA 3DZJA 1MNQA 3TKLA 3ZHRA 2WJYA 2CJPA 1P6XA 1D4OA 1G3UA 1TAQA 1WU7A 1OJ7A 1Z37A 1G0NA 3OJWA 1UKYA 2JBAB 3A9WA 2OV2A 3MUOA 4KKVA 4YJ3A 5FHRA 1C9EA 1VHDA 3QYAA 3TVTA 4MAAA 4BB9A 1L7PA 2PMBA 3KTAA 3HDQA 2II6A 2PM8A 1JXMA 1Z75A 1GNSA 3SP1A 3F2IA 4UOEA 1V0EA 1Q92A 1TA9A 3VJRA 1YLOA 3LL7A 5K99A 4G0WA 4MA5A 1CC1S 2QGZA 2Z8YA 1Z56C 3IP7A 4I0WB 3ZD8A 2J5BA 1ESDA 3BWMA 4CTNA 3K9QO 4IR7A 1G9XA 3O1JC 1JJAA 2AI3A 4RO0A 3WIEA 4YO8A 5FLYA 4E51A 1Y1TA 4MUGA 1ND5A 2Z2IA 1I0IA 5LZ8A 3DOCA 2ZBRA 3HFGA 3OO0A 5FWYB 2AUNA 3S2FA 3H3FA 4OFWA 3ECAA 2EHDA 3KFVA 2Q4BA 4J6EA 1HRKA 4E07A 1ZUIA 2YMQA 5B1EA 1Q91A 5A6SA 4I9UA 2BM9A 2V58A 3O4HA 1E2MA 3ADCA 1D1NA 1NBWB 5F1YA 3ZQ6A 1VQLB 1Z5PA 4DUYB 2ZS9A 3LBAA 1XZFA 1UP4A 2OVBA 2W8BA 4RE5A 5JIBA 1M8GA 2P5UA 4KDRA 2GUGA 1PYOA 2C7RA 5JEDA 3EMDA 4ZYTA 3H17A 4GR5A 5C5IA 3OQOA 3RWMB 1EJ6A 3VO8A 2PMCA 1DQPA 1EQAA 3VR3A 3QFFA 1ZGBA 2Y0PA 4JA2A 4XQ9A 3V7FA 1HLDA 2A94A 3EBLA 1VG8A 2QEQA 1CEYA 1JEEA 2OZPA 1T9GR 2AH5A 4R8LA 1OX4B 2EG9A 3CF4A 4YEJA 1TC1A 5JSZA 5KYGA 3ZD7A 4RFVA 2ES4A 3D6JA 4MXDA 4IHJF 3GVJA 1K5PA 3K8YA 5D5PA 2CFIA 1M7BA 3U6BA 1N5OX 1YC2A 2BHTA 2MOKA 3K96A 2H17A 2Q9UA 2QL7A 4D26A 2HLDA 4N3CA 1Y6JA 3AIOA 4FQ5A 5TMBA 2YTZA 1JEAA 2E82A 2LD4A 1PQWA 1QIMA 3JYQA 2PZGA 5K09A 3BUSA 5KTRA 4D45A 4B3XA 4LVCA 4BO8A 3Q8MA 1NU6A 2VA8A 3LKVA 3HDHA 3A4MA 3M5CA 3VR2A 3E84A 4Z9AA 5F5XA 5FYQA 3AVWA 2YIVX 5FUVA 4AX8A 1KSHA 3ENQA 3OLQA 5AI0A 3T12A 4HS9A 2EKPA 2I4MA 3EPJA 3OKXA 3JTMA 1DTSA 4Q5IA 3L8HA 3FTNA 4UUPA 4OUDA 4U63A 5AHWA 4MI1A 4HUTA 3TUJC 4TS9A 2OFFA 3LHSA 5L6LB 2PNFA 3EGVA 3BTUA 1OB2A 4K2AA 2OTJB 2UVDA 3K1TA 1ONSA 2YBDA 1USVA 3R7FA 3I8XA 3HN7A 5CTAA 1NMZA 3GN1A 2WWHA 4U6QA 4OK6A 1S8FA 1XL0A 4LNHA 3USCS 4A82A 4EMBA 1WQ1R 4XB6B 4OH1A 2DXIA 4YONB 1ZUWA 2QTVB 3O8OB 3PDIB 3M6WA 5KB3A 3CTPA 4O02B 5GJCA 4BX8A 4TROA 2AX3A 1JV2B 1RHJA 2VJIA 1C3LA 2PRSA 3MLBA 3QMMA 3K1YA 5B4UA 3H99A 3IR5A 1S4QA 2ZWMA 3AFNA 4HYTA 5CH5A 4WJLA 4Y2PA 4M0CA 2ZXFA 4RM2A 3WJ1A 5HIKA 5J4VA 4JWKA 4Z99A 1VIAA 1NVMB 3IV9A 1IJKA 1L5OA 3L01A 4ZZ1A 3WBJA 1EGQA 3RR2A 1M8KA 4L27A 1QQBA 2G9ZA 3STYA 3G68A 2P3MA 1OA0A 4BVFA 1SBQA 3EG9A 4AYWA 2GETA 4JL6A 2QRNA 2WSMA 2ZXIA 3TQCA 5DE3A 4BNJA 3RUHA 1SUPA 1QKJA 4IGFA 1O95D 1YJWB 4ENTA 4YRMA 1FPQA 3CUEF 3RVQA 1L8XA 1A4UA 3BD6A 2G5CA 2EW1A 1JEDA 3KB8A 3P0HA 2FEPA 2IYRA 3O5AA 1Z29A 1QK3A 4LVUA 2LDBA 5FOUA 1DSSG 2Q2WA 1XL1A 3TW6A 3BTOA 3KPVA 2FN8A 2Q4TA 3VDXA 5JAQA 2IPMA 1O54A 5AIBA 1ZD4A 1VB5A 2ZGVA 3RTEA 1I3MA 4LXIA 2FEMA 2LCIA 3O3CA 2XZLA 3TZEA 3C98A 1ADFA 3VC7A 4C7VA 1HOTA 1YCFA 3MWDB 4WNYA 3RLFA 4EGCB 3ZWDA 4EUHA 5BN1A 5JAOA 2IPLA 2C57A 2ZBEA 2YBEA 3MJTA 4YMSA 1KH3A 1T0UA 5DGDA 1GFWA 2C9OA 4EH1A 4PSDA 3HXOA 1HXHA 2FSVA 2OKCA 1M5TA 4LQCA 3RC9A 1AMNA 1NBMA 4MW6A 4RK0A 2YDYA 1ZCFA 1BO6A 4NVRA 3WL8A 1TQ8A 2NYUA 2HA5A 4AIRA 2XDAA 3BFXA 2B0CA 3P5BA 1RM5A 1VRCA 1VECA 3V4PB 4XSGA 1HDZA 4IMPA 1LDEA 1QQ6A 1Z88A 1ZD1A 4G56A 1HYEA 4ASUA 3NTOA 4OJMX 4PXAA 4QIHA 4EHNA 4TQAA 1UJ5A 3UPDA 1J20A 4FMCB 3BMCB 3QKUA 4MRVA 4Y0VA 2W11A 3Q1LA 3VX3A 1U8AA 4MGZR 3HZOA 3LYAA 2ACEA 1RLJA 1UM9A 1Y3BE 2WMNB 2B98A 3OTWA 3E20A 4DLSA 1Q1AA 3C15C 4JLBA 2P9BA 3AIIA 3SIPA 5BR8B 3EFOA 2XDYA 2AR7A 3GLIA