2VZSA

Chitosan product complex of amycolatopsis orientalis exo-chitosanase csxa
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
857
structure length
857
Chain Sequence
LSVGAAAGNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
total genus 283
structure length 857
sequence length 857
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzsA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzsA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzsA03
4L5FH 5GSRA 4WI8A 4O58H 1HK6A 3MMEA 4LCUA 3K4AA 3LKQA 5DC0A 1G9MC 5DJYA 1WZ1L 2XPGB 3BGMA 3MBXH 2IBZX 4MA3A 3GMNB 4DZBB 2DKMA 4MD0B 3GI8H 5M95B 4MJ6A 3U4AA 1EDTA 1XGRB 5JMOC 5JOFA 2XWTB 3EHBD 5I15L 3ALXA 3MRDA 2NPLX 4LEOA 5DSCA 2FYYB 3VGFA 1KEMH 4JN1H 1CZ8L 2ENYA 5MI0B 4HDIA 5EN2A 3FT2B 4LCIH 2VAJA 3FO2A 5EOQH 5JQ6L 3UP1A 4NC1E 3C6LD 4LCCB 4DXRA 4R97B 1PIFA 3MACH 1NL0L 3WHXA 3IGAB 2R9HD 3EYQD 3RKPA 2G3IA 2OSLB 5JR1H 4D0DA 4A6YA 1BBDL 1GL4B 1M7DB 1QSFD 2MWCA 2ZZUT 2H2SD 3RGVD 4RL3A 2YPVL 2DT3A 4CDHA 1MRDH 1CFTB 1CQYA 2X4PA 4G8EA 2HRPL 4Y5YA 4MAYC 1ZS2A 1MFEL 5MHSD 3JV6A 1A7BA 1VBRA 3X3GL 1RZFH 1YHTA 1YEJH 5C0AE 1CQKA 3WO4B 3DO7A 1T6WA 1YEGL 4L4TA 5H35A 3D2UD 5LG1A 3AU1A 5E94B 4YX2L 1JYNA 1W9WA 3OKNB 2VO5A 4MXWL 4FFZH 4LEXH 5K9KB 1I8IA 2EYTA 1FL6B 2VE6B 1G0YR 2N7BA 2XRAL 5TH2B 2W65A 4A3HA 5FCUL 5JHDB 3AQUA 3T3ME 1ZLWK 2GUOB 2WV3A 2XFXA 1T7ZA 3MRMB 3VGBA 3ILQC 3LH2L 4Z7VF 3VD5A 3D39B 3AJ7A 4XNZB 5HYSB 2EXYD 4BH7A 5C09A 5GNZA 1NWUA 1YEIL 1HKFA 2EIDA 3RL2A 3RIKA 5ADPL 1JP5A 3O11A 5HVFB 4G9FA 3VILA 2UZYB 4NQEA 4A41A 3U7YH 3TBVB 4NO2A 3QDJD 3VFSA 2EPLX 5LWYH 1XF3B 2GSGB 4JFFE 1UM4H 1QO3B 2OWCA 2VXTH 3B9DA 1J0IA 1FC2D 5JHDE 1ZGLM 1MRCL 1QFWI 4FQCL 3V4VH 2BGOA 4HG4J 3CLFL 7FABH 4HC1L 3CUPA 5D70H 5FYKU 1A22B 1MIEL 1WIPA 1W3JA 2ZUXA 3U36A 4NN7C 2BX5A 4NSKB 5JXAL 3C2AH 2CIPA 2J2ZA 1HKKA 3LPWA 5HDLA 2YL6A 1MCBA 1RJZA 1V02A 2EDFA 1KUMA 5GGVL 4WW2F 2OTWB 3OIHA 3JWOC 3TIEB 3V6BR 1AQKH 5IVOA 4AEIL 4WI4A 1OT5A 4ZSOE 1KT2A 5B4NA 3OMZA 4DEPB 4EQ2A 5CD5C 3AIEA 3LMJH 2JIXB 1G7MB 1CGTA 2UZXB 1HQRA 2E3ZA 5MEPB 1WC7A 2DDXA 1FP9A 1EVUA 4GMTH 4G3YH 3B3IA 5ESVB 1CICC 3LEKA 2A83A 3OHXA 3PZQA 2YS4A 1WFTA 4AIZB 1VCAA 2IANB 1QSFB 3LAFA 2KKQA 1A6ZA 1KCSH 1IGIL 5DMGC 1TZ7A 3DTXB 4IDLA 3VFMA 4JG0L 2AOSA 5JDSA 3RWJA 3HAEA 3HR6A 1CXKA 3OGVA 1MQQA 1UC6A 5IVNA 1T21A 2H9GA 4YAQB 4Y16D 4KTEL 2AGJL 5HHXH 4ZSOB 3BZ4A 4HUMB 5EU3B 5I1EL 3H9SB 4Y2DC 5GS1C 4S1SH 5L2KB 5DQDL 5CJQH 4Z7UB 3E8UL 2R1YA 2YKLH 4YFDB 1PKQB 4ALAL 1BMGA 2AABH 2QSQA 1OP5K 35C8H 1HT6A 2ZE0A 4AZCB 1LO2H 1XGUB 4Y8AA 2V5TA 3RA7L 4AM0B 3RX5A 3AHVA 1FSKC 4P5KB 2VLJB 5HVGB 1MHEA 2XM1A 4N1HB 2NY0D 1S9YA 2EH7L 5E95B 2D0HA 2AJUL 4FQQA 3OGRA 2VZUA 1XFPA 2P5EB 4XUPA 5KANG 3RX7A 2F53E 3OX8B 1RZJL 4Y19B 2W9EL 4MJIE 4RGNC 3VGGA 4LARH 3TJEH 2VOTA 3X13A 5FO7B 4Y5XB 1GIGH 4YHML 1U91B 4XMPH 2PF6A 1PMJX 1G94A 3AVEA 1ZA3A 5SWSE 1FNSH 3VG9B 2NY5H 3MR9B 4OFKA 4APQA 2EDOA 5DD0H 1GZQA 4MGXA 3L9RA 4WNQA 4RFNC 1H11A 3CX5J 1GORA 2E0PA 4QY8B 2OS7A 2OXGA 1T0MB 5E5UB 4TRPL 1NGPL 5KZ6A 4P57A 1DP0A 1DQQA 2ZG2A 3L4XA 2VZTA 5GGUA 4Q58C 2WWKO 1OD9A 4XC3L 4Y4HB 4FMFA 2JB5H 2DD8L 2W38A 2OJEB 1F2XK 2LS6A 1P6AB 3V0VB 5F70A 4XZUB 1FPTH 2Q6WA 5I9QC 4WW1A 4DEVA 2CKBA 1JFXA 2HKFH 3MNWA 3AMGA 4MAUH 3HPNA 1N59A 3ARBC 4JDVA 4XNUH 1IKFL 2QF8A 1CT8B 3H3BC 3BQUB 1YECL 5C2BL 3O2DA 4OF6A 3L4WA 1S7RA 1KXHA 3CU7A 4IS6B 1H3VA 3FFCA 4JDTL 3LN5B 1A6UH 3UC0H 2FSEB 5DTFA 4WUUA 4DWSD 4L9DA 1MJJA 5ERWA 3GSVA 5EUOE 1RYYA 5JUVA 1JGUH 3RUGA 1AKJD 3G6JF 2PR4L 3NGBB 1HIML 4KJYA 1OT2A 1CLCA 4LYRA 4FFVC 1JDAA 1MHCB 1ISZA 4MXQC 3GMRA 2W9LA 5FA3B 2GDVA 4L3ED 4HS3A 2XPKA 1D5XB 4JO3L 4H25B 4ALAH 1QLFA 4L9LA 4W7UA 3E6FA 2FH6A 3D39A 4NCC1 2W62A 3GIZH 4JFED 3EMQA 4JFZL 3VFNA 4DJMA 2ZUQB 1XH0A 3WNLA 3MLRL 4HIIB 5F7KC 4P23A 4N0CD 1AI1H 2Y6KA 1KLFA 5D7IF 2FATL 1CD0A 2A6DA 3QIUC 1YPZB 3WH7A 1U8KA 3EYUH 5EU4A 2Y36L 4IHOA 2UY4A 1RIUL 4K8RC 5C0AA 3PZMA 4OM0H 3II1A 1IC5L 3BN3B 5TF1L 3HPLA 3A67H 4UNUA 2V9TA 3NIFF 1PPIA 5DZNA 3T0EE 3MRHA 3NPSC 4XWGH 5HI4C 5J6HA 5D7IE 2B2XL 2PW2A 4QNPF 1FDLH 4PGBB 3L3IB 3OEBA 1BOGB 3BHBA 3VMOA 1I3GL 1CLOH 4LLMA 1AQDA 5C7XL 4KUCF 3MRQB 4JM2B 5KOVC 4LLYA 4PRPD 2D7TH 4OGZA 5E0CA 5I1AB 2EPKX 3MUZ1 4JFQA 1R24B 4PEEA 4NQTA 2ADJA 5EN2B 4I0PD 1GQPA 3I6LE 3AMLA 5E4EB 1MHEB 4MA8L 2DLIA 5D1XD 2FEDC 4G9DA 1JPGB 1SYVB 4LVOC 1I7UA 3OGCB 1YEKL 3BKJH 5T1MA 3PBGA 1YEDA 1J1PH 4I48A 3BAYA 3U1SL 1Z9OA 4BXSV 2DM3A 2OX5A 4ZZ5A 1IQWL 3L3KA 2DQEH 2CD0A 4YAQA 1MVUB 4NZRH 5DVNA 5DJCB 4NKDA 2Q86B 3A22A 4WWKA 4C83B 3HPJB 3P2TA 2HAZA 4PGEB 2PR4H 1CZSA 2MCPH 3QHFL 4R4NC 4X4YB 1BGXH 5JIHA 1BVKB 1WV7T 2NY2B 4PJEA 1IEAB 1C7TA 1YNTA 4E5XB 1W3HA 5DZLA 2MHAA 1RJYA 3NIYA 4KJWD 5DJ2B 5CKAA 4ZUVA 1CZTA 2ED8A 3GMOA 1J8KA 3MLZL 4AZ5A 2DM4A 3IFLL 2VDML 4XNQB 5ICXA 1XRVA 4N5ED 1OOAA 1UXXX 3A6CH 2JCCF 2I24N 4MJ5B 1BTCA 2QBXA 1ZLSL 3ZLQC 3WQWA 4Z0BH 1V6YA 1FZJB 4OD1H 2VMCA 5ITBH 4YNYB 1G9NC 1JWUB 5JLZA 1TE1A 4JZOB 4Y1AB 2Y7QB 4C56E 1ZOXA 4QF1B 1R5VA 4JFFD 2LAGB 4YC2C 4Y8DC 1B3YA 4P0DA 2R2BB 3QDMA 5CGYC 5F71A 1RMFH 1FA2A 2GK1B 5D8JH 5C9JB 4J3XA 4EUPG 5EUOA 1JNEA 5CAYB 3S34L 4CCEA 2XG4A 2JB6A 4AH2B 4P08A 4H1LB 1T5WA 4OUUB 5CBEB 2IG2L 4L3EB 3OXSB 1N0LA 2UUDK 2BVOB 1R7OA 3BZFB 4K2UL 4LVEA 3UZVB 1DL7H 1FO0B 2WHKA 1RIHH 3L6FB 1G1YA 3P11L 1UKOA 3IS0X 5FYLH 3GTNA 4Z18A 3ZKQD 2NY3C 2A3BA 4U6HA 1IGTB 4JRWA 4FFWD 5EOTA 3GSNH 4G6ML 2BHZA 1MIEH 2JB6B 3KYMB 3TLRA 1EO5A 3ARZA 3BDYH 2VZ3A 2BP3A 3HNYM 3VNYA 3ZE0E 5HPMA 4M61A 4WW2C 4M5ZH 1OPGH 4KQ3L 2KH2B 2F2HA 2X8RA 5D7JC 4O2EA 3SJVB 3T0XA 1LDPH 3FTGA 1A9EB 1CK0H 5CHNB 3ZDYF 3GH4A 4Y4HD 2ICEB 1DDHA 4YXKL 2G75A 1D5IH 4AD0A 5I1IL 4KV5E 1RJCA 4LLDB 3GSVB 2VXSH 3CXDH 3TO4A 4PP2B 5JOPE 5DEFB 4FZ8H 3C7OA 3HNTL 1JNHA 1N64H 3WMBA 2G5RA 4K94C 1DQLH 2FHCA 2OBGA 4QGYA 4WFGE 5L8KB 1ZVSA 1DBKH 4FHBD 2BVUA 4XP6L 1Q0YH 4ZFZA 1FP5A 2SEBB 1I3UA 1XGQA 4IISA 3CLEH 3HPJA 5CEZH 3IFLH 1IEBA 2YL9A 5C9KA 4TUFA 5CGTA 4Q9RH 1SY6A 1IGCH 2R1WA 2NR6C 4MX7B 3WNOA 1ZT4B 4FQPA 3MLUL 3TOPA 3VIMA 2VDNL 4D6FA 3WD5L 4L4OA 5ISZA 3FT4B 3JWDC 3LSOB 5E6IC 1ULPA 3CTTA 4JM2C 5GPRA 4L4VB 1ZS8B 2P5ED 2ED9A 4LRIA 1E6JL 1K8IA 1KN2H 4X6BB 4K23H 2VRQA 5EUOF 2WMKA 3BAKA 2BV9A 1K45A 1HQRB 3VDBA 3PXJA 1B6UA 1ZHKA 3VIIA 5C0IA 5A3ID 5EU6D 2P5EE 5I8OL 3L2MA 3P6BA 4EXPX 2OK0L 4AEFA 4H41A 2APXA 4LSTH 1D5ZB 4ODSL 1W0YT 4BSVA 4TUJA 5KVMC 3BUYB 4QRPE 2QPUA 3L5HA 4B5EA 3O4LA 4P5YA 2XTLA 4P5TC 3OXSA 4PLJC 3KNBA 4J3TA 1QR1A 1KEGL 4PB0H 3IETA 4DUWA 4YXHL 1FNFA 3SOBL 4LFHG 3ME0A 3TJEL 1BVZA 3EFFA 4KC3B 5BVJB 3CKHA 4ZO9A 4XP5H 2XFFA 5E9AA 1JI6A 5F1NA 1L7RA 1OSZA 3HUJA 3OGOE 5C6PB 2X89A 1QBLL 4EI5C 1F4YH 2EICA 1Q38A 5D1QA 3JZ7A 2J78A 1HN1A 4P48A 3T0WA 5FO8A 1YQVL 4XPFL 3MROB 3HE6D 8FABA 3OB8A 3ULSB 4JM4L 3S6TA 5C09B 2K1MA 1JMXA 5FKPA 1CECA 1XIWD 2EIEA 1QSFE 1MCOL 4PJ5E 4HIEB 4OSUL 1MF2H 3CFJA 3G08A 4OZHA 3AC0A 2WB5A 2CPCA 4YFEA 4P4KA 1S9WA 2B4CC 4X5LA 3MBWA 3TM6A 3WN5C 1XIWB 4L9LC 1JNLL 4TSBL 1H3WM 4UV7H 2P5WE 4R7DB 1WWBX 1R5IB 5K9KA 5A2BA 4MNGA 1RJYB 1Q8MA 5D1XB 4UZGA 5JBEA 4B3KA 4JFDD 3B2UD 4EN3C 3V5HB 2P8LB 4OLVL 4QXGL 4TQEH 4Y19E 1GRWA 1EJ6A 2GW5A 4TVSa 4NN5B 3SCVA 5IFAL 4XI5D 5DMJB 5AZEL 1XT5A 3SDAA 5KVDL 3T77A 3SIMA 1NLBL 1KB5B 1UCBL 4UAOB 2VLJE 4OZIE 3ROOB 1ISYA 3OF6A 1K4DB 5FFLA 1JGUL 4P2OB 3QR3A 4PGJA 2QQQA 3V9FA 1LL6A 1EHLL 3AXHA 4QTIL 2HWZL 4WUUB 3DROB 2I9TB 1OINA 4TVUA 4UFIA 3P4NA 4LCYA 5JUEL 1JPSL 3Q6GH 3HI1B 4NRXA 5E9DE 1SY6H 5IVXF 3GJEA 4WEBL 4JAMB 3V6FA 5ALCH 3VJ6B 4HP5A 3O6LH 2MQ3A 3LS4L 4NWTH 1CICA 4XTRD 4JR9H 1E0WA 3AHZA 4GAJH 3KPLA 1E43A 4HZ8A 3QNZB 1P69B 2W1WA 3NN8B 2EEDA 4GQ9H 2V9QA 4TNWK 3MRCA 2OTWA 1RD6A 2X1IA 1X5GA 1F4WH 2DQTH 5EH1A 3R8QA 4AK1A 3VIFA 4KI5D 2XN9E 2ZNXA 3WLBA 4OFDA 1EJOL 3OZPA 4RMTA 4JFHE 3N15A 4FQ1H 1ED3B 3MV8D 4PGBA 3KPRD 1P84K 5I8EB 4WJXA 3LEYH 1MCIA 5ITFA 5DJ6B 2BGPA 4XPHH 3CZFA 3SE9H 3QEHA 5CLWA 4Y16C 4MSWB 2YPLD 4X9HA 3IRPX 4P2RD 3GO1L 4AC1X 2F53A 5H8DA 1T5XA 1EXPA 3R0MA 1UXZA 4U1HA 2G2RB 1Z9LA 3MV11 2FX7H 3QIUB 2WO1A 3QYCA 5B3NA 4L8SA 3OAUH 4UZUA 3V95A 5IFTA 3ARDB 3IB4A 1KC5L 2DQFB 1ACYL 4BSJA 3W27A 4OIIL 5F7DB 1GPOL 1HZHH 3REWA 4ONHA 3T3PE 1QPKA 4MDPA 4W8LA 4NHCH 3ULUL 1MCKA 4M1GL 1AO7E 3FHAA 1NAMB 2PETA 1F00I 1GGIL 1EZVX 2YUZA 2WBJD 3WDHA 1GC1C 1YMHB 3ALGA 3QEGL 5J1AA 2MSPA 3NTCL 1ZA6B 4NN7B 1G7PA 4LLUB 4PJDB 1K6QL 3BKCL 1ZWIB 5K9OB 3I9GH 4OLYH 3KPSD 5GGSY 2ZCLH 4MCZB 2ZOXA 2WLYA 4ZE4A 3BIKB 1XYZA 1S9VB 4YHKL 4TVCA 3U7WH 5BMFH 4ZOBA 1FV1A 1YUHB 3OKLB 4AM0A 1FG9C 1SEBB 3DX9B 2AKRA 5DD5H 4MNQA 3SKJE 3KYOA 2Y4SA 3KJ4B 5TFSH 3PV6B 5F1NB 1LILA 1PW3A 1W9UA 2VM9A 3GZAA 2FEEI 4P3CH 3MA7A 5GRWA 5L2KA 3P40A 2DQDL 4YC2B 2WC7A 4AZHA 1K4DA 1VFUA 2ICWJ 3QOKA 4NZJA 2CGRH 5LGJA 5HHOB 1TTFA 5I1HL 2BY0A 3SDYH 2DIAA 4CD6A 3QPQD 3O4LB 1I8KB 4PUDA 4X0NA 1K4CB 4PBGA 4JKPL 2J4GA 1SY6L 4U2YA 4WV1A 4YXLH 4EE9A 3LS4H 4HWZB 3LKOA 1ZTXH 1H49A 4X5XA 4XAKE 4P9HH 4WLCA 1HSAA 4HBQA 2IWGA 3LD8C 1MLBB 3QDJE 3HC0B 1J9YA 4H8VA 2H8PA 3RBSA 5BXPA 1D9KC 1K8IB 3GDBA 1LEIB 1J05B 3U30C 2VISB 5JMRA 2X4SA 3T65A 3WKNA 1JXKA 1T1YB 3B5HA 1BWMA 2Z31C 1UA3A 1QG3A 3MS8A 1EA9C 5AAWA 3HNMA 5IDIA 3DOSA 3S88H 1KXTB 1MI5D 3HE7C 4BYHA 1CEOA 2OP4L 4UTBL 3U36B 1UHVA 4APQB 2WO3A 4HWZA 5JHLL 1WE5A 2XWJB 4GZEA 4OB5H 4Z5RB 4JFQB 3CK0L 4F9PC 4KY1L 5I18H 4WDIB 1XZ0A 1P9MA 2R8SL 5HTSA 5DHVH 2XG9A 4RDQG 3KWWA 5AUMB 4XNYH 4QLKA 3MJ8B 5IHSA 3W53A 4JZNA 1BEYH 2VSDA 5CILL 2X05A 1JZ6A 5KVGL 1VDGA 4AD5A 2GJRA 1UMHA 4QXTA 2NXYB 2NY1C 5FOBB 1RULH 3WO4C 3JVGC 3NSXA 2CQVA 4XXDB 3TGXA 5I2UA 1W3LA 5D8WA 3D3VD 5ICZB 5KSAA 3H0TA 4TOYH 2EDQA 3VCLB 1NC2D 3KS0H 3VXME 5F9AC 3O11B 5TF0A 4LKSA 4CUBA 1KB3A 4AQ1B 5EO1B 3WDRA 1DVFB 5C3LD 3MCG1 2QJDA 1NLDH 3TH2T 4NUJB 4ISVA 1OGAD 1XGYL 1KJ2A 3ARXA 5BJTB 1GCFA 1IGYA 3DETD 3KEHA 5HHMB 4RMSA 3PWLA 2CIKA 2BCKB 1EAPA 1LO0H 1IKNC 2C3WA 2AI0H 4Y5YB 1GQIA 3QEQA 3VIOA 1GOOA 4D72A 4MB3A 4XVJH 4KMLB 1FO0A 1QSFA 1X6NA 3APGA 3RGVA 4R3SA 4U5KA 5GS0L 4D3CH 1QBML 5I1KH 1P4BH 4MZ2A 2IGFL 3CDGB 4L1DA 3RVVC 3RU8L 1HX0A 1D6VH 1PSKH 2AJYH 5C0FB 2X70B 1ZGLP 2IAMC 4BDVB 3KWXA 2BNRB 5JNYB 1QNRA 2ZEWA 1MHPL 3WF0A 1FH7A 1MJJB 2C1OA 1NCDL 2YD1A 3L95B 4PUBL 3RAJL 3O3UN 4HJ0D 1U95A 3CX5K 1AGCA 5EBAA 2OYMA 1J0HA 5CEZL 5J13B 1JTTA 5DK3A 1MAML 1OAQH 4DGYL 3OKKA 3PZOA 2X09A 2Y64A 4MJ6B 2NY6D 4AY1A 4M6OH 1IGML 1CTOA 4AL8H 2A9ML 3CFBA 3ULUD 4HZ7A 3V7AE 4RISL 5BOZG 1GAFL 4JE4B 3C5JB 5E8EA 2X9XA 3LD8B 5FHAH 1XAUA 2F9BT 2GJ6D 2KQMA 4RMVA 4ZYKB 4NQDE 5T3ZD 2WVTA 1NX9A 5C09D 5JXHA 4BJLA 4J1UA 3OKYA 3E1F1 4M7JL 4U7MA 3V52H 3JBG7 3I3BA 4NNPH 2NX5B 2VYRE 3C2SA 3H7LA 3J8F7 1AY1L 3QDJA 3MODL 6A3HA 5BO1H 2ZX6A 3FFDB 4U0RB 2IXUA 5DPNA 5D6CA 3ROLA 1NGQH 2HG5A 2W61A 1RULL 3QQ9D 4NBYB 1GOKA 1TVPA 3L6FA 3VFRB 2QSVA 3N17A 4GRWE 1CBVL 3SDAC 1LHZA 4BQBA 5JR1L 3QDGD 1A6VH 5EU5B 3D85B 4OD2B 2VC9A 1U8NA 5EZJB 4FQXC 1FN4B 2YRLA 1GGTA 3T2NL 4PT6A 2GTWB 1EUUA 4GKZB 3ZTJH 1QI0A 2R39A 2ZX5A 4WI5A 1RUKL 4HPYH 3GBML 2HN7A 4PB9H 4FQQB 4XPFH 4XBEH 2OSXA 4WCYL 1GXEA 5E1AA 5B21A 3L3HA 4QDQA 4OZIF 2XIIA 2CRZA 2CLRB 4FP8H 4NOBA 4XP9L 2VXQL 3RKDD 5K9QI 5CYYA 3X12B 3BIKA 1WWCA 4HX1A 4GH7B 1I1AC 4YR6B 2OLDA 3MLTA 1CFTA 4KKAC 2R23A 3H42L 3IAGC 5DR5H 3L3GA 4LF3B 1N6QL 4TTDD 1EMTL 1PLGL 4HBCH 1Z6JT 1G7HB 4QHLB 4F7TA 4XZUG 2CDPA 4RE4A 1T21B 1NAML 4KAQL 4CN6A 4OGXH 3KHOA 1QYGL 1NMCB 3WUWB 2WAOA 1QFUH 2EE9A 3VRLE 5HHVH 4DN4H 3L5JA 2HT4D 2A3CA 1NCBL 4LPYA 3TA9A 4DCQA 5T5FH 4OLXH 1NBQA 2V4VA 4JRYE 4X8XA 1H2JA 1JXJA 1IAIL 4IHOB 1IGJA 1UM4L 1S9KC 4WJ5A 4W6YB 3M8OH 4NRZA 1RURL 4M3JA 3GM0A 3WLWC 5ILTH 4KTEH 1G6RL 1FG2B 2D9CA 1HL8A 4N1CA 4I3RL 4QRSA 4OLWH 2AEQH 2V3EA 3V7AG 1EEUA 3LQCA 1JGLH 1PAMA 2RVAA 3CVHL 4M02A 4C55A 3ZIZA 5ECUA 5E00B 4WV1B 4JX0A 3AHYA 4E8CA 1INQA 3GBNH 3M1BA 4BJ0A 1RZ8A 4G7YH 4ZDHA 4CJ1A 1ECEA 1V6WA 1RV6X 3QWOA 1WDQA 1UY4A 1YEEH 3AS1A 4YHYC 4Y16B 2X2YA 3W6MA 5B4XA 1CICB 3BPLC 4PTUA 1CD8A 4M1CD 2EEXA 1GUVA 2CKBL 4IRJB 4GZJA 3B8SA 4P59H 3RM8A 1SYSA 2OSWA 1RZJH 4X98B 3WD2A 3ARDD 1WBZA 2PWHA 3U5YA 5ABEA 2JELL 1T83C 2HVJB 1DWIM 3V5DA 1HHGA 3DROA 2I9TA 1JDCA 3NCMA 1DQML 2O5YL 2PW2B 3SGJA 4NZTL 1LWJA 4ELKB 4V2XA 3E3QC 2DLHA 3K4DA 3QI9C 5C0DA 5J1SC 1S8DA 3PP4L 2YPLB 3LEIA 3L4TA 4FA8A 1W9VA 3ULVL 5IT2H 4IRSC 3QH3B 4HX1B 4B41A 3TBTB 2W0LA 3QIWA 5LA2A 3K74B 1SEBA 2ZNWA 2Y6HA 2I25N 4G6JH 4U0QB 1DBBH 1RZ7L 1EEYB 1XF4A 2E9IA 4Z2IA 2XZQL 4XC1H 1F3DH 4G8FA 5TQ0H 2ORZA 5KBNC 4WIWA 4ZPVB 4LSPH 4JO1L 4XRCB 3F58L 1EMTH 5DK2A 3HC4H 2FGZA 5AYUL 4P57B 2J5LC 5BJTA 4WUUD 1W72B 4DWSA 4XPGH 4WW2B 1A21A 1VAHA 4Q9BA 2DSWA 3U2SA 4JQXC 2XGBA 5D7KD 1C5DA 3T4AB 1DQDH 1OTSC 4RWYH 1J10A 2VC2L 4UT6L 4PUEA 1BAFL 3HUJF 1H3XA 4UV4L 5A2JH 3ARFD 2BVPB 4IDJL 4QRTB 3UR7A 5AZ2H 1FFPA 3PHOA 2ZOKB 3MV9A 1SEQL 4JANB 3GKZA 1E6PA 3HE6C 2Y5TA 2W3JA 4UOQA 1J87A 3MO1B 2O61B 2ESVA 4LOUD 1WITA 3QG7H 1RP8A 4YK4C 4RMUA 3MLWL 4ETYA 2WNWA 2CGRL 1DBJL 3D39D 3W39A 2GK1A 3WQ5A 2GVYA 4OZHF 4OGYL 2DDQL 5I8EA 5SWSD 5I23A 3CAFA 1HL9A 2Q8BH 5DWUL 5J4MA 3CMOL 4HAFA 4RRPA 4P23D 2GHWB 4UQ3A 3MRDB 4XCFH 3ETBF 2Z92A 3R0NA 2W94A 2OL3L 4Y2OA 3N50A 3NN8A 4S1DC 4X6EB 5EC2B 3WXWH 3BZEB 3F7VA 5KVFL 2GJXA 4QAWA 1KCRL 1BWWA 3SDXA 1C92A 1UR1A 4F2MB 2A6JA 2YDSA 3PHQB 4PMNA 1UYXA 5HDQH 3T2QA 3DUSA 5I6SA 4AZBA 2GITB 3RWIB 1S9XB 5C0FA 2DLFH 3LS5L 1MCLA 1YECH 3MRPA 3C9NB 5JORB 3TVMC 3MREB 1LE9A 4EXKA 4PRPB 2Y07L 1UWXK 3MBEB 4UOW1 3V6ZB 5DJDA 4K3DH 5A6KA 4NNXB 4PJIE 1HJSA 2R4SH 3U4EA 5HPOA 2ED7A 2XZAH 3ARGC 1A2YA 2R1WB 4MX7A 1FVCB 2J6EH 2NTSP 3F12B 1A02N 4FRWA 3MTRA 3HMWL 1ZA3B 3L4YA 4AXNA 1FFOB 4PJ9B 1UGNA 1X44A 4HJJL 2X1PA 2XIBA 3RWHA 5D9NA 5IFHL 3WD3A 1VGEL 2D03L 3P30L 3BP4B 3LHPH 4Z78A 2DT1A 3VI4E 1HI6B 4UIKH 4I0PA 1TPXB 3T0DA 1H5VA 5TDNA 4OKVB 3GHEL 4X4XA 2DTML 4WWID 2E31A 3PGCA 3TO4B 4OCSL 5D1XA 3B2VH 1PD6A 4KRPC 3VXRD 4RMWA 2QQKL 3FOMA 4ZO7A 2X4TA 2AEIT 2B31A 2WVVA 5F88B 5IHBA 1MAJA 4OBRA 4ZNEE 5FUCE 3EYSL 2UYLB 4B7IA 4D94A 4UT9H 2A9NL 5ICZA 5KSAB 1KB5H 2RQ8A 3DSNA 2F19L 3LE0A 3CFDB 4OAWB 5FKPB 3DX6B 3MQIA 1V02E 4IRZL 4HXBL 1L7QA 2DQGH 4OQTA 1INDH 4R90H 4V1DB 5HDRA 4GT7A 1FH5H 2G9HA 1CL7H 1QO3A 4Y4KC 3HHRB 1BG9A 4ZSOA 4WSJA 1BLNB 5IHUH 1X7QA 1DEEB 1EK3A 3UAJD 2V17H 2A1WL 2EXYC 3NJVA 3QJHB 3VXMA 4UFKA 1XPWA 1KTDA 2WINA 1Z5LB 5LA0A 3BAIA 3HS0A 2BRRL 2D7OA 3BCDA 1KXVA 1D3CA 2ZCHH 1SJEB 2CK0L 4OTXL 4DUXA 2OYPA 5GHWH 4Q9QH 4XVTH 4XV0A 1VFMA 4R4FL 43C9A 3PQYE 3FXYA 5T3XL 3MRMA 5FUZL 3K75B 2CNCA 3QO1B 1OP5H 3K2UH 1GU3A 3U9UB 25C8L 2E6QA 2DIEA 2PI6A 2JCCA 3UO1L 5FB8B 2EDTA 3HC3L 5E03A 1IQDC 4WO4C 2J79A 1JUFA 4UMGA 1FAKT 1D2KA 4NSBA 1OP9A 1UD3A 3MCLH 3TWCL 4JY4B 3QDMD 1ZEAH 1RHFA 3I6LD 1D5MA 2QADC 3ZKSD 3VM7A 3BLPX 4DVRH 3FO0L 4JAMA 3VDAA 1U6AH 4NCC2 3MJ7A 1F6AB 4K7PY 4KFZC 2ZUSA 3OKKB 3VFUB 3KL5A 5G05L 4CMMA 5DRNB 4X4ZA 1PX3A 2JJWA 4NOFA 4DOHE 2ZOLA 8CGTA 1OM3L 4PRIE 1XC6A 2D1ZA 5JA9A 3I02A 3MYZA 3S35L 4JFXB 1T6VN 3L3DA 1KJ2H 4J4PC 4KUZL 3HNSL 4P2RB 4Y4FC 5IR1B 1JFHA 3ZHLA 1I1XA 4AMKL 3AZRA 1MFCH 5JIIA 2W1NA 5CZVH 1EV2E 1B90A 5GGSB 1IC1A 5F96H 5E99L 1BGXL 1HILA 3O9WB 4LPTA 1HYRC 5F1SA 2YBRB 2BJMH 4JFEE 1GONA 4HUXA 4AJ0A 1UWGH 2W9DL 4YEFA 3DLQR 5DRNA 3QGVA 5CKGA 4YIQB 2QLVB 1EERB 1E55A 2R0WL 4OCMC 3O0RH 4ZS6C 3I2KA 1OF2B 5DUPH 1LP9E 4NCDA 4PRHD 2B0SH 4FFYH 3QWRA 1KJMB 4ISVB 1OB1A 4ODWB 1ODAA 3NCOA 1CF8H 2VX4A 3FQWB 4NO3A 4M8UA 4Y4HA 2MOVA 2WSPA 3TEUA 1AGDB 2B1HL 1HCFX 1YYML 2EH8H 3NZHL 1L7TH 2Q3ZA 8FABB 4JRYD 1H4PA 1JRHL 3FRPG 3TO4D 2A74B 3HAEG 3QPXH 5JPNA 4JO4H 5CQ1A 4Q7NA 3N85H 3JV6B 5DRZB 5DD3L 5C1MB 2BRRH 1MLCB 4QRUB 1JN6A 3TN0A 4D8PB 1JGDA 5J56B 3OG2A 2X1XR 1IAOB 1E71M 2VQTA 5MEOB 1U8MA 1K8DB 4N5UA 1G7HA 2G9HB 1I1RA 2NY2D 1MAKA 3IT8D 1J1OH 3GMQB 1X4XA 4HWBA 5E8PA 5C2UB 3KAAA 3WHXB 2V72A 2GFBA 3HC3H 2P5EA 1CWVA 3WIHL 4EVNA 3EOYG 2VDQL 3BQUC 3W29A 5K33A 4MJ5A 3HKFA 3SY0A 3H7BA 4CMHB 3DETC 3GKWH 5C0GA 3SEPA 4I0PB 3OAZH 4NJAL 2NW2A 2ID5A 3VMNA 4H8UA 2LU3A 1E6XM 2BNJA 3P77B 4HCRH 1F3JA 3MJ9H 5GZNC 3VWJD 2P7TA 4L3AA 3D6GA 2IAMA 5MI0C 1E70M 1OB1B 3PG2A 1UD6A 1CENA 1XMWA 5TJWK 2VJXA 2YFUA 4FTVA 4GAGL 4Y5YC 1LE5B 1C3FA 4UOZA 1TNNA 4PREA 3QIWB 3VXOB 3WJLC 4W68A 1XCTB 3QH3A 5GGTL 4Q2ZA 2PXYC 3F12A 4HJ0C 5IMOA 1Q6FA 1HP4A 2X89D 5SWZA 3GUTA 3HNTH 4HUXB 3B8YA 3NCJH 4LPVA 3S3PA 4W88A 3SCMD 5IGXH 5KSBA 3RRQA 1WO2A 4MMZC 3HG1E 3OXRA 3MGOB 3HE6A 3CVHA 4X7EC 2FZ3B 3QO0B 4M29A 1VACB 4WKAA 4GW5B 5ID0A 1XIWA 1WC7B 5BCAA 4EKJA 4W93A 1EEZB 5ERWB 3GXDA 4XX1G 4F2MA 5FK9B 4PP2A 2EDKA 4LSVL 3VFTA 4PJXE 4HKBB 2JK5A 3DX8A 4Z7UF 3X3GH 5C07B 1A47A 3OGCA 4GKNA 4ZDHB 3VFUA 4I77H 3WN5A 1U58B 4W50A 1VJZA 2WANA 4OFYA 5ENWA 4KI5F 1MCOH 4WU5B 2A6IA 3I2HA 4TULH 1CIYA 2IH3A 1P4LA 5HI5D 4Z7WB 2P43B 3MO1A 1E4MM 2XWDA 1RZGB 1VFBA 4DKFH 1BYDA 4BUHA 3W39B 2GJZA 3O2VH 4MD4B 3ZKXC 3Q6FB 3ACGA 4XPGL 3SDAD 2YUWA 3AREB 1MY7A 1R87A 1VERA 3U9UA 1FVEB 5HOSA 4Z7WF 1ZHLB 2GK0B 1JAKA 4BK5A 4G6FD 7TAAA 5EWIL 4C54A 3N1FC 3MNZA 5FV2A 1V3IA 2D7MA 5C0RH 4RGNB 3OL2A 4LKXB 4TVPL 4JLRA 2YC1B 3SKMA 3KPQA 5D9SB 5DLMH 4QDSA 1I7ZA 2R15A 1B0RB 3NAAH 1SR0A 3FY1A 4CGTA 4V27A 2G60L 4UFHA 2XV6B 1CICD 2EDXA 3EYVB 3JWDH 3TPUB 1LJYA 4BELD 4NM8L 4P5MA 4QHMA 3ZJ6A 3S35X 1RUPH 3WLBB 1AHWC 1CGYA 1E4KC 3VI4F 5AEAA 3BEWB 4S11A 1R6VA 4KK8C 3PGFH 4EDXA 3GJFK 3VGAB 2R2BA 3QDMB 3WO3B 1WEJH 4HS3B 3MV8A 4Z0XB 1W2VA 2AJZA 1U8HA 3QXTA 4HMCA 4Q0XH 3TBTA 2E7HA 2B4CL 1XD1A 3EO1B 3B9AA 3MUGB 4UIMB 2X4PB 4G8EB 4JQIH 2J62A 1GHFL 1K9TA 1BX2B 2FDBP 3UJTH 4P2RA 5IR1A 4NKQB 3VWKA 2FECI 3LEXA 5A6SA 4G6FB 4FQ2L 4LYPA 3V5DB 2PTTB 4ETQB 1Q1JL 3I2FA 2H9GB 1Q72H 1ZLWH 5J12C 3VI3E 2P4AB 5I2IB 3B9KD 4L8SC 4M6ML 2G8ZA 3D0LA 1UD4A 3LDBC 2KBGA 2J88H 1HXYB 1RK1A 3MLYL 3TYGH 3W9DA 5F7YC 1ZSDB 3X11B 2ZXBA 4G6AC 1MVUA 1QSEE 3BWUC 1J5OL 4O2EB 2X40A 4YHNA 5JPMA 4NBZB 1WF5A 5GRJL 5IMOB 4HWBH 4DVBB 3RTQA 5AYQA 2A83B 3OHXB 4MQ7B 3RI5K 1UQYA 1KFAL 1NCAH 2BSSA 3Q1SH 4UDTA 2EDDA 4R8WH 4PGEA 5T3ZH 3O8XC 1T66D 3KPSA 3CX2A 5CCKL 2XVPA 3OAZK 2X44D 1UVQA 3QFDA 1S9WB 2W63A 2XKSA 2YKLL 1DZBA 5KSBE 5EOTB 3H9SD 4HF5L 4NYLA 1UACL 1GMMA 2OLHA 3CMGA 2C3XA 4W8JA 4MNQD 1A3RH 4Z77B 4PJIB 1W9TA 1PMHX 2QL1A 5D5MA 2O93L 5DHYB 1TJIH 1C90A 1MCHA 3VXRB 3OZ9H 1B31A 4PRPE 5KZCD 4MAYB 1NC4D 4MXVF 4DZ8A 3LKSB 3PP3H 4GKSB 2BDNH 4J3UA 5L2KD 1ONQA 4PLOB 1AQDB 2CJUH 2BNQB 4PJXA 5MP6L 1H3TA 4Y7EA 1Q6CA 5JXED 4Z9KB 4HWEL 4JHWH 2YR3A 1HH6B 5FIPA 2C1PB 5FYLL 1HKLL 4F9DA 1RUQH 1AE6L 3HPLB 3ORJA 3LY6A 4NQXA 2DB8A 4PMZA 1UWEL 3BAWA 4TOQA 2PYFA 2YPLE 1MCFA 5FYKD 4GZ9A 4DM2A 3UDWA 1DANT 3JWNC 5DZOA 1UKPA 1GGYA 2YPKA 4GKSA 3BRFA 5GHWL 43CAB 3DV4B 4GRMA 2JD9A 5DS8B 2ICCA 1K12A 4LVHB 1UYYA 3FOLB 3V4PH 4EJ1C 1X6LA 5A2KH 1P2CB 1N4XH 3CXHK 3L7FB 2DSKA 5JPNB 2Q87A 1INEL 3MXVL 3GB7A 2E6PA 4UDUB 1OGGA 4OD2A 2YC4A 1IC7H 3EOBB 2OWXA 4ZUVB 2FBJH 3IJ8A 5GS0D 4YHZL 5LCVH 1ZEAL 4L29B 3B43A 4ONOA 2YMXL 5D7JD 5EA0H 3JSSA 3VXSA 4FNLL 3W11C 4U1IA 2J1RA 3NA9L 2FGWL 2L7UA 3FFDA 3BDBA 2WO2A 3NIGE 2X5PA 2FJGB 4HAGA 4ZY9A 3S8WA 3AISA 4MSWA 4U6VL 1YY9D 4ESKA 5I2IA 4C7DA 2E8ZA 3AMKA 1J1XH 1DYOA 1KIRA 1NCCL 3V7MA 5HGHB 3V0AC 1NMAH 3ULVC 3D3VA 5D70L 4GUPA 1TITA 4ZE5A 2A6JB 1NC2A 2VDRH 4I18A 5F9JA 4NN6C 1FDLL 2XA3A 1W1TA 3WD5H 3LN5A 1NMBH 2ADFL 3NCYS 1W72H 3P77A 4S1DD 4LL9A 3ILPB 4GJTB 4OF3A 4HPHA 3AM8C 4WO4B 5IBUG 4RAVA 4XMKH 1VESA 4YX2H 3AGVA 1FZKB 3IDYC 4N0FB 1OGAA 1UZ4A 1D5MB 4ZO8A 3FFCE 3BGFB 4FFZL 3UTZB 1AGCB 3MLXL 4NN5C 2CDFA 3HI6H 3GNMH 4OQTH 4CW1B 1XCQB 4PIRF 4P5TB 4QHKJ 5FCUH 4LEOB 3ZKMD 3QQ3A 1VEOA 3C60C 5TE7L 3PABA 4QHUB 2CLVA 3BQUA 3CHFA 2XXCB 3QEQD 3MOBL 1X5AA 2O9RA 4O9HH 3ULVE 3HCVA 3IAPA 4GZIA 1FNHA 2BMKA 1YJDH 3LV3A 2CYGA 1OCQA 3DNKA 3L9RB 1XSIA 5B4MC 1ND0B 1HNYA 1A1NB 1QRKA 2ZUYA 1KB5A 1KPRB 1LK2A 2NXYD 4QRRB 3QJHA 1TR1A 1T04B 1CE1L 4FS0A 3ARGB 3WYRA 5IW1A 4N8PA 4WUKL 3A67L 5ANME 2P8LA 3ZR5A 5C6TL 5I74C 3TBSB 1C1EH 3U0PA 1OD7A 5DD6B 2DJUA 1ZHBA 5DO2C 5ADOH 2R0ZH 1TG7A 3GI9L 3F8UB 1WDPA 3DBXB 5IJRA 5BV7L 4R4ND 1BIIA 1J8HA 1MI5B 1RZGA 2EDBA 3DX9A 4A2LA 3VFOB 4HA3A 5JW4R 3C5ZA 5M3WA 2GJ6A 5GS1B 4RBPH 3ZHDA 2WW5A 3CDYA 5ELIA 4HLJA 4QXTB 3DV4A 1CTNA 1J88A 2JJSC 3EBVA 4D0BB 4U1NA 2Z91A 4HCRL 1OIMA 3MJ9L 4RFOL 3RPIA 4Z2LA 5D1QB 3H0TB 3BKYL 1AFVL 4HTYA 1U93B 4QRQB 1OQXA 1E6OH 1U8OA 1W9BM 1HI6A 3QO0A 3PTQA 4URIA 4D6JA 2Y23A 5CINL 4OCYH 3NFSL 2XACC 3QDGA 5EZOH 3V5KB 5HHOD 3QIUA 2VLLA 1KQZA 4MNMA 3LRSA 1S7WA 3AIVA 1HHHA 3BYYA 3BI9X 4H2CA 1HVQA 2BC4B 2YXMA 1ONQB 1ES0B 5IEHA 1KV3A 5JORA 1LE9B 5JOFB 2COQA 3FB8A 3ARRA 4M6NH 1DLHA 1H3PH 1MFAH 3SCNA 3P11H 5F1IA 2IQ9L 1U9KA 4B9ZA 3W38A 4UNTA 5HDBE 4IOSD 1A2YB 1WJ3A 5ACZB 2V7HB 5HGBA 4GAYA 2HJFB 4CD8A 3DUUB 4KMTL 4QT5A 3U9PL 1LDSA 1C16A 2L4OA 3CSPA 4HULB 5EO0A 2WP3O 2WVSA 4DN3L 3OKOA 5DMKA 3IXAA 3X3FH 3B6SB 2E33A 3AMDA 5I8CA 4XCNA 5E56A 5C0JB 2H8PB 5DF0A 3UBXG 4UTAL 1IGMH 2ZWLT 1ES0A 4PJAB 3CFKB 4Z7VE 2ITCB 5JPMB 4R0LA 4U1JB 4XPTL 5EU7E 1X5IA 1YYLL 3MUHL 2ZWYA 1HDMA 3T3MF 1XNTA 2DL9A 1E0OB 3OWEA 3TNMA 2IH1A 4N0RA 2CEQA 4XBPA 1J0JA 1CK0L 2NX5E 2VZOA 5GS2H 4LHSA 1NP0A 5CUSL 1RJLA 1R3LA 1ZBVA 3SE4C 5EBWA 4DAGH 1OAYH 5FL1A 5D8JL 4LBEA 4LSSH 3N04A 2NX5D 2FBOJ 5JNYA 1FYTD 1HQ4B 2HJLB 1OAUL 3HRZB 3DMMB 4UB0H 4LQFL 2NY4B 1WBYB 4CKQA 3CGTA 1HZHL 4XMLL 5E2UL 2GSJA 3EYOB 2AJSH 3MV8B 4U1NB 5D7SH 3VFOA 3LEVH 1F4XH 4WEMB 3PL6B 2BVPA 4Z6AT 4PJEF 2G60H 3RGHA 4JY5L 5D96B 3ZE1E 3WD1A 4UQEA 4PRAB 3IDJA 4W81A 1E4IA 5IYYA 1UWRA 3QHZH 3VIPA 4UT7H 1JDDA 4XCEA 4LSUL 3Q48A 3LQAL 2B20A 3CFJB 3G08B 3RHWK 4AT6A 4IIQB 4UI9L 5BYWA 4P7RA 3RM9A 2WNGA 3TBWA 2WBGA 5BRQA 3W9EA 1KENL 1X5KA 3ARDA 4G7VL 5IV2B 4L1HA 1XH1A 1LEGB 1JK8B 2CXKA 3UJIH 3IDMB 4YBLC 1KCVL 4LHUD 2XNAA 2CMRL 2OQJA 1C5BL 2ATKB 4X6DA 2YIHA 4XX6A 3ZL4H 5ESVA 2BSED 2Q20A 4F66A 3VUPA 3FB6B 1A8JH 3L5XH 4UR9A 3POHA 1Q9KA 3HG1B 4U3CA 3W2DL 4GG6A 1LQ0A 3VKKA 3HB3C 5HHMD 2BERA 3QIWD 4JO3H 4P4RB 5J3HD 5DC9B 1FJ1A 4LHUB 1ITBB 3O6KL 3MJ8A 3D18A 2V2XA 4ELME 2GJXB 2GJJA 5GRXG 3U0TA 3MLYH 1NEUA 4PLJD 3BJ91 3TZVA 3WQ8A 5A6BA 3GK8H 3QA3B 1OB0A 1T3FB 3BAEH 3BZDA 4LSQL 1W9PA 1VFOA 5DHYA 5I8CB 5I17A 3HI1A 4TVDA 2HTKC 4JPKH 2XZCH 4XVUC 4LHUG 2WSKA 1JZ5A 1NFDE 5F9JB 1GZPB 3TT3L 1JHKL 1T7XA 32C2A 5I6XB 4XPAL 4ODTH 1XHGA 3VGDA 3QJFA 4LDOB 4ZFOA 4WVRA 2AMGA 2OSYA 5GGUB 2A0LC 4MXWH 5AYUH 2B1AL 3ARFA 1OH4A 1S46A 1KCUH 1C16B 3MV9D 3BFOA 4R3SB 1NC2B 1TLKA 4RMRA 5JIPA 4QRSB 4XVHA 4FFVD 3RPKA 5F7EH 3CPLB 2ESCA 2ESVD 5EUKB 5KJRL 5F1IB 4D6EA 1Z5LA 4GRLC 2BCKA 4PLKC 3VXMB 5AZEH 4HEME 4PTWA 1YEIH 3NPZB 2WM0A 4IMKA 4UDUA 1E27A 1QFWH 1I7RB 5SWSA 1PFCA 2RFXA 4V2BA 4BQ2A 3EDKA 2E32A 1SG3A 4NWUL 1V8HA 2H32A 4U7SA 1E4WH 3I6GA 4HK3N 3WJJC 3WD0A 3WFHB 5JW4N 2VLRB 3MSGA 2UWEA 3P3YA 2W46A 3SQOL 1FO0L 5F3HA 1ODUA 5E0QA 3AU1B 5E94A 4HOXA 2NW2B 3PWNA 3BW9B 1KN4H 4TNVK 3EHBC 1P7HL 2CUHA 2QQNH 2IPKB 4IJ3C 4MA7H 1KIPA 1UMIA 2QHRH 1QA9A 3IDXH 1IQWH 1P53A 2ZPKL 4GRMB 5K9OA 5KVFH 4NO5B 3KJ6H 1MIML 2R9HC 4KH2A 5FO8B 5TDOB 4QKXB 5IUSA 1OF4A 2WBKA 3BD4A 4OKVA 4X4XB 2NT0A 1HF6A 1LK3H 4U6XA 3LZFH 1GPFA 1TQBB 1IGTA 5BV7B 1UEMA 1KJ3H 4NQXB 5J6HB 3W5NA 3VFRA 1WB0A 1DQJA 5AC4A 4G6KL 3FONB 4GO8A 5C08D 1NCNA 3C7GA 1UR8A 3RWCA 5MEQA 4JRXA 3RWGA 2V2TB 5DMGD 5KSUA 1GGBH 4PUBH 2O5XL 4EBQH 1BFVL 3HNVH 3PWPA 5JZ7C 1TVDA 3VXRA 1CGVA 3TA3B 1MSPA 1IARB 3OKEB 3QEHB 3P73A 2EO9A 5IVXE 3QXWA 1AXSA 3LKQB 1NEZG 1JWSB 2VRAA 1K3IA 1AMYA 2X0HA 4ZOEA 1FORL 5FA4B 2BMKB 4YHLL 4WWKC 3WFDL 5D93B 3QFDB 3JUYA 3MMUA 5D1QC 3GGWA 3LVEA 2PBGA 4QX2A 4KROD 1MFBH 1E6ZA 4YNYA 3FB8B 1AP2A 2MNUA 1IM9B 3BOVA 1OAZH 1FRGH 2GQHA 1D5IL 4PJCA 3O2DL 4NNPL 4QCIA 3VH8G 4MNKA 3BPNC 2ZIDA 1QUNA 1TVNA 3LRSB 5EBLA 5IB4B 4MMXC 2VDPL 3RJXA 4XNQA 2CITA 4LDEB 3RVTC 1CD9B 5ESAB 1C91A 3VXMD 4K3JL 4POYA 2I07A 4R2GC 5BV7C 2OI9C 4RGND 2WC3A 2UWEF 1BVLB 2DF3A 5F8RC 4XZBA 5FDYA 3NYDA 5IJVB 4UI2A 5JXJA 3L3DB 1I9RL 4OIBA 5H37H 4HZ6A 5TGBA 3SE8H 4CCDA 5FOOA 4LIQE 4QRRD 3HFML 1BP3B 1YEHL 4PJCB 3QEQB 3WL1A 5TE4L 3U6RA 3SEEA 2XVKA 5IHRA 2FRGP 1T2QL 4V2CB 3TBWB 1V5JA 4HIHB 1XF5A 4PREB 1ZA6A 2JJVA 4Q6IB 4HUWB 2B4KA 4AZ6A 2A3AA 5T3XH 4Q6YA 1L0QA 1A5FL 5HHQA 1Q0XL 5MENB 1QLRB 5DD0L 5IB5A 4WUUE 4NZUH 3LQZB 2L9LA 3B5TA 3VX0A 1O7VA 1B0RA 4NDMB 4HK0B 4QRPB 4HH9A 4O51B 1ZHBB 5E24E 4PF1A 5HHOE 3FRPA 4ODXB 5LGKA 4QHMB 1NGXB 5IVXA 4G9DB 4MDJA 2XWEA 2X1OA 1S7VB 4M8QA 3RKDC 1ITXA 4GXUN 3CSBA 2QHLA 4J28A 4A3YA 1YNKH 1B9ZA 4HIHA 4LCWE 3T1WA 3RZCA 3QG6B 4KKAD 4H1LA 4O2FA 2EXWD 4YBQD 3RJQB 3VXQB 2ZCLL 3HRZA 2FR4B 2WINB 1QFPA 3UTTB 4J3WA 4XP1L 4PBWD 4LU5H 5DUML 3KZSA 4OF0A 2VLKB 3EBAA 3IU4H 2P5WB 3AAZB 4S10A 5I1DB 4ZQKB 1CDUA 4OT1H 5E8OA 1IAMA 4A6YB 1CGUA 3OB0H 2J1TA 3I97A 3KL3A 4Z7WA 1IAIH 3WF2A 3O3AA 3TN0B 1F3DJ 4CL7A 3M8OL 1US3A 2ZX8A 1ODZA 2Q1EA 1S5HA 4H8WC 4KTYA 5D2NC 2FX9H 4F57H 4KTDH 5D9OA 4PRHA 3QWRD 3VO0A 4IRSB 5TPWL 3MNVB 3DX7B 4RDQF 1WUNT 2R0WH 4OM1L 3BAXA 2H6PA 5DA0B 1SBSL 3OJ2C 1UR9A 4B0MM 5L88L 5A6JA 2UY3A 1PZ2A 3HE6B 3OXRB 4JRYA 2Q7YA 4UUJB 5HJ3A 3O3DA 4DVBA 4I18B 4O02H 5D6DC 4OD3L 3VXUA 1FYTE 2A6KA 3IFOA 3ROOA 2VDPH 1MJUL 4JFSA 5F8QC 1D5BA 3KXFE 3LKOB 3JVGA 1TCMA 1U6AL 5T1LB 3RPMA 3TN0D 1MLBA 3IJSB 4LVHC 3BPNB 1K6AA 1EGJA 3U7VA 4JN2B 4M1CC 3AFLA 1C08B 1TNMA 4G43A 5TE6L 2Y36H 2EC8A 5ABHA 4O5LH 5BW7A 1Y6KR 3WE6B 1F90L 4WHTB 4KK6D 1XCTA 2HT2C 1E5JA 1EH9A 1F3JB 4KHTL 2R2HA 3QIBD 2EO7A 4LLQB 1WDRA 4RFNB 3O3EA 1WAAE 3VFVA 3C5SA 3RDKA 2P46B 2JJTC 1AR2A 4MDIB 4KVNH 1FIEA 5IP4A 2LVEA 3AS0A 3CH1A 5INDB 4OZ4A 2R23B 1CLOL 2D3LA 4F79A 1WPCA 5EORH 3PV6A 4M1DH 4OLUL 3VWJA 4ATLA 2IAMD 7A3HA 1NGZA 2DS4A 1E1EA 1FC1A 3JWOH 2HP4A 1I8MB 3CFCL 15C8H 3I84A 5D4YA 4FTVD 2AV1A 1K5NA 1L7IH 1FZOB 1R3IL 4XVSL 3WFHA 1A4JB 4KJQC 1HH6A 2CK2A 5L9DL 5E09A 5ESQA 2J8UB 4CMHC 2FX8H 1JGEA 1GYAA 4U05A 3F2ZA 1QOXA 5GRUL 2RFXB 1KB9J 5SWZD 5I1DA 1T5XB 4F7PB 3SCMA 4NQEB 4MB4A 5FM5M 1NGYA 4M43H 4CADB 3SJVE 3RQ3A 4D0CB 1MWAH 4HS6B 4RA0C 1KPRA 4HG4K 1EHLH 1GJUA 3VMPA 1MQKL 3EJYD 3FZUD 4JFHD 3UTQA 2IGFH 5ITFB 5A69A 4DTGL 4PMOA 1ZE3C 2DICA 4X7CC 1I1YA 3MRJA 1EO8H 3SJVD 3SURA 2H41A 1VJSA 1FPTL 1UYWL 1P4LB 4F7MA 5IB3A 4WY7L 1KELH 4NQCA 4OFYD 2FWOA 3L5WA 3MLSL 2V6HA 5ISZB 4LRNL 4EUPB 4PRDB 1MOEA 1OGBA 3CXHJ 3WEZA 1ED3A 3VDCA 4P23C 2XY1A 4YUEH 5F72S 4UQ2A 1WAAA 3PGDA 5IW6B 3INUL 3E2HB 1N2RA 4ZUWA 4E0RB 5F97E 4QEGA 4FQXD 4NJAH 4WO4A 1G9HA 4KJYB 4ZFZB 4KHXL 2WUCH 4G42B 3KS0J 3TZVB 1J18A 3A6BH 2K9UA 3GHBL 2ARJA 3OAYH 1V03A 2VXUL 4P3DA 5F9DC 4WF7A 3GYCA 2J7HA 2YK1L 2D24A 4X7TA 1UADC 1E15A 3L4ZA 4ZUUB 4PMQA 1KEXA 5ABDE 1DSFL 3S36X 1M53A 3VXUE 3RVUC 3F6LA 1KC5H 3ARTA 4Y4FA 1G9ML 4R0LB 4U1JA 5EBLB 4WI3A 2I9LA 4WW1B 2HFFA 4LCCC 2CBVA 2Y6JA 3QRGL 3MREA 5HPMB 3MJ7B 4AMCA 1EFXB 5KG9A 5I79A 5HY9A 1LWRA 3ARWA 3VA2C 3CZGA 5FKYA 1WICA 1Z0NA 2E6JA 3H8NA 5DJCA 1N7MH 3VX1A 3WIFB 1O8PA 2A6KB 3IFOB 4MAUL 4R9HA 4B16A 2WUHA 4JG1H 3DUUA 4KRPD 4KDTC 4NNYB 1LO3L 1A7PH 2OP4H 4UTBH 3I6KA 2BBAA 3STLA 3WDPP 2JCCB 5FB8A 4PJHB 3BDYL 3QCVL 4M9PA 1A14H 4X6CE 1OD8A 2LQRA 3HLAA 3MNVA 2OI9B 3RZWA 3VWKD 2YD2A 3C87A 2WMIA 2DQIL 1MQ8A 2EDRA 5M7QA 5KSUB 3EOTL 1G7IB 4X5WB 4NSKA 1N6QH 1T5WB 3QUYC 1U2CA 2YZ8A 5HYEA 3AIRA 3MSDA 3B9KA 3KLHD 1CZ8H 4HGWB 1BQLL 3S5LB 4LAQH 3MKKA 5BQ7B 5DC4B 3MRQA 1HCVA 5EOQL 4OMCA 3DVFA 4Q6IC 1L0XA 2UYLA 5KW9H 3RHWF 2NXZD 2NNAB 5IW3A 3RTQD 1YEFH 4HJGA 3UEQA 2J7GA 4PV8A 2VDOH 4M9OA 1XGTB 3FJTA 2HT3D 5D5MB 1U8JB 4KQ4L 1DBKL 1F11A 2J3SA 3ZM8A 4PTVA 3AB0C 4PRBB 5EO9A 1N6UA 2ZCKH 3D25A 1EGZA 2JIEA 1OCWH 3H9SA 4OZOA 4RIRA 4M48H 5EU4B 3UCRA 3GIVA 3OZOA 1UWXH 2VISA 1AGDA 4NO0B 1RFDH 4NQDB 3BVNB 1I3RA 4DK6A 2J7FA 1NC4A 3RWJB 5JDSB 3CH1B 4GSDH 3KE0A 3UPAA 3U0PB 1H8SA 1Z3GL 5CZKA 5JXEA 2Z1KA 3O9WA 2BVQB 1Q6GA 2VERN 3VE0A 5I1LB 4BK4A 3EMCA 5GGQL 3U6RB 2G3NA 5LVEA 3T8XA 1H41A 4ZAKC 2ZKHH 2ZJSH 2RGLA 1D6EA 4X9IA 5IQ9A 2NQCA 3QI9B 3IXTA 4C56B 3ISWA 5DJDB 3JV4B 1QPPA 4K7PX 2XYCA 1RHHB 3IDYB 4MNHB 4PB0L 5F7HA 1B30A 2GK2A 1G1CA 1Y0LA 4OLZH 4XVUD 4U1GC 3C7HA 2WWCA 3K0WA 2Y9RT 1WZMA 2Z92B 1CLVA 3GH5A 3TYGL 1CU4H 5K59F 3O6AA 3T0EB 1MFVA 4LQRA 1F58L 5GQBA 3TYFA 3VFPB 4MQTB 2OJZH 3BUTA 4E41D 5C3TA 4CNIB 5HHME 5EG6C 1E72M 1RZFL 1BD2E 2IADB 4HXAH 5D7JA 3VXSD 4Y4HC 2WCGA 4LNRB 1P5UA 3IF1A 5IMLB 3QO1A 1H5BB 1SMAA 3OPZH 5JW5A 3TCLA 3GH7A 2I60L 4FQLL 1V3HA 2C3VB 1KBKA 1FFPB 3D3VB 4NM4L 3WUFA 1SJEA 5AYBA 2BZDA 1NH6A 3ZYJA 4KI5E 3O3AB 1UM5H 1XR8A 4NRZB 3IETB 2O61A 3RU8H 1NCWL 5TQ2L 4L8CB 4JB9H 1XF3A 2YRPA 1BAFH 4DXTA 2E26A 4I5BB 1XR9B 1BLNA 1DQDL 4JRXB 3RWGB 4LU5L 5DUMH 1E4LA 1KLGB 4QCFA 5DK2B 3IDMA 1UR0A 3JTTB 4EK7A 4PBXA 2D20A 3QNXA 5FUIA 4OV5B 3V2AR 1NUNB 3ELAT 1Z2KA 2C3VA 5GNXA 1TFVA 2EYRA 2N4IA 2W1UA 3CHEA 3G6MA 3KXFD 2VZQA 3BN9C 1EEYA 3GB7B 2J8HA 3KVQA 3MBXL 2IANE 2MFNA 2W0FA 2XIDA 2VXQH 5HVWA 1JPST 4QDMA 3TONA 1GGUA 4OD1L 5EBMB 4MGQA 1RUAL 1QLFB 2EPMX 3PWPE 3BQUD 1BM3L 3OJMB 2CRIA 1OP3H 3GSRB 1OAKL 1FVDA 3RGVC 5DQDH 35C8L 3HMCA 4HZAA 4MQXC 1QI4A 1JYVA 1H6XA 6FABH 2GDUA 4JFYB 4AY0A 5CSBA 1LMKA 2CHNA 3D69A 4QOKA 4UILH 5GGSA 4HFUH 2V5YA 4LLQA 4JHZA 4NRSA 4NRXB 3SCPA 3PJSA 5I6XC 2J8UE 1BF8A 4AG4H 2YN5A 4TPRH 1NGQL 4IRZH 2H32B 1P4IH 2N56A 4UINH 1FNGB 4X9GA 1FN4A 4Y89A 1MCDA 5F7UA 2D7QA 4DWSC 1KF9B 4LGSB 5E9DD 4N8CH 1V6UA 3NQHA 4JVWA 4Y19D 5CMAB 2X4UB 3OKDA 5IMMA 5IESL 1LEKB 2MHAB 3GO1H 2Y07H 1RI8A 2AJ3A 1IL1A 3R1GH 5BZDA 2W47A 5D2LF 1UEYA 2GITA 4Q97A 4WFFD 1ADQL 5DJYB 1YEGH 3DHPA 1J8HD 3SN6N 2VLJD 2WQRA 4U1IB 4FXKA 1I9IH 3C5ZD 3VIHA 4WCYH 3H9SE 3VFGH 4RGMC 4WFHE 1T1YA 1HKMA 4OIIH 1PEZA 2JF1A 3WIIH 3ZOAA 4Z7NE 4P2QB 4KU1A 2RGSA 3KPMA 2CPUA 3GI8L 3OB0K 2Q86A 3B2VL 4NKDB 5BV7H 2WBJC 5EOCL 4LSRL 4ZEPA 4QT5B 4LCWB 2E7BA 5F93C 4HIEA 4I8DA 3A47A 2P24A 3LKNB 2WIIB 2FEEL 2WW8A 4PRBA 1IL1B 3GMMA 5BZDB 1SVZA 4K7FB 4EI5B 2R56H 1YNLH 3FRUA 2NYYD 2ORBH 1UM5L 1CDIA 4PJ9D 4C4KT 5C2BH 4HJGB 5I1AA 2AV7A 1PY4A 1CWYA 1NCWH 3D9AH 2DT2A 2FH8A 3X13B 5HHOA 5E70A 2PTTA 3QIUD 3QSKB 5EIIB 1AO7B 4FQJL 4I0KA 2R0KL 3KPPB 1YJDL 5JW4Q 1KULA 1DBAL 1G7LA 1PKQE 2A3HA 4PN2A 1H8OA 2P5WA 1LP9F 3AIWA 1JFQH 1IM3B 4KKLC 2OZ4L 3LN4B 2AV1B 4EEEA 1MFCL 1P5VA 1QSZA 3V6OA 5CJBA 3MRGA 7CGTA 4U6XB 2CDOA 2VCCA 3JWDL 3TBVA 4QXWA 4TSAL 4LF3A 4DTGH 1QPXA 2AEWA 2IQ9H 2FR4A 1EX0A 3WXVH 2L7JA 2VLMD 3EMZA 1W0WB 1NQ6A 4YE4H 1UQSB 1C5DB 3T4AA 1NQBA 1G7PB 2CLRA 3P0VL 4LLUA 4LSPL 4PJDA 4YO0A 1BPVA 3RIFK 6FABL 2GTZA 1OWWA 3AIQA 1I8LA 1VPOL 2XN9B 5SWSB 3GIZL 3P4MB 1HHKB 3EDJA 4AZIA 2WABA 4DXSA 1Y18A 2BSSB 4HA4A 4G5ZH 3KPQB 3LIZH 4U49A 5FGSA 1QFHA 3F65A 1ZLVK 3UTTE 4N42A 2Z4QB 4L8SB 2I9LB 1UOKA 2IPTH 1HIZA 4Y4FB 3BT2L 3C8XA 1XF5B 5IJVA 1KBBA 2NX5A 1HJUA 3TA3C 1FYTA 4JZ5A 4PD4J 1S7QA 1JPTL 5JBFA 4KY1H 2OM5A 3C08L 3ZYIA 4NQVB 4M6AA 5IB4A 4ELKA 1BGGA 5CIPB 1MPAH 3KGRA 3LPOA 3PWUB 3MLUH 2W66A 4Z2HA 4LNRA 4RGOL 5KN5B 3I85A 4XUTA 2ZICA 1CL7I 1N3NA 3C7EA 1S7RB 1XZ0B 1SYVA 3S3SA 1RIVL 4MLSA 3MUIA 5F7NC 1HHIB 4KRPB 4J23A 5DFAA 4HDIB 2XFYA 1UJ3A 2EKJA 3TFKC 1OP3K 4TOYL 4AISA 5FK9A 1FYHB 5DUBB 3CC5A 3L1OH 3EO9H 1BYAA 5FYJL 1HINL 3D39E 3U46B 5GGRA 2V3GA 1QSVA 5GJTL 1NDGA 4D8MA 1RZKC 4LLYB 4MA3B 4JDVB 2KPNA 4BZ1H 1QEWB 2CXGA 4FQJH 4LHUA 1NKRA 2X10A 1FLTX 5HHNB 3U0WL 1T03H 1HP5A 5MP6H 4H8WH 4KPHL 5HGBB 1SDDB 1NWSA 5LKNA 1JHJA 4Z7OE 3UX9B 5AWNL 5DN2A 1FBIH 4UFJA 3I2CL 4ERSH 1WTGT 4HJJH 4JREB 3T0BA 1VF8A 5GZND 4MHHI 2BC4A 2X4NB 3SDDB 4ZUTA 4WNQB 1C5BH 2PCPB 2X4QA 3PWVB 1AXIB 1D7FA 2QQIA 2GK0A 5IKCB 1EDQA 1GOHA 3UDWC 3PTKA 4U3AA 5KSVA 3TZVD 5A6BD 1LL4A 1I8IB 1QVOB 1EAPB 4ZTOL 1U91A 4NDMA 1FIGH 4XAWH 1D9KD 2YBUA 3W25A 1GOWA 3WSUA 4XNMB 3SDXF 4QHLA 3C8DA 4NUGH 1XF4B 3RA7H 3KPNA 3D3VE 2YD4A 2IH3B 5C8BB 2DJSA 3QQ4B 4K3GA 5IBTL 5LAXB 1GHSA 4DGYH 3K8KA 4MVBC 4GXPA 1BD2B 2BRQA 2WAGA 1CXEA 2IPKA 1YMHA 5JQHC 2QBWA 4P46B 1W1YA 1OGAE 1I9JL 3AREC 1GAFH 1OGTA 2BSRB 2IPUK 5LBSH 1US2A 1T0PB 4XXDA 3QUXA 2CERA 1PKQA 1YEKH 3BKJL 3H2WA 2LV4A 2VLRA 2PXYB 1MLCA 4QRUA 1JF5A 4BZ2L 2YG0A 1AJ7H 1I4FB 2VVNA 2NY5L 1YNTB 3U83A 3M17A 3VW3H 3WIHA 5CP3H 1R3HA 1AGFA 1ZHNB 2XOMA 1MXGA 3EO0A 3QQ9C 5BXTA 2AXFA 4FLOA 2BXZA 2W95A 1CDJA 1L0YA 4NP4L 3UEZA 3LEGA 3GMMB 2VX5A 3O6FC 4WEBH 5I15H 3MNWB 2KZWA 4UBDC 4JVUA 5L7XH 5EZLB 3EZ8A 2YD7A 4RBPK 1NGWB 3SDCC 4PJGB 4Z2KA 4PP1D 3MFFA 2UWEE 3L1OL 3EZJB 3WIFA 4NKIH 3K1DA 4FMVA 3CFBB 3BZEA 1AGEA 3L7EA 1EQPA 3VNZA 4B3LA 2F74A 1QNZL 5IMMB 1YPZF 3G5VB 1LO2L 5IIEB 3FT4A 5D2LA 1MWAB 1I1FB 1JHLL 2V2TA 3N0PB 1TCRB 4TULL 4HS8H 3EFDL 3CJJA 3QIBB 5FYKE 1B4JH 1UB5B 5E6IB 4XPAH 5T1KB 3ARGD 1G0DA 4FP8L 4RAVB 2J7MA 3I2CH 4ERSL 3OKDB 4DKFL 1SJHB 1FNAA 2KDGA 4K3HA 1CFBA 4D1IA 2I5YL 5C08A 5KVGH 3O2VL 5J89A 4JRXD 2BNUB 3SO3C 4S0TD 5IEKB 3BRDA 4PBVC 3AHXA 2YB7A 4FZ8L 3VRIB 3PWPD 2HFEB 2HLAB 5IFJB 1CG9B 3MXWL 3S96A 4ACZB 4M7LH 4BH7B 2CRMA 1W91A 4JRXE 4BH8A 2JJUA 3KYOB 2KQNA 4OCWH 3RZCB 5EJZB 4FK9A 3SCWA 1G7JB 1FLRL 4BS0A 4PJFF 1BFVH 2ENSA 2YWZA 1A3LH 1EO7A 3VVGA 1J5OH 3S6CA 5IVXB 3S98A 1C8XA 2AERT 3IFNL 4HUNB 2WMFA 1GOFA 2FJHA 4EUPA 2J7LA 2EDLA 4NUJA 4ZPVA 4RN5A 2P1YA 1LEGA 1L9NA 2CUMA 3ECQA 4M61B 4BZYA 4BFEA 2A73B 3DJ9A 5CWSA 3QUYA 5JIKA 4R7DA 5IMKA 4ZTPL 4X6CB 1ZT1B 5D7LE 4GXVL 1NOWA 1HWGB 5ADPH 1R86A 5E7BA 5IKCA 3TBSA 1X4YA 1F8TH 2AJXL 2R69H 3QPXL 5EC1B 3PNWA 2EYRB 4R26H 4XUQA 4RQQB 1QFWM 4XCEB 5DD1L 4LGXA 3R06A 1VEMA 4LPUA 5DO8A 3DMMA 1CDBA 4X6CF 3IKCB 3ECBA 1MCWM 1J8HE 4N5EC 43CAA 3HZYB 1ND0A 3CDFA 1XR9A 4X80L 4JVPA 2W60B 2APTA 2VCBA 3MYJB 4WI9A 1JF1B 1I85C 3SBWA 3B2UC 4UNVA 4Z7QE 1QEWA 4QRRA 1DLFL 1GCYA 2PYED 4JPWL 2EZ0C 2IADA 5D7JB 5F9OH 3DVNA 3TJHD 4D6HA 4XBPB 4NKMA 2VDMH 1K5NB 5CP3A 4ZENA 1S7XB 4YHIA 4NZCA 1WWAX 4YH6A 3WS6A 4PLNC 5JW5B 3K3QA 1QBBA 5C8JB 2A3EA 3E2HC 2PF0A 2V5CA 3UTSB 5DJAB 1DBMH 1JE6A 1JWUA 5JLZB 2WZ8A 4JFUA 1M71A 4YBLB 3VWJB 2G41A 2DQHH 4HKJB 4JM4H 4EDWH 2PTVA 4Z77A 1MWOA 3QXDB 1U95B 3U37A 3N11A 4ZUSA 3JV4A 4KUCD 1KGXA 3BYTA 4PJBA 5KVEH 2UY5A 2Z4FA 1KFAH 1MCPL 3O4OC 4N9OB 3V6FB 3VJ6A 1P1ZA 3RZCD 4NQUA 2ZUUA 1DVFD 4KGLA 3DIFB 3S4SA 4U31A 1AH1A 1S7QB 4F8XA 1K9EA 5I0ZA 4L0PA 4LXFA 1YA5A 3CVHB 2H1PL 2FJFB 1T2JA 2R8SH 5F7LB 1I8KA 2OR8A 4YQXH 5LQBH 4P02B 1TJIL 1NEZA 3C60B 5B38B 4GAYB 2O5ZH 1LP9A 5BRZD 2BHUA 2RV9A 3FO1A 3MXWH 5D5ME 5I30L 3ECBB 3D5HA 1Q6EA 3LPFA 3Q5TA 2W07A 4H88H 2XA8L 3E8UH 3KL0A 3VE0B 5KZCB 3WUWA 3IB3A 1NWRA 3HR5B 1A6WH 1X7QB 4H26A 3UBXB 4AG4A 3X14B 3NDZA 3EYFA 5F6IC 3M46A 2C3HA 1UCTA 1YUHA 3HAEH 4NQEE 2D7TL 4LHQB 1GHRA 4UUJA 5HJ3B 4PGDB 1OD0A 4X6EA 1BYCA 3REVB 1Z9MA 3AS2A 3QUXB 1REIA 1S7UB 4UQBA 1EGJL 4GXVH 1F45A 3GIVB 4H0IA 1XNAA 3DO7B 1QKZL 4P4KB 1R64A 5CXPA 1HSBB 1FV1B 3Q6GL 3VXUD 1MUJA 4LARL 4TSCL 3UYRH 4XUOA 3PWNB 4UTFA 1U42A 3UG5A 1C12B 1II4E 4XBGB 4AW7A 3N1MC 4GAJL 4RX4D 2Y2WA 5E2WL 2Z8WC 3QWQB 4UU9B 1JAEA 3WNPA 2Z93B 3O8XA 3S34H 1VFAB 5E8OB 5EU5A 2UWFA 4TRPH 2F8VA 5C0EA 1U92A 2ID4A 2HFTA 3RWHB 4U6HB 1OM0A 3ZE1F 2C1PA 3BPCA 1MCRA 4MJID 5DD6A 4PJEE 3QIBA 5I8KH 1CLZH 4CVWA 4F3FB 3SUVA 3BN9D 4GOSA 1OQOA 3VFWB 1DUZA 4HC1A 1NMCC 1CFSB 5CFHA 4XPHL 4OI9A 5FD0A 3MLZH 2QQKA 1RUPL 3GSUB 2DMCA 4ODVL 5I76A 3WCYA 1VGEH 5CEYB 5B4MD 1U8IA 4DZBA 4A3ZA 5HY9B 3S97C 3DIFA 5EUOB 3S4SB 1ZJBA 1NBVL 3K1KC 2D03H 3P30H 1H0GA 2PW1A 4CRPA 1VFBB 2X4OA 5C0NC 5ACZA 3KXFB 2DCJA 5T1DH 1M04A 4ATWA 2J7BA 1WFUA 3UJJH 2EPNA 4N8VG 1O8SA 5ANMB 5JW4M 4OCSH 1W9DM 1IFHL 3L5IA 4L9LB 3TBYB 1TA3B 1N3NB 5DYOB 3THMH 3RUGF 2CKBH 1BLIA 2A9NH 5TGBB 3SGKA 2VXVH 3MV7D 5FYLD 4Z95H 1R3KA 1X9QA 1IKFH 4NJ9H 4ORGB 4Y5VA 2D7PA 3FB5A 1KNOA 3BMVA 3OLDA 1CFNA 1YN7A 3RUGB 1DUYB 5FCZA 3CH9A 1KB9K 4WKHA 5M17A 2EDEA 1CXHA 1E4JA 1HEZA 4R5EA 3RPIB 3FTGB 3VM5A 5GRVK 3LB6C 3HE7B 4KVCH 3SJVA 3HZYA 4NWUH 4HU8A 3FFCB 1JK8A 3GMLB 1NCAL 4G42A 5FXCH 1VEPA 4NQCD 3VD9A 3WKMH 3HMXH 5FM8A 4EN3D 2BVQA 2W0FB 1U3HB 3STBA 1WQVT 4I2XB 3PZTA 3PGFL 5FUOL 2QTEA 4KWUA 4WRLA 1T4KB 3WUGA 2YEZB 3Q5YA 4FQXA 4NFBA 5I8OH 4WO4D 4OV5A 4GW4A 1F6LL 4U7KA 2YUXA 1OTUD 3VXRE 2AAVA 3P4MA 4LSTL 4MZ3A 2ERJB 5C7GA 5FKAB 4P8XA 1N5YH 3SCSA 3Q3GB 4L3CB 1X3DA 2VC2H 1JZ4A 5IB1A 1I1CA 1H3GA 3UNPA 4JHOA 1V7NH 1KEML 2QSCL 2PYFB 5EO9B 2DJ4A 1IJ9A 2ATPA 4FTVE 4I4WA 3BPCB 4N9GA 3CXDL 2VXSL 2FIKA 2XQYK 1X1NA 5DMIH 1CFQA 4Y4FD 1V6XA 4PJCE 1UZ8A 5JR2A 1HHGB 2ZSVA 3IDGA 4H5SB 1JPSH 4XPBL 3HNVL 1OSZB 2DWDA 3ZE0F 5DT1L 5C0CD 3CDZB 3SCRA 4ONFH 1PG7L 2Y8KA 1GH7A 2VWEC 1IM3A 5DWUH 1OARL 2WC4A 1TVBA 3E0GA 1QOKA 1BG4A 1A1OA 4KZDL 4OFPA 4UFMA 12E8H 2CO7B 3PZNA 3MV9E 1XGUA 5I1JL 2MQCA 5DFTA 5E00A 2HN7B 4H0HB 1N0XH 2VN7A 1E1FA 4PRID 3WSOA 4PG9A 5C0IB 1T89A 2F5BH 2CESA 3ET9F 4NYLB 5DK0B 2VXVL 2DLFL 3LS5H 4CD4A 5CSGA 3OZ9L 2VIRB 3NNGA 4E2OA 3LQAH 5FDWB 4ZD3H 1ESWA 2FL5B 4HFWA 2WHJA 4XB3A 3BN6A 4UOJA 4Z78B 2HJKB 4G3YL 2GUYA 5IVZB 2SEBA 2WWMD 4FABH 4C4KO 2DH2A 2F61A 1IGJB 4I3GA 3RTQB 1MJ7H 5TDPA 4EIGB 2MJWA 2XM2A 5A8QA 2EH8L 1UCBH 1AIFB 2CR6A 4JKLA 1DWJM 3QXAB 3RMEA 1JRHH 4MJ4A 1XH2A 4PJBF 3SDXE 1UJ3C 5GS0H 3RY6A 3KR3H 4MDOA 4XP5L 2DRUA 3BVNA 1NDMA 5EFDA 1AGBA 2YBTA 4PRHE 1MEXL 1RY7B 1T66C 3TFKD 4NC1C 2AW2A 1OAUH 4ZAKB 5FUOH 2DN7A 4PJBB 1NCDH 2NW0A 5E2UH 1MHPH 3O3BB 4OUOA 3WY1A 1INEH 4XH2A 5DYOA 3UG4A 4YR6A 4OFIA 3LEVL 1A7QH 3ZDXF 2GCYB 4OZGF 5F9WB 1AVAA 3BXNB 3BH8B 2DIJA 4HIXL 4ZUWB 4LP5A 5EZIL 5HHPB 4OBSA 4JY4A 2ITDB 5L2JB 4FLQA 2X0YA 2FB4H 4EI6B 3VWJC 3O9WD 2NZ9C 2P44B 2IJ0C 4J4PD 2BS9A 3MLVH 2BFVL 3DVNB 4F15B 4I4WB 5E2TL 2W9EH 2EIBA 5I73B 3JTTA 3RY5A 4MPKA 4NN6B 5MENE 4YHMH 4XP4L 1LG2A 2XQYG 5ETUA 5FGCB 4PJXB 5C0AB 5F21B 3VG0L 3WH6A 2BVOA 4OT1L 5DJZA 1FL5B 1GGCH 5DJ8A 3RWEA 2FX7L 1K9FA 1I7ZB 3DRTA 5CLTA 1A3HA 1XR8B 2VL5B 3DGGB 4PG2A 3STLB 3TH4T 4LKCB 4XCCL 3V4UL 2XQBH 4ZS7H 3LKNA 4NHCL 1NAKL 3SCMC 5E8NA 4ZS6D 4ENEC 1UM6L 1S7VA 3JXAA 4M8QB 2AGJH 1WTLA 3T2NH 4H7VA 4HUWA 1GOGA 4E41A 3W82A 1B0WA 5D72H 3POCA 4W85A 1VENA 4KROB 2YSSB 1DBML 2F5BL 5I1IH 1S9YB 3GSNL 5F6HI 5C71A 1H0DA 2XWBA 5CD3A 4LVNC 2BVYA 1X5JA 5E5MB 4X7SH 3K77A 1RP9A 3WFZA 3D0LB 3WSQH 3BISA 3WFCL 2VT0A 1WT5A 5A2LH 3BWAA 5JXGA 1HYSD 4WENB 1OPGL 1GNXA 5D71H 4Y5VB 2IEPA 5L0QB 3GBLA 4DEPC 2CDGA 3OG4B 1IBGH 2GAZA 4YFLF 2WN3A 3IXTB 1TZGH 4C56A 3F5JA 2A1WH 1K9DA 1FE8H 3MRLB 3MFGB 4PJ7E 3SDYL 4D0DB 2G5BA 3HMWH 3QFJD 4MGSA 1EOMA 2Y06H 1DUYA 2NY2C 5C7XH 4P7LA 3KDMB 4Q7DA 3TBYA 5DT5A 3JTSA 4U4BA 4EUPH 1JZ2A 4OJYA 5TQ2H 1RZIA 3CD4A 1CR9H 1NANH 1YC7A 3HI5L 5FYJE 4E5XA 2R0ZL 4U1KB 4XNXH 5GISH 3KXFA 4M7KL 1DLCA 1NEZB 3C60A 4P7OA 4PJCF 4KKCD 1BHGA 3D5OF 1VADA 1CDYA 2WIMA 3IU3B 4ZG1A 1DL7L 3V0VA 1U8LA 3C6SA 1TA3A 3H9HB 4CVZB 2DMBA 3B6SA 1MYRA 1FAIH 2P8PB 5B38G 1MCJA 3EB7A 2HKFL 5GSVA 5FDWA 1KJ2B 5KEZA 2VH5H 3L3KB 5D1ZC 5KAQG 3BP5B 2OL3B 4QOKD 3DYMA 3QXVA 3BRGC 2OCFD 3QULA 3JUZA 4JLRB 3SKMB 4RGMB 5JZ7D 4H20L 4YHKH 2DQGL 2QPSA 2VXTL 3EO0B 3MRRB 4FQCH 3V4VL 4AZ8A 4LMQE 4FLSA 4JO2L 1WEJL 3ULUE 1UWTA 4RE3A 2MPAH 5DDHA 2VABB 5E9DA 3L3OB 2APFA 1IAOA 5FYJU 4Y19A 1LK3L 1YEEL 4KROC 2ZSWB 3T4YB 1KJ3L 5FO7A 2I27N 1HXMB 1EHAA 1SM3L 2BSRA 1OD3A 4M6NL 4FN0A 5HYJB 2VLJA 4YWGL 3AAZA 4MB5A 3NFNB 4GBXC 5INCB 2Q8AL 4AEHH 1E0VA 1QW8A 1U8KB 4QRTA 4WDIA 3UZEA 3GMPB 4MCZA 2ATPB 2DEPA 4JDZA 4LOUC 4G6AD 2F15A 2F5AL 3QCUL 4TYUA 3KLAA 3ZE2E 1P6WA 4MA8H 4P5KA 4KRUA 5D7IA 3MRBB 4U1MB 3QDGE 4MDJB 4PRIB 5FECA 3MLRH 3QHOA 3O41A 4KJPC 4Y4KB 5CWSB 1FFOA 4PJ9A 3ZDYE 1NJ9B 1JNNL 3PWJA 3WH5A 2UY2A 3BP5A 1NFDB 1KBGL 4WTZA 3S88L 1PQZA 1UYQA 5MENA 1RU9H 2R4RH 1E27B 3GMRB 2EE2A 2LU4A 2P5WD 2EZ0D 1T1ZA 3CNKA 3WN6A 2H45A 1G7JA 5HI3D 3U4BH 3KDMA 1B2WL 2J8GA 4XNYL 4PMRA 5F96L 3S96B 2JF6A 1I3GH 4BA8A 1BZQK 4HWEH 4HIJB 1A0QL 3KPOB 2UV3A 4K55A 5CSZA 2Z35B 2C26A 3GK8L 3WFLA 3NPSB 1KNOB 3CIQA 3OLGA 3HRPA 3U46A 2DKUA 2AKRB 1R0AH 1RUQL 2HVKB 5E7FA 4X99A 4YLQT 1XCQA 4GLRI 5CD3B 3NVQA 3RZCC 1E4KA 1MWAA 1VKXB 5D2NE 5I71C 4JFEB 3G5XB 2HT4C 4PV8B 1AQHA 5IHLB 2Q8BL 3VD4A 1W9XA 1EEQA 4K9EH 2DDUA 3MU7A 1N2RB 4GQPH 4E0RA 3RNQA 1LNUA 1LO0L 3N18A 2CBUA 3L95A 5C6WH 1NCTA 4ODHL 2YSSA 2AK1H 3O6ML 4G5ZL 4W86A 5CPTA 4PJ7A 5FGBC 2CBJA 1FFQA 3K80A 4UV7L 3TA3A 1RIHL 5DJZB 3RWEB 4S1RL 2D4FA 2OQJB 1R3HB 2WP3T 1QQDA 2QQNA 4XP1H 1ZKAA 5A2AA 1YY9C 2ADGA 3EOAB 2VL5A 3DGGA 3UAJC 4LHJB 5DQJB 4ZNEA 4QO1A 4P9HC 5CJOL 3SCOA 3MV7B 4GW1B 2XUCA 1AXTL 5DVMA 1MAMH 5M03A 1J01A 3ZTNH 2Y1VA 1T20B 2VDKH 4XZWA 3OAYK 4X6DE 4YIQA 3JUGA 4GKNB 2QQKH 3THDA 1IE5A 4A42A 5E4IA 4AENA 1XF2B 3DC0A 3EGSA 3SUSA 2NY5C 4Z7VB 3VRIA 3S5LG 4APQC 2EIZA 1HSBA 3GSQB 3LDBB 3NH7H 1PZ5A 3P9MB 4P59L 3UR8A 4W87A 5E6YA 3UZQA 3BW9A 4YGVA 3LPPA 1QRNE 3P4OA 4WI7A 4ELMA 1ORQA 3I9GL 1WBZB 1Z0MA 3OLEA 5CSZB 1FGVH 4LCYB 4O9HL 3RCNA 5KSVB 1F4WL 2DQTL 2DQCL 3HB3D 3VRJB 1QI2A 4ZAKA 1UT9A 2IPTL 2XT1B 1MW2A 5IQ7H 4CMMB 4FQIL 5CJ8A 5DSCB 4X4YA 3QQNA 4J8RA 4HUKB 3KYNA 4P2CG 2AXHA 4EOWL 1D9KA 2VMFA 5F89A 1R0AL 4IPNB 1AGEB 3L7EB 3FT2A 1LO5A 1GIGL 3A23A 1LP9B 4DKDC 1MPAL 2IANA 4P46D 4OSUH 2QLYA 2IAMB 4OMDA 4OZHE 1INQB 2YWYA 4HPYL 5C08E 1YEDB 1JRHI 2DSVA 4MD0A 2UUDH 4I9WE 3BPLB 4PJ7F 2NY4C 2QQMA 4F9PA 5GS0C 3NACL 2WLZA 2NY0B 4PGZA 2A0LD 1GPOH 3WL9B 4K68A 4PJGA 4AEEA 1I1YB 3MRJB