2VZOA

Crystal structure of amycolatopsis orientalis exo-chitosanase csxa
Total Genus 274
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
274
sequence length
850
structure length
850
Chain Sequence
GNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSEFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
total genus 274
structure length 850
sequence length 850
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzoA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzoA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzoA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzoA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzoA03
1QKZH 3HC3H 4MJIE 4BSWA 4QRTB 1JGEB 4JGUA 4DEQA 4N8CH 2VISB 2BV9A 1EZVY 4ODBD 4TVCA 3LS5H 4U1HB 5F1KC 2BVQB 3OKLA 2YPVL 2F53E 5GS2D 1T2JA 2I07A 3G5ZA 2A73B 4GQ9H 2WWDA 1ETZB 3HPLA 2M1KA 4I0PD 3QPXL 2ZUUA 1CWYA 1W3JA 2XSBA 3HRZA 4N9OB 5JHLH 1YJDL 3KXFA 1W9SA 1Z9OA 2A0LD 1UYZA 1I7RB 2BNRB 1JL8A 3NA9H 3WUWB 2DRUA 3MLYH 4RISL 3R1GH 5I74C 2GIYA 3GI8H 4LKXB 3WFBH 5EZJA 2ADIB 3BN9D 1ZS8B 2QQKL 4WLCA 1KC5L 1OCWL 3MROA 4KKCD 5HHOA 4Z2JA 3TBSA 1QEWB 1XF5B 4M81A 2W94A 2B4CL 4YHEA 4MNLA 4KPHH 4W4NA 4EEEA 4N90E 4M48H 4V2XA 2J88H 3KR3H 4PN2A 1LGVA 4PMNA 4ODVL 4WFHE 1U30A 2CDGB 1KULA 4P59H 5HVHC 3AB0C 4FRWA 5TDNA 1EFXB 4WW2A 4K8RL 4CJ1A 1GAFH 3ARDB 3VXRE 1TZHA 1KB5L 3MJ9L 3VH8G 1OQXA 1AHWB 3GI9H 4PJBB 5GRWA 1XGYH 5AC4A 3QIUD 1FV1A 4JFDD 1RU9L 4PG9A 3KYOA 1FZKB 2AW2A 1L7IH 1HSAA 2DMBA 3OEBA 4JY6A 5JUEL 4LQFL 5AY7A 3MTRA 3VIJA 3SCMB 4POZD 3DX7A 4PJ8D 1BD2E 4HS6A 3ZHLA 1UX7A 2KL6A 4ZUWA 3RIAK 5F1IA 1QBLL 1FZOA 4MB5A 3TO4D 4LVHC 1BIIA 3S35L 4LQFH 2DI7A 1T21B 4ZO7A 4YHLH 3ZT6A 1KN2H 4PGCA 3WD2A 5E2UH 1DEEB 1E0WA 1CF8L 4OGAC 3S3JA 2OI9B 1ULVA 3BDBA 1FGVL 1Q9KB 4V1DE 4ZFOA 4QY8A 3MJ9H 4W70A 1IEBB 5HHPB 3QPXH 3LKOB 3RL2A 4QXUL 1F4WH 3UMTA 5C09D 1RJYB 5IV2A 5C07B 3OQ3B 2YD7A 4NUGH 4JRXB 3V0WL 2NLJA 1NMAL 1CIDA 4YGVA 1N8ZA 5AUMB 1J8HD 3BPLB 1CLYH 1R5IB 1XF2A 2VXVL 3PQYE 1NGPH 4XP1H 1TJGL 4KPHL 4FQJH 2Y5TB 2EE6A 3BD3A 3QEGL 4BUGA 5KBNC 3HAEH 4FMVA 1WAAF 4P2QB 1QZ1A 3W5MA 3RRQA 2UV3A 4YHOH 1IGIL 1KBKA 3SUTA 3O9WC 4FQIH 3ZHDA 3RVXC 4MA3A 5E8PB 4WU7A 2ESVE 1PY4A 2CBJA 3T8XB 3PXJA 3QNXA 2BRRH 4EOWL 5F88B 1TJIH 1FIGH 5IMKB 3UYRL 3CZKA 1HI6A 1IAMA 4Y5XB 4JY4A 3RY5A 4Y4KA 5SWSB 1JPTL 3EFDL 3KLSA 2GK0B 3VI3E 3VUPA 3NFSL 3VFSB 2CO6B 4KVNH 3TH3T 1NQ6A 3VNZA 1F3DJ 2EEDA 1ZHLB 2R8SL 1IC7L 3VXOB 1JJUA 5KZ6A 4X0KA 4PYSA 1W99A 2ID5A 2AABH 4ZOEA 3IJ9A 4DKFH 4LHQB 2QADB 3CX5K 4G8GE 4DW2H 2XT1B 4JFDB 1P4BL 5F7DB 3F5LA 1GGYA 2GHWB 5D71L 3ARTA 2EH8L 3PGFL 1XR8A 5ISZA 5I2IA 4V2CB 1E9LA 4Z7QE 4E41B 4M48L 1QFWI 5HGBA 1UA6H 1ZT7B 4OD3H 4EXKA 3QDJA 3NCJL 2OLHA 3JTSB 3WSQH 1TVHB 4XVUD 1OWQA 1YUHB 3WEXB 1IRAY 1NMCC 3QWQB 2DQCH 1I1RA 2X4SB 3MR9B 5JLZA 2WMKA 1XNTA 1LO3H 4PYGA 3NMEA 5FO7B 1QI5A 3U0TA 3RNKA 1FO0H 4M8QB 2TAAA 4XZBA 3CFEB 4FMKA 4D0CA 2N7BA 2BERA 3MV7B 3TNMA 5CEZL 4W8LA 3RDTB 3I2JA 2Q3ZA 1DFBH 2WC3A 4WUKH 1Q0XH 5FYLL 3GBNH 3Q0HA 1O6IA 1GGUA 1CYGA 2EDYA 2FEEI 4G6AC 1UWRA 5F7YC 4TXWA 4MNQB 3JV6B 4LPWA 1FRGH 4MADA 3OKLB 4LKCA 4HS3B 4ZPTA 5BXRA 3JVGA 4MD5A 2H32A 1KIRA 2BOCB 1M05A 4WUUB 2X0HA 2XWDA 1L9MA 1YEGL 2EDHA 4WO4B 1U8JA 3MXWH 4UDTB 3MV01 2OYPA 4A44A 1WLHA 5E0FA 1P9MA 4BSWB 4BQ5A 2AJVL 5A16B 4TUJB 3VFOA 2ZWYA 5BROA 1BJ8A 2NLJB 4LARL 1N4XL 1DVFD 4Z18A 5E5UB 4B9ZA 5HI3D 3QR3A 2B0SH 2Q7YB 3L2MA 4UTAL 1NGYB 2WYSA 2Y07H 2YBRB 3MUZ1 3CH9A 5JHDA 2A73A 2BSSB 5DA4A 2FD6H 3MUHL 3VG9C 3OGCA 5D8WA 2BVQA 2B2XH 3MREB 3RVWD 3BKYH 3VXQA 5B39A 1E1FA 1T20A 1A3LL 2YMXL 5CP3A 4L4VE 2AJ3A 2CKNA 3BEWB 2UZYB 1CR9L 4XHJD 5TDOB 5C0DA 3UR8A 3R0MA 3TYFB 4PRHE 3QOMA 5CPQA 1IQDB 2Z93A 2YZ1A 1ZGLB 1L9NA 3RGHA 2DQTL 3UTTA 3TM6A 1QW8A 2ZZUT 4X6CA 5F7HA 1DYOA 2ESVB 1SYVB 2CO7B 1OW0A 4OI8A 4I9WD 5G05L 1ZV5A 1I8IA 5T1LD 4HH9A 2OSYA 5TQ0L 2QQJA 2MQ0A 4WIWA 5CEXA 1BLNA 3FT2B 4G8GB 5EO1A 1R3JB 1H8SA 1DQTA 4XGZA 4IRJD 4PJ8C 2MPAH 1I7UA 3SQOH 3VFRB 1F5WA 1U95A 4ZFGH 2WSPA 3IT8D 2DSKA 3PP4H 1BIIB 4JZNB 3OGOE 4FFYL 3F5WB 1YEJL 3GKWL 2ENYA 3VVGA 2Y72A 4HT1H 2WHKA 2BSRB 1TPXC 3K75B 4FXKB 3SDDA 1GSMA 3P4OA 4F3FB 1TZ7A 4EI5A 2M26A 3VINA 3FFCA 2R1XA 1UYWL 4E41E 4R0LB 4HZLB 1BGXH 5FA3B 5AAMA 1GOQA 2OZ4L 4PG2C 2HH0L 3WL9B 3WD1A 4XBGA 3C8KB 2QHRH 4NKMA 1QSEA 3PABB 4PRWA 3FQUB 5CWSB 1PIFA 2ZUQB 3OL2A 4EN3B 2AEPL 3GMNA 1X5YA 2JELL 5A69A 4TSAL 4NHCH 4H8UA 4A3ZA 3LKPA 5FKYA 4AQOA 1CGTA 3V8OA 4G43A 4WU5B 4MGSA 5DJZA 2LABA 5IR1B 1WCBB 1YEEL 1MHEA 3SGDH 4NRZA 1TCRB 1UWXH 4FQXC 1V02E 4BZ2H 1ZGLA 5GJSL 3AROA 1D5ZB 4LCYB 4HBCH 4EDWL 4QP0A 2R0LL 3MV7E 4JEGB 4CAGA 3UESA 4GXVH 1JGEA 2C3XA 1UKPA 5LGJA 3HPJA 1IGFL 1VGEL 3QIBD 3HNSL 1MCWW 1OLLA 1JHJA 4FHBD 2F5AH 3MGAA 4O5LL 5C9JB 4A6OA 4NDMB 1JPSH 3P11L 3BPNC 1FAIH 2BSSA 4M1CC 4ARYA 4IPLA 1P7QA 5IHUH 3BZFB 1G1YA 4QHUB 2V5RA 2GK1B 4Z7VB 3KXFE 3IU3B 4Z0BL 3EYFB 4L0PA 1I7TA 3P9LB 4ZUTA 2BFGA 2GJ6B 3QDGA 1RUAH 3CU1A 3KLHD 1DEEA 2EEXA 4PGJA 5I77A 2NTFB 2KPNA 1UC6A 1E6XM 3GSWA 2MPAL 3SQOL 4EUPA 2HFTA 3IDXL 3TA9A 5ABHA 1MJUH 3LSOA 3R4DA 3IGAA 2VQTA 1Q1JL 2GI7A 3JV4B 4FXGB 5CLWA 4OZIF 1U8HA 4P5YA 2J8OA 4R3SB 43CAB 1U8KA 1W1TA 5CUSH 5FHBH 5K9JH 4HA1A 4X5WA 4M7LH 5ABDE 3S97C 3PUHA 5B21A 5LA2A 4OGYL 3AHYA 5BW7A 1GPFA 1SEQL 4U1JA 2PTTB 3WF4A 4PRHB 1MCLA 1NMBL 4U0RB 4GXUM 5HJ3B 1EAPA 4RQQB 2NT0A 1MQ8A 2P45B 4JHAL 4OFPA 4TTUA 4WGWB 5MP6H 1VFBA 1LG1A 4HLZG 4U5KA 1JFQH 3BYTA 3NACL 1JYNA 3KJ4B 5D2NA 2W9XA 4M7KL 4ZPVB 1LQ0A 1NFIA 3I6LE 4WSJA 4XPAL 3MRGB 1E73M 2G41A 3EHBD 3QRFM 4LU5H 3SO3C 3PWUB 1OBAA 1LLOA 4KXZH 5E2WH 2BHUA 3C6SB 5I19L 4GI6A 5E4IA 1K3IA 4CD7A 5CJOL 1S7XB 1GH7A 4G9FE 1E4XI 4K7PY 3I2CH 2XWJA 3W28A 1OAKH 1II4E 1TIUA 3QDJB 4U1GC 4W68A 3BQUA 4K3JL 3RX8A 5I17A 3PHAA 1QSEE 2OTUA 3UC0L 5T33L 1QTYT 2ORXA 1JGDB 3GIZL 1HNGA 1VFAB 1ZWIB 4UMGA 2X1WL 5J11B 1UWIA 3UPAA 4GI9A 1MNUL 4OZHB 2Q8AL 3UYOD 4DVRL 2XOMA 1HKLL 4OLXH 2C0HA 3VFNB 4BQ3A 3QUMH 3BAEL 1NCBL 3MRIB 1LWJA 5E9DB 3HOBA 1W0VA 3WL1A 1VJSA 2OMNA 1PQZB 5SWZA 1VA9A 3MS8A 1WC7A 4XBEL 1UR2A 3QDAA 4XC1L 3MFFA 1OAYL 2NW3B 3SKMB 4HK0B 3WO4B 3MRNA 2F53D 3FW6A 1JAKA 4ODXA 4AZCB 4OJFH 3TVMA 2X4UB 4LSSL 4QXTA 2G75A 5IB3B 4YXLL 1J1PH 4J23A 3I75B 3SDYH 4WHDA 5I15H 1ZEAH 4BKLA 4X83A 4MX7A 2KQNA 4WI3A 3K80A 3O8XD 4HULB 1MUJB 3TTOA 4H8WH 5I78A 1A64A 2NW2B 4Y2OA 3A67L 3KE0A 1MCWM 5JXEA 3DX8B 5H37H 1PDKA 3L3DA 3PHQA 2CUMA 2OYKA 4U6YA 1UA6L 5IHLB 2FSEA 1GQJA 4RX4A 3T08A 3P3YA 2WSKA 4RFEB 4GW5B 1X4YA 4J3SA 4YFDB 4IOIB 5EBAA 3IF1A 3ULSA 4NKQB 4H26B 5H94A 3RJXA 3CXHK 3CMOH 2J1EA 4NKOB 4JM4L 4KHTH 3ZJ8A 2XKNA 1WZKA 4RMUA 1EEYB 3HAEG 1BEYL 4FFZL 3FFCB 4K3EL 4RGNB 5BRZE 4CCCA 3O6KH 5HYQB 1A7OH 1JRHI 1CLZH 3WXVH 2ZUMA 1HP5A 3ECBB 4I3RH 3DROA 4IJ3B 5E9DE 1GNXA 1JPGB 2B5IC 3EOYG 2HFEB 4HX1B 3QNYA 1S7QB 4U33A 2EDTA 1AIFB 4NP4H 3VFRA 1CBGA 1I8LC 5DGRA 2D7OA 3ULUD 5E1AA 1JV5A 3G5YB 4G8GA 3HCVB 2J78A 1BIHA 3T2PA 5B4MC 1NGXB 3NNGA 1RZJC 3BZ4A 1E6NA 1CIYA 5I8OL 2P5ED 4NQDA 1UY1A 2DYPD 5EIYB 1U91B 3GSNA 1KACB 3NDZA 3WS3A 4GUPA 3ZDYE 1J0KA 1C5BL 1R5VB 4HMCA 1J88A 2X9YA 2HVJB 2VX6A 3ZR6A 4KRNA 4UBDD 3QDJE 1UA7A 3CDGA 3UAJD 4BDVB 2EYSA 3PQYD 4NO0A 3VXUD 1P4IL 1CU4H 4ZE5A 3WD3A 2E27H 4UV7L 2O92A 5IT2H 4PGDA 2Y2WA 3WH7A 2CRYA 3OWEA 1I1WA 3SCMD 1DCLA 2W07A 4U6VH 5EPMA 5AC5A 5FYKU 3HRZB 3F8UB 4ZUTB 4I5BA 4IRJC 5KVFH 2BFVH 1EO5A 1JTOA 4YXHH 1HN1A 2IANA 1SY6L 5GSRA 2ESVD 3SGKA 2E3VA 2GJZA 2X6MA 3I2IA 1UB6B 4F57H 1FNEB 4D72A 5HHNB 2ITDA 1UY0A 4NQVB 4I77H 1QEWA 1YYML 1TUXA 2R2EB 3GBEA 2ED8A 4YE4H 1INQA 3NJXA 2QQLL 2VLMD 5ILTH 1H9VA 1UENA 4XCYB 4H20L 4OSUH 5LGHL 3NUKA 1MRCH 5CG0A 1FVDA 4E42A 5FO9B 5D7SH 2J1SA 2CRMA 5F1NA 4CDGC 1CE6B 2WZEA 3UO1H 3L3IB 1BYCA 2AEWA 3IF1B 1DLHA 2WCGA 1KPRB 4K7PL 4U7KA 3WFHB 4XZWA 1QNOA 1QD0A 6TAAA 3NN8B 2O9PA 5DJ0A 3WFCL 3W5NA 2AJZA 1IAIL 3OEAA 5D5MA 4PT6A 2V2TA 4DQOH 3NCYS 3TGXA 5GIRA 1V0NA 2J88L 2ARWA 2VDRH 4R7DA 1FL3A 3AYRA 3ARPA 3EBAA 5LGHH 2AK4D 5E94A 2WUHA 1YC7A 2V72A 1KJMA 1G6RA 1ZVSB 1MRFH 3E6FA 2P5WD 4EI5C 1SFSA 3QFJD 1XGPA 3HI6L 3H42L 3OBAA 4H1LA 4Q58C 5CPTA 1Q9WB 2PXYC 1U6AL 1HHGB 2NTSP 2Q7NA 3NJ3A 1QBAA 5M5DA 3VJ6A 1CN4A 3D69B 1CIUA 2QSCL 1XNAA 4N0YH 4DKEH 5ID1B 1B88A 3H9ZA 1RJZA 2HG5A 5D9PA 5JHLL 1KWGA 3RWHA 5IMMB 1OTTD 1Y0LB 1KTLB 5HTSA 4NC1E 2ZXQA 1A2YB 2PETA 5IP4A 2VAAA 2VLJE 3SIMA 4M6ML 5GRJL 1MYRA 1F4XL 1BAFH 2W9LA 2PC8A 1WC7B 3HUJE 1H3WM 3RTQC 2A1WH 3SE8H 1T1YB 4WW1B 3H9HB 5BVPH 2NX5D 4R2GD 4B41A 5D7IE 32C2B 4U7MA 5IVXB 2R2HB 1DTUA 3TBTB 3U0WL 1J11A 4M6OL 5T1DL 4R4BB 4Z9KB 3T2NH 5IEKB 2GQHA 3BXWA 1A0QH 5KW9L 1US3A 1EA9C 5EC2A 5C0EA 1GYAA 3UDWC 5LA0A 1YPZE 1HXJA 3BISA 2J7EA 3D39D 1A7RH 2K7QA 2BZDA 5L2KA 3GNOA 2RAMA 5GXBB 3QO0B 4MCZB 5DJCB 1T4KB 1MW1A 3L5HA 4XWGL 4U2ZA 3OB0K 4MJ5B 5I16B 2A6KA 3SKUD 4AZ8A 1LO0L 1EEZB 4HA4A 4AIZB 5IVXF 3SDDD 3DETD 5GPRA 1T0NB 4XCEA 1W9BM 1UT9A 4P3DB 3GUTB 2ZXBA 3ES6B 3P73A 5JW4Q 1KCKA 2GFBA 4U6YB 1KXTB 4RAHA 4XPTH 1A7NL 5IVNA 2XACC 4X6EB 2HTLC 4X0VA 3G6LA 1A9EB 4FQPA 4K9EL 5HVGB 1BAGA 4ACZB 5HI4C 3VXTB 2GJPA 3ZDZF 3NFPB 1QSED 1IGJA 1Y6NR 3FRUA 3T65B 3KNBA 5A6BA 4UIKL 4XMKL 4WFFE 1I3VA 4OM1L 3CX2A 4X0KB 3RVVD 4XNQB 2NY0C 4MTVA 3MJ6A 1OD9A 1BF8A 1I4FB 3ZSTA 1P84J 3K4DA 5MP6L 4PMRA 3D3VA 4AT6B 5LBSH 1BVLA 3BESR 3BUYB 3WUWA 1IARB 4JY4B 2RGMA 2V2TB 4O58H 3MLSH 4M80A 4CN1A 1N59B 2A6JB 4HV8B 5HVHB 2BDNH 4R26L 5GGTL 1HKJA 5ELIA 1MF2L 3FONA 2PO6B 4P7RA 1JD7A 4MDIA 2DGAA 1T21A 1V3KA 3ROOB 2R39A 4RNRA 4HPOL 3KWWB 4R2GB 1MFCL 2HJFB 4AC1X 4WUUE 2OL3A 2WINA 1QRKA 1N6QH 3P9LA 4OLWL 1JHLL 4LLUB 3I75A 4TULH 3X17A 4AIZA 2H2PC 4KJYA 1J0ZA 5IB2A 2WCAA 1HXMA 4ZZ5A 1LK3H 1CFTA 3B9VA 2BVYA 4OV6F 3RZCD 4OIIL 5ERWA 1FBIL 4EANA 4M93C 1XCQA 4XAWH 1O7AA 1XGRA 4KJPC 2NXZB 1INEL 1N0LA 4X7FC 1UJ3B 3WMCA 1JMZA 5I1KL 4PYHA 5K59E 4PJAB 4XBEH 3SKJL 5FM8A 1F3JA 1UD6A 1VEMA 4ODUB 3OIHA 2XTJB 4MAYA 4U0QB 5E2TL 3IXTB 3LMJH 1RJZB 4G8EA 2DQGL 1PSKL 3CLFL 3HNVH 3VCLB 4MZ2A 2CDEA 1PG7L 3QXDB 4GS7B 3CFEA 2XKSA 3Q6GL 3L5XL 1I85C 3MV9D 1H3GA 1UYYA 4L4PA 4FQXB 3C5ZB 5F9JA 1DHKA 1KB5A 2XQXA 5D7IF 2VT0A 4JKPL 4YUEL 2D3NA 1RPQA 1C12B 2QTEA 3MMDA 4CNIB 1JU3A 2WMIA 4JY6B 1FORH 4X7TB 4KK5C 1ZSDB 4JCLA 4POZC 5TF1H 2AOSA 3QIUB 5GNXA 5I3DA 2XKUA 3HNTL 2ZX8A 35C8L 3W9DB 2R7EB 1Z32X 3LIZL 3S36X 4LAQL 4LDEB 1YPZB 2P48B 4ONGH 1NDGA 4S1QL 3SY0A 1HF6A 3LRSA 4RGOH 2WO1A 1LK2B 3RO8A 1AD9A 2ATKA 1GVIA 4OKVA 3KYMA 4S2SA 4HT1L 4O2FA 3U9PH 4PUEA 1KENH 1TDQA 2W60B 4Y5YB 4LLAA 5DS8B 5F7UA 1YMMB 2IAMB 4MJIA 2DQHH 4K2UH 3GH7A 4JL2A 2B20A 3RFZC 4IRSD 3UTQB 3MRQB 3IJYA 1UB6A 4XNUL 3PGDB 2R1WB 5F1OB 3D18A 1MW0A 1KF9B 3L7EA 3BP7B 2IANB 5GSRB 1F2QA 2IPKA 1E4WL 1ZANL 1HJSA 3S6TA 3LIZH 3DARA 5DD6A 1NDMB 4YAQA 2VZPA 2C3HA 1DLHB 3MGTA 3GEWB 4NZCA 3TPUA 4X9BA 1FVDB 4I0KA 4MA7H 1A6WH 4DTGH 4WV1A 2BC4B 5J6GB 3HB3D 3H9YA 1FFQA 3T77A 2P8PA 1FNSH 3JUGA 4B50A 5DMIH 4OQTA 3K74B 4RE3A 4Y16D 1G7JB 1KLFA 2D20A 4MGXA 3CHEA 4O00A 1CD0A 5C0AA 4U3XA 5DR5L 2E4TA 3JV6A 5T3XD 3PJSA 5DHVH 3SE4A 5B8CB 1LO2L 5C6TH 1EJOL 3BHBA 4UV4H 3UG3A 2BVTA 35C8H 5D6DC 5HPMA 5F9WB 3FO1A 4P2RD 5FHAL 4HK3N 1JDDA 3VFTA 2KUTA 3GSNL 1CVRA 2GJ6E 1T1ZB 1G7PB 2A6KB 4JFPA 3CO4A 4GIAA 4LBEB 4PGCB 1LEIA 4S3JA 4U3CA 4OTXL 3ACIA 1N7MH 1MHEB 5JIPA 2I26N 4UAPA 1HIMH 3DVNA 3L5WB 2JDAA 4NQDB 3X12B 2IPTL 3GIVB 1FJ1B 4CD4A 4H2CA 3OAYH 2HT2D 4X9YA 2GFBB 1CDJA 4WCYL 3L5XH 1WBXB 5LQBL 1ULPA 1IM3A 4JR9H 4J2XA 1RIVL 2AEPH 1DQLH 2HVJA 4XCEB 2AJSH 3U7WL 1MWAA 2Z9TA 5L8LB 2E32A 4NO3A 5C0CD 5FO8A 4OCSH 4ZO6A 1QSFB 3JTSA 3BPCA 2EBNA 5C09A 1EK3A 1HHHA 1G9NH 3BN6A 2VDKL 2XZAL 2W1NA 4R97B 1MCHA 5C0CB 1MJ8L 3GSUA 4MD4A 4WTZA 2Y1VA 2XOTA 3GSXA 5EZIH 1BTCA 1JGLL 1K12A 4Q22A 3I6LD 5DD1L 5E8DH 4GH7B 4LAJH 4JGMA 5E5RB 1UWWA 4ISVB 1U92B 4JRXD 4TUOB 4F7CB 5K9QI 5FYJD 3MSGA 3O2WH 3PTKA 4QRQB 5GZOD 4RIRB 3ZE2F 1MY5A 3IS0X 3I6KB 3FT2A 4PIRF 3PQYA 3IFPB 1KB9K 2IQAA 4XPGH 3EYFA 3SDCB 5AYBA 4JHWL 5HI3C 3WNLA 4GBXA 2W0LA 3QJHA 3UBXB 1QYGH 3OR6B 3QUKA 1VRXA 1RZKL 1FYTB 4HHAB 4OQ1A 1UZ6F 4S1SL 4B15A 5FGBA 1GC1L 1LQSR 1AR1C 4OJYA 3GGWB 1AHWC 1RUQL 5B3NA 3MRQA 3O81A 1GHFL 3HZMA 3BH9B 1D5IL 1U8JB 5AWNH 5J1XA 3IFLH 4KTEH 1AJ7H 1XD0A 2AABL 4RMSA 1UGNA 2DM2A 4DUWA 2ZOKA 2ADJA 2Z8SA 2Y24A 3JWDH 5M03A 3WENA 4PJHE 5C08E 4IMKA 4GQQA 5T1DH 3RZCC 4NQVA 4N8VB 3ARDD 3NAAH 1ONQA 5DJ6A 4AEEA 3QXUA 1CNVA 2UZIH 2RQ8A 2R2BA 1NAMA 2XN9D 5I8CA 2CITA 4KI5D 4QGTA 3PV7A 2DDXA 4H8WC 1XGTA 4U1NA 5LCWL 3BEVB 3HG1E 4IDJH 3WUWG 3JXAA 1IGIH 2FL5B 4TUKH 1NQBA 1FDLH 3QOKA 3U7BA 1JG9A 4P4RB 5A8OA 5EMYA 2FIKB 2ZUQC 2BCKB 3HI1B 1JFHA 5BOPA 3IIIA 3U82B 3C9NB 4F80A 2D24A 5H37G 1N26A 3QQ3B 4BSJA 4FK9A 1XR9A 3CGTA 2WN3A 4Y4FD 1Y18A 3CTTA 1PYWA 3BWAA 4HC1L 3ILPB 3QJFA 1TMQA 3WHXA 1AQKL 2VDPL 1WKYA 1KGCE 1PJ9A 1U95B 1AD9B 1B31A 1IGYA 2VO5A 3GMNB 2E6PA 5HYFA 3B9AA 3FAXA 3MOBL 3RGVA 4HU8A 3AJ7A 3O2DL 4P7QA 4NNPH 3H3PH 5L9DL 1KJ2L 4AW7A 3Q3GA 4ZS7L 5CJQH 1UCTA 3MQIA 3BMVA 5GRVK 1MWAL 4KTYA 4P2OB 5DLMH 1N6VA 3QULA 5ENWA 4RGNE 3S36H 1S5HB 2W66A 3WF1A 4NN6C 1OARH 1RZ7L 3FN9A 2EZ0D 4PJ5A 2D7MA 2NY2D 4XCCL 3LB6C 4NI3A 2NY4C 3PTMA 1VFFA 4FQXD 3TONA 2YDRA 4P9HL 3S98A 5DTFA 3I6GB 5FF6A 3MLXL 1OD3A 4X9IA 3FOLB 4Z7NE 2XTJD 2C1PB 5D1XB 5SWSD 1JPFA 1OAQH 5ISZD 4F57L 1HCVA 2A6IB 5IJVB 4UT6L 4Y8AA 4MQXD 2QJDA 1BQHA 1ZT4A 4UQ9A 1ZA6B 1LE9A 3D39A 1U8LB 5HBBA 3BZFA 3EYVA 2FJHA 4NBZB 4QHUA 5CMAB 4W93A 1CE1L 2OJEB 4JKLA 1CVSC 5DLML 1GGBH 4PUBH 5GGQH 1BREA 1LO4H 4YDIL 4P9MH 1A6UH 1HYSC 3L4XA 3QISA 3BKMH 1NFDE 1QHZA 7TAAA 3BZDA 2XQYG 5GGRA 1S9YB 3LEVH 3ECBA 2G3IA 1G7JA 2DSWA 1QSZA 3NCMA 1JI6A 1WDRA 4I0CC 3LSOB 4LXFA 1T0MB 2BGOA 3MRRA 3FKUS 2VDPH 1I75A 3F7QA 4WK9A 5DQJA 4P5KA 3D0VB 3E3QC 1MPXA 4NKIH 3EGSA 5DD6B 2XJ7A 2QMKA 5I8OH 1JNHB 1MPAH 5C0FA 4L4VA 4MJIB 4JM2D 1MFDH 1BFVL 4LLVA 4QRUB 2EDRA 1RMFH 1YN6A 3HG1A 3MOAH 4U1KA 5HYJD 1TCRA 4IDJL 1IM9B 1UZ1A 5I1AA 3VDHA 1IZJA 1P5VA 4ZS7H 5B8CC 3HE6C 4HF5H 3PGDA 4LSTL 5E7BA 5IQ9B 2EDEA 5GGRY 4J6RL 2X70A 1KG0A 4M61A 5A3IC 1KCRL 4IRJB 1OQOA 3HNMA 4XMPH 2GAZB 4I2XA 5DJYB 4PJ9B 3GSUB 4MD4B 4LSUH 4XBGB 1FSKB 4Z2KA 3GM0A 3DMMD 5CHNA 3F6LA 1LEKB 1YEHL 3DYPA 5IVZA 4JFZH 1TZGH 1JGUL 3JWDL 3EYVB 2EIZB 1XGQB 1TVBA 3BJLA 4BK5A 2CHOA 1MH5B 1NC2A 3OZ9L 1S9VA 4RIRA 2OYMA 1GC1H 1T6WA 4V1DA 3WIFB 1MI5B 3LKSB 5FKPA 3ZKNC 4X8JA 5E9DA 3DIFA 2FX9L 1HSBB 3T2QA 3C6LB 4M5ZH 2J8FA 2VL5A 2E9BA 2HYMA 5IW6A 3G6JF 3UP1A 1SEBA 3RVTD 4XCCH 1FG2A 5FUCE 4D0DB 4ALAL 4Z8FL 1OARL 2FDBP 3UTTD 5ALCL 4PRIE 4PV9A 4JKWA 4OD1H 4O4YL 4KDVA 3VXSD 1AH1A 4BH8B 2ZG3A 4QB2A 1A1NA 2ZOXA 1J0YA 5T1LA 1QLFA 1IQDC 3K2MC 4KJWD 4F7TA 1SR0A 3NSXA 3VI4F 3Q2CA 5GQBA 3FO0L 4K7PX 5I1IL 4U3AA 1MIEH 4O2EA 3VWKD 4G5ZL 4X80H 4P8VA 4OZHE 4HJGB 2EICA 3ULVC 2HYXA 4X6DB 5EZOH 1OSPL 1YQVL 3QI9D 1RZGB 3NABL 2Z4QA 1FFNB 1I7ZB 5TGBA 4YHMH 4F7EB 4PRBB 4PJ9A 5DUPL 5EU3A 2NW2A 2ZOLB 3Q5OA 4FQ2H 1OGAB 2XM1A 3QFJB 3WLBB 3MA9L 1J12A 1Z3GL 1KGWA 4RMVA 1C5DB 3BAEH 3EGSB 1ZKAA 3BP6A 1OAXL 4TVPD 3ROLA 2ZSWA 5L0QC 2YK1L 3WQ5A 4NKOA 1XCXA 5KJRL 4MAZA 3TFKC 4LK4A 1AR2A 1TVNA 3QDGB 2RVAA 2E9MA 5IG7B 3MLZL 4JDVB 3VRIB 3MUJA 2PTUA 1GJWA 1D6VH 4L9LA 4BA0A 3RZCB 4NIKB 1AC0A 1XC6A 1NANI 3MMUA 1GRWA 1UJ3C 4GQPH 4PJAE 4RMRA 3BRFA 1Q6GA 3IDNB 3T1FB 2W38A 4D1IA 5JBEA 2UYLA 2YPVH 2V5CA 3WKNA 5CJXC 3EDDA 4HMEA 2W1SA 3D5OF 1UFUA 4OAWA 1JWUB 2ZICA 2WVVB 2DTMH 5ANMA 3DUUA 3TTSA 1YDPA 2AV7B 3U46B 3VIGA 3CCHB 4G9DB 5FYKE 3N85L 2VMCA 1C08B 3GRWH 3QEUA 3GMMA 5JZ7C 4XB3A 1T4KA 1S7UB 2EEAA 2VLLA 1WO2A 1DWIM 4UQEA 1NCTA 2NXYC 4KRUA 2LAAA 3T4YA 4P02B 3LQAC 2FGZA 1EXPA 2YG0A 3CDGB 5ITBL 3LKRA 1M53A 1MFEL 1V03A 2ZOLA 1YMHA 4HJJH 2FX8H 2G60L 4QX0A 5EO9A 1NWSA 4P2CG 4XX1G 3UPRA 3EMCA 1J01A 2DI9A 3W9EA 4NC0B 3BZ4B 3N50A 3Q3GB 4MXVF 4NRYA 5SWZD 4TXEA 5E9AA 5HDQL 1MI5E 4M7KH 3IDUA 1SYSA 4GBXC 4MQXC 4AJ0A 3OF6A 2VCCA 3F5JA 3OKEB 1HSBA 2IADB 2P5EB 4X7CC 4NCC1 1UEMA 1QSFD 2CLZA 1AHWA 1YY9D 3AIWA 1C91A 3T4AA 3PZIA 3WKMH 1U0QA 1S9XA 1BJ1H 2DOCA 2OMBA 2Y7QB 4Q0XH 5BQ7A 2VITB 2WC7A 3DHUA 5DSCB 2W5FA 4DCQA 4OIBA 3PHOB 5CUSL 1KJ2B 5CSZB 1B90A 1NCAL 1WNOA 2JIWA 1NH6A 5JXED 3MYJA 1KIUA 3Q1SH 3PL6A 1BFTA 3HZVA 4Y2DC 4NQSA 4IEFB 4JFWA 4CADB 1BFNA 5A6KA 5JNYA 1KUMA 2E8ZA 3BH9A 1NOWA 1L4IA 4JO1H 4UIMA 5IK3B 3V6OE 4WU7B 1EEYA 3VD4A 3MNWA 1CDYA 2GK0A 4JRXA 3HJEA 4PF1A 2VX4A 3IRPX 3L3KA 4U1KB 5I1DB 4WKFA 2AEIT 4GO6B 4CBPA 4R9HA 2BXZA 3KPOB 4LDLB 3WDHA 1I9EA 5JOPE 5KSUA 1AQ0A 4X9FA 3WFHA 4WI5A 1I1XA 1FNSL 3OKYA 4OAWB 4RFNC 1A14L 4RBPH 4P2QA 1JP5A 3NCEB 2GEEA 3IDJB 2R0LH 1YNLH 2FHCA 2NSXA 2BSTB 2X4RA 2F54D 3WYRA 5FA4A 2OJEA 2NZ9D 5IESH 2F8QA 2B5IB 3QRGH 4KK9C 4IM8A 2GDVA 1HJWA 3MCKA 1XCWA 3L3GB 2CQVA 1N6QL 5CBAB 2W87A 3UAJC 3N85H 4LSQL 3DBXB 3TZVD 5ID0B 2FATH 3U0PA 4ZFGL 3L1OH 3HLAB 5EU6D 2YPKB 3SPVA 1DVFA 5CIPH 2PCPB 1Z3GH 2WKGA 3KPMB 3EO1B 3FHQA 1R0AH 1E72M 2FJGB 4D6EA 1KPVB 4XNXL 1UD5A 2FGWH 1UYWH 4JO4H 4CKVX 3T0XA 2VQ1A 3QHOA 4W88A 5IB1B 3BUTA 3GXIA 5EU7C 5E08L 4M1DL 4NC2B 1B1YA 4NO0D 5D8JH 1KENL 3T3PE 4LNRB 1ZE3C 1OW0C 5C0CE 2CHNA 1T1YA 4WW1A 4HJGA 1A7QH 2YC4A 1CGSL 2R0WH 2O61B 1T2QL 5JDSA 1SMOA 4LCWE 3THML 6CGTA 3AIUA 3FOMA 1EH9A 2DIAA 1D5XA 1BZ9B 3HUJB 5IW1B 5JW5B 1E6JL 1K2DA 4JDZB 4CD6A 3I6GA 5FF6B 3ZT7A 5FK9B 2Y07L 4PV9B 4KDTA 4UCFA 3QPQC 3O2VH 4FXLA 1Q9WA 4ODSH 3MGOB 1OY3B 3BT2L 1X5IA 4Z7WA 5JQHC 4Q97A 3FB7B 4XV0A 2OWWA 1LNUB 3EJYD 2YWYA 2QQQA 1YEGH 2VQUA 4N0UA 1NCCL 3OX8A 4LF3B 4OZGA 2VLKD 2DDUA 5JBDA 2EXWD 2H45A 1BP3B 4QDMA 1S7SA 1W72A 5DQ0A 2DLEA 4UTBL 4XPHL 5I6XB 3QWRA 1T7YA 5CEZD 1G0YR 1WIUA 2DQFA 3T0EB 2PTTA 5LKNA 3C5SB 5A2CA 5B8CA 4ALAH 5SWSA 3CHCA 1U41A 5BCAA 4FZEH 1CWVA 1C90A 4DK6A 4AT6A 3TPUB 1T83C 4DFHA 3AXIA 5DD3L 1CZVA 4RAUA 4Z7QF 2FBJL 4UDTA 2C9AA 2CDOA 2WVVA 2H32H 3TWCH 2Y25A 1T3FB 3RI5F 1V6WA 4QWWC 1LO0H 1AGEA 2LS6A 2XA3A 3CKHA 1PZ2A 1U2CA 3MBEC 1A7RL 3HG1B 3HC0A 3S4SB 4FQ2L 3RWDB 4P46B 4QXGH 2CGRH 1JWMA 1CZ8L 4I2XE 4YHML 1EOMA 5E5MB 3GUTA 2CJUH 4QRPB 3TBVB 4PMQA 3GSQA 4WHTA 5C0AE 5JR2A 4GAFB 1A5FL 3GXMA 4LSVL 2ID4A 3O4LB 2XG4A 5DJAB 5CFHA 4KZDL 1TQBC 5FEBA 5CSGA 2Z8VC 5FKAA 2APVA 3L9RA 2RR3A 3CDFA 3OKEA 3VXUB 4MNHA 2P24B 4ZAKB 3HNYM 4J4PA 4CNIA 3EMQA 1TA3B 3I3BA 4OM1H 5D2LF 1H8OA 1WSST 4O4YH 4JM2A 1BFVH 4TRPH 1WZLA 4PRPA 5J57B 3CVHA 3O11A 4XWOD 4QF1A 1C8QA 5EBLA 1FSKC 5CYYA 5L2KD 2VDQL 4PJHB 5C08B 5HI4D 3BPCB 4EQ2A 3HUJA 1IJ9A 1IC7H 2Y36H 5E6YA 4B53A 2APXA 5DEGB 2VITA 4MAUL 2QQLH 2IGFH 4FS0A 5IVXE 4LPCA 1ZHNA 4NKDA 1KBGL 4AIOA 4AEHH 3CPLA 3FMGH 3CJJA 3AXLB 4AY1A 2YD2A 1GZQA 1RJLA 5D9NA 1HX0A 2FWOA 2V2WB 3ILQD 3DO7B 5F3BA 3J8F7 1C12A 4DGVL 2YSSB 8A3HA 5G04L 2DD8H 2BMKA 2EC8A 3H6JA 3W37A 5DT1L 5FK9A 1IL1B 4R4FL 4DM2A 3UBXI 1PEWA 3SE9L 1YHTA 2D7TH 3BQUC 3LRHA 4DN4L 4M3KB 1JDCA 3VFWA 4KUCD 1UQSB 2A83B 4G9FB 1A5FH 5AG8A 1A6UL 1UJ3A 2WUBH 4RFEA 2KDGA 1C5CH 4XMLL 1Y7VA 1D7PM 4QLKA 1R3HA 1A6AB 3O3EA 2IALA 2CK0L 5GHWH 4XB7A 1FP8A 3IDIA 3W0KA 4OLUL 2G5RA 3X3FL 3VXSA 5EIVA 2H2PD 3THCA 2XVPA 3NGBC 1E6QM 4LCUB 5HGDB 4ZNEA 2R0ZL 3O11B 4X4MA 3U0PB 5ID0A 3WUFA 2WKLA 2OXGA 3FQRB 2VISA 4XNYH 3CUFA 3QEHA 1AD0A 2YXMA 3AICA 1KXQE 3CBWA 1T5XB 2VDNL 1I5PA 3CPUA 1ORSA 2HTKD 2BNQE 4J3XA 3KPOA 1FHLA 2AXHA 1E27B 3KXFD 2O9RA 2O93L 2F54E 1B6UA 1S7WB 1WAWA 2VDQH 2E8YA 3BSHA 2OWCA 2AV1A 1P4IH 1IGTB 1R6VA 3ARBD 4PB0L 1BQUA 1W8OA 2XA8L 3O4LA 4YQXH 3T0ED 3AZSA 5IFHH 1KIPB 2CYGA 1CECA 1OINA 4GW1A 4FFVD 4LSPH 4OZIA 5HHOD 1XZ0A 4ZS6C 3ZOAA 1Q94A 2BOCA 4WUUA 2J4WL 4PR5B 4MSWB 3U36A 3IFLL 2BC4A 1I1AA 4OI9A 2W60A 1G0XA 4CGTA 5J6GA 3VFPB 1E1EA 4FFWC 3C09C 1IT9L 2OL3L 4LSVH 2DAVA 2EYSB 3QDMD 3C60A 3ZL4H 1FL6B 2Z35A 4D6CA 2UVEA 1I8KB 3SCUA 3BVNB 5T3ZD 4TX6A 4PRIB 1QNRA 2R56L 2UY2A 4V27A 1EPFA 2DH3A 2W0PA 4P4KB 3CPLB 4TRPL 1MCNA 3D25A 3GMPB 5IWLA 3S8WA 4P5TD 1BQHB 1GU3A 5I8KL 2WO2A 3F7YB 1HKFA 5H2BB 3MUAA 4TX8A 3MRJB 4NC1C 4KRTA 5CZKA 3O41B 3S7GA 5D96B 5INDB 5IM7B 1EO7A 5D7KD 1PBGA 4AZ5A 1FFOA 4Y2DA 2R29L 5EFIA 1F8TL 1FHDA 4X7TA 4FLRA 3V52L 2MCPL 1AQKH 1S7TB 3U2SB 2CJUL 2HT3C 3ULVH 3WQVA 4P08A 4ATLA 4XNXH 4YHIB 1EEUA 2NR6D 4J12A 3DECA 3V0AC 1XGZA 4PJGA 4YHNA 2X7LB 3M8OL 3VCLA 2LTQC 5EO9B 2AKRA 4ZEPA 1P5UA 3N1FC 4GRWF 3ALPA 1N2RB 4QPWA 4KTDH 3BIKA 4ZFZA 3W24A 1ES0A 1NJ9B 3IFNL 2DMKA 1W9TA 3VE0B 5IESL 2Z92B 3O9WB 5SWQB 3V6BR 3MRDA 1AR1D 1Q38A 1IC4L 3UJJH 1KELH 1V08A 1W0WA 1H0IA 5BMFL 2R69L 4KFZC 4RWYH 1UA3A 3OGRA 3LAFA 3T0DA 1ISWA 5FUOL 2C26A 2JIEA 3WUZA 2GK1A 1G7MA 2XG9A 3NPSB 1SG3A 3T0AA 2WPGA 1ZTXL 2YDSA 2VMFA 5C0AD 4B3KA 2QQLA 1UXSB 3MLTA 4LASL 3GNML 1YEDB 3V6OA 2NY7L 4P57B 4AG4H 1WITA 4K3DL 3BKJL 5ESVA 1VBRA 3BCDA 2XPGA 3EYOA 1Q6FA 5T33H 4JHWH 4JZJA 3GMRB 3VXRB 1E0VA 2FLBT 3T77B 2X4OA 3VFGL 5HY9B 1E6JH 2JEQA 5J1SC 4KI5C 5KSBB 3D0LA 1OGAE 4FQQA 4LSQH 1A9BA 4L5FL 4OZIE 1T80A 3LEIA 2ZX6A 3BD5A 4MYWB 3E6HB 3U1SH 3L4UA 5E95B 4AH2A 1P7KA 5T1KB 3AU1A 3MJ8A 4BQ6A 5C0CA 1Q1JH 4PJDA 1JGLH 1G1CA 5AAWA 1U91A 4D6FA 3CMJA 1T66D 2BVDA 1XCTB 4JFXB 4N5ED 5I1GH 2VZQA 4L3EA 2ICEB 4F66A 1QP1A 3OV6A 4GAGL 3G6AB 4OFIA 4TQEL 3W38A 4YPGA 4U1LA 1G7QA 1GOGA 4N0RA 5CILL 5DHXB 5DR5H 1SEBB 3EO9L 3PWUA 3PDOB 3VA6A 5K9QG 1KGXA 1X5ZA 4BCEA 5A3HA 1R3KB 2F19H 1MCCA 1AGDA 2FCBA 4P99A 4A42A 2H6PA 1HKLH 1MFAH 1QSFE 4Y5VC 3WHE1 1WTGT 2YRZA 1TNMA 4MXWL 3RNKB 4FP8H 3SHSA 3VIKA 3RGVB 1HZHL 3DRQA 4OFDA 4PJ5B 4PJGE 4FN0A 2H1PL 3NTCH 1W1YA 3I02A 4OCLC 5EU5A 3AXLA 1ZHKB 1KPUB 1EMTL 5B4MD 1HP4A 1Y6KR 2JIXB 1GL4B 2YHGA 3CVIL 4HZAA 5KVGH 3CLEL 1MCBA 1BD2B 3DXAD 4NQCD 1ZVSA 3E6FB 1AGBB 5F9WC 3O6AA 3MV7D 1TFVA 1WISA 5CHNB 5SWSE 3VFSA 2F58L 3DX8A 4HOZA 2Y8VA 4XXDA 1E28A 2JF1A 5IUSA 1OP3K 3ZDZE 4JHAH 5J7CC 3X14B 1HKMA 1JNDA 2F61A 3N1MC 4P57A 1K9TA 5GJSH 5C7GA 5E7FA 4KAQH 1U8NB 1CFTB 5BO1H 5DMKA 4NN5C 5H94B 2VLKA 4OUUB 5D5MB 5ADPL 1JYVA 2FEDD 4J4PC 4NCC2 3ZZ1A 3LQCA 4AZ7A 3ZE1F 4QLLA 2B1HL 2FJFB 4JM2C 1PZUB 3PXHA 3PQYB 1V7MH 5E5MA 2FIRT 4WNQB 2VDML 1JWUA 2E9WA 1G6RB 3BGFC 1SHWB 5FO9A 4E42B 1SM3L 4XAWL 1NPUA 4P5MB 5FD0A 2HJLA 1JF1B 2FO4A 4TNWK 1DQJA 1F45A 1HH6A 2RJ2A 1EGJH 5HHME 1P2CB 3DETC 1UXWA 2IH3B 3D48R 4PRPE 1E56A 2EZ0C 1ZB5A 3SCVA 4UFJA 3BSGA 2HFFB 2DT3A 3MV8E 3IB4A 1QOKA 1RZFL 4XVSL 1TCMA 1T04A 1MCEA 2PUQT 5F72S 2DL2A 1MAKA 2F5AL 4TVSa 4UFKA 1VGEH 3E3QE 3CXDL 4YH6A 1L7TL 5EC2B 2F74A 2BVPA 3DX7B 5EFDA 3WIJA 3PHSA 4XVJL 4JREC 2C1OA 2UUDH 3S88L 1NGZB 2VZVA 4TTDC 2WV3A 1V3LA 1K3ZA 2NPLX 1YMME 1OF2B 3MYJB 3FFCD 3B2VL 3F7RA 3GSRB 2VLRD 2R4RH 1GZQB 1RJLB 4GKSB 2VNCA 3PF2A 4LASH 5ITFB 5HYIA 4PJBA 1OAXH 2IXUA 2J4GA 2OYLA 3EOBA 2JELH 1DBKH 2J6EL 4P3DA 5EORL 1EDGA 3OKKB 3ARDA 4HMDA 1EO8L 1T89A 1MFBH 4GG8B 4OUOA 4Y88A 3SCTA 1KTLA 4A45A 4F7TB 3KWXA 1KB9J 1WZ1L 3SKJH 1JZ4A 3CUPB 1YNKL 2H6PB 4PJCE 5T1MB 4HLJA 1YEHH 5C2UB 4QF1B 4UQ3B 2GJRA 4X4XB 1FGNL 1JF6A 4KJQD 1F58H 3CMGA 1MLBA 4LCWD 4X80L 2LU3A 1G7HB 2C3WA 1MIEL 3TH4T 2XGBA 3NYDA 4QX2A 1JHLH 2WWKO 2MMXA 3RUGA 3BSZH 1F90H 1NAEA 1K8DA 4HUUB 1LE5A 2WMHA 3P77B 5A95A 2QSVA 2CKBA 4IHOB 4EAMA 3REVA 4Z77A 3ZE1E 3V4UL 4JPVH 2PWDA 3PZMA 4PTWA 4LPXA 4ZNCD 4L4VB 1X6NA 4YIQA 2YB7A 1BYAA 1AGFA 4Z7VF 4HXBH 3EIFA 4F7PA 3BH8A 5GJTH 3UBXG 1I1AC 3O4LE 3PWLB 3ULVL 4X6DE 2CR6A 2LFGA 4G6FD 4AD5A 3HG1D 3NGBB 3DPBA 1INDL 3FO9A 4ERSL 4AH2B 3OZOA 1G7MB 4FA8A 1NANH 4I2XB 4JANA 1Y6MR 1CXKA 4JVPA 2FNBA 1ACYL 5I5RA 5ANMB 3E2HC 3FO0H 2JCCF 4LLDA 4FOMA 3BEWA 3TIDB 4W4OA 3TN0C 5D5ME 5I30H 4X4ME 3OLEA 1DFBL 4F9JA 3VXQB 4P9ML 3GMLB 2E9LA 4N1HB 1HI6B 1FC1A 3AY4C 4JZJB 4Y5XA 3Q5TA 4LSUL 4H88H 2NY6D 4HWZA 4WNQA 4LGRB 5I1EL 2W3JA 2J8GA 1B0GA 5I73B 2XVKA 5TDPB 3D3AA 3EKCA 4X6CE 2NXYD 4HQQL 5JBFA 1T2XA 3ARBA 1S7WA 3SJVD 1HCFX 1PZ5B 4WTZG 4WV1C 4P9HH 4UZSA 1EX0A 4KV5E 4FNLH 3AREC 5GGSB 2ZEXA 1R87A 3DX9A 3L95B 1U33A 4YXHL 2C7FA 5BRZD 3WFDL 4TNVF 1R7AA 3ULVD 1H15A 4RN5A 5IR1A 4OCRH 1FNAA 1MCSA 2DJSA 1BVNP 1UVQA 1NL0L 1VFOA 4JFEB 1ZT7A 2VXSH 4Q9CA 2ZX9A 4XHJC 1T7ZA 4WWKC 4NNPL 1YEKL 3B5TA 5DSCA 3CZ8A 1A21A 4EI5B 3OXSA 3LPOA 1G9HA 1FE8H 4I3SL 4OSUL 3W9DA 4BQCA 1XIWD 2H26A 5B38A 4K9EC 3TPKA 5FA3A 5HYJA 1G6RH 2Y06H 2DD8L 2V3EA 3SCWA 4NSKB 1UD2A 3QHZL 3L3HA 3VJ6B 3IXTA 4G8EB 1FO0L 4Y16C 2ZEWA 2OTWA 5FO7A 1EXUB 2LW8A 5DYOB 4NCDA 5F8QC 4CMHB 2GUOB 3I9GL 4YN5A 4YHOL 5F44A 4DVBB 4TUKL 5ESQA 5ILTL 1K45A 3DIFB 1SMAA 4JE4B 1ZHKA 2WW5A 4KK5D 2IGFL 1F3DH 3LEXA 5FUZH 1KGCD 2UY6A 3AIEA 4P23D 5IMLB 3MMEB 3B9KD 3MOQA 4JN2B 4F33B 3L5IA 4WI9A 3ARSA 5D93C 3GSQB 2VDLL 5SX5K 4JZJC 4NJ9L 2Q87A 4JFQB 2CIPA 1IAIH 1L0YA 4V1DD 4PJCF 2ARJB 1R5WB 2Z91A 4DGVH 5IB5B 1CTOA 2OM5A 2JJUA 1YDPB 2AV7A 3RNQA 4PREA 1Z6JT 3HMXA 2EJ1A 3R06B 3MROB 4ODTH 2X4RB 2EEBA 4XP4H 3SBWC 1RURL 1SYTA 3B2UD 3GKZA 1XH2A 3VIHA 1WDPA 4MA8H 2ZXDA 3WNKA 3EHBC 5DJAA 4KV5F 1GONA 4OF3A 2GTZB 3GJFK 1KXTA 1NDMA 3DRTA 4R3SA 43CAA 2I5YH 5MENE 2X4QB 2NZ9C 4UU9B 5A2AA 5KSVA 1P2CA 3CFCL 3HB3C 1CD8A 2QQKH 4I3RL 4N9GA 3DUSA 3PZOA 4GG6B 1OM3H 4U6XB 3NDYA 3ALFA 3PUIA 1J0JA 2G3NA 4NUJB 4IMKC 4TOYL 5FOOA 4YXLH 4MXVE 2EPOA 4IPNB 2DKMA 4I4WA 4H0GA 3P0VH 1QNSA 3MXVH 3WNNA 5HHNA 5F70A 3V6ZA 2XTLA 4G8GD 3HFML 3N18A 4HIIB 5BWFA 4HU0A 3SCQA 5DJ2A 5EWIH 7FABH 1AY1L 4YGAB 3QG6A 1HINH 2QV2A 5T1MA 1EUUA 4UTBH 4XPHH 1C5BH 5E8EA 4F2MB 1ISYA 2XWJB 2H26B 1RUPH 1QSFA 5IF0A 3QA3B 1UD3A 1HKIA 4QHLA 3ZDYF 2NW3A 3SKMA 4O51B 3C6SA 1MFBL 5L0QB 2DL9A 3WDJA 2XN9A 4JFEE 1NKOA 2HN7B 5T3XL 3MLYL 3JWOL 4Z7NF 3X12A 1K8DB 4NRRA 3AIRA 1JGVL 1W3LA 3VFNA 2CD0A 1MHPH 5EOQL 3TIEB 1I1FA 4XXCA 2GCYB 4AEIL 2B4KA 2BSRA 1XF5A 3MA7B 4FABH 4CMMB 4U1LB 1BPLB 2JJVA 3RGVC 1W9WA 4CU9A 1JNJA 4ZXBC 3QUYB 1QUNA 1HHHB 3O2WL 4G7YL 3WXVL 1RHFA 1KNOB 3AM8C 2PR4L 3UEQA 1P7HL 3QXAB 5DHYA 4ZDHA 4BFGA 1NAMB 5I8CB 5ACLA 2Y23A 4K8RH 1E3XA 3STBA 1NCNA 5J89A 3QUML 5A8PA 2BNJA 2DJ4A 1KB5B 4P0DA 4ZXBB 4DVRH 4AD3A 3RQ3A 1A4KA 3T04D 3LPWA 1UMHA 1NGQL 1WPCA 3VFPA 3O6FA 4GW4A 1R7OA 1IAKB 4HPGA 2HFEA 3GO1H 3ESVF 5L88L 3KJ6H 1ACYH 1MCRA 3LEKA 4WEMB 4XCYA 3WS6A 2Z35B 1PBYA 3ARUA 4MX7B 1IGCL 4APQB 2AJSL 2FH6A 2EDFA 4HIHA 3RZWA 2VIRA 1F6FB 3BD4A 1NX9A 1ZBWA 3IU3A 4JANB 5F6HJ 4XTRD 4TNWF 1MJ7L 4HWNA 3M6DA 4RISH 25C8L 2PW1A 4U1NB 3OLDA 1UXZA 1OVZA 3O4OB 2VR4A 4OCXL 5A8NA 3ULSB 4XVTH 1BYBA 1W0YT 3OZPA 2AJZB 2VXUH 2ZJSL 1NEZG 1QO3A 5I73C 5JNYB 1T3FA 2JJSC 4K3GA 3CUJA 5ACZB 1FL5A 1A3QA 1ROWA 5ICXB 2VVNA 5CJOH 5A1AA 5B3JF 4X5XB 5MENB 3ARGC 2HMID 5D1ZA 1GHSA 4R4NC 1UH3A 3PV6A 1SVZA 3FB6A 2AMGA 1FAKT 5I1JH 3EMZA 4HS6B 5C3TA 5J13B 4G42B 4URTB 3O3EB 4S1DD 2XFXB 3P11H 4QRPE 1LWRA 4CVWA 1F11A 1YNKH 3OG6B 3CZFA 1DBML 3S96A 3TLRA 4L4TA 5BZDA 2D4FA 4XT1C 1LDPH 1KGYA 4N42A 2I25N 3QRGL 1N5AA 2V9RA 3HZYA 1IILE 3OA5A 3MFGB 1NGXA 15C8L 1K4DA 4K94C 5F89A 2DT0A 3PZNA 3SCMC 2EXWC 5CLTA 5BRZB 2N7AA 1PLGH 1SBSL 2CR3A 4HW6A 2ZUWA 3POHA 5CAYB 4LQRA 4GSDL 3RM8A 2IWGA 3ABZA 4JLRB 4U0RC 2W46A 1MCKA 4UV4L 4Y7EA 2V2WA 2XG5A 5E2WL 1CDGA 1E4WH 1BQHG 3SGJC 1B4RA 5DUML 3U9UA 3SCSA 2IBBA 3VI4E 3LMJL 3QGVA 2AEQH 4Z76B 5IJRA 4XNUH 1UCBH 2J7CA 1V05A 2XN9B 3F62A 1TTGA 4OGZA 3VILA 4U05A 1X5XA 1FP9A 3FO1B 4GAGH 4MJ5A 5HSFA 4QCFA 4P2OA 6FABL 1A6WL 3MODL 3UTZB 4OOZA 3IDGA 1HE7A 2AVGA 2E6JA 2Y5EA 1RZ8A 2BNQD 4ZOAA 1MAMH 4YFLF 3H8NA 4RGOL 1EXUA 3H7BB 4ZUUA 5D7JA 4S1QH 2G5BA 4BSVB 3CSBA 1A6PA 1UH4A 5DFVC 4BA8A 3KPNA 1AO7A 3AY4A 4Y5XC 1FL3B 2ZUXA 5GS1C 2I9TA 4O02H 5A8QA 5DT5A 1H8NA 3RU8H 4M1GL 4GRWH 5HYEA 5GGTA 3QYCA 2K7PA 1JNHA 3A4AA 2D0FA 2DQHL 3SDCD 1E15A 3IVKA 5I2UA 4EZMA 4YUEH 1Y0LA 1K4DB 4ESKA 3ARBC 5B3JE 1ETZA 3GJFB 1IM9A 4EIGB 2AK1L 4NHCL 4XWOC 5F1NB 1ECEA 3II1A 3GMLA 5L2JA 4UAOC 1W1PA 2X0YA 1IFHH 1NAML 3A47A 2D2OA 1FAIL 2ZOKB 4PRPB 4BYHA 4PSRA 3VWKA 4TTGA 2CETA 2J8HA 3BKYL 4LAQH 4UI2A 4FQQB 3E2HB 4QTIL 4RWYL 3B6SB 2VRKA 3TO4C 4A3HA 4O2CB 3W2DL 3L3DB 3PHQB 2HVMA 1MFVA 4Y4HC 2I9LA 4OKVB 4GBXB 4JFHE 4H5SB 4AY0A 3AS3A 3ILQC 4ZAKD 4OQTL 4KZEL 4FFWD 4L9LC 1CL7I 5EBWA 2D03L 2NMSA 3U48A 3CIQA 2W63A 3ARFA 4TSAH 5DVOA 4OCNC 4DUVA 1TE1A 1ZT1A 3QO0A 4MCZA 5DJCA 1F6AA 2QKIA 3MXWL 2FGLA 5CJXA 5DT7A 1GOMA 4C83A 4F8TA 2WBWB 5A6LA 2H3NA 3H2WA 2JF6A 3H3BC 3MV9A 4FP8L 1ZXQA 1T5XA 3MA7A 4HIXH 2DSVA 1GOOA 2FD6L 3MR9A 4R26H 1OSPH 3U30C 4JRYD 5A3ID 3RDTC 3B2UC 4LKCB 4ZPTB 3ZLQC 4KKNA 5IVXA 5IYYA 3LD8B 3O45B 3O9WD 5I1HH 4Z2LA 3KZSA 3OKOA 2D22A 1J87A 3QUYC 4FFYH 4NKDB 4KWUA 4WTWA 1UB5A 4OLWH 2ADGB 4JLRA 3QUZC 1NC2B 2YUWA 1BAFL 3MRJA 2A38A 4PLJC 5I1GL 1D9KC 1KTKE 4XPFH 2BNUB 1LP9A 3MRMB 2DQIH 3CDCA 3LDBB 3R8BB 1FV1B 3S5LA 4DWSC 3KYAA 3GHBH 4W6XB 2GSIB 4ODHH 5DDHA 4Z5RA 1M04A 4HAGA 1H0DA 3FQNA 4ONFH 1FRGL 1I8KA 3EDJA 3HA0A 4LP5A 1DSFH 3C5ZD 1X5LA 5GS0D 1KLGB 1DJSA 2PW2A 4JZNA 1F4YH 2CIKB 4XUNA 3TTYA 1OSZB 5FYLH 4D8PA 2CUHA 1AE6L 1MHCB 1XF4B 2CKBL 3FO2B 3REWA 3B9EA 5M94B 1W2PA 4RE4A 1UWEH 1WF5A 3QIWC 4GJTB 4YPGB 5ESVB 1ITXA 1I9IH 1ODZA 4LSPL 5F7FA 1NLDL 4PMOA 1N59A 1E5NA 1DUZA 2EDJA 5LG1A 5IFHL 1ZTXH 3BO8B 2VLKE 3ARZA 5HYSB 1KGUA 1SYVA 2XY1A 4BQ8A 3HR5A 3FB8A 2VWEC 5MENA 3G9AB 1TNNA 1FVEA 1E4XH 3MRRB 1EUTA 2HA1A 3BVNA 3QI9C 2X4OB 3NH7H 4D0QA 3WJLC 4H20H 3PZQA 3W6LA 4JAWA 2J62A 2EPLX 3NIFF 1X5GA 1UXWB 3MOAL 2DQEL 1YEFH 1RHHA 1ZHLA 5ADOL 3TFKD 2Q6WB 1B3YA 2V7HB 1FIGL 4NRZB 2FB4L 2QQMA 2VR9A 3MLTB 4IRZL 4U6XA 2Z91B 3GHEH 4LIQH 3KPRA 5DHVB 4LHUA 2VZ3A 5DK0A 3WF0A 1JD9A 3JWOH 3GTNA 5I0ZA 2NY0D 3G5VB 3WEZA 4YWGL 5L8KB 3NN8A 1FFPB 2BHZA 1T5WA 1FP5A 4RRPA 3LE0A 3C7OA 1FG9C 4F9LC 1MRFL 4I9WE 2CLRA 1ZJAA 4JFVA 4DN4H 4DAGL 3CUGA 1KLUA 5D7IA 1W0WB 4YDKH 1TJGH 3G5XA 3LEVL 3MZTA 4WUKL 5I1LB 2JE8A 2VC2L 2JFEX 4R7NA 1EVTC 3PGFH 1AY1H 5L7XL 5KSBE 3U0TB 1RMFL 2XRAL 4NWUH 5L6YH 3P0VL 1YMMA 1IKNC 4MD5B 1C8PA 1QSEB 3AM8A 1RULH 4NJAL 3S35X 5BVJA 5D7SL 4KRPD 4NKIL 4HCRL 5SV4A 4LGXA 4DJMA 3OG2A 4FQIL 1IGMH 4GMTL 2QMJA 1OAQL 1NUNB 3D2UA 5FO8B 1O7VA 1AGFB 1RVFL 4OD3L 1MXDA 3EFDH 4NKMB 2OZ4A 3TZVA 1HYRC 4UFLA 3BWUC 1S78D 5EU6A 4QOKE 5BV7H 5SWZE 1JIBA 1NARA 5J1AB 1AGDB 3DVGA 3FRPA 4JO3H 4JIEA 4Y4KC 3LCYA 2WAHA 1KJ2A 2B7DT 4YHIA 4KK9D 3G08A 4YC2B 3T0EE 2P49B 3A6OA 5H35B 3MYZA 4DW2L 1NWTA 3WEMA 4OB5H 1IEAA 4U49A 1FZJB 2AJYH 2BCKA 2OBGA 2J47A 4ZTOH 4WI6A 3UO1L 4HZ6A 5EZJB 5LCVH 5DEFB 2ZCKH 2HISA 5IT2L 2KKQA 2QSTA 4OB5L 4DZBB 3B83A 5C0AB 4G8IA 4P5TA 4PJFB 3F7VA 4KDTC 5E00B 2BVEA 2JJSA 2RFXB 4KROC 5TDPA 4UTFA 1NLBL 1YY9C 3V9FA 3E8UH 4DKAA 2HLFD 5HPMB 4XX6A 3UYRH 3MNZA 1I8IB 3CSGA 1T7VA 1F2XK 2R0KH 2ZUVA 1X7QB 1JTTA 1DL7L 1SY6H 4KRPB 3SKJE 3MO4A 1FNLA 1T20B 2HJLB 4NNXA 5J6HB 3ROOA 1DUYA 5EBMB 3POCA 1LEIB 3AMGA 1KC5H 1CF8H 1QFHA 3H9SD 1GHRA 1B2YA 2CMRH 1GUIA 4L8BB 4KK8C 4PJEA 1KN2L 2FEDC 3VFTB 4HKZA 3MACH 1OP5H 1OM0A 4MLIA 1VF8A 4E2OA 1HQ4A 1KJ2H 1KFAL 4MNKA 2FJFA 4XNZC 1H1NA 2A6JA 4JDVA 3WSOA 3OB0H 4Y1AD 3ZKXC 4P59L 2DCKA 4OYUA 1WFUA 4JFHD 4W87A 3WH8A 2EIBA 1DEDA 1NOUA 2X44D 3MNWB 4JQXA 2DM3A 2OK0H 1U93B 2J7DA 3QWRD 1MCQA 3FFDA 4R8WL 2OXHA 3PZVA 2VAJA 1RU9H 1FE8L 4APQA 2WBJB 2KBGA 4XC1H 2IH3A 4LDOB 5DZOA 1OGAA 1GOHA 4HAFA 4KKAC 1NM9A 1BOGB 3MBEA 4QRRB 3BGAA 4L3AA 3LHPH 1NL0H 1XSJA 2UY4A 2YC1A 1W2VA 2ITCB 3MNVB 5E24E 5ICYB 1SMDA 2XQBL 4RSVA 2YPLE 3CUHA 3KG5A 3SE3C 3D9AH 4LCYA 3MV8B 1VFMA 5IG7A 3F2ZA 2XGIA 1CL7H 1UR0A 1GC1C 5IKCB 1BYDA 3WN6A 4JFOB 3HS0A 2QF8A 5CS7A 5JOEA 5KAQF 1KLGA 2BY1A 1NLBH 4PRID 5D7JC 4PJ5D 1MWAB 2B9VA 3LN4A 1P6FA 2H8PA 3WL9A 2AS5M 1KCSL 5E2VH 4KJQC 3G08B 3DJ9A 3BH4A 3JTTA 2BVUA 4GG6E 4LU5L 1S5HA 1V6XA 1HKKA 3RP1A 3QEQD 4N5UA 3ARRA 4LSSH 1K9FA 4HFWB 2ED9A 5TE4L 3VXMD 1UKSA 2V17H 3BLPX 4S1SH 5CP7A 3S5LB 1QOXA 1J5OH 4AAXA 1KB3A 4FQHA 4MJ6A 4FLSA 1BVKB 3CFBA 4Z2IA 1IQWH 1OT5A 4DAGH 4OCSL 3MUY1 4V28A 4Z7WF 4WI7A 3T3ME 4LVNC 5L8JB 4GRLD 4L3ED 5D7LA 5C3LD 1XH3A 1D5XB 3K2UL 5AYQA 4YHPB 5BJTA 5JR1H 4PTVA 2XZCL 4OZGF 3SKOA 3M7SA 2BHYA 2J5LB 2W92A 3IKCB 3RWGA 1HL8A 4WSKA 5FGSA 4NO2A 3IU4L 1N7ML 1IGML 2FB4H 3EJYC 3RDTD 1PMHX 1U9KA 2IAMC 3GSRA 4K3JH 3S4SA 3ZO0A 4U6TA 4WV1B 1HXYA 1AQHA 1MLCA 3BCFA 1WAAE 4UT7L 4HUXA 4RZCA 2LU7A 1U8MA 5I66A 3VW3L 1DANU 4P49A 1U8OB 1E4XL 3RUGF 3ETBF 4FZEL 3KLAB 2R1YA 3QWOB 3DRTB 4JRWA 3BX7C 4Z0BH 4YDKL 4L4VD 3U7WH 4DWSD 4E9LA 1KLUB 4PUDA 5IBTL 4H26A 4N9GB 4XPBL 4K94L 4O9HH 2WHMA 1FH8A 3KHOA 1EHAA 2Q6WA 5EN2B 4QT5B 4MAVA 2EPMX 1U3HB 3CSPA 4XBPB 4HKXB 5FA4B 2J6EH 3V7MA 1N3NB 4M43L 4ORGB 4A6YA 4ARXA 4EUPB 5I6SA 4R96B 5ABFA 1SEQH 2V2XA 3RHWF 2KD7A 2ADJB 4OGYH 4Y4HB 5IV2B 5HYSA 1FHGA 3FL7A 4U7SA 1QPKA 2WCSA 4JVWA 3MRHB 4M6NL 5JXAH 1D9KA 5FECB 2YLAA 1CK0H 4ODHL 3WEOA 5EIIB 5AUMA 3QDHA 1MCPH 2VKXA 4D6GA 1FVEB 2IQ9L 4X99A 3ZM8A 4AWEA 4JM2F 2QR0A 2VMDA 3DSFL 4MMZC 1REIA 2J22A 4PJIE 2J1VA 4PJXA 2FJHB 2ZSWB 5CMAA 3AISA 3THMH 2Z1SA 3RWFA 5AG9A 3VD3A 5A40E 5A43C 1RZFH 4LCWA 4XVSH 2VCAA 1C93A 5GRVL 1OIFA 3MGOA 1WBXA 3DO7A 2AXFB 4LYPA 4BF7A 5HHVL 1PX4A 5IGXH 3DWTA 3OAUH 3L5WA 1LNUA 1S46A 5EA0L 4HUNB 5FDYA 2YPLB 1SJHA 4U2YA 3S37H 5GS1B 2FX8L 4IOSD 5FHBL 1UWGL 2HKHH 4HJJL 4TVPH 2CKRA 3WD5H 2H8PB 2IALB 5J11C 5FM5M 1J8HB 2BVPB 5F7KC 4UOJA 4GKNB 1EV2E 4ZS6D 4L8SA 2E7LA 3DYMA 3GMOA 5JHDE 5C09B 3FOLA 1ZOXA 1IVLA 4G3YH 4OCYL 3QI9A 3EYSH 3WJLA 5HBFA 3G6DH 2A2QT 1HHKB 4YDVA 3U79A 5EO0A 1BVKA 3MRKA 2BMKB 3SDAD 2FH8A 3WELA 3ZTJG 3LH2H 2JCCB 3AGVA 1WV7T 2X70B 2APWA 3WH5A 3JWDC 4NN7C 1BM3H 1B3XA 1QA9B 3VGGA 32C2A 2HRPL 3MRLB 3VMNA 1CPUA 5EUOB 3WF2A 4PB9H 3DXAE 4H41A 1UCBL 5EJZB 2DLGA 4L9DA 2XNAB 3RKDC 4UU9A 4F9LA 3P30H 1CK0L 2KQMA 1P9MC 3RWFB 2HRLA 1GORA 5EN2A 1UWQA 1YEEH 3PTQA 3G6DL 5T5FH 4KVCH 5DQJB 5K9OB 2BOBA 3EYSL 3EYUH 1QLEL 4JFDE 3F58H 3IDAA 2E40A 3VIIA 4UINH 3Q6GH 5TH2A 5C8JB 1WWCA 1MREH 1PSKH 3CLFH 3QQNA 2VUOA 4NO5A 3L4WA 3WHE0 2WHLA 5GGRB 4P46A 1G94A 2UY3A 4RCAA 1V3JA 1MJJA 1DBMH 5IW3A 5MEND 3T0EC 2PYFA 3QUMB 4JRYB 1I1YA 1YQVH 2CNCA 3RBGA 1S9WA 3P1IA 2DQFB 2DQTH 3VGEA 2ZG2A 3STZB 4MD0A 3LKPB 1BHGA 3V6OC 1CZTA 3THDA 4N8VA 3IDYB 4JDTH 4IUGA 4MQTB 2Z31D 2Y6SC 5IMOA 5D6CA 5IHSA 1KN4L 1W0NA 6FABH 1T22B 4RDQF 2VMEA 3TT1L 4HPHA 3IJSB 4YBQC 4UT7H 3QIUA 3RL2B 5A16A 5ISZE 3P40A 4PJ5E 4A2MA 4CW1B 3UTOA 5HDQH 4NZRH 4H0IA 5TE6L 4NBXB 5BV7C 1BD2A 3DURB 5D7JB 4P2RE 3PP3H 5FXCH 1N8ZB 3A21A 3PN8A 2DQXA 4O02L 5BZWB 1R5VA 3AXXA 2G60H 3WUGA 2OCFD 5FGCB 2R2HA 2NY5C 4P5TC 3UZVB 1GGIH 5J1AA 1UUQA 3ARYA 3B5HA 5FCUL 1MFUA 2XIBA 4MJ2A 1LD9A 1Z5LA 4JPIA 4U1SB 15C8H 2JLLA 1XH1A 4HWEL 4BH7B 1MXGA 4K3DH 2E26A 2V7NB 2LVEA 4KKAD 2DIJA 2QQKA 5IFTA 4CJ0A 1SJHB 3HC4L 1J7VR 5DF0A 3IETA 2O9OA 3N04A 4NRXB 3BFOA 1ADQH 4PG2A 4H7VA 1KCVL 1UM5H 3PBGA 2J7HA 4GKNA 3VWJA 3OHXA 1JF5A 2PBGA 4CCEA 4H1LG 2NR6C 3M45A 2J5LC 2GJ6D 2HKFH 5D7KE 2EDWA 4RNRB 3ARGB 4M6NH 5J12B 3HZYB 1MIMH 1HDMB 1U8IA 1UD4A 4Q9RL 4HOXA 3AC0A 4TYUA 1OGGA 2VCBA 4GAYB 1ND0A 4OMCA 2XUCA 1CDCA 2XV6B 4OGXL 4LLUA 3ZE0F 4OCXH 1V5JA 4Q6IA 4ML4A 2XQBH 1XR8B 1CGYA 1XIWA 4PGBB 4GMSH 4Z0XB 12E8L 4R90L 1S7UA 4JFDA 2ZNWA 3QH3B 4P2QD 3OPZH 4NPYB 3EO0A 3P4MA 4HKBB 3MA9H 4M24A 4HJ0C 1MQQA 3PDDA 4C54A 3SE3A 4OOUA 3C60B 2OL3B 4F8QA 5IIEA 3UETA 1R5IA 1KJMB 3WQ8A 4NM8L 2DIEA 1GZPB 2H2SC 1P8JA 1MQRA 4M6MH 4L29A 5GRJH 5J9PB 4M7LT 1FLTX 3PG2A 5ICXA 4XBPA 4A6YB 4Z95H 5KSVB 4LCCC 1UKTA 3UR7A 5DJ0B 3IJYB 3RKPA 3K4AA 2KH2B 3H0TA 4MA3B 5E8PA 2F5BH 1W2KT 5I8KH 1EEZA 2R23B 4Q9QH 1PQZA 5SWZB 4MDOA 3HI6H 5FB8B 4S3KA 3NCJH 4W84A 1IAKA 4PJ7B 1CFNA 4JHBA 2EDXA 2O5YH 4K8RD 1UR8A 1CDUA 5F7LB 4AZIA 43C9A 5EOQH 2AP2A 4YAQB 4EKXA 4M5ZL 4OM0L 4ATDA 1I3RB 1JGVH 4JO2L 4HDIB 1HHKA 1HOCB 1L7IL 4OFYD 1ZVYA 1IT9H 3WFCH 1RZJH 2AQ3A 5E03A 3MCG1 3BXNA 3AMDA 2AKRB 2NY5H 3FNDA 2J1KA 1AQDB 2WMJA 2DM4A 1DQDH 4WJ5A 1NCWH 1CBVH 2WBGA 2E27L 1GOKA 2X1OA 4MJ6B 1FH7A 1HINL 5FYJL 5I2IB 5ISZB 2IAMA 3WBDA 4XUQA 5EWIL 7FABL 3STLB 4PB0H 1ZLWH 3SGEH 4EJ1C 2ICWA 1Q9OA 3F7PC 2PW2B 1FPTL 1W8NA 1KCRH 1ZU8A 4PRIA 5GRUL 4PJFE 4F9PA 4W50A 3ZR5A 4G6JL 4YPJA 4Z7VE 1BZQK 3IXAA 4D0DA 5DO8A 1JRHL 1MOEA 3SUSA 5DK2B 4NRYB 4YHYB 1FYTE 1MHPL 3F5KA 3KPSD 3N1GC 4YR6A 5KVFL 1CI5A 3HAEA 1IC5H 3MLVH 4WFED 5HD8D 1LO5B 3WDPP 3L3OB 5DVMA 1EDTA 5DFVD 3ARWA 4Y19D 3TP4A 1S7VA 4LVNB 3NZHL 2W67A 5IM7A 1DVFB 1J18A 4QGYA 2WIIB 2APTA 4FQJL 4X6CB 4D1JA 5FDWA 5KOMC 1N64L 1HH9A 3NAAL 1V3MA 3BZEB 4FQHB 1CLYL 5A2JH 2R9HC 2EECA 5E4EB 3CDYA 2QPSA 5IOPA 2WUBL 3MJ7A 2F54B 3MBXL 3U9UB 2FECI 1MSPA 1MCOH 3HHRB 3VMPA 3CIVA 5C0NC 1YA5A 3QCTL 1XGYL 5D1ZD 2G9HB 3L3JA 1V0KA 1NGZA 3OGCB 2VZTA 1YEKH 2CEQA 5IEHB 1AGEB 1JNNH 1FGVH 4KTEL 3BKML 4ZTOL 5JW4N 2GY7B 5AWNL 4QB1A 3VFVB 3HI1A 1OGBA 1IBGH 1GGBL 4RQQA 1K8IB 4LP4A 2SEBB 5CEYB 1YEDA 1U8QB 5JXEC 1LEGA 1MI5D 1QKZL 3F12B 4KKLC 5ACMA 1WFNA 5EH1A 2CLRB 2R23A 1TQCB 2ORBH 1JZ7A 2R2CA 1A7PL 2NXZD 3NIGE 4TVDA 2QEJA 5LWYL 2XICA 4XPGL 1DL7H 2DQEH 1D9KB 4PP2B 1NGYA 4PJIA 5KSBA 1FPTH 5JO5B 4C55A 2YRPA 3PV6B 1J8KA 3NH7L 4KDWA 3SUWA 3SCPA 5ANME 2PYFB 1T1XB 4HPYL 3NA4A 3P4NB 4PRAA 2X10A 1WCGA 1KB5H 4G43B 2G4FA 1CZSA 1IBGL 4XP5L 1ZLWK 1GAFL 3RHWK 4H88L 2E7LC 2AERT 2BP3A 5LCVL 4UDUA 5EZIL 4OLYH 3AMLA 5DC9B 4Z7OE 1G6RL 3CSYB 3OKMB 5DN2A 2RGLA 2YBUA 5EOTB 1X6LA 4UQ3A 3FY1A 2CKBH 4AK1A 2WZ8A 2EDQA 5IOPB 1NKGA 4EUPH 3AHXA 2EKJA 1OCWH 1FQ9C 2A6IA 3CH8A 3KYNA 3W27A 1PW3A 1XMWA 4YK4B 4BJLA 1Z5LB 1MLBB 1U3JA 2FWOB 3P77A 3EFFA 2E6QA 1AO7D 1JZ3A 1RK0A 4HXBL 1U3YA 3I2GA 2OR8A 4OGXH 4LEOA 1X5KA 3C9NA 3KPLA 1BF2A 4JQVC 4JKMA 2IXVA 4LCWB 1MIML 4BH7A 4NT6A 4TSBL 1NC4D 1WB0A 3AREB 2YS4A 3KAAA 3QB7C 3ZT5A 3G6AA 2A9NH 2HLAA 4NOBA 4XC3H 2WQRA 2IH1A 3GB7A 4H0HB 5CGTA 1WBYA 1LP9F 3VGBA 5I8EB 2W65A 5F6HI 1NLDH 2FBOJ 1KEGL 1AGCB 4JJHA 3S5LG 4UAOB 1CCZA 5GGSA 2WHJA 3WL0A 1UD8A 1B9ZA 4EVNA 1G6VK 2YKKA 3RPKA 1P53A 12E8H 2HT2C 3K77A 2BXYA 2NTFA 2FDMA 3DLQR 4JO2H 3NIGF 4P3CL 3UJTL 2XXCB 5C07D 5C0RL 4BQ2A 1U2HA 1I85A 5IFAH 2ZCHL 1FH9A 2CRZA 2WIMA 4N8VG 5F8RC 3RIKA 1E6SM 3UTTE 2VKWA 5E6IC 5DJXA 1AI1H 2ZEYA 1OIMA 4KQ3L 2XYCA 5JDJA 4HOWA 3QUMA 3HN3A 1EERB 3JBG7 4PBXA 4Y7MA 5C9JA 1S7RA 4L8DA 1BGAA 4XPAH 1K8IA 4P9HC 4HWBL 4KI5M 1T7WA 2Q8BL 4F58H 4R7NB 1GIGH 1GZJA 2Z8WC 2J7FA 4FG6C 3L4YA 1DQML 1T7XA 3WBAA 4HWUA 2BOBB 4L1DA 4N1CA 1NBVH 5E56A 1S3KH 1U8NA 1SJXA 3ULUE 3VWKB 1KYOJ 2XZAH 4H8VA 2EC9T 1XF2B 2PXYA 2JTDA 4MCYB 3GBML 3PWPA 3NCCB 3JUZA 3QXTA 1V6VA 2YBTA 4D0BA 4P23B 2CESA 3FB8B 3FZUC 5FYKD 2ICWI 3RU8L 5C09E 4GXVL 5C0BD 5FV1L 3W29A 4OF0A 9CGTA 2EDOA 5CEZE 4AENA 1Q72L 3LQZA 3HAEB 3BKCH 4HGWA 4I5BB 4LRIC 4ZSOE 5LQBH 1ZT4B 4Y4FB 1L8NA 2IFFH 5DVLA 2IPTH 5DMGD 3U57A 4KVCL 5F3BB 2DLHA 3RNQB 1MHCA 1AKJB 1XF4A 2K1MA 2GTWB 3VIFA 1WWWX 5HGDA 3W11D 1A8JH 4QHKI 5I76A 1IAOA 1WQVT 5IW1A 1BD2D 3DXAB 3LV3B 3CXDH 2EE9A 2GT9A 4AISA 3O3BB 4IBLT 4WJXA 5GRXG 1E4KA 4PGEB 3TZVB 4QDSA 1XIWC 2DQUL 4KRMB 3KDMB 4WFEE 4WJ5B 1BLNB 4YX2L 3SKOB 5JOFB 2EYRB 1FYTD 2F53A 3TC9A 4B7LA 2WZPD 5ICZA 4HBCL 1E5JA 4MZ3A 1JVKA 2OJZL 4BZYA 2OLDA 3CVIH 3O3AB 5LJYH 1J1OL 5DYOA 4KMLB 4UQ2A 3X3GH 3O8XA 4UOW1 1JCKA 4P4RA 5F7DA 3KHQA 4Q2ZA 3OMZA 4M1GH 2X1IA 3PDOA 1XR9B 4LLVB 4QRUA 1QI4A 3GFUA 2J1RA 3TBSB 1MFAL 4RA3A 3BI9X 4NZRL 3W81A 1W1VA 5KS9F 1O8PA 2EDBA 4FTVE 3P9MA 2HG5B 4FQLH 1TVPA 2DBLL 5IVZB 4A4AA 2A0LC 2AV1B 3BQUD 4FQCH 3KPSE 4L4OA 1KXHA 3D69A 4U1IB 4K2UL 3ZYZA 1ZL1A 4IMLA 3SGDI 3P6BA 3GMRA 3VXRA 1JE6A 1PFCA 3WS6C 1QHPA 2APBA 2NY1D 3G6JA 2E9JA 2OX5A 3O3DB 5JMRA 1V0LA 1JWMB 4BZ1H 1ZJBA 3QEHB 4JFUA 5EULV 4KUZL 5GS3A 2YC1B 3PWVB 5E94B 2BNQB 4JFYB 3AIVA 5EIQA 4IM4A 2YN3A 4MS8D 1KEMH 4PJEF 4XVTL 1MQKH 2A9MH 5TQ0H 4X6EA 3MZGB 5JO5A 2WWMD 2V5DA 5KVGL 4L5FH 1KJVA 2OI9C 2CDFA 2HJKA 4JFFE 3SDXB 3U5UA 3RWJB 3WMBA 4QRPA 3TBVA 3HNTH 4J3TA 1UWGH 2HKHL 3LN5A 1Z0MA 4TVPL 1MCIA 1KIPA 5TPWL 4LLWA 2GFTA 2FSEB 3WIIH 2D7PA 2X1QA 3F58L 5GS0L 1YZZA 1PIGA 5I16A 5DS8A 2VOTA 3DHPA 2YD3A 2Z4FA 1ACZA 4RL3A 1E6ZA 1J1OH 1CDIA 3BGMB 3BW9B 2P5EA 2ZCLH 4NQDD 5CEYA 4HSQA 4DZ8A 4TNVK 4TPRH 3IAQA 4NM4H 1J05B 3VXPA 1IT0A 4NQUA 3UEZA 1FNEA 5E8OB 1UADC 1R8LA 5FV2A 3C6LA 4WWID 4OLZL 4PG9B 5B22A 4PTTB 3QXAA 4ZDHB 3V4VL 5D96C 4KXZI 1ISZA 3GJEB 2QPUA 3VMOA 1RV6X 3QCUL 3GJFH 1Q0XL 2I24N 3I2FA 2X9WA 2VZ1A 1GPOL 1YY8B 4YDVB 1Z9LA 4YHPA 4WEBL 2VXUL 4AEIH 3U6RA 4A2LA 4PD4K 5F71A 1UEYA 2E7HA 3MV7A 1BQLH 1RK0B 4Y8DC 3TNMB 3U1SL 2ESVA 3ALWA 2VXQH 1ZLUH 2LTQB 1MJ7H 3JXSA 1BG4A 3VKKA 4OLVL 3DO3A 4YBLB 5DD5H 1KIQA 5HDBF 2R4SH 1YMMD 2VN7A 4UUJB 2LE9A 2X4NB 5D1QB 4M5YH 5MEOA 1ZA3A 3HKFA 4S10A 3TBYA 1TVHA 2DQDL 3GBNL 3GO1L 5L88H 3VTRA 4XP6H 1BFOA 1QRNA 3QO1B 5E6IB 1U42A 1D5BA 4LMQE 4JG1L 3I84A 1R3JA 2O5ZL 4EI5D 1XV8A 2B1AL 4OIAA 4OZIB 3AMCA 1BPVA 2Z8RA 1GIGL 3B3IB 1JXJA 4LRNH 2WLYA 3QQ9D 1TVBB 2WINB 4APQD 3Q5YA 3ACGA 4XP5H 1OGAD 2BJML 1PKQE 2D31A 3UTPE 3RBSA 1J9CT 2BNQA 2ZEZA 4LYRA 1WUNT 3O6LL 4LSRL 1L0XA 4ORGA 5EU7E 3PIQA 2R8SH 1SJVA 5A94A 3CFCH 1EOKA 1FL6A 3V8CA 2GDUA 5D93B 2PF6A 1KPVA 2DN7A 3I50H 3VXOA 5KOVC 1W9DM 4CDHA 3LQZB 1M7XA 5LA1A 1JZ6A 1RP9A 2ORBL 4AD0A 4NNXB 5C0RH 1N3NA 1Q94B 3KL3A 2EH8H 1DDHB 4LNVA 3BKJH 4DEPB 4DOHE 3S4SG 3VWKC 3KPSB 4D9RD 4YIQB 1I9RH 4ZD3L 2XXMB 3IJ8A 5C8BB 4TVUA 4UZGA 1UOKA 1LEGB 5ALBL 1RK1B 3QEQA 4AMCA 1KCSH 5E2VL 2VLRA 2AJUH 4ETQB 2XSAA 2OK0L 3S3PA 1NMAH 2XVLA 4XZUG 2DJUA 5JIWA 4IOFD 2A9NL 5CSYA 5BMFH 2D9CA 2AXJA 3VFUA 4R4BA 3I2KA 4OZHF 2QQNL 4L8DB 5I71C 1N64H 4W6WB 4JAMA 4XI5C 4W4ZA 5DEZA 2HTLD 1A9EA 5K9OA 4C59B 4WU5A 3L4ZA 5I74B 5FUZL 1DWAM 1G0CA 3BAYA 4YFEA 3MACL 4GPNA 1P4LB 3VH8A