2VZPA

Atomic resolution structure of the c-terminal cbm35 from amycolatopsis orientalis exo-chitosanase csxa
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
126
structure length
126
Chain Sequence
b'DPVDYQAEDATIVQGAVESNHAGYTGTGFVNYDNVAGSSVEWTVTVPSAGTYDVVVRYANGTTTSRPLDFSVNGSISASGVAFGSTGTWPAWTTKTVRVTLAAGVNKIKAVATTANGGPNVDKITL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 26
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzpA00
1UWWA 3FL7A 4MGSA 2VMEA 3I3EA 3GM8A 2ZEYA 4LKSA 1JZ3A 2ID4A 4CUAA 1OD3A 3C7EA 4OZOA 4ZY9A 3VDBA 3A21A 4KMQA 2WAOA 2BZDA 3IAQA 3CZJA 2VZRA 5LA2A 4AAXA 1RYYA 3E1F1 1GOHA 1US2A 2WQ8A 1XC6A 4HG6B 4A4AA 3I2IA 3ACIA 1UX7A 3CIHA 1JYXA 3NJXA 1D7PM 1O8SA 4P00B 1GNYA 2J1AA 3WNLA 1NAEA 3DYMA 4ZZ5A 3AC0A 4RYDA 5HPOA 4A6OA 2W3JA 2DCKA 2VZ3A 2W5FA 5FUIA 3A23A 3K46A 4QX0A 1SG3A 3CZUA 3J7HA 3IB3A 2PQSA 4ZXEA 2JE8A 4CVUA 2C9KA 4IUGA 3OB8A 4KI5M 3WF4A 2J1TA 3OGRA 5EJ1B 2YC4A 3DYOA 1TG7A 1W8OA 3OEAA 1UXZA 4OMCA 1JU4A 4QDQA 2VCAA 4W50A 2B4KA 4AG4A 1SHWB 2VO5A 1IQDC 1JI6A 1WCQA 4DEQA 2Y64A 4ARXA 1H6XA 1UMHA 2W92A 5J1XA 1PX3A 3ETPA 2ZEWA 2J22A 2Y8KA 1O59A 2W1UA 5IYYA 2QQIA 4QPWA 4QX1A 3FHQA 3VD5A 3T08A 2VQTA 2VQUA 2R7EB 2XONA 2C4XA 3A7QA 2WDBA 5G04L 2W1SA 2VMDA 1F4HA 4MGQA 1UXXX 4XUQA 3C7GA 3MV11 3C7HA 1W9WA 3LPGA 4JHZA 3WEZA 3VD9A 3ACGA 4ZZ8A 2YFZA 1DLCA 5C7GA 4XVHA 3FN9A 2X05A 4E8CA 5JXIA 2Z4FA 3PUIA 2HLEA 1UYZA 2Y6LA 5DN2A 1WKYA 2WN2A 1JHJA 2Y6GA 2WO2A 5DQ0A 4BJ0A 4MOAA 2KD7A 4QB1A 2Y6HA 4XUNA 2E33A 2EICA 1F4AA 3MBWA 4PQQA 3SEPA 4DEVA 4BDVB 3VD4A 2W9XA 3C7OA 1KEXA 2WBKA 2QQJA 1DYOA 1XNAA 2C26A 3OGVA 3W5MA 5CYYA 2L9LA 4OMDA 1J84A 3A22A 2QQMA 4QB2A 3P6BA 3VDCA 3WNOA 1BHGA 5C70A 2RJ2A 4W4ZA 3T09A 4CU7A 4JX0A 4QX2A 4A42A 3WF0A 1GQPA 3K4DA 3BN6A 3WSOA 3HNBM 2W46A 3THCA 2CDPA 1JZ5A 4A3ZA 1OH4A 1ULOA 1UY1A 2W95A 3I3DA 3C8XA 1JZ7A 1UMIA 3SKVA 5IFPA 1DP0A 2WN3A 2W91A 3I2HA 3LPFA 1PMHX 2YFUA 1HN1A 3MUZ1 2W94A 1W9SA 3I97A 4BXSV 1J83A 1UZ0A 4CU6A 3WNKA 5B4NA 2ORXA 3WF2A 3GGLA 5A1AA 3DECA 2VZUA 3D3AA 1OT5A 3I2FA 3K4AA 1UY0A 2WAAA 2BGPA 3SEEA 2V5DA 5JMOA 4CUCA 2QQLA 2W1QA 1UY3A 1SDDB 3MO4A 1CZTA 2V4VA 1JU3A 3CDZB 4QAWA 1I5PA 4P08A 2X10A 1K3IA 2EIEA 2WZEA 3IDAA 1JYNA 3WNPA 3LEGA 2QQOA 2VC9A 3P1IA 1XNTA 4DXTA 4D8MA 4DUXA 3F2ZA 1PX4A 2DCJA 2VZVA 1H6YA 1GU3A 1JYVA 4DUVA 5LCWL 1MPXA 3ABZA 4QB6A 2ORZA 1JYWA 5B4XA 4TXWA 3WF3A 4DXRA 3VDAA 1W0NA 4GWJA 4W8JA 3IAPA 3K77A 4BK4A 2QQNA 5F7UA 4L0PA 3FHAA 4MADA 2WABA 3ZM8A 1OF4A 4P5YA 3HPNA 4DXSA 4QDSA 4QX3A 3GXUA 3VD3A 3WNMA 1JZ4A 5HXMA 2ZEXA 1GOFA 2VM9A 3T2OA 2YC2A 2ZXQA 3T2QA 5C71A 1K45A 3JXSA 5EIYB 2WO1A 4M4PA 3W5NA 1TVGA 2J1EA 2VMCA 2WO3A 4A41A 2BBAA 2CDOA 2EIBA 2YG0A 4GWIA 5EJZB 2OKXA 3NJVA 3CMGA 5DPNA 3K75B 3NNGA 5CZKA 2XHNA 3WF1A 3SKJE 5IHRA 2J7MA 4MO3M 2VJXA 2VR4A 1NX9A 2VZQA 1W99A 5JXGA 5I0DA 3EB7A 2BGOA 1NKGA 1ULPA 1JZ6A 3LQCA 3GDBA 4LHSA 3CQOA 3OEBA 4JKKA 2VL4A 4E8DA 1XPWA 1CZVA 4DUWA 1CIYA 1UYYA 1R64A 2W47A 1CX1A 3NQHA 2RV9A 4LQRA 2VZOA 2VCCA 4UAPA 3LEKA 2VTFA 1K12A 2E31A 2JDAA 2V72A 4GZ9A 3DYPA 3HEIA 4XURA 2VZPA 4D0QA 2DDUA 3WQBA 2VOTA 2VCBA 1UY2A 3T0AA 5G05L 1O8PA 4FI9A 5JR2A 1JZ8A 1UYXA 2XQXA 4JKLA 2Y6JA 4OUEA 4UOJA 4PT6A 3I2GA 3T2PA 3T0DA 2QQKA 3EYPA 3PUHA 1L7RA 1W8NA 3UETA 3NRUA 4XUOA 3ACHA 4KWUA 1UY4A 2JKXA 3OG2A 2WYSA 2B9VA 4A45A 3BGAA 1OF3A 2JD9A 4TTGA 1CZSA 2BERA 4BK5A 3LEIA 3ECQA 3ACFA 2EIDA 3CKHA 5LA1A 3C7FA 3WNNA 1EUTA 3HOBA 1JZ2A 1W9TA 1GOGA 3U37A 4JKMA 5DMYA 5LA0A 2Y6KA 3K4ZA 1GUIA 3VD7A 4QDRA 1PMJX 4XZUG 1L7QA 1EUUA 1P8JA 2HYXA 3OBAA 4M4RA 5JXHA 2VZTA 3T0BA 4A44A 3I2JA 4CU9A 2W1WA 2WZ8A 4P02B 2WUHA 1KGYA 2XOMA 4ET7A 3LE0A 4Z2AA 5IJRA 4CUBA 2J1SA 3IIIA 2ZEZA 4ARYA 1T2XA 3OGSA 2YB7A 4XUPA 2QBXA 3THDA 5JXJA 2E26A 3HN3A 3MUY1 4LPLA 3HJRA 5JUVA 1NUKA 2X09A 4CU8A 1GMMA 3I2KA 1US3A 5IFTA 2VMFA 1K42A 2RVAA 4UI9L 3HNYM 4YPJA 2E32A 2VZSA 2LW8A 4RN5A 4XUTA 3UNPA 3HNMA 1LNSA 1YQ2A 2VZ1A 4PF1A 2J1RA 2LS6A 3UESA 3MV01 2J1VA 2W87A 3I3BA 2J1UA 4OYUA
chains in the Genus database with same CATH superfamily
1UWWA 3DEMA 1V00A 1JXNA 4RR3C 2ZABA 4P9WA 1S55A 1VAVA 3W21A 1RUI2 1ZVFA 3O1SA 1S2BA 3NO8A 1BK1A 1ZZCA 5I93A 2VD7A 2NN8A 4CUAA 3AJYA 4OZOA 5T5LA 3DUIA 3A21A 2RDQA 3POSA 4KMQA 1W90A 3I54A 2WFF3 1EPZA 3R4UA 4OQ9A 4GKXA 4LHKA 3ZFEB 4AAXA 5L73A 1QQP3 2PTMA 4QX7A 3N4MA 1HRI3 1XC6A 4A4AA 2HEYF 1Q8VA 4Q8KA 2DFCA 3P3PA 4D6SA 1D7PM 1V6MA 4AOCA 4G9SB 5C5TA 1JHNA 2UYBA 1SLAA 1VAMA 3CEWA 5BNNA 5KC6A 5JOXA 1O4TA 1QF3A 3IPVB 1W28A 4EN6B 2WT2A 4QPIC 1EP0A 3AC0A 4ZZ5A 3Q8EA 2W5FA 2R072 2ZX3A 2NZ9A 2IZWA 1XNDA 4QX0A 4LE3A 1SG3A 2Q1ZB 2UURA 3I59B 5A7PA 1URXA 2P4EA 2Z69A 4XOGA 1ZBA2 5A3WA 5C3QA 1OA3A 1QIQA 3OB8A 4BQYA 1Y9QA 2A6YA 3CL1A 1NCRB 2HWD3 2ZGTA 4GAZA 3WVJA 3H8RA 1IS6A 5FJHA 3OGRA 1Y3TA 1LOBA 2WFF1 3AJZA 5GZFA 1OKQA 4URAA 4HONA 4X8NA 4ZU7A 2E7QA 3QCWA 5LK5A 5AFBA 3OEAA 4XDQA 1QQP1 4YZ5A 4FXGB 1HRI1 1OLMA 3PU8A 1CAXB 4K8FA 4IEOA 4NRQA 1CESA 4OMCA 3CHXA 3N9PA 4QDQA 4C0HA 2WNVA 4Q4Y2 1IG0A 2VCAA 2DTYA 1SHWB 3ES4A 1JI6A 1VBB2 3CU7A 4RGKA 5F1RA 1AL23 4ARXA 1FX5A 1ZRIA 3WCSA 2WLPA 3FC0A 4UF0A 2W92A 4AHYA 4RQPC 1LKNA 1OLQA 1C4RA 1PX3A 3EXUA 4Y26A 5LBBA 3H3UA 2YPJA 4AFCA 5D8AA 4BE3A 2QCSB 4AEJA 1SFPA 2W1UA 1LOFC 1LGBA 2QQIA 5F6KA 1YQ5A 4L2NA 4QPWA 3FHQA 3N9NA 3O14A 4YVSC 3T08A 1GANA 2P5BA 4OCTA 1HRV2 3BALA 2C1FA 2JG9C 1UKGA 3A7QA 4NIGA 2GP3A 1D2SA 2NYYA 2VXJA 5FZBA 1K5MB 2JEMA 1D4M3 5E88A 1G9DA 2GSYA 1XYNA 1WW4A 2VMDA 2YUEA 3NNFA 2PELA 4TZDA 3E5QA 2IVJA 1W0PA 1IQAA 5ACA2 4I01A 2B8MA 4HETA 5H9PA 3RSJA 4YW7A 3L9JT 4AVVA 3FLRA 3WQ1A 1AL21 5FWEA 3LPGA 3AYAA 4JHZA 3WEZA 1HLCA 2D97A 3KQ4B 4UT5A 1G8WA 1AYN2 3P5BA 3CJXA 1IS5A 4IQPA 4LO7A 3PUIA 2HLEA 4FPKA 4MXWA 4QQPA 4QU1A 2Y6GA 2WO2A 1GZWB 1SLCA 3JD71 3POYA 5BNOC 2BUKA 5FPVA 4XUNA 2EICA 1F4AA 3B9IA 3B02A 4MGZE 4DEVA 3AKSA 3RYKA 2EXHA 1KD7A 1HJFA 1H8VA 1POV1 3OGVA 4YGBA 3W5MA 4ZU4A 5CYYA 3B5LB 4I09A 2L9LA 1CQ9A 4KBZA 5FYSA 1LB2A 4F7ZA 2D6NA 1LOAA 1UO9A 2Q8EA 1BQPA 5FZ1A 2BV4A 2VVDA 5HCFA 2EALA 1TMF2 2MEV2 2UU8A 3A4UA 3ZDVA 3WNOA 3B3QE 5EYXA 3BKZA 3T09A 5HV4A 1VPHA 3RGBA 2W52A 2YBPA 1TZOA 4FP3A 4CU7A 2G1MA 5A7NA 3WP5A 3VBFC 2VNRA 4WVZA 4PLMA 2EAKA 5FAXA 2GNMA 1ST8A 3HNBM 1AXKA 4KNCA 1OFNA 2R043 1VRH3 1JZ5A 2RG4A 2ZMNA 1C8M3 3ASIA 3FJSA 4B1MA 2NP0A 1ZZ8A 3AKRA 2R063 1SBEA 4I0WB 4CEYC 4ES9A 5A1FA 3AP5A 1JZ7A 3I2OA 1GKBA 4XETA 5JOYA 3ZOIA 1OUXA 2AREA 3BUCA 3AKTA 1PGSA 1QXRA 4AVSA 2YFUA 2D3PA 3VKOA 3B94A 1RUF2 1VBA1 3CJIC 5FUPA 1VBD1 3PIJA 4IEVA 1UAIA 4HVRA 1LOEA 4N9IA 3LA3A 4CE8A 1GBGA 4DY3A 3M3QA 1CPNA 5B4NA 1W6QB 2JJ6A 2ORXA 2Y60A 4L92A 1RUI1 2RJLA 3WF2A 1UNBA 3DGTA 1XNKA 3KS7A 4RR3B 4KU7A 4EN0A 5A1AA 4IXLA 4CTEA 3I4IA 1JYCA 1UPIA 2W0XA 3RMYA 2D93A 1DGWX 1PZ9A 2BOIA 4MYEA 4QPYA 4UBHA 4TSVA 1VRH1 4QQLA 3ZPYA 4E2QA 1W2OA 4LO5B 1C8M1 2WAAA 2YMZA 1SQ4A 1SLIA 2E7TA 1STMA 2V5DA 3AZWA 1RXFA 2XJTA 2Y26A 4BWOA 2R061 3AFGA 2QQLA 4QM9A 2IXJA 1UZYA 1CZTA 2V4VA 4K9SA 1JU3A 2G9GA 4NOTA 4WM8C 3EQEA 1V70A 3CDZB 1RMU3 2WZR2 1OPOA 2WNUA 1QJU3 3M1HA 1JW6A 2BGCA 4J1WA 2PHRA 1J3RA 5FY1A 3S57A 1ZRDA 3DXTA 3VKNA 1BLZA 2EIEA 2WZEA 2VW1A 4C90A 1IPSA 1ULFA 3WDTA 4QPIB 1W8FA 4XFAA 1W6MA 3RWNA 1XNTA 2QQUA 1WLCA 4DUXA 2IXHA 1LHOA 1AR92 2D3RA 3K48A 2O8QA 4AEDA 2PA7A 3OD0A 4QWNA 2JDZA 1GU3A 1JYVA 1UOGA 2E9QA 3GF6A 1W8TA 4IEWA 4XF0A 4AQTA 5IVJA 3ZYGA 2HYKA 2FBEA 1PM4A 5T5JA 3ZYHA 1HKDA 2FCVA 5CKQA 1J3PA 3POGA 1WCUA 4QB6A 1UOFA 1WBFA 1LTEA 2RS33 5FPBA 5CG8A 4QPGC 2RR12 2HWC3 5K9YA 3IKWA 4TXWA 5FZOB 4LT5A 4QXHA 5LBFA 4CCLA 2R1DA 3MIBA 1REDA 4GWJA 1LENA 3VDAA 4BZ4A 4BXFA 3U75A 3IAPA 2Q5TA 5DG1A 3HR9A 1RMU1 4PHZA 1GP4A 4U2AA 1QJU1 3AYEA 2IFRA 5F7UA 4XXAA 1HB2A 4KGQA 3ZM8A 4P9YA 3HPNA 1R083 3ZN6A 4E2SA 4COUA 4JTNA 5LK7B 5C3RA 3T2TA 3G6JB 5IVCA 3P3NA 1RUC3 4IESA 4HKOA 1QOSA 4RQPB 5HXMA 1UQXA 1RUD2 4CPBA 1GOFA 1QU0A 4COVA 3SMHA 1QJEA 1W8HA 2YC2A 2ZXQA 3EO6A 4LIUA 3UGFA 3VBSC 5C71A 2Z79A 3WW2A 4BCUA 4KQ7A 1W8UA 1OA4A 1TME2 1VBC2 2PHFA 3RZZA 1R093 5JZGC 4IE6A 2RDRA 3TNPB 1TVGA 2WO3A 4LBMA 5ABJA 3IMNA 4BH9A 2ZKLA 3OJBA 1HRV1 4PDWA 4IEZA 2QNKA 3KLSA 4LBQB 2ZOEB 2YC0A 1O5LA 4QKDA 2EXIA 4YVSB 4XCBA 4Y4YA 2HWC1 2DCZA 2JG9B 1ENSA 1ENXA 1PHMA 2XJUA 3M2MA 4HSJA 4LBOA 1VIWB 1XNBA 2YG0A 2OKXA 4B29A 3NJVA 2E53A 3LCPA 5FY0A 3NNGA 3WV6A 2A3WA 3BTZA 4YFZA 4YVWC 4UBGA 5DUUA 4JDMA 1AJOA 1LESA 3SKJE 3H1MA 2YROA 4Q27A 2AENA 3SNMA 2OIIA 5I0SA 1VAKA 4HVOA 2D6PA 2VR4A 1AXZA 4S2DA 4DQAA 1O3QA 3GALA 4E9KA 2JICA 3BCWA 1PM7A 5FLHA 2B39A 4QQHA 1CAWA 5EFUA 1D0GA 1ZZBA 2CWMA 1JZ6A 3LQCA 4Q4W3 5A3NA 1J1LA 1WMXA 4AVBA 5BNOB 1NA1B 4HN1A 2VL4A 4FAHA 2BVBA 2RDNA 5APAA 5IW0A 1KS5A 4D7TA 1NCQC 2KA3A 3TAYA 2EF6A 3TN93 4DUWA 4WZCA 5FOJB 1YFUA 4Y1VA 1OD5A 1OLME 2ZGQA 1MQTA 1U0AA 4P9GA 1PK6A 4UYBA 3FHIB 2W47A 4XQ4A 1AX1A 1NT0A 1RUJ2 5FZEA 1LCLA 2RV9A 2VZOA 5DZEA 2VCCA 4UAPA 2VTXA 4S2FA 5GLUA 2VTFA 2E31A 3PVNA 1FOD3 3VLBB 2JDUA 1JS9A 3ZSLA 2XWJB 1OXCA 2DDUA 3PMEA 4PF5A 2A1XA 2VOTA 1OFSA 5FMDA 3U07A 1O8PA 3WW3A 5DZFA 4JKLA 3BB6A 3U4XA 3HQXA 1NY71 4N53C 3TEZA 4QX8A 1F31A 1L3JA 1W06A 3L2YA 4CYDA 5FYBA 5KR7A 2AEZA 3WQ0A 5JOZA 2P1BA 3KSCA 4I30A 4JRLA 3I2DA 4YLZA 2QQKA 3EYPA 1AHSA 2OT7A 5FXXA 3VBHB 2P6HA 4N9HA 3ZFEA 3JCIA 2FQPA 3PUHA 4LO4B 5A32B 1MEC3 5FYYA 2HWB2 1DYPA 1IPJA 5BV6A 3RQ0A 1E5IA 1F15A 3BIWE 4I0AA 5IK7A 5FZGA 4LBQD 3N9QA 1W9YA 2WKKA 3OG2A 1PGW1 4E2GA 1IOAA 4MGKE 4CCJA 4YGDA 5F6LB 3IZOA 4AHXA 1RJ8A 2VUCA 3BGAA 4CDWB 1EYBA 2JD9A 1MS3A 2YBKA 3CJIB 4BK5A 3IPVA 4L97A 4O9GA 4P9XA 4WM7A 4CEWC 4D7YA 5DUVA 1Q5OA 5DDJ3 5FBJA 2RS13 2VOXA 2D5FA 3VHNA 3C7FA 4LLFA 3HOBA 4COYA 2GN3A 3I59A 3LAGA 1O3TA 1QXJA 2BVVA 3K4ZA 3USUB 4OHXA 3PDQA 2WR9A 5CKNA 3O0XA 3POWA 3WG1A 1NCRA 1EUUA 1P8JA 1S2EA 2HYXA 4QQOA 3RVHA 3HWJA 1H4HA 4Q29A 1VMFA 1NQDA 2OUHA 4QHZA 2DYCA 1N3QA 2ZHNA 3AZYA 3PVEA 5EZWA 3BIEA 3U0ZA 1KDKA 1YI9A 1CAXA 4WM8B 3GNEA 4UFMA 4R9DA 3OGGA 2FZ2A 4ARYA 3V0AB 2XWBB 4RFT0 2Z42A 4LKDA 1T2XA 2GDFA 5FR3A 4AVAA 2R32A 1MS8A 2CGPA 4XILA 4NIIA 4EWAA 1NQJA 5FPLA 3HN3A 3KT4A 3MUY1 2JENA 1LHWA 5DDJ1 1IPKA 2RS11 3HJRA 4FQZA 3WW1A 4XBNA 4YM0A 2A75A 4PIZA 3TEYA 2E7AA 1SFNA 4E4ZA 4JDNA 4NVPA 2QJVA 1OHFA 4IEQA 2Q8DA 5J48A 4FTEA 5FQ0B 1HB4A 4XYXA 4G3YC 4XW3A 5A7OA 1NG0A 5K7PA 3RRDA 1WCSA 1HIXA 5FZIA 3ZFEC 3ZFFC 2X5IA 5IVYA 1K5JA 4LA3A 4RN5A 5J3UA 1K5MA 1SPPB 1S4CA 1YFXA 2JXAA 4BIFA 1LOGA 1W04A 3F95A 4EJRA 1LNSA 1POV0 1KJLA 1YQ2A 2VZ1A 4PF1A 1G9AA 4IEYA 2LS6A 3UESA 3ZO0B 2ZX1A 2J1VA 4CCNA 3NV4A 2XLFA 4JV4A 4QGNA 3J8F3 1NYWA 5FKCA 1KJRA 3D8CA 1RUD1 5JI7A 2XVGA 3I3BA 3VB9A 4EE2A 5D21A 2ZJCA 1YWKA 4MZUA 3ORJA 2J1UA 3U4SA 3VZKA 3TB0A 5LZ6A 4OHYA 1XE8A 3NW4A 3AKQA 3VBSB 1QXPA 4MGSA 2JG8B 1FMD3 3ZYIB 4UWDA 1JBCA 1VBC1 3ZKUA 1XYPA 2D6KA 1GZWA 5F2WA 2VMEA 5JZGB 1FXZA 5C4WB 3I3EA 4AQSA 1AR83 2ZEYA 3MW4A 4LKSA 3BTYA 1X33A 1W03A 3N7LA 2WFF2 1ZA7A 3N35A 4Y22B 2GH2A 5FYHA 2VMIA 2W39A 1DG6A 5JSOA 3IAQA 1QQP2 1UU5A 1YFWA 4J6GA 4DMIA 1HRI2 1V6KA 5LA2A 3MZHA 5CFDB 3WNXA 4K21A 4CA9A 3WCRA 1US2A 2WQ8A 3AMNA 3GHNA 4YVWB 3WDVA 1Z0HA 3ACLA 4AL9A 3R4SA 1GNYA 5E89A 4D94A 3B69A 4LBLA 1DQ6A 1E5SA 3OF1A 4X8PA 4EZHA 2CAUA 4A6OA 1Y43B 3NJZA 4IL7A 2OZJA 2VZ3A 1FMD1 5C9AB 4CCMA 2X8KA 3A23A 2DBNA 3AVRA 2JDPA 1YRZA 2PQSA 3MIGA 5J96B 1AR81 2R6QA 2RMU3 2JE8A 4CVUA 4LR4A 4KI5M 5CB7A 3OPZA 3POFA 5IAVA 4DO0A 2XLAA 3VBRA 2V09A 3VHOA 1NCQB 3DYOA 1TG7A 1C5HA 4XJ9A 1SBFA 1W8OA 3JQXA 4YGCA 3D5OA 1GNZA 2JWPA 4DXZA 3AX4A 1PZ8A 1JU4A 5KC5A 3OY8B 1CN1A 3ZSJA 4Q0UA 1W6OB 3VL9A 5IUQA 1AL22 3R05A 2VULA 2D43A 2VO5A 1IQDC 3ZXJA 1QJX3 4RHV3 4XHBA 1W6QA 4W6WA 5T54A 3ZN4A 3PUAA 4AI9A 4RR3A 4XF4A 1I5ZA 1XRUA 4IDZA 1JOPA 5A3UA 4A7KA 1UCXA 2DUQA 1TE1B 2ZEWA 1RC6A 3IDEA 1C1FA 2ZGNA 3LA2A 4N53B 2ZA9A 5FPAA 5FY7A 1PO23 3RZKA 3BI3A 5IYYA 3PJYA 4GB33 5A3OA 4B7KA 1POQA 2WQZC 4QX1A 3SISA 3I49A 3VL8A 1L7LA 2DBIA 5IK4A 5KHGA 2VQTA 5F5AA 2P34A 2R7EB 4E4DX 3VV1A 2C4XA 2QQWA 2WDBA 3M7AA 4RSUA 5G04L 2WS91 3J9SA 2OS2A 1X82A 1FNZA 4GIQA 4KWKA 2SLIA 5DG2A 4BA6A 4K40A 4AI1A 2XG3A 2ZZQA 2P17A 3KV6A 4R4XA 1VMHA 3O0WA 4NMIA 1QJX1 2OQ7A 4QPIA 3H9AA 1WMDA 3C7HA 1W9WA 4RHV1 4CEWB 1KRIA 1BEV3 1H2LA 5I0UA 4W6YA 1DLCA 3HMYA 4XVHA 1A8DA 1OQDA 3D82A 5EV7A 1H1MA 4EQVA 1XE0A 4Y5TA 5FZ7A 1UYZA 5GLTA 3VZLA 3D0SA 5EP9A 5GZGA 1WKYA 4FFFA 1YJLA 1JHJA 5JSRA 1PO21 5DQ0A 5L7OA 1UX6A 4AQ6A 2GNBA 2HWF1 2VNGA 4PLOA 1NLSA 1SACA 1TEIA 5L7OB 2O8OA 4GKYA 3ATGA 3MBWA 5FZOA 3PLQA 3SEPA 2FZ1A 4XMAA 3LDKA 3VD4A 2W9XA 4NAMA 2BBVA 4FPHA 4AR2A 1KEXA 5IVEA 5C3OA 2QQJA 4NIHA 3MIDA 3LSEA 1RHI3 2WWSA 1UPSA 3D0JA 3KCCA 1ULCA 2GU9A 3W59A 1COV1 5I0RA 1VBD2 2OZ6A 4XBQA 2D40A 3S7IA 4CRQA 1HV0A 1A78A 3KWVA 4RQPA 2YYOA 3UK9A 3VDCA 2JIGA 4NHYA 3GJAA 3LIGA 1BEV1 5ANQA 5I0TA 3KD4A 4W4ZA 1ACCA 4YYOA 2MHFA 2I2SA 1QWRA 1JH5A 5GJ6A 2E63A 1AXYA 5CKMA 4BIOA 3J7MA 3K51A 5J37A 2P3KA 1LOFA 1E5RA 4QX2A 1Y4WA 1LRHA 3WX5A 5KXCA 1VRH2 2RS51 4A42A 3AMPA 1C8M2 1ND3B 1Q8PA 1R1A3 3BN6A 4FPLA 4XFFA 4YVSA 4LBQA 1ZA4A 5ANNA 1DQ1A 4ATEA 2JG9A 1UZVA 3PUQA 3ZFFB 2R062 3K3OA 4YM3A 2XL7A 1NZCA 1PO13 2ZGMA 5H9RA 4E4HA 3FMGA 3GBWA 1M4WA 5EWSA 2R1BA 1GWMA 2ZGKA 3KMHA 3OD4A 3LDRA 4PBOA 1LEMA 3SKVA 2WN3A 4DINB 2PHXA 5IFPA 3N7KA 1RHI1 4WBBA 1G9CA 3I2HA 4YWAA 2AGSA 1Q43A 2WNEA 4QXCA 1SFYA 1F35A 4LUKA 1EAH3 3SXWA 5FPXA 4QKNA 1V9U3 5FLIA 2OXBA 1MS4A 3ZXAC 1JUIA 1GWLA 2XBO3 1J83A 5GALA 3RZHA 1JYIA 1CIWA 1DGRA 4FAGA 1Q8OA 3JB4C 4HOOA 4CU6A 1YHFA 4E27A 3OYWA 4RFRB 3MLJA 2FCUA 4FBFA 5FUIA 3GGLA 2DURA 3RS6A 3L2HA 5L7OC 4LORA 1VRBA 4GJZA 5A3MA 3D3AA 5BNOA 1NA1A 4TLFA 1EY2A 2Q30A 1OUSA 2V4AA 1J59A 3K4AA 3DXUA 5KHKA 2XR4A 4JHTA 3MW3A 3O12A 3AKPA 4PI2A 3I8TA 4DB5A 3KV9A 4DY5A 2X29A 3T1MA 1UU6A 4UW5A 1RIRA 2Q0AA 1AR73 1IS4A 1CR7A 1UY3A 4Q5OA 1RMU2 3ZN5A 1DLLA 1SDDB 3MO4A 1QJU2 3O1PA 2ZX0A 3AP6A 1SMVA 3PUSA 2NMOA 4ZKTB 3QH6A 1EAH1 5DAPA 3M8LA 2IXLA 1KS4A 1QKQA 2BFUL 4W65A 4LJHA 4MHUA 5FXZA 2P3JA 3IIAA 4MV2A 2XBO1 3WNPA 4CP9B 3LEGA 4FPJA 1T6GC 2QQOA 1M06G 1BMV1 4Y4RA 1N1TA 1QH6A 2VC9A 3GCWA 4GXLA 1FPN3 3VBFA 3WY6A 4DXTA 1KFXL 2BU9A 4D8MA 4QKFA 3Q8AA 2DCJA 3LZZA 4JGZB 5HI0A 2HWD1 3HBKA 5FO8B 1H2NA 4ZS2A 1BXHA 1OQ1A 3RMXA 3NJYA 2HJIA 2RS32 4DUVA 1Q3EA 3NV2A 1JN2P 4KL1A 4OHZA 5I8YA 2HWC2 4CDUC 3ZDSA 1Z7S3 4CEYA 4NE9A 3TYJA 1AR71 4CSWA 3WF3A 3SH5A 4YW2A 3VKFC 1XJAA 5CVRA 1WLDA 5E8AA 3RYRA 4H7LA 1SLLA 5DZGA 1UOJA 4UW6A 2R16A 4AI3A 4TN7A 2QQNA 4DOUA 3CJIA 2XVKA 2WABA 2D5HA 1FV2A 1RUC2 1WGPA 4LK6A 3GXUA 3WNMA 5A6QA 1NZIA 4GMP3 4HXCA 2GNTA 1AL0G 2VQAA 3ROUA 3UV9A 1T6BX 3USUA 2XLGA 1NA1C 4O7XA 4AEMA 4R9CA 1UW8A 2B45X 2BP6A 2WO1A 4IV1C 1C3HA 4RS5C 2J1EA 2VW2A 1Y7BA 3FBYA 3WP3A 4MLOA 1UD1A 2A6XA 2BBAA 3B9CA 1YI7A 2QQVA 2CU5A 3KCYA 4QXBA 5JAXA 1H9WA 3QLQA 2ADEA 1D4M1 5E6HA 3IT8A 4LOTA 3K2OA 3OPTA 4WM8A 4MSVA 3LFMA 1DGRN 3NAPC 2IVIB 4XXPA 1LHUA 1U5ZA 1XB9A 3K75B 3PVOA 2GMEA 5CZKA 5C3PA 2PN5A 2XHNA 3PMSA 4CP2A 2WSVA 1CJPA 1TNFA 5FK8A 4AFBA 1MS5A 3AXEA 1V6JA 4A7YA 1QY4A 4IEPA 4GMP1 1NX9A 3UKNA 2EAAA 2OPWA 3D4KA 5JXGA 4HL0A 4YZ2A 4YG6A 2VOWA 1NY72 1RUH3 4Q4W2 4CXXA 5FQ0A 3FBMA 3QOPA 4QKBA 4HK9A 5CFCB 3VBHC 5AVAA 1GZ9A 1D0HA 4Q4X3 3O1UA 4QPGA 3IN9A 4XACA 4O65A 3MIEA 3HIFA 4OI1A 5F37A 2NM1A 2LRPA 1NXD1 4XEZA 4E8DA 1SPPA 1XBFA 2YGLA 1XPWA 1CZVA 4D6RA 2LALA 3O7OA 1CIYA 1PGW2 2ES3A 1UYYA 3O1MA 3KM5A 5KHJA 4CDWC 3VDDB 4PCRA 1R64A 4SLIA 5F32A 5DAVA 5FY8A 3ZR5A 2QUOA 1DQ0A 2HWE3 1QMJA 1WW5A 1W2NA 2GH8A 3GHMA 3LEKA 1CAVB 3RZMA 2CAVA 1LGCA 2V72A 1RVF3 5DUWA 4B7EA 4F83A 3DYPA 5F3IA 4AHWA 5LCWL 4MX3A 2E51A 5GLWA 2AACA 3VBSA 2JG8A 2OA2A 3WQBA 3THTA 1BBT3 5IATA 2R041 1ZX5A 1RUH1 3BU0A 3URFA 2EA7A 4FI9A 5J7MA 1JZ8A 3K3NA 5JZGA 3M70A 4CDXC 4C8DA 1DF0A 2YDEA 4OUEA 4UOJA 4D3WA 5F5IA 1FI2A 2QDNA 4LBKA 4PT6A 5FZ9A 3I2GA 4Q4X1 4B4PA 1QNYA 3MF9A 4G4FA 5A70A 3OTFA 3M3OA 2VUJA 4GJYA 1SLBA 4FCAA 4FFHA 3GZAA 4Y33A 5FTTC 4NWVA 2B7YA 1AZDA 1HXS3 1L7RA 1H1IA 5A6ZA 2GAUA 4Y5Z0 1X50A 4JQTA 1ZBA3 1APNA 4KWUA 1UY4A 2JKXA 5LY2A 4YVWA 3LA7A 3WSOA 2CGNA 3N9OA 2GP5A 5FO9B 2ARCA 3AYCA 4XF3A 2HWE1 3S30A 2VH9A 1OF3A 4JZRA 2DVGA 5DDJ2 4AGRA 2ZMLA 1RVF1 2RS12 4TTGA 3ECQA 3ACFA 1OQEA 2BNNA 2WT0A 4AWDA 4M3CB 5LA1A 4AVCA 5C9AA 4HVQA 3KHCA 1GFF2 1BBT1 1EUTA 1Y9MA 3H7YA 1BZWA 4Q4V3 1SEFA 2R0HA 2VPVA 2Y6KA 1ZRRA 4NJ4A 4BLIA 1BKZA 2YXSA 4QDRA 4JTOA 2Y38A 4XZUG 4SBVA 3WLUA 3FFZA 4FPOB 5FREA 4M4RA 3ZLIA 5JXHA 3MICA 2VZTA 4A44A 4FOYA 3I2JA 1NCQA 5DABA 2W08A 2WZ8A 3QD6A 5T50A 1RUG3 2IC1A 2XOMA 1KGYA 4ET7A 1CD3G 2KXLA 3ES1A 2X53S 4GWNA 4CP1A 5FMOL 1BJQA 3I7DA 3MIHA 4CUBA 2XHKA 3ZFGB 1W6OA 5A33B 3DL3A 3KT7A 3TBDA 2F4LA 1V6OA 1FYUA 1S0IA 4Q0VA 4XUPA 3THDA 5K4LA 4B1LA 1XU2A 2JG8C 2EXJA 1O7FA 4WVMB 2Z5WA 4KH9A 1MVEA 4JGYB 1NUKA 1GMMA 4HKLA 1C1LA 5C4WC 1H8TB 4GALA 2YGMA 4AI2A 4F3JA 4N53A 2TNFA 4N43B 2UY8A 1US3A 4FFGA 4Q4V1 2RS31 2VMFA 1K42A 4QU2A 3DKWA 5L9VA 2XH6A 4UI9L 1XU1A 3AXDA 3N9LA 4CDUB 4H14A 4KBBA 5CFDC 3VBOC 3T30A 4ZPIA 1UIJA 2PYTA 2VZSA 3V56A 5K8SA 2BJSA 2LW8A 5FZFA 3WQ7A 5M0TA 3MFAA 3PJQA 2JE9A 4XUTA 1JOJA 2DTWA 1R081 5L19A 1ZNPA 4TWTA 2DUPA 2XMLA 4YG3A 3RDIA 1RUC1 2WYFA 5KXEA 2YBSA 3AYDA 3MV01 5FOBB 2W87A 1DCSA 4CEWA 1CVNA 2PLV3 5CNAA 5I8SA 1Q56A 3AK0A 2GC1A 5C9AC 1KFUL 4AAPA 1U12A 1CPMA 1FMD2 2JX9A 4YZ4A 4FTSA 5FWJA 3O5SA 1R091 4MUVA 5KWRA 3LD8A 2BQPA 2JKBA 2ZPXA 2OYZA 2BNMA 2BWAA 2DV9A 1AR82 1VBE3 4FTBA 5FP4A 2DVBA 4IV1B 4RS5B 3GM8A 4BLJA 1JZ3A 1MZ5A 3ZX7A 2ID4A 2E6VA 3CBNA 1E5HA 3C7EA 4ZY9A 2Q8OA 2DVDA 4CDQC 3VDBA 4UXAA 1QNWA 2WAOA 5LBEA 4QD2A 3CZJA 4LBJA 2VZRA 4K1YA 2B42B 3O0VA 3NAPB 2VE1A 3OCPA 3E1F1 4D6QA 1Q8SA 1GOHA 3VHPA 1YXWA 4HG6B 5C6CA 2CGOA 1ENQA 1UX7A 1FNYA 3CIHA 1JYXA 1ZREA 3NJXA 5DAXA 3HAGA 1OMIA 4D69A 4P00B 2PLV1 2K2SA 2XVLA 2J1AA 1MS0A 1NAEA 2ZMKA 2GMPA 5FXVA 3KQRA 4YSFA 3LGRA 4Q4W1 3KF5A 4H2AA 2W3JA 2DCKA 1YIFA 4JRAA 3WHTA 1BCXA 5C33A 5IVBA 1VBE1 2ADDA 2RMU2 2FDHA 3CZUA 3J7HA 1RUF3 4M3CF 4ISRA 4ZXEA 2BFUS 1DGWA 1F5JA 3DCQA 4Y20B 5FYTA 3TN91 2VNOA 1LR5A 3VBUC 3ZFFA 3PURA 4IUGA 5AC93 4OI4A 2WS92 3WF4A 5D8AB 2J1TA 2JDMA 1W8WA 1WA6X 2YC4A 4XJ8A 1S0JA 5EJ1B 4AW7A 5CA6A 4Q0PA 1X9PA 1Y9GA 4MGYE 3MPBA 1FOD1 4LO8A 1XQNA 1B35B 1PNGA 4FT8A 4OFGA 5FZCA 5J98B 4DS0A 1AYM3 4YARA 3TWIA 1QJX2 4RHV2 1G86A 4W50A 2ET1A 4AG4A 5F9TA 1WCQA 3EBRA 1WCKA 4DEQA 1QJY3 4UW3A 1HB1A 1UMHA 4NRMA 4YZ3A 2WZR3 5J1XA 2TUNA 4Z07A 4I02A 4XQWA 1PO22 1YEWA 2ATFA 4GQ7A 5ERLA 4CDXB 2HWF2 2J22A 2Y8KA 1VE0A 4XZPA 1O59A 4DZGA 4NROA 3GZEA 4GD4A 1RJ7A 4MXVA 4EWDA 1U5XA 1MEC1 5F5CA 5AC91 1HN0A 1O6UA 5FZHA 2VQUA 3WUDA 3H42B 2J42A 2XUEA 4XJZA 1QOOA 1S0EA 4YW4A 3R6SA 4IV3B 3ST7A 2ZGPA 1COV2 2WT1A 4LEJA 5FZ6A 4CCDA 2BRTA 1O3SA 4NUBA 2Y34A 3JUUA 4LUMA 2VMHA 4Q26A 1HQWA 2C6SA 1AYM1 1S0DA 4COZA 2DFBA 2C24A 1CAUB 2RM23 1W2UA 4MGQA 5F8PA 5CAZA 1UXXX 4XUQA 1BEV2 5KHHA 3LSDA 3MV11 4CP9A 1A8MA 1QJY1 2A73B 3BPZA 1TQ5A 2VVFA 3VD9A 2PHUA 4ZZ8A 2YFZA 3WZ1A 5BNPC 3SLIA 2AC1A 4ORFA 5C7GA 2RS52 1ND3C 3FN9A 2WA3A 3MHZA 2X05A 4BU2A 2Z4FA 5LEJA 4B4QA 4P5HA 3V0AA 5DN2A 3GCXA 5FMBA 2ZGLA 4N7UA 1O5UA 4KWLA 3VKMA 4QM8A 4BJ0A 3J26N 4URTA 5FZ0A 5EJ3A 2KD7A 4QB1A 2Y6HA 1MS9A 1IG3A 4JAAA 4BDVB 1I6XA 2XKOA 1UN1A 1G9FA 1RHI2 3C7OA 3INAA 4UFLA 2WBKA 4IERA 5FZMA 1HQLA 1PGL1 2VBPA 2XUMA 3POIA 2ZGRA 2C26A 3S5QA 3ZXLA 5BUVA 2A3YA 2A6ZA 4FVVA 4OMDA 1QHDA 3MPPG 4NPRA 2PQQA 3KV4A 4K20A 2RM21 4KWJA 5TSWA 1PVC3 3QBQA 5A3LA 2D3SA 2GZWA 3SH3A 3P6BA 2ZZJA 2JE7A 1X9TA 1ULEA 4LNVA 1BHGA 2WIIB 4HSLA 2GMMA 3X29B 5C70A 1OC1A 4XQDA 4GMP0 3CNAA 2RJ2A 2IFWA 3N36A 4FOWA 4YW3A 2I07B 2A70A 3WT3A 1S0FA 4JX0A 1JOBA 1SDWA 1R1A2 1XSRA 4H55A 4NO4A 1RXGA 5H9SA 4INDA 3WF0A 3KV5A 3VUOA 2GC3A 4M01A 5HCHA 2QKDA 2CTVA 3G7DA 3THCA 2CDPA 1PO12 4ZONA 3VBOB 1QDOA 2WJSA 2AH2A 1MR5A 1ND2B 3SCHA 3OUHA 4A3ZA 4CXYA 4BMBA 1ULOA 2VY0A 1XYOA 3SQOA 4YW5A 2CWSA 1UY1A 4PLNA 5FK7A 3THPA 5JSPA 1WMEA 4Q8LA 1F5FA 2FMDA 1EAH2 3J8F1 5IWFA 1V9U2 1H4GA 3A0NA 1PMHX 5FPZA 4LBNA 2XBO2 1PVC1 3TOJA 3RNSA 3MUZ1 2W94A 1N47A 5FY9A 1YFYA 1BMV2 2GC2A 4LMFA 4BXSV 3S0MA 2QZ3A 3MEPA 4NN0A 4BB3A 5GZCA 4L8QA 1UZ0A 1WWYA 3FLPA 4JGZC 1SBDA 3RG0A 1R1ZA 4N7IA 3GYDA 4XF9A 2HWD2 4NWWA 4ZXKA 5JDBA 4F8AA 4NPMA 2VUAA 1SLTA 4AXOA 3D6EA 5CFCA 3VZOA 2DCTA 3DECA 1DZRA 3N3HA 5LB6A 4TYSA 2VZUA 3CO2A 4XAAA 4EWEA 3AP9A 2VTXJ 3MGUA 1RUE3 2UYAA 3I2FA 1LAJA 3FFQA 3BODA 2PAKA 1AR72 2VECA 4CDQB 4FOVA 1DDLA 4IGPA 2YV8A 2A71A 3HN1A 4XE9A 4ASMB 5JPMB 2VUDA 3SEEA 3T3YA 3LIHA 1H9PA 4Q2FA 5A7SA 4CUCA 2H0BA 2G19A 2W1QA 5JMOA 4X6QB 2RDSA 5DAQA 1FATA 1E57A 1ZZ7A 1H2KA 5FUNA 5LWBA 4GH4C 4XIOA 1CAVA 1I5PA 1HX6A 1V6LA 4P08A 2OVUA 1SCSA 4NHMA 2X10A 2AZ5A 2F4PA 1V0AA 4HN0A 2DCYA 4IGOA 5E1RA 1OA2A 5C8CB 2FDFA 3IDAA 2V73A 4BMEA 2BNOA 4CCKA 3LOIA 2ZX2A 3LB9A 2RMU1 1UU4A 2BW8A 3ZN6B 2JB4A 2BTVC 2VZVA 1MZFA 3OSDA 4IW3A 3U11A 1GZCA 2ARAA 2ZHKA 5IAXA 1O3RA 2VBBA 3OBRA 1GYKA 5JI9A 1RUE1 3ZPOA 1Z7S2 3VBUB 3E6CC 1D4M2 1RUNA 1MPXA 4PIXA 2Q1MA 2WSUA 1YO8A 3V65A 3ZYFA 4YG0A 2Q8CA 1X7NA 2Y33A 5FLJA 5B4XA 5SV8A 3WXPA 3EJKA 3M3IA 3ELNA 3NL1A 4DXRA 2YHJA 3UGHA 3PTYA 3OUIA 4XFGA 2VU9A 2D6OX 4P9LA 3B93A 3QACA 4MG2A 1KDMA 2ZX4A 4L0PA 4Z8BA 5CIRA 1B09A 1CJDA 1OF4A 1YIPA 3MLKA 4P5YA 4QDSA 1HV1A 4XHXA 2WFPA 5L36A 3O1RA 4UFKA 3LDBA 4M3CA 3NNJA 4MH0E 4R9AA 1JZ4A 5EXOA 2VM9A 4M0NA 5CFCC 5FZAA 3T2OA 1FAYA 1ALYA 3T2QA 2XXZA 3RYPA 4GB31 4UFIA 4NRPA 1FT9A 1MS1A 2VBDA 5FXWA 5A80A 4ATFA 5EIYB 4M4PA 4MHRA 2PXJA 3AB0A 4NPLA 2VMCA 4KU8A 4A41A 1N1SA 2O1QA 4L99A 3PU3A 4HPKB 3VDDC 3CF6E 1EV13 2XQRA 4YZ1A 1YYNA 3ZFGA 4LO6B 5A33A 1DHKB 2KR2A 1A6CA 2PHLA 3E6BA 2XPJA 3CMGA 5H9QA 1BVP1 4I0BA 1EPWA 2P6CA 4HANA 4AQ2A 4Y1XA 3TRSB 5FFOC 1YNAA 1HW5A 4K6BA 3ZVXA 4OHWA 1LHVA 5A7WB 4WVMA 3MLLA 2H6BA 2J7MA 4MO3M 1NE4A 4AK3A 1PK6B 1ZM1A 3JQWA 2R042 4LITA 1RUH2 2B46X 1DQ4A 1W99A 1H8TA 3NVCA 5F5QA 3AP4A 5BNPB 3UL2A 4FPEA 5C5UA 4Z1VA 2LROA 3SCFA 5I0DA 3R4DB 4YW6A 1X8MA 2BGOA 3EB7A 4Q4X2 3WDYA 3DPRC 3H3LA 1NKGA 1RUOA 4CDUA 3AMQA 2BPA2 4M0HA 3GDBA 4LHSA 2I45A 3CQOA 4IE5A 3OEBA 2D98A 2ZBJA 2AUYA 1ASJ3 1BK0A 3WG3A 2VOKA 2WNOA 2F17A 4QHOA 5T52A 3KVBA 3WR0A 3U10A 2JECA 1EV11 5JPNB 4CPBD 3HQUA 2SBAA 3WOGA 5I8TA 5EHDA 1XSQA 1MVQA 2IUWA 4NHKA 1S0CA 2HWE2 1BVVA 4GA9A 1CX1A 2GN7A 1W3XA 3NQHA 3EMRA 4Z92B 2UY9A 1RVF2 4LQRA 4EV0A 5CU1A 3H7JA 4XFBA 3SH4A 3T4VA 1K12A 2JDAA 5T5PA 3WDWA 1PIV3 4GZ9A 1G9BA 2ENRA 1F2NA 3ITQA 4OLLA 3HEIA 4XFIA 5BYNA 1BBT2 3N9MA 2VZPA 3V0BB 5FPUA 1AR63 1O91A 4D0QA 5LBCA 1R1A1 4JCKA 5LY1A 3B00A 3AL5A 4OZXA 1QGLA 4IV1A 1O4YA 2XQXA 4RS5A 1PNFA 2Y6JA 4AFDA 2LM3A 4WM7B 4YGEA 1PO11 1OOPC 5D1IA 3T0DA 1HXS2 3GZUC 1ASJ1 5FJKA 2CY6A 3E5UA 5IK5A 2QTWB 3ZFGC 3NAPA 3A0KA 4C0BA 4M00A 1GNHA 2DUOA 1I1EA 4BOWA 2PAMA 1V9U1 3NRUA 4XUOA 3RJRA 3BTXA 2WYSA 3C2UA 1PVXA 2B9VA 3O1VA 4A45A 2D6MA 3H1WA 4K7JA 2HH9A 3H1YA 4J1XA 4XBLA 4JGYC 4ZHNA 1DFQA 1CZSA 1PIV1 2BERA 3LEIA 5C3SA 3Q9OA 1H8TC 3U14A 5K0UB 1C28A 4N43C 1AR61 4R9BA 4Q4V2 1QDCA 2ZKNA 3WNNA 3OOXA 3GJBA 1JZ2A 1GOGA 3U37A 3VBHA 2VQ0A 1REFA 5LA0A 3VD7A 5A32A 5I91A 4Y20A 5A7QA 5CG9A 2ETEA 1H30A 1PMJX 5FDBA 2VAUA 5IT6A 2CV6A 1UYPA 2FDJA 1RUG2 3OBAA 4N90A 1J1TA 1XOYA 4LOSA 2W1WA 2A3XA 3HT1A 2DVFA 5FYUA 3BVCA 5FZKA 3J7LA 3ENRA 1OI6A 2HKXA 2P2KA 2WUHA 3SCGA 1R082 3KHBA 5JMCA 1A3KA 3LE0A 4CDWA 3JD73 3ZKYA 4Z2AA 4XJAA 5CEHA 1B35A 2J1SA 3IIIA 3NMBA 2TEPA 3KF3A 4FPFA 4GH4B 5FYIA 5GZEA 4NIAA 4K8RB 2XGXA 1ZBE3 2X5IB 4QGLA 4FOQA 1LOCA 3WUCA 5FZ3A 1LGNA 2ARXA 5DUXA 1POV3 1FPN1 3HBZA 3OGSA 4LIVA 3ZYJB 3JBG3 1R092 3IBMA 5FP8A 3NNMA 3E5XA 2FDGA 5HXVA 1BYHA 1OKOA 2B9UA 4BQ4A 5BNNC 4CDXA 1NOVA 1WW7A 4FPYA 4CCCA 3H8XA 3AVSA 1AVBA 3AZVA 3B01A 3I2KA 2TBVA 5FZ4A 5IFTA 1Z7S1 3OGJA 2WRAA 2O14A 3AZXA 2RVAA 3MFCA 4J25A 4DFSA 2CSGA 1AJKA 2IWGB 3HNYM 5FP9A 5AVPA 4AI8A 1VP6A 1YQ8A 3NSTA 2EXKA 4IV3A 2MPFA 3RFRA 1W3VA 4BM8A 1DGLA 2LUWA 5FV3A 2JDNA 4BQ3A 3UNPA 1U5IA 2XJRA 3WP6A 2WINB 5CISA 1OVSA 1CAUA 1ZBE1 2J1RA 1REEA 3KVAA 4YNIA 2PLV2 4BQWA 2QE3A 3MDPA 3FUOA 1WMFA 3CLPA 4FFIA 2WNVC 1GSLA 3JBG1 1DBNA 4IGQA 3RJ2X 2C0ZA 5JCTA 1DYKA 1IS3A 1VBE2 3B7MA 3NV1A 1WLWA 4OYUA 1VBA3 4B8EA 4YFWA 4NHXA 3FL7A 1VBD3 2Y0IA 5IVFA 3TN92 2IXCA 1OSGA 1JODA 5D8AC 1HQNA 1RUI3 1I9RA 1GQHA 1OD3A 3KGZA 4NHLA 1N3PA 1QJFA 3JB8A 2BZDA 1YLLA 1G7YA 1B35C 1FOD2 5FY4A 5JOWA 1RYYA 3J4UH 5FYCA 1SZBA 1ZRFA 4CXWA 2OQ6A 4AE2A 3VBRB 2WL1A 3ACIA 3I2IA 1A34A 4MVTA 4C1XA 5A1LA 1O8SA 2VW0A 4FPCA 4LA2A 1C5IA 2VNVA 5FZ8A 3WNLA 1W39A 5CADA 1DQ5A 3DYMA 5C4WA 1MACA 3ZXGA 5JLVA 4RYDA 4BQ2A 4EN9B 5HPOA 2GALA 2K46A 2HBUA 4Y22A 1GV9A 4R8HA 4U36A 2ZHLA 5F39A 3DPRB 1W9FA 3K46A 3PTRB 2WA4A 1MEC2 5GZDA 1UZZA 1S1AA 3HQRA 3IB3A 4LKEA 2R073 2Q1FA 5AC92 5GLZA 4JC1A 5CFDA 3USSA 1GQGA 3VBOA 1ND2A 2WQ4A 2WLQA 1NE6A 2C9KA 3WG2A 4IV3C 2QFEA 3POBA 4AEKA 5FMCA 3UKVA 1J58A 1ODNA 4AVTA 1W2TA 4QT6A 2VXRA 5IK8A 3FZ3A 2JDKA 5FO7B 1F9KA 3ME2A 3DKQA 3TEWA 1AYM2 1UXZA 4XC9A 4AZZA 3MF6A 2O0OA 2VMGA 1IKQA 5GKAC 4TLGA 3FX3A 4BQ5A 3RZGA 2GC0A 2ZAAA 4DRVA 1QJY2 2B4KA 2FD8A 4M3CE 4UFJA 2EIGA 1U5YA 2Y64A 1AF9A 4Q4Y3 5FYVA 3WINE 4S2GA 1W0OA 1H6XA 2RHPA 2ERFA 1VBB3 4H7MA 2ZGOA 1UIKA 4XDPA 1JMUB 3ETPA 3IDBB 3IDCB 4IETA 3ZIWA 2JB8A 1DZQA 3W58A 4CCOA 4P9JA 2C5DA 1YQ6A 1PZ7A 4RGGA 1IGOA 2R071 1LODA 4E4SA 1OOPB 3NNLA 2LTNA 4ASLA 4LHLA 1HXS1 4CDQA 5JWPA 4FXKB 2UWAA 4Q0SA 4WVWA 3NKTA 1GLHA 1FV3A 4B3NA 1ENRA 1ZBA1 3VD5A 3OY8A 1W6NB 4ES8A 1PGL2 4ITCA 5T3NA 2XONA 4IE4A 1W6PB 5SV5A 2VOVA 5C8WA 5DXDA 4ZS3A 1HRV3 1XXNA 3AMHA 3ZXKA 2A6WA 1D4VB 2RM22 3KGLA 2VCMA 3ON7A 1MZ6A 2K9ZA 3NV3A 2W1SA 1J3QA 1N1VA 3PHMA 1F4HA 3QH7A 4HZFA 4RL7A 1NXMA 2PFWA 3PIGA 1DZTA 3NKGA 1GZTA 1I3HA 1LU1A 5C8CA 4HMZA 4PI0A 1QOTA 4DNYA 3ZSKA 3C7GA 3BOPA 2XL9A 4Q4Y1 5ACA3 3BPSA 3WD5A 2DF7A 1VBB1 3ACGA 3U1XA 2F6BA 1QJZA 1DQ2A 2ZGSA 1RGSA 4JVAA 4E8CA 2VVEA 5JXIA 3H8OA 3PNAA 3HVDA 5FZDA 1AYN3 2Y6LA 1IKPA 3RZJA 3VBUA 1ND2C 1GR3A 2WN2A 2PHDA 2ZAHA 1RUG1 2R0FA 4A3XA 4XDOA 4UW4A 2N7GA 2ZHMA 3LKJA 4MOAA 4O9EA 2JDHA 3AMMA 5JR7B 3WG4A 2E33A 2OX0A 4IEXA 1KITA 2G9FA 2R30A 4EN8B 3Q8FA 4PQQA 2ZTNA 5LW9A 3WP4A 3AP7A 4AFAA 4Q0QA 4V1PA 5F3EA 3J8F2 5A3TA 2NQYA 2P3IA 2G9ZA 1HJGA 2XJQA 3UT0A 1DYOA 1XNAA 5BY5A 4HK8A 2BDRA 2D7FA 1PVC2 1RINA 1MZEA 1J84A 2CYFA 1H0BA 2H0VA 5F2SA 5F3GA 3S7EA 4DIQA 5KBFA 4R4ZA 5KXDA 3A22A 4I3GA 2PHWA 2QQMA 4LE4A 4QB2A 2DWRA 4I2OA 2WNUC 2NMNA 4X6RB 5ACA1 3ZMOA 4AFMA 2QQPA 3WW4A 5BNNB 5GM0A 3VZNA 3OUJA 2P37A 3JU9A 1TMF3 2MEV3 3ZXDA 2H6CA 4CZSA 3VHRA 3ZXEA 3ZYBA 1AYN1 4HT1T 3H0OA 1GQPA 2UWBA 3K4DA 1UMZA 4XCAA 2W46A 4PIYA 5BPXA 3RWKX 3OYWB 1WW6A 3UJQA 4MGIE 1IHMA 4XTPA 4AEDC 4HPKA 5CBLA 1OH4A 2DU1A 4RD7A 4AHZA 2BEOA 4DPNA 4BISA 2FDKA 3UKTA 2W95A 3I3DA 3C8XA 5JIUA 1UMIA 1DP0A 3T1LA 2W91A 3V64A 2ZS6B 1N3OA 1OBNA 5C8CC 3LPFA 1S2KA 2YU2A 4AI0A 3VZMA 5A7WA 5KHIA 4FP2A 1HN1A 4Z82A 3WDXA 2WNVB 5BXXA 3T4HB 4Y3OA 1C57A 1W9SA 4A6SA 3I97A 2ILMA 1WCDJ 3Q8CA 5BNPA 5FRAA 4XFCA 2YY1A 1ND3A 3UGGA 3DF0A 1YQCA 3WNKA 1UOBA 1TMF1 2MEV1 1VALA 4UF0B 1ZZ6A 2B5HA 3FE5A 5J36A 1OVPA 1RUE2 4YW1A 2K0GA 1CWPA 3ZYRA 1OT5A 4L11A 4XABA 4QXKA 2OUJA 3O1TA 4AGGA 1X36A 3VBFB 2EVXA 5ABJC 1UY0A 2BGPA 3C3VA 4LULA 3SHRA 4PDWC 4GULA 3I3MA 3S5AA 1SCRA 2CHHA 3SITA 1VJ2A 3OBTA 1D2QA 3HD8B 3MI8A 5L9BA 5J09A 3LEMA 4CEYB 4OI2A 4QAWA 2FCTA 1KQRA 1OURA 3BTAA 2W68A 4YRDA 5T55A 1W2AX 4IEUA 1K3IA 4ISQA 4P9IA 3V0BA 1YC61 1JYNA 3VKLA 1RUF1 4GB32 4OUMA 1GP6A 3P1IA 1IZ3A 2PMWB 2W2IA 2Y6FA 4XTMA 3F2ZA 1PX4A 3FUQA 1H6YA 3ZSEA 2FDIA 1CONA 2NLRA 4OUSA 1QH7A 4HFSA 4KG0A 4LKFA 1AR93 2QVSB 4MXWB 4ONUA 4QQ2A 4AGVA 1XE7A 1TNRA 3ABZA 2ORZA 1JYWA 2DVAA 5E16A 5F3CA 4ASKA 1OPMA 4QHBA 1C8NA 2A6VA 1W0NA 2RR13 5AFEA 4W8JA 1AX0A 2JDYA 4PJYA 5GLVA 2YZ4A 3K77A 4R52A 5LASA 4BK4A 1MQTC 3ALQA 1PK6C 4QGMA 3WDUA 2P3YA 3FHAA 1H2MA 4MADA 4DXSA 5K0UA 2WZR1 1S0BA 4JGZA 4QX3A 3KZ4C 4K1ZA 5LRRA 5FYMA 4YM2A 3U78A 5L9RA 3VD3A 4DRRA 2AR6A 3MW2A 2ZEXA 3E6DA 2HBTA 4YM1A 3SC7X 2Q4SA 5A3PA 3M4FA 1AX2A 1K45A 1RUD3 1ONAA 1LHNA 3JXSA 4I3PA 5HBAA 2UWCA 3TNQA 3W5NA 1RITA 4XJUA 1AR91 4L9BA 3S6PA 1RL3A 1TME3 1VBC3 3AM2A 3BU7A 1EV12 4BQXA 3LOBA 3KCXA 4LK7A 4EN7B 3VN4A 4BHPA 4P14A 2CDOA 2EIBA 2XJPA 4HBNA 2PHTA 4HKWA 4WVVA 4EROA 4GH4A 4GWIA 1ZYBA 4UFHA 2RR11 1G6NA 5EJZB 3TEXA 1WLTA 3BYWA 4QPGB 2HEVF 5DPNA 5FP7A 3E97A 1GP5A 3LF7A 2V5YA 3AZZA 1KXGA 3J7NA 1ZZ9A 2Y0OA 4LLOA 3WF1A 1W8ZA 3FLTA 5HV0A 4AF9A 5IHRA 4META 3JZVA 5FCCA 5FY5A 2VJXA 1WD4A 4XIKA 2VZQA 4XFHA 2CNAA 4FO9A 1ULGA 3IM0A 2FHRA 4WM7C 2Z2SB 4LXLA 3W20A 3AL6A 1UKRA 2GNDA 1S0GA 4A2UA 4NR1A 4IE7A 3APBA 5LEKA 1ULPA 2YU1A 5KXBA 2XJSA 1ASJ2 3O1OA 4V2VA 5DAWA 5LATA 1TME1 4JKKA 3ILFA 4MGTA 5LA9A 1NCRC 3PL0A 2WC2A 3KT1A 2HEWF 3POEA 4XAEA 4B4RA 2PAEA 2JIJA 2WWJA 4KG8A 4D7SA 2D6LX 3KB5A 2XJVA 4O61A 2D44A 1N1YA 3UJOA 1GICA 5EQUA 3EHKA 5K0UC 3MIFA 1PIV2 1OH3A 2BOJA 3DN7A 4XF1A 5LRSA 1JUHA 1VLNA 2AEYA 1RUJ3 2WNUB 5EPAA 5FP3A 1AR62 3M3EA 4OHVA 3NWKA 3ETQA 4XPVA 3N7JA 4LHNA 4XURA 2VGDA 4OI0A 1XNCA 3WHUA 1OLRA 1VB2A 2CL2A 3FWEA 4ZU5A 1V6IA 2VCBA 1UY2A 4Y1UA 3T0AA 5G05L 3ZXFA 4QMAA 1W6MB 1LECA 3AFKA 2NPIA 4GWMA 1UYXA 4H3WA 4Z2WA 5JR2A 3MYXA 4V2WA 1PMIA 1X8EA 3T2PA 4RGAA 3LFIA 4AEDB 4CCEA 5FZLA 3VDDA 4Y5SA 2QZ2A 3OPWA 4EYUA 1WBLA 2XDVA 4CUGA 5ISLA 1Z78A 1W8NA 3BOWA 5EYYA 2X5IC 3UETA 5BNQA 2C9AA 4IE0A 3ACHA 1K5MC 3H3ZA 2HWB3 5HCBA 4Q1RA 5B2GB 1WD3A 1FPN2 4OULA 4CP0A 2IXIA 3H50A 2FMYA 2WS93 4FPGA 5FMOS 1HB3A 2YPDA 4Y1YA 1RUJ1 4RA0A 3W9AA 2JD4A 2WZPP 2XKPA 3RI8A 4K3UA 3UYJA 4PBPA 4XJWA 2A5ZA 2OPKA 1UL9A 4WV8A 4OVEA 3ZIXA 2EIDA 3CKHA 1W05A 2KM2A 1RTVA 3DPRA 4NIDA 1WZXA 4EZ4A 1W9TA 4FQ4A 2IXKA 3GZTB 5DMYA 4JKMA 1GUIA 1O4ZA 1UF2C 3GBGA 1CGPA 1L7QA 4Y24A 2RE9A 5FBZA 3H8UA 1LU2A 1GWKA 4QX5A 4OQ8A 3T0BA 5ABJB 3PVBB 4CU9A 3JD72 4P02B 4A7ZA 3Q8BA 1F8VA 2WO7A 4PDWB 1LULA 5FIXA 1VB4A 2HWF3 5D2AA 5A6YA 4LTAA 1ZBE2 2AYHA 4WZFA 5IJRA 4Q1PA 2HWB1 1NLQA 2ZEZA 4KGGA 3M3CA 4Y1ZA 3JBG2 1AUYA 2ARBA 1H1AA 2ZACA 4C91A 4FSJA 2YB7A 3VGIA 2QBXA 5JXJA 2ZCWA 4C1WA 1COV3 2E26A 2WWUA 4LPLA 2QDRA 1HDKA 5JUVA 2X09A 1LJ7A 3RI9A 1ODMA 2R49A 3VZJA 4JQRA 4CU8A 3ILRA 3OBZA 1ZRCA 4HLTA 1OOPA 3GBFA 2BWCA 3LWCA 1RB8G 1V6NA 5A6XA 2OW4A 4PQ9A 5FYZA 1CAWB 2VG9A 1DIWA 1YUDA 4S2HA 3IMMA 1W6NA 4BQ1A 5FKBA 4AYUA 1YJKA 5HCAA 1W6PA 2RS53 1YCIA 4YPJA 5T5OA 3ZSMA 1WUVA 2DU0A 2E32A 1CX4A 3RZLA 3I3QA 2MNGA 2A7AA 1Q8QA 1LEDA 1UZWA 3N7MA 2G4IA 2ZGUA 3POJA 4NAOA 3VBRC 4BPZA 3R0RA 4COWA 3IWZA 2RJKA 3DV8A 3HNMA 4N8MA 2XB6C 1VR3A 2ET7A 3ZYPA 1DU3D 1MQTB 4JGYA 5JVVA 4XMIA 1JYTA 1WA4A 5JIAA 4JDOA 4BYYA 4N43A 3ZMNA 4W6XA 2I74A 1QEXA 1JTZX 1NLRA 1VBA2 1VMJA 3HT2A 1ULDA 3RPQA 2BYVE 5IVVA 3ILNA 3ZR6A
chains in the Genus database with same CATH topology
1UWWA 3FL7A 4MGSA 2VMEA 3I3EA 3GM8A 2ZEYA 4LKSA 1JZ3A 2ID4A 4CUAA 1OD3A 3C7EA 4OZOA 4ZY9A 3VDBA 3A21A 4KMQA 2WAOA 2BZDA 3IAQA 3CZJA 2VZRA 5LA2A 4AAXA 1RYYA 3E1F1 1GOHA 1US2A 2WQ8A 1XC6A 4HG6B 4A4AA 3I2IA 3ACIA 1UX7A 3CIHA 1JYXA 3NJXA 1D7PM 1O8SA 4P00B 1GNYA 2J1AA 3WNLA 1NAEA 3DYMA 4ZZ5A 3AC0A 4RYDA 5HPOA 4A6OA 2W3JA 2DCKA 2VZ3A 2W5FA 5FUIA 3A23A 3K46A 4QX0A 1SG3A 3CZUA 3J7HA 3IB3A 2PQSA 4ZXEA 2JE8A 4CVUA 2C9KA 4IUGA 3OB8A 4KI5M 3WF4A 2J1TA 3OGRA 5EJ1B 2YC4A 3DYOA 1TG7A 1W8OA 3OEAA 1UXZA 4OMCA 1JU4A 4QDQA 2VCAA 4W50A 2B4KA 4AG4A 1SHWB 2VO5A 1IQDC 1JI6A 1WCQA 4DEQA 2Y64A 4ARXA 1H6XA 1UMHA 2W92A 5J1XA 1PX3A 3ETPA 2ZEWA 2J22A 2Y8KA 1O59A 2W1UA 5IYYA 2QQIA 4QPWA 4QX1A 3FHQA 3VD5A 3T08A 2VQTA 2VQUA 2R7EB 2XONA 2C4XA 3A7QA 2WDBA 5G04L 2W1SA 2VMDA 1F4HA 4MGQA 1UXXX 4XUQA 3C7GA 3MV11 3C7HA 1W9WA 3LPGA 4JHZA 3WEZA 3VD9A 3ACGA 4ZZ8A 2YFZA 1DLCA 5C7GA 4XVHA 3FN9A 2X05A 4E8CA 5JXIA 2Z4FA 3PUIA 2HLEA 1UYZA 2Y6LA 5DN2A 1WKYA 2WN2A 1JHJA 2Y6GA 2WO2A 5DQ0A 4BJ0A 4MOAA 2KD7A 4QB1A 2Y6HA 4XUNA 2E33A 2EICA 1F4AA 3MBWA 4PQQA 3SEPA 4DEVA 4BDVB 3VD4A 2W9XA 3C7OA 1KEXA 2WBKA 2QQJA 1DYOA 1XNAA 2C26A 3OGVA 3W5MA 5CYYA 2L9LA 4OMDA 1J84A 3A22A 2QQMA 4QB2A 3P6BA 3VDCA 3WNOA 1BHGA 5C70A 2RJ2A 4W4ZA 3T09A 4CU7A 4JX0A 4QX2A 4A42A 3WF0A 1GQPA 3K4DA 3BN6A 3WSOA 3HNBM 2W46A 3THCA 2CDPA 1JZ5A 4A3ZA 1OH4A 1ULOA 1UY1A 2W95A 3I3DA 3C8XA 1JZ7A 1UMIA 3SKVA 5IFPA 1DP0A 2WN3A 2W91A 3I2HA 3LPFA 1PMHX 2YFUA 1HN1A 3MUZ1 2W94A 1W9SA 3I97A 4BXSV 1J83A 1UZ0A 4CU6A 3WNKA 5B4NA 2ORXA 3WF2A 3GGLA 5A1AA 3DECA 2VZUA 3D3AA 1OT5A 3I2FA 3K4AA 1UY0A 2WAAA 2BGPA 3SEEA 2V5DA 5JMOA 4CUCA 2QQLA 2W1QA 1UY3A 1SDDB 3MO4A 1CZTA 2V4VA 1JU3A 3CDZB 4QAWA 1I5PA 4P08A 2X10A 1K3IA 2EIEA 2WZEA 3IDAA 1JYNA 3WNPA 3LEGA 2QQOA 2VC9A 3P1IA 1XNTA 4DXTA 4D8MA 4DUXA 3F2ZA 1PX4A 2DCJA 2VZVA 1H6YA 1GU3A 1JYVA 4DUVA 5LCWL 1MPXA 3ABZA 4QB6A 2ORZA 1JYWA 5B4XA 4TXWA 3WF3A 4DXRA 3VDAA 1W0NA 4GWJA 4W8JA 3IAPA 3K77A 4BK4A 2QQNA 5F7UA 4L0PA 3FHAA 4MADA 2WABA 3ZM8A 1OF4A 4P5YA 3HPNA 4DXSA 4QDSA 4QX3A 3GXUA 3VD3A 3WNMA 1JZ4A 5HXMA 2ZEXA 1GOFA 2VM9A 3T2OA 2YC2A 2ZXQA 3T2QA 5C71A 1K45A 3JXSA 5EIYB 2WO1A 4M4PA 3W5NA 1TVGA 2J1EA 2VMCA 2WO3A 4A41A 2BBAA 2CDOA 2EIBA 2YG0A 4GWIA 5EJZB 2OKXA 3NJVA 3CMGA 5DPNA 3K75B 3NNGA 5CZKA 2XHNA 3WF1A 3SKJE 5IHRA 2J7MA 4MO3M 2VJXA 2VR4A 1NX9A 2VZQA 1W99A 5JXGA 5I0DA 3EB7A 2BGOA 1NKGA 1ULPA 1JZ6A 3LQCA 3GDBA 4LHSA 3CQOA 3OEBA 4JKKA 2VL4A 4E8DA 1XPWA 1CZVA 4DUWA 1CIYA 1UYYA 1R64A 2W47A 1CX1A 3NQHA 2RV9A 4LQRA 2VZOA 2VCCA 4UAPA 3LEKA 2VTFA 1K12A 2E31A 2JDAA 2V72A 4GZ9A 3DYPA 3HEIA 4XURA 2VZPA 4D0QA 2DDUA 3WQBA 2VOTA 2VCBA 1UY2A 3T0AA 5G05L 1O8PA 4FI9A 5JR2A 1JZ8A 1UYXA 2XQXA 4JKLA 2Y6JA 4OUEA 4UOJA 4PT6A 3I2GA 3T2PA 3T0DA 2QQKA 3EYPA 3PUHA 1L7RA 1W8NA 3UETA 3NRUA 4XUOA 3ACHA 4KWUA 1UY4A 2JKXA 3OG2A 2WYSA 2B9VA 4A45A 3BGAA 1OF3A 2JD9A 4TTGA 1CZSA 2BERA 4BK5A 3LEIA 3ECQA 3ACFA 2EIDA 3CKHA 5LA1A 3C7FA 3WNNA 1EUTA 3HOBA 1JZ2A 1W9TA 1GOGA 3U37A 4JKMA 5DMYA 5LA0A 2Y6KA 3K4ZA 1GUIA 3VD7A 4QDRA 1PMJX 4XZUG 1L7QA 1EUUA 1P8JA 2HYXA 3OBAA 4M4RA 5JXHA 2VZTA 3T0BA 4A44A 3I2JA 4CU9A 2W1WA 2WZ8A 4P02B 2WUHA 1KGYA 2XOMA 4ET7A 3LE0A 4Z2AA 5IJRA 4CUBA 2J1SA 3IIIA 2ZEZA 4ARYA 1T2XA 3OGSA 2YB7A 4XUPA 2QBXA 3THDA 5JXJA 2E26A 3HN3A 3MUY1 4LPLA 3HJRA 5JUVA 1NUKA 2X09A 4CU8A 1GMMA 3I2KA 1US3A 5IFTA 2VMFA 1K42A 2RVAA 4UI9L 3HNYM 4YPJA 2E32A 2VZSA 2LW8A 4RN5A 4XUTA 3UNPA 3HNMA 1LNSA 1YQ2A 2VZ1A 4PF1A 2J1RA 2LS6A 3UESA 3MV01 2J1VA 2W87A 3I3BA 2J1UA 4OYUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UWW A;  3FL7 A;  4MGS A;  2VME A;  3I3E A;  3GM8 A;  2ZEY A;  4LKS A;  1JZ3 A;  2ID4 A;  4CUA A;  1OD3 A;  3C7E A;  4OZO A;  4ZY9 A;  3VDB A;  3A21 A;  4KMQ A;  2WAO A;  2BZD A;  3IAQ A;  3CZJ A;  2VZR A;  5LA2 A;  4AAX A;  1RYY A;  3E1F 1;  1GOH A;  1US2 A;  2WQ8 A;  1XC6 A;  4HG6 B;  4A4A A;  3I2I A;  3ACI A;  1UX7 A;  3CIH A;  1JYX A;  3NJX A;  1D7P M;  1O8S A;  4P00 B;  1GNY A;  2J1A A;  3WNL A;  1NAE A;  3DYM A;  4ZZ5 A;  3AC0 A;  4RYD A;  5HPO A;  4A6O A;  2W3J A;  2DCK A;  2VZ3 A;  2W5F A;  5FUI A;  3A23 A;  3K46 A;  4QX0 A;  1SG3 A;  3CZU A;  3J7H A;  3IB3 A;  2PQS A;  4ZXE A;  2JE8 A;  4CVU A;  2C9K A;  4IUG A;  3OB8 A;  4KI5 M;  3WF4 A;  2J1T A;  3OGR A;  5EJ1 B;  2YC4 A;  3DYO A;  1TG7 A;  1W8O A;  3OEA A;  1UXZ A;  4OMC A;  1JU4 A;  4QDQ A;  2VCA A;  4W50 A;  2B4K A;  4AG4 A;  1SHW B;  2VO5 A;  1IQD C;  1JI6 A;  1WCQ A;  4DEQ A;  2Y64 A;  4ARX A;  1H6X A;  1UMH A;  2W92 A;  5J1X A;  1PX3 A;  3ETP A;  2ZEW A;  2J22 A;  2Y8K A;  1O59 A;  2W1U A;  5IYY A;  2QQI A;  4QPW A;  4QX1 A;  3FHQ A;  3VD5 A;  3T08 A;  2VQT A;  2VQU A;  2R7E B;  2XON A;  2C4X A;  3A7Q A;  2WDB A;  5G04 L;  2W1S A;  2VMD A;  1F4H A;  4MGQ A;  1UXX X;  4XUQ A;  3C7G A;  3MV1 1;  3C7H A;  1W9W A;  3LPG A;  4JHZ A;  3WEZ A;  3VD9 A;  3ACG A;  4ZZ8 A;  2YFZ A;  1DLC A;  5C7G A;  4XVH A;  3FN9 A;  2X05 A;  4E8C A;  5JXI A;  2Z4F A;  3PUI A;  2HLE A;  1UYZ A;  2Y6L A;  5DN2 A;  1WKY A;  2WN2 A;  1JHJ A;  2Y6G A;  2WO2 A;  5DQ0 A;  4BJ0 A;  4MOA A;  2KD7 A;  4QB1 A;  2Y6H A;  4XUN A;  2E33 A;  2EIC A;  1F4A A;  3MBW A;  4PQQ A;  3SEP A;  4DEV A;  4BDV B;  3VD4 A;  2W9X A;  3C7O A;  1KEX A;  2WBK A;  2QQJ A;  1DYO A;  1XNA A;  2C26 A;  3OGV A;  3W5M A;  5CYY A;  2L9L A;  4OMD A;  1J84 A;  3A22 A;  2QQM A;  4QB2 A;  3P6B A;  3VDC A;  3WNO A;  1BHG A;  5C70 A;  2RJ2 A;  4W4Z A;  3T09 A;  4CU7 A;  4JX0 A;  4QX2 A;  4A42 A;  3WF0 A;  1GQP A;  3K4D A;  3BN6 A;  3WSO A;  3HNB M;  2W46 A;  3THC A;  2CDP A;  1JZ5 A;  4A3Z A;  1OH4 A;  1ULO A;  1UY1 A;  2W95 A;  3I3D A;  3C8X A;  1JZ7 A;  1UMI A;  3SKV A;  5IFP A;  1DP0 A;  2WN3 A;  2W91 A;  3I2H A;  3LPF A;  1PMH X;  2YFU A;  1HN1 A;  3MUZ 1;  2W94 A;  1W9S A;  3I97 A;  4BXS V;  1J83 A;  1UZ0 A;  4CU6 A;  3WNK A;  5B4N A;  2ORX A;  3WF2 A;  3GGL A;  5A1A A;  3DEC A;  2VZU A;  3D3A A;  1OT5 A;  3I2F A;  3K4A A;  1UY0 A;  2WAA A;  2BGP A;  3SEE A;  2V5D A;  5JMO A;  4CUC A;  2QQL A;  2W1Q A;  1UY3 A;  1SDD B;  3MO4 A;  1CZT A;  2V4V A;  1JU3 A;  3CDZ B;  4QAW A;  1I5P A;  4P08 A;  2X10 A;  1K3I A;  2EIE A;  2WZE A;  3IDA A;  1JYN A;  3WNP A;  3LEG A;  2QQO A;  2VC9 A;  3P1I A;  1XNT A;  4DXT A;  4D8M A;  4DUX A;  3F2Z A;  1PX4 A;  2DCJ A;  2VZV A;  1H6Y A;  1GU3 A;  1JYV A;  4DUV A;  5LCW L;  1MPX A;  3ABZ A;  4QB6 A;  2ORZ A;  1JYW A;  5B4X A;  4TXW A;  3WF3 A;  4DXR A;  3VDA A;  1W0N A;  4GWJ A;  4W8J A;  3IAP A;  3K77 A;  4BK4 A;  2QQN A;  5F7U A;  4L0P A;  3FHA A;  4MAD A;  2WAB A;  3ZM8 A;  1OF4 A;  4P5Y A;  3HPN A;  4DXS A;  4QDS A;  4QX3 A;  3GXU A;  3VD3 A;  3WNM A;  1JZ4 A;  5HXM A;  2ZEX A;  1GOF A;  2VM9 A;  3T2O A;  2YC2 A;  2ZXQ A;  3T2Q A;  5C71 A;  1K45 A;  3JXS A;  5EIY B;  2WO1 A;  4M4P A;  3W5N A;  1TVG A;  2J1E A;  2VMC A;  2WO3 A;  4A41 A;  2BBA A;  2CDO A;  2EIB A;  2YG0 A;  4GWI A;  5EJZ B;  2OKX A;  3NJV A;  3CMG A;  5DPN A;  3K75 B;  3NNG A;  5CZK A;  2XHN A;  3WF1 A;  3SKJ E;  5IHR A;  2J7M A;  4MO3 M;  2VJX A;  2VR4 A;  1NX9 A;  2VZQ A;  1W99 A;  5JXG A;  5I0D A;  3EB7 A;  2BGO A;  1NKG A;  1ULP A;  1JZ6 A;  3LQC A;  3GDB A;  4LHS A;  3CQO A;  3OEB A;  4JKK A;  2VL4 A;  4E8D A;  1XPW A;  1CZV A;  4DUW A;  1CIY A;  1UYY A;  1R64 A;  2W47 A;  1CX1 A;  3NQH A;  2RV9 A;  4LQR A;  2VZO A;  2VCC A;  4UAP A;  3LEK A;  2VTF A;  1K12 A;  2E31 A;  2JDA A;  2V72 A;  4GZ9 A;  3DYP A;  3HEI A;  4XUR A;  2VZP A;  4D0Q A;  2DDU A;  3WQB A;  2VOT A;  2VCB A;  1UY2 A;  3T0A A;  5G05 L;  1O8P A;  4FI9 A;  5JR2 A;  1JZ8 A;  1UYX A;  2XQX A;  4JKL A;  2Y6J A;  4OUE A;  4UOJ A;  4PT6 A;  3I2G A;  3T2P A;  3T0D A;  2QQK A;  3EYP A;  3PUH A;  1L7R A;  1W8N A;  3UET A;  3NRU A;  4XUO A;  3ACH A;  4KWU A;  1UY4 A;  2JKX A;  3OG2 A;  2WYS A;  2B9V A;  4A45 A;  3BGA A;  1OF3 A;  2JD9 A;  4TTG A;  1CZS A;  2BER A;  4BK5 A;  3LEI A;  3ECQ A;  3ACF A;  2EID A;  3CKH A;  5LA1 A;  3C7F A;  3WNN A;  1EUT A;  3HOB A;  1JZ2 A;  1W9T A;  1GOG A;  3U37 A;  4JKM A;  5DMY A;  5LA0 A;  2Y6K A;  3K4Z A;  1GUI A;  3VD7 A;  4QDR A;  1PMJ X;  4XZU G;  1L7Q A;  1EUU A;  1P8J A;  2HYX A;  3OBA A;  4M4R A;  5JXH A;  2VZT A;  3T0B A;  4A44 A;  3I2J A;  4CU9 A;  2W1W A;  2WZ8 A;  4P02 B;  2WUH A;  1KGY A;  2XOM A;  4ET7 A;  3LE0 A;  4Z2A A;  5IJR A;  4CUB A;  2J1S A;  3III A;  2ZEZ A;  4ARY A;  1T2X A;  3OGS A;  2YB7 A;  4XUP A;  2QBX A;  3THD A;  5JXJ A;  2E26 A;  3HN3 A;  3MUY 1;  4LPL A;  3HJR A;  5JUV A;  1NUK A;  2X09 A;  4CU8 A;  1GMM A;  3I2K A;  1US3 A;  5IFT A;  2VMF A;  1K42 A;  2RVA A;  4UI9 L;  3HNY M;  4YPJ A;  2E32 A;  2VZS A;  2LW8 A;  4RN5 A;  4XUT A;  3UNP A;  3HNM A;  1LNS A;  1YQ2 A;  2VZ1 A;  4PF1 A;  2J1R A;  2LS6 A;  3UES A;  3MV0 1;  2J1V A;  2W87 A;  3I3B A;  2J1U A;  4OYU A; 
#chains in the Genus database with same CATH topology
 1UWW A;  3DEM A;  1V00 A;  1JXN A;  4RR3 C;  2ZAB A;  4P9W A;  1S55 A;  1VAV A;  3W21 A;  1RUI 2;  1ZVF A;  3O1S A;  1S2B A;  3NO8 A;  1BK1 A;  1ZZC A;  5I93 A;  2VD7 A;  2NN8 A;  4CUA A;  3AJY A;  4OZO A;  5T5L A;  3DUI A;  3A21 A;  2RDQ A;  3POS A;  4KMQ A;  1W90 A;  3I54 A;  2WFF 3;  1EPZ A;  3R4U A;  4OQ9 A;  4GKX A;  4LHK A;  3ZFE B;  4AAX A;  5L73 A;  1QQP 3;  2PTM A;  4QX7 A;  3N4M A;  1HRI 3;  1XC6 A;  4A4A A;  2HEY F;  1Q8V A;  4Q8K A;  2DFC A;  3P3P A;  4D6S A;  1D7P M;  1V6M A;  4AOC A;  4G9S B;  5C5T A;  1JHN A;  2UYB A;  1SLA A;  1VAM A;  3CEW A;  5BNN A;  5KC6 A;  5JOX A;  1O4T A;  1QF3 A;  3IPV B;  1W28 A;  4EN6 B;  2WT2 A;  4QPI C;  1EP0 A;  3AC0 A;  4ZZ5 A;  3Q8E A;  2W5F A;  2R07 2;  2ZX3 A;  2NZ9 A;  2IZW A;  1XND A;  4QX0 A;  4LE3 A;  1SG3 A;  2Q1Z B;  2UUR A;  3I59 B;  5A7P A;  1URX A;  2P4E A;  2Z69 A;  4XOG A;  1ZBA 2;  5A3W A;  5C3Q A;  1OA3 A;  1QIQ A;  3OB8 A;  4BQY A;  1Y9Q A;  2A6Y A;  3CL1 A;  1NCR B;  2HWD 3;  2ZGT A;  4GAZ A;  3WVJ A;  3H8R A;  1IS6 A;  5FJH A;  3OGR A;  1Y3T A;  1LOB A;  2WFF 1;  3AJZ A;  5GZF A;  1OKQ A;  4URA A;  4HON A;  4X8N A;  4ZU7 A;  2E7Q A;  3QCW A;  5LK5 A;  5AFB A;  3OEA A;  4XDQ A;  1QQP 1;  4YZ5 A;  4FXG B;  1HRI 1;  1OLM A;  3PU8 A;  1CAX B;  4K8F A;  4IEO A;  4NRQ A;  1CES A;  4OMC A;  3CHX A;  3N9P A;  4QDQ A;  4C0H A;  2WNV A;  4Q4Y 2;  1IG0 A;  2VCA A;  2DTY A;  1SHW B;  3ES4 A;  1JI6 A;  1VBB 2;  3CU7 A;  4RGK A;  5F1R A;  1AL2 3;  4ARX A;  1FX5 A;  1ZRI A;  3WCS A;  2WLP A;  3FC0 A;  4UF0 A;  2W92 A;  4AHY A;  4RQP C;  1LKN A;  1OLQ A;  1C4R A;  1PX3 A;  3EXU A;  4Y26 A;  5LBB A;  3H3U A;  2YPJ A;  4AFC A;  5D8A A;  4BE3 A;  2QCS B;  4AEJ A;  1SFP A;  2W1U A;  1LOF C;  1LGB A;  2QQI A;  5F6K A;  1YQ5 A;  4L2N A;  4QPW A;  3FHQ A;  3N9N A;  3O14 A;  4YVS C;  3T08 A;  1GAN A;  2P5B A;  4OCT A;  1HRV 2;  3BAL A;  2C1F A;  2JG9 C;  1UKG A;  3A7Q A;  4NIG A;  2GP3 A;  1D2S A;  2NYY A;  2VXJ A;  5FZB A;  1K5M B;  2JEM A;  1D4M 3;  5E88 A;  1G9D A;  2GSY A;  1XYN A;  1WW4 A;  2VMD A;  2YUE A;  3NNF A;  2PEL A;  4TZD A;  3E5Q A;  2IVJ A;  1W0P A;  1IQA A;  5ACA 2;  4I01 A;  2B8M A;  4HET A;  5H9P A;  3RSJ A;  4YW7 A;  3L9J T;  4AVV A;  3FLR A;  3WQ1 A;  1AL2 1;  5FWE A;  3LPG A;  3AYA A;  4JHZ A;  3WEZ A;  1HLC A;  2D97 A;  3KQ4 B;  4UT5 A;  1G8W A;  1AYN 2;  3P5B A;  3CJX A;  1IS5 A;  4IQP A;  4LO7 A;  3PUI A;  2HLE A;  4FPK A;  4MXW A;  4QQP A;  4QU1 A;  2Y6G A;  2WO2 A;  1GZW B;  1SLC A;  3JD7 1;  3POY A;  5BNO C;  2BUK A;  5FPV A;  4XUN A;  2EIC A;  1F4A A;  3B9I A;  3B02 A;  4MGZ E;  4DEV A;  3AKS A;  3RYK A;  2EXH A;  1KD7 A;  1HJF A;  1H8V A;  1POV 1;  3OGV A;  4YGB A;  3W5M A;  4ZU4 A;  5CYY A;  3B5L B;  4I09 A;  2L9L A;  1CQ9 A;  4KBZ A;  5FYS A;  1LB2 A;  4F7Z A;  2D6N A;  1LOA A;  1UO9 A;  2Q8E A;  1BQP A;  5FZ1 A;  2BV4 A;  2VVD A;  5HCF A;  2EAL A;  1TMF 2;  2MEV 2;  2UU8 A;  3A4U A;  3ZDV A;  3WNO A;  3B3Q E;  5EYX A;  3BKZ A;  3T09 A;  5HV4 A;  1VPH A;  3RGB A;  2W52 A;  2YBP A;  1TZO A;  4FP3 A;  4CU7 A;  2G1M A;  5A7N A;  3WP5 A;  3VBF C;  2VNR A;  4WVZ A;  4PLM A;  2EAK A;  5FAX A;  2GNM A;  1ST8 A;  3HNB M;  1AXK A;  4KNC A;  1OFN A;  2R04 3;  1VRH 3;  1JZ5 A;  2RG4 A;  2ZMN A;  1C8M 3;  3ASI A;  3FJS A;  4B1M A;  2NP0 A;  1ZZ8 A;  3AKR A;  2R06 3;  1SBE A;  4I0W B;  4CEY C;  4ES9 A;  5A1F A;  3AP5 A;  1JZ7 A;  3I2O A;  1GKB A;  4XET A;  5JOY A;  3ZOI A;  1OUX A;  2ARE A;  3BUC A;  3AKT A;  1PGS A;  1QXR A;  4AVS A;  2YFU A;  2D3P A;  3VKO A;  3B94 A;  1RUF 2;  1VBA 1;  3CJI C;  5FUP A;  1VBD 1;  3PIJ A;  4IEV A;  1UAI A;  4HVR A;  1LOE A;  4N9I A;  3LA3 A;  4CE8 A;  1GBG A;  4DY3 A;  3M3Q A;  1CPN A;  5B4N A;  1W6Q B;  2JJ6 A;  2ORX A;  2Y60 A;  4L92 A;  1RUI 1;  2RJL A;  3WF2 A;  1UNB A;  3DGT A;  1XNK A;  3KS7 A;  4RR3 B;  4KU7 A;  4EN0 A;  5A1A A;  4IXL A;  4CTE A;  3I4I A;  1JYC A;  1UPI A;  2W0X A;  3RMY A;  2D93 A;  1DGW X;  1PZ9 A;  2BOI A;  4MYE A;  4QPY A;  4UBH A;  4TSV A;  1VRH 1;  4QQL A;  3ZPY A;  4E2Q A;  1W2O A;  4LO5 B;  1C8M 1;  2WAA A;  2YMZ A;  1SQ4 A;  1SLI A;  2E7T A;  1STM A;  2V5D A;  3AZW A;  1RXF A;  2XJT A;  2Y26 A;  4BWO A;  2R06 1;  3AFG A;  2QQL A;  4QM9 A;  2IXJ A;  1UZY A;  1CZT A;  2V4V A;  4K9S A;  1JU3 A;  2G9G A;  4NOT A;  4WM8 C;  3EQE A;  1V70 A;  3CDZ B;  1RMU 3;  2WZR 2;  1OPO A;  2WNU A;  1QJU 3;  3M1H A;  1JW6 A;  2BGC A;  4J1W A;  2PHR A;  1J3R A;  5FY1 A;  3S57 A;  1ZRD A;  3DXT A;  3VKN A;  1BLZ A;  2EIE A;  2WZE A;  2VW1 A;  4C90 A;  1IPS A;  1ULF A;  3WDT A;  4QPI B;  1W8F A;  4XFA A;  1W6M A;  3RWN A;  1XNT A;  2QQU A;  1WLC A;  4DUX A;  2IXH A;  1LHO A;  1AR9 2;  2D3R A;  3K48 A;  2O8Q A;  4AED A;  2PA7 A;  3OD0 A;  4QWN A;  2JDZ A;  1GU3 A;  1JYV A;  1UOG A;  2E9Q A;  3GF6 A;  1W8T A;  4IEW A;  4XF0 A;  4AQT A;  5IVJ A;  3ZYG A;  2HYK A;  2FBE A;  1PM4 A;  5T5J A;  3ZYH A;  1HKD A;  2FCV A;  5CKQ A;  1J3P A;  3POG A;  1WCU A;  4QB6 A;  1UOF A;  1WBF A;  1LTE A;  2RS3 3;  5FPB A;  5CG8 A;  4QPG C;  2RR1 2;  2HWC 3;  5K9Y A;  3IKW A;  4TXW A;  5FZO B;  4LT5 A;  4QXH A;  5LBF A;  4CCL A;  2R1D A;  3MIB A;  1RED A;  4GWJ A;  1LEN A;  3VDA A;  4BZ4 A;  4BXF A;  3U75 A;  3IAP A;  2Q5T A;  5DG1 A;  3HR9 A;  1RMU 1;  4PHZ A;  1GP4 A;  4U2A A;  1QJU 1;  3AYE A;  2IFR A;  5F7U A;  4XXA A;  1HB2 A;  4KGQ A;  3ZM8 A;  4P9Y A;  3HPN A;  1R08 3;  3ZN6 A;  4E2S A;  4COU A;  4JTN A;  5LK7 B;  5C3R A;  3T2T A;  3G6J B;  5IVC A;  3P3N A;  1RUC 3;  4IES A;  4HKO A;  1QOS A;  4RQP B;  5HXM A;  1UQX A;  1RUD 2;  4CPB A;  1GOF A;  1QU0 A;  4COV A;  3SMH A;  1QJE A;  1W8H A;  2YC2 A;  2ZXQ A;  3EO6 A;  4LIU A;  3UGF A;  3VBS C;  5C71 A;  2Z79 A;  3WW2 A;  4BCU A;  4KQ7 A;  1W8U A;  1OA4 A;  1TME 2;  1VBC 2;  2PHF A;  3RZZ A;  1R09 3;  5JZG C;  4IE6 A;  2RDR A;  3TNP B;  1TVG A;  2WO3 A;  4LBM A;  5ABJ A;  3IMN A;  4BH9 A;  2ZKL A;  3OJB A;  1HRV 1;  4PDW A;  4IEZ A;  2QNK A;  3KLS A;  4LBQ B;  2ZOE B;  2YC0 A;  1O5L A;  4QKD A;  2EXI A;  4YVS B;  4XCB A;  4Y4Y A;  2HWC 1;  2DCZ A;  2JG9 B;  1ENS A;  1ENX A;  1PHM A;  2XJU A;  3M2M A;  4HSJ A;  4LBO A;  1VIW B;  1XNB A;  2YG0 A;  2OKX A;  4B29 A;  3NJV A;  2E53 A;  3LCP A;  5FY0 A;  3NNG A;  3WV6 A;  2A3W A;  3BTZ A;  4YFZ A;  4YVW C;  4UBG A;  5DUU A;  4JDM A;  1AJO A;  1LES A;  3SKJ E;  3H1M A;  2YRO A;  4Q27 A;  2AEN A;  3SNM A;  2OII A;  5I0S A;  1VAK A;  4HVO A;  2D6P A;  2VR4 A;  1AXZ A;  4S2D A;  4DQA A;  1O3Q A;  3GAL A;  4E9K A;  2JIC A;  3BCW A;  1PM7 A;  5FLH A;  2B39 A;  4QQH A;  1CAW A;  5EFU A;  1D0G A;  1ZZB A;  2CWM A;  1JZ6 A;  3LQC A;  4Q4W 3;  5A3N A;  1J1L A;  1WMX A;  4AVB A;  5BNO B;  1NA1 B;  4HN1 A;  2VL4 A;  4FAH A;  2BVB A;  2RDN A;  5APA A;  5IW0 A;  1KS5 A;  4D7T A;  1NCQ C;  2KA3 A;  3TAY A;  2EF6 A;  3TN9 3;  4DUW A;  4WZC A;  5FOJ B;  1YFU A;  4Y1V A;  1OD5 A;  1OLM E;  2ZGQ A;  1MQT A;  1U0A A;  4P9G A;  1PK6 A;  4UYB A;  3FHI B;  2W47 A;  4XQ4 A;  1AX1 A;  1NT0 A;  1RUJ 2;  5FZE A;  1LCL A;  2RV9 A;  2VZO A;  5DZE A;  2VCC A;  4UAP A;  2VTX A;  4S2F A;  5GLU A;  2VTF A;  2E31 A;  3PVN A;  1FOD 3;  3VLB B;  2JDU A;  1JS9 A;  3ZSL A;  2XWJ B;  1OXC A;  2DDU A;  3PME A;  4PF5 A;  2A1X A;  2VOT A;  1OFS A;  5FMD A;  3U07 A;  1O8P A;  3WW3 A;  5DZF A;  4JKL A;  3BB6 A;  3U4X A;  3HQX A;  1NY7 1;  4N53 C;  3TEZ A;  4QX8 A;  1F31 A;  1L3J A;  1W06 A;  3L2Y A;  4CYD A;  5FYB A;  5KR7 A;  2AEZ A;  3WQ0 A;  5JOZ A;  2P1B A;  3KSC A;  4I30 A;  4JRL A;  3I2D A;  4YLZ A;  2QQK A;  3EYP A;  1AHS A;  2OT7 A;  5FXX A;  3VBH B;  2P6H A;  4N9H A;  3ZFE A;  3JCI A;  2FQP A;  3PUH A;  4LO4 B;  5A32 B;  1MEC 3;  5FYY A;  2HWB 2;  1DYP A;  1IPJ A;  5BV6 A;  3RQ0 A;  1E5I A;  1F15 A;  3BIW E;  4I0A A;  5IK7 A;  5FZG A;  4LBQ D;  3N9Q A;  1W9Y A;  2WKK A;  3OG2 A;  1PGW 1;  4E2G A;  1IOA A;  4MGK E;  4CCJ A;  4YGD A;  5F6L B;  3IZO A;  4AHX A;  1RJ8 A;  2VUC A;  3BGA A;  4CDW B;  1EYB A;  2JD9 A;  1MS3 A;  2YBK A;  3CJI B;  4BK5 A;  3IPV A;  4L97 A;  4O9G A;  4P9X A;  4WM7 A;  4CEW C;  4D7Y A;  5DUV A;  1Q5O A;  5DDJ 3;  5FBJ A;  2RS1 3;  2VOX A;  2D5F A;  3VHN A;  3C7F A;  4LLF A;  3HOB A;  4COY A;  2GN3 A;  3I59 A;  3LAG A;  1O3T A;  1QXJ A;  2BVV A;  3K4Z A;  3USU B;  4OHX A;  3PDQ A;  2WR9 A;  5CKN A;  3O0X A;  3POW A;  3WG1 A;  1NCR A;  1EUU A;  1P8J A;  1S2E A;  2HYX A;  4QQO A;  3RVH A;  3HWJ A;  1H4H A;  4Q29 A;  1VMF A;  1NQD A;  2OUH A;  4QHZ A;  2DYC A;  1N3Q A;  2ZHN A;  3AZY A;  3PVE A;  5EZW A;  3BIE A;  3U0Z A;  1KDK A;  1YI9 A;  1CAX A;  4WM8 B;  3GNE A;  4UFM A;  4R9D A;  3OGG A;  2FZ2 A;  4ARY A;  3V0A B;  2XWB B;  4RFT 0;  2Z42 A;  4LKD A;  1T2X A;  2GDF A;  5FR3 A;  4AVA A;  2R32 A;  1MS8 A;  2CGP A;  4XIL A;  4NII A;  4EWA A;  1NQJ A;  5FPL A;  3HN3 A;  3KT4 A;  3MUY 1;  2JEN A;  1LHW A;  5DDJ 1;  1IPK A;  2RS1 1;  3HJR A;  4FQZ A;  3WW1 A;  4XBN A;  4YM0 A;  2A75 A;  4PIZ A;  3TEY A;  2E7A A;  1SFN A;  4E4Z A;  4JDN A;  4NVP A;  2QJV A;  1OHF A;  4IEQ A;  2Q8D A;  5J48 A;  4FTE A;  5FQ0 B;  1HB4 A;  4XYX A;  4G3Y C;  4XW3 A;  5A7O A;  1NG0 A;  5K7P A;  3RRD A;  1WCS A;  1HIX A;  5FZI A;  3ZFE C;  3ZFF C;  2X5I A;  5IVY A;  1K5J A;  4LA3 A;  4RN5 A;  5J3U A;  1K5M A;  1SPP B;  1S4C A;  1YFX A;  2JXA A;  4BIF A;  1LOG A;  1W04 A;  3F95 A;  4EJR A;  1LNS A;  1POV 0;  1KJL A;  1YQ2 A;  2VZ1 A;  4PF1 A;  1G9A A;  4IEY A;  2LS6 A;  3UES A;  3ZO0 B;  2ZX1 A;  2J1V A;  4CCN A;  3NV4 A;  2XLF A;  4JV4 A;  4QGN A;  3J8F 3;  1NYW A;  5FKC A;  1KJR A;  3D8C A;  1RUD 1;  5JI7 A;  2XVG A;  3I3B A;  3VB9 A;  4EE2 A;  5D21 A;  2ZJC A;  1YWK A;  4MZU A;  3ORJ A;  2J1U A;  3U4S A;  3VZK A;  3TB0 A;  5LZ6 A;  4OHY A;  1XE8 A;  3NW4 A;  3AKQ A;  3VBS B;  1QXP A;  4MGS A;  2JG8 B;  1FMD 3;  3ZYI B;  4UWD A;  1JBC A;  1VBC 1;  3ZKU A;  1XYP A;  2D6K A;  1GZW A;  5F2W A;  2VME A;  5JZG B;  1FXZ A;  5C4W B;  3I3E A;  4AQS A;  1AR8 3;  2ZEY A;  3MW4 A;  4LKS A;  3BTY A;  1X33 A;  1W03 A;  3N7L A;  2WFF 2;  1ZA7 A;  3N35 A;  4Y22 B;  2GH2 A;  5FYH A;  2VMI A;  2W39 A;  1DG6 A;  5JSO A;  3IAQ A;  1QQP 2;  1UU5 A;  1YFW A;  4J6G A;  4DMI A;  1HRI 2;  1V6K A;  5LA2 A;  3MZH A;  5CFD B;  3WNX A;  4K21 A;  4CA9 A;  3WCR A;  1US2 A;  2WQ8 A;  3AMN A;  3GHN A;  4YVW B;  3WDV A;  1Z0H A;  3ACL A;  4AL9 A;  3R4S A;  1GNY A;  5E89 A;  4D94 A;  3B69 A;  4LBL A;  1DQ6 A;  1E5S A;  3OF1 A;  4X8P A;  4EZH A;  2CAU A;  4A6O A;  1Y43 B;  3NJZ A;  4IL7 A;  2OZJ A;  2VZ3 A;  1FMD 1;  5C9A B;  4CCM A;  2X8K A;  3A23 A;  2DBN A;  3AVR A;  2JDP A;  1YRZ A;  2PQS A;  3MIG A;  5J96 B;  1AR8 1;  2R6Q A;  2RMU 3;  2JE8 A;  4CVU A;  4LR4 A;  4KI5 M;  5CB7 A;  3OPZ A;  3POF A;  5IAV A;  4DO0 A;  2XLA A;  3VBR A;  2V09 A;  3VHO A;  1NCQ B;  3DYO A;  1TG7 A;  1C5H A;  4XJ9 A;  1SBF A;  1W8O A;  3JQX A;  4YGC A;  3D5O A;  1GNZ A;  2JWP A;  4DXZ A;  3AX4 A;  1PZ8 A;  1JU4 A;  5KC5 A;  3OY8 B;  1CN1 A;  3ZSJ A;  4Q0U A;  1W6O B;  3VL9 A;  5IUQ A;  1AL2 2;  3R05 A;  2VUL A;  2D43 A;  2VO5 A;  1IQD C;  3ZXJ A;  1QJX 3;  4RHV 3;  4XHB A;  1W6Q A;  4W6W A;  5T54 A;  3ZN4 A;  3PUA A;  4AI9 A;  4RR3 A;  4XF4 A;  1I5Z A;  1XRU A;  4IDZ A;  1JOP A;  5A3U A;  4A7K A;  1UCX A;  2DUQ A;  1TE1 B;  2ZEW A;  1RC6 A;  3IDE A;  1C1F A;  2ZGN A;  3LA2 A;  4N53 B;  2ZA9 A;  5FPA A;  5FY7 A;  1PO2 3;  3RZK A;  3BI3 A;  5IYY A;  3PJY A;  4GB3 3;  5A3O A;  4B7K A;  1POQ A;  2WQZ C;  4QX1 A;  3SIS A;  3I49 A;  3VL8 A;  1L7L A;  2DBI A;  5IK4 A;  5KHG A;  2VQT A;  5F5A A;  2P34 A;  2R7E B;  4E4D X;  3VV1 A;  2C4X A;  2QQW A;  2WDB A;  3M7A A;  4RSU A;  5G04 L;  2WS9 1;  3J9S A;  2OS2 A;  1X82 A;  1FNZ A;  4GIQ A;  4KWK A;  2SLI A;  5DG2 A;  4BA6 A;  4K40 A;  4AI1 A;  2XG3 A;  2ZZQ A;  2P17 A;  3KV6 A;  4R4X A;  1VMH A;  3O0W A;  4NMI A;  1QJX 1;  2OQ7 A;  4QPI A;  3H9A A;  1WMD A;  3C7H A;  1W9W A;  4RHV 1;  4CEW B;  1KRI A;  1BEV 3;  1H2L A;  5I0U A;  4W6Y A;  1DLC A;  3HMY A;  4XVH A;  1A8D A;  1OQD A;  3D82 A;  5EV7 A;  1H1M A;  4EQV A;  1XE0 A;  4Y5T A;  5FZ7 A;  1UYZ A;  5GLT A;  3VZL A;  3D0S A;  5EP9 A;  5GZG A;  1WKY A;  4FFF A;  1YJL A;  1JHJ A;  5JSR A;  1PO2 1;  5DQ0 A;  5L7O A;  1UX6 A;  4AQ6 A;  2GNB A;  2HWF 1;  2VNG A;  4PLO A;  1NLS A;  1SAC A;  1TEI A;  5L7O B;  2O8O A;  4GKY A;  3ATG A;  3MBW A;  5FZO A;  3PLQ A;  3SEP A;  2FZ1 A;  4XMA A;  3LDK A;  3VD4 A;  2W9X A;  4NAM A;  2BBV A;  4FPH A;  4AR2 A;  1KEX A;  5IVE A;  5C3O A;  2QQJ A;  4NIH A;  3MID A;  3LSE A;  1RHI 3;  2WWS A;  1UPS A;  3D0J A;  3KCC A;  1ULC A;  2GU9 A;  3W59 A;  1COV 1;  5I0R A;  1VBD 2;  2OZ6 A;  4XBQ A;  2D40 A;  3S7I A;  4CRQ A;  1HV0 A;  1A78 A;  3KWV A;  4RQP A;  2YYO A;  3UK9 A;  3VDC A;  2JIG A;  4NHY A;  3GJA A;  3LIG A;  1BEV 1;  5ANQ A;  5I0T A;  3KD4 A;  4W4Z A;  1ACC A;  4YYO A;  2MHF A;  2I2S A;  1QWR A;  1JH5 A;  5GJ6 A;  2E63 A;  1AXY A;  5CKM A;  4BIO A;  3J7M A;  3K51 A;  5J37 A;  2P3K A;  1LOF A;  1E5R A;  4QX2 A;  1Y4W A;  1LRH A;  3WX5 A;  5KXC A;  1VRH 2;  2RS5 1;  4A42 A;  3AMP A;  1C8M 2;  1ND3 B;  1Q8P A;  1R1A 3;  3BN6 A;  4FPL A;  4XFF A;  4YVS A;  4LBQ A;  1ZA4 A;  5ANN A;  1DQ1 A;  4ATE A;  2JG9 A;  1UZV A;  3PUQ A;  3ZFF B;  2R06 2;  3K3O A;  4YM3 A;  2XL7 A;  1NZC A;  1PO1 3;  2ZGM A;  5H9R A;  4E4H A;  3FMG A;  3GBW A;  1M4W A;  5EWS A;  2R1B A;  1GWM A;  2ZGK A;  3KMH A;  3OD4 A;  3LDR A;  4PBO A;  1LEM A;  3SKV A;  2WN3 A;  4DIN B;  2PHX A;  5IFP A;  3N7K A;  1RHI 1;  4WBB A;  1G9C A;  3I2H A;  4YWA A;  2AGS A;  1Q43 A;  2WNE A;  4QXC A;  1SFY A;  1F35 A;  4LUK A;  1EAH 3;  3SXW A;  5FPX A;  4QKN A;  1V9U 3;  5FLI A;  2OXB A;  1MS4 A;  3ZXA C;  1JUI A;  1GWL A;  2XBO 3;  1J83 A;  5GAL A;  3RZH A;  1JYI A;  1CIW A;  1DGR A;  4FAG A;  1Q8O A;  3JB4 C;  4HOO A;  4CU6 A;  1YHF A;  4E27 A;  3OYW A;  4RFR B;  3MLJ A;  2FCU A;  4FBF A;  5FUI A;  3GGL A;  2DUR A;  3RS6 A;  3L2H A;  5L7O C;  4LOR A;  1VRB A;  4GJZ A;  5A3M A;  3D3A A;  5BNO A;  1NA1 A;  4TLF A;  1EY2 A;  2Q30 A;  1OUS A;  2V4A A;  1J59 A;  3K4A A;  3DXU A;  5KHK A;  2XR4 A;  4JHT A;  3MW3 A;  3O12 A;  3AKP A;  4PI2 A;  3I8T A;  4DB5 A;  3KV9 A;  4DY5 A;  2X29 A;  3T1M A;  1UU6 A;  4UW5 A;  1RIR A;  2Q0A A;  1AR7 3;  1IS4 A;  1CR7 A;  1UY3 A;  4Q5O A;  1RMU 2;  3ZN5 A;  1DLL A;  1SDD B;  3MO4 A;  1QJU 2;  3O1P A;  2ZX0 A;  3AP6 A;  1SMV A;  3PUS A;  2NMO A;  4ZKT B;  3QH6 A;  1EAH 1;  5DAP A;  3M8L A;  2IXL A;  1KS4 A;  1QKQ A;  2BFU L;  4W65 A;  4LJH A;  4MHU A;  5FXZ A;  2P3J A;  3IIA A;  4MV2 A;  2XBO 1;  3WNP A;  4CP9 B;  3LEG A;  4FPJ A;  1T6G C;  2QQO A;  1M06 G;  1BMV 1;  4Y4R A;  1N1T A;  1QH6 A;  2VC9 A;  3GCW A;  4GXL A;  1FPN 3;  3VBF A;  3WY6 A;  4DXT A;  1KFX L;  2BU9 A;  4D8M A;  4QKF A;  3Q8A A;  2DCJ A;  3LZZ A;  4JGZ B;  5HI0 A;  2HWD 1;  3HBK A;  5FO8 B;  1H2N A;  4ZS2 A;  1BXH A;  1OQ1 A;  3RMX A;  3NJY A;  2HJI A;  2RS3 2;  4DUV A;  1Q3E A;  3NV2 A;  1JN2 P;  4KL1 A;  4OHZ A;  5I8Y A;  2HWC 2;  4CDU C;  3ZDS A;  1Z7S 3;  4CEY A;  4NE9 A;  3TYJ A;  1AR7 1;  4CSW A;  3WF3 A;  3SH5 A;  4YW2 A;  3VKF C;  1XJA A;  5CVR A;  1WLD A;  5E8A A;  3RYR A;  4H7L A;  1SLL A;  5DZG A;  1UOJ A;  4UW6 A;  2R16 A;  4AI3 A;  4TN7 A;  2QQN A;  4DOU A;  3CJI A;  2XVK A;  2WAB A;  2D5H A;  1FV2 A;  1RUC 2;  1WGP A;  4LK6 A;  3GXU A;  3WNM A;  5A6Q A;  1NZI A;  4GMP 3;  4HXC A;  2GNT A;  1AL0 G;  2VQA A;  3ROU A;  3UV9 A;  1T6B X;  3USU A;  2XLG A;  1NA1 C;  4O7X A;  4AEM A;  4R9C A;  1UW8 A;  2B45 X;  2BP6 A;  2WO1 A;  4IV1 C;  1C3H A;  4RS5 C;  2J1E A;  2VW2 A;  1Y7B A;  3FBY A;  3WP3 A;  4MLO A;  1UD1 A;  2A6X A;  2BBA A;  3B9C A;  1YI7 A;  2QQV A;  2CU5 A;  3KCY A;  4QXB A;  5JAX A;  1H9W A;  3QLQ A;  2ADE A;  1D4M 1;  5E6H A;  3IT8 A;  4LOT A;  3K2O A;  3OPT A;  4WM8 A;  4MSV A;  3LFM A;  1DGR N;  3NAP C;  2IVI B;  4XXP A;  1LHU A;  1U5Z A;  1XB9 A;  3K75 B;  3PVO A;  2GME A;  5CZK A;  5C3P A;  2PN5 A;  2XHN A;  3PMS A;  4CP2 A;  2WSV A;  1CJP A;  1TNF A;  5FK8 A;  4AFB A;  1MS5 A;  3AXE A;  1V6J A;  4A7Y A;  1QY4 A;  4IEP A;  4GMP 1;  1NX9 A;  3UKN A;  2EAA A;  2OPW A;  3D4K A;  5JXG A;  4HL0 A;  4YZ2 A;  4YG6 A;  2VOW A;  1NY7 2;  1RUH 3;  4Q4W 2;  4CXX A;  5FQ0 A;  3FBM A;  3QOP A;  4QKB A;  4HK9 A;  5CFC B;  3VBH C;  5AVA A;  1GZ9 A;  1D0H A;  4Q4X 3;  3O1U A;  4QPG A;  3IN9 A;  4XAC A;  4O65 A;  3MIE A;  3HIF A;  4OI1 A;  5F37 A;  2NM1 A;  2LRP A;  1NXD 1;  4XEZ A;  4E8D A;  1SPP A;  1XBF A;  2YGL A;  1XPW A;  1CZV A;  4D6R A;  2LAL A;  3O7O A;  1CIY A;  1PGW 2;  2ES3 A;  1UYY A;  3O1M A;  3KM5 A;  5KHJ A;  4CDW C;  3VDD B;  4PCR A;  1R64 A;  4SLI A;  5F32 A;  5DAV A;  5FY8 A;  3ZR5 A;  2QUO A;  1DQ0 A;  2HWE 3;  1QMJ A;  1WW5 A;  1W2N A;  2GH8 A;  3GHM A;  3LEK A;  1CAV B;  3RZM A;  2CAV A;  1LGC A;  2V72 A;  1RVF 3;  5DUW A;  4B7E A;  4F83 A;  3DYP A;  5F3I A;  4AHW A;  5LCW L;  4MX3 A;  2E51 A;  5GLW A;  2AAC A;  3VBS A;  2JG8 A;  2OA2 A;  3WQB A;  3THT A;  1BBT 3;  5IAT A;  2R04 1;  1ZX5 A;  1RUH 1;  3BU0 A;  3URF A;  2EA7 A;  4FI9 A;  5J7M A;  1JZ8 A;  3K3N A;  5JZG A;  3M70 A;  4CDX C;  4C8D A;  1DF0 A;  2YDE A;  4OUE A;  4UOJ A;  4D3W A;  5F5I A;  1FI2 A;  2QDN A;  4LBK A;  4PT6 A;  5FZ9 A;  3I2G A;  4Q4X 1;  4B4P A;  1QNY A;  3MF9 A;  4G4F A;  5A70 A;  3OTF A;  3M3O A;  2VUJ A;  4GJY A;  1SLB A;  4FCA A;  4FFH A;  3GZA A;  4Y33 A;  5FTT C;  4NWV A;  2B7Y A;  1AZD A;  1HXS 3;  1L7R A;  1H1I A;  5A6Z A;  2GAU A;  4Y5Z 0;  1X50 A;  4JQT A;  1ZBA 3;  1APN A;  4KWU A;  1UY4 A;  2JKX A;  5LY2 A;  4YVW A;  3LA7 A;  3WSO A;  2CGN A;  3N9O A;  2GP5 A;  5FO9 B;  2ARC A;  3AYC A;  4XF3 A;  2HWE 1;  3S30 A;  2VH9 A;  1OF3 A;  4JZR A;  2DVG A;  5DDJ 2;  4AGR A;  2ZML A;  1RVF 1;  2RS1 2;  4TTG A;  3ECQ A;  3ACF A;  1OQE A;  2BNN A;  2WT0 A;  4AWD A;  4M3C B;  5LA1 A;  4AVC A;  5C9A A;  4HVQ A;  3KHC A;  1GFF 2;  1BBT 1;  1EUT A;  1Y9M A;  3H7Y A;  1BZW A;  4Q4V 3;  1SEF A;  2R0H A;  2VPV A;  2Y6K A;  1ZRR A;  4NJ4 A;  4BLI A;  1BKZ A;  2YXS A;  4QDR A;  4JTO A;  2Y38 A;  4XZU G;  4SBV A;  3WLU A;  3FFZ A;  4FPO B;  5FRE A;  4M4R A;  3ZLI A;  5JXH A;  3MIC A;  2VZT A;  4A44 A;  4FOY A;  3I2J A;  1NCQ A;  5DAB A;  2W08 A;  2WZ8 A;  3QD6 A;  5T50 A;  1RUG 3;  2IC1 A;  2XOM A;  1KGY A;  4ET7 A;  1CD3 G;  2KXL A;  3ES1 A;  2X53 S;  4GWN A;  4CP1 A;  5FMO L;  1BJQ A;  3I7D A;  3MIH A;  4CUB A;  2XHK A;  3ZFG B;  1W6O A;  5A33 B;  3DL3 A;  3KT7 A;  3TBD A;  2F4L A;  1V6O A;  1FYU A;  1S0I A;  4Q0V A;  4XUP A;  3THD A;  5K4L A;  4B1L A;  1XU2 A;  2JG8 C;  2EXJ A;  1O7F A;  4WVM B;  2Z5W A;  4KH9 A;  1MVE A;  4JGY B;  1NUK A;  1GMM A;  4HKL A;  1C1L A;  5C4W C;  1H8T B;  4GAL A;  2YGM A;  4AI2 A;  4F3J A;  4N53 A;  2TNF A;  4N43 B;  2UY8 A;  1US3 A;  4FFG A;  4Q4V 1;  2RS3 1;  2VMF A;  1K42 A;  4QU2 A;  3DKW A;  5L9V A;  2XH6 A;  4UI9 L;  1XU1 A;  3AXD A;  3N9L A;  4CDU B;  4H14 A;  4KBB A;  5CFD C;  3VBO C;  3T30 A;  4ZPI A;  1UIJ A;  2PYT A;  2VZS A;  3V56 A;  5K8S A;  2BJS A;  2LW8 A;  5FZF A;  3WQ7 A;  5M0T A;  3MFA A;  3PJQ A;  2JE9 A;  4XUT A;  1JOJ A;  2DTW A;  1R08 1;  5L19 A;  1ZNP A;  4TWT A;  2DUP A;  2XML A;  4YG3 A;  3RDI A;  1RUC 1;  2WYF A;  5KXE A;  2YBS A;  3AYD A;  3MV0 1;  5FOB B;  2W87 A;  1DCS A;  4CEW A;  1CVN A;  2PLV 3;  5CNA A;  5I8S A;  1Q56 A;  3AK0 A;  2GC1 A;  5C9A C;  1KFU L;  4AAP A;  1U12 A;  1CPM A;  1FMD 2;  2JX9 A;  4YZ4 A;  4FTS A;  5FWJ A;  3O5S A;  1R09 1;  4MUV A;  5KWR A;  3LD8 A;  2BQP A;  2JKB A;  2ZPX A;  2OYZ A;  2BNM A;  2BWA A;  2DV9 A;  1AR8 2;  1VBE 3;  4FTB A;  5FP4 A;  2DVB A;  4IV1 B;  4RS5 B;  3GM8 A;  4BLJ A;  1JZ3 A;  1MZ5 A;  3ZX7 A;  2ID4 A;  2E6V A;  3CBN A;  1E5H A;  3C7E A;  4ZY9 A;  2Q8O A;  2DVD A;  4CDQ C;  3VDB A;  4UXA A;  1QNW A;  2WAO A;  5LBE A;  4QD2 A;  3CZJ A;  4LBJ A;  2VZR A;  4K1Y A;  2B42 B;  3O0V A;  3NAP B;  2VE1 A;  3OCP A;  3E1F 1;  4D6Q A;  1Q8S A;  1GOH A;  3VHP A;  1YXW A;  4HG6 B;  5C6C A;  2CGO A;  1ENQ A;  1UX7 A;  1FNY A;  3CIH A;  1JYX A;  1ZRE A;  3NJX A;  5DAX A;  3HAG A;  1OMI A;  4D69 A;  4P00 B;  2PLV 1;  2K2S A;  2XVL A;  2J1A A;  1MS0 A;  1NAE A;  2ZMK A;  2GMP A;  5FXV A;  3KQR A;  4YSF A;  3LGR A;  4Q4W 1;  3KF5 A;  4H2A A;  2W3J A;  2DCK A;  1YIF A;  4JRA A;  3WHT A;  1BCX A;  5C33 A;  5IVB A;  1VBE 1;  2ADD A;  2RMU 2;  2FDH A;  3CZU A;  3J7H A;  1RUF 3;  4M3C F;  4ISR A;  4ZXE A;  2BFU S;  1DGW A;  1F5J A;  3DCQ A;  4Y20 B;  5FYT A;  3TN9 1;  2VNO A;  1LR5 A;  3VBU C;  3ZFF A;  3PUR A;  4IUG A;  5AC9 3;  4OI4 A;  2WS9 2;  3WF4 A;  5D8A B;  2J1T A;  2JDM A;  1W8W A;  1WA6 X;  2YC4 A;  4XJ8 A;  1S0J A;  5EJ1 B;  4AW7 A;  5CA6 A;  4Q0P A;  1X9P A;  1Y9G A;  4MGY E;  3MPB A;  1FOD 1;  4LO8 A;  1XQN A;  1B35 B;  1PNG A;  4FT8 A;  4OFG A;  5FZC A;  5J98 B;  4DS0 A;  1AYM 3;  4YAR A;  3TWI A;  1QJX 2;  4RHV 2;  1G86 A;  4W50 A;  2ET1 A;  4AG4 A;  5F9T A;  1WCQ A;  3EBR A;  1WCK A;  4DEQ A;  1QJY 3;  4UW3 A;  1HB1 A;  1UMH A;  4NRM A;  4YZ3 A;  2WZR 3;  5J1X A;  2TUN A;  4Z07 A;  4I02 A;  4XQW A;  1PO2 2;  1YEW A;  2ATF A;  4GQ7 A;  5ERL A;  4CDX B;  2HWF 2;  2J22 A;  2Y8K A;  1VE0 A;  4XZP A;  1O59 A;  4DZG A;  4NRO A;  3GZE A;  4GD4 A;  1RJ7 A;  4MXV A;  4EWD A;  1U5X A;  1MEC 1;  5F5C A;  5AC9 1;  1HN0 A;  1O6U A;  5FZH A;  2VQU A;  3WUD A;  3H42 B;  2J42 A;  2XUE A;  4XJZ A;  1QOO A;  1S0E A;  4YW4 A;  3R6S A;  4IV3 B;  3ST7 A;  2ZGP A;  1COV 2;  2WT1 A;  4LEJ A;  5FZ6 A;  4CCD A;  2BRT A;  1O3S A;  4NUB A;  2Y34 A;  3JUU A;  4LUM A;  2VMH A;  4Q26 A;  1HQW A;  2C6S A;  1AYM 1;  1S0D A;  4COZ A;  2DFB A;  2C24 A;  1CAU B;  2RM2 3;  1W2U A;  4MGQ A;  5F8P A;  5CAZ A;  1UXX X;  4XUQ A;  1BEV 2;  5KHH A;  3LSD A;  3MV1 1;  4CP9 A;  1A8M A;  1QJY 1;  2A73 B;  3BPZ A;  1TQ5 A;  2VVF A;  3VD9 A;  2PHU A;  4ZZ8 A;  2YFZ A;  3WZ1 A;  5BNP C;  3SLI A;  2AC1 A;  4ORF A;  5C7G A;  2RS5 2;  1ND3 C;  3FN9 A;  2WA3 A;  3MHZ A;  2X05 A;  4BU2 A;  2Z4F A;  5LEJ A;  4B4Q A;  4P5H A;  3V0A A;  5DN2 A;  3GCX A;  5FMB A;  2ZGL A;  4N7U A;  1O5U A;  4KWL A;  3VKM A;  4QM8 A;  4BJ0 A;  3J26 N;  4URT A;  5FZ0 A;  5EJ3 A;  2KD7 A;  4QB1 A;  2Y6H A;  1MS9 A;  1IG3 A;  4JAA A;  4BDV B;  1I6X A;  2XKO A;  1UN1 A;  1G9F A;  1RHI 2;  3C7O A;  3INA A;  4UFL A;  2WBK A;  4IER A;  5FZM A;  1HQL A;  1PGL 1;  2VBP A;  2XUM A;  3POI A;  2ZGR A;  2C26 A;  3S5Q A;  3ZXL A;  5BUV A;  2A3Y A;  2A6Z A;  4FVV A;  4OMD A;  1QHD A;  3MPP G;  4NPR A;  2PQQ A;  3KV4 A;  4K20 A;  2RM2 1;  4KWJ A;  5TSW A;  1PVC 3;  3QBQ A;  5A3L A;  2D3S A;  2GZW A;  3SH3 A;  3P6B A;  2ZZJ A;  2JE7 A;  1X9T A;  1ULE A;  4LNV A;  1BHG A;  2WII B;  4HSL A;  2GMM A;  3X29 B;  5C70 A;  1OC1 A;  4XQD A;  4GMP 0;  3CNA A;  2RJ2 A;  2IFW A;  3N36 A;  4FOW A;  4YW3 A;  2I07 B;  2A70 A;  3WT3 A;  1S0F A;  4JX0 A;  1JOB A;  1SDW A;  1R1A 2;  1XSR A;  4H55 A;  4NO4 A;  1RXG A;  5H9S A;  4IND A;  3WF0 A;  3KV5 A;  3VUO A;  2GC3 A;  4M01 A;  5HCH A;  2QKD A;  2CTV A;  3G7D A;  3THC A;  2CDP A;  1PO1 2;  4ZON A;  3VBO B;  1QDO A;  2WJS A;  2AH2 A;  1MR5 A;  1ND2 B;  3SCH A;  3OUH A;  4A3Z A;  4CXY A;  4BMB A;  1ULO A;  2VY0 A;  1XYO A;  3SQO A;  4YW5 A;  2CWS A;  1UY1 A;  4PLN A;  5FK7 A;  3THP A;  5JSP A;  1WME A;  4Q8L A;  1F5F A;  2FMD A;  1EAH 2;  3J8F 1;  5IWF A;  1V9U 2;  1H4G A;  3A0N A;  1PMH X;  5FPZ A;  4LBN A;  2XBO 2;  1PVC 1;  3TOJ A;  3RNS A;  3MUZ 1;  2W94 A;  1N47 A;  5FY9 A;  1YFY A;  1BMV 2;  2GC2 A;  4LMF A;  4BXS V;  3S0M A;  2QZ3 A;  3MEP A;  4NN0 A;  4BB3 A;  5GZC A;  4L8Q A;  1UZ0 A;  1WWY A;  3FLP A;  4JGZ C;  1SBD A;  3RG0 A;  1R1Z A;  4N7I A;  3GYD A;  4XF9 A;  2HWD 2;  4NWW A;  4ZXK A;  5JDB A;  4F8A A;  4NPM A;  2VUA A;  1SLT A;  4AXO A;  3D6E A;  5CFC A;  3VZO A;  2DCT A;  3DEC A;  1DZR A;  3N3H A;  5LB6 A;  4TYS A;  2VZU A;  3CO2 A;  4XAA A;  4EWE A;  3AP9 A;  2VTX J;  3MGU A;  1RUE 3;  2UYA A;  3I2F A;  1LAJ A;  3FFQ A;  3BOD A;  2PAK A;  1AR7 2;  2VEC A;  4CDQ B;  4FOV A;  1DDL A;  4IGP A;  2YV8 A;  2A71 A;  3HN1 A;  4XE9 A;  4ASM B;  5JPM B;  2VUD A;  3SEE A;  3T3Y A;  3LIH A;  1H9P A;  4Q2F A;  5A7S A;  4CUC A;  2H0B A;  2G19 A;  2W1Q A;  5JMO A;  4X6Q B;  2RDS A;  5DAQ A;  1FAT A;  1E57 A;  1ZZ7 A;  1H2K A;  5FUN A;  5LWB A;  4GH4 C;  4XIO A;  1CAV A;  1I5P A;  1HX6 A;  1V6L A;  4P08 A;  2OVU A;  1SCS A;  4NHM A;  2X10 A;  2AZ5 A;  2F4P A;  1V0A A;  4HN0 A;  2DCY A;  4IGO A;  5E1R A;  1OA2 A;  5C8C B;  2FDF A;  3IDA A;  2V73 A;  4BME A;  2BNO A;  4CCK A;  3LOI A;  2ZX2 A;  3LB9 A;  2RMU 1;  1UU4 A;  2BW8 A;  3ZN6 B;  2JB4 A;  2BTV C;  2VZV A;  1MZF A;  3OSD A;  4IW3 A;  3U11 A;  1GZC A;  2ARA A;  2ZHK A;  5IAX A;  1O3R A;  2VBB A;  3OBR A;  1GYK A;  5JI9 A;  1RUE 1;  3ZPO A;  1Z7S 2;  3VBU B;  3E6C C;  1D4M 2;  1RUN A;  1MPX A;  4PIX A;  2Q1M A;  2WSU A;  1YO8 A;  3V65 A;  3ZYF A;  4YG0 A;  2Q8C A;  1X7N A;  2Y33 A;  5FLJ A;  5B4X A;  5SV8 A;  3WXP A;  3EJK A;  3M3I A;  3ELN A;  3NL1 A;  4DXR A;  2YHJ A;  3UGH A;  3PTY A;  3OUI A;  4XFG A;  2VU9 A;  2D6O X;  4P9L A;  3B93 A;  3QAC A;  4MG2 A;  1KDM A;  2ZX4 A;  4L0P A;  4Z8B A;  5CIR A;  1B09 A;  1CJD A;  1OF4 A;  1YIP A;  3MLK A;  4P5Y A;  4QDS A;  1HV1 A;  4XHX A;  2WFP A;  5L36 A;  3O1R A;  4UFK A;  3LDB A;  4M3C A;  3NNJ A;  4MH0 E;  4R9A A;  1JZ4 A;  5EXO A;  2VM9 A;  4M0N A;  5CFC C;  5FZA A;  3T2O A;  1FAY A;  1ALY A;  3T2Q A;  2XXZ A;  3RYP A;  4GB3 1;  4UFI A;  4NRP A;  1FT9 A;  1MS1 A;  2VBD A;  5FXW A;  5A80 A;  4ATF A;  5EIY B;  4M4P A;  4MHR A;  2PXJ A;  3AB0 A;  4NPL A;  2VMC A;  4KU8 A;  4A41 A;  1N1S A;  2O1Q A;  4L99 A;  3PU3 A;  4HPK B;  3VDD C;  3CF6 E;  1EV1 3;  2XQR A;  4YZ1 A;  1YYN A;  3ZFG A;  4LO6 B;  5A33 A;  1DHK B;  2KR2 A;  1A6C A;  2PHL A;  3E6B A;  2XPJ A;  3CMG A;  5H9Q A;  1BVP 1;  4I0B A;  1EPW A;  2P6C A;  4HAN A;  4AQ2 A;  4Y1X A;  3TRS B;  5FFO C;  1YNA A;  1HW5 A;  4K6B A;  3ZVX A;  4OHW A;  1LHV A;  5A7W B;  4WVM A;  3MLL A;  2H6B A;  2J7M A;  4MO3 M;  1NE4 A;  4AK3 A;  1PK6 B;  1ZM1 A;  3JQW A;  2R04 2;  4LIT A;  1RUH 2;  2B46 X;  1DQ4 A;  1W99 A;  1H8T A;  3NVC A;  5F5Q A;  3AP4 A;  5BNP B;  3UL2 A;  4FPE A;  5C5U A;  4Z1V A;  2LRO A;  3SCF A;  5I0D A;  3R4D B;  4YW6 A;  1X8M A;  2BGO A;  3EB7 A;  4Q4X 2;  3WDY A;  3DPR C;  3H3L A;  1NKG A;  1RUO A;  4CDU A;  3AMQ A;  2BPA 2;  4M0H A;  3GDB A;  4LHS A;  2I45 A;  3CQO A;  4IE5 A;  3OEB A;  2D98 A;  2ZBJ A;  2AUY A;  1ASJ 3;  1BK0 A;  3WG3 A;  2VOK A;  2WNO A;  2F17 A;  4QHO A;  5T52 A;  3KVB A;  3WR0 A;  3U10 A;  2JEC A;  1EV1 1;  5JPN B;  4CPB D;  3HQU A;  2SBA A;  3WOG A;  5I8T A;  5EHD A;  1XSQ A;  1MVQ A;  2IUW A;  4NHK A;  1S0C A;  2HWE 2;  1BVV A;  4GA9 A;  1CX1 A;  2GN7 A;  1W3X A;  3NQH A;  3EMR A;  4Z92 B;  2UY9 A;  1RVF 2;  4LQR A;  4EV0 A;  5CU1 A;  3H7J A;  4XFB A;  3SH4 A;  3T4V A;  1K12 A;  2JDA A;  5T5P A;  3WDW A;  1PIV 3;  4GZ9 A;  1G9B A;  2ENR A;  1F2N A;  3ITQ A;  4OLL A;  3HEI A;  4XFI A;  5BYN A;  1BBT 2;  3N9M A;  2VZP A;  3V0B B;  5FPU A;  1AR6 3;  1O91 A;  4D0Q A;  5LBC A;  1R1A 1;  4JCK A;  5LY1 A;  3B00 A;  3AL5 A;  4OZX A;  1QGL A;  4IV1 A;  1O4Y A;  2XQX A;  4RS5 A;  1PNF A;  2Y6J A;  4AFD A;  2LM3 A;  4WM7 B;  4YGE A;  1PO1 1;  1OOP C;  5D1I A;  3T0D A;  1HXS 2;  3GZU C;  1ASJ 1;  5FJK A;  2CY6 A;  3E5U A;  5IK5 A;  2QTW B;  3ZFG C;  3NAP A;  3A0K A;  4C0B A;  4M00 A;  1GNH A;  2DUO A;  1I1E A;  4BOW A;  2PAM A;  1V9U 1;  3NRU A;  4XUO A;  3RJR A;  3BTX A;  2WYS A;  3C2U A;  1PVX A;  2B9V A;  3O1V A;  4A45 A;  2D6M A;  3H1W A;  4K7J A;  2HH9 A;  3H1Y A;  4J1X A;  4XBL A;  4JGY C;  4ZHN A;  1DFQ A;  1CZS A;  1PIV 1;  2BER A;  3LEI A;  5C3S A;  3Q9O A;  1H8T C;  3U14 A;  5K0U B;  1C28 A;  4N43 C;  1AR6 1;  4R9B A;  4Q4V 2;  1QDC A;  2ZKN A;  3WNN A;  3OOX A;  3GJB A;  1JZ2 A;  1GOG A;  3U37 A;  3VBH A;  2VQ0 A;  1REF A;  5LA0 A;  3VD7 A;  5A32 A;  5I91 A;  4Y20 A;  5A7Q A;  5CG9 A;  2ETE A;  1H30 A;  1PMJ X;  5FDB A;  2VAU A;  5IT6 A;  2CV6 A;  1UYP A;  2FDJ A;  1RUG 2;  3OBA A;  4N90 A;  1J1T A;  1XOY A;  4LOS A;  2W1W A;  2A3X A;  3HT1 A;  2DVF A;  5FYU A;  3BVC A;  5FZK A;  3J7L A;  3ENR A;  1OI6 A;  2HKX A;  2P2K A;  2WUH A;  3SCG A;  1R08 2;  3KHB A;  5JMC A;  1A3K A;  3LE0 A;  4CDW A;  3JD7 3;  3ZKY A;  4Z2A A;  4XJA A;  5CEH A;  1B35 A;  2J1S A;  3III A;  3NMB A;  2TEP A;  3KF3 A;  4FPF A;  4GH4 B;  5FYI A;  5GZE A;  4NIA A;  4K8R B;  2XGX A;  1ZBE 3;  2X5I B;  4QGL A;  4FOQ A;  1LOC A;  3WUC A;  5FZ3 A;  1LGN A;  2ARX A;  5DUX A;  1POV 3;  1FPN 1;  3HBZ A;  3OGS A;  4LIV A;  3ZYJ B;  3JBG 3;  1R09 2;  3IBM A;  5FP8 A;  3NNM A;  3E5X A;  2FDG A;  5HXV A;  1BYH A;  1OKO A;  2B9U A;  4BQ4 A;  5BNN C;  4CDX A;  1NOV A;  1WW7 A;  4FPY A;  4CCC A;  3H8X A;  3AVS A;  1AVB A;  3AZV A;  3B01 A;  3I2K A;  2TBV A;  5FZ4 A;  5IFT A;  1Z7S 1;  3OGJ A;  2WRA A;  2O14 A;  3AZX A;  2RVA A;  3MFC A;  4J25 A;  4DFS A;  2CSG A;  1AJK A;  2IWG B;  3HNY M;  5FP9 A;  5AVP A;  4AI8 A;  1VP6 A;  1YQ8 A;  3NST A;  2EXK A;  4IV3 A;  2MPF A;  3RFR A;  1W3V A;  4BM8 A;  1DGL A;  2LUW A;  5FV3 A;  2JDN A;  4BQ3 A;  3UNP A;  1U5I A;  2XJR A;  3WP6 A;  2WIN B;  5CIS A;  1OVS A;  1CAU A;  1ZBE 1;  2J1R A;  1REE A;  3KVA A;  4YNI A;  2PLV 2;  4BQW A;  2QE3 A;  3MDP A;  3FUO A;  1WMF A;  3CLP A;  4FFI A;  2WNV C;  1GSL A;  3JBG 1;  1DBN A;  4IGQ A;  3RJ2 X;  2C0Z A;  5JCT A;  1DYK A;  1IS3 A;  1VBE 2;  3B7M A;  3NV1 A;  1WLW A;  4OYU A;  1VBA 3;  4B8E A;  4YFW A;  4NHX A;  3FL7 A;  1VBD 3;  2Y0I A;  5IVF A;  3TN9 2;  2IXC A;  1OSG A;  1JOD A;  5D8A C;  1HQN A;  1RUI 3;  1I9R A;  1GQH A;  1OD3 A;  3KGZ A;  4NHL A;  1N3P A;  1QJF A;  3JB8 A;  2BZD A;  1YLL A;  1G7Y A;  1B35 C;  1FOD 2;  5FY4 A;  5JOW A;  1RYY A;  3J4U H;  5FYC A;  1SZB A;  1ZRF A;  4CXW A;  2OQ6 A;  4AE2 A;  3VBR B;  2WL1 A;  3ACI A;  3I2I A;  1A34 A;  4MVT A;  4C1X A;  5A1L A;  1O8S A;  2VW0 A;  4FPC A;  4LA2 A;  1C5I A;  2VNV A;  5FZ8 A;  3WNL A;  1W39 A;  5CAD A;  1DQ5 A;  3DYM A;  5C4W A;  1MAC A;  3ZXG A;  5JLV A;  4RYD A;  4BQ2 A;  4EN9 B;  5HPO A;  2GAL A;  2K46 A;  2HBU A;  4Y22 A;  1GV9 A;  4R8H A;  4U36 A;  2ZHL A;  5F39 A;  3DPR B;  1W9F A;  3K46 A;  3PTR B;  2WA4 A;  1MEC 2;  5GZD A;  1UZZ A;  1S1A A;  3HQR A;  3IB3 A;  4LKE A;  2R07 3;  2Q1F A;  5AC9 2;  5GLZ A;  4JC1 A;  5CFD A;  3USS A;  1GQG A;  3VBO A;  1ND2 A;  2WQ4 A;  2WLQ A;  1NE6 A;  2C9K A;  3WG2 A;  4IV3 C;  2QFE A;  3POB A;  4AEK A;  5FMC A;  3UKV A;  1J58 A;  1ODN A;  4AVT A;  1W2T A;  4QT6 A;  2VXR A;  5IK8 A;  3FZ3 A;  2JDK A;  5FO7 B;  1F9K A;  3ME2 A;  3DKQ A;  3TEW A;  1AYM 2;  1UXZ A;  4XC9 A;  4AZZ A;  3MF6 A;  2O0O A;  2VMG A;  1IKQ A;  5GKA C;  4TLG A;  3FX3 A;  4BQ5 A;  3RZG A;  2GC0 A;  2ZAA A;  4DRV A;  1QJY 2;  2B4K A;  2FD8 A;  4M3C E;  4UFJ A;  2EIG A;  1U5Y A;  2Y64 A;  1AF9 A;  4Q4Y 3;  5FYV A;  3WIN E;  4S2G A;  1W0O A;  1H6X A;  2RHP A;  2ERF A;  1VBB 3;  4H7M A;  2ZGO A;  1UIK A;  4XDP A;  1JMU B;  3ETP A;  3IDB B;  3IDC B;  4IET A;  3ZIW A;  2JB8 A;  1DZQ A;  3W58 A;  4CCO A;  4P9J A;  2C5D A;  1YQ6 A;  1PZ7 A;  4RGG A;  1IGO A;  2R07 1;  1LOD A;  4E4S A;  1OOP B;  3NNL A;  2LTN A;  4ASL A;  4LHL A;  1HXS 1;  4CDQ A;  5JWP A;  4FXK B;  2UWA A;  4Q0S A;  4WVW A;  3NKT A;  1GLH A;  1FV3 A;  4B3N A;  1ENR A;  1ZBA 1;  3VD5 A;  3OY8 A;  1W6N B;  4ES8 A;  1PGL 2;  4ITC A;  5T3N A;  2XON A;  4IE4 A;  1W6P B;  5SV5 A;  2VOV A;  5C8W A;  5DXD A;  4ZS3 A;  1HRV 3;  1XXN A;  3AMH A;  3ZXK A;  2A6W A;  1D4V B;  2RM2 2;  3KGL A;  2VCM A;  3ON7 A;  1MZ6 A;  2K9Z A;  3NV3 A;  2W1S A;  1J3Q A;  1N1V A;  3PHM A;  1F4H A;  3QH7 A;  4HZF A;  4RL7 A;  1NXM A;  2PFW A;  3PIG A;  1DZT A;  3NKG A;  1GZT A;  1I3H A;  1LU1 A;  5C8C A;  4HMZ A;  4PI0 A;  1QOT A;  4DNY A;  3ZSK A;  3C7G A;  3BOP A;  2XL9 A;  4Q4Y 1;  5ACA 3;  3BPS A;  3WD5 A;  2DF7 A;  1VBB 1;  3ACG A;  3U1X A;  2F6B A;  1QJZ A;  1DQ2 A;  2ZGS A;  1RGS A;  4JVA A;  4E8C A;  2VVE A;  5JXI A;  3H8O A;  3PNA A;  3HVD A;  5FZD A;  1AYN 3;  2Y6L A;  1IKP A;  3RZJ A;  3VBU A;  1ND2 C;  1GR3 A;  2WN2 A;  2PHD A;  2ZAH A;  1RUG 1;  2R0F A;  4A3X A;  4XDO A;  4UW4 A;  2N7G A;  2ZHM A;  3LKJ A;  4MOA A;  4O9E A;  2JDH A;  3AMM A;  5JR7 B;  3WG4 A;  2E33 A;  2OX0 A;  4IEX A;  1KIT A;  2G9F A;  2R30 A;  4EN8 B;  3Q8F A;  4PQQ A;  2ZTN A;  5LW9 A;  3WP4 A;  3AP7 A;  4AFA A;  4Q0Q A;  4V1P A;  5F3E A;  3J8F 2;  5A3T A;  2NQY A;  2P3I A;  2G9Z A;  1HJG A;  2XJQ A;  3UT0 A;  1DYO A;  1XNA A;  5BY5 A;  4HK8 A;  2BDR A;  2D7F A;  1PVC 2;  1RIN A;  1MZE A;  1J84 A;  2CYF A;  1H0B A;  2H0V A;  5F2S A;  5F3G A;  3S7E A;  4DIQ A;  5KBF A;  4R4Z A;  5KXD A;  3A22 A;  4I3G A;  2PHW A;  2QQM A;  4LE4 A;  4QB2 A;  2DWR A;  4I2O A;  2WNU C;  2NMN A;  4X6R B;  5ACA 1;  3ZMO A;  4AFM A;  2QQP A;  3WW4 A;  5BNN B;  5GM0 A;  3VZN A;  3OUJ A;  2P37 A;  3JU9 A;  1TMF 3;  2MEV 3;  3ZXD A;  2H6C A;  4CZS A;  3VHR A;  3ZXE A;  3ZYB A;  1AYN 1;  4HT1 T;  3H0O A;  1GQP A;  2UWB A;  3K4D A;  1UMZ A;  4XCA A;  2W46 A;  4PIY A;  5BPX A;  3RWK X;  3OYW B;  1WW6 A;  3UJQ A;  4MGI E;  1IHM A;  4XTP A;  4AED C;  4HPK A;  5CBL A;  1OH4 A;  2DU1 A;  4RD7 A;  4AHZ A;  2BEO A;  4DPN A;  4BIS A;  2FDK A;  3UKT A;  2W95 A;  3I3D A;  3C8X A;  5JIU A;  1UMI A;  1DP0 A;  3T1L A;  2W91 A;  3V64 A;  2ZS6 B;  1N3O A;  1OBN A;  5C8C C;  3LPF A;  1S2K A;  2YU2 A;  4AI0 A;  3VZM A;  5A7W A;  5KHI A;  4FP2 A;  1HN1 A;  4Z82 A;  3WDX A;  2WNV B;  5BXX A;  3T4H B;  4Y3O A;  1C57 A;  1W9S A;  4A6S A;  3I97 A;  2ILM A;  1WCD J;  3Q8C A;  5BNP A;  5FRA A;  4XFC A;  2YY1 A;  1ND3 A;  3UGG A;  3DF0 A;  1YQC A;  3WNK A;  1UOB A;  1TMF 1;  2MEV 1;  1VAL A;  4UF0 B;  1ZZ6 A;  2B5H A;  3FE5 A;  5J36 A;  1OVP A;  1RUE 2;  4YW1 A;  2K0G A;  1CWP A;  3ZYR A;  1OT5 A;  4L11 A;  4XAB A;  4QXK A;  2OUJ A;  3O1T A;  4AGG A;  1X36 A;  3VBF B;  2EVX A;  5ABJ C;  1UY0 A;  2BGP A;  3C3V A;  4LUL A;  3SHR A;  4PDW C;  4GUL A;  3I3M A;  3S5A A;  1SCR A;  2CHH A;  3SIT A;  1VJ2 A;  3OBT A;  1D2Q A;  3HD8 B;  3MI8 A;  5L9B A;  5J09 A;  3LEM A;  4CEY B;  4OI2 A;  4QAW A;  2FCT A;  1KQR A;  1OUR A;  3BTA A;  2W68 A;  4YRD A;  5T55 A;  1W2A X;  4IEU A;  1K3I A;  4ISQ A;  4P9I A;  3V0B A;  1YC6 1;  1JYN A;  3VKL A;  1RUF 1;  4GB3 2;  4OUM A;  1GP6 A;  3P1I A;  1IZ3 A;  2PMW B;  2W2I A;  2Y6F A;  4XTM A;  3F2Z A;  1PX4 A;  3FUQ A;  1H6Y A;  3ZSE A;  2FDI A;  1CON A;  2NLR A;  4OUS A;  1QH7 A;  4HFS A;  4KG0 A;  4LKF A;  1AR9 3;  2QVS B;  4MXW B;  4ONU A;  4QQ2 A;  4AGV A;  1XE7 A;  1TNR A;  3ABZ A;  2ORZ A;  1JYW A;  2DVA A;  5E16 A;  5F3C A;  4ASK A;  1OPM A;  4QHB A;  1C8N A;  2A6V A;  1W0N A;  2RR1 3;  5AFE A;  4W8J A;  1AX0 A;  2JDY A;  4PJY A;  5GLV A;  2YZ4 A;  3K77 A;  4R52 A;  5LAS A;  4BK4 A;  1MQT C;  3ALQ A;  1PK6 C;  4QGM A;  3WDU A;  2P3Y A;  3FHA A;  1H2M A;  4MAD A;  4DXS A;  5K0U A;  2WZR 1;  1S0B A;  4JGZ A;  4QX3 A;  3KZ4 C;  4K1Z A;  5LRR A;  5FYM A;  4YM2 A;  3U78 A;  5L9R A;  3VD3 A;  4DRR A;  2AR6 A;  3MW2 A;  2ZEX A;  3E6D A;  2HBT A;  4YM1 A;  3SC7 X;  2Q4S A;  5A3P A;  3M4F A;  1AX2 A;  1K45 A;  1RUD 3;  1ONA A;  1LHN A;  3JXS A;  4I3P A;  5HBA A;  2UWC A;  3TNQ A;  3W5N A;  1RIT A;  4XJU A;  1AR9 1;  4L9B A;  3S6P A;  1RL3 A;  1TME 3;  1VBC 3;  3AM2 A;  3BU7 A;  1EV1 2;  4BQX A;  3LOB A;  3KCX A;  4LK7 A;  4EN7 B;  3VN4 A;  4BHP A;  4P14 A;  2CDO A;  2EIB A;  2XJP A;  4HBN A;  2PHT A;  4HKW A;  4WVV A;  4ERO A;  4GH4 A;  4GWI A;  1ZYB A;  4UFH A;  2RR1 1;  1G6N A;  5EJZ B;  3TEX A;  1WLT A;  3BYW A;  4QPG B;  2HEV F;  5DPN A;  5FP7 A;  3E97 A;  1GP5 A;  3LF7 A;  2V5Y A;  3AZZ A;  1KXG A;  3J7N A;  1ZZ9 A;  2Y0O A;  4LLO A;  3WF1 A;  1W8Z A;  3FLT A;  5HV0 A;  4AF9 A;  5IHR A;  4MET A;  3JZV A;  5FCC A;  5FY5 A;  2VJX A;  1WD4 A;  4XIK A;  2VZQ A;  4XFH A;  2CNA A;  4FO9 A;  1ULG A;  3IM0 A;  2FHR A;  4WM7 C;  2Z2S B;  4LXL A;  3W20 A;  3AL6 A;  1UKR A;  2GND A;  1S0G A;  4A2U A;  4NR1 A;  4IE7 A;  3APB A;  5LEK A;  1ULP A;  2YU1 A;  5KXB A;  2XJS A;  1ASJ 2;  3O1O A;  4V2V A;  5DAW A;  5LAT A;  1TME 1;  4JKK A;  3ILF A;  4MGT A;  5LA9 A;  1NCR C;  3PL0 A;  2WC2 A;  3KT1 A;  2HEW F;  3POE A;  4XAE A;  4B4R A;  2PAE A;  2JIJ A;  2WWJ A;  4KG8 A;  4D7S A;  2D6L X;  3KB5 A;  2XJV A;  4O61 A;  2D44 A;  1N1Y A;  3UJO A;  1GIC A;  5EQU A;  3EHK A;  5K0U C;  3MIF A;  1PIV 2;  1OH3 A;  2BOJ A;  3DN7 A;  4XF1 A;  5LRS A;  1JUH A;  1VLN A;  2AEY A;  1RUJ 3;  2WNU B;  5EPA A;  5FP3 A;  1AR6 2;  3M3E A;  4OHV A;  3NWK A;  3ETQ A;  4XPV A;  3N7J A;  4LHN A;  4XUR A;  2VGD A;  4OI0 A;  1XNC A;  3WHU A;  1OLR A;  1VB2 A;  2CL2 A;  3FWE A;  4ZU5 A;  1V6I A;  2VCB A;  1UY2 A;  4Y1U A;  3T0A A;  5G05 L;  3ZXF A;  4QMA A;  1W6M B;  1LEC A;  3AFK A;  2NPI A;  4GWM A;  1UYX A;  4H3W A;  4Z2W A;  5JR2 A;  3MYX A;  4V2W A;  1PMI A;  1X8E A;  3T2P A;  4RGA A;  3LFI A;  4AED B;  4CCE A;  5FZL A;  3VDD A;  4Y5S A;  2QZ2 A;  3OPW A;  4EYU A;  1WBL A;  2XDV A;  4CUG A;  5ISL A;  1Z78 A;  1W8N A;  3BOW A;  5EYY A;  2X5I C;  3UET A;  5BNQ A;  2C9A A;  4IE0 A;  3ACH A;  1K5M C;  3H3Z A;  2HWB 3;  5HCB A;  4Q1R A;  5B2G B;  1WD3 A;  1FPN 2;  4OUL A;  4CP0 A;  2IXI A;  3H50 A;  2FMY A;  2WS9 3;  4FPG A;  5FMO S;  1HB3 A;  2YPD A;  4Y1Y A;  1RUJ 1;  4RA0 A;  3W9A A;  2JD4 A;  2WZP P;  2XKP A;  3RI8 A;  4K3U A;  3UYJ A;  4PBP A;  4XJW A;  2A5Z A;  2OPK A;  1UL9 A;  4WV8 A;  4OVE A;  3ZIX A;  2EID A;  3CKH A;  1W05 A;  2KM2 A;  1RTV A;  3DPR A;  4NID A;  1WZX A;  4EZ4 A;  1W9T A;  4FQ4 A;  2IXK A;  3GZT B;  5DMY A;  4JKM A;  1GUI A;  1O4Z A;  1UF2 C;  3GBG A;  1CGP A;  1L7Q A;  4Y24 A;  2RE9 A;  5FBZ A;  3H8U A;  1LU2 A;  1GWK A;  4QX5 A;  4OQ8 A;  3T0B A;  5ABJ B;  3PVB B;  4CU9 A;  3JD7 2;  4P02 B;  4A7Z A;  3Q8B A;  1F8V A;  2WO7 A;  4PDW B;  1LUL A;  5FIX A;  1VB4 A;  2HWF 3;  5D2A A;  5A6Y A;  4LTA A;  1ZBE 2;  2AYH A;  4WZF A;  5IJR A;  4Q1P A;  2HWB 1;  1NLQ A;  2ZEZ A;  4KGG A;  3M3C A;  4Y1Z A;  3JBG 2;  1AUY A;  2ARB A;  1H1A A;  2ZAC A;  4C91 A;  4FSJ A;  2YB7 A;  3VGI A;  2QBX A;  5JXJ A;  2ZCW A;  4C1W A;  1COV 3;  2E26 A;  2WWU A;  4LPL A;  2QDR A;  1HDK A;  5JUV A;  2X09 A;  1LJ7 A;  3RI9 A;  1ODM A;  2R49 A;  3VZJ A;  4JQR A;  4CU8 A;  3ILR A;  3OBZ A;  1ZRC A;  4HLT A;  1OOP A;  3GBF A;  2BWC A;  3LWC A;  1RB8 G;  1V6N A;  5A6X A;  2OW4 A;  4PQ9 A;  5FYZ A;  1CAW B;  2VG9 A;  1DIW A;  1YUD A;  4S2H A;  3IMM A;  1W6N A;  4BQ1 A;  5FKB A;  4AYU A;  1YJK A;  5HCA A;  1W6P A;  2RS5 3;  1YCI A;  4YPJ A;  5T5O A;  3ZSM A;  1WUV A;  2DU0 A;  2E32 A;  1CX4 A;  3RZL A;  3I3Q A;  2MNG A;  2A7A A;  1Q8Q A;  1LED A;  1UZW A;  3N7M A;  2G4I A;  2ZGU A;  3POJ A;  4NAO A;  3VBR C;  4BPZ A;  3R0R A;  4COW A;  3IWZ A;  2RJK A;  3DV8 A;  3HNM A;  4N8M A;  2XB6 C;  1VR3 A;  2ET7 A;  3ZYP A;  1DU3 D;  1MQT B;  4JGY A;  5JVV A;  4XMI A;  1JYT A;  1WA4 A;  5JIA A;  4JDO A;  4BYY A;  4N43 A;  3ZMN A;  4W6X A;  2I74 A;  1QEX A;  1JTZ X;  1NLR A;  1VBA 2;  1VMJ A;  3HT2 A;  1ULD A;  3RPQ A;  2BYV E;  5IVV A;  3ILN A;  3ZR6 A; 
#chains in the Genus database with same CATH homology
 1UWW A;  3FL7 A;  4MGS A;  2VME A;  3I3E A;  3GM8 A;  2ZEY A;  4LKS A;  1JZ3 A;  2ID4 A;  4CUA A;  1OD3 A;  3C7E A;  4OZO A;  4ZY9 A;  3VDB A;  3A21 A;  4KMQ A;  2WAO A;  2BZD A;  3IAQ A;  3CZJ A;  2VZR A;  5LA2 A;  4AAX A;  1RYY A;  3E1F 1;  1GOH A;  1US2 A;  2WQ8 A;  1XC6 A;  4HG6 B;  4A4A A;  3I2I A;  3ACI A;  1UX7 A;  3CIH A;  1JYX A;  3NJX A;  1D7P M;  1O8S A;  4P00 B;  1GNY A;  2J1A A;  3WNL A;  1NAE A;  3DYM A;  4ZZ5 A;  3AC0 A;  4RYD A;  5HPO A;  4A6O A;  2W3J A;  2DCK A;  2VZ3 A;  2W5F A;  5FUI A;  3A23 A;  3K46 A;  4QX0 A;  1SG3 A;  3CZU A;  3J7H A;  3IB3 A;  2PQS A;  4ZXE A;  2JE8 A;  4CVU A;  2C9K A;  4IUG A;  3OB8 A;  4KI5 M;  3WF4 A;  2J1T A;  3OGR A;  5EJ1 B;  2YC4 A;  3DYO A;  1TG7 A;  1W8O A;  3OEA A;  1UXZ A;  4OMC A;  1JU4 A;  4QDQ A;  2VCA A;  4W50 A;  2B4K A;  4AG4 A;  1SHW B;  2VO5 A;  1IQD C;  1JI6 A;  1WCQ A;  4DEQ A;  2Y64 A;  4ARX A;  1H6X A;  1UMH A;  2W92 A;  5J1X A;  1PX3 A;  3ETP A;  2ZEW A;  2J22 A;  2Y8K A;  1O59 A;  2W1U A;  5IYY A;  2QQI A;  4QPW A;  4QX1 A;  3FHQ A;  3VD5 A;  3T08 A;  2VQT A;  2VQU A;  2R7E B;  2XON A;  2C4X A;  3A7Q A;  2WDB A;  5G04 L;  2W1S A;  2VMD A;  1F4H A;  4MGQ A;  1UXX X;  4XUQ A;  3C7G A;  3MV1 1;  3C7H A;  1W9W A;  3LPG A;  4JHZ A;  3WEZ A;  3VD9 A;  3ACG A;  4ZZ8 A;  2YFZ A;  1DLC A;  5C7G A;  4XVH A;  3FN9 A;  2X05 A;  4E8C A;  5JXI A;  2Z4F A;  3PUI A;  2HLE A;  1UYZ A;  2Y6L A;  5DN2 A;  1WKY A;  2WN2 A;  1JHJ A;  2Y6G A;  2WO2 A;  5DQ0 A;  4BJ0 A;  4MOA A;  2KD7 A;  4QB1 A;  2Y6H A;  4XUN A;  2E33 A;  2EIC A;  1F4A A;  3MBW A;  4PQQ A;  3SEP A;  4DEV A;  4BDV B;  3VD4 A;  2W9X A;  3C7O A;  1KEX A;  2WBK A;  2QQJ A;  1DYO A;  1XNA A;  2C26 A;  3OGV A;  3W5M A;  5CYY A;  2L9L A;  4OMD A;  1J84 A;  3A22 A;  2QQM A;  4QB2 A;  3P6B A;  3VDC A;  3WNO A;  1BHG A;  5C70 A;  2RJ2 A;  4W4Z A;  3T09 A;  4CU7 A;  4JX0 A;  4QX2 A;  4A42 A;  3WF0 A;  1GQP A;  3K4D A;  3BN6 A;  3WSO A;  3HNB M;  2W46 A;  3THC A;  2CDP A;  1JZ5 A;  4A3Z A;  1OH4 A;  1ULO A;  1UY1 A;  2W95 A;  3I3D A;  3C8X A;  1JZ7 A;  1UMI A;  3SKV A;  5IFP A;  1DP0 A;  2WN3 A;  2W91 A;  3I2H A;  3LPF A;  1PMH X;  2YFU A;  1HN1 A;  3MUZ 1;  2W94 A;  1W9S A;  3I97 A;  4BXS V;  1J83 A;  1UZ0 A;  4CU6 A;  3WNK A;  5B4N A;  2ORX A;  3WF2 A;  3GGL A;  5A1A A;  3DEC A;  2VZU A;  3D3A A;  1OT5 A;  3I2F A;  3K4A A;  1UY0 A;  2WAA A;  2BGP A;  3SEE A;  2V5D A;  5JMO A;  4CUC A;  2QQL A;  2W1Q A;  1UY3 A;  1SDD B;  3MO4 A;  1CZT A;  2V4V A;  1JU3 A;  3CDZ B;  4QAW A;  1I5P A;  4P08 A;  2X10 A;  1K3I A;  2EIE A;  2WZE A;  3IDA A;  1JYN A;  3WNP A;  3LEG A;  2QQO A;  2VC9 A;  3P1I A;  1XNT A;  4DXT A;  4D8M A;  4DUX A;  3F2Z A;  1PX4 A;  2DCJ A;  2VZV A;  1H6Y A;  1GU3 A;  1JYV A;  4DUV A;  5LCW L;  1MPX A;  3ABZ A;  4QB6 A;  2ORZ A;  1JYW A;  5B4X A;  4TXW A;  3WF3 A;  4DXR A;  3VDA A;  1W0N A;  4GWJ A;  4W8J A;  3IAP A;  3K77 A;  4BK4 A;  2QQN A;  5F7U A;  4L0P A;  3FHA A;  4MAD A;  2WAB A;  3ZM8 A;  1OF4 A;  4P5Y A;  3HPN A;  4DXS A;  4QDS A;  4QX3 A;  3GXU A;  3VD3 A;  3WNM A;  1JZ4 A;  5HXM A;  2ZEX A;  1GOF A;  2VM9 A;  3T2O A;  2YC2 A;  2ZXQ A;  3T2Q A;  5C71 A;  1K45 A;  3JXS A;  5EIY B;  2WO1 A;  4M4P A;  3W5N A;  1TVG A;  2J1E A;  2VMC A;  2WO3 A;  4A41 A;  2BBA A;  2CDO A;  2EIB A;  2YG0 A;  4GWI A;  5EJZ B;  2OKX A;  3NJV A;  3CMG A;  5DPN A;  3K75 B;  3NNG A;  5CZK A;  2XHN A;  3WF1 A;  3SKJ E;  5IHR A;  2J7M A;  4MO3 M;  2VJX A;  2VR4 A;  1NX9 A;  2VZQ A;  1W99 A;  5JXG A;  5I0D A;  3EB7 A;  2BGO A;  1NKG A;  1ULP A;  1JZ6 A;  3LQC A;  3GDB A;  4LHS A;  3CQO A;  3OEB A;  4JKK A;  2VL4 A;  4E8D A;  1XPW A;  1CZV A;  4DUW A;  1CIY A;  1UYY A;  1R64 A;  2W47 A;  1CX1 A;  3NQH A;  2RV9 A;  4LQR A;  2VZO A;  2VCC A;  4UAP A;  3LEK A;  2VTF A;  1K12 A;  2E31 A;  2JDA A;  2V72 A;  4GZ9 A;  3DYP A;  3HEI A;  4XUR A;  2VZP A;  4D0Q A;  2DDU A;  3WQB A;  2VOT A;  2VCB A;  1UY2 A;  3T0A A;  5G05 L;  1O8P A;  4FI9 A;  5JR2 A;  1JZ8 A;  1UYX A;  2XQX A;  4JKL A;  2Y6J A;  4OUE A;  4UOJ A;  4PT6 A;  3I2G A;  3T2P A;  3T0D A;  2QQK A;  3EYP A;  3PUH A;  1L7R A;  1W8N A;  3UET A;  3NRU A;  4XUO A;  3ACH A;  4KWU A;  1UY4 A;  2JKX A;  3OG2 A;  2WYS A;  2B9V A;  4A45 A;  3BGA A;  1OF3 A;  2JD9 A;  4TTG A;  1CZS A;  2BER A;  4BK5 A;  3LEI A;  3ECQ A;  3ACF A;  2EID A;  3CKH A;  5LA1 A;  3C7F A;  3WNN A;  1EUT A;  3HOB A;  1JZ2 A;  1W9T A;  1GOG A;  3U37 A;  4JKM A;  5DMY A;  5LA0 A;  2Y6K A;  3K4Z A;  1GUI A;  3VD7 A;  4QDR A;  1PMJ X;  4XZU G;  1L7Q A;  1EUU A;  1P8J A;  2HYX A;  3OBA A;  4M4R A;  5JXH A;  2VZT A;  3T0B A;  4A44 A;  3I2J A;  4CU9 A;  2W1W A;  2WZ8 A;  4P02 B;  2WUH A;  1KGY A;  2XOM A;  4ET7 A;  3LE0 A;  4Z2A A;  5IJR A;  4CUB A;  2J1S A;  3III A;  2ZEZ A;  4ARY A;  1T2X A;  3OGS A;  2YB7 A;  4XUP A;  2QBX A;  3THD A;  5JXJ A;  2E26 A;  3HN3 A;  3MUY 1;  4LPL A;  3HJR A;  5JUV A;  1NUK A;  2X09 A;  4CU8 A;  1GMM A;  3I2K A;  1US3 A;  5IFT A;  2VMF A;  1K42 A;  2RVA A;  4UI9 L;  3HNY M;  4YPJ A;  2E32 A;  2VZS A;  2LW8 A;  4RN5 A;  4XUT A;  3UNP A;  3HNM A;  1LNS A;  1YQ2 A;  2VZ1 A;  4PF1 A;  2J1R A;  2LS6 A;  3UES A;  3MV0 1;  2J1V A;  2W87 A;  3I3B A;  2J1U A;  4OYU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...