2VZPA

Atomic resolution structure of the c-terminal cbm35 from amycolatopsis orientalis exo-chitosanase csxa
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
126
structure length
126
Chain Sequence
b'DPVDYQAEDATIVQGAVESNHAGYTGTGFVNYDNVAGSSVEWTVTVPSAGTYDVVVRYANGTTTSRPLDFSVNGSISASGVAFGSTGTWPAWTTKTVRVTLAAGVNKIKAVATTANGGPNVDKITL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
molecule tags Hydrolase
source organism Amycolatopsis orientalis
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
total genus 26
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzpA00
2VZ3A 2BGPA 3ETPA 1W8OA 5I0DA 1DYOA 2W87A 4MO3M 4P5YA 4IUGA 3ZM8A 3VD4A 2J1VA 3SKVA 4ZZ8A 4P08A 2DCKA 5C7GA 1XC6A 2WAAA 2OKXA 1SHWB 4ARXA 3ECQA 3CDZB 1CIYA 3HNYM 2QBXA 3VD9A 1H6XA 3K46A 3WQBA 3WF3A 2J7MA 1UMHA 2WO3A 3MUZ1 4D8MA 2W9XA 2YB7A 5B4NA 5JUVA 4GWJA 3I2HA 1DP0A 3WF0A 4DEVA 3HOBA 3A23A 2VCCA 1GU3A 3P1IA 4A6OA 3LE0A 4CU7A 3IIIA 3MV01 3HJRA 3VDCA 1UYXA 3NRUA 4MGSA 3UESA 5JXIA 2ORXA 1XNAA 4XURA 1UZ0A 2VQUA 3IAPA 3LQCA 4OMCA 1TVGA 4QDSA 3WNMA 1JZ4A 2C26A 3CQOA 3T2QA 1MPXA 4CU6A 2ZXQA 2HLEA 3PUIA 1CZVA 4HG6B 4ZZ5A 2JE8A 2R7EB 2WQ8A 4AG4A 5LA1A 1P8JA 3T2PA 4CUAA 3DYOA 2ZEXA 2VMCA 2VJXA 2VZSA 3MUY1 2PQSA 2RV9A 1JZ7A 3LEGA 4QB6A 3VD7A 1W9TA 3ACFA 4W4ZA 5LA2A 3VD5A 4UAPA 2XOMA 2V72A 2VO5A 1XPWA 4DUVA 5DQ0A 2WN2A 2W91A 1JZ5A 4UOJA 4MADA 1JZ8A 1JYWA 3WNLA 5JR2A 2ORZA 5DN2A 3WSOA 3K77A 4DXSA 1GUIA 3ACIA 2LS6A 1GQPA 2WO1A 4RN5A 1KEXA 5HPOA 1JYNA 3ACGA 1K3IA 1W9SA 3WNPA 3UNPA 5CYYA 1UXZA 2W1QA 3BN6A 5IJRA 4RYDA 3THDA 3K4ZA 5CZKA 4AAXA 2WDBA 3C7OA 2QQMA 4CUCA 4YPJA 2V5DA 2DCJA 3A22A 1NUKA 3GGLA 4M4RA 4P00B 2WABA 2VCBA 1K45A 4QDQA 2J1SA 2E32A 2VZPA 2VZTA 3PUHA 3CIHA 4DUXA 4QX2A 4XUTA 2X05A 4JHZA 3VDAA 2ZEWA 3HEIA 1US3A 2VOTA 1GOGA 2W1UA 3LEKA 3WF1A 3A21A 2W3JA 1UY0A 1JYVA 4KWUA 3SEEA 2XQXA 5IYYA 2VM9A 3J7HA 4LPLA 4CUBA 1UY4A 1WCQA 5B4XA 1JZ6A 2EICA 1K42A 3FL7A 2WZ8A 3D3AA 4XUNA 3C7HA 1UX7A 2BERA 2W95A 3DYMA 1DLCA 2B4KA 3CZJA 4ZXEA 4BK4A 2C4XA 4A4AA 1PX3A 1JYXA 4QB2A 4XZUG 3I2KA 1EUTA 3THCA 3I2FA 3C7GA 3ACHA 5J1XA 4A44A 3HN3A 1SG3A 2W92A 3IAQA 1OT5A 3W5NA 3CMGA 3FHAA 4JKMA 2WO2A 4CVUA 1GOHA 1UYZA 2W1WA 4L0PA 2WUHA 3GM8A 4GZ9A 5DPNA 5G04L 2VR4A 3P6BA 3GXUA 3MV11 1J84A 4A41A 2W5FA 5IFPA 2YFUA 1O8SA 2VZRA 3IB3A 5EJZB 3HNBM 3T08A 4DUWA 4LKSA 1GOFA 3AC0A 2VMEA 4DXTA 2QQJA 2DDUA 3W5MA 1JI6A 2VZOA 1UYYA 3JXSA 3OG2A 1EUUA 3NJVA 4MOAA 4LHSA 5EIYB 4A45A 2QQOA 3I2GA 2VZUA 4KMQA 1F4AA 3LEIA 1NAEA 3F2ZA 3OBAA 2E33A 2JD9A 5G05L 1R64A 2EIEA 4QPWA 5FUIA 3OGRA 3NNGA 1UY1A 2W1SA 3E1F1 5JXJA 4CU9A 2VTFA 3K4AA 2V4VA 4CU8A 4A3ZA 4TXWA 3OGVA 2CDOA 1OF3A 1JHJA 1JU3A 3I2IA 1W9WA 2C9KA 2VZ1A 5DMYA 2ZEZA 3NQHA 1ULPA 2WN3A 5C70A 2ID4A 2YG0A 3FN9A 4OZOA 2HYXA 4A42A 2W47A 4XUPA 4BK5A 3T09A 3K75B 2J1RA 4QAWA 4QX1A 3BGAA 1PMJX 1UMIA 3FHQA 4M4PA 4ZY9A 3ABZA 3I3DA 3OEBA 4OMDA 4BXSV 2VMDA 1OD3A 5EJ1B 3T0AA 3OGSA 5HXMA 4TTGA 1W8NA 1TG7A 1UXXX 4UI9L 2BBAA 3SEPA 1IQDC 2W94A 1BHGA 1ULOA 5JXGA 3DECA 1JZ3A 2VC9A 4MGQA 2QQKA 5F7UA 1UY2A 2J1TA 4KI5M 1CZSA 4XVHA 4DXRA 3WNKA 3C7EA 2RJ2A 1CZTA 4PQQA 4GWIA 3HNMA 1I5PA 2VQTA 1SDDB 3I97A 2B9VA 3WF2A 3VDBA 1KGYA 1W99A 2BGOA 2WAOA 3OB8A 2WYSA 4QB1A 2J1EA 2VCAA 2QQNA 1RYYA 3CZUA 4QX3A 1US2A 1XNTA 4ARYA 4JKKA 5LA0A 1GMMA 2YC4A 3OEAA 3IDAA 2L9LA 4JKLA 1O59A 2Y6GA 2EIDA 4DEQA 2VL4A 2XONA 1OH4A 4E8CA 1NKGA 3WF4A 4LQRA 3A7QA 3GDBA 2BZDA 3WNNA 1F4HA 2Y8KA 3DYPA 3T0DA 2WZEA 3I2JA 3HPNA 5LCWL 2W46A 4FI9A 1H6YA 1L7QA 2KD7A 4E8DA 1J83A 2X10A 2J1UA 3NJXA 4BDVB 4JX0A 5IHRA 2EIBA 2RVAA 4W8JA 2YFZA 1CX1A 2Y6LA 3EYPA 1UY3A 2JDAA 3K4DA 1HN1A 2QQLA 4PF1A 2XHNA 1YQ2A 1PX4A 1GNYA 2CDPA 4XUQA 4PT6A 2E26A 1PMHX 4XUOA 1WKYA 4QDRA 3T0BA 2X09A 3WEZA 5A1AA 2J1AA 1JU4A 1LNSA 2Y6HA 4D0QA 2Y6JA 2QQIA 4BJ0A 2J22A 2WBKA 1OF4A 4Z2AA 5JMOA 3WNOA 2Y6KA 2Z4FA 1JZ2A 3EB7A 3I3BA 4W50A 3LPGA 3C8XA 3T2OA 1K12A 2LW8A 4OYUA 2ZEYA 3MBWA 2VZQA 3LPFA 1W0NA 3U37A 1O8PA 4OUEA 3UETA 4QX0A 3C7FA 3I3EA 2E31A 1NX9A 1UWWA 2Y64A 3SKJE 5JXHA 5C71A 3MO4A 3VD3A 1T2XA 5IFTA 4ET7A 2YC2A 2VZVA 1L7RA 1D7PM 2VMFA 2JKXA 3CKHA 4P02B
chains in the Genus database with same CATH superfamily
3WW3A 1TMF1 2WFF3 4FP3A 1QKQA 1H1AA 3V0AA 1W8OA 5I0DA 3HMYA 4MO3M 3AYEA 3POIA 2RM22 3ZM8A 2Y34A 3OCPA 4CEWB 4PQ9A 4P9YA 4UF0B 3FMGA 2EAKA 2JENA 1SLLA 3HN1A 2KA3A 2Q8DA 3TB0A 2VAUA 4AGVA 4E4ZA 2OKXA 3WXPA 2AZ5A 4LJHA 3HNYM 4ISQA 3VD9A 2WJSA 3WG4A 1H6XA 3AMQA 3SITA 5T5LA 4XC9A 3WF3A 5M0TA 3SMHA 4YGDA 1UKGA 3MF9A 2WO3A 3IIAA 4D8MA 3KQRA 2YB7A 3ZDVA 4NIHA 3ZFFA 4RS5A 5FPAA 5KHIA 3WF0A 5JSPA 4FQZA 1J59A 1AYN2 1HN0A 4IESA 4FAHA 5FO9B 3WW2A 3VZNA 1U0AA 4AI8A 3LDBA 1NZIA 1VMHA 1W8HA 3WQ0A 1HXS2 1LU2A 1WW7A 2YPDA 2E6VA 1V6IA 3LE0A 2IXJA 2XJSA 3AKTA 2JXAA 4YGBA 5BNNB 5FXWA 2FDKA 2Y60A 3UESA 1LHOA 4PBPA 1LOFA 5JOXA 3ITQA 1AL23 3NW4A 4QMAA 4AHYA 2B8MA 4CDUA 2E53A 3MIBA 3M8LA 5AVPA 2ZMKA 4NIAA 2JE7A 5FYMA 3CJXA 2OQ6A 1CN1A 4DY5A 2F4PA 2JB4A 2ARCA 3U11A 3UYJA 5C3SA 4YW7A 2OZJA 2PFWA 2WWJA 1H30A 1UZ0A 2VQUA 1O4YA 3HQXA 3Q8FA 2DV9A 4UFKA 5A3OA 4GWNA 1IOAA 2GNBA 3WNMA 1K5MA 4XFBA 2RS52 4O9EA 2C26A 4RQPC 1V0AA 1BBT3 3IN9A 4Q1PA 4BQYA 4NRMA 1MPXA 4CU6A 2ZXQA 2VH9A 3D82A 3ES4A 2HLEA 3PUIA 2CTVA 2CNAA 5A3LA 3CJIC 2WYFA 5FWEA 5L9BA 5LA1A 4BQ5A 1RUI2 1SCSA 3DF0A 4N43A 4TYSA 5FMOS 5A3MA 1RUF1 2NP0A 1IPKA 2OT7A 1RUH3 2WKKA 2PQSA 3HT2A 5FJKA 1RMU1 2WSUA 1V6MA 4QB6A 4UBGA 3VD7A 2XKPA 3CHXA 1KDKA 3FUQA 4W4ZA 4CPBA 4COZA 3ZSJA 2GALA 2XOMA 2CWMA 3POFA 3LIHA 1W03A 2PAMA 5JAXA 1XYOA 2D43A 5DQ0A 4HANA 4YM1A 4G9SB 4IEUA 2W91A 2JKBA 4JZRA 2PHXA 1JOBA 4YZ4A 1A6CA 5DN2A 3TNPB 5FWJA 1UIKA 1BK1A 2KR2A 2Q4SA 1GUIA 4F3JA 1PVXA 2EAAA 4GIQA 1WW6A 1IS5A 5FZOB 4OQ9A 4GH4B 4D6SA 2WO1A 3AP9A 1AYM1 3KB5A 4RN5A 1RHI3 2GNTA 2Y26A 1W9SA 4YW3A 2E9QA 2QJVA 3IT8A 4XZPA 4XJWA 4FTSA 3U1XA 5IJRA 5LEJA 1OLME 4V2VA 5D21A 4BMBA 1IKQA 4Q4Y3 5FP9A 4AAXA 1IG0A 2WDBA 3W20A 4HN1A 4NMIA 3H8RA 1YYNA 2V5DA 2XQRA 4IV3C 4NPRA 5HCFA 4IGPA 3KCYA 2X5IC 2AEYA 4WM8B 1F35A 1OC1A 4P00B 3CBNA 1QOOA 1HQNA 4ATEA 3B93A 4Y1UA 2FDFA 3PUHA 2PMWB 2AREA 3CIHA 3KD4A 3RNSA 4YW5A 3VDAA 4A2UA 1MZ5A 4LEJA 1MZFA 3LEKA 2DVBA 1UD1A 5E89A 1UY0A 5C9AA 4EQVA 5DDJ3 5IYYA 3J7HA 2VNOA 1J1TA 4EV0A 4OI4A 1EV12 2DVDA 4CUBA 4JDMA 4N53A 4GD4A 3KF5A 1VRBA 1WCQA 2VBPA 5FAXA 1FNZA 1HB2A 1UU4A 4PIXA 2UY9A 4Q27A 5CNAA 4CCNA 2MHFA 3Q8BA 2JE9A 3SH4A 1JZ6A 1FATA 5FXXA 2EICA 2QQPA 2P3IA 1H2MA 3RSJA 3GZEA 1QH7A 2D40A 2ZGQA 4LK7A 4XIKA 2WZ8A 4IE4A 2BQPA 1X36A 3LA2A 3C7HA 3QH6A 2WA3A 3DYMA 3VLBB 2C9AA 2DWRA 3JB8A 5FBZA 2EVXA 3PMSA 4ZXEA 2GH2A 3JZVA 2R072 1W6PA 1NLRA 3LSDA 4HK9A 4P02B 4QQHA 1O4ZA 3O7OA 2DUOA 4QB2A 4XZUG 1XRUA 2IXIA 4K6BA 1Q8SA 4QKDA 3GBFA 3I7DA 5T50A 3I2KA 3ZSMA 4QX8A 2RE9A 5LW9A 1KD7A 2Q30A 4CXWA 5CISA 2BVBA 4U36A 1A78A 4EWDA 2Q5TA 5F9TA 4Q4W3 5GZCA 1UU5A 5FYCA 1AJKA 4H2AA 3GBGA 3NV3A 5K0UA 4X8PA 1IHMA 5EHDA 4CEYA 2RR11 3CMGA 1AR71 3FHAA 3D5OA 1ODNA 4WZCA 1W6MB 3GHNA 3M3IA 2VMHA 4GKYA 3AKQA 3HQUA 5DG2A 3GYDA 2YZ4A 4IGOA 4P9LA 1ASJ3 2WZR3 1D4M2 4Y22B 5F6LB 1FYUA 5GKAC 5JIAA 4EZHA 2W1WA 3M3OA 4M0NA 4U2AA 5CFCC 3MFAA 1AL21 5T5OA 3L2HA 2UURA 4GH4C 3HAGA 5DPNA 1SLBA 3P6BA 4N9IA 1LOFC 3N7MA 5FYVA 3MV11 3QLQA 1BMV2 3OYWB 3KVAA 3URFA 1H8TB 1TEIA 4UYBA 3WINE 4UW3A 1RUJ2 4YM3A 5IFPA 2A1XA 2VNGA 2VUCA 1AHSA 4LITA 4XFIA 5IVFA 3T08A 1N47A 2EALA 4QPGC 4AGRA 3H8OA 2D3RA 2FD8A 4E9KA 2A6WA 4OLLA 1GOFA 1VBB1 5IVCA 2VMEA 2A75A 4XHBA 3OPTA 1NE4A 3W5MA 1JYIA 1F9KA 2RM23 2VW1A 4P9IA 3B3QE 5F5AA 4PLNA 2DU0A 1LTEA 1WLTA 2WFPA 3AZWA 5K8SA 4LHSA 1LHVA 5EIYB 1D2SA 3I2GA 2BP6A 4ZXKA 5FCCA 1NAEA 4IETA 1PIV2 2WS93 3B00A 1MS3A 4JVAA 2AEZA 5C3QA 3G7DA 2JD9A 2GN7A 3UK9A 5GALA 1RGSA 1RUJ1 1SLCA 4AFBA 2WLPA 4ZKTB 3QCWA 5LBBA 1VIWB 2Z42A 4CU9A 1H9WA 2VTFA 4ITCA 1TE1B 2PXJA 2VBBA 3BCWA 3I4IA 4WVMB 4XTPA 4AOCA 2HWE1 5FUNA 3Q8AA 4JTOA 1DQ0A 1NCRC 1RVF1 2CDOA 3POYA 1NA1A 4B1MA 1W6OA 1BCXA 5KC5A 3FLTA 1LGNA 5FMBA 1HQWA 2HEYF 2VZ1A 2G19A 1OMIA 1J3QA 1WD3A 1BYHA 3BOPA 2PYTA 2ZEZA 3IPVB 3OJBA 4OFGA 5JWPA 1CPMA 2RHPA 2WN3A 1XU2A 4OZXA 5I93A 1W39A 2ID4A 4HZFA 4L8QA 5LASA 4KGGA 1QJZA 2WNVB 4OZOA 2BDRA 2GZWA 2R042 5J98B 5F37A 1RINA 2HYXA 4L11A 2ZGUA 3T4VA 5JSRA 3RMXA 1C3HA 5FYHA 1WA4A 4XUPA 4BK5A 1OXCA 1LOEA 1C5IA 1RL3A 5KXBA 4INDA 2VQ0A 1BKZA 3HBZA 4FXGB 4MGKE 2FCUA 4UXAA 4GMP3 4AI9A 3FHQA 1UZZA 5FTTC 2RR13 3L2YA 4LK6A 4Q0PA 2LALA 4AFMA 4BQXA 3NWKA 1RTVA 2WT2A 3OGSA 2VECA 4TTGA 1Q8OA 1W8NA 3H0OA 3VBHA 3VBOA 2CU5A 4FPCA 2ET1A 3SEPA 3UGGA 1WCKA 3PDQA 3NSTA 4MHUA 2W94A 1BHGA 1HKDA 3AL6A 2AYHA 2JICA 3LA3A 5F3EA 4LIUA 5FJHA 3NJYA 4MGQA 4RHV2 5EWSA 2J1TA 5FXZA 3LFIA 5JIUA 4HT1T 4KWKA 1GWKA 5FYSA 2IFRA 1IS4A 1VBA2 4DXRA 1DLLA 1RUI3 4TN7A 1JHNA 1BVP1 2DCYA 2BV4A 4AL9A 1CZTA 1W04A 3HBKA 1V70A 4PQQA 3RZZA 2IXKA 1QJFA 4K21A 4AVCA 2B9VA 4LMFA 1KJLA 4JGYC 1NA1C 1QJY1 5CKQA 2FDGA 4QM9A 1R082 2BUKA 4CEWC 3OPWA 1GZWA 1QQP3 3POEA 3A0NA 1UKRA 4RR3A 1HLCA 4GB31 3GZUC 1C28A 1F5FA 1ZZ6A 3DPRA 4LR4A 3WZ1A 3ZSLA 3ZYIB 5ABJC 5C8CB 1GANA 1QWRA 4XBNA 4E4DX 3EMRA 4RD7A 2WIIB 5LA0A 4TZDA 1WWYA 1MEC3 1QXPA 1VBC1 1L3JA 2X5IA 1SDWA 3VHOA 4CXYA 3DEMA 2AACA 1LHNA 4LXLA 3THPA 1PVC3 3POJA 1LKNA 2BNMA 1W8UA 2AUYA 1GZCA 1OURA 4BMEA 1WCSA 2WNOA 4Z92B 4N7UA 2H6CA 1OH4A 1K5JA 3LD8A 3WUDA 1OKOA 4YG6A 1VBD3 1RUG1 1QJY2 4FOWA 1RMU3 1GP5A 1U5ZA 4LTAA 3ZYGA 3VBRA 4COVA 2BZDA 3ZYRA 3P3NA 3J7MA 1F4HA 1YIPA 1PO21 1E5SA 1G9AA 5AVAA 5IAVA 5A32B 3VKLA 1H6YA 5A3WA 1KFXL 1X9PA 4CSWA 3A4UA 3SISA 2XJUA 2J1UA 1W2AX 2E7AA 3F95A 4JX0A 4XQDA 1W6MA 4HONA 2VW2A 2WO7A 5DAXA 2ZHKA 2ZGLA 4MXVA 3VDDC 3WHUA 3B69A 1YNAA 1PNFA 3EYPA 4QQOA 1UY3A 1WBFA 2Y0IA 1ZBA3 1UPSA 5FY9A 2I07B 3FBYA 5FZIA 3K4DA 1HN1A 3MYXA 5FO7B 5IVJA 2YY1A 1BVVA 2P34A 5FZGA 3FWEA 3AM2A 5B2GB 3I8TA 1YQ2A 1W8FA 5C4WA 3OGJA 3USSA 1HV0A 3AJYA 2CHHA 3PU3A 2R49A 4LHNA 1MVEA 1GNYA 4TSVA 1ZBE2 4DS0A 3O1RA 3CJIB 3H42B 2XLAA 3W9AA 4ASLA 4YZ5A 1PMIA 4XUOA 5DAQA 4COWA 2R043 4A7KA 1OOPA 1WKYA 4HPKA 2QFEA 1UL9A 1N1VA 4B7EA 4AYUA 2JX9A 5K9YA 3B94A 3VBUC 4KQ7A 5JZGB 1JBCA 1WCDJ 1ZX5A 4KWLA 3TN92 4MGTA 4NJ4A 5BNPA 2UWAA 4KU7A 4BJ0A 2XKOA 2HWF1 3KHBA 1VRH2 3KGLA 4H3WA 4E2QA 3VB9A 1CAWB 4OULA 5I8SA 4B3NA 3EJKA 1HXS1 1NA1B 4LE3A 2HJIA 3DV8A 3MPBA 3MZHA 4ASKA 4R52A 1BK0A 1BMV1 3V56A 3CO2A 1S0DA 5H9SA 2DBIA 2DVGA 1ZA7A 2LW8A 3AKRA 3E6DA 1V6LA 1JODA 2ZHLA 3IPVA 4PBOA 1I3HA 4OHZA 1RJ7A 3LPFA 3RZKA 3U37A 2BBVA 2RS11 3S7EA 1JW6A 3LF7A 4HMZA 2HKXA 1DBNA 4NROA 4XOGA 1PIV3 1AF9A 1UZWA 3DKQA 1MS1A 4OUEA 4XDPA 2QVSB 1N3OA 3C7FA 4FAGA 5A70A 2QKDA 1NX9A 4JQRA 1VBB3 1MQTB 1W6QB 5JXHA 2JDKA 4DPNA 5C71A 1SCRA 3MO4A 4W6XA 1T2XA 1JTZX 2HEVF 2D97A 2BFUL 2RJLA 4Y20B 5LBFA 5IFTA 5LRSA 2ZGRA 4OI1A 4XCBA 2XL7A 5FZAA 4CPBD 5C5TA 4FPYA 4PI2A 3BYWA 4XAEA 2JKXA 4MG2A 1Y9GA 1FAYA 2FCVA 4X6QB 3VBSC 1RC6A 4R4XA 5GZFA 1PO22 2Q8EA 4AK3A 3UKTA 1H8TA 2VZ3A 1XQNA 4HVQA 3ETPA 3DL3A 4H7LA 1PM7A 5FMCA 5JR7B 4P5YA 1RUH1 4AQ2A 5BUVA 3VD4A 2VNRA 4ZZ8A 5HCAA 4P08A 2XVKA 2DCKA 4XACA 3GZTB 4CZSA 2YMZA 4IEYA 5FYZA 2QBXA 3QBQA 2YUEA 1DQ6A 5GZEA 3JBG2 5DAPA 5I0UA 1CPNA 3BIWE 2XGXA 5CFCA 4CCLA 2WRAA 4XXPA 4DB5A 3THTA 1XYPA 3MUZ1 1PK6A 1XE7A 5CB7A 3WLUA 1VBC2 1D4M1 3WDWA 4GWJA 1POQA 2SLIA 3I2HA 5I91A 1XB9A 4XF3A 1GZTA 1LHWA 3JB4C 4Q4W2 3BB6A 3O1TA 5FZ1A 4C0HA 1WBLA 3BTAA 3P3PA 3ZFGB 4DEVA 1HRV2 1AYM3 1NCQB 3A23A 4RR3B 3OY8A 3UKVA 1H2LA 5ABJA 4GWMA 2VCCA 3DPRB 3NNMA 1RUG2 1SPPA 4MUVA 1VJ2A 4XMAA 2C0ZA 4A6OA 1ST8A 3G6JB 1FMD2 4NPMA 3M1HA 3MV01 4QHOA 3H1WA 2PLV1 3VDCA 1UYXA 1X82A 3NRUA 4UW6A 5LA9A 1Q8VA 3R4DB 4JTNA 2B39A 4PDWA 4Q0SA 4CUGA 3EBRA 5FZ3A 1C57A 5A7OA 4FOQA 1RUNA 4GQ7A 2PHRA 3R4SA 4LBQB 3M7AA 1ENQA 4A6SA 4AVVA 2QDRA 3N36A 2Z2SB 4LKDA 1EV13 3J8F2 3IAPA 2PQQA 1KS4A 3CEWA 5DDJ2 5FY1A 2GC0A 4B8EA 4MXWB 4M3CA 3AYDA 4NHMA 1OBNA 5IK7A 1R091 4OQ8A 4XQWA 4JHTA 4O61A 3U07A 1R081 3GCXA 2LTNA 2VTXA 1H8TC 3M70A 4WZFA 4D6QA 4HG6B 4OI0A 3V0AB 4AG4A 2EXKA 1GP6A 1OOPC 4R4ZA 3FE5A 5A33B 5LZ6A 1P8JA 5LK7B 4BZ4A 4E4SA 3HQRA 1C8M2 1PNGA 3DYOA 2YBKA 4M3CF 1C4RA 4UF0A 4CCJA 4CUAA 1CAVB 1LR5A 4QPGB 3RYPA 5BY5A 3AZZA 1MS0A 3MIGA 1MACA 3RYRA 3MUY1 5ANNA 5FMDA 3VBRB 5C4WC 1DZQA 1JZ7A 4B4PA 2GN3A 3IDEA 3N7KA 3POGA 5LA2A 4K9SA 4RHV1 2JDUA 2TEPA 4F83A 1V6JA 4LHLA 1J58A 2BTVC 2BPA2 2P4EA 1Q8PA 4IERA 2R32A 5H9PA 1JZ5A 4CDXA 2ZZQA 2NMNA 3MFCA 2R061 5T5JA 4YARA 2ORZA 3RJ2X 3D8CA 4YFWA 3WSOA 3H3LA 1FOD1 1OA4A 1BEV3 3LIGA 1XXNA 4DINB 3FHIB 1ODMA 3VKMA 2RS12 2VW0A 4J25A 4XBQA 3S57A 5FPLA 1JYNA 1YEWA 2VOVA 1K3IA 4A7YA 4QXBA 4OHWA 3AMHA 3WNPA 1KXGA 1DU3D 3ZN4A 1AR92 4L9BA 3OD0A 3CJIA 1QY4A 3GBWA 2QDNA 4C0BA 4E2SA 3ZFFC 1UXZA 2PELA 2K9ZA 4RYDA 1NE6A 2QUOA 1VMJA 2IC1A 1SLAA 3J8F3 4NR1A 5FZLA 3PNAA 1C1FA 4IW3A 2ZGOA 2HWF2 1WMDA 3C7OA 3NO8A 2P37A 3I59B 4YPJA 4Q4X3 1SBFA 3VDDA 3VKOA 2DCJA 1W2TA 1APNA 3HIFA 4URAA 4AVAA 1SLIA 1VMFA 2D6KA 1NUKA 1ULEA 4CCKA 2H6BA 1NZCA 4LO6B 1DHKB 5A1FA 3MIDA 1VAKA 3AP7A 2O8OA 2J1SA 2E32A 1CQ9A 4BA6A 1D0GA 4XUTA 2HWE2 3ZPOA 4E27A 3OUIA 4JHZA 1UOJA 5IW0A 4AE2A 4BOWA 4LOSA 4XFFA 4CDUC 1GOGA 2W1UA 3EXUA 2D3PA 3WF1A 1S1AA 4HLTA 2W3JA 4LT5A 5CFDB 1A8MA 5JCTA 3RMYA 1LEMA 1UY4A 5D1IA 5FY0A 3ZIWA 1EV11 2BWAA 1REDA 3S7IA 1ZRDA 1EPWA 2R1DA 1PZ9A 2P3KA 1AL22 2RDQA 3VKFC 3GF6A 4IEQA 4RS5B 4XUNA 1UX7A 1PHMA 2W95A 3IDBB 4CP0A 3LOIA 5FY8A 3FZ3A 2CL2A 5F5CA 1YJLA 2HWB2 1DGRA 1ASJ1 2XVLA 5FZOA 1RUF3 4NAMA 1W3XA 1H4HA 3VBRC 1FT9A 2VU9A 3ZR6A 3ZXAC 4FSJA 4DRRA 5HCHA 2W92A 3IAQA 1MVQA 2P6HA 3LCPA 3O14A 1LGCA 3CF6E 4F8AA 3OPZA 2Y0OA 3D0JA 3RG0A 3FBMA 2MEV3 1PO12 1QJU1 4CVUA 2NN8A 5IVYA 1H1IA 4L97A 1GOHA 2OIIA 4QT6A 5EJ3A 1AL0G 1UYZA 2ZGSA 3OY8B 2Y33A 4O9GA 3RWKX 4BQ1A 5ABJB 3CL1A 3N9OA 3N4MA 1XNCA 1PZ8A 2WUHA 3VL8A 5L9VA 4WM8A 4EN7B 2CV6A 5G04L 1COV2 4FXKB 4EN6B 4CYDA 2IXHA 3AMNA 5KHKA 1J84A 5LY1A 1QJEA 2X53S 1Y7BA 3KSCA 4HBNA 3E6BA 4DRVA 1SACA 1UF2C 2UU8A 1LGBA 2VTXJ 1O8SA 2XJRA 3TN93 4BISA 2QZ3A 2CGOA 4UFJA 4JRLA 4FPHA 3KVBA 2H0BA 3WD5A 4QPIA 4TLFA 2BYVE 1H2KA 2WT1A 4BQWA 4OVEA 4M3CB 1ZBE3 4LBMA 1QOSA 2C6SA 1TNRA 3ILFA 3A0KA 3O0WA 3BODA 1UZVA 4M00A 1ALYA 2C5DA 2GH8A 1PK6C 2QQOA 3SCGA 4A45A 5FOBB 3BALA 3KWVA 2YGLA 1F15A 1QJX2 3O1UA 2WNUB 4BM8A 3ZX7A 2VXRA 2Y38A 4LKFA 4ASMB 4I3PA 2HWD2 5J96B 3MF6A 2BOIA 5G05L 1ACCA 1R64A 3MLKA 4HFSA 4Y5Z0 4FPOB 3O1VA 3BIEA 2A6VA 4BLJA 3NNGA 1IS3A 2MPFA 1V9U3 1ZYBA 2QNKA 3ZO0B 1SMVA 2GC2A 1AR82 4Z82A 3Q9OA 4LE4A 2V4VA 1RIRA 3QOPA 4AI3A 4A3ZA 4YG3A 4CEYB 2BNNA 5HV0A 2AH2A 1W9WA 1VBD2 2C9KA 2XBO2 3MI8A 5FY5A 3N3HA 1RHI1 1YI9A 2AENA 3GNEA 5L73A 5DMYA 1JYCA 1ZRRA 5A3NA 1NOVA 3NQHA 2R041 4MHRA 3VBUB 4QQ2A 4AQSA 5JZGC 5JOWA 5FLJA 3WNXA 5C70A 4PF5A 5JMCA 4AVTA 2QE3A 1G7YA 1R1A3 4GXLA 2VOWA 1S2EA 3VL9A 2E7TA 4FOVA 5T54A 4ZS2A 1VAVA 2DU1A 3NNFA 1W2NA 1VE0A 2Q0AA 2XLGA 3POBA 5DABA 3USUA 1DZTA 1B35A 3ACLA 1RVF2 2UWCA 2WS91 4HOOA 3O0XA 4QAWA 4ZONA 3WG2A 1DYPA 1RUF2 1FX5A 5A7NA 4XHXA 4RQPB 4D94A 4YW4A 4AEJA 4BXSV 1OD3A 3WQ1A 2D98A 1QEXA 1H2NA 2A3WA 3L9JT 3KGZA 2P5BA 3NNLA 4S2GA 4CDQC 5A3PA 4DXZA 2JG8B 3N35A 1CIWA 4FPLA 4UWDA 1YIFA 1TG7A 3PHMA 2EXIA 1HB3A 2JD4A 4QQLA 1PZ7A 1QU0A 2QZ2A 5JXGA 2SBAA 1RUE2 1V00A 1BQPA 1FPN1 1N3QA 1JZ3A 5CA6A 2JDPA 1QJX1 1W6NA 4I30A 3ASIA 1UY2A 4FPEA 4HK8A 2W68A 4KI5M 2I45A 4L2NA 4N7IA 1DCSA 3OBZA 1QQP2 2VBDA 3LDKA 5L19A 5LY2A 3UV9A 1ZZ9A 4COUA 4RSUA 4A7ZA 1QNYA 3WNKA 1UMZA 3HWJA 3J7LA 4IGQA 3UGFA 3UGHA 2E63A 4N53C 2MNGA 4L92A 1WGPA 2YBPA 1SDDB 3TRSB 5K7PA 3BU7A 4PDWC 1UOGA 3WF2A 5C33A 5DZEA 3KF3A 1W99A 3SXWA 1BEV1 2DVFA 1BXHA 1CJDA 2BGOA 4QPYA 2H0VA 3DKWA 3E5XA 4WV8A 1WW4A 2OA2A 2J1EA 2VCAA 1COV1 3VN4A 1KS5A 2ZA9A 1O91A 4HKOA 4XPVA 3BPSA 2XMLA 1XU1A 4H7MA 1W9YA 2RDRA 2N7GA 1GMMA 5DUUA 1QNWA 3IDAA 2VUDA 5BPXA 1M4WA 1S0IA 3IZOA 4NPLA 5A80A 2HEWF 4FP2A 5HCBA 2Y6GA 1OD5A 1UNBA 2VY0A 2VL4A 3ME2A 4CEYC 4Y5TA 5FZ4A 3HD8B 3ZFGC 1U12A 4YW6A 4AXOA 4I02A 4FFGA 3KQ4B 1VP6A 1ND2B 5F39A 2D44A 4CDQA 1G9CA 3A7QA 3GDBA 2WZR1 3WNNA 1ZVFA 2Y8KA 3DYPA 5AC91 3IKWA 1ULDA 4QKBA 3TEXA 4I2OA 2G9FA 3ZYFA 5KHGA 1KRIA 1YO8A 4PCRA 4AVSA 4E2GA 2VXJA 1DZRA 3POSA 1YFWA 3S6PA 1TME3 4Z2WA 1ZBA1 1TQ5A 1J83A 2VE1A 2X10A 3MW3A 2W08A 4PJYA 1R1A1 2FDJA 3NAPB 2VUAA 4W8JA 1QQP1 3PURA 4LOTA 2E51A 2JDMA 2R0FA 1H0BA 1N1SA 4YVSC 4GA9A 3ZFEA 1G6NA 4CA9A 2UWBA 1C8M3 1REFA 3H1YA 4AQTA 2PHLA 3M3QA 4XFCA 4IE6A 1O3RA 3OUJA 5EXOA 2CDPA 1TMF2 1XSRA 1WD4A 5F3CA 1PMHX 4LBQD 3ZXJA 3LA7A 2WQZC 2PHWA 4BU2A 5K4LA 1U5IA 3RZHA 2OW4A 4KNCA 1VBE2 1LCLA 2X09A 4ATFA 3WEZA 1RUG3 5A1AA 1DGWA 2JIGA 3UJOA 2J1AA 4G4FA 3AP6A 4DQAA 1QOTA 1N3PA 4OHYA 2ENRA 4D0QA 2Y6JA 1F8VA 3V65A 5FLIA 3ALQA 1AR63 2WBKA 1OF4A 4MGIE 3B9CA 1S2BA 2A71A 4LULA 2WQ4A 3AKPA 5AFEA 5FP4A 1JZ2A 1D4M3 2BJSA 1ASJ2 2OZ6A 2WNUA 3EB7A 2RS51 4YSFA 2JG9C 3B01A 4Y1VA 4DFSA 3JBG3 5KC6A 1AR91 1POV1 4C8DA 3SH3A 2ZEYA 3IBMA 4D69A 3LFMA 1AYM2 1WMXA 4GB33 1YHFA 1ONAA 1CAUB 2BW8A 3RRDA 3WOGA 5FDBA 3BI3A 3VBHB 3KCCA 4O65A 5JOZA 1XE0A 1ZZ7A 2F6BA 1OLQA 2ZX0A 3M3CA 3UETA 4NAOA 5DXDA 1Y4WA 4XJZA 1HRI3 3KZ4C 4GJZA 3R6SA 2HWD1 5FBJA 4YVSA 5L7OA 1URXA 2HWC2 4B4QA 5AFBA 5BNNC 3B5LB 3ZFEC 3E5UA 3VD3A 3ATGA 2A6XA 2K46A 1ND2C 2IZWA 2YC2A 4ET7A 1AYN1 2VZVA 4IV1C 2RS33 4K7JA 5EPAA 1D7PM 3RYKA 3E5QA 5CBLA 3VBOC 3ZDSA 3JU9A 2Q1FA 4YGCA 2ZHMA 5JDBA 1YQ8A 3CU7A 4NN0A 2BGPA 3MLJA 3GZAA 4W6WA 5A7WA 2ARXA 1UW8A 4N43C 4FPKA 2ZX3A 3RI8A 2PHFA 3ELNA 1CR7A 3NAPC 4BH9A 3BU0A 4P9GA 4QU1A 3T1MA 5C7GA 5FK8A 1XC6A 2WAAA 2DUQA 3K51A 4FT8A 3WCSA 3IMNA 1YQ6A 2Z5WA 2O1QA 3CDZB 1GV9A 5DUWA 2E7QA 1TMF3 5D2AA 3RJRA 4BWOA 3K46A 4F7ZA 3RZGA 3MW2A 5A7PA 1IGOA 2PLV3 4NVPA 3O5SA 2WL1A 2DCTA 4FFHA 1UMHA 2GSYA 2ZMNA 2XUEA 5BNQA 2VUJA 1QF3A 2W9XA 3MGUA 4W6YA 3WP6A 5B4NA 2ERFA 1H8VA 4ES9A 1ENXA 4Y33A 3VZMA 4A3XA 1OLRA 4BCUA 5FXVA 4IE5A 3ZYBA 5BNOA 2FCTA 4Q4Y2 4QX5A 4RFT0 3W59A 5KXEA 1NQDA 1JUIA 2ZAAA 5AC92 2WNVC 5BNPB 3P1IA 1SBDA 4Q1RA 2RG4A 2JDHA 4YRDA 1FOD3 5J7MA 4AHZA 3RZJA 4DNYA 3HJRA 5E8AA 5KHJA 3VBFA 2ZCWA 5JXIA 1RHI2 1CAWA 1VRH3 4IXLA 5FP8A 1VBD1 1SFPA 3SHRA 1H9PA 3RFRA 5T55A 1KQRA 1MQTA 2DTYA 2P6CA 3AB0A 2QTWB 2JB8A 3ZYPA 1XNAA 1VB2A 4NHLA 4XURA 2JECA 4META 4NRPA 5FZHA 4IV3A 5FZKA 2JG9B 5C3PA 3KHCA 3PTRB 4OMCA 1E57A 5E88A 2J42A 1OFNA 1TVGA 4QDSA 4I0WB 5FPZA 4GAZA 1JZ4A 3JBG1 4UT5A 5F8PA 4XCAA 5CU1A 4X8NA 5F3GA 1Z7S2 5T52A 3OGGA 4ZZ5A 4IL7A 3X29B 3ZN6B 2UY8A 2CWSA 1DGLA 3BTYA 4FO9A 3T2PA 1RUH2 2EXJA 1B35B 1E5HA 4XJUA 4J6GA 4M3CE 1JUHA 4I3GA 3RZLA 2VJXA 3U10A 2VZSA 4QQPA 4Q4V3 4QU2A 1ZBA2 1QJY3 5I0RA 4LNVA 1YFUA 2RV9A 3ZFEB 4RQPA 3TWIA 2ARAA 2XHKA 1UO9A 4ZU5A 1Y9MA 4LUKA 4UAPA 2Q8OA 2V72A 2VO5A 3PVOA 1DQ4A 4LHKA 4B7KA 4BE3A 5LBEA 1PVC2 3EHKA 2WN2A 4AFAA 5KXDA 1DIWA 5D8AC 5FZFA 4UOJA 1PGL1 1OQDA 3K2OA 5C8CC 1JZ8A 3WDUA 2FZ1A 3KT1A 5JR2A 1JYWA 4N43B 1CX4A 4I01A 2NQYA 1HRV1 2XUMA 1W8WA 1JMUB 1RUC3 1ENSA 2BEOA 4Q5OA 5DG1A 2ZS6B 3WP4A 2LS6A 1RUE3 4YG0A 5A1LA 1ZZCA 3Q8CA 4LLFA 3D4KA 5FMOL 3OOXA 2GMMA 3ACGA 1JXNA 4CCOA 1CAXB 3J7NA 1FNYA 3N9LA 4FVVA 4YGEA 1NLSA 3HVDA 5FKCA 5LB6A 1LODA 1OPOA 5CYYA 4UFLA 4KU8A 1MEC2 1AJOA 1IPJA 1F31A 1W05A 2HH9A 3BN6A 3ES1A 1JH5A 4KL1A 4R9DA 3THDA 2UYBA 2NYYA 3K4ZA 4GMP0 3RDIA 3M2MA 4BQ3A 1W6PB 2C24A 1IKPA 2ATFA 4IEZA 1J1LA 2QQMA 4JC1A 2FQPA 4FPGA 4CUCA 3OBTA 2OPWA 3OSDA 5T3NA 4MXWA 2JWPA 5BNPC 1QXJA 3VZLA 2XPJA 3JD73 4FTBA 5F2SA 2VCBA 2NM1A 2G9ZA 4QDQA 3U78A 2UYAA 2VZPA 2YBSA 1IPSA 2VZTA 1UAIA 1TZOA 4QX2A 2X05A 3B02A 4LBQA 4QKFA 1YQ5A 2XJVA 1UOFA 1US3A 2VOTA 1MZEA 4B29A 3ZXGA 4LBOA 4QPGA 4AVBA 1ZBE1 5FYYA 1ND3A 1S0CA 4FCAA 1JYVA 1AYN3 4WBBA 5J37A 2W2IA 4Q29A 4XJ9A 3S5AA 2WZPP 3VUOA 1ND2A 2BFUS 2HBTA 4NIIA 3LOBA 1GLHA 2D5HA 4XE9A 3ZMNA 4CDQB 1CD3G 2WFF2 3NL1A 4GH4A 3W58A 4CDWA 4EN0A 4QHZA 2ZAHA 1AR83 3NV2A 3OYWA 4O7XA 3ZVXA 1PGW1 1ULFA 5GJ6A 1JOPA 3T4HB 3FL7A 4YWAA 3BUCA 4G3YC 1ZM1A 4HVRA 4Q8LA 1PGSA 1X8EA 2G9GA 3J8F1 4EE2A 3PIGA 2BERA 4Q2FA 5L7OB 1DLCA 4HETA 4BK4A 1G9DA 2A3YA 3WCRA 4DZGA 1PX3A 1JYXA 4Y22A 1QJX3 1AR73 3ON7A 4Q4X1 3VZKA 5C9AB 1SEFA 4XFAA 4E4HA 4P9XA 3AJZA 4LUMA 1EUTA 3IM0A 4EROA 3I2FA 2D5FA 4N53B 5J1XA 2MEV1 4OHVA 3HN3A 1QJU3 4P9WA 4TWTA 1WZXA 4UFHA 5IVBA 1XNDA 3MW4A 3TAYA 5FR3A 1OKQA 1OT5A 5FO8B 4PDWB 1Z78A 4CDXB 3W5NA 4QXCA 4R9AA 3ST7A 5IVEA 5E16A 1TNFA 3AYCA 2XBO1 4J1WA 4HL0A 4YYOA 2JEMA 3U75A 2VVDA 4PLOA 3VDDB 3C2UA 1J3RA 4K1YA 4C1WA 3IDCB 4L0PA 4Q0QA 3K3OA 4XETA 3GM8A 4XJAA 2ZOEB 3PLQA 4LLOA 4AR2A 2ZACA 3VBFB 5KR7A 1MQTC 3WY6A 4NHYA 2OUJA 1HW5A 2DFBA 5FUPA 1UU6A 2DFCA 3ROUA 2PLV2 1LB2A 2YFUA 2VZRA 1FMD1 1OVPA 2OXBA 4CP9A 4DUWA 4CCCA 4LKSA 1Q5OA 2OX0A 4QGLA 4XJ8A 1X33A 1MS4A 1V6NA 5FK7A 4GJYA 1PM4A 3AC0A 5FZ7A 1BZWA 5CFDA 5BNOC 1A34A 5C8WA 1AXKA 2Q1MA 4DXTA 3BVCA 2QQJA 2DDUA 5A7QA 5IK5A 2WNVA 1AR61 3LWCA 4MSVA 1JI6A 1WW5A 3DXTA 1CAUA 1X9TA 1UYYA 3RZMA 2BRTA 3JXSA 1XNBA 4Y1ZA 1QIQA 3FLPA 4NIDA 1VBA1 2ZABA 1RUJ3 3DXUA 1EUUA 2NZ9A 3NJVA 3OG2A 4MOAA 5D8AA 5FLHA 1DDLA 4IQPA 3POWA 4KMQA 5JVVA 1F4AA 2CGPA 3LEIA 1DFQA 4OUSA 1H4GA 3U0ZA 3F2ZA 4QKNA 3TYJA 1G9FA 1EAH1 1Z0HA 2AR6A 1W28A 1IS6A 3OBAA 1NQJA 4YVSB 4MLOA 3I49A 4M01A 1C8NA 5GLZA 1AX0A 2DYCA 3VZJA 1HX6A 5BYNA 3LB9A 4KGQA 2ZJCA 1OSGA 1MS9A 2P1BA 2ZGPA 1Q43A 2PHTA 1UY1A 3WR0A 4WVZA 3AK0A 4AHXA 4MGZE 5JXJA 3K4AA 5CEHA 3Q8EA 1AXZA 4Z07A 3JD72 4CU8A 4TXWA 4YNIA 1W8TA 3OGVA 3R4UA 1OF3A 1JHJA 1JU3A 5I8YA 5GZDA 3I54A 1CONA 5IATA 4GB32 2B42B 1KDMA 1UX6A 2WZR2 2DURA 4XQ4A 3ZR5A 4WM7C 5L7OC 1ULPA 2YU1A 4LIVA 4D3WA 5GM0A 2HWE3 4IEXA 2R073 4FTEA 2GMEA 3FN9A 3I3QA 2DUPA 3D0SA 3MPPG 4Y3OA 5EFUA 5IT6A 1DGRN 3MHZA 3C3VA 3T09A 3VBSB 4JQTA 3K75B 4OHXA 4XF4A 5FY7A 4MYEA 1O5LA 2I2SA 4Q4X2 5CIRA 1RUC2 2J1RA 4AEDB 2D3SA 5J36A 4C1XA 5CG8A 1SLTA 3BGAA 3ZYJB 3ETQA 4YZ3A 1UMIA 2V09A 1OQ1A 3ABZA 2VULA 5JOYA 1VR3A 2VMDA 3HR9A 4NRQA 5FP3A 4Q26A 1W3VA 1VBE3 3S30A 1TME1 1AR93 2ETEA 3ZSEA 5HXMA 5A3UA 1RJ8A 1UXXX 1CAXA 2FMYA 2BBAA 1IZ3A 2IUWA 1RUD1 1U5YA 2RDSA 3B9IA 4WVMA 2WFF1 1OPMA 1ULOA 4CCDA 5A6YA 3SCFA 1DGWX 2QQVA 4DOUA 2QQKA 1AX2A 5F7UA 2WR9A 2XLFA 3VKNA 1BBT1 4Q4V2 3TN91 1CZSA 1HRI1 2TUNA 4JV4A 4XVHA 4IV3B 1NCQC 2G1MA 2P2KA 4IEVA 1G8WA 2YXSA 4RR3C 2VOXA 1MZ6A 3DPRC 3C7EA 2AGSA 3SCHA 3WDVA 1Z7S3 5DZGA 4GWIA 1WLDA 3E97A 2VQTA 3VBOB 3AYAA 3I97A 1C8M1 2PHUA 4KG8A 2JIJA 3WQ7A 1AZDA 1QMJA 2RS31 2OVUA 4K8RB 2DVAA 1OA2A 2EIGA 1HJFA 1KGYA 1QHDA 2JDYA 4QHBA 1NY72 5E6HA 1GKBA 1LHUA 2ZX1A 2WAOA 3E6CC 3ENRA 4YW2A 4NIGA 1YCIA 3H9AA 5FYBA 4IE0A 3B7MA 1ZZ8A 1W8ZA 3DGTA 3DN7A 3FLRA 5FFOC 4AW7A 3PL0A 1D4VB 2QQNA 3VV1A 3CZUA 3H7YA 4FOYA 1XNKA 4FPFA 5A32A 4ARYA 2PAEA 1U5XA 5C6CA 3O1SA 1OI6A 1A3KA 2EA7A 1V9U1 2L9LA 2OQ7A 3ZFFB 4YVWA 2XG3A 1O59A 1GQHA 2EIDA 1YXWA 4D7YA 4N8MA 1FOD2 4DEQA 4KG0A 5ISLA 1VAMA 2XONA 4IE7A 2HBUA 4D7SA 5AC93 4E8CA 1NY71 3VBUA 1LENA 3ILNA 4NE9A 4AZZA 1PGL2 4LO8A 3WF4A 1I6XA 5FP7A 2D6MA 2OPKA 4LQRA 4UW4A 4MZUA 1NYWA 5CKNA 4UW5A 4QGNA 2YGMA 5IK8A 3T0DA 2WZEA 2DBNA 2JG8A 3I2JA 1S0GA 3NJZA 3H8UA 3LEMA 2W46A 3T1LA 3H3ZA 4LBLA 2IVJA 4DY3A 3H7JA 2X5IB 5ACA1 5E1RA 2GC1A 2V4AA 2KXLA 3NJXA 4GALA 5DUVA 3WT3A 2OUHA 4BDVB 5IHRA 1BBT2 2EIBA 5BV6A 4AEDC 4AWDA 1GZWB 1G9BA 2Y6LA 5FZBA 1CX1A 3UL2A 3V0BB 1KITA 4ES8A 1K5MB 2Z69A 1OUSA 2QQLA 4BQ4A 2A3XA 1ZA4A 2XHNA 3AP5A 3FJSA 5ERLA 3WW4A 1PX4A 1GR3A 3IWZA 3TOJA 5F1RA 4AFDA 3MEPA 1HB1A 1DQ5A 4XF0A 4XUQA 2E26A 2Q8CA 1YUDA 5IWFA 4JGYA 2W52A 1R1ZA 5IUQA 2RS53 1X50A 2ET7A 4XDQA 1VB4A 3AZXA 2VVFA 5F5IA 4HSLA 3BTZA 1HXS3 3ZPYA 5SV8A 3AP4A 2ILMA 1O3TA 3KLSA 2Y6HA 1UPIA 2ARBA 1OVSA 4CP2A 3NV1A 3ZYHA 5HXVA 3SNMA 1YFYA 2JDNA 2RJKA 2J22A 4XW3A 4NWWA 3EQEA 2ZTNA 4Z2AA 3WP5A 4YVWC 4XILA 5JMOA 3JQWA 5F2WA 3WNOA 2ZKNA 2Z4FA 4MVTA 5I0TA 2IFWA 3GHMA 3I3BA 3LPGA 4AI1A 1K12A 1ZRIA 1S0JA 3K3NA 4OYUA 2BGCA 2YU2A 1ND3C 4ORFA 3MBWA 3TBDA 1AUYA 1W0NA 3KCXA 3QH7A 1E5IA 5CFDC 1FV2A 4R8HA 5FREA 5JI7A 1O3QA 3OD4A 1EPZA 4AQ6A 5IVVA 4RGKA 4BXFA 4S2FA 1HB4A 3I3EA 4NUBA 3RI9A 2ZKLA 4FFIA 3WDYA 1J3PA 3FFQA 5EYXA 3PVBB 4AEDA 1HDKA 3VGIA 4RS5C 3LZZA 1NCQA 1GNHA 4N9HA 3KT4A 1OH3A 1Y43B 2BOJA 4XAAA 2HWB1 5FZ9A 4BQ2A 3W21A 1ZZBA 5FZ6A 2F17A 5F32A 1RUD3 1RXFA 3UT0A 3WG1A 3EO6A 2XR4A 1BJQA 1YC61 2VMFA 1PK6B 1W0OA 3H1MA 4XXAA 1VALA 3QD6A 1WCUA 1V6OA 1OLMA 4UFIA 5T5PA 3ZKYA 1W90A 5GLUA 5IK4A 1QDCA 2P3JA 5A7SA 1DYOA 1HQLA 2W87A 1M06G 2RMU2 3KV9A 1VLNA 4IUGA 4P14A 3UKNA 2J1VA 4DO0A 1EYBA 4XABA 1N1YA 4IEWA 3SKVA 2A7AA 3I2OA 2CAVA 4NO4A 2K2SA 1STMA 2GNDA 1SHWB 3AMMA 3ECQA 4ARXA 3ZXLA 3LKJA 1CIYA 3H8XA 5C3OA 4YM0A 1K5MC 1YI7A 3WQBA 3AXEA 1TME2 4EWEA 2J7MA 2YYOA 5FZ8A 4BLIA 4Y4YA 1E5RA 1S0EA 5FRAA 2XDVA 5JUVA 2VPVA 1COV3 1DP0A 2GAUA 5BNNA 4ZPIA 1AXYA 5LWBA 1W6QA 5KXCA 4X6RB 1NCRB 3CNAA 1EP0A 4Y24A 3PJYA 3HOBA 3OUHA 4P9JA 3WW1A 2VG9A 5A6ZA 5EV7A 1AR72 1GU3A 5JI9A 4CU7A 1O7FA 3IIIA 5GLVA 1O6UA 1PO13 4B1LA 2MEV2 3U14A 1CVNA 1NLQA 3LDRA 5JPMB 4MGSA 5KWRA 2YC0A 1I1EA 5K0UB 2FDHA 1A8DA 1SFYA 4SLIA 4YVWB 1MS8A 4XFGA 4CDXC 1RMU2 2EXHA 1EAH3 3V64A 4SBVA 2ORXA 2X29A 2ZBJA 2IWGB 3SC7X 3ZN5A 4CRQA 2WNUC 4LO7A 3BPZA 3LQCA 5DUXA 5F6KA 3AXDA 1FXZA 1C5HA 4LBKA 1FPN3 2D6NA 1SZBA 2YROA 4I0AA 4ISRA 1FV3A 1JOJA 4Q0UA 2XB6C 1ULCA 4AAPA 3AX4A 2ZGNA 3CQOA 4I09A 2R062 5GLWA 4AI2A 4DIQA 3LAGA 3MIFA 3T2QA 1DF0A 5JSOA 1GZ9A 1B09A 1CZVA 2FHRA 2JE8A 4AEMA 2R7EB 2WQ8A 5C5UA 2RMU1 1T6GC 3VBSA 3AZVA 3CLPA 4XF1A 4MX3A 4EJRA 2RM21 5J09A 4GULA 2VMIA 5A6XA 1AX1A 1OUXA 2VMCA 2YV8A 2ZEXA 3ZXFA 3LSEA 1R093 5L9RA 3ZFGA 4J1XA 2B45X 4QD2A 2NLRA 3LEGA 5EQUA 3UJQA 3FUOA 4Y4RA 3S5QA 4OI2A 1W9TA 3ACFA 3PJQA 3VD5A 2ZGKA 4KBZA 5FZCA 3T3YA 1XPWA 2ZMLA 3IMMA 1UYPA 4DUVA 4RA0A 3AFGA 4YZ2A 3TEZA 1YJKA 4JGZB 1EY2A 2CAUA 2ZGTA 5B4XA 1VBA3 4JGYB 1LESA 4MADA 4LORA 3WNLA 1R092 4FPJA 4H55A 1XSQA 1CAVA 3N9NA 3K77A 4DXSA 1RVF3 5DDJ1 3WUCA 2O14A 3NV4A 3ACIA 1GQPA 1SQ4A 3D6EA 1GFF2 3U4XA 3NNJA 1KEXA 2LUWA 1SFNA 2OS2A 2R0HA 2WLQA 2ES3A 3JD71 4V1PA 1OHFA 5HPOA 2YHJA 2JG8C 2WNEA 2R063 3AKSA 3KV4A 5ACA2 4XYXA 3UNPA 4HKLA 4S2DA 2B5HA 3PUAA 4XEZA 3WDTA 5A33A 2RR12 2W1QA 4Y1YA 3RGBA 1XYNA 3ZMOA 5CZKA 4S2HA 2ADEA 2JG9A 2P3YA 1WA6X 3RS6A 1BEV2 4XBLA 4WM7B 1EAH2 1PVC1 3A22A 3ZOIA 3MIEA 4LKEA 5FYTA 3GGLA 3ZIXA 2QQUA 3O12A 4M4RA 2WABA 4Q4W1 1K45A 3GCWA 2R071 4LO5B 1LULA 1V9U2 4PI0A 4DUXA 1I9RA 5K0UC 3OTFA 3KS7A 4H14A 4PHZA 3SLIA 3NMBA 2ZEWA 3HEIA 1LECA 2GP3A 1YRZA 1UQXA 4LO4B 2VCMA 3TNQA 4C91A 3ZLIA 3WVJA 2HWD3 3A21A 3ZXKA 4XTMA 5JLVA 1LJ7A 3N7JA 4HXCA 1D2QA 4KWUA 4QPIC 3SEEA 2XQXA 2VM9A 3QACA 4LPLA 1ZREA 3ORJA 2XXZA 2R6QA 2ZPXA 2ZZJA 3INAA 1MR5A 4JDNA 4XMIA 4LBJA 4BIFA 4CEWA 1OFSA 2WC2A 1Y3TA 2R1BA 1PIV1 3FX3A 4L99A 4ZU4A 3VHPA 4Y26A 5JPNB 1XE8A 5FPXA 1K42A 2XWBB 1ZNPA 3N9PA 2CYFA 2FBEA 1VPHA 3D3AA 4XFHA 4WVVA 1W6OB 3KV6A 4OUMA 1UN1A 5TSWA 5IAXA 2R30A 2NPIA 2B4KA 2LM3A 4XIOA 3RVHA 1RUOA 1POV0 3CZJA 4URTA 2C4XA 4A4AA 2WS92 4EYUA 5I8TA 4PLMA 3O1MA 2RMU3 5L36A 3I59A 4Q4V1 3FC0A 2BNOA 3THCA 1KJRA 4BPZA 3C7GA 1NXD1 3ACHA 3K48A 2PA7A 4A44A 1DG6A 2YDEA 3ZXEA 1SG3A 5LBCA 4K8FA 1RXGA 3J26N 3WG3A 1RUD2 5CADA 1S0BA 4JGZC 1ULGA 4JKMA 2WO2A 5CAZA 2PHDA 4AHWA 1FMD3 5FYUA 1FI2A 1T6BX 5FYIA 5FKBA 4AI0A 3KT7A 4PIYA 2VMGA 5C8CA 1W2OA 2ADDA 5J3UA 4EN8B 1DYKA 1UCXA 2Z79A 2I74A 3MICA 3M3EA 4NWVA 1HRV3 3AFKA 1Y9QA 1CWPA 4GZ9A 3BOWA 2VR4A 3GXUA 2P17A 2ZX2A 4K3UA 4MH0E 1Q56A 5EZWA 4DMIA 1LOGA 4K40A 4QXHA 1VRH1 4W65A 4A41A 2W5FA 1F2NA 5SV5A 2HWB3 3NVCA 3PUSA 3ZN6A 5H9QA 2XJQA 3IB3A 1NCRA 2RS32 3PVNA 5EJZB 2W39A 3HNBM 3DCQA 2WINB 5FPVA 3I2DA 3SQOA 4YLZA 3KV5A 4IEPA 2CGNA 2QQWA 3P5BA 2HWC3 2CY6A 2VZOA 5EYYA 3LGRA 4GKXA 3R0RA 4LA3A 1I5ZA 1VBE1 2GP5A 1HRI2 1GNZA 5FIXA 3USUB 2VNVA 2EF6A 4KWJA 2LRPA 4QM8A 1JS9A 2VZUA 5KHHA 5FZDA 1LAJA 4UBHA 2D6LX 2R16A 2D93A 1POV3 3WV6A 4K1ZA 4CP1A 2O8QA 2XWJB 1Z7S1 2E33A 4TLGA 4XDOA 1UZYA 2EIEA 5FPBA 2A73B 4QPWA 3PTYA 5FUIA 4QPIB 3OGRA 1QGLA 4HN0A 4QX7A 2YPJA 4YW1A 3RWNA 3SH5A 4AFCA 2DTWA 4CDWB 1Q8QA 3N7LA 3M4FA 1GYKA 4EZ4A 4RFRB 2W1SA 3E1F1 2PN5A 3PIJA 2ZX4A 3VBHC 2IVIB 4CE8A 4MV2A 5CVRA 1RUC1 3R05A 3KM5A 4Y5SA 1BLZA 4BB3A 5CG9A 3DUIA 3I2IA 1S0FA 1WMFA 1AR62 4CXXA 3FFZA 3H50A 2HWF3 2VQAA 1RB8G 2D6PA 4D7TA 2WA4A 1LOAA 4V2WA 4R9CA 1JN2P 2YG0A 5F5QA 1C1LA 3MDPA 4ONUA 3MIHA 4WM8C 4HVOA 4IV1B 1H1MA 2IXLA 3NKTA 4A42A 4Q8KA 2W47A 2F4LA 2FDIA 2V5YA 2ZHNA 4Q0VA 2B7YA 1GICA 2RS13 1ENRA 4KBBA 4C90A 3VZOA 3BKZA 5FQ0B 2GNMA 5GZGA 4CP9B 4CCMA 3T30A 4QX1A 1QXRA 1PMJX 4PIZA 4JCKA 3WP3A 4M4PA 3J9SA 3OEBA 3I3DA 4ZY9A 1ND3B 4OMDA 3WHTA 3AMPA 4Z1VA 5EJ1B 3T0AA 1O5UA 5DAWA 1LEDA 2IXCA 5DZFA 4FQ4A 4UI9L 1WMEA 1XJAA 4Y1XA 1IQDC 4NOTA 3PVEA 1IQAA 1B35C 3APBA 3JQXA 4FFFA 3DECA 2FZ2A 1GBGA 2VC9A 5HI0A 4K20A 4B4RA 1XOYA 5KBFA 5GLTA 1NG0A 1OA3A 2LROA 1OOPB 4HPKB 4WM7A 3H3UA 4N90A 3AVRA 3GALA 4COYA 1X8MA 1GQGA 3WX5A 2PAKA 1HV1A 5CKMA 1LOCA 2RJ2A 5J48A 5FOJB 2A70A 4WVWA 1WLCA 3HNMA 5C4WB 1I5PA 5D8AB 5FZMA 1RUI1 2K0GA 1GWMA 3PU8A 1CGPA 4CDUB 3VDBA 1LRHA 1RUE1 3JCIA 5C3RA 5FZ0A 4HKWA 2GU9A 3PMEA 3OB8A 1DQ1A 2QCSB 4I0BA 2WYSA 4QGMA 4QB1A 1V6KA 2AC1A 1NXMA 4Z8BA 2BVVA 2GMPA 2B9UA 5JZGA 4BYYA 5CFCB 2VGDA 1RYYA 4QX3A 1AVBA 1XNTA 1US2A 1UIJA 1W2UA 4JKKA 2XJPA 4CDWC 2YC4A 1HJGA 1YWKA 3OEAA 1GSLA 2TBVA 3AVSA 4JKLA 5BXXA 2GC3A 2WSVA 2DF7A 2XJTA 5FZEA 5ACA3 2TNFA 4JGZA 3AZYA 4GMP1 1DQ2A 2DCZA 2A6ZA 1W6NB 1XBFA 1CJPA 1QH6A 2X8KA 4BIOA 1S4CA 5FPUA 2BU9A 1SPPB 1KFUL 1NKGA 3NKGA 3RPQA 3VHNA 3PUQA 4Y20A 5EP9A 4Q4Y1 5FY4A 3HPNA 1MEC1 1VBC3 4QXKA 5LCWL 1R083 3O1PA 3I3MA 3N9QA 4AGGA 1YLLA 4FI9A 1L7QA 2KD7A 1O4TA 5A6QA 1CESA 4E8DA 3J4UH 3JUUA 4RL7A 4EN9B 2G4IA 4AF9A 2XL9A 3AL5A 5ANQA 1RITA 2PTMA 2RVAA 2W0XA 2YFZA 1PGW2 5FV3A 3GJBA 4LBNA 5H9RA 5LK5A 4FBFA 2HWC1 4ZU7A 2JDAA 1FPN2 1MS5A 1X7NA 4KH9A 3ZSKA 2NMOA 3MLLA 4NHXA 3WDXA 4YFZA 3KMHA 4ZS3A 4PF1A 3U4SA 2B46X 3V0BA 1O3SA 1PO23 4RHV3 3OBRA 4ZHNA 3TEYA 2VVEA 2JDZA 5A3TA 4YM2A 1S55A 5LATA 4RGGA 4YZ1A 4PT6A 5HBAA 3OF1A 1R1A2 1GP4A 5C9AC 2ZGMA 4QDRA 2JJ6A 3BTXA 3T0BA 4HSJA 3VHRA 1GWLA 1W9FA 3O1OA 4BHPA 1VBB2 2CSGA 4JDOA 4UFMA 2XVGA 1JU4A 1LNSA 5DAVA 4MGYE 2RDNA 1HIXA 2WWSA 4EWAA 2QQIA 2XBO3 1IG3A 1QDOA 4OCTA 2O0OA 2A6YA 2V73A 2VOKA 4R9BA 5LRRA 4JAAA 4D6RA 1JYTA 5HV4A 2Y6KA 2Q1ZB 3T2TA 5A7WB 1W06A 3NAPA 2A5ZA 1YFXA 4W50A 1WLWA 2WT0A 3C8XA 1W0PA 3T2OA 3ZXDA 2WWUA 2VZQA 3N9MA 4RGAA 2GDFA 1L7LA 1ZRCA 3GJAA 3VBFC 1Q3EA 1ZRFA 1AR81 1N1TA 2D6OX 1LOBA 4IV1A 1O8PA 1UOBA 1PO11 1QJU2 3O0VA 2Y6FA 2HYKA 4IDZA 4QX0A 4AEKA 4CCEA 2OYZA 2D7FA 2E31A 1D0HA 1G86A 5FQ0A 1UWWA 1WUVA 2Y64A 3SKJE 5BNOB 5F3IA 4P5HA 5APAA 1NT0A 2BWCA 2KM2A 3ILRA 4QWNA 2XH6A 3RQ0A 1LU1A 1S2KA 4M0HA 4NHKA 2FMDA 3ZKUA 1OQEA 4IEOA 5I0SA 5LEKA 1L7RA 3HT1A 3TEWA 4CTEA 4LA2A 4JRAA 4XF9A 2C1FA 3CKHA 2VD7A 1SBEA 3S0MA 1YQCA 1F5JA 1REEA
chains in the Genus database with same CATH topology
2VZ3A 2BGPA 3ETPA 1W8OA 5I0DA 1DYOA 2W87A 4MO3M 4P5YA 4IUGA 3ZM8A 3VD4A 2J1VA 3SKVA 4ZZ8A 4P08A 2DCKA 5C7GA 1XC6A 2WAAA 2OKXA 1SHWB 4ARXA 3ECQA 3CDZB 1CIYA 3HNYM 2QBXA 3VD9A 1H6XA 3K46A 3WQBA 3WF3A 2J7MA 1UMHA 2WO3A 3MUZ1 4D8MA 2W9XA 2YB7A 5B4NA 5JUVA 4GWJA 3I2HA 1DP0A 3WF0A 4DEVA 3HOBA 3A23A 2VCCA 1GU3A 3P1IA 4A6OA 3LE0A 4CU7A 3IIIA 3MV01 3HJRA 3VDCA 1UYXA 3NRUA 4MGSA 3UESA 5JXIA 2ORXA 1XNAA 4XURA 1UZ0A 2VQUA 3IAPA 3LQCA 4OMCA 1TVGA 4QDSA 3WNMA 1JZ4A 2C26A 3CQOA 3T2QA 1MPXA 4CU6A 2ZXQA 2HLEA 3PUIA 1CZVA 4HG6B 4ZZ5A 2JE8A 2R7EB 2WQ8A 4AG4A 5LA1A 1P8JA 3T2PA 4CUAA 3DYOA 2ZEXA 2VMCA 2VJXA 2VZSA 3MUY1 2PQSA 2RV9A 1JZ7A 3LEGA 4QB6A 3VD7A 1W9TA 3ACFA 4W4ZA 5LA2A 3VD5A 4UAPA 2XOMA 2V72A 2VO5A 1XPWA 4DUVA 5DQ0A 2WN2A 2W91A 1JZ5A 4UOJA 4MADA 1JZ8A 1JYWA 3WNLA 5JR2A 2ORZA 5DN2A 3WSOA 3K77A 4DXSA 1GUIA 3ACIA 2LS6A 1GQPA 2WO1A 4RN5A 1KEXA 5HPOA 1JYNA 3ACGA 1K3IA 1W9SA 3WNPA 3UNPA 5CYYA 1UXZA 2W1QA 3BN6A 5IJRA 4RYDA 3THDA 3K4ZA 5CZKA 4AAXA 2WDBA 3C7OA 2QQMA 4CUCA 4YPJA 2V5DA 2DCJA 3A22A 1NUKA 3GGLA 4M4RA 4P00B 2WABA 2VCBA 1K45A 4QDQA 2J1SA 2E32A 2VZPA 2VZTA 3PUHA 3CIHA 4DUXA 4QX2A 4XUTA 2X05A 4JHZA 3VDAA 2ZEWA 3HEIA 1US3A 2VOTA 1GOGA 2W1UA 3LEKA 3WF1A 3A21A 2W3JA 1UY0A 1JYVA 4KWUA 3SEEA 2XQXA 5IYYA 2VM9A 3J7HA 4LPLA 4CUBA 1UY4A 1WCQA 5B4XA 1JZ6A 2EICA 1K42A 3FL7A 2WZ8A 3D3AA 4XUNA 3C7HA 1UX7A 2BERA 2W95A 3DYMA 1DLCA 2B4KA 3CZJA 4ZXEA 4BK4A 2C4XA 4A4AA 1PX3A 1JYXA 4QB2A 4XZUG 3I2KA 1EUTA 3THCA 3I2FA 3C7GA 3ACHA 5J1XA 4A44A 3HN3A 1SG3A 2W92A 3IAQA 1OT5A 3W5NA 3CMGA 3FHAA 4JKMA 2WO2A 4CVUA 1GOHA 1UYZA 2W1WA 4L0PA 2WUHA 3GM8A 4GZ9A 5DPNA 5G04L 2VR4A 3P6BA 3GXUA 3MV11 1J84A 4A41A 2W5FA 5IFPA 2YFUA 1O8SA 2VZRA 3IB3A 5EJZB 3HNBM 3T08A 4DUWA 4LKSA 1GOFA 3AC0A 2VMEA 4DXTA 2QQJA 2DDUA 3W5MA 1JI6A 2VZOA 1UYYA 3JXSA 3OG2A 1EUUA 3NJVA 4MOAA 4LHSA 5EIYB 4A45A 2QQOA 3I2GA 2VZUA 4KMQA 1F4AA 3LEIA 1NAEA 3F2ZA 3OBAA 2E33A 2JD9A 5G05L 1R64A 2EIEA 4QPWA 5FUIA 3OGRA 3NNGA 1UY1A 2W1SA 3E1F1 5JXJA 4CU9A 2VTFA 3K4AA 2V4VA 4CU8A 4A3ZA 4TXWA 3OGVA 2CDOA 1OF3A 1JHJA 1JU3A 3I2IA 1W9WA 2C9KA 2VZ1A 5DMYA 2ZEZA 3NQHA 1ULPA 2WN3A 5C70A 2ID4A 2YG0A 3FN9A 4OZOA 2HYXA 4A42A 2W47A 4XUPA 4BK5A 3T09A 3K75B 2J1RA 4QAWA 4QX1A 3BGAA 1PMJX 1UMIA 3FHQA 4M4PA 4ZY9A 3ABZA 3I3DA 3OEBA 4OMDA 4BXSV 2VMDA 1OD3A 5EJ1B 3T0AA 3OGSA 5HXMA 4TTGA 1W8NA 1TG7A 1UXXX 4UI9L 2BBAA 3SEPA 1IQDC 2W94A 1BHGA 1ULOA 5JXGA 3DECA 1JZ3A 2VC9A 4MGQA 2QQKA 5F7UA 1UY2A 2J1TA 4KI5M 1CZSA 4XVHA 4DXRA 3WNKA 3C7EA 2RJ2A 1CZTA 4PQQA 4GWIA 3HNMA 1I5PA 2VQTA 1SDDB 3I97A 2B9VA 3WF2A 3VDBA 1KGYA 1W99A 2BGOA 2WAOA 3OB8A 2WYSA 4QB1A 2J1EA 2VCAA 2QQNA 1RYYA 3CZUA 4QX3A 1US2A 1XNTA 4ARYA 4JKKA 5LA0A 1GMMA 2YC4A 3OEAA 3IDAA 2L9LA 4JKLA 1O59A 2Y6GA 2EIDA 4DEQA 2VL4A 2XONA 1OH4A 4E8CA 1NKGA 3WF4A 4LQRA 3A7QA 3GDBA 2BZDA 3WNNA 1F4HA 2Y8KA 3DYPA 3T0DA 2WZEA 3I2JA 3HPNA 5LCWL 2W46A 4FI9A 1H6YA 1L7QA 2KD7A 4E8DA 1J83A 2X10A 2J1UA 3NJXA 4BDVB 4JX0A 5IHRA 2EIBA 2RVAA 4W8JA 2YFZA 1CX1A 2Y6LA 3EYPA 1UY3A 2JDAA 3K4DA 1HN1A 2QQLA 4PF1A 2XHNA 1YQ2A 1PX4A 1GNYA 2CDPA 4XUQA 4PT6A 2E26A 1PMHX 4XUOA 1WKYA 4QDRA 3T0BA 2X09A 3WEZA 5A1AA 2J1AA 1JU4A 1LNSA 2Y6HA 4D0QA 2Y6JA 2QQIA 4BJ0A 2J22A 2WBKA 1OF4A 4Z2AA 5JMOA 3WNOA 2Y6KA 2Z4FA 1JZ2A 3EB7A 3I3BA 4W50A 3LPGA 3C8XA 3T2OA 1K12A 2LW8A 4OYUA 2ZEYA 3MBWA 2VZQA 3LPFA 1W0NA 3U37A 1O8PA 4OUEA 3UETA 4QX0A 3C7FA 3I3EA 2E31A 1NX9A 1UWWA 2Y64A 3SKJE 5JXHA 5C71A 3MO4A 3VD3A 1T2XA 5IFTA 4ET7A 2YC2A 2VZVA 1L7RA 1D7PM 2VMFA 2JKXA 3CKHA 4P02B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VZ3 A;  2BGP A;  3ETP A;  1W8O A;  5I0D A;  1DYO A;  2W87 A;  4MO3 M;  4P5Y A;  4IUG A;  3ZM8 A;  3VD4 A;  2J1V A;  3SKV A;  4ZZ8 A;  4P08 A;  2DCK A;  5C7G A;  1XC6 A;  2WAA A;  2OKX A;  1SHW B;  4ARX A;  3ECQ A;  3CDZ B;  1CIY A;  3HNY M;  2QBX A;  3VD9 A;  1H6X A;  3K46 A;  3WQB A;  3WF3 A;  2J7M A;  1UMH A;  2WO3 A;  3MUZ 1;  4D8M A;  2W9X A;  2YB7 A;  5B4N A;  5JUV A;  4GWJ A;  3I2H A;  1DP0 A;  3WF0 A;  4DEV A;  3HOB A;  3A23 A;  2VCC A;  1GU3 A;  3P1I A;  4A6O A;  3LE0 A;  4CU7 A;  3III A;  3MV0 1;  3HJR A;  3VDC A;  1UYX A;  3NRU A;  4MGS A;  3UES A;  5JXI A;  2ORX A;  1XNA A;  4XUR A;  1UZ0 A;  2VQU A;  3IAP A;  3LQC A;  4OMC A;  1TVG A;  4QDS A;  3WNM A;  1JZ4 A;  2C26 A;  3CQO A;  3T2Q A;  1MPX A;  4CU6 A;  2ZXQ A;  2HLE A;  3PUI A;  1CZV A;  4HG6 B;  4ZZ5 A;  2JE8 A;  2R7E B;  2WQ8 A;  4AG4 A;  5LA1 A;  1P8J A;  3T2P A;  4CUA A;  3DYO A;  2ZEX A;  2VMC A;  2VJX A;  2VZS A;  3MUY 1;  2PQS A;  2RV9 A;  1JZ7 A;  3LEG A;  4QB6 A;  3VD7 A;  1W9T A;  3ACF A;  4W4Z A;  5LA2 A;  3VD5 A;  4UAP A;  2XOM A;  2V72 A;  2VO5 A;  1XPW A;  4DUV A;  5DQ0 A;  2WN2 A;  2W91 A;  1JZ5 A;  4UOJ A;  4MAD A;  1JZ8 A;  1JYW A;  3WNL A;  5JR2 A;  2ORZ A;  5DN2 A;  3WSO A;  3K77 A;  4DXS A;  1GUI A;  3ACI A;  2LS6 A;  1GQP A;  2WO1 A;  4RN5 A;  1KEX A;  5HPO A;  1JYN A;  3ACG A;  1K3I A;  1W9S A;  3WNP A;  3UNP A;  5CYY A;  1UXZ A;  2W1Q A;  3BN6 A;  5IJR A;  4RYD A;  3THD A;  3K4Z A;  5CZK A;  4AAX A;  2WDB A;  3C7O A;  2QQM A;  4CUC A;  4YPJ A;  2V5D A;  2DCJ A;  3A22 A;  1NUK A;  3GGL A;  4M4R A;  4P00 B;  2WAB A;  2VCB A;  1K45 A;  4QDQ A;  2J1S A;  2E32 A;  2VZP A;  2VZT A;  3PUH A;  3CIH A;  4DUX A;  4QX2 A;  4XUT A;  2X05 A;  4JHZ A;  3VDA A;  2ZEW A;  3HEI A;  1US3 A;  2VOT A;  1GOG A;  2W1U A;  3LEK A;  3WF1 A;  3A21 A;  2W3J A;  1UY0 A;  1JYV A;  4KWU A;  3SEE A;  2XQX A;  5IYY A;  2VM9 A;  3J7H A;  4LPL A;  4CUB A;  1UY4 A;  1WCQ A;  5B4X A;  1JZ6 A;  2EIC A;  1K42 A;  3FL7 A;  2WZ8 A;  3D3A A;  4XUN A;  3C7H A;  1UX7 A;  2BER A;  2W95 A;  3DYM A;  1DLC A;  2B4K A;  3CZJ A;  4ZXE A;  4BK4 A;  2C4X A;  4A4A A;  1PX3 A;  1JYX A;  4QB2 A;  4XZU G;  3I2K A;  1EUT A;  3THC A;  3I2F A;  3C7G A;  3ACH A;  5J1X A;  4A44 A;  3HN3 A;  1SG3 A;  2W92 A;  3IAQ A;  1OT5 A;  3W5N A;  3CMG A;  3FHA A;  4JKM A;  2WO2 A;  4CVU A;  1GOH A;  1UYZ A;  2W1W A;  4L0P A;  2WUH A;  3GM8 A;  4GZ9 A;  5DPN A;  5G04 L;  2VR4 A;  3P6B A;  3GXU A;  3MV1 1;  1J84 A;  4A41 A;  2W5F A;  5IFP A;  2YFU A;  1O8S A;  2VZR A;  3IB3 A;  5EJZ B;  3HNB M;  3T08 A;  4DUW A;  4LKS A;  1GOF A;  3AC0 A;  2VME A;  4DXT A;  2QQJ A;  2DDU A;  3W5M A;  1JI6 A;  2VZO A;  1UYY A;  3JXS A;  3OG2 A;  1EUU A;  3NJV A;  4MOA A;  4LHS A;  5EIY B;  4A45 A;  2QQO A;  3I2G A;  2VZU A;  4KMQ A;  1F4A A;  3LEI A;  1NAE A;  3F2Z A;  3OBA A;  2E33 A;  2JD9 A;  5G05 L;  1R64 A;  2EIE A;  4QPW A;  5FUI A;  3OGR A;  3NNG A;  1UY1 A;  2W1S A;  3E1F 1;  5JXJ A;  4CU9 A;  2VTF A;  3K4A A;  2V4V A;  4CU8 A;  4A3Z A;  4TXW A;  3OGV A;  2CDO A;  1OF3 A;  1JHJ A;  1JU3 A;  3I2I A;  1W9W A;  2C9K A;  2VZ1 A;  5DMY A;  2ZEZ A;  3NQH A;  1ULP A;  2WN3 A;  5C70 A;  2ID4 A;  2YG0 A;  3FN9 A;  4OZO A;  2HYX A;  4A42 A;  2W47 A;  4XUP A;  4BK5 A;  3T09 A;  3K75 B;  2J1R A;  4QAW A;  4QX1 A;  3BGA A;  1PMJ X;  1UMI A;  3FHQ A;  4M4P A;  4ZY9 A;  3ABZ A;  3I3D A;  3OEB A;  4OMD A;  4BXS V;  2VMD A;  1OD3 A;  5EJ1 B;  3T0A A;  3OGS A;  5HXM A;  4TTG A;  1W8N A;  1TG7 A;  1UXX X;  4UI9 L;  2BBA A;  3SEP A;  1IQD C;  2W94 A;  1BHG A;  1ULO A;  5JXG A;  3DEC A;  1JZ3 A;  2VC9 A;  4MGQ A;  2QQK A;  5F7U A;  1UY2 A;  2J1T A;  4KI5 M;  1CZS A;  4XVH A;  4DXR A;  3WNK A;  3C7E A;  2RJ2 A;  1CZT A;  4PQQ A;  4GWI A;  3HNM A;  1I5P A;  2VQT A;  1SDD B;  3I97 A;  2B9V A;  3WF2 A;  3VDB A;  1KGY A;  1W99 A;  2BGO A;  2WAO A;  3OB8 A;  2WYS A;  4QB1 A;  2J1E A;  2VCA A;  2QQN A;  1RYY A;  3CZU A;  4QX3 A;  1US2 A;  1XNT A;  4ARY A;  4JKK A;  5LA0 A;  1GMM A;  2YC4 A;  3OEA A;  3IDA A;  2L9L A;  4JKL A;  1O59 A;  2Y6G A;  2EID A;  4DEQ A;  2VL4 A;  2XON A;  1OH4 A;  4E8C A;  1NKG A;  3WF4 A;  4LQR A;  3A7Q A;  3GDB A;  2BZD A;  3WNN A;  1F4H A;  2Y8K A;  3DYP A;  3T0D A;  2WZE A;  3I2J A;  3HPN A;  5LCW L;  2W46 A;  4FI9 A;  1H6Y A;  1L7Q A;  2KD7 A;  4E8D A;  1J83 A;  2X10 A;  2J1U A;  3NJX A;  4BDV B;  4JX0 A;  5IHR A;  2EIB A;  2RVA A;  4W8J A;  2YFZ A;  1CX1 A;  2Y6L A;  3EYP A;  1UY3 A;  2JDA A;  3K4D A;  1HN1 A;  2QQL A;  4PF1 A;  2XHN A;  1YQ2 A;  1PX4 A;  1GNY A;  2CDP A;  4XUQ A;  4PT6 A;  2E26 A;  1PMH X;  4XUO A;  1WKY A;  4QDR A;  3T0B A;  2X09 A;  3WEZ A;  5A1A A;  2J1A A;  1JU4 A;  1LNS A;  2Y6H A;  4D0Q A;  2Y6J A;  2QQI A;  4BJ0 A;  2J22 A;  2WBK A;  1OF4 A;  4Z2A A;  5JMO A;  3WNO A;  2Y6K A;  2Z4F A;  1JZ2 A;  3EB7 A;  3I3B A;  4W50 A;  3LPG A;  3C8X A;  3T2O A;  1K12 A;  2LW8 A;  4OYU A;  2ZEY A;  3MBW A;  2VZQ A;  3LPF A;  1W0N A;  3U37 A;  1O8P A;  4OUE A;  3UET A;  4QX0 A;  3C7F A;  3I3E A;  2E31 A;  1NX9 A;  1UWW A;  2Y64 A;  3SKJ E;  5JXH A;  5C71 A;  3MO4 A;  3VD3 A;  1T2X A;  5IFT A;  4ET7 A;  2YC2 A;  2VZV A;  1L7R A;  1D7P M;  2VMF A;  2JKX A;  3CKH A;  4P02 B; 
#chains in the Genus database with same CATH topology
 3WW3 A;  1TMF 1;  2WFF 3;  4FP3 A;  1QKQ A;  1H1A A;  3V0A A;  1W8O A;  5I0D A;  3HMY A;  4MO3 M;  3AYE A;  3POI A;  2RM2 2;  3ZM8 A;  2Y34 A;  3OCP A;  4CEW B;  4PQ9 A;  4P9Y A;  4UF0 B;  3FMG A;  2EAK A;  2JEN A;  1SLL A;  3HN1 A;  2KA3 A;  2Q8D A;  3TB0 A;  2VAU A;  4AGV A;  4E4Z A;  2OKX A;  3WXP A;  2AZ5 A;  4LJH A;  3HNY M;  4ISQ A;  3VD9 A;  2WJS A;  3WG4 A;  1H6X A;  3AMQ A;  3SIT A;  5T5L A;  4XC9 A;  3WF3 A;  5M0T A;  3SMH A;  4YGD A;  1UKG A;  3MF9 A;  2WO3 A;  3IIA A;  4D8M A;  3KQR A;  2YB7 A;  3ZDV A;  4NIH A;  3ZFF A;  4RS5 A;  5FPA A;  5KHI A;  3WF0 A;  5JSP A;  4FQZ A;  1J59 A;  1AYN 2;  1HN0 A;  4IES A;  4FAH A;  5FO9 B;  3WW2 A;  3VZN A;  1U0A A;  4AI8 A;  3LDB A;  1NZI A;  1VMH A;  1W8H A;  3WQ0 A;  1HXS 2;  1LU2 A;  1WW7 A;  2YPD A;  2E6V A;  1V6I A;  3LE0 A;  2IXJ A;  2XJS A;  3AKT A;  2JXA A;  4YGB A;  5BNN B;  5FXW A;  2FDK A;  2Y60 A;  3UES A;  1LHO A;  4PBP A;  1LOF A;  5JOX A;  3ITQ A;  1AL2 3;  3NW4 A;  4QMA A;  4AHY A;  2B8M A;  4CDU A;  2E53 A;  3MIB A;  3M8L A;  5AVP A;  2ZMK A;  4NIA A;  2JE7 A;  5FYM A;  3CJX A;  2OQ6 A;  1CN1 A;  4DY5 A;  2F4P A;  2JB4 A;  2ARC A;  3U11 A;  3UYJ A;  5C3S A;  4YW7 A;  2OZJ A;  2PFW A;  2WWJ A;  1H30 A;  1UZ0 A;  2VQU A;  1O4Y A;  3HQX A;  3Q8F A;  2DV9 A;  4UFK A;  5A3O A;  4GWN A;  1IOA A;  2GNB A;  3WNM A;  1K5M A;  4XFB A;  2RS5 2;  4O9E A;  2C26 A;  4RQP C;  1V0A A;  1BBT 3;  3IN9 A;  4Q1P A;  4BQY A;  4NRM A;  1MPX A;  4CU6 A;  2ZXQ A;  2VH9 A;  3D82 A;  3ES4 A;  2HLE A;  3PUI A;  2CTV A;  2CNA A;  5A3L A;  3CJI C;  2WYF A;  5FWE A;  5L9B A;  5LA1 A;  4BQ5 A;  1RUI 2;  1SCS A;  3DF0 A;  4N43 A;  4TYS A;  5FMO S;  5A3M A;  1RUF 1;  2NP0 A;  1IPK A;  2OT7 A;  1RUH 3;  2WKK A;  2PQS A;  3HT2 A;  5FJK A;  1RMU 1;  2WSU A;  1V6M A;  4QB6 A;  4UBG A;  3VD7 A;  2XKP A;  3CHX A;  1KDK A;  3FUQ A;  4W4Z A;  4CPB A;  4COZ A;  3ZSJ A;  2GAL A;  2XOM A;  2CWM A;  3POF A;  3LIH A;  1W03 A;  2PAM A;  5JAX A;  1XYO A;  2D43 A;  5DQ0 A;  4HAN A;  4YM1 A;  4G9S B;  4IEU A;  2W91 A;  2JKB A;  4JZR A;  2PHX A;  1JOB A;  4YZ4 A;  1A6C A;  5DN2 A;  3TNP B;  5FWJ A;  1UIK A;  1BK1 A;  2KR2 A;  2Q4S A;  1GUI A;  4F3J A;  1PVX A;  2EAA A;  4GIQ A;  1WW6 A;  1IS5 A;  5FZO B;  4OQ9 A;  4GH4 B;  4D6S A;  2WO1 A;  3AP9 A;  1AYM 1;  3KB5 A;  4RN5 A;  1RHI 3;  2GNT A;  2Y26 A;  1W9S A;  4YW3 A;  2E9Q A;  2QJV A;  3IT8 A;  4XZP A;  4XJW A;  4FTS A;  3U1X A;  5IJR A;  5LEJ A;  1OLM E;  4V2V A;  5D21 A;  4BMB A;  1IKQ A;  4Q4Y 3;  5FP9 A;  4AAX A;  1IG0 A;  2WDB A;  3W20 A;  4HN1 A;  4NMI A;  3H8R A;  1YYN A;  2V5D A;  2XQR A;  4IV3 C;  4NPR A;  5HCF A;  4IGP A;  3KCY A;  2X5I C;  2AEY A;  4WM8 B;  1F35 A;  1OC1 A;  4P00 B;  3CBN A;  1QOO A;  1HQN A;  4ATE A;  3B93 A;  4Y1U A;  2FDF A;  3PUH A;  2PMW B;  2ARE A;  3CIH A;  3KD4 A;  3RNS A;  4YW5 A;  3VDA A;  4A2U A;  1MZ5 A;  4LEJ A;  1MZF A;  3LEK A;  2DVB A;  1UD1 A;  5E89 A;  1UY0 A;  5C9A A;  4EQV A;  5DDJ 3;  5IYY A;  3J7H A;  2VNO A;  1J1T A;  4EV0 A;  4OI4 A;  1EV1 2;  2DVD A;  4CUB A;  4JDM A;  4N53 A;  4GD4 A;  3KF5 A;  1VRB A;  1WCQ A;  2VBP A;  5FAX A;  1FNZ A;  1HB2 A;  1UU4 A;  4PIX A;  2UY9 A;  4Q27 A;  5CNA A;  4CCN A;  2MHF A;  3Q8B A;  2JE9 A;  3SH4 A;  1JZ6 A;  1FAT A;  5FXX A;  2EIC A;  2QQP A;  2P3I A;  1H2M A;  3RSJ A;  3GZE A;  1QH7 A;  2D40 A;  2ZGQ A;  4LK7 A;  4XIK A;  2WZ8 A;  4IE4 A;  2BQP A;  1X36 A;  3LA2 A;  3C7H A;  3QH6 A;  2WA3 A;  3DYM A;  3VLB B;  2C9A A;  2DWR A;  3JB8 A;  5FBZ A;  2EVX A;  3PMS A;  4ZXE A;  2GH2 A;  3JZV A;  2R07 2;  1W6P A;  1NLR A;  3LSD A;  4HK9 A;  4P02 B;  4QQH A;  1O4Z A;  3O7O A;  2DUO A;  4QB2 A;  4XZU G;  1XRU A;  2IXI A;  4K6B A;  1Q8S A;  4QKD A;  3GBF A;  3I7D A;  5T50 A;  3I2K A;  3ZSM A;  4QX8 A;  2RE9 A;  5LW9 A;  1KD7 A;  2Q30 A;  4CXW A;  5CIS A;  2BVB A;  4U36 A;  1A78 A;  4EWD A;  2Q5T A;  5F9T A;  4Q4W 3;  5GZC A;  1UU5 A;  5FYC A;  1AJK A;  4H2A A;  3GBG A;  3NV3 A;  5K0U A;  4X8P A;  1IHM A;  5EHD A;  4CEY A;  2RR1 1;  3CMG A;  1AR7 1;  3FHA A;  3D5O A;  1ODN A;  4WZC A;  1W6M B;  3GHN A;  3M3I A;  2VMH A;  4GKY A;  3AKQ A;  3HQU A;  5DG2 A;  3GYD A;  2YZ4 A;  4IGO A;  4P9L A;  1ASJ 3;  2WZR 3;  1D4M 2;  4Y22 B;  5F6L B;  1FYU A;  5GKA C;  5JIA A;  4EZH A;  2W1W A;  3M3O A;  4M0N A;  4U2A A;  5CFC C;  3MFA A;  1AL2 1;  5T5O A;  3L2H A;  2UUR A;  4GH4 C;  3HAG A;  5DPN A;  1SLB A;  3P6B A;  4N9I A;  1LOF C;  3N7M A;  5FYV A;  3MV1 1;  3QLQ A;  1BMV 2;  3OYW B;  3KVA A;  3URF A;  1H8T B;  1TEI A;  4UYB A;  3WIN E;  4UW3 A;  1RUJ 2;  4YM3 A;  5IFP A;  2A1X A;  2VNG A;  2VUC A;  1AHS A;  4LIT A;  4XFI A;  5IVF A;  3T08 A;  1N47 A;  2EAL A;  4QPG C;  4AGR A;  3H8O A;  2D3R A;  2FD8 A;  4E9K A;  2A6W A;  4OLL A;  1GOF A;  1VBB 1;  5IVC A;  2VME A;  2A75 A;  4XHB A;  3OPT A;  1NE4 A;  3W5M A;  1JYI A;  1F9K A;  2RM2 3;  2VW1 A;  4P9I A;  3B3Q E;  5F5A A;  4PLN A;  2DU0 A;  1LTE A;  1WLT A;  2WFP A;  3AZW A;  5K8S A;  4LHS A;  1LHV A;  5EIY B;  1D2S A;  3I2G A;  2BP6 A;  4ZXK A;  5FCC A;  1NAE A;  4IET A;  1PIV 2;  2WS9 3;  3B00 A;  1MS3 A;  4JVA A;  2AEZ A;  5C3Q A;  3G7D A;  2JD9 A;  2GN7 A;  3UK9 A;  5GAL A;  1RGS A;  1RUJ 1;  1SLC A;  4AFB A;  2WLP A;  4ZKT B;  3QCW A;  5LBB A;  1VIW B;  2Z42 A;  4CU9 A;  1H9W A;  2VTF A;  4ITC A;  1TE1 B;  2PXJ A;  2VBB A;  3BCW A;  3I4I A;  4WVM B;  4XTP A;  4AOC A;  2HWE 1;  5FUN A;  3Q8A A;  4JTO A;  1DQ0 A;  1NCR C;  1RVF 1;  2CDO A;  3POY A;  1NA1 A;  4B1M A;  1W6O A;  1BCX A;  5KC5 A;  3FLT A;  1LGN A;  5FMB A;  1HQW A;  2HEY F;  2VZ1 A;  2G19 A;  1OMI A;  1J3Q A;  1WD3 A;  1BYH A;  3BOP A;  2PYT A;  2ZEZ A;  3IPV B;  3OJB A;  4OFG A;  5JWP A;  1CPM A;  2RHP A;  2WN3 A;  1XU2 A;  4OZX A;  5I93 A;  1W39 A;  2ID4 A;  4HZF A;  4L8Q A;  5LAS A;  4KGG A;  1QJZ A;  2WNV B;  4OZO A;  2BDR A;  2GZW A;  2R04 2;  5J98 B;  5F37 A;  1RIN A;  2HYX A;  4L11 A;  2ZGU A;  3T4V A;  5JSR A;  3RMX A;  1C3H A;  5FYH A;  1WA4 A;  4XUP A;  4BK5 A;  1OXC A;  1LOE A;  1C5I A;  1RL3 A;  5KXB A;  4IND A;  2VQ0 A;  1BKZ A;  3HBZ A;  4FXG B;  4MGK E;  2FCU A;  4UXA A;  4GMP 3;  4AI9 A;  3FHQ A;  1UZZ A;  5FTT C;  2RR1 3;  3L2Y A;  4LK6 A;  4Q0P A;  2LAL A;  4AFM A;  4BQX A;  3NWK A;  1RTV A;  2WT2 A;  3OGS A;  2VEC A;  4TTG A;  1Q8O A;  1W8N A;  3H0O A;  3VBH A;  3VBO A;  2CU5 A;  4FPC A;  2ET1 A;  3SEP A;  3UGG A;  1WCK A;  3PDQ A;  3NST A;  4MHU A;  2W94 A;  1BHG A;  1HKD A;  3AL6 A;  2AYH A;  2JIC A;  3LA3 A;  5F3E A;  4LIU A;  5FJH A;  3NJY A;  4MGQ A;  4RHV 2;  5EWS A;  2J1T A;  5FXZ A;  3LFI A;  5JIU A;  4HT1 T;  4KWK A;  1GWK A;  5FYS A;  2IFR A;  1IS4 A;  1VBA 2;  4DXR A;  1DLL A;  1RUI 3;  4TN7 A;  1JHN A;  1BVP 1;  2DCY A;  2BV4 A;  4AL9 A;  1CZT A;  1W04 A;  3HBK A;  1V70 A;  4PQQ A;  3RZZ A;  2IXK A;  1QJF A;  4K21 A;  4AVC A;  2B9V A;  4LMF A;  1KJL A;  4JGY C;  1NA1 C;  1QJY 1;  5CKQ A;  2FDG A;  4QM9 A;  1R08 2;  2BUK A;  4CEW C;  3OPW A;  1GZW A;  1QQP 3;  3POE A;  3A0N A;  1UKR A;  4RR3 A;  1HLC A;  4GB3 1;  3GZU C;  1C28 A;  1F5F A;  1ZZ6 A;  3DPR A;  4LR4 A;  3WZ1 A;  3ZSL A;  3ZYI B;  5ABJ C;  5C8C B;  1GAN A;  1QWR A;  4XBN A;  4E4D X;  3EMR A;  4RD7 A;  2WII B;  5LA0 A;  4TZD A;  1WWY A;  1MEC 3;  1QXP A;  1VBC 1;  1L3J A;  2X5I A;  1SDW A;  3VHO A;  4CXY A;  3DEM A;  2AAC A;  1LHN A;  4LXL A;  3THP A;  1PVC 3;  3POJ A;  1LKN A;  2BNM A;  1W8U A;  2AUY A;  1GZC A;  1OUR A;  4BME A;  1WCS A;  2WNO A;  4Z92 B;  4N7U A;  2H6C A;  1OH4 A;  1K5J A;  3LD8 A;  3WUD A;  1OKO A;  4YG6 A;  1VBD 3;  1RUG 1;  1QJY 2;  4FOW A;  1RMU 3;  1GP5 A;  1U5Z A;  4LTA A;  3ZYG A;  3VBR A;  4COV A;  2BZD A;  3ZYR A;  3P3N A;  3J7M A;  1F4H A;  1YIP A;  1PO2 1;  1E5S A;  1G9A A;  5AVA A;  5IAV A;  5A32 B;  3VKL A;  1H6Y A;  5A3W A;  1KFX L;  1X9P A;  4CSW A;  3A4U A;  3SIS A;  2XJU A;  2J1U A;  1W2A X;  2E7A A;  3F95 A;  4JX0 A;  4XQD A;  1W6M A;  4HON A;  2VW2 A;  2WO7 A;  5DAX A;  2ZHK A;  2ZGL A;  4MXV A;  3VDD C;  3WHU A;  3B69 A;  1YNA A;  1PNF A;  3EYP A;  4QQO A;  1UY3 A;  1WBF A;  2Y0I A;  1ZBA 3;  1UPS A;  5FY9 A;  2I07 B;  3FBY A;  5FZI A;  3K4D A;  1HN1 A;  3MYX A;  5FO7 B;  5IVJ A;  2YY1 A;  1BVV A;  2P34 A;  5FZG A;  3FWE A;  3AM2 A;  5B2G B;  3I8T A;  1YQ2 A;  1W8F A;  5C4W A;  3OGJ A;  3USS A;  1HV0 A;  3AJY A;  2CHH A;  3PU3 A;  2R49 A;  4LHN A;  1MVE A;  1GNY A;  4TSV A;  1ZBE 2;  4DS0 A;  3O1R A;  3CJI B;  3H42 B;  2XLA A;  3W9A A;  4ASL A;  4YZ5 A;  1PMI A;  4XUO A;  5DAQ A;  4COW A;  2R04 3;  4A7K A;  1OOP A;  1WKY A;  4HPK A;  2QFE A;  1UL9 A;  1N1V A;  4B7E A;  4AYU A;  2JX9 A;  5K9Y A;  3B94 A;  3VBU C;  4KQ7 A;  5JZG B;  1JBC A;  1WCD J;  1ZX5 A;  4KWL A;  3TN9 2;  4MGT A;  4NJ4 A;  5BNP A;  2UWA A;  4KU7 A;  4BJ0 A;  2XKO A;  2HWF 1;  3KHB A;  1VRH 2;  3KGL A;  4H3W A;  4E2Q A;  3VB9 A;  1CAW B;  4OUL A;  5I8S A;  4B3N A;  3EJK A;  1HXS 1;  1NA1 B;  4LE3 A;  2HJI A;  3DV8 A;  3MPB A;  3MZH A;  4ASK A;  4R52 A;  1BK0 A;  1BMV 1;  3V56 A;  3CO2 A;  1S0D A;  5H9S A;  2DBI A;  2DVG A;  1ZA7 A;  2LW8 A;  3AKR A;  3E6D A;  1V6L A;  1JOD A;  2ZHL A;  3IPV A;  4PBO A;  1I3H A;  4OHZ A;  1RJ7 A;  3LPF A;  3RZK A;  3U37 A;  2BBV A;  2RS1 1;  3S7E A;  1JW6 A;  3LF7 A;  4HMZ A;  2HKX A;  1DBN A;  4NRO A;  4XOG A;  1PIV 3;  1AF9 A;  1UZW A;  3DKQ A;  1MS1 A;  4OUE A;  4XDP A;  2QVS B;  1N3O A;  3C7F A;  4FAG A;  5A70 A;  2QKD A;  1NX9 A;  4JQR A;  1VBB 3;  1MQT B;  1W6Q B;  5JXH A;  2JDK A;  4DPN A;  5C71 A;  1SCR A;  3MO4 A;  4W6X A;  1T2X A;  1JTZ X;  2HEV F;  2D97 A;  2BFU L;  2RJL A;  4Y20 B;  5LBF A;  5IFT A;  5LRS A;  2ZGR A;  4OI1 A;  4XCB A;  2XL7 A;  5FZA A;  4CPB D;  5C5T A;  4FPY A;  4PI2 A;  3BYW A;  4XAE A;  2JKX A;  4MG2 A;  1Y9G A;  1FAY A;  2FCV A;  4X6Q B;  3VBS C;  1RC6 A;  4R4X A;  5GZF A;  1PO2 2;  2Q8E A;  4AK3 A;  3UKT A;  1H8T A;  2VZ3 A;  1XQN A;  4HVQ A;  3ETP A;  3DL3 A;  4H7L A;  1PM7 A;  5FMC A;  5JR7 B;  4P5Y A;  1RUH 1;  4AQ2 A;  5BUV A;  3VD4 A;  2VNR A;  4ZZ8 A;  5HCA A;  4P08 A;  2XVK A;  2DCK A;  4XAC A;  3GZT B;  4CZS A;  2YMZ A;  4IEY A;  5FYZ A;  2QBX A;  3QBQ A;  2YUE A;  1DQ6 A;  5GZE A;  3JBG 2;  5DAP A;  5I0U A;  1CPN A;  3BIW E;  2XGX A;  5CFC A;  4CCL A;  2WRA A;  4XXP A;  4DB5 A;  3THT A;  1XYP A;  3MUZ 1;  1PK6 A;  1XE7 A;  5CB7 A;  3WLU A;  1VBC 2;  1D4M 1;  3WDW A;  4GWJ A;  1POQ A;  2SLI A;  3I2H A;  5I91 A;  1XB9 A;  4XF3 A;  1GZT A;  1LHW A;  3JB4 C;  4Q4W 2;  3BB6 A;  3O1T A;  5FZ1 A;  4C0H A;  1WBL A;  3BTA A;  3P3P A;  3ZFG B;  4DEV A;  1HRV 2;  1AYM 3;  1NCQ B;  3A23 A;  4RR3 B;  3OY8 A;  3UKV A;  1H2L A;  5ABJ A;  4GWM A;  2VCC A;  3DPR B;  3NNM A;  1RUG 2;  1SPP A;  4MUV A;  1VJ2 A;  4XMA A;  2C0Z A;  4A6O A;  1ST8 A;  3G6J B;  1FMD 2;  4NPM A;  3M1H A;  3MV0 1;  4QHO A;  3H1W A;  2PLV 1;  3VDC A;  1UYX A;  1X82 A;  3NRU A;  4UW6 A;  5LA9 A;  1Q8V A;  3R4D B;  4JTN A;  2B39 A;  4PDW A;  4Q0S A;  4CUG A;  3EBR A;  5FZ3 A;  1C57 A;  5A7O A;  4FOQ A;  1RUN A;  4GQ7 A;  2PHR A;  3R4S A;  4LBQ B;  3M7A A;  1ENQ A;  4A6S A;  4AVV A;  2QDR A;  3N36 A;  2Z2S B;  4LKD A;  1EV1 3;  3J8F 2;  3IAP A;  2PQQ A;  1KS4 A;  3CEW A;  5DDJ 2;  5FY1 A;  2GC0 A;  4B8E A;  4MXW B;  4M3C A;  3AYD A;  4NHM A;  1OBN A;  5IK7 A;  1R09 1;  4OQ8 A;  4XQW A;  4JHT A;  4O61 A;  3U07 A;  1R08 1;  3GCX A;  2LTN A;  2VTX A;  1H8T C;  3M70 A;  4WZF A;  4D6Q A;  4HG6 B;  4OI0 A;  3V0A B;  4AG4 A;  2EXK A;  1GP6 A;  1OOP C;  4R4Z A;  3FE5 A;  5A33 B;  5LZ6 A;  1P8J A;  5LK7 B;  4BZ4 A;  4E4S A;  3HQR A;  1C8M 2;  1PNG A;  3DYO A;  2YBK A;  4M3C F;  1C4R A;  4UF0 A;  4CCJ A;  4CUA A;  1CAV B;  1LR5 A;  4QPG B;  3RYP A;  5BY5 A;  3AZZ A;  1MS0 A;  3MIG A;  1MAC A;  3RYR A;  3MUY 1;  5ANN A;  5FMD A;  3VBR B;  5C4W C;  1DZQ A;  1JZ7 A;  4B4P A;  2GN3 A;  3IDE A;  3N7K A;  3POG A;  5LA2 A;  4K9S A;  4RHV 1;  2JDU A;  2TEP A;  4F83 A;  1V6J A;  4LHL A;  1J58 A;  2BTV C;  2BPA 2;  2P4E A;  1Q8P A;  4IER A;  2R32 A;  5H9P A;  1JZ5 A;  4CDX A;  2ZZQ A;  2NMN A;  3MFC A;  2R06 1;  5T5J A;  4YAR A;  2ORZ A;  3RJ2 X;  3D8C A;  4YFW A;  3WSO A;  3H3L A;  1FOD 1;  1OA4 A;  1BEV 3;  3LIG A;  1XXN A;  4DIN B;  3FHI B;  1ODM A;  3VKM A;  2RS1 2;  2VW0 A;  4J25 A;  4XBQ A;  3S57 A;  5FPL A;  1JYN A;  1YEW A;  2VOV A;  1K3I A;  4A7Y A;  4QXB A;  4OHW A;  3AMH A;  3WNP A;  1KXG A;  1DU3 D;  3ZN4 A;  1AR9 2;  4L9B A;  3OD0 A;  3CJI A;  1QY4 A;  3GBW A;  2QDN A;  4C0B A;  4E2S A;  3ZFF C;  1UXZ A;  2PEL A;  2K9Z A;  4RYD A;  1NE6 A;  2QUO A;  1VMJ A;  2IC1 A;  1SLA A;  3J8F 3;  4NR1 A;  5FZL A;  3PNA A;  1C1F A;  4IW3 A;  2ZGO A;  2HWF 2;  1WMD A;  3C7O A;  3NO8 A;  2P37 A;  3I59 B;  4YPJ A;  4Q4X 3;  1SBF A;  3VDD A;  3VKO A;  2DCJ A;  1W2T A;  1APN A;  3HIF A;  4URA A;  4AVA A;  1SLI A;  1VMF A;  2D6K A;  1NUK A;  1ULE A;  4CCK A;  2H6B A;  1NZC A;  4LO6 B;  1DHK B;  5A1F A;  3MID A;  1VAK A;  3AP7 A;  2O8O A;  2J1S A;  2E32 A;  1CQ9 A;  4BA6 A;  1D0G A;  4XUT A;  2HWE 2;  3ZPO A;  4E27 A;  3OUI A;  4JHZ A;  1UOJ A;  5IW0 A;  4AE2 A;  4BOW A;  4LOS A;  4XFF A;  4CDU C;  1GOG A;  2W1U A;  3EXU A;  2D3P A;  3WF1 A;  1S1A A;  4HLT A;  2W3J A;  4LT5 A;  5CFD B;  1A8M A;  5JCT A;  3RMY A;  1LEM A;  1UY4 A;  5D1I A;  5FY0 A;  3ZIW A;  1EV1 1;  2BWA A;  1RED A;  3S7I A;  1ZRD A;  1EPW A;  2R1D A;  1PZ9 A;  2P3K A;  1AL2 2;  2RDQ A;  3VKF C;  3GF6 A;  4IEQ A;  4RS5 B;  4XUN A;  1UX7 A;  1PHM A;  2W95 A;  3IDB B;  4CP0 A;  3LOI A;  5FY8 A;  3FZ3 A;  2CL2 A;  5F5C A;  1YJL A;  2HWB 2;  1DGR A;  1ASJ 1;  2XVL A;  5FZO A;  1RUF 3;  4NAM A;  1W3X A;  1H4H A;  3VBR C;  1FT9 A;  2VU9 A;  3ZR6 A;  3ZXA C;  4FSJ A;  4DRR A;  5HCH A;  2W92 A;  3IAQ A;  1MVQ A;  2P6H A;  3LCP A;  3O14 A;  1LGC A;  3CF6 E;  4F8A A;  3OPZ A;  2Y0O A;  3D0J A;  3RG0 A;  3FBM A;  2MEV 3;  1PO1 2;  1QJU 1;  4CVU A;  2NN8 A;  5IVY A;  1H1I A;  4L97 A;  1GOH A;  2OII A;  4QT6 A;  5EJ3 A;  1AL0 G;  1UYZ A;  2ZGS A;  3OY8 B;  2Y33 A;  4O9G A;  3RWK X;  4BQ1 A;  5ABJ B;  3CL1 A;  3N9O A;  3N4M A;  1XNC A;  1PZ8 A;  2WUH A;  3VL8 A;  5L9V A;  4WM8 A;  4EN7 B;  2CV6 A;  5G04 L;  1COV 2;  4FXK B;  4EN6 B;  4CYD A;  2IXH A;  3AMN A;  5KHK A;  1J84 A;  5LY1 A;  1QJE A;  2X53 S;  1Y7B A;  3KSC A;  4HBN A;  3E6B A;  4DRV A;  1SAC A;  1UF2 C;  2UU8 A;  1LGB A;  2VTX J;  1O8S A;  2XJR A;  3TN9 3;  4BIS A;  2QZ3 A;  2CGO A;  4UFJ A;  4JRL A;  4FPH A;  3KVB A;  2H0B A;  3WD5 A;  4QPI A;  4TLF A;  2BYV E;  1H2K A;  2WT1 A;  4BQW A;  4OVE A;  4M3C B;  1ZBE 3;  4LBM A;  1QOS A;  2C6S A;  1TNR A;  3ILF A;  3A0K A;  3O0W A;  3BOD A;  1UZV A;  4M00 A;  1ALY A;  2C5D A;  2GH8 A;  1PK6 C;  2QQO A;  3SCG A;  4A45 A;  5FOB B;  3BAL A;  3KWV A;  2YGL A;  1F15 A;  1QJX 2;  3O1U A;  2WNU B;  4BM8 A;  3ZX7 A;  2VXR A;  2Y38 A;  4LKF A;  4ASM B;  4I3P A;  2HWD 2;  5J96 B;  3MF6 A;  2BOI A;  5G05 L;  1ACC A;  1R64 A;  3MLK A;  4HFS A;  4Y5Z 0;  4FPO B;  3O1V A;  3BIE A;  2A6V A;  4BLJ A;  3NNG A;  1IS3 A;  2MPF A;  1V9U 3;  1ZYB A;  2QNK A;  3ZO0 B;  1SMV A;  2GC2 A;  1AR8 2;  4Z82 A;  3Q9O A;  4LE4 A;  2V4V A;  1RIR A;  3QOP A;  4AI3 A;  4A3Z A;  4YG3 A;  4CEY B;  2BNN A;  5HV0 A;  2AH2 A;  1W9W A;  1VBD 2;  2C9K A;  2XBO 2;  3MI8 A;  5FY5 A;  3N3H A;  1RHI 1;  1YI9 A;  2AEN A;  3GNE A;  5L73 A;  5DMY A;  1JYC A;  1ZRR A;  5A3N A;  1NOV A;  3NQH A;  2R04 1;  4MHR A;  3VBU B;  4QQ2 A;  4AQS A;  5JZG C;  5JOW A;  5FLJ A;  3WNX A;  5C70 A;  4PF5 A;  5JMC A;  4AVT A;  2QE3 A;  1G7Y A;  1R1A 3;  4GXL A;  2VOW A;  1S2E A;  3VL9 A;  2E7T A;  4FOV A;  5T54 A;  4ZS2 A;  1VAV A;  2DU1 A;  3NNF A;  1W2N A;  1VE0 A;  2Q0A A;  2XLG A;  3POB A;  5DAB A;  3USU A;  1DZT A;  1B35 A;  3ACL A;  1RVF 2;  2UWC A;  2WS9 1;  4HOO A;  3O0X A;  4QAW A;  4ZON A;  3WG2 A;  1DYP A;  1RUF 2;  1FX5 A;  5A7N A;  4XHX A;  4RQP B;  4D94 A;  4YW4 A;  4AEJ A;  4BXS V;  1OD3 A;  3WQ1 A;  2D98 A;  1QEX A;  1H2N A;  2A3W A;  3L9J T;  3KGZ A;  2P5B A;  3NNL A;  4S2G A;  4CDQ C;  5A3P A;  4DXZ A;  2JG8 B;  3N35 A;  1CIW A;  4FPL A;  4UWD A;  1YIF A;  1TG7 A;  3PHM A;  2EXI A;  1HB3 A;  2JD4 A;  4QQL A;  1PZ7 A;  1QU0 A;  2QZ2 A;  5JXG A;  2SBA A;  1RUE 2;  1V00 A;  1BQP A;  1FPN 1;  1N3Q A;  1JZ3 A;  5CA6 A;  2JDP A;  1QJX 1;  1W6N A;  4I30 A;  3ASI A;  1UY2 A;  4FPE A;  4HK8 A;  2W68 A;  4KI5 M;  2I45 A;  4L2N A;  4N7I A;  1DCS A;  3OBZ A;  1QQP 2;  2VBD A;  3LDK A;  5L19 A;  5LY2 A;  3UV9 A;  1ZZ9 A;  4COU A;  4RSU A;  4A7Z A;  1QNY A;  3WNK A;  1UMZ A;  3HWJ A;  3J7L A;  4IGQ A;  3UGF A;  3UGH A;  2E63 A;  4N53 C;  2MNG A;  4L92 A;  1WGP A;  2YBP A;  1SDD B;  3TRS B;  5K7P A;  3BU7 A;  4PDW C;  1UOG A;  3WF2 A;  5C33 A;  5DZE A;  3KF3 A;  1W99 A;  3SXW A;  1BEV 1;  2DVF A;  1BXH A;  1CJD A;  2BGO A;  4QPY A;  2H0V A;  3DKW A;  3E5X A;  4WV8 A;  1WW4 A;  2OA2 A;  2J1E A;  2VCA A;  1COV 1;  3VN4 A;  1KS5 A;  2ZA9 A;  1O91 A;  4HKO A;  4XPV A;  3BPS A;  2XML A;  1XU1 A;  4H7M A;  1W9Y A;  2RDR A;  2N7G A;  1GMM A;  5DUU A;  1QNW A;  3IDA A;  2VUD A;  5BPX A;  1M4W A;  1S0I A;  3IZO A;  4NPL A;  5A80 A;  2HEW F;  4FP2 A;  5HCB A;  2Y6G A;  1OD5 A;  1UNB A;  2VY0 A;  2VL4 A;  3ME2 A;  4CEY C;  4Y5T A;  5FZ4 A;  3HD8 B;  3ZFG C;  1U12 A;  4YW6 A;  4AXO A;  4I02 A;  4FFG A;  3KQ4 B;  1VP6 A;  1ND2 B;  5F39 A;  2D44 A;  4CDQ A;  1G9C A;  3A7Q A;  3GDB A;  2WZR 1;  3WNN A;  1ZVF A;  2Y8K A;  3DYP A;  5AC9 1;  3IKW A;  1ULD A;  4QKB A;  3TEX A;  4I2O A;  2G9F A;  3ZYF A;  5KHG A;  1KRI A;  1YO8 A;  4PCR A;  4AVS A;  4E2G A;  2VXJ A;  1DZR A;  3POS A;  1YFW A;  3S6P A;  1TME 3;  4Z2W A;  1ZBA 1;  1TQ5 A;  1J83 A;  2VE1 A;  2X10 A;  3MW3 A;  2W08 A;  4PJY A;  1R1A 1;  2FDJ A;  3NAP B;  2VUA A;  4W8J A;  1QQP 1;  3PUR A;  4LOT A;  2E51 A;  2JDM A;  2R0F A;  1H0B A;  1N1S A;  4YVS C;  4GA9 A;  3ZFE A;  1G6N A;  4CA9 A;  2UWB A;  1C8M 3;  1REF A;  3H1Y A;  4AQT A;  2PHL A;  3M3Q A;  4XFC A;  4IE6 A;  1O3R A;  3OUJ A;  5EXO A;  2CDP A;  1TMF 2;  1XSR A;  1WD4 A;  5F3C A;  1PMH X;  4LBQ D;  3ZXJ A;  3LA7 A;  2WQZ C;  2PHW A;  4BU2 A;  5K4L A;  1U5I A;  3RZH A;  2OW4 A;  4KNC A;  1VBE 2;  1LCL A;  2X09 A;  4ATF A;  3WEZ A;  1RUG 3;  5A1A A;  1DGW A;  2JIG A;  3UJO A;  2J1A A;  4G4F A;  3AP6 A;  4DQA A;  1QOT A;  1N3P A;  4OHY A;  2ENR A;  4D0Q A;  2Y6J A;  1F8V A;  3V65 A;  5FLI A;  3ALQ A;  1AR6 3;  2WBK A;  1OF4 A;  4MGI E;  3B9C A;  1S2B A;  2A71 A;  4LUL A;  2WQ4 A;  3AKP A;  5AFE A;  5FP4 A;  1JZ2 A;  1D4M 3;  2BJS A;  1ASJ 2;  2OZ6 A;  2WNU A;  3EB7 A;  2RS5 1;  4YSF A;  2JG9 C;  3B01 A;  4Y1V A;  4DFS A;  3JBG 3;  5KC6 A;  1AR9 1;  1POV 1;  4C8D A;  3SH3 A;  2ZEY A;  3IBM A;  4D69 A;  3LFM A;  1AYM 2;  1WMX A;  4GB3 3;  1YHF A;  1ONA A;  1CAU B;  2BW8 A;  3RRD A;  3WOG A;  5FDB A;  3BI3 A;  3VBH B;  3KCC A;  4O65 A;  5JOZ A;  1XE0 A;  1ZZ7 A;  2F6B A;  1OLQ A;  2ZX0 A;  3M3C A;  3UET A;  4NAO A;  5DXD A;  1Y4W A;  4XJZ A;  1HRI 3;  3KZ4 C;  4GJZ A;  3R6S A;  2HWD 1;  5FBJ A;  4YVS A;  5L7O A;  1URX A;  2HWC 2;  4B4Q A;  5AFB A;  5BNN C;  3B5L B;  3ZFE C;  3E5U A;  3VD3 A;  3ATG A;  2A6X A;  2K46 A;  1ND2 C;  2IZW A;  2YC2 A;  4ET7 A;  1AYN 1;  2VZV A;  4IV1 C;  2RS3 3;  4K7J A;  5EPA A;  1D7P M;  3RYK A;  3E5Q A;  5CBL A;  3VBO C;  3ZDS A;  3JU9 A;  2Q1F A;  4YGC A;  2ZHM A;  5JDB A;  1YQ8 A;  3CU7 A;  4NN0 A;  2BGP A;  3MLJ A;  3GZA A;  4W6W A;  5A7W A;  2ARX A;  1UW8 A;  4N43 C;  4FPK A;  2ZX3 A;  3RI8 A;  2PHF A;  3ELN A;  1CR7 A;  3NAP C;  4BH9 A;  3BU0 A;  4P9G A;  4QU1 A;  3T1M A;  5C7G A;  5FK8 A;  1XC6 A;  2WAA A;  2DUQ A;  3K51 A;  4FT8 A;  3WCS A;  3IMN A;  1YQ6 A;  2Z5W A;  2O1Q A;  3CDZ B;  1GV9 A;  5DUW A;  2E7Q A;  1TMF 3;  5D2A A;  3RJR A;  4BWO A;  3K46 A;  4F7Z A;  3RZG A;  3MW2 A;  5A7P A;  1IGO A;  2PLV 3;  4NVP A;  3O5S A;  2WL1 A;  2DCT A;  4FFH A;  1UMH A;  2GSY A;  2ZMN A;  2XUE A;  5BNQ A;  2VUJ A;  1QF3 A;  2W9X A;  3MGU A;  4W6Y A;  3WP6 A;  5B4N A;  2ERF A;  1H8V A;  4ES9 A;  1ENX A;  4Y33 A;  3VZM A;  4A3X A;  1OLR A;  4BCU A;  5FXV A;  4IE5 A;  3ZYB A;  5BNO A;  2FCT A;  4Q4Y 2;  4QX5 A;  4RFT 0;  3W59 A;  5KXE A;  1NQD A;  1JUI A;  2ZAA A;  5AC9 2;  2WNV C;  5BNP B;  3P1I A;  1SBD A;  4Q1R A;  2RG4 A;  2JDH A;  4YRD A;  1FOD 3;  5J7M A;  4AHZ A;  3RZJ A;  4DNY A;  3HJR A;  5E8A A;  5KHJ A;  3VBF A;  2ZCW A;  5JXI A;  1RHI 2;  1CAW A;  1VRH 3;  4IXL A;  5FP8 A;  1VBD 1;  1SFP A;  3SHR A;  1H9P A;  3RFR A;  5T55 A;  1KQR A;  1MQT A;  2DTY A;  2P6C A;  3AB0 A;  2QTW B;  2JB8 A;  3ZYP A;  1XNA A;  1VB2 A;  4NHL A;  4XUR A;  2JEC A;  4MET A;  4NRP A;  5FZH A;  4IV3 A;  5FZK A;  2JG9 B;  5C3P A;  3KHC A;  3PTR B;  4OMC A;  1E57 A;  5E88 A;  2J42 A;  1OFN A;  1TVG A;  4QDS A;  4I0W B;  5FPZ A;  4GAZ A;  1JZ4 A;  3JBG 1;  4UT5 A;  5F8P A;  4XCA A;  5CU1 A;  4X8N A;  5F3G A;  1Z7S 2;  5T52 A;  3OGG A;  4ZZ5 A;  4IL7 A;  3X29 B;  3ZN6 B;  2UY8 A;  2CWS A;  1DGL A;  3BTY A;  4FO9 A;  3T2P A;  1RUH 2;  2EXJ A;  1B35 B;  1E5H A;  4XJU A;  4J6G A;  4M3C E;  1JUH A;  4I3G A;  3RZL A;  2VJX A;  3U10 A;  2VZS A;  4QQP A;  4Q4V 3;  4QU2 A;  1ZBA 2;  1QJY 3;  5I0R A;  4LNV A;  1YFU A;  2RV9 A;  3ZFE B;  4RQP A;  3TWI A;  2ARA A;  2XHK A;  1UO9 A;  4ZU5 A;  1Y9M A;  4LUK A;  4UAP A;  2Q8O A;  2V72 A;  2VO5 A;  3PVO A;  1DQ4 A;  4LHK A;  4B7K A;  4BE3 A;  5LBE A;  1PVC 2;  3EHK A;  2WN2 A;  4AFA A;  5KXD A;  1DIW A;  5D8A C;  5FZF A;  4UOJ A;  1PGL 1;  1OQD A;  3K2O A;  5C8C C;  1JZ8 A;  3WDU A;  2FZ1 A;  3KT1 A;  5JR2 A;  1JYW A;  4N43 B;  1CX4 A;  4I01 A;  2NQY A;  1HRV 1;  2XUM A;  1W8W A;  1JMU B;  1RUC 3;  1ENS A;  2BEO A;  4Q5O A;  5DG1 A;  2ZS6 B;  3WP4 A;  2LS6 A;  1RUE 3;  4YG0 A;  5A1L A;  1ZZC A;  3Q8C A;  4LLF A;  3D4K A;  5FMO L;  3OOX A;  2GMM A;  3ACG A;  1JXN A;  4CCO A;  1CAX B;  3J7N A;  1FNY A;  3N9L A;  4FVV A;  4YGE A;  1NLS A;  3HVD A;  5FKC A;  5LB6 A;  1LOD A;  1OPO A;  5CYY A;  4UFL A;  4KU8 A;  1MEC 2;  1AJO A;  1IPJ A;  1F31 A;  1W05 A;  2HH9 A;  3BN6 A;  3ES1 A;  1JH5 A;  4KL1 A;  4R9D A;  3THD A;  2UYB A;  2NYY A;  3K4Z A;  4GMP 0;  3RDI A;  3M2M A;  4BQ3 A;  1W6P B;  2C24 A;  1IKP A;  2ATF A;  4IEZ A;  1J1L A;  2QQM A;  4JC1 A;  2FQP A;  4FPG A;  4CUC A;  3OBT A;  2OPW A;  3OSD A;  5T3N A;  4MXW A;  2JWP A;  5BNP C;  1QXJ A;  3VZL A;  2XPJ A;  3JD7 3;  4FTB A;  5F2S A;  2VCB A;  2NM1 A;  2G9Z A;  4QDQ A;  3U78 A;  2UYA A;  2VZP A;  2YBS A;  1IPS A;  2VZT A;  1UAI A;  1TZO A;  4QX2 A;  2X05 A;  3B02 A;  4LBQ A;  4QKF A;  1YQ5 A;  2XJV A;  1UOF A;  1US3 A;  2VOT A;  1MZE A;  4B29 A;  3ZXG A;  4LBO A;  4QPG A;  4AVB A;  1ZBE 1;  5FYY A;  1ND3 A;  1S0C A;  4FCA A;  1JYV A;  1AYN 3;  4WBB A;  5J37 A;  2W2I A;  4Q29 A;  4XJ9 A;  3S5A A;  2WZP P;  3VUO A;  1ND2 A;  2BFU S;  2HBT A;  4NII A;  3LOB A;  1GLH A;  2D5H A;  4XE9 A;  3ZMN A;  4CDQ B;  1CD3 G;  2WFF 2;  3NL1 A;  4GH4 A;  3W58 A;  4CDW A;  4EN0 A;  4QHZ A;  2ZAH A;  1AR8 3;  3NV2 A;  3OYW A;  4O7X A;  3ZVX A;  1PGW 1;  1ULF A;  5GJ6 A;  1JOP A;  3T4H B;  3FL7 A;  4YWA A;  3BUC A;  4G3Y C;  1ZM1 A;  4HVR A;  4Q8L A;  1PGS A;  1X8E A;  2G9G A;  3J8F 1;  4EE2 A;  3PIG A;  2BER A;  4Q2F A;  5L7O B;  1DLC A;  4HET A;  4BK4 A;  1G9D A;  2A3Y A;  3WCR A;  4DZG A;  1PX3 A;  1JYX A;  4Y22 A;  1QJX 3;  1AR7 3;  3ON7 A;  4Q4X 1;  3VZK A;  5C9A B;  1SEF A;  4XFA A;  4E4H A;  4P9X A;  3AJZ A;  4LUM A;  1EUT A;  3IM0 A;  4ERO A;  3I2F A;  2D5F A;  4N53 B;  5J1X A;  2MEV 1;  4OHV A;  3HN3 A;  1QJU 3;  4P9W A;  4TWT A;  1WZX A;  4UFH A;  5IVB A;  1XND A;  3MW4 A;  3TAY A;  5FR3 A;  1OKQ A;  1OT5 A;  5FO8 B;  4PDW B;  1Z78 A;  4CDX B;  3W5N A;  4QXC A;  4R9A A;  3ST7 A;  5IVE A;  5E16 A;  1TNF A;  3AYC A;  2XBO 1;  4J1W A;  4HL0 A;  4YYO A;  2JEM A;  3U75 A;  2VVD A;  4PLO A;  3VDD B;  3C2U A;  1J3R A;  4K1Y A;  4C1W A;  3IDC B;  4L0P A;  4Q0Q A;  3K3O A;  4XET A;  3GM8 A;  4XJA A;  2ZOE B;  3PLQ A;  4LLO A;  4AR2 A;  2ZAC A;  3VBF B;  5KR7 A;  1MQT C;  3WY6 A;  4NHY A;  2OUJ A;  1HW5 A;  2DFB A;  5FUP A;  1UU6 A;  2DFC A;  3ROU A;  2PLV 2;  1LB2 A;  2YFU A;  2VZR A;  1FMD 1;  1OVP A;  2OXB A;  4CP9 A;  4DUW A;  4CCC A;  4LKS A;  1Q5O A;  2OX0 A;  4QGL A;  4XJ8 A;  1X33 A;  1MS4 A;  1V6N A;  5FK7 A;  4GJY A;  1PM4 A;  3AC0 A;  5FZ7 A;  1BZW A;  5CFD A;  5BNO C;  1A34 A;  5C8W A;  1AXK A;  2Q1M A;  4DXT A;  3BVC A;  2QQJ A;  2DDU A;  5A7Q A;  5IK5 A;  2WNV A;  1AR6 1;  3LWC A;  4MSV A;  1JI6 A;  1WW5 A;  3DXT A;  1CAU A;  1X9T A;  1UYY A;  3RZM A;  2BRT A;  3JXS A;  1XNB A;  4Y1Z A;  1QIQ A;  3FLP A;  4NID A;  1VBA 1;  2ZAB A;  1RUJ 3;  3DXU A;  1EUU A;  2NZ9 A;  3NJV A;  3OG2 A;  4MOA A;  5D8A A;  5FLH A;  1DDL A;  4IQP A;  3POW A;  4KMQ A;  5JVV A;  1F4A A;  2CGP A;  3LEI A;  1DFQ A;  4OUS A;  1H4G A;  3U0Z A;  3F2Z A;  4QKN A;  3TYJ A;  1G9F A;  1EAH 1;  1Z0H A;  2AR6 A;  1W28 A;  1IS6 A;  3OBA A;  1NQJ A;  4YVS B;  4MLO A;  3I49 A;  4M01 A;  1C8N A;  5GLZ A;  1AX0 A;  2DYC A;  3VZJ A;  1HX6 A;  5BYN A;  3LB9 A;  4KGQ A;  2ZJC A;  1OSG A;  1MS9 A;  2P1B A;  2ZGP A;  1Q43 A;  2PHT A;  1UY1 A;  3WR0 A;  4WVZ A;  3AK0 A;  4AHX A;  4MGZ E;  5JXJ A;  3K4A A;  5CEH A;  3Q8E A;  1AXZ A;  4Z07 A;  3JD7 2;  4CU8 A;  4TXW A;  4YNI A;  1W8T A;  3OGV A;  3R4U A;  1OF3 A;  1JHJ A;  1JU3 A;  5I8Y A;  5GZD A;  3I54 A;  1CON A;  5IAT A;  4GB3 2;  2B42 B;  1KDM A;  1UX6 A;  2WZR 2;  2DUR A;  4XQ4 A;  3ZR5 A;  4WM7 C;  5L7O C;  1ULP A;  2YU1 A;  4LIV A;  4D3W A;  5GM0 A;  2HWE 3;  4IEX A;  2R07 3;  4FTE A;  2GME A;  3FN9 A;  3I3Q A;  2DUP A;  3D0S A;  3MPP G;  4Y3O A;  5EFU A;  5IT6 A;  1DGR N;  3MHZ A;  3C3V A;  3T09 A;  3VBS B;  4JQT A;  3K75 B;  4OHX A;  4XF4 A;  5FY7 A;  4MYE A;  1O5L A;  2I2S A;  4Q4X 2;  5CIR A;  1RUC 2;  2J1R A;  4AED B;  2D3S A;  5J36 A;  4C1X A;  5CG8 A;  1SLT A;  3BGA A;  3ZYJ B;  3ETQ A;  4YZ3 A;  1UMI A;  2V09 A;  1OQ1 A;  3ABZ A;  2VUL A;  5JOY A;  1VR3 A;  2VMD A;  3HR9 A;  4NRQ A;  5FP3 A;  4Q26 A;  1W3V A;  1VBE 3;  3S30 A;  1TME 1;  1AR9 3;  2ETE A;  3ZSE A;  5HXM A;  5A3U A;  1RJ8 A;  1UXX X;  1CAX A;  2FMY A;  2BBA A;  1IZ3 A;  2IUW A;  1RUD 1;  1U5Y A;  2RDS A;  3B9I A;  4WVM A;  2WFF 1;  1OPM A;  1ULO A;  4CCD A;  5A6Y A;  3SCF A;  1DGW X;  2QQV A;  4DOU A;  2QQK A;  1AX2 A;  5F7U A;  2WR9 A;  2XLF A;  3VKN A;  1BBT 1;  4Q4V 2;  3TN9 1;  1CZS A;  1HRI 1;  2TUN A;  4JV4 A;  4XVH A;  4IV3 B;  1NCQ C;  2G1M A;  2P2K A;  4IEV A;  1G8W A;  2YXS A;  4RR3 C;  2VOX A;  1MZ6 A;  3DPR C;  3C7E A;  2AGS A;  3SCH A;  3WDV A;  1Z7S 3;  5DZG A;  4GWI A;  1WLD A;  3E97 A;  2VQT A;  3VBO B;  3AYA A;  3I97 A;  1C8M 1;  2PHU A;  4KG8 A;  2JIJ A;  3WQ7 A;  1AZD A;  1QMJ A;  2RS3 1;  2OVU A;  4K8R B;  2DVA A;  1OA2 A;  2EIG A;  1HJF A;  1KGY A;  1QHD A;  2JDY A;  4QHB A;  1NY7 2;  5E6H A;  1GKB A;  1LHU A;  2ZX1 A;  2WAO A;  3E6C C;  3ENR A;  4YW2 A;  4NIG A;  1YCI A;  3H9A A;  5FYB A;  4IE0 A;  3B7M A;  1ZZ8 A;  1W8Z A;  3DGT A;  3DN7 A;  3FLR A;  5FFO C;  4AW7 A;  3PL0 A;  1D4V B;  2QQN A;  3VV1 A;  3CZU A;  3H7Y A;  4FOY A;  1XNK A;  4FPF A;  5A32 A;  4ARY A;  2PAE A;  1U5X A;  5C6C A;  3O1S A;  1OI6 A;  1A3K A;  2EA7 A;  1V9U 1;  2L9L A;  2OQ7 A;  3ZFF B;  4YVW A;  2XG3 A;  1O59 A;  1GQH A;  2EID A;  1YXW A;  4D7Y A;  4N8M A;  1FOD 2;  4DEQ A;  4KG0 A;  5ISL A;  1VAM A;  2XON A;  4IE7 A;  2HBU A;  4D7S A;  5AC9 3;  4E8C A;  1NY7 1;  3VBU A;  1LEN A;  3ILN A;  4NE9 A;  4AZZ A;  1PGL 2;  4LO8 A;  3WF4 A;  1I6X A;  5FP7 A;  2D6M A;  2OPK A;  4LQR A;  4UW4 A;  4MZU A;  1NYW A;  5CKN A;  4UW5 A;  4QGN A;  2YGM A;  5IK8 A;  3T0D A;  2WZE A;  2DBN A;  2JG8 A;  3I2J A;  1S0G A;  3NJZ A;  3H8U A;  3LEM A;  2W46 A;  3T1L A;  3H3Z A;  4LBL A;  2IVJ A;  4DY3 A;  3H7J A;  2X5I B;  5ACA 1;  5E1R A;  2GC1 A;  2V4A A;  2KXL A;  3NJX A;  4GAL A;  5DUV A;  3WT3 A;  2OUH A;  4BDV B;  5IHR A;  1BBT 2;  2EIB A;  5BV6 A;  4AED C;  4AWD A;  1GZW B;  1G9B A;  2Y6L A;  5FZB A;  1CX1 A;  3UL2 A;  3V0B B;  1KIT A;  4ES8 A;  1K5M B;  2Z69 A;  1OUS A;  2QQL A;  4BQ4 A;  2A3X A;  1ZA4 A;  2XHN A;  3AP5 A;  3FJS A;  5ERL A;  3WW4 A;  1PX4 A;  1GR3 A;  3IWZ A;  3TOJ A;  5F1R A;  4AFD A;  3MEP A;  1HB1 A;  1DQ5 A;  4XF0 A;  4XUQ A;  2E26 A;  2Q8C A;  1YUD A;  5IWF A;  4JGY A;  2W52 A;  1R1Z A;  5IUQ A;  2RS5 3;  1X50 A;  2ET7 A;  4XDQ A;  1VB4 A;  3AZX A;  2VVF A;  5F5I A;  4HSL A;  3BTZ A;  1HXS 3;  3ZPY A;  5SV8 A;  3AP4 A;  2ILM A;  1O3T A;  3KLS A;  2Y6H A;  1UPI A;  2ARB A;  1OVS A;  4CP2 A;  3NV1 A;  3ZYH A;  5HXV A;  3SNM A;  1YFY A;  2JDN A;  2RJK A;  2J22 A;  4XW3 A;  4NWW A;  3EQE A;  2ZTN A;  4Z2A A;  3WP5 A;  4YVW C;  4XIL A;  5JMO A;  3JQW A;  5F2W A;  3WNO A;  2ZKN A;  2Z4F A;  4MVT A;  5I0T A;  2IFW A;  3GHM A;  3I3B A;  3LPG A;  4AI1 A;  1K12 A;  1ZRI A;  1S0J A;  3K3N A;  4OYU A;  2BGC A;  2YU2 A;  1ND3 C;  4ORF A;  3MBW A;  3TBD A;  1AUY A;  1W0N A;  3KCX A;  3QH7 A;  1E5I A;  5CFD C;  1FV2 A;  4R8H A;  5FRE A;  5JI7 A;  1O3Q A;  3OD4 A;  1EPZ A;  4AQ6 A;  5IVV A;  4RGK A;  4BXF A;  4S2F A;  1HB4 A;  3I3E A;  4NUB A;  3RI9 A;  2ZKL A;  4FFI A;  3WDY A;  1J3P A;  3FFQ A;  5EYX A;  3PVB B;  4AED A;  1HDK A;  3VGI A;  4RS5 C;  3LZZ A;  1NCQ A;  1GNH A;  4N9H A;  3KT4 A;  1OH3 A;  1Y43 B;  2BOJ A;  4XAA A;  2HWB 1;  5FZ9 A;  4BQ2 A;  3W21 A;  1ZZB A;  5FZ6 A;  2F17 A;  5F32 A;  1RUD 3;  1RXF A;  3UT0 A;  3WG1 A;  3EO6 A;  2XR4 A;  1BJQ A;  1YC6 1;  2VMF A;  1PK6 B;  1W0O A;  3H1M A;  4XXA A;  1VAL A;  3QD6 A;  1WCU A;  1V6O A;  1OLM A;  4UFI A;  5T5P A;  3ZKY A;  1W90 A;  5GLU A;  5IK4 A;  1QDC A;  2P3J A;  5A7S A;  1DYO A;  1HQL A;  2W87 A;  1M06 G;  2RMU 2;  3KV9 A;  1VLN A;  4IUG A;  4P14 A;  3UKN A;  2J1V A;  4DO0 A;  1EYB A;  4XAB A;  1N1Y A;  4IEW A;  3SKV A;  2A7A A;  3I2O A;  2CAV A;  4NO4 A;  2K2S A;  1STM A;  2GND A;  1SHW B;  3AMM A;  3ECQ A;  4ARX A;  3ZXL A;  3LKJ A;  1CIY A;  3H8X A;  5C3O A;  4YM0 A;  1K5M C;  1YI7 A;  3WQB A;  3AXE A;  1TME 2;  4EWE A;  2J7M A;  2YYO A;  5FZ8 A;  4BLI A;  4Y4Y A;  1E5R A;  1S0E A;  5FRA A;  2XDV A;  5JUV A;  2VPV A;  1COV 3;  1DP0 A;  2GAU A;  5BNN A;  4ZPI A;  1AXY A;  5LWB A;  1W6Q A;  5KXC A;  4X6R B;  1NCR B;  3CNA A;  1EP0 A;  4Y24 A;  3PJY A;  3HOB A;  3OUH A;  4P9J A;  3WW1 A;  2VG9 A;  5A6Z A;  5EV7 A;  1AR7 2;  1GU3 A;  5JI9 A;  4CU7 A;  1O7F A;  3III A;  5GLV A;  1O6U A;  1PO1 3;  4B1L A;  2MEV 2;  3U14 A;  1CVN A;  1NLQ A;  3LDR A;  5JPM B;  4MGS A;  5KWR A;  2YC0 A;  1I1E A;  5K0U B;  2FDH A;  1A8D A;  1SFY A;  4SLI A;  4YVW B;  1MS8 A;  4XFG A;  4CDX C;  1RMU 2;  2EXH A;  1EAH 3;  3V64 A;  4SBV A;  2ORX A;  2X29 A;  2ZBJ A;  2IWG B;  3SC7 X;  3ZN5 A;  4CRQ A;  2WNU C;  4LO7 A;  3BPZ A;  3LQC A;  5DUX A;  5F6K A;  3AXD A;  1FXZ A;  1C5H A;  4LBK A;  1FPN 3;  2D6N A;  1SZB A;  2YRO A;  4I0A A;  4ISR A;  1FV3 A;  1JOJ A;  4Q0U A;  2XB6 C;  1ULC A;  4AAP A;  3AX4 A;  2ZGN A;  3CQO A;  4I09 A;  2R06 2;  5GLW A;  4AI2 A;  4DIQ A;  3LAG A;  3MIF A;  3T2Q A;  1DF0 A;  5JSO A;  1GZ9 A;  1B09 A;  1CZV A;  2FHR A;  2JE8 A;  4AEM A;  2R7E B;  2WQ8 A;  5C5U A;  2RMU 1;  1T6G C;  3VBS A;  3AZV A;  3CLP A;  4XF1 A;  4MX3 A;  4EJR A;  2RM2 1;  5J09 A;  4GUL A;  2VMI A;  5A6X A;  1AX1 A;  1OUX A;  2VMC A;  2YV8 A;  2ZEX A;  3ZXF A;  3LSE A;  1R09 3;  5L9R A;  3ZFG A;  4J1X A;  2B45 X;  4QD2 A;  2NLR A;  3LEG A;  5EQU A;  3UJQ A;  3FUO A;  4Y4R A;  3S5Q A;  4OI2 A;  1W9T A;  3ACF A;  3PJQ A;  3VD5 A;  2ZGK A;  4KBZ A;  5FZC A;  3T3Y A;  1XPW A;  2ZML A;  3IMM A;  1UYP A;  4DUV A;  4RA0 A;  3AFG A;  4YZ2 A;  3TEZ A;  1YJK A;  4JGZ B;  1EY2 A;  2CAU A;  2ZGT A;  5B4X A;  1VBA 3;  4JGY B;  1LES A;  4MAD A;  4LOR A;  3WNL A;  1R09 2;  4FPJ A;  4H55 A;  1XSQ A;  1CAV A;  3N9N A;  3K77 A;  4DXS A;  1RVF 3;  5DDJ 1;  3WUC A;  2O14 A;  3NV4 A;  3ACI A;  1GQP A;  1SQ4 A;  3D6E A;  1GFF 2;  3U4X A;  3NNJ A;  1KEX A;  2LUW A;  1SFN A;  2OS2 A;  2R0H A;  2WLQ A;  2ES3 A;  3JD7 1;  4V1P A;  1OHF A;  5HPO A;  2YHJ A;  2JG8 C;  2WNE A;  2R06 3;  3AKS A;  3KV4 A;  5ACA 2;  4XYX A;  3UNP A;  4HKL A;  4S2D A;  2B5H A;  3PUA A;  4XEZ A;  3WDT A;  5A33 A;  2RR1 2;  2W1Q A;  4Y1Y A;  3RGB A;  1XYN A;  3ZMO A;  5CZK A;  4S2H A;  2ADE A;  2JG9 A;  2P3Y A;  1WA6 X;  3RS6 A;  1BEV 2;  4XBL A;  4WM7 B;  1EAH 2;  1PVC 1;  3A22 A;  3ZOI A;  3MIE A;  4LKE A;  5FYT A;  3GGL A;  3ZIX A;  2QQU A;  3O12 A;  4M4R A;  2WAB A;  4Q4W 1;  1K45 A;  3GCW A;  2R07 1;  4LO5 B;  1LUL A;  1V9U 2;  4PI0 A;  4DUX A;  1I9R A;  5K0U C;  3OTF A;  3KS7 A;  4H14 A;  4PHZ A;  3SLI A;  3NMB A;  2ZEW A;  3HEI A;  1LEC A;  2GP3 A;  1YRZ A;  1UQX A;  4LO4 B;  2VCM A;  3TNQ A;  4C91 A;  3ZLI A;  3WVJ A;  2HWD 3;  3A21 A;  3ZXK A;  4XTM A;  5JLV A;  1LJ7 A;  3N7J A;  4HXC A;  1D2Q A;  4KWU A;  4QPI C;  3SEE A;  2XQX A;  2VM9 A;  3QAC A;  4LPL A;  1ZRE A;  3ORJ A;  2XXZ A;  2R6Q A;  2ZPX A;  2ZZJ A;  3INA A;  1MR5 A;  4JDN A;  4XMI A;  4LBJ A;  4BIF A;  4CEW A;  1OFS A;  2WC2 A;  1Y3T A;  2R1B A;  1PIV 1;  3FX3 A;  4L99 A;  4ZU4 A;  3VHP A;  4Y26 A;  5JPN B;  1XE8 A;  5FPX A;  1K42 A;  2XWB B;  1ZNP A;  3N9P A;  2CYF A;  2FBE A;  1VPH A;  3D3A A;  4XFH A;  4WVV A;  1W6O B;  3KV6 A;  4OUM A;  1UN1 A;  5TSW A;  5IAX A;  2R30 A;  2NPI A;  2B4K A;  2LM3 A;  4XIO A;  3RVH A;  1RUO A;  1POV 0;  3CZJ A;  4URT A;  2C4X A;  4A4A A;  2WS9 2;  4EYU A;  5I8T A;  4PLM A;  3O1M A;  2RMU 3;  5L36 A;  3I59 A;  4Q4V 1;  3FC0 A;  2BNO A;  3THC A;  1KJR A;  4BPZ A;  3C7G A;  1NXD 1;  3ACH A;  3K48 A;  2PA7 A;  4A44 A;  1DG6 A;  2YDE A;  3ZXE A;  1SG3 A;  5LBC A;  4K8F A;  1RXG A;  3J26 N;  3WG3 A;  1RUD 2;  5CAD A;  1S0B A;  4JGZ C;  1ULG A;  4JKM A;  2WO2 A;  5CAZ A;  2PHD A;  4AHW A;  1FMD 3;  5FYU A;  1FI2 A;  1T6B X;  5FYI A;  5FKB A;  4AI0 A;  3KT7 A;  4PIY A;  2VMG A;  5C8C A;  1W2O A;  2ADD A;  5J3U A;  4EN8 B;  1DYK A;  1UCX A;  2Z79 A;  2I74 A;  3MIC A;  3M3E A;  4NWV A;  1HRV 3;  3AFK A;  1Y9Q A;  1CWP A;  4GZ9 A;  3BOW A;  2VR4 A;  3GXU A;  2P17 A;  2ZX2 A;  4K3U A;  4MH0 E;  1Q56 A;  5EZW A;  4DMI A;  1LOG A;  4K40 A;  4QXH A;  1VRH 1;  4W65 A;  4A41 A;  2W5F A;  1F2N A;  5SV5 A;  2HWB 3;  3NVC A;  3PUS A;  3ZN6 A;  5H9Q A;  2XJQ A;  3IB3 A;  1NCR A;  2RS3 2;  3PVN A;  5EJZ B;  2W39 A;  3HNB M;  3DCQ A;  2WIN B;  5FPV A;  3I2D A;  3SQO A;  4YLZ A;  3KV5 A;  4IEP A;  2CGN A;  2QQW A;  3P5B A;  2HWC 3;  2CY6 A;  2VZO A;  5EYY A;  3LGR A;  4GKX A;  3R0R A;  4LA3 A;  1I5Z A;  1VBE 1;  2GP5 A;  1HRI 2;  1GNZ A;  5FIX A;  3USU B;  2VNV A;  2EF6 A;  4KWJ A;  2LRP A;  4QM8 A;  1JS9 A;  2VZU A;  5KHH A;  5FZD A;  1LAJ A;  4UBH A;  2D6L X;  2R16 A;  2D93 A;  1POV 3;  3WV6 A;  4K1Z A;  4CP1 A;  2O8Q A;  2XWJ B;  1Z7S 1;  2E33 A;  4TLG A;  4XDO A;  1UZY A;  2EIE A;  5FPB A;  2A73 B;  4QPW A;  3PTY A;  5FUI A;  4QPI B;  3OGR A;  1QGL A;  4HN0 A;  4QX7 A;  2YPJ A;  4YW1 A;  3RWN A;  3SH5 A;  4AFC A;  2DTW A;  4CDW B;  1Q8Q A;  3N7L A;  3M4F A;  1GYK A;  4EZ4 A;  4RFR B;  2W1S A;  3E1F 1;  2PN5 A;  3PIJ A;  2ZX4 A;  3VBH C;  2IVI B;  4CE8 A;  4MV2 A;  5CVR A;  1RUC 1;  3R05 A;  3KM5 A;  4Y5S A;  1BLZ A;  4BB3 A;  5CG9 A;  3DUI A;  3I2I A;  1S0F A;  1WMF A;  1AR6 2;  4CXX A;  3FFZ A;  3H50 A;  2HWF 3;  2VQA A;  1RB8 G;  2D6P A;  4D7T A;  2WA4 A;  1LOA A;  4V2W A;  4R9C A;  1JN2 P;  2YG0 A;  5F5Q A;  1C1L A;  3MDP A;  4ONU A;  3MIH A;  4WM8 C;  4HVO A;  4IV1 B;  1H1M A;  2IXL A;  3NKT A;  4A42 A;  4Q8K A;  2W47 A;  2F4L A;  2FDI A;  2V5Y A;  2ZHN A;  4Q0V A;  2B7Y A;  1GIC A;  2RS1 3;  1ENR A;  4KBB A;  4C90 A;  3VZO A;  3BKZ A;  5FQ0 B;  2GNM A;  5GZG A;  4CP9 B;  4CCM A;  3T30 A;  4QX1 A;  1QXR A;  1PMJ X;  4PIZ A;  4JCK A;  3WP3 A;  4M4P A;  3J9S A;  3OEB A;  3I3D A;  4ZY9 A;  1ND3 B;  4OMD A;  3WHT A;  3AMP A;  4Z1V A;  5EJ1 B;  3T0A A;  1O5U A;  5DAW A;  1LED A;  2IXC A;  5DZF A;  4FQ4 A;  4UI9 L;  1WME A;  1XJA A;  4Y1X A;  1IQD C;  4NOT A;  3PVE A;  1IQA A;  1B35 C;  3APB A;  3JQX A;  4FFF A;  3DEC A;  2FZ2 A;  1GBG A;  2VC9 A;  5HI0 A;  4K20 A;  4B4R A;  1XOY A;  5KBF A;  5GLT A;  1NG0 A;  1OA3 A;  2LRO A;  1OOP B;  4HPK B;  4WM7 A;  3H3U A;  4N90 A;  3AVR A;  3GAL A;  4COY A;  1X8M A;  1GQG A;  3WX5 A;  2PAK A;  1HV1 A;  5CKM A;  1LOC A;  2RJ2 A;  5J48 A;  5FOJ B;  2A70 A;  4WVW A;  1WLC A;  3HNM A;  5C4W B;  1I5P A;  5D8A B;  5FZM A;  1RUI 1;  2K0G A;  1GWM A;  3PU8 A;  1CGP A;  4CDU B;  3VDB A;  1LRH A;  1RUE 1;  3JCI A;  5C3R A;  5FZ0 A;  4HKW A;  2GU9 A;  3PME A;  3OB8 A;  1DQ1 A;  2QCS B;  4I0B A;  2WYS A;  4QGM A;  4QB1 A;  1V6K A;  2AC1 A;  1NXM A;  4Z8B A;  2BVV A;  2GMP A;  2B9U A;  5JZG A;  4BYY A;  5CFC B;  2VGD A;  1RYY A;  4QX3 A;  1AVB A;  1XNT A;  1US2 A;  1UIJ A;  1W2U A;  4JKK A;  2XJP A;  4CDW C;  2YC4 A;  1HJG A;  1YWK A;  3OEA A;  1GSL A;  2TBV A;  3AVS A;  4JKL A;  5BXX A;  2GC3 A;  2WSV A;  2DF7 A;  2XJT A;  5FZE A;  5ACA 3;  2TNF A;  4JGZ A;  3AZY A;  4GMP 1;  1DQ2 A;  2DCZ A;  2A6Z A;  1W6N B;  1XBF A;  1CJP A;  1QH6 A;  2X8K A;  4BIO A;  1S4C A;  5FPU A;  2BU9 A;  1SPP B;  1KFU L;  1NKG A;  3NKG A;  3RPQ A;  3VHN A;  3PUQ A;  4Y20 A;  5EP9 A;  4Q4Y 1;  5FY4 A;  3HPN A;  1MEC 1;  1VBC 3;  4QXK A;  5LCW L;  1R08 3;  3O1P A;  3I3M A;  3N9Q A;  4AGG A;  1YLL A;  4FI9 A;  1L7Q A;  2KD7 A;  1O4T A;  5A6Q A;  1CES A;  4E8D A;  3J4U H;  3JUU A;  4RL7 A;  4EN9 B;  2G4I A;  4AF9 A;  2XL9 A;  3AL5 A;  5ANQ A;  1RIT A;  2PTM A;  2RVA A;  2W0X A;  2YFZ A;  1PGW 2;  5FV3 A;  3GJB A;  4LBN A;  5H9R A;  5LK5 A;  4FBF A;  2HWC 1;  4ZU7 A;  2JDA A;  1FPN 2;  1MS5 A;  1X7N A;  4KH9 A;  3ZSK A;  2NMO A;  3MLL A;  4NHX A;  3WDX A;  4YFZ A;  3KMH A;  4ZS3 A;  4PF1 A;  3U4S A;  2B46 X;  3V0B A;  1O3S A;  1PO2 3;  4RHV 3;  3OBR A;  4ZHN A;  3TEY A;  2VVE A;  2JDZ A;  5A3T A;  4YM2 A;  1S55 A;  5LAT A;  4RGG A;  4YZ1 A;  4PT6 A;  5HBA A;  3OF1 A;  1R1A 2;  1GP4 A;  5C9A C;  2ZGM A;  4QDR A;  2JJ6 A;  3BTX A;  3T0B A;  4HSJ A;  3VHR A;  1GWL A;  1W9F A;  3O1O A;  4BHP A;  1VBB 2;  2CSG A;  4JDO A;  4UFM A;  2XVG A;  1JU4 A;  1LNS A;  5DAV A;  4MGY E;  2RDN A;  1HIX A;  2WWS A;  4EWA A;  2QQI A;  2XBO 3;  1IG3 A;  1QDO A;  4OCT A;  2O0O A;  2A6Y A;  2V73 A;  2VOK A;  4R9B A;  5LRR A;  4JAA A;  4D6R A;  1JYT A;  5HV4 A;  2Y6K A;  2Q1Z B;  3T2T A;  5A7W B;  1W06 A;  3NAP A;  2A5Z A;  1YFX A;  4W50 A;  1WLW A;  2WT0 A;  3C8X A;  1W0P A;  3T2O A;  3ZXD A;  2WWU A;  2VZQ A;  3N9M A;  4RGA A;  2GDF A;  1L7L A;  1ZRC A;  3GJA A;  3VBF C;  1Q3E A;  1ZRF A;  1AR8 1;  1N1T A;  2D6O X;  1LOB A;  4IV1 A;  1O8P A;  1UOB A;  1PO1 1;  1QJU 2;  3O0V A;  2Y6F A;  2HYK A;  4IDZ A;  4QX0 A;  4AEK A;  4CCE A;  2OYZ A;  2D7F A;  2E31 A;  1D0H A;  1G86 A;  5FQ0 A;  1UWW A;  1WUV A;  2Y64 A;  3SKJ E;  5BNO B;  5F3I A;  4P5H A;  5APA A;  1NT0 A;  2BWC A;  2KM2 A;  3ILR A;  4QWN A;  2XH6 A;  3RQ0 A;  1LU1 A;  1S2K A;  4M0H A;  4NHK A;  2FMD A;  3ZKU A;  1OQE A;  4IEO A;  5I0S A;  5LEK A;  1L7R A;  3HT1 A;  3TEW A;  4CTE A;  4LA2 A;  4JRA A;  4XF9 A;  2C1F A;  3CKH A;  2VD7 A;  1SBE A;  3S0M A;  1YQC A;  1F5J A;  1REE A; 
#chains in the Genus database with same CATH homology
 2VZ3 A;  2BGP A;  3ETP A;  1W8O A;  5I0D A;  1DYO A;  2W87 A;  4MO3 M;  4P5Y A;  4IUG A;  3ZM8 A;  3VD4 A;  2J1V A;  3SKV A;  4ZZ8 A;  4P08 A;  2DCK A;  5C7G A;  1XC6 A;  2WAA A;  2OKX A;  1SHW B;  4ARX A;  3ECQ A;  3CDZ B;  1CIY A;  3HNY M;  2QBX A;  3VD9 A;  1H6X A;  3K46 A;  3WQB A;  3WF3 A;  2J7M A;  1UMH A;  2WO3 A;  3MUZ 1;  4D8M A;  2W9X A;  2YB7 A;  5B4N A;  5JUV A;  4GWJ A;  3I2H A;  1DP0 A;  3WF0 A;  4DEV A;  3HOB A;  3A23 A;  2VCC A;  1GU3 A;  3P1I A;  4A6O A;  3LE0 A;  4CU7 A;  3III A;  3MV0 1;  3HJR A;  3VDC A;  1UYX A;  3NRU A;  4MGS A;  3UES A;  5JXI A;  2ORX A;  1XNA A;  4XUR A;  1UZ0 A;  2VQU A;  3IAP A;  3LQC A;  4OMC A;  1TVG A;  4QDS A;  3WNM A;  1JZ4 A;  2C26 A;  3CQO A;  3T2Q A;  1MPX A;  4CU6 A;  2ZXQ A;  2HLE A;  3PUI A;  1CZV A;  4HG6 B;  4ZZ5 A;  2JE8 A;  2R7E B;  2WQ8 A;  4AG4 A;  5LA1 A;  1P8J A;  3T2P A;  4CUA A;  3DYO A;  2ZEX A;  2VMC A;  2VJX A;  2VZS A;  3MUY 1;  2PQS A;  2RV9 A;  1JZ7 A;  3LEG A;  4QB6 A;  3VD7 A;  1W9T A;  3ACF A;  4W4Z A;  5LA2 A;  3VD5 A;  4UAP A;  2XOM A;  2V72 A;  2VO5 A;  1XPW A;  4DUV A;  5DQ0 A;  2WN2 A;  2W91 A;  1JZ5 A;  4UOJ A;  4MAD A;  1JZ8 A;  1JYW A;  3WNL A;  5JR2 A;  2ORZ A;  5DN2 A;  3WSO A;  3K77 A;  4DXS A;  1GUI A;  3ACI A;  2LS6 A;  1GQP A;  2WO1 A;  4RN5 A;  1KEX A;  5HPO A;  1JYN A;  3ACG A;  1K3I A;  1W9S A;  3WNP A;  3UNP A;  5CYY A;  1UXZ A;  2W1Q A;  3BN6 A;  5IJR A;  4RYD A;  3THD A;  3K4Z A;  5CZK A;  4AAX A;  2WDB A;  3C7O A;  2QQM A;  4CUC A;  4YPJ A;  2V5D A;  2DCJ A;  3A22 A;  1NUK A;  3GGL A;  4M4R A;  4P00 B;  2WAB A;  2VCB A;  1K45 A;  4QDQ A;  2J1S A;  2E32 A;  2VZP A;  2VZT A;  3PUH A;  3CIH A;  4DUX A;  4QX2 A;  4XUT A;  2X05 A;  4JHZ A;  3VDA A;  2ZEW A;  3HEI A;  1US3 A;  2VOT A;  1GOG A;  2W1U A;  3LEK A;  3WF1 A;  3A21 A;  2W3J A;  1UY0 A;  1JYV A;  4KWU A;  3SEE A;  2XQX A;  5IYY A;  2VM9 A;  3J7H A;  4LPL A;  4CUB A;  1UY4 A;  1WCQ A;  5B4X A;  1JZ6 A;  2EIC A;  1K42 A;  3FL7 A;  2WZ8 A;  3D3A A;  4XUN A;  3C7H A;  1UX7 A;  2BER A;  2W95 A;  3DYM A;  1DLC A;  2B4K A;  3CZJ A;  4ZXE A;  4BK4 A;  2C4X A;  4A4A A;  1PX3 A;  1JYX A;  4QB2 A;  4XZU G;  3I2K A;  1EUT A;  3THC A;  3I2F A;  3C7G A;  3ACH A;  5J1X A;  4A44 A;  3HN3 A;  1SG3 A;  2W92 A;  3IAQ A;  1OT5 A;  3W5N A;  3CMG A;  3FHA A;  4JKM A;  2WO2 A;  4CVU A;  1GOH A;  1UYZ A;  2W1W A;  4L0P A;  2WUH A;  3GM8 A;  4GZ9 A;  5DPN A;  5G04 L;  2VR4 A;  3P6B A;  3GXU A;  3MV1 1;  1J84 A;  4A41 A;  2W5F A;  5IFP A;  2YFU A;  1O8S A;  2VZR A;  3IB3 A;  5EJZ B;  3HNB M;  3T08 A;  4DUW A;  4LKS A;  1GOF A;  3AC0 A;  2VME A;  4DXT A;  2QQJ A;  2DDU A;  3W5M A;  1JI6 A;  2VZO A;  1UYY A;  3JXS A;  3OG2 A;  1EUU A;  3NJV A;  4MOA A;  4LHS A;  5EIY B;  4A45 A;  2QQO A;  3I2G A;  2VZU A;  4KMQ A;  1F4A A;  3LEI A;  1NAE A;  3F2Z A;  3OBA A;  2E33 A;  2JD9 A;  5G05 L;  1R64 A;  2EIE A;  4QPW A;  5FUI A;  3OGR A;  3NNG A;  1UY1 A;  2W1S A;  3E1F 1;  5JXJ A;  4CU9 A;  2VTF A;  3K4A A;  2V4V A;  4CU8 A;  4A3Z A;  4TXW A;  3OGV A;  2CDO A;  1OF3 A;  1JHJ A;  1JU3 A;  3I2I A;  1W9W A;  2C9K A;  2VZ1 A;  5DMY A;  2ZEZ A;  3NQH A;  1ULP A;  2WN3 A;  5C70 A;  2ID4 A;  2YG0 A;  3FN9 A;  4OZO A;  2HYX A;  4A42 A;  2W47 A;  4XUP A;  4BK5 A;  3T09 A;  3K75 B;  2J1R A;  4QAW A;  4QX1 A;  3BGA A;  1PMJ X;  1UMI A;  3FHQ A;  4M4P A;  4ZY9 A;  3ABZ A;  3I3D A;  3OEB A;  4OMD A;  4BXS V;  2VMD A;  1OD3 A;  5EJ1 B;  3T0A A;  3OGS A;  5HXM A;  4TTG A;  1W8N A;  1TG7 A;  1UXX X;  4UI9 L;  2BBA A;  3SEP A;  1IQD C;  2W94 A;  1BHG A;  1ULO A;  5JXG A;  3DEC A;  1JZ3 A;  2VC9 A;  4MGQ A;  2QQK A;  5F7U A;  1UY2 A;  2J1T A;  4KI5 M;  1CZS A;  4XVH A;  4DXR A;  3WNK A;  3C7E A;  2RJ2 A;  1CZT A;  4PQQ A;  4GWI A;  3HNM A;  1I5P A;  2VQT A;  1SDD B;  3I97 A;  2B9V A;  3WF2 A;  3VDB A;  1KGY A;  1W99 A;  2BGO A;  2WAO A;  3OB8 A;  2WYS A;  4QB1 A;  2J1E A;  2VCA A;  2QQN A;  1RYY A;  3CZU A;  4QX3 A;  1US2 A;  1XNT A;  4ARY A;  4JKK A;  5LA0 A;  1GMM A;  2YC4 A;  3OEA A;  3IDA A;  2L9L A;  4JKL A;  1O59 A;  2Y6G A;  2EID A;  4DEQ A;  2VL4 A;  2XON A;  1OH4 A;  4E8C A;  1NKG A;  3WF4 A;  4LQR A;  3A7Q A;  3GDB A;  2BZD A;  3WNN A;  1F4H A;  2Y8K A;  3DYP A;  3T0D A;  2WZE A;  3I2J A;  3HPN A;  5LCW L;  2W46 A;  4FI9 A;  1H6Y A;  1L7Q A;  2KD7 A;  4E8D A;  1J83 A;  2X10 A;  2J1U A;  3NJX A;  4BDV B;  4JX0 A;  5IHR A;  2EIB A;  2RVA A;  4W8J A;  2YFZ A;  1CX1 A;  2Y6L A;  3EYP A;  1UY3 A;  2JDA A;  3K4D A;  1HN1 A;  2QQL A;  4PF1 A;  2XHN A;  1YQ2 A;  1PX4 A;  1GNY A;  2CDP A;  4XUQ A;  4PT6 A;  2E26 A;  1PMH X;  4XUO A;  1WKY A;  4QDR A;  3T0B A;  2X09 A;  3WEZ A;  5A1A A;  2J1A A;  1JU4 A;  1LNS A;  2Y6H A;  4D0Q A;  2Y6J A;  2QQI A;  4BJ0 A;  2J22 A;  2WBK A;  1OF4 A;  4Z2A A;  5JMO A;  3WNO A;  2Y6K A;  2Z4F A;  1JZ2 A;  3EB7 A;  3I3B A;  4W50 A;  3LPG A;  3C8X A;  3T2O A;  1K12 A;  2LW8 A;  4OYU A;  2ZEY A;  3MBW A;  2VZQ A;  3LPF A;  1W0N A;  3U37 A;  1O8P A;  4OUE A;  3UET A;  4QX0 A;  3C7F A;  3I3E A;  2E31 A;  1NX9 A;  1UWW A;  2Y64 A;  3SKJ E;  5JXH A;  5C71 A;  3MO4 A;  3VD3 A;  1T2X A;  5IFT A;  4ET7 A;  2YC2 A;  2VZV A;  1L7R A;  1D7P M;  2VMF A;  2JKX A;  3CKH A;  4P02 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...