2VZPA

Atomic resolution structure of the c-terminal cbm35 from amycolatopsis orientalis exo-chitosanase csxa
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
126
structure length
126
Chain Sequence
DPVDYQAEDATIVQGAVESNHAGYTGTGFVNYDNVAGSSVEWTVTVPSAGTYDVVVRYANGTTTSRPLDFSVNGSISASGVAFGSTGTWPAWTTKTVRVTLAAGVNKIKAVATTANGGPNVDKITL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
total genus 26
structure length 126
sequence length 126
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16990 CBM_35 Carbohydrate binding module (family 35)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzpA00
3MO4A 4FI9A 2HYXA 5EIYB 4DUXA 1K45A 4XUQA 1J83A 1WKYA 2LW8A 5DMYA 3VD3A 4DXSA 4IUGA 1XNAA 4CU7A 1GNYA 2YC2A 3EB7A 2VQUA 1GMMA 3OGSA 2VTFA 2W1QA 3OGRA 2YFUA 4ZZ5A 2VMEA 3A23A 2E33A 4JX0A 2VC9A 2KD7A 2W9XA 1HN1A 1NKGA 2WN2A 5IFTA 3ZM8A 2VQTA 2VZQA 2QQIA 5JXJA 1UMHA 3BN6A 1K42A 2VM9A 4BXSV 2QBXA 3JXSA 2B9VA 3ECQA 5EJ1B 4CUCA 5F7UA 3OGVA 2VZRA 3WNLA 3SKVA 3IDAA 3I2IA 3LPFA 2QQNA 3WF0A 2W46A 1UYXA 4XUPA 3T2QA 1W0NA 5CZKA 3IB3A 2CDPA 5B4NA 3HNBM 2WDBA 5IHRA 5JXHA 2XQXA 4OYUA 3OBAA 1UY0A 3C7FA 2DCKA 2QQJA 3EYPA 4XURA 1KEXA 3IIIA 4OMDA 1JZ7A 3I3BA 4W8JA 2XOMA 4DUVA 1SHWB 2X10A 5EJZB 3GDBA 1GOHA 1OF3A 3CIHA 1SDDB 2VZUA 2VCAA 1UY4A 2VZVA 3DECA 1CZTA 4A41A 4DXTA 1JZ3A 2VMDA 4CU9A 1UY3A 3IAQA 3OEAA 3WF4A 3K75B 3PUHA 4A3ZA 2C26A 5DQ0A 2WZ8A 4RN5A 2VZOA 3VDAA 4A42A 4GZ9A 5I0DA 2YB7A 4QX2A 4UI9L 4DEVA 3WF2A 2V72A 1JZ8A 2ZXQA 3WQBA 3VD9A 4ARXA 2JD9A 4P5YA 4E8DA 3HEIA 2X05A 3A21A 3WNNA 2LS6A 4LHSA 4XUTA 4W50A 3D3AA 1EUUA 2DCJA 4QDSA 4P08A 3AC0A 4YPJA 3GXUA 2VJXA 1UYZA 2VO5A 4L0PA 2WBKA 2QQLA 4P02B 1PMHX 4RYDA 2J22A 1UY1A 1GOGA 2XONA 1UMIA 3I2FA 3ACGA 2QQOA 3HOBA 5C7GA 1DLCA 4XUOA 4M4RA 3C7HA 2J1AA 2Y8KA 3I2KA 2ZEYA 2WABA 1US2A 4QB1A 3LE0A 3OB8A 4JKMA 1XNTA 2C9KA 2J1RA 4XUNA 3OEBA 3MUY1 3WNPA 3LQCA 3W5MA 4XVHA 1JU3A 1UYYA 2VR4A 3I2GA 5JR2A 1UY2A 4PF1A 1W8NA 1TG7A 1OH4A 2V5DA 4AG4A 2JDAA 4MO3M 2VZ1A 4GWIA 3LEKA 4KMQA 3T0DA 3I3DA 3WNKA 4KWUA 3NQHA 2WAAA 4DXRA 1OD3A 5LA0A 3WEZA 2RVAA 2WQ8A 2Y6GA 5HPOA 3VDBA 2BERA 1L7RA 3PUIA 1US3A 2VMFA 4JHZA 1ULPA 2VZTA 3J7HA 2X09A 1O8SA 3GGLA 4A4AA 3HJRA 4PT6A 1P8JA 1PX4A 1JI6A 1K3IA 2JE8A 3P6BA 2EIEA 4W4ZA 2RV9A 1OT5A 1IQDC 1JZ4A 4A6OA 1W9TA 5IFPA 4P00B 4BK4A 3VD7A 2Y6JA 2WZEA 2YG0A 3T09A 1SG3A 2W87A 1JYXA 2WAOA 1MPXA 3CZJA 1F4HA 2ORXA 2BZDA 2RJ2A 1K12A 2Z4FA 2WO3A 4M4PA 2CDOA 4OUEA 2PQSA 1EUTA 2QQKA 3T0AA 2Y64A 3U37A 1BHGA 4QX3A 5IJRA 1UXZA 2L9LA 3WSOA 2W47A 5CYYA 4BJ0A 4QDQA 3CDZB 3K4AA 5JUVA 4LKSA 1NX9A 1L7QA 2EIBA 1JYNA 1W9WA 1I5PA 4CUBA 2J1EA 4BK5A 4QAWA 4GWJA 1UX7A 1GUIA 1YQ2A 3A7QA 4QPWA 5G04L 4DUWA 3CQOA 5C71A 2Y6KA 3NJVA 2WUHA 2V4VA 5A1AA 4MGQA 2B4KA 2W94A 4ZXEA 3CKHA 1GU3A 1JHJA 1CZSA 5IYYA 1DYOA 3T2PA 4QX0A 2HLEA 2VL4A 3I3EA 1UWWA 4CVUA 2JKXA 4ZZ8A 3IAPA 4PQQA 3K77A 3ETPA 3UNPA 3A22A 3LPGA 4QB6A 4ZY9A 2W92A 2EIDA 3CMGA 4QDRA 3VD4A 1GQPA 1XPWA 3LEIA 3HNMA 1H6YA 3SEEA 2XHNA 5LA2A 3THCA 3UESA 3T08A 2J1VA 3NRUA 3ACFA 5FUIA 1NAEA 2VOTA 5LA1A 2W1UA 4MGSA 4ET7A 3FL7A 2BGOA 4D0QA 2WYSA 3HN3A 2J7MA 1CX1A 4MOAA 3NNGA 1JZ6A 4UOJA 4OZOA 1GOFA 2WO1A 2R7EB 1T2XA 1XC6A 1UZ0A 1LNSA 2W95A 3WNOA 2ORZA 3I97A 5LCWL 2VMCA 4BDVB 3P1IA 2W1WA 5DPNA 4KI5M 2VCCA 3BGAA 3MV11 3DYMA 2WN3A 2QQMA 5HXMA 2ZEZA 3SKJE 2W3JA 5JXIA 1JU4A 3WF3A 3DYOA 4DEQA 4LQRA 4A44A 3I2HA 1CZVA 2E32A 3K4DA 3W5NA 3FHQA 1DP0A 2Y6HA 2DDUA 2VZSA 1JZ5A 3K4ZA 2E26A 2E31A 3ABZA 5JMOA 1CIYA 2J1TA 2BGPA 2ZEXA 2WO2A 3K46A 3F2ZA 1ULOA 3MUZ1 4ARYA 1WCQA 2J1SA 2W91A 4AAXA 2VZ3A 3C8XA 3DYPA 4TXWA 4JKKA 3E1F1 5J1XA 2ZEWA 4OMCA 4CUAA 4CU6A 5C70A 1O8PA 3I2JA 4QX1A 1R64A 2OKXA 3GM8A 1PX3A 4A45A 3T2OA 4TTGA 2YC4A 4QB2A 3T0BA 3ACIA 2W5FA 1JZ2A 1O59A 4XZUG 2VZPA 4HG6B 4Z2AA 1OF4A 3NJXA 3WNMA 3OG2A 3HNYM 2VCBA 1PMJX 1D7PM 1TVGA 1JYWA 1W8OA 3C7OA 3FN9A 3UETA 1W99A 2J1UA 3C7GA 3CZUA 4UAPA 4D8MA 3C7EA 1KGYA 1W9SA 2C4XA 4LPLA 5G05L 1F4AA 1UXXX 2EICA 2ID4A 1J84A 3VD5A 2W1SA 3FHAA 3VDCA 1RYYA 3LEGA 4E8CA 3MV01 1NUKA 2Y6LA 1H6XA 4MADA 5B4XA 3SEPA 3THDA 5JXGA 1JYVA 4CU8A 5DN2A 4JKLA 2YFZA 3HPNA 2BBAA 3WF1A 3MBWA 3ACHA
chains in the Genus database with same CATH superfamily
5C3OA 3KZ4C 3BODA 4IEZA 2CYFA 2WNVB 1GV9A 1UL9A 1ST8A 1CONA 1HV1A 5FP3A 5A7OA 3T3YA 5FKBA 4DINB 4DUXA 1W8FA 4NPRA 4B3NA 4CCOA 1J83A 4NE9A 1D4VB 2LW8A 4XF0A 5FZ8A 3VKMA 1GQGA 2XKOA 2QUOA 3VZJA 4QGMA 2V09A 3DEMA 1UU6A 4M01A 4MGKE 2EALA 1XXNA 4AQTA 1LENA 4C1XA 3NAPC 4NAOA 5EXOA 5L9RA 3WDYA 4B4QA 2JG8A 4UWDA 4DOUA 5K9YA 5FWJA 2PAEA 3EB7A 4N9HA 1AUYA 4RS5A 5CU1A 4HVQA 1GMMA 5CEHA 4WM7A 2HWF2 1UCXA 1UPSA 3AZZA 3C3VA 4H2AA 4NWWA 1SLCA 3AVSA 4OUSA 4QGLA 3VBHC 1HXS3 2D44A 5DUUA 4CP2A 5LRRA 3JBG1 1LULA 1BEV2 1LKNA 5FZAA 3AYAA 1JBCA 1Y3TA 4AEDA 4JX0A 4XMIA 1J3PA 4R4ZA 1OVSA 4D7SA 4ONUA 2W9XA 4X6QB 2WN2A 2BPA2 5IT6A 3AB0A 2WFF1 4BU2A 5JAXA 1OUSA 1WMXA 4JTOA 2VZQA 2QQIA 1OH3A 4MSVA 3BN6A 4NR1A 4J1XA 5L7OB 4BXSV 5FR3A 1YFUA 2ZGKA 2P2KA 5F39A 5FYHA 3ZR5A 2QQPA 1RXGA 2IFWA 5ISLA 2VZRA 4FPEA 3VBFA 3SKVA 2WNUC 1VIWB 1ZBA1 2QQNA 2YV8A 1HV0A 2RJLA 2TNFA 4SBVA 4IE4A 1AJOA 1D4M3 4Y1XA 5CZKA 4D7YA 3IB3A 1RHI3 3W59A 1PZ9A 3HNBM 2WDBA 2OW4A 2GNTA 2UU8A 4XEZA 4ZPIA 1MACA 1G9FA 2BQPA 5CBLA 4HN0A 4Q4X2 2ZABA 3H8UA 3VKOA 1UY0A 2RR11 4COVA 4IE5A 2DCKA 1UNBA 3ZIXA 4RA0A 4CPBA 1JZ7A 1UW8A 1W0PA 1IOAA 1LHWA 2NPIA 1QQP3 1SBDA 2MNGA 2X10A 3JZVA 5FKCA 3ZXJA 1O4ZA 1LHNA 2BUKA 4AI1A 4P9GA 3CU7A 2VZUA 3J7LA 3KS7A 1UY4A 3O7OA 2R061 4XXPA 1CZTA 3VKFC 4XF9A 3HBZA 2CSGA 4DXTA 2D97A 1YQ5A 5CA6A 2XJRA 2BWCA 5JSPA 5FZ3A 3IAQA 1EY2A 1RJ8A 4QHBA 1REEA 4LEJA 3J7NA 2NMOA 2BU9A 4XFGA 3TYJA 1MZFA 1QJX3 3EO6A 4A42A 3D0SA 3ITQA 3PUQA 1Q5OA 5I0DA 4DEVA 4AWDA 2V72A 3KV5A 4L8QA 3RZLA 3RYRA 3KSCA 1VAKA 2OXBA 4I3PA 4RGGA 1MVEA 2VPVA 5FZ6A 4PI0A 3ZSMA 3MBWA 4YRDA 1XNDA 2BVBA 5A7PA 3PIJA 2D6MA 1JYCA 4P5YA 1COV1 3CL1A 2XB6C 1AXZA 3WNNA 5AVAA 4LHSA 4GMP0 4BLIA 2R1DA 1NYWA 5DXDA 1AYN1 4CDUC 1AVBA 3LOBA 1EUUA 4HONA 1LOFA 4YPJA 1GFF2 4LTAA 3WDUA 5FZOB 3TAYA 3WOGA 4XXAA 2PHRA 4P02B 4RYDA 3ZPOA 3PVNA 4AK3A 3MF9A 1OI6A 3RZJA 2J22A 4WVZA 4CSWA 3VL8A 4PCRA 3WCRA 1DFQA 1UMIA 3OPTA 5FZ9A 4BISA 3KVAA 5ACA2 5DUVA 3O1RA 1LOCA 1SFYA 2VBDA 2B5HA 1H8TB 1H2MA 3PVOA 4MHRA 4XJAA 3IDEA 2NQYA 4YYOA 2F17A 4E4HA 4AQ2A 2Z69A 1OOPB 2P37A 4PDWA 3O1SA 4NIGA 1G7YA 1EP0A 1U5YA 1YYNA 3UKVA 2W52A 3PTYA 4LIVA 1AJKA 2C9KA 5L7OA 3QOPA 3LA2A 2J1RA 4IV3B 5A7QA 4Q4Y3 1OD5A 1I6XA 1RC6A 2NMNA 1VRH2 2ZGNA 1VE0A 4RHV1 4XVHA 4QM9A 4MH0E 3OGJA 1UYYA 4CEWB 3I2GA 2RM23 3ZSKA 4PF1A 3ZSEA 3O0VA 2R063 3M7AA 1CAUB 1RMU2 4AG4A 1OKOA 1O6UA 2BOIA 1TE1B 2WT2A 4L97A 1O4TA 2VZ1A 4LUKA 1CIWA 3S0MA 5ABJB 1BEV3 4R9BA 1XU1A 1FT9A 2Y34A 5K0UC 1RUG3 3NKGA 4BYYA 1W9YA 5KHGA 2BNMA 5FUPA 3WUCA 3EXUA 1KDMA 4LORA 4U2AA 5BNPC 3AKTA 3WG4A 4IEOA 2ZGOA 3T1LA 1ULCA 3VZNA 1ZZ8A 4QXCA 4TLFA 1ULPA 2JG9B 1I5ZA 4BQ1A 5LBEA 2VZTA 1RUI3 2XLFA 3GGLA 3OBTA 2ZMNA 2X5IC 2UY8A 5E88A 1V70A 1WCUA 5FYVA 1K3IA 4CXWA 3VDDB 3ZDVA 2CGNA 3K48A 1DZQA 1RHI2 3FHIB 4CEYA 5HV0A 4LBOA 1LAJA 4O65A 1GZ9A 2O14A 2DYCA 3THPA 2FHRA 1UOGA 4ZS3A 2JWPA 3T09A 3S30A 4LITA 1FATA 2BVVA 2VMHA 2RHPA 3MGUA 3AMPA 3ZMOA 1DF0A 4HZFA 4I2OA 1F4HA 1UX6A 1FPN3 2C5DA 5GLUA 3RGBA 2Z4FA 5I0RA 1EUTA 2AR6A 5DAXA 1VALA 3IDBB 4COUA 3AXDA 3KD4A 5FO9B 3ILFA 1RITA 1ZBE2 2YXSA 3B69A 5IJRA 3AZWA 4NN0A 4KWKA 1HB3A 1WBLA 2P3YA 4BJ0A 4DFSA 4QDQA 3CDZB 1ZZBA 4S2FA 4XFCA 3BUCA 3MICA 5EYXA 4Q0QA 5FPAA 4Y26A 3JD71 2XXZA 5J7MA 1AL21 2EIBA 2D5FA 1R083 2Y6FA 3VBHA 4ASLA 2QCSB 4Q4W2 2E51A 2JDKA 3USUB 1I5PA 4GKYA 4CCNA 2FMYA 3WVJA 5FXXA 3TRSB 4XMAA 3GCWA 4EQVA 1SLBA 2GZWA 1SFNA 3DF0A 4CUBA 3QH7A 4CDXB 1G9CA 1TMF1 2OQ7A 1UX7A 5C3RA 3UL2A 3D8CA 3AMHA 5EJ3A 3CQOA 2IXKA 1IGOA 1NCQA 1HQWA 2WUHA 4KGQA 4AI3A 4G4FA 3Q8AA 5BPXA 4MGQA 1KITA 2WNVC 2XDVA 4E4SA 4LO7A 1W06A 3N7MA 4MV2A 1CZSA 5JOZA 3AJYA 1ND3A 2X5IA 5IYYA 1O3QA 4LLFA 3H42B 4D7TA 2ZGQA 3DN7A 3NAPA 1WCKA 3AM2A 2JKXA 3E97A 3K77A 4L2NA 2WA3A 1LEMA 3NL1A 4YVWB 4Z8BA 5F37A 2O8QA 3A22A 3LB9A 3BTYA 4KWJA 3OPWA 1W8UA 4YW7A 1CAXB 3I59A 3RI8A 2PAKA 3CMGA 1UOJA 3RPQA 3GYDA 1JW6A 2JIJA 5DG1A 3IWZA 1H6YA 5KC6A 2DCYA 2JICA 2HWD2 1VRH3 1FOD1 4PDWB 1OOPA 5FO7B 5A6ZA 1BCXA 1S55A 3E5XA 1ULFA 2WRAA 2RM22 1WLDA 4YW6A 4NHXA 4FPKA 3T08A 4BXFA 3V0BA 2VBPA 2XJUA 1RMU3 2XLGA 3ACFA 3J9SA 5F5IA 1NAEA 2TBVA 2VW0A 4QT6A 3VBSB 1POV0 4FAGA 3RZGA 1XJAA 5C33A 2CAVA 3MFCA 5FDBA 5JOXA 5KXEA 1KRIA 5FYMA 3M3EA 3I54A 1MEC1 2W1UA 4XJWA 1RUG2 3GNEA 4MGSA 1VMFA 1GZCA 3P5BA 4KL1A 5FLHA 5IATA 2VOXA 2WZR2 1H30A 4QPGB 3M3QA 2BGOA 4D0QA 5FZFA 1BJQA 1WW4A 5CFCC 3FFZA 4XPVA 3CJIC 1QXPA 4L92A 2JB4A 2PHTA 1RHI1 1WA6X 2RS11 4MOAA 4IEXA 4LUMA 2IVIB 3N35A 4NIAA 4AL9A 2A7AA 4QU1A 1F8VA 4Q0VA 3UGGA 3LCPA 4FQ4A 5JLVA 3U0ZA 2DVBA 2ZX1A 3T30A 3T4VA 1RUI2 1QNYA 4Q4V2 5A3TA 1LOAA 5ANQA 4AI2A 3IKWA 2R7EB 2WLPA 5LK7B 5A80A 5JSOA 3WINE 2CGPA 1QWRA 2PLV3 1W6PA 1UZ0A 2MEV1 2RE9A 1UIJA 4G3YC 1D2SA 2EIGA 5DPNA 3K3OA 4CDWA 3TEWA 3T4HB 1A3KA 2JENA 3UGHA 4AOCA 3GALA 2XJPA 4BMEA 4AVAA 2QQMA 3GJAA 1KJLA 4FPOB 3KLSA 5EWSA 3B7MA 2XBO1 1EAH2 5A6XA 4AGGA 1FPN2 1PNFA 2JE7A 2ZEZA 1GSLA 2DUQA 2HWE2 3DPRC 3N7KA 3DPRA 4JGZC 5BNPA 4A44A 1WLCA 2MHFA 2Z5WA 1V6MA 2DVDA 2E32A 3KM5A 2EXHA 3W5NA 5GKAC 1PHMA 2DDUA 4CUGA 5C5UA 4C0BA 3RFRA 1VBA1 1BBT2 2WS93 2E26A 4I30A 1ND2B 5EZWA 1F15A 3WD5A 1E5HA 2F4PA 2FBEA 2Z2SB 4XQ4A 4CDQC 2X53S 3UJOA 4Y5TA 4BQ2A 1O4YA 5EPAA 4LLOA 2GAUA 3BPSA 2AYHA 5TSWA 3NW4A 1R082 3F2ZA 3OTFA 3BCWA 4LBQD 2D3RA 4Q4W3 5CKNA 1W6QA 4B8EA 1OPMA 4JKKA 5FY4A 1PNGA 1BZWA 4XJ9A 3POBA 4QXHA 4HVOA 1O8PA 4HETA 4P9YA 5GLTA 3ATGA 4QQOA 3ZXFA 5EQUA 4M00A 1W8HA 4NOTA 3CO2A 5F9TA 1NE6A 3NVCA 4QKFA 4OHXA 1R64A 2W68A 4CDXC 5I0TA 3VBRC 4Y24A 4FAHA 1X36A 3WW1A 4QB2A 5A32B 1X8EA 3ZDSA 1REFA 4IEYA 5GZFA 5LY1A 3ZXEA 4ES9A 1PZ7A 1JZ2A 4AW7A 2VZPA 3WDWA 1S0IA 2WIIB 1PO23 1QDCA 4C0HA 1X9TA 4IV1C 1B35A 2XLAA 3M2MA 4XHBA 1HRV2 3O5SA 3MW3A 4RR3A 3FBYA 2AEYA 3KQ4B 3ZFGB 4CEYC 3OG2A 5HBAA 1HRI1 3OJBA 3N3HA 1YQ8A 4JVAA 2XMLA 5FLJA 1I3HA 2VCBA 4GH4A 5FZ7A 3CJIB 3MIHA 3VBOC 1PMJX 4DY3A 1WGPA 5K0UA 1WUVA 1W8OA 1RUG1 2HBUA 3C7OA 2XVKA 1LRHA 3FN9A 1OA2A 4HT1T 4OHYA 3KV6A 5CAZA 2DFBA 3VL9A 1GLHA 1AR82 2HKXA 4YW1A 4UAPA 3J26N 4NROA 3J7MA 3TN93 1N3OA 2ZA9A 1LU2A 4FXKB 3ZO0B 3KF3A 3VBSA 5C3PA 4KBBA 1GICA 3C7EA 1KGYA 1RUE3 2A70A 3HT2A 4NHLA 1QDOA 4AI0A 2RR12 4OFGA 5DZEA 2ZX0A 3F95A 4Q26A 5FYCA 5JI9A 3DCQA 2FDGA 2C9AA 4G9SB 3UJQA 1FNZA 1XSQA 4QWNA 5F1RA 1BLZA 2BNOA 1NLQA 2XL9A 5FZ0A 4CDQA 4NJ4A 1F4AA 1PO13 1XYNA 2ID4A 2NZ9A 4BPZA 2WZR3 4CP0A 1J84A 4FO9A 2K2SA 4S2HA 3FHAA 1AX2A 1Q8PA 2A6YA 2O1QA 1PIV3 4NWVA 5JI7A 1C4RA 1RYYA 4JTNA 3OBRA 4O9GA 4OVEA 1UZYA 5F6LB 1N1VA 1VBB1 2VY0A 4MADA 4OI4A 4UW4A 5B4XA 5JXGA 2G9ZA 1JYVA 4FVVA 4EN0A 3EQEA 4CU8A 5DN2A 1QGLA 4INDA 2JG9C 1DCSA 2QFEA 1QIQA 4JKLA 3KCCA 2RS51 2YFZA 5EYYA 1WMFA 3RZZA 3R05A 1MS9A 1NOVA 4KG0A 4AI9A 4JDOA 3Q8FA 3TBDA 2JDNA 4XZPA 1QF3A 1F2NA 1Q56A 1QJY1 1HRV1 1V9U3 3GZTB 4JDNA 2WFPA 3M3IA 4KH9A 4XJZA 5FYZA 4CRQA 1K45A 4XFBA 1PVC2 1NCQB 3OY8A 3PUSA 2LRPA 2XH6A 3CEWA 2UYBA 4A6SA 1ZNPA 4IEQA 1VBC1 3VD3A 3SITA 4DXSA 1FYUA 3AFGA 4IUGA 3RYPA 1WWYA 1XNAA 2HWB2 2JD4A 2VQAA 1AL0G 1HQLA 4QD2A 1C5HA 1S1AA 1EAH3 2YC2A 4MHUA 3SCHA 4WM7C 1ENRA 4GH4C 1R081 2RMU1 1W2NA 3VBOB 4XABA 1HRI3 1VAVA 1QJZA 3CJIA 4ISRA 2ZZQA 4K1ZA 4MGZE 3VHPA 3ZFGA 1XRUA 4NMIA 3WQ0A 4YLZA 4AHZA 2WC2A 1HN1A 1NKGA 1QY4A 3KT1A 3SXWA 4EV0A 2QZ3A 2OVUA 3KGLA 1HKDA 2JX9A 2NN8A 4NRMA 5FY1A 1K42A 4BMBA 2VM9A 3B01A 4XE9A 2G4IA 4LR4A 1NZIA 4CZSA 1LGBA 2QBXA 3VBOA 2NP0A 1Q8VA 3ECQA 3AP6A 4FPGA 1SLTA 1WMDA 4JZRA 4KU7A 5BV6A 2QDRA 3VLBB 2YDEA 3ZLIA 2WQZC 3WP3A 2R072 3LKJA 2FQPA 3WNLA 1ASJ3 1VRBA 4IERA 3I2IA 3WF0A 1H4GA 2ADEA 4XUPA 2VCMA 5JPMB 1W0NA 1ZZ6A 2LTNA 2CDPA 2WZPP 5FY0A 3FLRA 4FFGA 2QKDA 5HCBA 3VDDA 5JXHA 3KT4A 2XQXA 5FJKA 4UFHA 5KXCA 2FDKA 3OBAA 3H1YA 2Q0AA 2QQJA 3IMNA 1NE4A 1KEXA 1RVF3 4IESA 4XJ8A 3I3BA 4CTEA 3H1WA 4W8JA 5J3UA 2XOMA 2YYOA 1SHWB 3AL5A 5EJZB 1W6NA 3FJSA 1J3RA 5FPLA 1GOHA 1H1AA 1PO22 1GBGA 2R1BA 3CIHA 4C8DA 4WVWA 1HRV3 4OZXA 4ES8A 1RUC2 5L9VA 1DGRN 3KCYA 4DY5A 2DU0A 4CU9A 4Q0UA 3I3QA 5FBZA 1Y9GA 3O0WA 4GB33 3K75B 1E5SA 5BNPB 5J09A 4QHOA 2ENRA 4XAEA 5DG2A 4XBQA 4Z92B 2QVSB 2WZ8A 3LSEA 4J6GA 3RWNA 1WZXA 3GBWA 1HQNA 4DS0A 3AP9A 2WWJA 2A1XA 3BI3A 5DZFA 2VTXJ 4UI9L 5IVYA 1C5IA 1D0GA 1DQ2A 1X8MA 4Q29A 4EWEA 1JMUB 5FTTC 4DIQA 1CAUA 1VBD3 5JIUA 2ZXQA 2QZ2A 3NV1A 2ZGSA 4D94A 2A6XA 1VBB2 5HV4A 3WQBA 1RUF1 2RR13 5D8AA 4FQZA 1AR91 4Y1ZA 2PELA 5F3CA 4FOQA 4UW5A 4FTEA 2JD9A 4QXBA 1NQJA 2BEOA 4E8DA 1RUJ1 1WD3A 2JDPA 4NHKA 5DDJ2 5GJ6A 1GWLA 2EVXA 5FV3A 2R041 4UFJA 4XCBA 3K51A 4P08A 5T54A 1PIV2 3DXTA 2OUHA 1LOFC 2JDZA 2VJXA 5BNNA 1J58A 1CJDA 4EE2A 2QQLA 1PMHX 1RJ7A 3R4SA 3NKTA 3D0JA 3FUOA 4H3WA 1YUDA 4Y20B 4AFBA 4XFFA 1NLRA 2JDYA 3OCPA 1ASJ1 3MIBA 3QLQA 4YW3A 3X29B 2QQOA 1DLCA 1K5JA 2A3WA 4LHKA 4CPBD 3PJQA 5FZOA 4AFMA 2WABA 3HMYA 3WQ7A 3KMHA 3KF5A 3VBUA 2YBSA 4I09A 4JKMA 5A33A 4CDUB 5ERLA 5DAPA 4CCKA 2Q1ZB 3V64A 2AACA 4GH4B 1OUXA 3W5MA 1FMD3 5FCCA 3U1XA 4MGYE 2VR4A 1LOGA 4D6RA 5JR2A 1W8NA 2W39A 3LGRA 2VNGA 2A6WA 5FFOC 1SLAA 3RJRA 3ZX7A 4AVBA 1JYIA 1ZRFA 2RDQA 3S7IA 5LZ6A 4GWIA 4KMQA 3SNMA 4LK7A 3V0AB 4QGNA 4IXLA 1WBFA 3T0DA 1GP6A 4BH9A 3NJYA 3WNKA 1OBNA 5A32A 3PU8A 4FPCA 1OD3A 2QNKA 2ZX4A 3WEZA 4YM1A 5L19A 2XJTA 3HN1A 2HBTA 1V6NA 5A7NA 1BMV2 2QJVA 4FPFA 3VDBA 4KU8A 1FXZA 2BERA 5E16A 4EWAA 1W28A 4BQ4A 1US3A 4QKDA 2BWAA 3LWCA 1D2QA 4URAA 1RUF3 3BTXA 3VKNA 3WNXA 1AF9A 1WMEA 2LUWA 1GWMA 2R073 5C3SA 4N53B 1LB2A 1HX6A 3HT1A 1H9WA 1MR5A 1ASJ2 4NUBA 2YPDA 3BYWA 1GANA 4PT6A 4PLOA 4K6BA 4DQAA 1JI6A 4RGAA 2Z42A 4JQRA 1CGPA 1ODMA 1IQDC 2B9UA 3IZOA 4A6OA 2BW8A 5IFPA 5IVBA 1G86A 1ZZCA 4IEWA 5D1IA 4BK4A 1FX5A 2AGSA 3VD7A 3ALQA 3RZHA 2WZEA 4YG3A 2YMZA 1MS0A 4GMP3 4YGBA 5HXVA 1GNZA 3CZJA 1RINA 5FMBA 1GZTA 3ES1A 2HEWF 3OBZA 2RS12 3SQOA 1MZ5A 1N3PA 4I3GA 2HYKA 3W21A 3TN91 3WW4A 1N3QA 4DMIA 3HBKA 5FMCA 1F31A 2QQKA 3AK0A 3POJA 3T2TA 1Z7S2 3T0AA 1BHGA 3NNFA 3WW3A 5L7OC 1GQHA 4DO0A 5KBFA 1MZ6A 3IT8A 1ENQA 1UXZA 4GB32 5DZGA 1RUD2 2W08A 5A3LA 5DDJ1 2W47A 3QD6A 2ZBJA 1JN2P 1DQ5A 1QOTA 4P14A 2R30A 4Y1VA 1DQ0A 3MDPA 5JUVA 1IG0A 4LKSA 1XYPA 2VXRA 4I0AA 4LHLA 1HXS1 1XNBA 3ROUA 3UK9A 4IL7A 3SH3A 3JU9A 5EP9A 1IPJA 2GN3A 5C9AA 3SC7X 4EN8B 2FCVA 1UF2C 4TN7A 1GKBA 4LKFA 2J1EA 1VB4A 4ZKTB 1AYM1 2ZS6B 1GWKA 1GUIA 1YQ2A 4UFMA 5D2AA 4QPWA 4URTA 2Y6KA 1BKZA 4CXXA 2OZJA 5FP8A 5LEKA 2B42B 4IETA 5FZBA 5L36A 4A7YA 2W94A 4YW5A 3CKHA 1ZVFA 1BBT1 1JHJA 1SLLA 5AFEA 4FOVA 1OLMA 3AKSA 1ZM1A 1IPKA 1DYOA 3T2PA 2HWF3 3I3EA 1UWWA 1IS3A 4YZ2A 3RZKA 1NT0A 4Q27A 3WY6A 3MFAA 4PQQA 2Q1MA 4ZZ8A 2GC2A 5IVVA 3UNPA 4OQ8A 1OA3A 1UZVA 2VOVA 1RIRA 1GYKA 4M3CE 5F6KA 4B1MA 3ZXKA 4GULA 2R0FA 3A0NA 1G8WA 5C9AB 5CADA 1JUHA 1S2KA 2GC1A 1EV11 3B5LB 3SHRA 3WW2A 1CQ9A 2AZ5A 2RMU3 4XF1A 5CVRA 4A7KA 3S5AA 4K7JA 3PIGA 4GAZA 3ZVXA 1GQPA 3VD4A 1Q3EA 4AEDC 3LFMA 1F5FA 3L2HA 2ZGPA 1OA4A 1TME1 1R1A1 4GMP1 4M0HA 4BM8A 1UO9A 2ET1A 1AXKA 3AVRA 2XHNA 5LA2A 5F5QA 1BK0A 3THCA 3I7DA 2FCUA 4TZDA 1YQ6A 5KHJA 3AL6A 5A3OA 1VAMA 4XACA 3RS6A 1AR73 1BVVA 1D4M2 4LT5A 2HH9A 1O3SA 2HEVF 1ND3B 1M06G 1UD1A 4PHZA 3FL7A 4RSUA 3IDCB 4CCJA 3D4KA 1AL22 4Q4X3 1G9AA 2OZ6A 4JRLA 3HN3A 2HWC1 4KNCA 1CX1A 3LIGA 2GNDA 1VB2A 3SH4A 2QE3A 2A71A 3R0RA 3AP5A 3BB6A 4LNVA 5K4LA 4E2SA 4CE8A 5ACA1 1TMF2 2D93A 1X50A 2VU9A 3LDRA 4P5HA 4WZCA 3RYKA 2ZKNA 5AC91 2D43A 2DTYA 1UU5A 1GOFA 5DAWA 4YZ3A 1AYN3 1S0GA 1KFXL 1OPOA 3ZYHA 4BB3A 4E9KA 3USUA 4B1LA 3UYJA 1ONAA 1SCSA 2W95A 4B4RA 2DV9A 1OHFA 2Y38A 5GM0A 4DXZA 3I97A 1ZREA 5LCWL 2UWAA 2VMCA 5IAVA 1HLCA 1AZDA 1IS5A 2WYFA 4H55A 1AX0A 2P17A 4KI5M 2ERFA 3BGAA 5LA9A 5M0TA 2IVJA 2UWCA 1STMA 4Z82A 4R9CA 5FZDA 1AHSA 4HKLA 2UURA 2RS13 3SKJE 2YGMA 4K40A 3OUHA 2ZGMA 3JBG3 2JKBA 3DYOA 4DEQA 5KWRA 1W3XA 1TNRA 1U0AA 1Z7S3 1H2NA 2ZCWA 3PMSA 3GBGA 2ZHNA 1ODNA 1DQ4A 2CWMA 5FZ4A 1RUD3 2VZSA 3BKZA 1O5UA 2VNVA 2P5BA 3B02A 1TME3 2J1TA 2XR4A 2YUEA 4IDZA 3VV1A 5A3WA 4FSJA 2MEV3 4FFIA 3ZYGA 5LASA 1Q8SA 2YGLA 5A6QA 1N47A 3N7LA 3CLPA 2ZACA 2ZHMA 2W91A 3U10A 4CCLA 3O1UA 2VZ3A 4JRAA 3E1F1 2G1MA 1MVQA 4TWTA 5LB6A 5IAXA 2ZEWA 1T6GC 3EMRA 3I2JA 2BTVC 4W6XA 3BTZA 3B93A 3GHNA 1JTZX 3ZFFB 1SBFA 3R4DB 2HWC3 4Q4Y2 4QX1A 5FPXA 1ZRRA 1TZOA 3N9NA 1HJFA 2HEYF 3AZYA 4LBQB 3MZHA 1RUI1 1PX3A 4RFRB 5H9SA 3GHMA 4AVVA 2JE9A 4M3CF 4NAMA 1YO8A 1I9RA 2R062 1W2AX 2P6CA 3ES4A 4KG8A 4QMAA 4N43A 1IG3A 2QQVA 2W5FA 5IWFA 4HK8A 5GZGA 4LXLA 3MF6A 2VMIA 2VXJA 3NJXA 2PHDA 4Y5SA 5D8AB 4IV1B 4H14A 3N4MA 5LRSA 3HNYM 4JQTA 1LODA 2ES3A 2E7AA 3FZ3A 4ATEA 1D7PM 4IV3A 4LKDA 1JYWA 4O7XA 1Q8QA 3GF6A 2D6PA 1X33A 1JXNA 1SACA 2VTXA 4UYBA 3FLTA 1W99A 4U36A 3C7GA 5JR7B 5FPUA 3JQXA 4LBQA 2C24A 3RSJA 2ZJCA 4DPNA 4D8MA 1XU2A 3FLPA 4F83A 5F5AA 3VBSC 1H8TA 1Q8OA 1W9SA 5CNAA 2K0GA 2XPJA 1YFYA 2C4XA 1FOD3 5C8CA 4LPLA 1UQXA 5G05L 2EICA 3ETQA 4QKNA 5IK8A 1MQTC 2WA4A 3RG0A 3LDBA 1AL23 3N9OA 4DRVA 1R1ZA 4IW3A 2VBBA 1LU1A 4YW2A 3WDVA 4AF9A 5F8PA 1DYPA 1NUKA 2Y6LA 2XVLA 3THDA 2OUJA 1WW6A 4AE2A 5SV8A 2DCTA 4XC9A 1TMF3 2ATFA 3U78A 3VZKA 1NA1B 1PK6B 2GNBA 1C28A 2RG4A 3AX4A 3UKNA 4CCEA 5FOJB 3H8RA 4KBZA 2Z79A 1CX4A 4FPLA 1OF3A 1Y4WA 3ACHA 3ASIA 4MXWB 1ZA7A 5F2SA 3J8F1 4FI9A 1UKGA 2HYXA 4NRPA 1HB2A 5F3GA 4AQ6A 1GNHA 4KQ7A 3PMEA 1ENSA 4WM8A 1W8WA 1MS4A 4IGPA 4GWMA 1VRH1 3EJKA 3BU0A 2FMDA 4MXVA 2WL1A 2WO7A 1LECA 1KFUL 1SZBA 3H9AA 1WKYA 3M3OA 4AEMA 1S4CA 3POSA 4WVVA 1JOBA 3MPBA 3O1MA 3WP4A 1DZRA 1B35C 5IK4A 3FUQA 5BXXA 1GP5A 2VQUA 3TB0A 1IZ3A 1UKRA 3RZMA 1SFPA 4MGIE 1N1TA 3EHKA 2CNAA 2VD7A 2W1QA 2YFUA 1BQPA 3NV2A 2VMEA 2WT1A 4R4XA 3O12A 5FPZA 4XOGA 1H2KA 3VBUB 1XQNA 5J37A 3GCXA 1QH6A 5D8AC 2VC9A 3ZYJB 3LZZA 1BK1A 3N9LA 2KD7A 2XBO3 4YARA 5IFTA 1OOPC 2Y0IA 4LBJA 2GP5A 5GZDA 3WG3A 2RDRA 2GNMA 2Q8OA 1UMHA 2GU9A 1H8TC 4Y1UA 4W6WA 4COWA 2PHWA 4NIIA 3ZFEB 5T5OA 3PTRB 3HWJA 4YM0A 5EJ1B 5FIXA 1JOPA 5JZGB 5F32A 5F7UA 2QDNA 4FP2A 4MZUA 2E7QA 4QPGC 1FI2A 3OYWA 3OGVA 5A70A 5LW9A 4AGRA 5FPBA 2OT7A 4UT5A 5BNNB 2C1FA 3I2OA 4MYEA 3KQRA 4YM3A 3OPZA 2R6QA 1B09A 4CDWC 2GH8A 2W46A 1QXJA 4CCMA 2GC3A 5EV7A 3T2QA 1G9BA 1SDWA 5BNOA 2ILMA 5IHRA 2HWD3 4IEPA 4Y3OA 2VAUA 3U75A 2PYTA 3VDDC 4OYUA 2Q8CA 3C7FA 4PBOA 3P3NA 2CL2A 2I45A 3EYPA 3M1HA 4X8PA 4AI8A 1CAVA 3IIIA 4OMDA 4AEDB 1FPN1 1UOFA 1IKQA 4DUVA 3PHMA 1YI7A 4CDQB 1SDDB 1YJLA 2VZVA 5FYSA 3DECA 4B7KA 3M8LA 1MS8A 2ZTNA 3IN9A 5FXWA 1JZ3A 2CV6A 2IZWA 4V2WA 2VMDA 5T50A 4DNYA 2ZMLA 2VUJA 1UY3A 4NIDA 3PVEA 4A7ZA 1LOEA 2PXJA 1A8DA 3OF1A 3KWVA 4NVPA 3WXPA 1PO21 2C26A 2ZX2A 4ATFA 3DUIA 3N7JA 3VDAA 1QH7A 3K2OA 3FE5A 4IQPA 4GZ9A 5K0UB 5FK8A 2YB7A 1LJ7A 4Q4X1 4HN1A 3E5QA 5FZMA 1QJU3 2XJVA 3ZPYA 5A3PA 3VD9A 4QQPA 4RR3B 1Y7BA 3BOWA 1LESA 2XG3A 4CP9A 2WS91 4EN9B 1REDA 1KXGA 1YFWA 2PLV2 3TNPB 2X05A 1PM4A 2ARXA 1KD7A 2ZGRA 3A21A 5FAXA 4BQ3A 2LS6A 4LE4A 4OUMA 5E6HA 1VP6A 4XUTA 2EF6A 5IVCA 5LATA 1RUNA 1MZEA 3JB4C 2XQRA 3CBNA 2SLIA 2DCJA 1RUE1 3J8F2 2VECA 5C4WA 2ZKLA 3AC0A 5DUXA 3RDIA 3HQXA 5C4WC 2BBVA 3DV8A 3GXUA 4CCDA 3AZVA 1S2EA 1OXCA 4GB31 4SLIA 4AHWA 4HL0A 2D6NA 1YNAA 2ET7A 4OLLA 4JAAA 5C8WA 1UY1A 4NPMA 2HWE3 5FZHA 2R042 1TNFA 1GOGA 2XONA 1H1IA 3RJ2X 3OSDA 3H1MA 5C7GA 4ASKA 3W9AA 2A5ZA 4XUOA 4F8AA 2XKPA 1VPHA 1OQEA 1W6QB 4M4RA 3O1PA 3WZ1A 3C7HA 2J1AA 2WNEA 1LEDA 4P9IA 2Y8KA 3I2KA 2ZEYA 1LGNA 4OHVA 5GLWA 5JZGA 4QB1A 3Q8EA 1ALYA 1HW5A 3DKWA 3LE0A 5JIAA 3OB8A 5KXDA 5A7SA 1JUIA 1XNTA 2F4LA 2ZGLA 1J3QA 1E5IA 1CD3G 5EHDA 2CGOA 3MUY1 5DAQA 3THTA 3WNPA 1GZWB 2I07B 3NV3A 4IE0A 4C91A 3VZLA 2FCTA 1HB1A 5FOBB 1Z0HA 1JU3A 2ARAA 1TG7A 1XNCA 1TEIA 3AP4A 2TUNA 2YBKA 3C2UA 1RXFA 1H2LA 4UFIA 1S0BA 2AC1A 2VW1A 4OI2A 5SV5A 3I3DA 3OY8B 1OURA 4E2GA 4KWUA 1OLQA 1O7FA 5J98B 4UW3A 1VMHA 3NQHA 2WAAA 5HCFA 1IPSA 5LA0A 1VJ2A 4AHXA 2W0XA 1POV1 1FV3A 2WQ8A 4NO4A 2VULA 3V65A 1CAWB 3S5QA 4GXLA 2A3XA 5L9BA 5A6YA 5HPOA 2EAAA 2QQWA 1L7RA 2J42A 2PHFA 2UYAA 3PUIA 2WFF2 1W8ZA 4NIHA 2KXLA 2E7TA 1UZZA 2VMFA 4JHZA 4HANA 3HD8B 4WM8B 3PNAA 4LBLA 3WHTA 3TNQA 3J7HA 3NJZA 3ZSLA 1BMV1 2R0HA 4GD4A 3ZYRA 3NNJA 3V0AA 2B45X 4GALA 5FXVA 2JE8A 1VBE1 1MEC3 3AMNA 1ENXA 2EIEA 4W4ZA 1RB8G 4N7UA 2BP6A 1NA1A 1PK6A 3H3UA 4EZHA 4IGQA 1W6MA 3B3QE 1D4M1 1W9TA 1XBFA 2PHLA 2Q4SA 3KCXA 3ME2A 5LBFA 2WWUA 1JHNA 1ZRIA 2OIIA 3RRDA 2Y60A 2HWB1 2D5HA 2OQ6A 4HSLA 2YG0A 1PMIA 1UN1A 4IV3C 4R9AA 5GLVA 5H9PA 1JYXA 4HPKA 1MPXA 4N8MA 4LBKA 3VHRA 1QJY3 2VW2A 3MIDA 3M3CA 5LY2A 3ZXLA 2ORXA 2BZDA 2DWRA 3OUJA 4JGYC 1COV3 1PM7A 1WCSA 5C8CB 1A34A 4M4PA 5T5JA 4OUEA 4QPYA 3O1VA 4IGOA 3A0KA 1VBA3 1SMVA 1VBC3 4QX3A 2A73B 3ZKUA 2PLV1 5A7WA 3FX3A 1H1MA 4Y20A 3WLUA 2CHHA 1K5MC 1SBEA 1XE0A 3AXEA 3Q8BA 2YROA 1K5MA 5CYYA 1J1TA 2JG8C 3M70A 4E4ZA 2GMMA 3K4AA 1NX9A 2IFRA 4JHTA 5KC5A 1L7QA 1QJX1 2FDIA 1S0EA 1W9FA 1QJU2 5FUNA 4RQPC 3ENRA 1CAXA 1QMJA 3I59B 4OI1A 4AEKA 5JWPA 3DGTA 2IXHA 3U11A 1F9KA 3O14A 1V9U2 4IE7A 4YVWA 3UV9A 3VBRB 5KHKA 2OPWA 5FRAA 4LMFA 4QAWA 4LBMA 3NAPB 4GWJA 4QQ2A 2C0ZA 4WZFA 2LALA 4BWOA 1UZWA 1HXS2 3I4IA 1VBD1 2X5IB 2PQQA 4YNIA 3NJVA 1RL3A 2V4VA 4HMZA 1OQ1A 4XDOA 1PGL2 5I8YA 4WM8C 1LOBA 4JV4A 2RDSA 2EXKA 3LA3A 2D3SA 3OD0A 1MQTA 1S0CA 1GU3A 4ZXEA 5T52A 4Z1VA 3H0OA 2RM21 4Y4YA 4IEUA 3POEA 4M0NA 2R043 5FJHA 1PGW1 3ZFFA 4LBNA 4Q4W1 4XAAA 1HRI2 1ULDA 1W2OA 2B39A 2GC0A 4CVUA 2LROA 2OA2A 4AQSA 4QQLA 1NXD1 4PJYA 1U5IA 2GP3A 1XB9A 4ITCA 3USSA 2IXIA 3EBRA 4QB6A 3SH5A 5ABJC 4E2QA 2EIDA 1PZ8A 4QDRA 5FLIA 1RVF1 3MLKA 4ZU7A 5K7PA 1XPWA 3LEIA 4EZ4A 1JH5A 3SEEA 4BE3A 4EYUA 1YJKA 2PA7A 4N9IA 2GN7A 1EV12 4Q4Y1 4FPHA 2VUCA 2YU2A 2R32A 3U14A 4RHV3 3UESA 1RUJ3 5GALA 4Q4V1 1LGCA 2P4EA 5FMDA 2VE1A 2VG9A 1RUOA 1ZYBA 4CDWB 3OGGA 1A8MA 4WVMA 2WNUB 3ZN6A 1FNYA 4V1PA 5BNNC 5IK5A 4RS5C 1W04A 5FQ0B 1W6PB 4RGKA 2R16A 1S0FA 1OSGA 2B8MA 2IXCA 4JCKA 5B2GB 5CFCA 2WYSA 2BOJA 1WW7A 3B9IA 1VBE2 1WLWA 4CXYA 3S57A 2J7MA 1PGL1 1APNA 1UAIA 2HWD1 4CEYB 2VOKA 1OC1A 2WFF3 1SPPB 5FZKA 4KGGA 3NNGA 4W6YA 2DBIA 4QQHA 3TOJA 1AYM2 3LFIA 1W6OA 4OZOA 3QH6A 1RUC3 4WBBA 4Z07A 4YG6A 3VBUC 1DG6A 2VVEA 4LJHA 5E8AA 3ZIWA 2DF7A 1QQP1 4I0WB 1J1LA 1MEC2 4QPGA 1LNSA 3WNOA 4HK9A 2ORZA 2O8OA 4AHYA 4AYUA 1R093 3BALA 5AC92 3AYEA 5FPVA 1NCRA 2DURA 1C8M2 4BIFA 4GIQA 3I49A 4L99A 4ZXKA 5I93A 4D6QA 1NY72 1W2UA 3MV11 1CN1A 1XOYA 3DYMA 1VBB3 2FD8A 1S0DA 1UIKA 5HXMA 3V56A 2E53A 1WW5A 5ABJA 4PLNA 2XHKA 4NHYA 5JXIA 2VH9A 5ACA3 4LQRA 2VGDA 1CAVB 4YSFA 4V2VA 3POGA 3FHQA 1DP0A 3WV6A 3E5UA 2DUPA 3JB8A 3AYCA 1YC61 4AVCA 1V6LA 2DU1A 2E31A 3ABZA 2X8KA 5I0UA 5JMOA 1CIYA 3TEZA 3H7JA 2XGXA 4X6RB 3WP6A 4YFWA 4XDQA 1G6NA 5BNOB 1ZBE1 3PLQA 2Q5TA 2CY6A 3I8TA 3K46A 3RQ0A 2ZGTA 4K8RB 3MUZ1 4ARYA 3JD73 4PIXA 4F3JA 2XWBB 3KVBA 2GSYA 2G9GA 4TXWA 4XQWA 2RS33 3G6JB 1LHUA 4Q0SA 3BPZA 4A3XA 5J1XA 4LOSA 4CUAA 4LA2A 4OMCA 2CWSA 2WR9A 4ASMB 3BVCA 5C70A 1CJPA 1H9PA 1V0AA 2XWJB 4Q1RA 4EN6B 1VR3A 1YXWA 3HQRA 5DUWA 3LSDA 1C1FA 5FYTA 2Y0OA 4CDXA 4IE6A 3NNLA 2DTWA 2OKXA 1C8M1 2QQUA 4JGYA 1QXRA 4K9SA 5FZEA 4A45A 3D5OA 2ZOEB 3LOIA 5KR7A 1EPZA 2YC4A 3MEPA 5BUVA 2VUAA 1A6CA 2D6OX 3RMXA 3N36A 4O9EA 4D6SA 3B00A 3ACIA 4BZ4A 2WLQA 5GZCA 2PN5A 4XJUA 1O59A 1RUC1 4QU2A 2WQ4A 4FPYA 4XZUG 1JODA 3N9MA 2Q8DA 1PGSA 1J59A 1YIPA 4HOOA 2FDFA 1OF4A 1SPPA 4O61A 1DU3D 1YQCA 4N7IA 3WNMA 4IEVA 2P3JA 3APBA 1JZ8A 1NG0A 5A1LA 3BTAA 5CISA 3BIEA 2HWF1 1R091 1AR63 1RTVA 1NZCA 1W39A 1HDKA 2B7YA 2VUDA 5T3NA 5CFCB 1SCRA 4HKOA 4RQPA 1BEV1 2Y26A 3GBFA 1QKQA 3MIGA 3PL0A 2F6BA 2J1UA 3POIA 1RUF2 1JOJA 1EV13 1MS1A 3ZXDA 2JDMA 4FCAA 4QXKA 5K8SA 4RHV2 4AVSA 1RUJ2 1UPIA 4CA9A 5CKQA 1CPMA 5CFDC 1CPNA 1KS5A 4QPIA 2BYVE 1NCQC 4I0BA 1RMU1 2XVGA 4PIYA 5FYYA 1ULEA 4Y33A 1FAYA 1UXXX 2D40A 1OFNA 3SISA 3ZYPA 5E1RA 1OKQA 1C1LA 2ETEA 2P34A 3JUUA 1ZBE3 4Y22B 3O0XA 2XJQA 1VBE3 3LEGA 4AZZA 5HCHA 3MPPG 2YC0A 5T5LA 4E8CA 3OUIA 3MV01 2WINB 3H50A 1S0JA 5IVEA 1O3RA 2D7FA 5BNOC 3U4SA 3T1MA 3VUOA 4JC1A 4S2GA 1WCDJ 4YVWC 1UOBA 1AYM3 2BDRA 1ND2A 4PIZA 4EJRA 1NY71 2ZX3A 2RS31 2BBAA 4Y22A 1QU0A 5I91A 4XBNA 1X9PA 4N90A 3WHUA 1DQ1A 1N1YA 3MO4A 3JQWA 4BOWA 1MQTB 1DGLA 4JGZB 4X8NA 4N53A 4AFCA 2H6CA 4Q0PA 3L9JT 3DPRB 1EPWA 5EIYB 4XUQA 4D69A 2VNOA 1YHFA 3J4UH 2BGCA 5JOYA 1R092 5AC93 1MS3A 5E89A 1C8M3 4YGEA 1S2BA 4QPIB 1BVP1 5DMYA 3TEYA 2A75A 5A3MA 1V6IA 2OPKA 2D3PA 4IV1A 3WG1A 4XETA 4BIOA 4CU7A 5JPNB 2H0BA 1GNYA 3WG2A 4CEWC 4YVSC 5LEJA 3UKTA 3OGSA 4A2UA 4RQPB 2DFCA 2VTFA 4TSVA 4HBNA 4XYXA 3OGRA 4ZZ5A 1IS4A 4N43B 2SBAA 4QX7A 4RD7A 5C5TA 1AR61 3A23A 3CHXA 1NXMA 2E33A 5GLZA 2DVAA 4J25A 4QM8A 3ZFGC 2CAUA 2JG8B 2JEMA 3WUDA 3N9PA 1POQA 2B46X 3PJYA 5A7WB 4E4DX 3ZM8A 4FBFA 2VQTA 3KT7A 2RDNA 4CP1A 5JXJA 1X7NA 5CG9A 1DGRA 3KV4A 3JXSA 2B9VA 2YY1A 3JD72 5A1FA 5C8CC 2WNVA 3SLIA 4HVRA 4JGYB 4CUCA 1NQDA 3MW4A 4W65A 5IVJA 2UWBA 5AFBA 2OX0A 4H7MA 1PVXA 2RS32 3H3ZA 4FFHA 4YM2A 3IDAA 2RMU2 3VBFC 3ZFFC 2Q1FA 5ANNA 3LPFA 2GH2A 2BFUL 5T5PA 2XL7A 3VB9A 5JOWA 4XCAA 1UYXA 4FTSA 4P9XA 1DQ6A 5B4NA 5FZ1A 4Q2FA 3AMMA 2FDHA 1AX1A 5KHHA 3N9QA 4AAPA 2AEZA 4PDWC 4XILA 2PMWB 4L11A 1QJFA 4XURA 2IC1A 5FYIA 4AR2A 2UY9A 3MI8A 2XUMA 4LULA 5IK7A 2ARBA 4N53C 5FXZA 3ZOIA 1Z7S1 3AP7A 3GDBA 1AR72 5J48A 3K3NA 3KHCA 3KV9A 2VCAA 4Q8KA 1W3VA 2R071 3E6DA 1BYHA 1PO11 1X82A 2TEPA 1V6OA 4Q4V3 4A41A 3AJZA 3IBMA 1W05A 1CAWA 2D6LX 4AGVA 3NNMA 1AR62 4D3WA 1QOOA 3PDQA 3VGIA 3E6CC 1PIV1 3VHNA 3OEAA 1W0OA 3W58A 3PUHA 3WF4A 4A3ZA 5FO8B 4K20A 5DQ0A 3AMQA 2AH2A 4RN5A 4TYSA 3S7EA 2VZOA 1BXHA 5FREA 1DIWA 4NPLA 1YIFA 3QCWA 4QX2A 1Q43A 4XQDA 1U5XA 4MGTA 3WF2A 1DZTA 1L3JA 5CKMA 4AFDA 5H9RA 4JGZA 3U07A 1AYN2 5JMCA 4MUVA 4UF0B 2JIGA 3ZN4A 1DYKA 2GDFA 1AR81 4OHZA 1Z78A 1IKPA 1NCRB 2BRTA 3GZAA 4ARXA 4BHPA 2C6SA 5FP4A 3VZMA 3HEIA 1GZWA 2E63A 1RUH3 1YLLA 4F7ZA 1KDKA 2FZ2A 2CTVA 1W6NB 4Q1PA 5FY5A 5I8SA 4COYA 1H8VA 4W50A 4AEJA 1M4WA 3D3AA 4QDSA 3M4FA 1GR3A 5FWEA 4LO6B 3G7DA 1BBT3 2WS92 1UYZA 2VO5A 4L0PA 3VBFB 2NYYA 2YZ4A 2WBKA 3HVDA 3ZYBA 4PQ9A 1QNWA 2EAKA 3WR0A 3JBG2 4YZ4A 1LHOA 2PFWA 3POYA 4FOWA 3I2FA 3ACGA 3HOBA 4XFIA 1QJU1 3NV4A 1DDLA 2O0OA 2RS52 2R49A 2EXIA 4XTMA 2P6HA 4XDPA 2ADDA 2V4AA 1TME2 5FY8A 4ZHNA 3L2YA 1U12A 1FV2A 4KWLA 1LCLA 1US2A 3IIAA 5C4WB 3P3PA 1KJRA 4WVMB 3ZXAC 2MEV2 4WV8A 1LR5A 5A3UA 4XUNA 3OEBA 4P9WA 3LQCA 1PVC1 3MIEA 1W90A 3ZXGA 5A3NA 1E57A 5JCTA 2IXLA 3MIFA 1UY2A 1G9DA 1NCRC 2ZAHA 2PHUA 4CDUA 5HCAA 1OH4A 4RL7A 1ULGA 1V6JA 2PAMA 2V5DA 4R8HA 2JDAA 5FYBA 2IXJA 4MO3M 4DB5A 4XIKA 1DGWX 2LM3A 2GMPA 3ILRA 3LEKA 5FMOL 1CR7A 3ACLA 3MYXA 2HWC2 5C9AC 2FZ1A 4DXRA 1DHKB 1DBNA 4MX3A 2RVAA 2JG9A 1F5JA 2Y6GA 2I74A 3OOXA 3S6PA 3FMGA 1ZZ7A 4I01A 3BOPA 4OI0A 3AYDA 4TLGA 5FZCA 1ZRCA 5LK5A 3AFKA 1DLLA 1AR83 2HJIA 3MLJA 2JDUA 1QHDA 3WQ1A 3ZYIB 3TN92 2DUOA 5AVPA 2X09A 5CG8A 1O8SA 2I2SA 1ZZ9A 4BLJA 1RUE2 2WSVA 1RUH1 4GJZA 4A4AA 4ZONA 3HJRA 2W2IA 4BQYA 1N1SA 1P8JA 1AR71 1PX4A 4LO5B 2WSUA 3P6BA 4FFFA 4YGDA 4COZA 2DVFA 1T6BX 2RV9A 1OT5A 2A6ZA 1URXA 1PO12 4MG2A 1JZ4A 2AUYA 4RFT0 1HIXA 3AKPA 4CEWA 4YFZA 3HQUA 4P00B 3VKLA 1KQRA 1W03A 2Y6JA 3LD8A 1YWKA 1SG3A 2W87A 4FTBA 2WAOA 5DAVA 3SMHA 2P3IA 5BNQA 5CFDB 1RGSA 4YG0A 2Q30A 4Z2WA 3NWKA 1XYOA 2RJ2A 1FOD2 1K12A 1K5MB 1CESA 2WT0A 2WO3A 1W2TA 2CDOA 3ZFEA 2JB8A 2YBPA 3FC0A 5FY9A 2PQSA 3U37A 2VOWA 4HFSA 2Y64A 1LTEA 2NLRA 2VVFA 2PHXA 4LOTA 4AVTA 4K21A 4AFAA 2L9LA 2P1BA 4UBHA 3RWKX 5FY7A 3ZKYA 1V6KA 3PVBB 2DVGA 3WSOA 4XHXA 5F2WA 4Q5OA 1Y9QA 1PVC3 2Q8EA 3HAGA 1EYBA 4LK6A 1UMZA 3VHOA 4UW6A 1I1EA 3GJBA 4K1YA 3A4UA 1OLME 1QOSA 3AKQA 4FXGB 4HPKB 1HJGA 2ZMKA 1JYNA 2E9QA 3D6EA 4UFLA 1W9WA 4XF3A 3E6BA 2HWB3 4YVSB 2N7GA 1WA4A 3TWIA 5KHIA 4LA3A 1W6OB 3IPVB 1AR93 1B35B 3WDTA 4XF4A 4BK5A 1SEFA 1RUH2 1O5LA 3H3LA 1C3HA 1SQ4A 2D98A 2G19A 3A7QA 3ORJA 5G04L 4PBPA 4DUWA 2ZZJA 1YFXA 4QPIC 5C71A 5A1AA 3U4XA 1RUD1 4R52A 3B9CA 3HR9A 4ZU4A 4GJYA 1R1A2 4ZS2A 5C3QA 1V9U1 2B4KA 5CB7A 3IM0A 2JJ6A 5FP7A 5FQ0A 4MXWA 4OULA 4P9LA 3SCFA 1XE7A 4QX0A 5JSRA 2HLEA 2VL4A 2MPFA 2WNUA 1ZBA3 2ZGUA 5T55A 3ZN6B 4BQ5A 2P3KA 3IAPA 4GWNA 4YGCA 3ETPA 1NA1C 1PK6C 3POWA 4GA9A 4H7LA 4K8FA 4M3CB 4UXAA 2AREA 4YVSA 2RS53 2XBO2 2BNNA 1XSRA 2AENA 3TEXA 3LPGA 4Y1YA 2HWE1 4ZY9A 2W92A 1XE8A 4B7EA 5JZGC 4ZU5A 1ZA4A 2V5YA 4PF5A 1OQDA 3ON7A 3ILNA 3HNMA 1L7LA 2D6KA 2KA3A 3RNSA 4L9BA 5LBBA 4GQ7A 2EXJA 3UT0A 4OQ9A 5H9QA 2ZAAA 2J1VA 1RVF2 3NRUA 5FUIA 3GZUC 2VOTA 5FZIA 1YEWA 1GP4A 5LA1A 5IUQA 3ZSJA 2K46A 4UFKA 1ZX5A 4LO4B 4QKBA 5DABA 4ET7A 4Y4RA 4XTPA 1AXYA 4XIOA 3OD4A 1DGWA 2IWGB 3MW2A 3QACA 1Y43B 5C6CA 3ST7A 4PLMA 4LIUA 4EN7B 1OFSA 3SCGA 2G9FA 1CWPA 1OLRA 1H0BA 4E27A 1H4HA 4QX5A 5D21A 5FBJA 3NO8A 5FYUA 3CNAA 4HXCA 4CYDA 1F35A 3KGZA 4OHWA 4UOJA 4YZ5A 1JZ6A 3VBRA 3PUAA 4XFAA 2WO1A 1VBD2 4QHZA 1JS9A 4LHNA 4HLTA 3LIHA 4LO8A 4K3UA 1T2XA 4FPJA 4N43C 5FMOS 1XC6A 4FP3A 1XNKA 1C57A 4FT8A 5DDJ3 4WM7B 5APAA 5CIRA 1D0HA 1ND3C 4NHMA 2YU1A 4RS5B 4BDVB 4RR3C 3P1IA 2W1WA 5L73A 1VLNA 3LDKA 4QX8A 3WP5A 2A3YA 3AZXA 2VCCA 1ACCA 3JCIA 4B29A 3LAGA 2GALA 2WN3A 2Y33A 4C1WA 4C90A 3O1TA 4MVTA 5GZEA 4P9JA 2WNOA 2DCZA 3WCSA 2W3JA 3MLLA 2OS2A 1LHVA 1JU4A 2YHJA 3URFA 2QTWB 3WF3A 4YWAA 4ISQA 3I2HA 3H7YA 1CZVA 3DKQA 2PTMA 3K4DA 3AKRA 3J8F3 5BYNA 2Y6HA 1UU4A 3GZEA 4JDMA 2ZHLA 3ZN5A 2WKKA 3V0BB 1Y9MA 2V73A 5LBCA 1JZ5A 4EROA 3K4ZA 4B4PA 4J1WA 4FOYA 5LWBA 2BGPA 3POFA 2ZEXA 3ZMNA 5J96B 4M3CA 5F3IA 3W20A 1W6MB 1VMJA 4UBGA 2WO2A 4BQWA 1IQAA 3Q9OA 1ULOA 2JDHA 2CU5A 1C8NA 2H6BA 3UGFA 3WT3A 5FP9A 1FMD2 1V00A 3KB5A 1WCQA 1NLSA 2J1SA 2K9ZA 1WD4A 3DXUA 1CVNA 4AAXA 4BQXA 5IW0A 3C8XA 3DYPA 3IMMA 5KXBA 3ZR6A 4XFHA 1JYTA 2IUWA 3MHZA 1AR92 3H8OA 1POV3 1OMIA 3RMYA 4CCCA 4CU6A 4Q8LA 2RJKA 2OYZA 5IVFA 3RVHA 3KHBA 1E5RA 3BU7A 3CJXA 5A33B 4ORFA 4PI2A 3RI9A 1R1A3 3OYWB 3INAA 3IPVA 3PU3A 4LKEA 3GM8A 5BY5A 3T2OA 5HI0A 3H8XA 4TTGA 2KM2A 2H0VA 3R6SA 3ZFEC 2EA7A 3T0BA 1ZRDA 5EFUA 2ARCA 2NM1A 3PURA 1QQP2 1ZBA2 4AXOA 4DRRA 4HG6B 4Z2AA 2WZR1 3I2DA 5F5CA 1W8TA 3FFQA 3VN4A 5J36A 5JDBA 2FDJA 1IS6A 4XBLA 2X29A 2BJSA 3R4UA 5I0SA 4GKXA 1IHMA 1O91A 4UF0A 1TQ5A 2KR2A 4YW4A 4EWDA 2VMGA 3ZYFA 4HKWA 3VBHB 3I3MA 1TVGA 3O1OA 4BA6A 3Q8CA 3UETA 1YCIA 4NRQA 1MS5A 3CZUA 1QJX2 3CF6E 3HIFA 5FK7A 1WLTA 2YPJA 4I02A 3BIWE 2A6VA 1HB4A 2XJSA 3QBQA 3LEMA 2ZPXA 5CFDA 2JECA 4HSJA 1U5ZA 4Y5Z0 2XUEA 5FZGA 2E6VA 1O3TA 4DZGA 3VZOA 1FMD1 1HN0A 3DL3A 2BV4A 2VVDA 4META 2WJSA 1QJEA 1YI9A 2BFUS 3ELNA 3NMBA 4MLOA 3B94A 5JVVA 2GMEA 1KS4A 1OVPA 1UYPA 1QEXA 2VNRA 3VD5A 2W1SA 1A78A 3VDCA 4YZ1A 3LA7A 4LE3A 3LF7A 2WWSA 1EAH1 2ZHKA 3WDXA 1H6XA 3D82A 3FBMA 3NSTA 1QJY2 4R9DA 2VQ0A 3SEPA 4BCUA 1PGW2 3FWEA 5F3EA 1YRZA 1COV2 1ND2C 4OCTA 5I8TA 4S2DA 3HPNA 4XW3A 5FZLA 3WF1A 2DBNA 3WX5A 4CP9B 2JXAA 1VBA2 1VBC2 1SLIA
chains in the Genus database with same CATH topology
3MO4A 4FI9A 2HYXA 5EIYB 4DUXA 1K45A 4XUQA 1J83A 1WKYA 2LW8A 5DMYA 3VD3A 4DXSA 4IUGA 1XNAA 4CU7A 1GNYA 2YC2A 3EB7A 2VQUA 1GMMA 3OGSA 2VTFA 2W1QA 3OGRA 2YFUA 4ZZ5A 2VMEA 3A23A 2E33A 4JX0A 2VC9A 2KD7A 2W9XA 1HN1A 1NKGA 2WN2A 5IFTA 3ZM8A 2VQTA 2VZQA 2QQIA 5JXJA 1UMHA 3BN6A 1K42A 2VM9A 4BXSV 2QBXA 3JXSA 2B9VA 3ECQA 5EJ1B 4CUCA 5F7UA 3OGVA 2VZRA 3WNLA 3SKVA 3IDAA 3I2IA 3LPFA 2QQNA 3WF0A 2W46A 1UYXA 4XUPA 3T2QA 1W0NA 5CZKA 3IB3A 2CDPA 5B4NA 3HNBM 2WDBA 5IHRA 5JXHA 2XQXA 4OYUA 3OBAA 1UY0A 3C7FA 2DCKA 2QQJA 3EYPA 4XURA 1KEXA 3IIIA 4OMDA 1JZ7A 3I3BA 4W8JA 2XOMA 4DUVA 1SHWB 2X10A 5EJZB 3GDBA 1GOHA 1OF3A 3CIHA 1SDDB 2VZUA 2VCAA 1UY4A 2VZVA 3DECA 1CZTA 4A41A 4DXTA 1JZ3A 2VMDA 4CU9A 1UY3A 3IAQA 3OEAA 3WF4A 3K75B 3PUHA 4A3ZA 2C26A 5DQ0A 2WZ8A 4RN5A 2VZOA 3VDAA 4A42A 4GZ9A 5I0DA 2YB7A 4QX2A 4UI9L 4DEVA 3WF2A 2V72A 1JZ8A 2ZXQA 3WQBA 3VD9A 4ARXA 2JD9A 4P5YA 4E8DA 3HEIA 2X05A 3A21A 3WNNA 2LS6A 4LHSA 4XUTA 4W50A 3D3AA 1EUUA 2DCJA 4QDSA 4P08A 3AC0A 4YPJA 3GXUA 2VJXA 1UYZA 2VO5A 4L0PA 2WBKA 2QQLA 4P02B 1PMHX 4RYDA 2J22A 1UY1A 1GOGA 2XONA 1UMIA 3I2FA 3ACGA 2QQOA 3HOBA 5C7GA 1DLCA 4XUOA 4M4RA 3C7HA 2J1AA 2Y8KA 3I2KA 2ZEYA 2WABA 1US2A 4QB1A 3LE0A 3OB8A 4JKMA 1XNTA 2C9KA 2J1RA 4XUNA 3OEBA 3MUY1 3WNPA 3LQCA 3W5MA 4XVHA 1JU3A 1UYYA 2VR4A 3I2GA 5JR2A 1UY2A 4PF1A 1W8NA 1TG7A 1OH4A 2V5DA 4AG4A 2JDAA 4MO3M 2VZ1A 4GWIA 3LEKA 4KMQA 3T0DA 3I3DA 3WNKA 4KWUA 3NQHA 2WAAA 4DXRA 1OD3A 5LA0A 3WEZA 2RVAA 2WQ8A 2Y6GA 5HPOA 3VDBA 2BERA 1L7RA 3PUIA 1US3A 2VMFA 4JHZA 1ULPA 2VZTA 3J7HA 2X09A 1O8SA 3GGLA 4A4AA 3HJRA 4PT6A 1P8JA 1PX4A 1JI6A 1K3IA 2JE8A 3P6BA 2EIEA 4W4ZA 2RV9A 1OT5A 1IQDC 1JZ4A 4A6OA 1W9TA 5IFPA 4P00B 4BK4A 3VD7A 2Y6JA 2WZEA 2YG0A 3T09A 1SG3A 2W87A 1JYXA 2WAOA 1MPXA 3CZJA 1F4HA 2ORXA 2BZDA 2RJ2A 1K12A 2Z4FA 2WO3A 4M4PA 2CDOA 4OUEA 2PQSA 1EUTA 2QQKA 3T0AA 2Y64A 3U37A 1BHGA 4QX3A 5IJRA 1UXZA 2L9LA 3WSOA 2W47A 5CYYA 4BJ0A 4QDQA 3CDZB 3K4AA 5JUVA 4LKSA 1NX9A 1L7QA 2EIBA 1JYNA 1W9WA 1I5PA 4CUBA 2J1EA 4BK5A 4QAWA 4GWJA 1UX7A 1GUIA 1YQ2A 3A7QA 4QPWA 5G04L 4DUWA 3CQOA 5C71A 2Y6KA 3NJVA 2WUHA 2V4VA 5A1AA 4MGQA 2B4KA 2W94A 4ZXEA 3CKHA 1GU3A 1JHJA 1CZSA 5IYYA 1DYOA 3T2PA 4QX0A 2HLEA 2VL4A 3I3EA 1UWWA 4CVUA 2JKXA 4ZZ8A 3IAPA 4PQQA 3K77A 3ETPA 3UNPA 3A22A 3LPGA 4QB6A 4ZY9A 2W92A 2EIDA 3CMGA 4QDRA 3VD4A 1GQPA 1XPWA 3LEIA 3HNMA 1H6YA 3SEEA 2XHNA 5LA2A 3THCA 3UESA 3T08A 2J1VA 3NRUA 3ACFA 5FUIA 1NAEA 2VOTA 5LA1A 2W1UA 4MGSA 4ET7A 3FL7A 2BGOA 4D0QA 2WYSA 3HN3A 2J7MA 1CX1A 4MOAA 3NNGA 1JZ6A 4UOJA 4OZOA 1GOFA 2WO1A 2R7EB 1T2XA 1XC6A 1UZ0A 1LNSA 2W95A 3WNOA 2ORZA 3I97A 5LCWL 2VMCA 4BDVB 3P1IA 2W1WA 5DPNA 4KI5M 2VCCA 3BGAA 3MV11 3DYMA 2WN3A 2QQMA 5HXMA 2ZEZA 3SKJE 2W3JA 5JXIA 1JU4A 3WF3A 3DYOA 4DEQA 4LQRA 4A44A 3I2HA 1CZVA 2E32A 3K4DA 3W5NA 3FHQA 1DP0A 2Y6HA 2DDUA 2VZSA 1JZ5A 3K4ZA 2E26A 2E31A 3ABZA 5JMOA 1CIYA 2J1TA 2BGPA 2ZEXA 2WO2A 3K46A 3F2ZA 1ULOA 3MUZ1 4ARYA 1WCQA 2J1SA 2W91A 4AAXA 2VZ3A 3C8XA 3DYPA 4TXWA 4JKKA 3E1F1 5J1XA 2ZEWA 4OMCA 4CUAA 4CU6A 5C70A 1O8PA 3I2JA 4QX1A 1R64A 2OKXA 3GM8A 1PX3A 4A45A 3T2OA 4TTGA 2YC4A 4QB2A 3T0BA 3ACIA 2W5FA 1JZ2A 1O59A 4XZUG 2VZPA 4HG6B 4Z2AA 1OF4A 3NJXA 3WNMA 3OG2A 3HNYM 2VCBA 1PMJX 1D7PM 1TVGA 1JYWA 1W8OA 3C7OA 3FN9A 3UETA 1W99A 2J1UA 3C7GA 3CZUA 4UAPA 4D8MA 3C7EA 1KGYA 1W9SA 2C4XA 4LPLA 5G05L 1F4AA 1UXXX 2EICA 2ID4A 1J84A 3VD5A 2W1SA 3FHAA 3VDCA 1RYYA 3LEGA 4E8CA 3MV01 1NUKA 2Y6LA 1H6XA 4MADA 5B4XA 3SEPA 3THDA 5JXGA 1JYVA 4CU8A 5DN2A 4JKLA 2YFZA 3HPNA 2BBAA 3WF1A 3MBWA 3ACHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MO4 A;  4FI9 A;  2HYX A;  5EIY B;  4DUX A;  1K45 A;  4XUQ A;  1J83 A;  1WKY A;  2LW8 A;  5DMY A;  3VD3 A;  4DXS A;  4IUG A;  1XNA A;  4CU7 A;  1GNY A;  2YC2 A;  3EB7 A;  2VQU A;  1GMM A;  3OGS A;  2VTF A;  2W1Q A;  3OGR A;  2YFU A;  4ZZ5 A;  2VME A;  3A23 A;  2E33 A;  4JX0 A;  2VC9 A;  2KD7 A;  2W9X A;  1HN1 A;  1NKG A;  2WN2 A;  5IFT A;  3ZM8 A;  2VQT A;  2VZQ A;  2QQI A;  5JXJ A;  1UMH A;  3BN6 A;  1K42 A;  2VM9 A;  4BXS V;  2QBX A;  3JXS A;  2B9V A;  3ECQ A;  5EJ1 B;  4CUC A;  5F7U A;  3OGV A;  2VZR A;  3WNL A;  3SKV A;  3IDA A;  3I2I A;  3LPF A;  2QQN A;  3WF0 A;  2W46 A;  1UYX A;  4XUP A;  3T2Q A;  1W0N A;  5CZK A;  3IB3 A;  2CDP A;  5B4N A;  3HNB M;  2WDB A;  5IHR A;  5JXH A;  2XQX A;  4OYU A;  3OBA A;  1UY0 A;  3C7F A;  2DCK A;  2QQJ A;  3EYP A;  4XUR A;  1KEX A;  3III A;  4OMD A;  1JZ7 A;  3I3B A;  4W8J A;  2XOM A;  4DUV A;  1SHW B;  2X10 A;  5EJZ B;  3GDB A;  1GOH A;  1OF3 A;  3CIH A;  1SDD B;  2VZU A;  2VCA A;  1UY4 A;  2VZV A;  3DEC A;  1CZT A;  4A41 A;  4DXT A;  1JZ3 A;  2VMD A;  4CU9 A;  1UY3 A;  3IAQ A;  3OEA A;  3WF4 A;  3K75 B;  3PUH A;  4A3Z A;  2C26 A;  5DQ0 A;  2WZ8 A;  4RN5 A;  2VZO A;  3VDA A;  4A42 A;  4GZ9 A;  5I0D A;  2YB7 A;  4QX2 A;  4UI9 L;  4DEV A;  3WF2 A;  2V72 A;  1JZ8 A;  2ZXQ A;  3WQB A;  3VD9 A;  4ARX A;  2JD9 A;  4P5Y A;  4E8D A;  3HEI A;  2X05 A;  3A21 A;  3WNN A;  2LS6 A;  4LHS A;  4XUT A;  4W50 A;  3D3A A;  1EUU A;  2DCJ A;  4QDS A;  4P08 A;  3AC0 A;  4YPJ A;  3GXU A;  2VJX A;  1UYZ A;  2VO5 A;  4L0P A;  2WBK A;  2QQL A;  4P02 B;  1PMH X;  4RYD A;  2J22 A;  1UY1 A;  1GOG A;  2XON A;  1UMI A;  3I2F A;  3ACG A;  2QQO A;  3HOB A;  5C7G A;  1DLC A;  4XUO A;  4M4R A;  3C7H A;  2J1A A;  2Y8K A;  3I2K A;  2ZEY A;  2WAB A;  1US2 A;  4QB1 A;  3LE0 A;  3OB8 A;  4JKM A;  1XNT A;  2C9K A;  2J1R A;  4XUN A;  3OEB A;  3MUY 1;  3WNP A;  3LQC A;  3W5M A;  4XVH A;  1JU3 A;  1UYY A;  2VR4 A;  3I2G A;  5JR2 A;  1UY2 A;  4PF1 A;  1W8N A;  1TG7 A;  1OH4 A;  2V5D A;  4AG4 A;  2JDA A;  4MO3 M;  2VZ1 A;  4GWI A;  3LEK A;  4KMQ A;  3T0D A;  3I3D A;  3WNK A;  4KWU A;  3NQH A;  2WAA A;  4DXR A;  1OD3 A;  5LA0 A;  3WEZ A;  2RVA A;  2WQ8 A;  2Y6G A;  5HPO A;  3VDB A;  2BER A;  1L7R A;  3PUI A;  1US3 A;  2VMF A;  4JHZ A;  1ULP A;  2VZT A;  3J7H A;  2X09 A;  1O8S A;  3GGL A;  4A4A A;  3HJR A;  4PT6 A;  1P8J A;  1PX4 A;  1JI6 A;  1K3I A;  2JE8 A;  3P6B A;  2EIE A;  4W4Z A;  2RV9 A;  1OT5 A;  1IQD C;  1JZ4 A;  4A6O A;  1W9T A;  5IFP A;  4P00 B;  4BK4 A;  3VD7 A;  2Y6J A;  2WZE A;  2YG0 A;  3T09 A;  1SG3 A;  2W87 A;  1JYX A;  2WAO A;  1MPX A;  3CZJ A;  1F4H A;  2ORX A;  2BZD A;  2RJ2 A;  1K12 A;  2Z4F A;  2WO3 A;  4M4P A;  2CDO A;  4OUE A;  2PQS A;  1EUT A;  2QQK A;  3T0A A;  2Y64 A;  3U37 A;  1BHG A;  4QX3 A;  5IJR A;  1UXZ A;  2L9L A;  3WSO A;  2W47 A;  5CYY A;  4BJ0 A;  4QDQ A;  3CDZ B;  3K4A A;  5JUV A;  4LKS A;  1NX9 A;  1L7Q A;  2EIB A;  1JYN A;  1W9W A;  1I5P A;  4CUB A;  2J1E A;  4BK5 A;  4QAW A;  4GWJ A;  1UX7 A;  1GUI A;  1YQ2 A;  3A7Q A;  4QPW A;  5G04 L;  4DUW A;  3CQO A;  5C71 A;  2Y6K A;  3NJV A;  2WUH A;  2V4V A;  5A1A A;  4MGQ A;  2B4K A;  2W94 A;  4ZXE A;  3CKH A;  1GU3 A;  1JHJ A;  1CZS A;  5IYY A;  1DYO A;  3T2P A;  4QX0 A;  2HLE A;  2VL4 A;  3I3E A;  1UWW A;  4CVU A;  2JKX A;  4ZZ8 A;  3IAP A;  4PQQ A;  3K77 A;  3ETP A;  3UNP A;  3A22 A;  3LPG A;  4QB6 A;  4ZY9 A;  2W92 A;  2EID A;  3CMG A;  4QDR A;  3VD4 A;  1GQP A;  1XPW A;  3LEI A;  3HNM A;  1H6Y A;  3SEE A;  2XHN A;  5LA2 A;  3THC A;  3UES A;  3T08 A;  2J1V A;  3NRU A;  3ACF A;  5FUI A;  1NAE A;  2VOT A;  5LA1 A;  2W1U A;  4MGS A;  4ET7 A;  3FL7 A;  2BGO A;  4D0Q A;  2WYS A;  3HN3 A;  2J7M A;  1CX1 A;  4MOA A;  3NNG A;  1JZ6 A;  4UOJ A;  4OZO A;  1GOF A;  2WO1 A;  2R7E B;  1T2X A;  1XC6 A;  1UZ0 A;  1LNS A;  2W95 A;  3WNO A;  2ORZ A;  3I97 A;  5LCW L;  2VMC A;  4BDV B;  3P1I A;  2W1W A;  5DPN A;  4KI5 M;  2VCC A;  3BGA A;  3MV1 1;  3DYM A;  2WN3 A;  2QQM A;  5HXM A;  2ZEZ A;  3SKJ E;  2W3J A;  5JXI A;  1JU4 A;  3WF3 A;  3DYO A;  4DEQ A;  4LQR A;  4A44 A;  3I2H A;  1CZV A;  2E32 A;  3K4D A;  3W5N A;  3FHQ A;  1DP0 A;  2Y6H A;  2DDU A;  2VZS A;  1JZ5 A;  3K4Z A;  2E26 A;  2E31 A;  3ABZ A;  5JMO A;  1CIY A;  2J1T A;  2BGP A;  2ZEX A;  2WO2 A;  3K46 A;  3F2Z A;  1ULO A;  3MUZ 1;  4ARY A;  1WCQ A;  2J1S A;  2W91 A;  4AAX A;  2VZ3 A;  3C8X A;  3DYP A;  4TXW A;  4JKK A;  3E1F 1;  5J1X A;  2ZEW A;  4OMC A;  4CUA A;  4CU6 A;  5C70 A;  1O8P A;  3I2J A;  4QX1 A;  1R64 A;  2OKX A;  3GM8 A;  1PX3 A;  4A45 A;  3T2O A;  4TTG A;  2YC4 A;  4QB2 A;  3T0B A;  3ACI A;  2W5F A;  1JZ2 A;  1O59 A;  4XZU G;  2VZP A;  4HG6 B;  4Z2A A;  1OF4 A;  3NJX A;  3WNM A;  3OG2 A;  3HNY M;  2VCB A;  1PMJ X;  1D7P M;  1TVG A;  1JYW A;  1W8O A;  3C7O A;  3FN9 A;  3UET A;  1W99 A;  2J1U A;  3C7G A;  3CZU A;  4UAP A;  4D8M A;  3C7E A;  1KGY A;  1W9S A;  2C4X A;  4LPL A;  5G05 L;  1F4A A;  1UXX X;  2EIC A;  2ID4 A;  1J84 A;  3VD5 A;  2W1S A;  3FHA A;  3VDC A;  1RYY A;  3LEG A;  4E8C A;  3MV0 1;  1NUK A;  2Y6L A;  1H6X A;  4MAD A;  5B4X A;  3SEP A;  3THD A;  5JXG A;  1JYV A;  4CU8 A;  5DN2 A;  4JKL A;  2YFZ A;  3HPN A;  2BBA A;  3WF1 A;  3MBW A;  3ACH A; 
#chains in the Genus database with same CATH topology
 5C3O A;  3KZ4 C;  3BOD A;  4IEZ A;  2CYF A;  2WNV B;  1GV9 A;  1UL9 A;  1ST8 A;  1CON A;  1HV1 A;  5FP3 A;  5A7O A;  3T3Y A;  5FKB A;  4DIN B;  4DUX A;  1W8F A;  4NPR A;  4B3N A;  4CCO A;  1J83 A;  4NE9 A;  1D4V B;  2LW8 A;  4XF0 A;  5FZ8 A;  3VKM A;  1GQG A;  2XKO A;  2QUO A;  3VZJ A;  4QGM A;  2V09 A;  3DEM A;  1UU6 A;  4M01 A;  4MGK E;  2EAL A;  1XXN A;  4AQT A;  1LEN A;  4C1X A;  3NAP C;  4NAO A;  5EXO A;  5L9R A;  3WDY A;  4B4Q A;  2JG8 A;  4UWD A;  4DOU A;  5K9Y A;  5FWJ A;  2PAE A;  3EB7 A;  4N9H A;  1AUY A;  4RS5 A;  5CU1 A;  4HVQ A;  1GMM A;  5CEH A;  4WM7 A;  2HWF 2;  1UCX A;  1UPS A;  3AZZ A;  3C3V A;  4H2A A;  4NWW A;  1SLC A;  3AVS A;  4OUS A;  4QGL A;  3VBH C;  1HXS 3;  2D44 A;  5DUU A;  4CP2 A;  5LRR A;  3JBG 1;  1LUL A;  1BEV 2;  1LKN A;  5FZA A;  3AYA A;  1JBC A;  1Y3T A;  4AED A;  4JX0 A;  4XMI A;  1J3P A;  4R4Z A;  1OVS A;  4D7S A;  4ONU A;  2W9X A;  4X6Q B;  2WN2 A;  2BPA 2;  5IT6 A;  3AB0 A;  2WFF 1;  4BU2 A;  5JAX A;  1OUS A;  1WMX A;  4JTO A;  2VZQ A;  2QQI A;  1OH3 A;  4MSV A;  3BN6 A;  4NR1 A;  4J1X A;  5L7O B;  4BXS V;  5FR3 A;  1YFU A;  2ZGK A;  2P2K A;  5F39 A;  5FYH A;  3ZR5 A;  2QQP A;  1RXG A;  2IFW A;  5ISL A;  2VZR A;  4FPE A;  3VBF A;  3SKV A;  2WNU C;  1VIW B;  1ZBA 1;  2QQN A;  2YV8 A;  1HV0 A;  2RJL A;  2TNF A;  4SBV A;  4IE4 A;  1AJO A;  1D4M 3;  4Y1X A;  5CZK A;  4D7Y A;  3IB3 A;  1RHI 3;  3W59 A;  1PZ9 A;  3HNB M;  2WDB A;  2OW4 A;  2GNT A;  2UU8 A;  4XEZ A;  4ZPI A;  1MAC A;  1G9F A;  2BQP A;  5CBL A;  4HN0 A;  4Q4X 2;  2ZAB A;  3H8U A;  3VKO A;  1UY0 A;  2RR1 1;  4COV A;  4IE5 A;  2DCK A;  1UNB A;  3ZIX A;  4RA0 A;  4CPB A;  1JZ7 A;  1UW8 A;  1W0P A;  1IOA A;  1LHW A;  2NPI A;  1QQP 3;  1SBD A;  2MNG A;  2X10 A;  3JZV A;  5FKC A;  3ZXJ A;  1O4Z A;  1LHN A;  2BUK A;  4AI1 A;  4P9G A;  3CU7 A;  2VZU A;  3J7L A;  3KS7 A;  1UY4 A;  3O7O A;  2R06 1;  4XXP A;  1CZT A;  3VKF C;  4XF9 A;  3HBZ A;  2CSG A;  4DXT A;  2D97 A;  1YQ5 A;  5CA6 A;  2XJR A;  2BWC A;  5JSP A;  5FZ3 A;  3IAQ A;  1EY2 A;  1RJ8 A;  4QHB A;  1REE A;  4LEJ A;  3J7N A;  2NMO A;  2BU9 A;  4XFG A;  3TYJ A;  1MZF A;  1QJX 3;  3EO6 A;  4A42 A;  3D0S A;  3ITQ A;  3PUQ A;  1Q5O A;  5I0D A;  4DEV A;  4AWD A;  2V72 A;  3KV5 A;  4L8Q A;  3RZL A;  3RYR A;  3KSC A;  1VAK A;  2OXB A;  4I3P A;  4RGG A;  1MVE A;  2VPV A;  5FZ6 A;  4PI0 A;  3ZSM A;  3MBW A;  4YRD A;  1XND A;  2BVB A;  5A7P A;  3PIJ A;  2D6M A;  1JYC A;  4P5Y A;  1COV 1;  3CL1 A;  2XB6 C;  1AXZ A;  3WNN A;  5AVA A;  4LHS A;  4GMP 0;  4BLI A;  2R1D A;  1NYW A;  5DXD A;  1AYN 1;  4CDU C;  1AVB A;  3LOB A;  1EUU A;  4HON A;  1LOF A;  4YPJ A;  1GFF 2;  4LTA A;  3WDU A;  5FZO B;  3TAY A;  3WOG A;  4XXA A;  2PHR A;  4P02 B;  4RYD A;  3ZPO A;  3PVN A;  4AK3 A;  3MF9 A;  1OI6 A;  3RZJ A;  2J22 A;  4WVZ A;  4CSW A;  3VL8 A;  4PCR A;  3WCR A;  1DFQ A;  1UMI A;  3OPT A;  5FZ9 A;  4BIS A;  3KVA A;  5ACA 2;  5DUV A;  3O1R A;  1LOC A;  1SFY A;  2VBD A;  2B5H A;  1H8T B;  1H2M A;  3PVO A;  4MHR A;  4XJA A;  3IDE A;  2NQY A;  4YYO A;  2F17 A;  4E4H A;  4AQ2 A;  2Z69 A;  1OOP B;  2P37 A;  4PDW A;  3O1S A;  4NIG A;  1G7Y A;  1EP0 A;  1U5Y A;  1YYN A;  3UKV A;  2W52 A;  3PTY A;  4LIV A;  1AJK A;  2C9K A;  5L7O A;  3QOP A;  3LA2 A;  2J1R A;  4IV3 B;  5A7Q A;  4Q4Y 3;  1OD5 A;  1I6X A;  1RC6 A;  2NMN A;  1VRH 2;  2ZGN A;  1VE0 A;  4RHV 1;  4XVH A;  4QM9 A;  4MH0 E;  3OGJ A;  1UYY A;  4CEW B;  3I2G A;  2RM2 3;  3ZSK A;  4PF1 A;  3ZSE A;  3O0V A;  2R06 3;  3M7A A;  1CAU B;  1RMU 2;  4AG4 A;  1OKO A;  1O6U A;  2BOI A;  1TE1 B;  2WT2 A;  4L97 A;  1O4T A;  2VZ1 A;  4LUK A;  1CIW A;  3S0M A;  5ABJ B;  1BEV 3;  4R9B A;  1XU1 A;  1FT9 A;  2Y34 A;  5K0U C;  1RUG 3;  3NKG A;  4BYY A;  1W9Y A;  5KHG A;  2BNM A;  5FUP A;  3WUC A;  3EXU A;  1KDM A;  4LOR A;  4U2A A;  5BNP C;  3AKT A;  3WG4 A;  4IEO A;  2ZGO A;  3T1L A;  1ULC A;  3VZN A;  1ZZ8 A;  4QXC A;  4TLF A;  1ULP A;  2JG9 B;  1I5Z A;  4BQ1 A;  5LBE A;  2VZT A;  1RUI 3;  2XLF A;  3GGL A;  3OBT A;  2ZMN A;  2X5I C;  2UY8 A;  5E88 A;  1V70 A;  1WCU A;  5FYV A;  1K3I A;  4CXW A;  3VDD B;  3ZDV A;  2CGN A;  3K48 A;  1DZQ A;  1RHI 2;  3FHI B;  4CEY A;  5HV0 A;  4LBO A;  1LAJ A;  4O65 A;  1GZ9 A;  2O14 A;  2DYC A;  3THP A;  2FHR A;  1UOG A;  4ZS3 A;  2JWP A;  3T09 A;  3S30 A;  4LIT A;  1FAT A;  2BVV A;  2VMH A;  2RHP A;  3MGU A;  3AMP A;  3ZMO A;  1DF0 A;  4HZF A;  4I2O A;  1F4H A;  1UX6 A;  1FPN 3;  2C5D A;  5GLU A;  3RGB A;  2Z4F A;  5I0R A;  1EUT A;  2AR6 A;  5DAX A;  1VAL A;  3IDB B;  4COU A;  3AXD A;  3KD4 A;  5FO9 B;  3ILF A;  1RIT A;  1ZBE 2;  2YXS A;  3B69 A;  5IJR A;  3AZW A;  4NN0 A;  4KWK A;  1HB3 A;  1WBL A;  2P3Y A;  4BJ0 A;  4DFS A;  4QDQ A;  3CDZ B;  1ZZB A;  4S2F A;  4XFC A;  3BUC A;  3MIC A;  5EYX A;  4Q0Q A;  5FPA A;  4Y26 A;  3JD7 1;  2XXZ A;  5J7M A;  1AL2 1;  2EIB A;  2D5F A;  1R08 3;  2Y6F A;  3VBH A;  4ASL A;  2QCS B;  4Q4W 2;  2E51 A;  2JDK A;  3USU B;  1I5P A;  4GKY A;  4CCN A;  2FMY A;  3WVJ A;  5FXX A;  3TRS B;  4XMA A;  3GCW A;  4EQV A;  1SLB A;  2GZW A;  1SFN A;  3DF0 A;  4CUB A;  3QH7 A;  4CDX B;  1G9C A;  1TMF 1;  2OQ7 A;  1UX7 A;  5C3R A;  3UL2 A;  3D8C A;  3AMH A;  5EJ3 A;  3CQO A;  2IXK A;  1IGO A;  1NCQ A;  1HQW A;  2WUH A;  4KGQ A;  4AI3 A;  4G4F A;  3Q8A A;  5BPX A;  4MGQ A;  1KIT A;  2WNV C;  2XDV A;  4E4S A;  4LO7 A;  1W06 A;  3N7M A;  4MV2 A;  1CZS A;  5JOZ A;  3AJY A;  1ND3 A;  2X5I A;  5IYY A;  1O3Q A;  4LLF A;  3H42 B;  4D7T A;  2ZGQ A;  3DN7 A;  3NAP A;  1WCK A;  3AM2 A;  2JKX A;  3E97 A;  3K77 A;  4L2N A;  2WA3 A;  1LEM A;  3NL1 A;  4YVW B;  4Z8B A;  5F37 A;  2O8Q A;  3A22 A;  3LB9 A;  3BTY A;  4KWJ A;  3OPW A;  1W8U A;  4YW7 A;  1CAX B;  3I59 A;  3RI8 A;  2PAK A;  3CMG A;  1UOJ A;  3RPQ A;  3GYD A;  1JW6 A;  2JIJ A;  5DG1 A;  3IWZ A;  1H6Y A;  5KC6 A;  2DCY A;  2JIC A;  2HWD 2;  1VRH 3;  1FOD 1;  4PDW B;  1OOP A;  5FO7 B;  5A6Z A;  1BCX A;  1S55 A;  3E5X A;  1ULF A;  2WRA A;  2RM2 2;  1WLD A;  4YW6 A;  4NHX A;  4FPK A;  3T08 A;  4BXF A;  3V0B A;  2VBP A;  2XJU A;  1RMU 3;  2XLG A;  3ACF A;  3J9S A;  5F5I A;  1NAE A;  2TBV A;  2VW0 A;  4QT6 A;  3VBS B;  1POV 0;  4FAG A;  3RZG A;  1XJA A;  5C33 A;  2CAV A;  3MFC A;  5FDB A;  5JOX A;  5KXE A;  1KRI A;  5FYM A;  3M3E A;  3I54 A;  1MEC 1;  2W1U A;  4XJW A;  1RUG 2;  3GNE A;  4MGS A;  1VMF A;  1GZC A;  3P5B A;  4KL1 A;  5FLH A;  5IAT A;  2VOX A;  2WZR 2;  1H30 A;  4QPG B;  3M3Q A;  2BGO A;  4D0Q A;  5FZF A;  1BJQ A;  1WW4 A;  5CFC C;  3FFZ A;  4XPV A;  3CJI C;  1QXP A;  4L92 A;  2JB4 A;  2PHT A;  1RHI 1;  1WA6 X;  2RS1 1;  4MOA A;  4IEX A;  4LUM A;  2IVI B;  3N35 A;  4NIA A;  4AL9 A;  2A7A A;  4QU1 A;  1F8V A;  4Q0V A;  3UGG A;  3LCP A;  4FQ4 A;  5JLV A;  3U0Z A;  2DVB A;  2ZX1 A;  3T30 A;  3T4V A;  1RUI 2;  1QNY A;  4Q4V 2;  5A3T A;  1LOA A;  5ANQ A;  4AI2 A;  3IKW A;  2R7E B;  2WLP A;  5LK7 B;  5A80 A;  5JSO A;  3WIN E;  2CGP A;  1QWR A;  2PLV 3;  1W6P A;  1UZ0 A;  2MEV 1;  2RE9 A;  1UIJ A;  4G3Y C;  1D2S A;  2EIG A;  5DPN A;  3K3O A;  4CDW A;  3TEW A;  3T4H B;  1A3K A;  2JEN A;  3UGH A;  4AOC A;  3GAL A;  2XJP A;  4BME A;  4AVA A;  2QQM A;  3GJA A;  1KJL A;  4FPO B;  3KLS A;  5EWS A;  3B7M A;  2XBO 1;  1EAH 2;  5A6X A;  4AGG A;  1FPN 2;  1PNF A;  2JE7 A;  2ZEZ A;  1GSL A;  2DUQ A;  2HWE 2;  3DPR C;  3N7K A;  3DPR A;  4JGZ C;  5BNP A;  4A44 A;  1WLC A;  2MHF A;  2Z5W A;  1V6M A;  2DVD A;  2E32 A;  3KM5 A;  2EXH A;  3W5N A;  5GKA C;  1PHM A;  2DDU A;  4CUG A;  5C5U A;  4C0B A;  3RFR A;  1VBA 1;  1BBT 2;  2WS9 3;  2E26 A;  4I30 A;  1ND2 B;  5EZW A;  1F15 A;  3WD5 A;  1E5H A;  2F4P A;  2FBE A;  2Z2S B;  4XQ4 A;  4CDQ C;  2X53 S;  3UJO A;  4Y5T A;  4BQ2 A;  1O4Y A;  5EPA A;  4LLO A;  2GAU A;  3BPS A;  2AYH A;  5TSW A;  3NW4 A;  1R08 2;  3F2Z A;  3OTF A;  3BCW A;  4LBQ D;  2D3R A;  4Q4W 3;  5CKN A;  1W6Q A;  4B8E A;  1OPM A;  4JKK A;  5FY4 A;  1PNG A;  1BZW A;  4XJ9 A;  3POB A;  4QXH A;  4HVO A;  1O8P A;  4HET A;  4P9Y A;  5GLT A;  3ATG A;  4QQO A;  3ZXF A;  5EQU A;  4M00 A;  1W8H A;  4NOT A;  3CO2 A;  5F9T A;  1NE6 A;  3NVC A;  4QKF A;  4OHX A;  1R64 A;  2W68 A;  4CDX C;  5I0T A;  3VBR C;  4Y24 A;  4FAH A;  1X36 A;  3WW1 A;  4QB2 A;  5A32 B;  1X8E A;  3ZDS A;  1REF A;  4IEY A;  5GZF A;  5LY1 A;  3ZXE A;  4ES9 A;  1PZ7 A;  1JZ2 A;  4AW7 A;  2VZP A;  3WDW A;  1S0I A;  2WII B;  1PO2 3;  1QDC A;  4C0H A;  1X9T A;  4IV1 C;  1B35 A;  2XLA A;  3M2M A;  4XHB A;  1HRV 2;  3O5S A;  3MW3 A;  4RR3 A;  3FBY A;  2AEY A;  3KQ4 B;  3ZFG B;  4CEY C;  3OG2 A;  5HBA A;  1HRI 1;  3OJB A;  3N3H A;  1YQ8 A;  4JVA A;  2XML A;  5FLJ A;  1I3H A;  2VCB A;  4GH4 A;  5FZ7 A;  3CJI B;  3MIH A;  3VBO C;  1PMJ X;  4DY3 A;  1WGP A;  5K0U A;  1WUV A;  1W8O A;  1RUG 1;  2HBU A;  3C7O A;  2XVK A;  1LRH A;  3FN9 A;  1OA2 A;  4HT1 T;  4OHY A;  3KV6 A;  5CAZ A;  2DFB A;  3VL9 A;  1GLH A;  1AR8 2;  2HKX A;  4YW1 A;  4UAP A;  3J26 N;  4NRO A;  3J7M A;  3TN9 3;  1N3O A;  2ZA9 A;  1LU2 A;  4FXK B;  3ZO0 B;  3KF3 A;  3VBS A;  5C3P A;  4KBB A;  1GIC A;  3C7E A;  1KGY A;  1RUE 3;  2A70 A;  3HT2 A;  4NHL A;  1QDO A;  4AI0 A;  2RR1 2;  4OFG A;  5DZE A;  2ZX0 A;  3F95 A;  4Q26 A;  5FYC A;  5JI9 A;  3DCQ A;  2FDG A;  2C9A A;  4G9S B;  3UJQ A;  1FNZ A;  1XSQ A;  4QWN A;  5F1R A;  1BLZ A;  2BNO A;  1NLQ A;  2XL9 A;  5FZ0 A;  4CDQ A;  4NJ4 A;  1F4A A;  1PO1 3;  1XYN A;  2ID4 A;  2NZ9 A;  4BPZ A;  2WZR 3;  4CP0 A;  1J84 A;  4FO9 A;  2K2S A;  4S2H A;  3FHA A;  1AX2 A;  1Q8P A;  2A6Y A;  2O1Q A;  1PIV 3;  4NWV A;  5JI7 A;  1C4R A;  1RYY A;  4JTN A;  3OBR A;  4O9G A;  4OVE A;  1UZY A;  5F6L B;  1N1V A;  1VBB 1;  2VY0 A;  4MAD A;  4OI4 A;  4UW4 A;  5B4X A;  5JXG A;  2G9Z A;  1JYV A;  4FVV A;  4EN0 A;  3EQE A;  4CU8 A;  5DN2 A;  1QGL A;  4IND A;  2JG9 C;  1DCS A;  2QFE A;  1QIQ A;  4JKL A;  3KCC A;  2RS5 1;  2YFZ A;  5EYY A;  1WMF A;  3RZZ A;  3R05 A;  1MS9 A;  1NOV A;  4KG0 A;  4AI9 A;  4JDO A;  3Q8F A;  3TBD A;  2JDN A;  4XZP A;  1QF3 A;  1F2N A;  1Q56 A;  1QJY 1;  1HRV 1;  1V9U 3;  3GZT B;  4JDN A;  2WFP A;  3M3I A;  4KH9 A;  4XJZ A;  5FYZ A;  4CRQ A;  1K45 A;  4XFB A;  1PVC 2;  1NCQ B;  3OY8 A;  3PUS A;  2LRP A;  2XH6 A;  3CEW A;  2UYB A;  4A6S A;  1ZNP A;  4IEQ A;  1VBC 1;  3VD3 A;  3SIT A;  4DXS A;  1FYU A;  3AFG A;  4IUG A;  3RYP A;  1WWY A;  1XNA A;  2HWB 2;  2JD4 A;  2VQA A;  1AL0 G;  1HQL A;  4QD2 A;  1C5H A;  1S1A A;  1EAH 3;  2YC2 A;  4MHU A;  3SCH A;  4WM7 C;  1ENR A;  4GH4 C;  1R08 1;  2RMU 1;  1W2N A;  3VBO B;  4XAB A;  1HRI 3;  1VAV A;  1QJZ A;  3CJI A;  4ISR A;  2ZZQ A;  4K1Z A;  4MGZ E;  3VHP A;  3ZFG A;  1XRU A;  4NMI A;  3WQ0 A;  4YLZ A;  4AHZ A;  2WC2 A;  1HN1 A;  1NKG A;  1QY4 A;  3KT1 A;  3SXW A;  4EV0 A;  2QZ3 A;  2OVU A;  3KGL A;  1HKD A;  2JX9 A;  2NN8 A;  4NRM A;  5FY1 A;  1K42 A;  4BMB A;  2VM9 A;  3B01 A;  4XE9 A;  2G4I A;  4LR4 A;  1NZI A;  4CZS A;  1LGB A;  2QBX A;  3VBO A;  2NP0 A;  1Q8V A;  3ECQ A;  3AP6 A;  4FPG A;  1SLT A;  1WMD A;  4JZR A;  4KU7 A;  5BV6 A;  2QDR A;  3VLB B;  2YDE A;  3ZLI A;  2WQZ C;  3WP3 A;  2R07 2;  3LKJ A;  2FQP A;  3WNL A;  1ASJ 3;  1VRB A;  4IER A;  3I2I A;  3WF0 A;  1H4G A;  2ADE A;  4XUP A;  2VCM A;  5JPM B;  1W0N A;  1ZZ6 A;  2LTN A;  2CDP A;  2WZP P;  5FY0 A;  3FLR A;  4FFG A;  2QKD A;  5HCB A;  3VDD A;  5JXH A;  3KT4 A;  2XQX A;  5FJK A;  4UFH A;  5KXC A;  2FDK A;  3OBA A;  3H1Y A;  2Q0A A;  2QQJ A;  3IMN A;  1NE4 A;  1KEX A;  1RVF 3;  4IES A;  4XJ8 A;  3I3B A;  4CTE A;  3H1W A;  4W8J A;  5J3U A;  2XOM A;  2YYO A;  1SHW B;  3AL5 A;  5EJZ B;  1W6N A;  3FJS A;  1J3R A;  5FPL A;  1GOH A;  1H1A A;  1PO2 2;  1GBG A;  2R1B A;  3CIH A;  4C8D A;  4WVW A;  1HRV 3;  4OZX A;  4ES8 A;  1RUC 2;  5L9V A;  1DGR N;  3KCY A;  4DY5 A;  2DU0 A;  4CU9 A;  4Q0U A;  3I3Q A;  5FBZ A;  1Y9G A;  3O0W A;  4GB3 3;  3K75 B;  1E5S A;  5BNP B;  5J09 A;  4QHO A;  2ENR A;  4XAE A;  5DG2 A;  4XBQ A;  4Z92 B;  2QVS B;  2WZ8 A;  3LSE A;  4J6G A;  3RWN A;  1WZX A;  3GBW A;  1HQN A;  4DS0 A;  3AP9 A;  2WWJ A;  2A1X A;  3BI3 A;  5DZF A;  2VTX J;  4UI9 L;  5IVY A;  1C5I A;  1D0G A;  1DQ2 A;  1X8M A;  4Q29 A;  4EWE A;  1JMU B;  5FTT C;  4DIQ A;  1CAU A;  1VBD 3;  5JIU A;  2ZXQ A;  2QZ2 A;  3NV1 A;  2ZGS A;  4D94 A;  2A6X A;  1VBB 2;  5HV4 A;  3WQB A;  1RUF 1;  2RR1 3;  5D8A A;  4FQZ A;  1AR9 1;  4Y1Z A;  2PEL A;  5F3C A;  4FOQ A;  4UW5 A;  4FTE A;  2JD9 A;  4QXB A;  1NQJ A;  2BEO A;  4E8D A;  1RUJ 1;  1WD3 A;  2JDP A;  4NHK A;  5DDJ 2;  5GJ6 A;  1GWL A;  2EVX A;  5FV3 A;  2R04 1;  4UFJ A;  4XCB A;  3K51 A;  4P08 A;  5T54 A;  1PIV 2;  3DXT A;  2OUH A;  1LOF C;  2JDZ A;  2VJX A;  5BNN A;  1J58 A;  1CJD A;  4EE2 A;  2QQL A;  1PMH X;  1RJ7 A;  3R4S A;  3NKT A;  3D0J A;  3FUO A;  4H3W A;  1YUD A;  4Y20 B;  4AFB A;  4XFF A;  1NLR A;  2JDY A;  3OCP A;  1ASJ 1;  3MIB A;  3QLQ A;  4YW3 A;  3X29 B;  2QQO A;  1DLC A;  1K5J A;  2A3W A;  4LHK A;  4CPB D;  3PJQ A;  5FZO A;  4AFM A;  2WAB A;  3HMY A;  3WQ7 A;  3KMH A;  3KF5 A;  3VBU A;  2YBS A;  4I09 A;  4JKM A;  5A33 A;  4CDU B;  5ERL A;  5DAP A;  4CCK A;  2Q1Z B;  3V64 A;  2AAC A;  4GH4 B;  1OUX A;  3W5M A;  1FMD 3;  5FCC A;  3U1X A;  4MGY E;  2VR4 A;  1LOG A;  4D6R A;  5JR2 A;  1W8N A;  2W39 A;  3LGR A;  2VNG A;  2A6W A;  5FFO C;  1SLA A;  3RJR A;  3ZX7 A;  4AVB A;  1JYI A;  1ZRF A;  2RDQ A;  3S7I A;  5LZ6 A;  4GWI A;  4KMQ A;  3SNM A;  4LK7 A;  3V0A B;  4QGN A;  4IXL A;  1WBF A;  3T0D A;  1GP6 A;  4BH9 A;  3NJY A;  3WNK A;  1OBN A;  5A32 A;  3PU8 A;  4FPC A;  1OD3 A;  2QNK A;  2ZX4 A;  3WEZ A;  4YM1 A;  5L19 A;  2XJT A;  3HN1 A;  2HBT A;  1V6N A;  5A7N A;  1BMV 2;  2QJV A;  4FPF A;  3VDB A;  4KU8 A;  1FXZ A;  2BER A;  5E16 A;  4EWA A;  1W28 A;  4BQ4 A;  1US3 A;  4QKD A;  2BWA A;  3LWC A;  1D2Q A;  4URA A;  1RUF 3;  3BTX A;  3VKN A;  3WNX A;  1AF9 A;  1WME A;  2LUW A;  1GWM A;  2R07 3;  5C3S A;  4N53 B;  1LB2 A;  1HX6 A;  3HT1 A;  1H9W A;  1MR5 A;  1ASJ 2;  4NUB A;  2YPD A;  3BYW A;  1GAN A;  4PT6 A;  4PLO A;  4K6B A;  4DQA A;  1JI6 A;  4RGA A;  2Z42 A;  4JQR A;  1CGP A;  1ODM A;  1IQD C;  2B9U A;  3IZO A;  4A6O A;  2BW8 A;  5IFP A;  5IVB A;  1G86 A;  1ZZC A;  4IEW A;  5D1I A;  4BK4 A;  1FX5 A;  2AGS A;  3VD7 A;  3ALQ A;  3RZH A;  2WZE A;  4YG3 A;  2YMZ A;  1MS0 A;  4GMP 3;  4YGB A;  5HXV A;  1GNZ A;  3CZJ A;  1RIN A;  5FMB A;  1GZT A;  3ES1 A;  2HEW F;  3OBZ A;  2RS1 2;  3SQO A;  1MZ5 A;  1N3P A;  4I3G A;  2HYK A;  3W21 A;  3TN9 1;  3WW4 A;  1N3Q A;  4DMI A;  3HBK A;  5FMC A;  1F31 A;  2QQK A;  3AK0 A;  3POJ A;  3T2T A;  1Z7S 2;  3T0A A;  1BHG A;  3NNF A;  3WW3 A;  5L7O C;  1GQH A;  4DO0 A;  5KBF A;  1MZ6 A;  3IT8 A;  1ENQ A;  1UXZ A;  4GB3 2;  5DZG A;  1RUD 2;  2W08 A;  5A3L A;  5DDJ 1;  2W47 A;  3QD6 A;  2ZBJ A;  1JN2 P;  1DQ5 A;  1QOT A;  4P14 A;  2R30 A;  4Y1V A;  1DQ0 A;  3MDP A;  5JUV A;  1IG0 A;  4LKS A;  1XYP A;  2VXR A;  4I0A A;  4LHL A;  1HXS 1;  1XNB A;  3ROU A;  3UK9 A;  4IL7 A;  3SH3 A;  3JU9 A;  5EP9 A;  1IPJ A;  2GN3 A;  5C9A A;  3SC7 X;  4EN8 B;  2FCV A;  1UF2 C;  4TN7 A;  1GKB A;  4LKF A;  2J1E A;  1VB4 A;  4ZKT B;  1AYM 1;  2ZS6 B;  1GWK A;  1GUI A;  1YQ2 A;  4UFM A;  5D2A A;  4QPW A;  4URT A;  2Y6K A;  1BKZ A;  4CXX A;  2OZJ A;  5FP8 A;  5LEK A;  2B42 B;  4IET A;  5FZB A;  5L36 A;  4A7Y A;  2W94 A;  4YW5 A;  3CKH A;  1ZVF A;  1BBT 1;  1JHJ A;  1SLL A;  5AFE A;  4FOV A;  1OLM A;  3AKS A;  1ZM1 A;  1IPK A;  1DYO A;  3T2P A;  2HWF 3;  3I3E A;  1UWW A;  1IS3 A;  4YZ2 A;  3RZK A;  1NT0 A;  4Q27 A;  3WY6 A;  3MFA A;  4PQQ A;  2Q1M A;  4ZZ8 A;  2GC2 A;  5IVV A;  3UNP A;  4OQ8 A;  1OA3 A;  1UZV A;  2VOV A;  1RIR A;  1GYK A;  4M3C E;  5F6K A;  4B1M A;  3ZXK A;  4GUL A;  2R0F A;  3A0N A;  1G8W A;  5C9A B;  5CAD A;  1JUH A;  1S2K A;  2GC1 A;  1EV1 1;  3B5L B;  3SHR A;  3WW2 A;  1CQ9 A;  2AZ5 A;  2RMU 3;  4XF1 A;  5CVR A;  4A7K A;  3S5A A;  4K7J A;  3PIG A;  4GAZ A;  3ZVX A;  1GQP A;  3VD4 A;  1Q3E A;  4AED C;  3LFM A;  1F5F A;  3L2H A;  2ZGP A;  1OA4 A;  1TME 1;  1R1A 1;  4GMP 1;  4M0H A;  4BM8 A;  1UO9 A;  2ET1 A;  1AXK A;  3AVR A;  2XHN A;  5LA2 A;  5F5Q A;  1BK0 A;  3THC A;  3I7D A;  2FCU A;  4TZD A;  1YQ6 A;  5KHJ A;  3AL6 A;  5A3O A;  1VAM A;  4XAC A;  3RS6 A;  1AR7 3;  1BVV A;  1D4M 2;  4LT5 A;  2HH9 A;  1O3S A;  2HEV F;  1ND3 B;  1M06 G;  1UD1 A;  4PHZ A;  3FL7 A;  4RSU A;  3IDC B;  4CCJ A;  3D4K A;  1AL2 2;  4Q4X 3;  1G9A A;  2OZ6 A;  4JRL A;  3HN3 A;  2HWC 1;  4KNC A;  1CX1 A;  3LIG A;  2GND A;  1VB2 A;  3SH4 A;  2QE3 A;  2A71 A;  3R0R A;  3AP5 A;  3BB6 A;  4LNV A;  5K4L A;  4E2S A;  4CE8 A;  5ACA 1;  1TMF 2;  2D93 A;  1X50 A;  2VU9 A;  3LDR A;  4P5H A;  4WZC A;  3RYK A;  2ZKN A;  5AC9 1;  2D43 A;  2DTY A;  1UU5 A;  1GOF A;  5DAW A;  4YZ3 A;  1AYN 3;  1S0G A;  1KFX L;  1OPO A;  3ZYH A;  4BB3 A;  4E9K A;  3USU A;  4B1L A;  3UYJ A;  1ONA A;  1SCS A;  2W95 A;  4B4R A;  2DV9 A;  1OHF A;  2Y38 A;  5GM0 A;  4DXZ A;  3I97 A;  1ZRE A;  5LCW L;  2UWA A;  2VMC A;  5IAV A;  1HLC A;  1AZD A;  1IS5 A;  2WYF A;  4H55 A;  1AX0 A;  2P17 A;  4KI5 M;  2ERF A;  3BGA A;  5LA9 A;  5M0T A;  2IVJ A;  2UWC A;  1STM A;  4Z82 A;  4R9C A;  5FZD A;  1AHS A;  4HKL A;  2UUR A;  2RS1 3;  3SKJ E;  2YGM A;  4K40 A;  3OUH A;  2ZGM A;  3JBG 3;  2JKB A;  3DYO A;  4DEQ A;  5KWR A;  1W3X A;  1TNR A;  1U0A A;  1Z7S 3;  1H2N A;  2ZCW A;  3PMS A;  3GBG A;  2ZHN A;  1ODN A;  1DQ4 A;  2CWM A;  5FZ4 A;  1RUD 3;  2VZS A;  3BKZ A;  1O5U A;  2VNV A;  2P5B A;  3B02 A;  1TME 3;  2J1T A;  2XR4 A;  2YUE A;  4IDZ A;  3VV1 A;  5A3W A;  4FSJ A;  2MEV 3;  4FFI A;  3ZYG A;  5LAS A;  1Q8S A;  2YGL A;  5A6Q A;  1N47 A;  3N7L A;  3CLP A;  2ZAC A;  2ZHM A;  2W91 A;  3U10 A;  4CCL A;  3O1U A;  2VZ3 A;  4JRA A;  3E1F 1;  2G1M A;  1MVQ A;  4TWT A;  5LB6 A;  5IAX A;  2ZEW A;  1T6G C;  3EMR A;  3I2J A;  2BTV C;  4W6X A;  3BTZ A;  3B93 A;  3GHN A;  1JTZ X;  3ZFF B;  1SBF A;  3R4D B;  2HWC 3;  4Q4Y 2;  4QX1 A;  5FPX A;  1ZRR A;  1TZO A;  3N9N A;  1HJF A;  2HEY F;  3AZY A;  4LBQ B;  3MZH A;  1RUI 1;  1PX3 A;  4RFR B;  5H9S A;  3GHM A;  4AVV A;  2JE9 A;  4M3C F;  4NAM A;  1YO8 A;  1I9R A;  2R06 2;  1W2A X;  2P6C A;  3ES4 A;  4KG8 A;  4QMA A;  4N43 A;  1IG3 A;  2QQV A;  2W5F A;  5IWF A;  4HK8 A;  5GZG A;  4LXL A;  3MF6 A;  2VMI A;  2VXJ A;  3NJX A;  2PHD A;  4Y5S A;  5D8A B;  4IV1 B;  4H14 A;  3N4M A;  5LRS A;  3HNY M;  4JQT A;  1LOD A;  2ES3 A;  2E7A A;  3FZ3 A;  4ATE A;  1D7P M;  4IV3 A;  4LKD A;  1JYW A;  4O7X A;  1Q8Q A;  3GF6 A;  2D6P A;  1X33 A;  1JXN A;  1SAC A;  2VTX A;  4UYB A;  3FLT A;  1W99 A;  4U36 A;  3C7G A;  5JR7 B;  5FPU A;  3JQX A;  4LBQ A;  2C24 A;  3RSJ A;  2ZJC A;  4DPN A;  4D8M A;  1XU2 A;  3FLP A;  4F83 A;  5F5A A;  3VBS C;  1H8T A;  1Q8O A;  1W9S A;  5CNA A;  2K0G A;  2XPJ A;  1YFY A;  2C4X A;  1FOD 3;  5C8C A;  4LPL A;  1UQX A;  5G05 L;  2EIC A;  3ETQ A;  4QKN A;  5IK8 A;  1MQT C;  2WA4 A;  3RG0 A;  3LDB A;  1AL2 3;  3N9O A;  4DRV A;  1R1Z A;  4IW3 A;  2VBB A;  1LU1 A;  4YW2 A;  3WDV A;  4AF9 A;  5F8P A;  1DYP A;  1NUK A;  2Y6L A;  2XVL A;  3THD A;  2OUJ A;  1WW6 A;  4AE2 A;  5SV8 A;  2DCT A;  4XC9 A;  1TMF 3;  2ATF A;  3U78 A;  3VZK A;  1NA1 B;  1PK6 B;  2GNB A;  1C28 A;  2RG4 A;  3AX4 A;  3UKN A;  4CCE A;  5FOJ B;  3H8R A;  4KBZ A;  2Z79 A;  1CX4 A;  4FPL A;  1OF3 A;  1Y4W A;  3ACH A;  3ASI A;  4MXW B;  1ZA7 A;  5F2S A;  3J8F 1;  4FI9 A;  1UKG A;  2HYX A;  4NRP A;  1HB2 A;  5F3G A;  4AQ6 A;  1GNH A;  4KQ7 A;  3PME A;  1ENS A;  4WM8 A;  1W8W A;  1MS4 A;  4IGP A;  4GWM A;  1VRH 1;  3EJK A;  3BU0 A;  2FMD A;  4MXV A;  2WL1 A;  2WO7 A;  1LEC A;  1KFU L;  1SZB A;  3H9A A;  1WKY A;  3M3O A;  4AEM A;  1S4C A;  3POS A;  4WVV A;  1JOB A;  3MPB A;  3O1M A;  3WP4 A;  1DZR A;  1B35 C;  5IK4 A;  3FUQ A;  5BXX A;  1GP5 A;  2VQU A;  3TB0 A;  1IZ3 A;  1UKR A;  3RZM A;  1SFP A;  4MGI E;  1N1T A;  3EHK A;  2CNA A;  2VD7 A;  2W1Q A;  2YFU A;  1BQP A;  3NV2 A;  2VME A;  2WT1 A;  4R4X A;  3O12 A;  5FPZ A;  4XOG A;  1H2K A;  3VBU B;  1XQN A;  5J37 A;  3GCX A;  1QH6 A;  5D8A C;  2VC9 A;  3ZYJ B;  3LZZ A;  1BK1 A;  3N9L A;  2KD7 A;  2XBO 3;  4YAR A;  5IFT A;  1OOP C;  2Y0I A;  4LBJ A;  2GP5 A;  5GZD A;  3WG3 A;  2RDR A;  2GNM A;  2Q8O A;  1UMH A;  2GU9 A;  1H8T C;  4Y1U A;  4W6W A;  4COW A;  2PHW A;  4NII A;  3ZFE B;  5T5O A;  3PTR B;  3HWJ A;  4YM0 A;  5EJ1 B;  5FIX A;  1JOP A;  5JZG B;  5F32 A;  5F7U A;  2QDN A;  4FP2 A;  4MZU A;  2E7Q A;  4QPG C;  1FI2 A;  3OYW A;  3OGV A;  5A70 A;  5LW9 A;  4AGR A;  5FPB A;  2OT7 A;  4UT5 A;  5BNN B;  2C1F A;  3I2O A;  4MYE A;  3KQR A;  4YM3 A;  3OPZ A;  2R6Q A;  1B09 A;  4CDW C;  2GH8 A;  2W46 A;  1QXJ A;  4CCM A;  2GC3 A;  5EV7 A;  3T2Q A;  1G9B A;  1SDW A;  5BNO A;  2ILM A;  5IHR A;  2HWD 3;  4IEP A;  4Y3O A;  2VAU A;  3U75 A;  2PYT A;  3VDD C;  4OYU A;  2Q8C A;  3C7F A;  4PBO A;  3P3N A;  2CL2 A;  2I45 A;  3EYP A;  3M1H A;  4X8P A;  4AI8 A;  1CAV A;  3III A;  4OMD A;  4AED B;  1FPN 1;  1UOF A;  1IKQ A;  4DUV A;  3PHM A;  1YI7 A;  4CDQ B;  1SDD B;  1YJL A;  2VZV A;  5FYS A;  3DEC A;  4B7K A;  3M8L A;  1MS8 A;  2ZTN A;  3IN9 A;  5FXW A;  1JZ3 A;  2CV6 A;  2IZW A;  4V2W A;  2VMD A;  5T50 A;  4DNY A;  2ZML A;  2VUJ A;  1UY3 A;  4NID A;  3PVE A;  4A7Z A;  1LOE A;  2PXJ A;  1A8D A;  3OF1 A;  3KWV A;  4NVP A;  3WXP A;  1PO2 1;  2C26 A;  2ZX2 A;  4ATF A;  3DUI A;  3N7J A;  3VDA A;  1QH7 A;  3K2O A;  3FE5 A;  4IQP A;  4GZ9 A;  5K0U B;  5FK8 A;  2YB7 A;  1LJ7 A;  4Q4X 1;  4HN1 A;  3E5Q A;  5FZM A;  1QJU 3;  2XJV A;  3ZPY A;  5A3P A;  3VD9 A;  4QQP A;  4RR3 B;  1Y7B A;  3BOW A;  1LES A;  2XG3 A;  4CP9 A;  2WS9 1;  4EN9 B;  1RED A;  1KXG A;  1YFW A;  2PLV 2;  3TNP B;  2X05 A;  1PM4 A;  2ARX A;  1KD7 A;  2ZGR A;  3A21 A;  5FAX A;  4BQ3 A;  2LS6 A;  4LE4 A;  4OUM A;  5E6H A;  1VP6 A;  4XUT A;  2EF6 A;  5IVC A;  5LAT A;  1RUN A;  1MZE A;  3JB4 C;  2XQR A;  3CBN A;  2SLI A;  2DCJ A;  1RUE 1;  3J8F 2;  2VEC A;  5C4W A;  2ZKL A;  3AC0 A;  5DUX A;  3RDI A;  3HQX A;  5C4W C;  2BBV A;  3DV8 A;  3GXU A;  4CCD A;  3AZV A;  1S2E A;  1OXC A;  4GB3 1;  4SLI A;  4AHW A;  4HL0 A;  2D6N A;  1YNA A;  2ET7 A;  4OLL A;  4JAA A;  5C8W A;  1UY1 A;  4NPM A;  2HWE 3;  5FZH A;  2R04 2;  1TNF A;  1GOG A;  2XON A;  1H1I A;  3RJ2 X;  3OSD A;  3H1M A;  5C7G A;  4ASK A;  3W9A A;  2A5Z A;  4XUO A;  4F8A A;  2XKP A;  1VPH A;  1OQE A;  1W6Q B;  4M4R A;  3O1P A;  3WZ1 A;  3C7H A;  2J1A A;  2WNE A;  1LED A;  4P9I A;  2Y8K A;  3I2K A;  2ZEY A;  1LGN A;  4OHV A;  5GLW A;  5JZG A;  4QB1 A;  3Q8E A;  1ALY A;  1HW5 A;  3DKW A;  3LE0 A;  5JIA A;  3OB8 A;  5KXD A;  5A7S A;  1JUI A;  1XNT A;  2F4L A;  2ZGL A;  1J3Q A;  1E5I A;  1CD3 G;  5EHD A;  2CGO A;  3MUY 1;  5DAQ A;  3THT A;  3WNP A;  1GZW B;  2I07 B;  3NV3 A;  4IE0 A;  4C91 A;  3VZL A;  2FCT A;  1HB1 A;  5FOB B;  1Z0H A;  1JU3 A;  2ARA A;  1TG7 A;  1XNC A;  1TEI A;  3AP4 A;  2TUN A;  2YBK A;  3C2U A;  1RXF A;  1H2L A;  4UFI A;  1S0B A;  2AC1 A;  2VW1 A;  4OI2 A;  5SV5 A;  3I3D A;  3OY8 B;  1OUR A;  4E2G A;  4KWU A;  1OLQ A;  1O7F A;  5J98 B;  4UW3 A;  1VMH A;  3NQH A;  2WAA A;  5HCF A;  1IPS A;  5LA0 A;  1VJ2 A;  4AHX A;  2W0X A;  1POV 1;  1FV3 A;  2WQ8 A;  4NO4 A;  2VUL A;  3V65 A;  1CAW B;  3S5Q A;  4GXL A;  2A3X A;  5L9B A;  5A6Y A;  5HPO A;  2EAA A;  2QQW A;  1L7R A;  2J42 A;  2PHF A;  2UYA A;  3PUI A;  2WFF 2;  1W8Z A;  4NIH A;  2KXL A;  2E7T A;  1UZZ A;  2VMF A;  4JHZ A;  4HAN A;  3HD8 B;  4WM8 B;  3PNA A;  4LBL A;  3WHT A;  3TNQ A;  3J7H A;  3NJZ A;  3ZSL A;  1BMV 1;  2R0H A;  4GD4 A;  3ZYR A;  3NNJ A;  3V0A A;  2B45 X;  4GAL A;  5FXV A;  2JE8 A;  1VBE 1;  1MEC 3;  3AMN A;  1ENX A;  2EIE A;  4W4Z A;  1RB8 G;  4N7U A;  2BP6 A;  1NA1 A;  1PK6 A;  3H3U A;  4EZH A;  4IGQ A;  1W6M A;  3B3Q E;  1D4M 1;  1W9T A;  1XBF A;  2PHL A;  2Q4S A;  3KCX A;  3ME2 A;  5LBF A;  2WWU A;  1JHN A;  1ZRI A;  2OII A;  3RRD A;  2Y60 A;  2HWB 1;  2D5H A;  2OQ6 A;  4HSL A;  2YG0 A;  1PMI A;  1UN1 A;  4IV3 C;  4R9A A;  5GLV A;  5H9P A;  1JYX A;  4HPK A;  1MPX A;  4N8M A;  4LBK A;  3VHR A;  1QJY 3;  2VW2 A;  3MID A;  3M3C A;  5LY2 A;  3ZXL A;  2ORX A;  2BZD A;  2DWR A;  3OUJ A;  4JGY C;  1COV 3;  1PM7 A;  1WCS A;  5C8C B;  1A34 A;  4M4P A;  5T5J A;  4OUE A;  4QPY A;  3O1V A;  4IGO A;  3A0K A;  1VBA 3;  1SMV A;  1VBC 3;  4QX3 A;  2A73 B;  3ZKU A;  2PLV 1;  5A7W A;  3FX3 A;  1H1M A;  4Y20 A;  3WLU A;  2CHH A;  1K5M C;  1SBE A;  1XE0 A;  3AXE A;  3Q8B A;  2YRO A;  1K5M A;  5CYY A;  1J1T A;  2JG8 C;  3M70 A;  4E4Z A;  2GMM A;  3K4A A;  1NX9 A;  2IFR A;  4JHT A;  5KC5 A;  1L7Q A;  1QJX 1;  2FDI A;  1S0E A;  1W9F A;  1QJU 2;  5FUN A;  4RQP C;  3ENR A;  1CAX A;  1QMJ A;  3I59 B;  4OI1 A;  4AEK A;  5JWP A;  3DGT A;  2IXH A;  3U11 A;  1F9K A;  3O14 A;  1V9U 2;  4IE7 A;  4YVW A;  3UV9 A;  3VBR B;  5KHK A;  2OPW A;  5FRA A;  4LMF A;  4QAW A;  4LBM A;  3NAP B;  4GWJ A;  4QQ2 A;  2C0Z A;  4WZF A;  2LAL A;  4BWO A;  1UZW A;  1HXS 2;  3I4I A;  1VBD 1;  2X5I B;  2PQQ A;  4YNI A;  3NJV A;  1RL3 A;  2V4V A;  4HMZ A;  1OQ1 A;  4XDO A;  1PGL 2;  5I8Y A;  4WM8 C;  1LOB A;  4JV4 A;  2RDS A;  2EXK A;  3LA3 A;  2D3S A;  3OD0 A;  1MQT A;  1S0C A;  1GU3 A;  4ZXE A;  5T52 A;  4Z1V A;  3H0O A;  2RM2 1;  4Y4Y A;  4IEU A;  3POE A;  4M0N A;  2R04 3;  5FJH A;  1PGW 1;  3ZFF A;  4LBN A;  4Q4W 1;  4XAA A;  1HRI 2;  1ULD A;  1W2O A;  2B39 A;  2GC0 A;  4CVU A;  2LRO A;  2OA2 A;  4AQS A;  4QQL A;  1NXD 1;  4PJY A;  1U5I A;  2GP3 A;  1XB9 A;  4ITC A;  3USS A;  2IXI A;  3EBR A;  4QB6 A;  3SH5 A;  5ABJ C;  4E2Q A;  2EID A;  1PZ8 A;  4QDR A;  5FLI A;  1RVF 1;  3MLK A;  4ZU7 A;  5K7P A;  1XPW A;  3LEI A;  4EZ4 A;  1JH5 A;  3SEE A;  4BE3 A;  4EYU A;  1YJK A;  2PA7 A;  4N9I A;  2GN7 A;  1EV1 2;  4Q4Y 1;  4FPH A;  2VUC A;  2YU2 A;  2R32 A;  3U14 A;  4RHV 3;  3UES A;  1RUJ 3;  5GAL A;  4Q4V 1;  1LGC A;  2P4E A;  5FMD A;  2VE1 A;  2VG9 A;  1RUO A;  1ZYB A;  4CDW B;  3OGG A;  1A8M A;  4WVM A;  2WNU B;  3ZN6 A;  1FNY A;  4V1P A;  5BNN C;  5IK5 A;  4RS5 C;  1W04 A;  5FQ0 B;  1W6P B;  4RGK A;  2R16 A;  1S0F A;  1OSG A;  2B8M A;  2IXC A;  4JCK A;  5B2G B;  5CFC A;  2WYS A;  2BOJ A;  1WW7 A;  3B9I A;  1VBE 2;  1WLW A;  4CXY A;  3S57 A;  2J7M A;  1PGL 1;  1APN A;  1UAI A;  2HWD 1;  4CEY B;  2VOK A;  1OC1 A;  2WFF 3;  1SPP B;  5FZK A;  4KGG A;  3NNG A;  4W6Y A;  2DBI A;  4QQH A;  3TOJ A;  1AYM 2;  3LFI A;  1W6O A;  4OZO A;  3QH6 A;  1RUC 3;  4WBB A;  4Z07 A;  4YG6 A;  3VBU C;  1DG6 A;  2VVE A;  4LJH A;  5E8A A;  3ZIW A;  2DF7 A;  1QQP 1;  4I0W B;  1J1L A;  1MEC 2;  4QPG A;  1LNS A;  3WNO A;  4HK9 A;  2ORZ A;  2O8O A;  4AHY A;  4AYU A;  1R09 3;  3BAL A;  5AC9 2;  3AYE A;  5FPV A;  1NCR A;  2DUR A;  1C8M 2;  4BIF A;  4GIQ A;  3I49 A;  4L99 A;  4ZXK A;  5I93 A;  4D6Q A;  1NY7 2;  1W2U A;  3MV1 1;  1CN1 A;  1XOY A;  3DYM A;  1VBB 3;  2FD8 A;  1S0D A;  1UIK A;  5HXM A;  3V56 A;  2E53 A;  1WW5 A;  5ABJ A;  4PLN A;  2XHK A;  4NHY A;  5JXI A;  2VH9 A;  5ACA 3;  4LQR A;  2VGD A;  1CAV B;  4YSF A;  4V2V A;  3POG A;  3FHQ A;  1DP0 A;  3WV6 A;  3E5U A;  2DUP A;  3JB8 A;  3AYC A;  1YC6 1;  4AVC A;  1V6L A;  2DU1 A;  2E31 A;  3ABZ A;  2X8K A;  5I0U A;  5JMO A;  1CIY A;  3TEZ A;  3H7J A;  2XGX A;  4X6R B;  3WP6 A;  4YFW A;  4XDQ A;  1G6N A;  5BNO B;  1ZBE 1;  3PLQ A;  2Q5T A;  2CY6 A;  3I8T A;  3K46 A;  3RQ0 A;  2ZGT A;  4K8R B;  3MUZ 1;  4ARY A;  3JD7 3;  4PIX A;  4F3J A;  2XWB B;  3KVB A;  2GSY A;  2G9G A;  4TXW A;  4XQW A;  2RS3 3;  3G6J B;  1LHU A;  4Q0S A;  3BPZ A;  4A3X A;  5J1X A;  4LOS A;  4CUA A;  4LA2 A;  4OMC A;  2CWS A;  2WR9 A;  4ASM B;  3BVC A;  5C70 A;  1CJP A;  1H9P A;  1V0A A;  2XWJ B;  4Q1R A;  4EN6 B;  1VR3 A;  1YXW A;  3HQR A;  5DUW A;  3LSD A;  1C1F A;  5FYT A;  2Y0O A;  4CDX A;  4IE6 A;  3NNL A;  2DTW A;  2OKX A;  1C8M 1;  2QQU A;  4JGY A;  1QXR A;  4K9S A;  5FZE A;  4A45 A;  3D5O A;  2ZOE B;  3LOI A;  5KR7 A;  1EPZ A;  2YC4 A;  3MEP A;  5BUV A;  2VUA A;  1A6C A;  2D6O X;  3RMX A;  3N36 A;  4O9E A;  4D6S A;  3B00 A;  3ACI A;  4BZ4 A;  2WLQ A;  5GZC A;  2PN5 A;  4XJU A;  1O59 A;  1RUC 1;  4QU2 A;  2WQ4 A;  4FPY A;  4XZU G;  1JOD A;  3N9M A;  2Q8D A;  1PGS A;  1J59 A;  1YIP A;  4HOO A;  2FDF A;  1OF4 A;  1SPP A;  4O61 A;  1DU3 D;  1YQC A;  4N7I A;  3WNM A;  4IEV A;  2P3J A;  3APB A;  1JZ8 A;  1NG0 A;  5A1L A;  3BTA A;  5CIS A;  3BIE A;  2HWF 1;  1R09 1;  1AR6 3;  1RTV A;  1NZC A;  1W39 A;  1HDK A;  2B7Y A;  2VUD A;  5T3N A;  5CFC B;  1SCR A;  4HKO A;  4RQP A;  1BEV 1;  2Y26 A;  3GBF A;  1QKQ A;  3MIG A;  3PL0 A;  2F6B A;  2J1U A;  3POI A;  1RUF 2;  1JOJ A;  1EV1 3;  1MS1 A;  3ZXD A;  2JDM A;  4FCA A;  4QXK A;  5K8S A;  4RHV 2;  4AVS A;  1RUJ 2;  1UPI A;  4CA9 A;  5CKQ A;  1CPM A;  5CFD C;  1CPN A;  1KS5 A;  4QPI A;  2BYV E;  1NCQ C;  4I0B A;  1RMU 1;  2XVG A;  4PIY A;  5FYY A;  1ULE A;  4Y33 A;  1FAY A;  1UXX X;  2D40 A;  1OFN A;  3SIS A;  3ZYP A;  5E1R A;  1OKQ A;  1C1L A;  2ETE A;  2P34 A;  3JUU A;  1ZBE 3;  4Y22 B;  3O0X A;  2XJQ A;  1VBE 3;  3LEG A;  4AZZ A;  5HCH A;  3MPP G;  2YC0 A;  5T5L A;  4E8C A;  3OUI A;  3MV0 1;  2WIN B;  3H50 A;  1S0J A;  5IVE A;  1O3R A;  2D7F A;  5BNO C;  3U4S A;  3T1M A;  3VUO A;  4JC1 A;  4S2G A;  1WCD J;  4YVW C;  1UOB A;  1AYM 3;  2BDR A;  1ND2 A;  4PIZ A;  4EJR A;  1NY7 1;  2ZX3 A;  2RS3 1;  2BBA A;  4Y22 A;  1QU0 A;  5I91 A;  4XBN A;  1X9P A;  4N90 A;  3WHU A;  1DQ1 A;  1N1Y A;  3MO4 A;  3JQW A;  4BOW A;  1MQT B;  1DGL A;  4JGZ B;  4X8N A;  4N53 A;  4AFC A;  2H6C A;  4Q0P A;  3L9J T;  3DPR B;  1EPW A;  5EIY B;  4XUQ A;  4D69 A;  2VNO A;  1YHF A;  3J4U H;  2BGC A;  5JOY A;  1R09 2;  5AC9 3;  1MS3 A;  5E89 A;  1C8M 3;  4YGE A;  1S2B A;  4QPI B;  1BVP 1;  5DMY A;  3TEY A;  2A75 A;  5A3M A;  1V6I A;  2OPK A;  2D3P A;  4IV1 A;  3WG1 A;  4XET A;  4BIO A;  4CU7 A;  5JPN B;  2H0B A;  1GNY A;  3WG2 A;  4CEW C;  4YVS C;  5LEJ A;  3UKT A;  3OGS A;  4A2U A;  4RQP B;  2DFC A;  2VTF A;  4TSV A;  4HBN A;  4XYX A;  3OGR A;  4ZZ5 A;  1IS4 A;  4N43 B;  2SBA A;  4QX7 A;  4RD7 A;  5C5T A;  1AR6 1;  3A23 A;  3CHX A;  1NXM A;  2E33 A;  5GLZ A;  2DVA A;  4J25 A;  4QM8 A;  3ZFG C;  2CAU A;  2JG8 B;  2JEM A;  3WUD A;  3N9P A;  1POQ A;  2B46 X;  3PJY A;  5A7W B;  4E4D X;  3ZM8 A;  4FBF A;  2VQT A;  3KT7 A;  2RDN A;  4CP1 A;  5JXJ A;  1X7N A;  5CG9 A;  1DGR A;  3KV4 A;  3JXS A;  2B9V A;  2YY1 A;  3JD7 2;  5A1F A;  5C8C C;  2WNV A;  3SLI A;  4HVR A;  4JGY B;  4CUC A;  1NQD A;  3MW4 A;  4W65 A;  5IVJ A;  2UWB A;  5AFB A;  2OX0 A;  4H7M A;  1PVX A;  2RS3 2;  3H3Z A;  4FFH A;  4YM2 A;  3IDA A;  2RMU 2;  3VBF C;  3ZFF C;  2Q1F A;  5ANN A;  3LPF A;  2GH2 A;  2BFU L;  5T5P A;  2XL7 A;  3VB9 A;  5JOW A;  4XCA A;  1UYX A;  4FTS A;  4P9X A;  1DQ6 A;  5B4N A;  5FZ1 A;  4Q2F A;  3AMM A;  2FDH A;  1AX1 A;  5KHH A;  3N9Q A;  4AAP A;  2AEZ A;  4PDW C;  4XIL A;  2PMW B;  4L11 A;  1QJF A;  4XUR A;  2IC1 A;  5FYI A;  4AR2 A;  2UY9 A;  3MI8 A;  2XUM A;  4LUL A;  5IK7 A;  2ARB A;  4N53 C;  5FXZ A;  3ZOI A;  1Z7S 1;  3AP7 A;  3GDB A;  1AR7 2;  5J48 A;  3K3N A;  3KHC A;  3KV9 A;  2VCA A;  4Q8K A;  1W3V A;  2R07 1;  3E6D A;  1BYH A;  1PO1 1;  1X82 A;  2TEP A;  1V6O A;  4Q4V 3;  4A41 A;  3AJZ A;  3IBM A;  1W05 A;  1CAW A;  2D6L X;  4AGV A;  3NNM A;  1AR6 2;  4D3W A;  1QOO A;  3PDQ A;  3VGI A;  3E6C C;  1PIV 1;  3VHN A;  3OEA A;  1W0O A;  3W58 A;  3PUH A;  3WF4 A;  4A3Z A;  5FO8 B;  4K20 A;  5DQ0 A;  3AMQ A;  2AH2 A;  4RN5 A;  4TYS A;  3S7E A;  2VZO A;  1BXH A;  5FRE A;  1DIW A;  4NPL A;  1YIF A;  3QCW A;  4QX2 A;  1Q43 A;  4XQD A;  1U5X A;  4MGT A;  3WF2 A;  1DZT A;  1L3J A;  5CKM A;  4AFD A;  5H9R A;  4JGZ A;  3U07 A;  1AYN 2;  5JMC A;  4MUV A;  4UF0 B;  2JIG A;  3ZN4 A;  1DYK A;  2GDF A;  1AR8 1;  4OHZ A;  1Z78 A;  1IKP A;  1NCR B;  2BRT A;  3GZA A;  4ARX A;  4BHP A;  2C6S A;  5FP4 A;  3VZM A;  3HEI A;  1GZW A;  2E63 A;  1RUH 3;  1YLL A;  4F7Z A;  1KDK A;  2FZ2 A;  2CTV A;  1W6N B;  4Q1P A;  5FY5 A;  5I8S A;  4COY A;  1H8V A;  4W50 A;  4AEJ A;  1M4W A;  3D3A A;  4QDS A;  3M4F A;  1GR3 A;  5FWE A;  4LO6 B;  3G7D A;  1BBT 3;  2WS9 2;  1UYZ A;  2VO5 A;  4L0P A;  3VBF B;  2NYY A;  2YZ4 A;  2WBK A;  3HVD A;  3ZYB A;  4PQ9 A;  1QNW A;  2EAK A;  3WR0 A;  3JBG 2;  4YZ4 A;  1LHO A;  2PFW A;  3POY A;  4FOW A;  3I2F A;  3ACG A;  3HOB A;  4XFI A;  1QJU 1;  3NV4 A;  1DDL A;  2O0O A;  2RS5 2;  2R49 A;  2EXI A;  4XTM A;  2P6H A;  4XDP A;  2ADD A;  2V4A A;  1TME 2;  5FY8 A;  4ZHN A;  3L2Y A;  1U12 A;  1FV2 A;  4KWL A;  1LCL A;  1US2 A;  3IIA A;  5C4W B;  3P3P A;  1KJR A;  4WVM B;  3ZXA C;  2MEV 2;  4WV8 A;  1LR5 A;  5A3U A;  4XUN A;  3OEB A;  4P9W A;  3LQC A;  1PVC 1;  3MIE A;  1W90 A;  3ZXG A;  5A3N A;  1E57 A;  5JCT A;  2IXL A;  3MIF A;  1UY2 A;  1G9D A;  1NCR C;  2ZAH A;  2PHU A;  4CDU A;  5HCA A;  1OH4 A;  4RL7 A;  1ULG A;  1V6J A;  2PAM A;  2V5D A;  4R8H A;  2JDA A;  5FYB A;  2IXJ A;  4MO3 M;  4DB5 A;  4XIK A;  1DGW X;  2LM3 A;  2GMP A;  3ILR A;  3LEK A;  5FMO L;  1CR7 A;  3ACL A;  3MYX A;  2HWC 2;  5C9A C;  2FZ1 A;  4DXR A;  1DHK B;  1DBN A;  4MX3 A;  2RVA A;  2JG9 A;  1F5J A;  2Y6G A;  2I74 A;  3OOX A;  3S6P A;  3FMG A;  1ZZ7 A;  4I01 A;  3BOP A;  4OI0 A;  3AYD A;  4TLG A;  5FZC A;  1ZRC A;  5LK5 A;  3AFK A;  1DLL A;  1AR8 3;  2HJI A;  3MLJ A;  2JDU A;  1QHD A;  3WQ1 A;  3ZYI B;  3TN9 2;  2DUO A;  5AVP A;  2X09 A;  5CG8 A;  1O8S A;  2I2S A;  1ZZ9 A;  4BLJ A;  1RUE 2;  2WSV A;  1RUH 1;  4GJZ A;  4A4A A;  4ZON A;  3HJR A;  2W2I A;  4BQY A;  1N1S A;  1P8J A;  1AR7 1;  1PX4 A;  4LO5 B;  2WSU A;  3P6B A;  4FFF A;  4YGD A;  4COZ A;  2DVF A;  1T6B X;  2RV9 A;  1OT5 A;  2A6Z A;  1URX A;  1PO1 2;  4MG2 A;  1JZ4 A;  2AUY A;  4RFT 0;  1HIX A;  3AKP A;  4CEW A;  4YFZ A;  3HQU A;  4P00 B;  3VKL A;  1KQR A;  1W03 A;  2Y6J A;  3LD8 A;  1YWK A;  1SG3 A;  2W87 A;  4FTB A;  2WAO A;  5DAV A;  3SMH A;  2P3I A;  5BNQ A;  5CFD B;  1RGS A;  4YG0 A;  2Q30 A;  4Z2W A;  3NWK A;  1XYO A;  2RJ2 A;  1FOD 2;  1K12 A;  1K5M B;  1CES A;  2WT0 A;  2WO3 A;  1W2T A;  2CDO A;  3ZFE A;  2JB8 A;  2YBP A;  3FC0 A;  5FY9 A;  2PQS A;  3U37 A;  2VOW A;  4HFS A;  2Y64 A;  1LTE A;  2NLR A;  2VVF A;  2PHX A;  4LOT A;  4AVT A;  4K21 A;  4AFA A;  2L9L A;  2P1B A;  4UBH A;  3RWK X;  5FY7 A;  3ZKY A;  1V6K A;  3PVB B;  2DVG A;  3WSO A;  4XHX A;  5F2W A;  4Q5O A;  1Y9Q A;  1PVC 3;  2Q8E A;  3HAG A;  1EYB A;  4LK6 A;  1UMZ A;  3VHO A;  4UW6 A;  1I1E A;  3GJB A;  4K1Y A;  3A4U A;  1OLM E;  1QOS A;  3AKQ A;  4FXG B;  4HPK B;  1HJG A;  2ZMK A;  1JYN A;  2E9Q A;  3D6E A;  4UFL A;  1W9W A;  4XF3 A;  3E6B A;  2HWB 3;  4YVS B;  2N7G A;  1WA4 A;  3TWI A;  5KHI A;  4LA3 A;  1W6O B;  3IPV B;  1AR9 3;  1B35 B;  3WDT A;  4XF4 A;  4BK5 A;  1SEF A;  1RUH 2;  1O5L A;  3H3L A;  1C3H A;  1SQ4 A;  2D98 A;  2G19 A;  3A7Q A;  3ORJ A;  5G04 L;  4PBP A;  4DUW A;  2ZZJ A;  1YFX A;  4QPI C;  5C71 A;  5A1A A;  3U4X A;  1RUD 1;  4R52 A;  3B9C A;  3HR9 A;  4ZU4 A;  4GJY A;  1R1A 2;  4ZS2 A;  5C3Q A;  1V9U 1;  2B4K A;  5CB7 A;  3IM0 A;  2JJ6 A;  5FP7 A;  5FQ0 A;  4MXW A;  4OUL A;  4P9L A;  3SCF A;  1XE7 A;  4QX0 A;  5JSR A;  2HLE A;  2VL4 A;  2MPF A;  2WNU A;  1ZBA 3;  2ZGU A;  5T55 A;  3ZN6 B;  4BQ5 A;  2P3K A;  3IAP A;  4GWN A;  4YGC A;  3ETP A;  1NA1 C;  1PK6 C;  3POW A;  4GA9 A;  4H7L A;  4K8F A;  4M3C B;  4UXA A;  2ARE A;  4YVS A;  2RS5 3;  2XBO 2;  2BNN A;  1XSR A;  2AEN A;  3TEX A;  3LPG A;  4Y1Y A;  2HWE 1;  4ZY9 A;  2W92 A;  1XE8 A;  4B7E A;  5JZG C;  4ZU5 A;  1ZA4 A;  2V5Y A;  4PF5 A;  1OQD A;  3ON7 A;  3ILN A;  3HNM A;  1L7L A;  2D6K A;  2KA3 A;  3RNS A;  4L9B A;  5LBB A;  4GQ7 A;  2EXJ A;  3UT0 A;  4OQ9 A;  5H9Q A;  2ZAA A;  2J1V A;  1RVF 2;  3NRU A;  5FUI A;  3GZU C;  2VOT A;  5FZI A;  1YEW A;  1GP4 A;  5LA1 A;  5IUQ A;  3ZSJ A;  2K46 A;  4UFK A;  1ZX5 A;  4LO4 B;  4QKB A;  5DAB A;  4ET7 A;  4Y4R A;  4XTP A;  1AXY A;  4XIO A;  3OD4 A;  1DGW A;  2IWG B;  3MW2 A;  3QAC A;  1Y43 B;  5C6C A;  3ST7 A;  4PLM A;  4LIU A;  4EN7 B;  1OFS A;  3SCG A;  2G9F A;  1CWP A;  1OLR A;  1H0B A;  4E27 A;  1H4H A;  4QX5 A;  5D21 A;  5FBJ A;  3NO8 A;  5FYU A;  3CNA A;  4HXC A;  4CYD A;  1F35 A;  3KGZ A;  4OHW A;  4UOJ A;  4YZ5 A;  1JZ6 A;  3VBR A;  3PUA A;  4XFA A;  2WO1 A;  1VBD 2;  4QHZ A;  1JS9 A;  4LHN A;  4HLT A;  3LIH A;  4LO8 A;  4K3U A;  1T2X A;  4FPJ A;  4N43 C;  5FMO S;  1XC6 A;  4FP3 A;  1XNK A;  1C57 A;  4FT8 A;  5DDJ 3;  4WM7 B;  5APA A;  5CIR A;  1D0H A;  1ND3 C;  4NHM A;  2YU1 A;  4RS5 B;  4BDV B;  4RR3 C;  3P1I A;  2W1W A;  5L73 A;  1VLN A;  3LDK A;  4QX8 A;  3WP5 A;  2A3Y A;  3AZX A;  2VCC A;  1ACC A;  3JCI A;  4B29 A;  3LAG A;  2GAL A;  2WN3 A;  2Y33 A;  4C1W A;  4C90 A;  3O1T A;  4MVT A;  5GZE A;  4P9J A;  2WNO A;  2DCZ A;  3WCS A;  2W3J A;  3MLL A;  2OS2 A;  1LHV A;  1JU4 A;  2YHJ A;  3URF A;  2QTW B;  3WF3 A;  4YWA A;  4ISQ A;  3I2H A;  3H7Y A;  1CZV A;  3DKQ A;  2PTM A;  3K4D A;  3AKR A;  3J8F 3;  5BYN A;  2Y6H A;  1UU4 A;  3GZE A;  4JDM A;  2ZHL A;  3ZN5 A;  2WKK A;  3V0B B;  1Y9M A;  2V73 A;  5LBC A;  1JZ5 A;  4ERO A;  3K4Z A;  4B4P A;  4J1W A;  4FOY A;  5LWB A;  2BGP A;  3POF A;  2ZEX A;  3ZMN A;  5J96 B;  4M3C A;  5F3I A;  3W20 A;  1W6M B;  1VMJ A;  4UBG A;  2WO2 A;  4BQW A;  1IQA A;  3Q9O A;  1ULO A;  2JDH A;  2CU5 A;  1C8N A;  2H6B A;  3UGF A;  3WT3 A;  5FP9 A;  1FMD 2;  1V00 A;  3KB5 A;  1WCQ A;  1NLS A;  2J1S A;  2K9Z A;  1WD4 A;  3DXU A;  1CVN A;  4AAX A;  4BQX A;  5IW0 A;  3C8X A;  3DYP A;  3IMM A;  5KXB A;  3ZR6 A;  4XFH A;  1JYT A;  2IUW A;  3MHZ A;  1AR9 2;  3H8O A;  1POV 3;  1OMI A;  3RMY A;  4CCC A;  4CU6 A;  4Q8L A;  2RJK A;  2OYZ A;  5IVF A;  3RVH A;  3KHB A;  1E5R A;  3BU7 A;  3CJX A;  5A33 B;  4ORF A;  4PI2 A;  3RI9 A;  1R1A 3;  3OYW B;  3INA A;  3IPV A;  3PU3 A;  4LKE A;  3GM8 A;  5BY5 A;  3T2O A;  5HI0 A;  3H8X A;  4TTG A;  2KM2 A;  2H0V A;  3R6S A;  3ZFE C;  2EA7 A;  3T0B A;  1ZRD A;  5EFU A;  2ARC A;  2NM1 A;  3PUR A;  1QQP 2;  1ZBA 2;  4AXO A;  4DRR A;  4HG6 B;  4Z2A A;  2WZR 1;  3I2D A;  5F5C A;  1W8T A;  3FFQ A;  3VN4 A;  5J36 A;  5JDB A;  2FDJ A;  1IS6 A;  4XBL A;  2X29 A;  2BJS A;  3R4U A;  5I0S A;  4GKX A;  1IHM A;  1O91 A;  4UF0 A;  1TQ5 A;  2KR2 A;  4YW4 A;  4EWD A;  2VMG A;  3ZYF A;  4HKW A;  3VBH B;  3I3M A;  1TVG A;  3O1O A;  4BA6 A;  3Q8C A;  3UET A;  1YCI A;  4NRQ A;  1MS5 A;  3CZU A;  1QJX 2;  3CF6 E;  3HIF A;  5FK7 A;  1WLT A;  2YPJ A;  4I02 A;  3BIW E;  2A6V A;  1HB4 A;  2XJS A;  3QBQ A;  3LEM A;  2ZPX A;  5CFD A;  2JEC A;  4HSJ A;  1U5Z A;  4Y5Z 0;  2XUE A;  5FZG A;  2E6V A;  1O3T A;  4DZG A;  3VZO A;  1FMD 1;  1HN0 A;  3DL3 A;  2BV4 A;  2VVD A;  4MET A;  2WJS A;  1QJE A;  1YI9 A;  2BFU S;  3ELN A;  3NMB A;  4MLO A;  3B94 A;  5JVV A;  2GME A;  1KS4 A;  1OVP A;  1UYP A;  1QEX A;  2VNR A;  3VD5 A;  2W1S A;  1A78 A;  3VDC A;  4YZ1 A;  3LA7 A;  4LE3 A;  3LF7 A;  2WWS A;  1EAH 1;  2ZHK A;  3WDX A;  1H6X A;  3D82 A;  3FBM A;  3NST A;  1QJY 2;  4R9D A;  2VQ0 A;  3SEP A;  4BCU A;  1PGW 2;  3FWE A;  5F3E A;  1YRZ A;  1COV 2;  1ND2 C;  4OCT A;  5I8T A;  4S2D A;  3HPN A;  4XW3 A;  5FZL A;  3WF1 A;  2DBN A;  3WX5 A;  4CP9 B;  2JXA A;  1VBA 2;  1VBC 2;  1SLI A; 
#chains in the Genus database with same CATH homology
 3MO4 A;  4FI9 A;  2HYX A;  5EIY B;  4DUX A;  1K45 A;  4XUQ A;  1J83 A;  1WKY A;  2LW8 A;  5DMY A;  3VD3 A;  4DXS A;  4IUG A;  1XNA A;  4CU7 A;  1GNY A;  2YC2 A;  3EB7 A;  2VQU A;  1GMM A;  3OGS A;  2VTF A;  2W1Q A;  3OGR A;  2YFU A;  4ZZ5 A;  2VME A;  3A23 A;  2E33 A;  4JX0 A;  2VC9 A;  2KD7 A;  2W9X A;  1HN1 A;  1NKG A;  2WN2 A;  5IFT A;  3ZM8 A;  2VQT A;  2VZQ A;  2QQI A;  5JXJ A;  1UMH A;  3BN6 A;  1K42 A;  2VM9 A;  4BXS V;  2QBX A;  3JXS A;  2B9V A;  3ECQ A;  5EJ1 B;  4CUC A;  5F7U A;  3OGV A;  2VZR A;  3WNL A;  3SKV A;  3IDA A;  3I2I A;  3LPF A;  2QQN A;  3WF0 A;  2W46 A;  1UYX A;  4XUP A;  3T2Q A;  1W0N A;  5CZK A;  3IB3 A;  2CDP A;  5B4N A;  3HNB M;  2WDB A;  5IHR A;  5JXH A;  2XQX A;  4OYU A;  3OBA A;  1UY0 A;  3C7F A;  2DCK A;  2QQJ A;  3EYP A;  4XUR A;  1KEX A;  3III A;  4OMD A;  1JZ7 A;  3I3B A;  4W8J A;  2XOM A;  4DUV A;  1SHW B;  2X10 A;  5EJZ B;  3GDB A;  1GOH A;  1OF3 A;  3CIH A;  1SDD B;  2VZU A;  2VCA A;  1UY4 A;  2VZV A;  3DEC A;  1CZT A;  4A41 A;  4DXT A;  1JZ3 A;  2VMD A;  4CU9 A;  1UY3 A;  3IAQ A;  3OEA A;  3WF4 A;  3K75 B;  3PUH A;  4A3Z A;  2C26 A;  5DQ0 A;  2WZ8 A;  4RN5 A;  2VZO A;  3VDA A;  4A42 A;  4GZ9 A;  5I0D A;  2YB7 A;  4QX2 A;  4UI9 L;  4DEV A;  3WF2 A;  2V72 A;  1JZ8 A;  2ZXQ A;  3WQB A;  3VD9 A;  4ARX A;  2JD9 A;  4P5Y A;  4E8D A;  3HEI A;  2X05 A;  3A21 A;  3WNN A;  2LS6 A;  4LHS A;  4XUT A;  4W50 A;  3D3A A;  1EUU A;  2DCJ A;  4QDS A;  4P08 A;  3AC0 A;  4YPJ A;  3GXU A;  2VJX A;  1UYZ A;  2VO5 A;  4L0P A;  2WBK A;  2QQL A;  4P02 B;  1PMH X;  4RYD A;  2J22 A;  1UY1 A;  1GOG A;  2XON A;  1UMI A;  3I2F A;  3ACG A;  2QQO A;  3HOB A;  5C7G A;  1DLC A;  4XUO A;  4M4R A;  3C7H A;  2J1A A;  2Y8K A;  3I2K A;  2ZEY A;  2WAB A;  1US2 A;  4QB1 A;  3LE0 A;  3OB8 A;  4JKM A;  1XNT A;  2C9K A;  2J1R A;  4XUN A;  3OEB A;  3MUY 1;  3WNP A;  3LQC A;  3W5M A;  4XVH A;  1JU3 A;  1UYY A;  2VR4 A;  3I2G A;  5JR2 A;  1UY2 A;  4PF1 A;  1W8N A;  1TG7 A;  1OH4 A;  2V5D A;  4AG4 A;  2JDA A;  4MO3 M;  2VZ1 A;  4GWI A;  3LEK A;  4KMQ A;  3T0D A;  3I3D A;  3WNK A;  4KWU A;  3NQH A;  2WAA A;  4DXR A;  1OD3 A;  5LA0 A;  3WEZ A;  2RVA A;  2WQ8 A;  2Y6G A;  5HPO A;  3VDB A;  2BER A;  1L7R A;  3PUI A;  1US3 A;  2VMF A;  4JHZ A;  1ULP A;  2VZT A;  3J7H A;  2X09 A;  1O8S A;  3GGL A;  4A4A A;  3HJR A;  4PT6 A;  1P8J A;  1PX4 A;  1JI6 A;  1K3I A;  2JE8 A;  3P6B A;  2EIE A;  4W4Z A;  2RV9 A;  1OT5 A;  1IQD C;  1JZ4 A;  4A6O A;  1W9T A;  5IFP A;  4P00 B;  4BK4 A;  3VD7 A;  2Y6J A;  2WZE A;  2YG0 A;  3T09 A;  1SG3 A;  2W87 A;  1JYX A;  2WAO A;  1MPX A;  3CZJ A;  1F4H A;  2ORX A;  2BZD A;  2RJ2 A;  1K12 A;  2Z4F A;  2WO3 A;  4M4P A;  2CDO A;  4OUE A;  2PQS A;  1EUT A;  2QQK A;  3T0A A;  2Y64 A;  3U37 A;  1BHG A;  4QX3 A;  5IJR A;  1UXZ A;  2L9L A;  3WSO A;  2W47 A;  5CYY A;  4BJ0 A;  4QDQ A;  3CDZ B;  3K4A A;  5JUV A;  4LKS A;  1NX9 A;  1L7Q A;  2EIB A;  1JYN A;  1W9W A;  1I5P A;  4CUB A;  2J1E A;  4BK5 A;  4QAW A;  4GWJ A;  1UX7 A;  1GUI A;  1YQ2 A;  3A7Q A;  4QPW A;  5G04 L;  4DUW A;  3CQO A;  5C71 A;  2Y6K A;  3NJV A;  2WUH A;  2V4V A;  5A1A A;  4MGQ A;  2B4K A;  2W94 A;  4ZXE A;  3CKH A;  1GU3 A;  1JHJ A;  1CZS A;  5IYY A;  1DYO A;  3T2P A;  4QX0 A;  2HLE A;  2VL4 A;  3I3E A;  1UWW A;  4CVU A;  2JKX A;  4ZZ8 A;  3IAP A;  4PQQ A;  3K77 A;  3ETP A;  3UNP A;  3A22 A;  3LPG A;  4QB6 A;  4ZY9 A;  2W92 A;  2EID A;  3CMG A;  4QDR A;  3VD4 A;  1GQP A;  1XPW A;  3LEI A;  3HNM A;  1H6Y A;  3SEE A;  2XHN A;  5LA2 A;  3THC A;  3UES A;  3T08 A;  2J1V A;  3NRU A;  3ACF A;  5FUI A;  1NAE A;  2VOT A;  5LA1 A;  2W1U A;  4MGS A;  4ET7 A;  3FL7 A;  2BGO A;  4D0Q A;  2WYS A;  3HN3 A;  2J7M A;  1CX1 A;  4MOA A;  3NNG A;  1JZ6 A;  4UOJ A;  4OZO A;  1GOF A;  2WO1 A;  2R7E B;  1T2X A;  1XC6 A;  1UZ0 A;  1LNS A;  2W95 A;  3WNO A;  2ORZ A;  3I97 A;  5LCW L;  2VMC A;  4BDV B;  3P1I A;  2W1W A;  5DPN A;  4KI5 M;  2VCC A;  3BGA A;  3MV1 1;  3DYM A;  2WN3 A;  2QQM A;  5HXM A;  2ZEZ A;  3SKJ E;  2W3J A;  5JXI A;  1JU4 A;  3WF3 A;  3DYO A;  4DEQ A;  4LQR A;  4A44 A;  3I2H A;  1CZV A;  2E32 A;  3K4D A;  3W5N A;  3FHQ A;  1DP0 A;  2Y6H A;  2DDU A;  2VZS A;  1JZ5 A;  3K4Z A;  2E26 A;  2E31 A;  3ABZ A;  5JMO A;  1CIY A;  2J1T A;  2BGP A;  2ZEX A;  2WO2 A;  3K46 A;  3F2Z A;  1ULO A;  3MUZ 1;  4ARY A;  1WCQ A;  2J1S A;  2W91 A;  4AAX A;  2VZ3 A;  3C8X A;  3DYP A;  4TXW A;  4JKK A;  3E1F 1;  5J1X A;  2ZEW A;  4OMC A;  4CUA A;  4CU6 A;  5C70 A;  1O8P A;  3I2J A;  4QX1 A;  1R64 A;  2OKX A;  3GM8 A;  1PX3 A;  4A45 A;  3T2O A;  4TTG A;  2YC4 A;  4QB2 A;  3T0B A;  3ACI A;  2W5F A;  1JZ2 A;  1O59 A;  4XZU G;  2VZP A;  4HG6 B;  4Z2A A;  1OF4 A;  3NJX A;  3WNM A;  3OG2 A;  3HNY M;  2VCB A;  1PMJ X;  1D7P M;  1TVG A;  1JYW A;  1W8O A;  3C7O A;  3FN9 A;  3UET A;  1W99 A;  2J1U A;  3C7G A;  3CZU A;  4UAP A;  4D8M A;  3C7E A;  1KGY A;  1W9S A;  2C4X A;  4LPL A;  5G05 L;  1F4A A;  1UXX X;  2EIC A;  2ID4 A;  1J84 A;  3VD5 A;  2W1S A;  3FHA A;  3VDC A;  1RYY A;  3LEG A;  4E8C A;  3MV0 1;  1NUK A;  2Y6L A;  1H6X A;  4MAD A;  5B4X A;  3SEP A;  3THD A;  5JXG A;  1JYV A;  4CU8 A;  5DN2 A;  4JKL A;  2YFZ A;  3HPN A;  2BBA A;  3WF1 A;  3MBW A;  3ACH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...