2VZSA

Chitosan product complex of amycolatopsis orientalis exo-chitosanase csxa
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
857
structure length
857
Chain Sequence
LSVGAAAGNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
total genus 283
structure length 857
sequence length 857
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzsA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzsA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzsA03
1IL1A 1ZHLA 3HZVA 4P9HL 4PJXE 4UTAL 4PIRF 3QI9B 1KSRA 3HE7B 2VLJA 4F9LA 1CF8H 1FGVH 3GO1L 1DVFC 1KGWA 2XZAH 5I18L 1A14L 3INUH 5TE7H 4NQCD 4M9PA 2D23A 4DWSA 1XGPB 4UCFA 2EDNA 4U0RB 2C26A 3OKOB 3MLUH 3ZKMC 3OKYA 2W1UA 5L8KB 4OLVL 4H26A 4NC1C 1OGAD 2FSEB 1GIGH 3WFEH 1L7RA 1XGYL 3QH3B 4M9OA 3V79C 3U6RB 2DT3A 3MBEC 4D71A 1KJ2H 3CLEL 2ADJA 5D4YA 1BGXH 2EYRB 4PJ9A 3O2DL 1WAAF 1LQ0A 1E55A 4GG6F 4F7MB 5IJKA 1B3WA 1U42A 1A4KA 1U8PB 2B0SH 2AXJA 3TYFA 2R8SH 3N15A 4CCCA 2X09A 2E7HA 1HHGB 1B3VA 3FB6B 4CL7A 3RZWA 1BVZA 4WO4D 1ND0B 4WWID 4R96B 4F9PC 1B3YA 4AQOA 1KQYA 3GSVA 2L7JA 2J75A 1G6RA 4FQ2H 2GJ6D 3WH9A 1HHGA 3BH8A 1PPIA 1V08A 4M29A 2FR4B 1MWAH 5IXEA 2V7HA 1H2JA 3EB7A 5AYBA 5CHNB 2QQNA 4FQJH 5F71A 4MVBC 1MVYA 3T2NH 2VURA 1T5XA 2QADB 1QPKA 2AGJL 1S9YA 5T3XL 5HJ3A 4P23D 4JM2D 2JTDA 3ULSB 1U91B 2NY5H 3V5KA 1I1AC 2IXVA 1K6QL 4ELMB 3H7LA 1C8XA 1UWIA 4PJ7F 2J1SA 4Y7MA 2B4CL 3ZSSA 1UUQA 1RJZA 1OM0A 4TQEH 4FFWC 2NY0D 2EDRA 4M1CC 3BPNC 3X14A 1N0LA 2ZCHL 3N06B 3NCCB 4LMQE 2X1QA 3QO1A 3L7EA 4PG9B 1QSFE 3ARWA 5JDSB 4O5LH 4JDTL 5DK0A 4LK4A 3VXSB 4YHZL 5IOPB 5EBWA 2H6PB 1PZUB 1K4CA 4MJ6A 1PX3A 4RIRA 2PO6C 3FQTB 2DPEA 4NO5A 1MFUA 4JANA 4F37F 3KPPB 2ILLA 4U1GC 8A3HA 3QXDA 5FO7B 1W72L 3DV4B 5HHNA 3ZT6A 3GSNL 4P8XA 1GGCH 5L6YL 3W25A 4IRSB 1I7UA 5C08E 3CUIA 3IDIA 4NPYA 1FP5A 1XGQB 4WJ5B 5CILL 1A6ZA 3H7BA 3S88L 2Y6KA 2NX5A 3GNMH 1WKYA 1FN4A 5EBAA 4JM4H 3QWOB 5FO9A 4PJ5E 3IFLL 1SJHB 1J8HB 3Q5OA 1UM6H 3UTSE 4BZYA 3BD4A 1GZPB 5C92A 1HYSC 2IGFL 3MBXL 1BVLA 4C57C 1FNLA 1UH3A 4MB4A 1XZ0B 3QBTB 3LEVH 3W29A 4KJPC 3OKKA 1E0WA 1ONQB 4IOIA 4BK5A 1BECA 3DROB 2ITDB 4R7DB 3U4AA 4CCEA 3VRLF 3OEAA 5KS9B 2OL3L 2V5TA 1KN2L 1ISVA 4H25A 1E27B 3MREB 1JPTL 4WTZG 2VDQL 4X4ZA 1J0HA 3BMWA 5CJBA 1T0MB 3SKJL 2HKFH 3N50A 5C0BD 1GOFA 1T1WA 2C3VA 2KDGA 4YO0A 2FHFA 1EEZB 1FRGH 5LGJB 3U37A 1V7NH 2P24B 4WU5A 2BNUA 4F37K 1NFDE 3D6GA 2W95A 5GGUB 1FYTA 4JO2H 1S7VA 5BS0D 2A2QT 1IGCH 1BBDH 4FQXA 1DFBL 1NAKH 4K3DL 4P57A 1UKQA 3SDDC 3AXLB 1CIUA 2DSUA 1SM3L 2QQKL 1JJUA 4F7EB 2AK4A 3OHXB 1QFWM 3LQAC 4AZ5A 4RGNE 3SEEA 3BO8A 1G84A 1K6QH 3FRUA 2D03L 4FMVA 4PJ7A 3WBAA 4TUOB 1QUNA 2H32B 1XYFA 2Q20A 4A42A 4OOUA 2EH7H 1B6DA 1Q38A 4NRXB 4TUKH 4B15A 4GG8A 1W9DM 1T7WA 4PSRA 3OX8B 5EU6B 2F58H 1VBUA 1TJIL 1Y18A 4XP5H 4W81A 3IGAB 1VFAA 4OIFA 1OAZL 3K2UL 4LOUD 4UQAA 2FECL 4OZ4A 3D39A 4PY7A 1MCEA 2J7DA 4FFYH 1BQSA 3D25B 1JGIA 3DVGA 3QCTL 4JY6A 5IFAH 2XA8L 1XIWA 4KVNL 3AS2A 4BSJA 2WSPA 5CQ1A 2GYSA 2JIWA 4U1SB 4UNUA 4NQUA 5I66B 3DHMA 2QMKA 4M8UA 3MGTB 5CJOH 3RWEA 5B8CA 3AY4A 5ANMA 4FQ1L 4RFOH 2GJJA 4W8LA 3MLTA 2Y5TB 3RVUC 2YA1A 4JFVA 3EMQA 1LL4A 1Q4NX 4Y4KD 2A9MH 6FABL 2OWCA 1FNSL 4MCZA 4YXKL 5D7LB 3STZB 3ORJA 5F7YC 1S9YB 3MLVH 2QQNH 3FJTA 3HNVH 4FABL 3I2HA 4WW2F 4IMKA 1YEGH 3L3HA 4GWIA 3GKWH 4M7KH 2E8ZA 1KTDB 3T0EE 4H5SA 3TFKC 3IU3A 4UDTA 4YGVB 1FHGA 3WLWC 1C8YA 4JFDD 2BY1A 3S36L 3QQ4A 3RUGF 3WDHA 4ACZB 2K1MA 1MYRA 1OF2B 5BRZA 4OM1L 4L29B 1JGLH 2VDMH 3LVEA 2Q8BH 3WIHH 4QRQA 4Y16B 5IFJB 5TE7L 1VENA 3UPCA 3RM4A 3AXXA 1RU9L 3MUZ1 2WO3A 4HK3N 3QEGH 1QO3A 3BZEA 4ZXEA 2ZE0A 3LN5B 2WLZA 5FIEA 4AIXA 4OCYL 3RJXA 2IADB 1U93A 1BOYA 2OTUA 1IAIM 1IAKB 4RNRA 3VIIA 5HYFA 4RGND 2J47A 1GVIA 1KIRA 4KKCC 1A3QA 1I8IA 2AAVA 3CZGA 2UY3A 1OPGL 2B7DT 4YR6B 4GZJA 4LVNB 1OPGH 4Z7WB 4HDIA 4KKAD 4M6ML 2P46B 4Q74A 4Y1AB 4D0BB 4XNYL 3CZEA 4JKMA 4FABH 2XFFA 5C07D 3S4SG 4PREB 5KSUB 2B1AL 2YSSA 4IRJA 4O00A 4M6OH 3EGSB 4FQ2L 2W46A 1JV5B 5CSBA 2JJWA 3RJDA 2I9LB 1SYTA 5EIIA 3NACL 1S7WB 3PF2A 4MLIA 5D6CA 5CZVH 1GOQA 3KL3A 4YXHH 5MEPA 3WUGA 3GMRA 1GNXA 2DCJA 3HPNA 5BZWB 4GXVH 1NUDA 4DVBA 4TYUA 5C0DB 4DJMA 3WIFA 4XNZC 3U5UA 5IB3A 1T0MA 1QBLL 4UT9L 4Y2DA 4KUCF 1Q9LA 4PGZA 2R2HA 4PJBE 3MOQA 4OIBA 5L0QB 3MACH 1JPGA 3I2IA 3NPSB 1W1TA 3V6ZA 3DUSA 4OZFB 1HCVA 4YX2L 4LGXA 2OZ4H 1S7SB 2HFGH 2DSZA 2QBWA 5A3IC 4QDQA 1P5UA 2D7NA 3JSSA 5C2BL 1G0DA 5BXFB 4GFTB 1V6XA 4M56A 4YHEA 3T8XB 1T22A 4HFWB 4KUZH 3TCLB 3ZYJA 4PQQA 3KPSE 4QXUL 1VADA 2E0PA 3KJ4B 5C0GA 5TDPA 1CIYA 4W93A 5EOQH 3RWCA 1TZ7A 2WNGA 5HYQA 2R7EB 4U7SA 2PW2A 1NOUA 4WWKC 4AMKL 1MW0A 3QIUB 3BAYA 3MRDA 4NKDA 4JFQA 5D7LD 5K9JH 3MRIA 3VMNA 4KAQL 3NTCH 3NZ8B 5DO8A 4LVHB 3WJJC 4WI7A 2FL5A 4U2YA 1JK8A 2V5CA 2OM5A 2NZ9D 1MJUL 1L8NA 3LEVL 3T1WA 4L4JA 2Y25A 5C8JB 4WKFA 1NQBA 3QQNA 1EMTL 4OI9A 2CDGA 1MRCL 5GHWH 3S35H 5I8CB 5E7BA 2GY5A 3O6ML 3PWJA 3CZFA 3QNZB 4LLWA 1OGAA 1DWJM 1SFSA 1JHLH 3G6AA 4ZXBA 4KGJA 2NXZB 4DQOH 3SCUA 3RIFF 1NKOA 5EB9A 4CVZA 5E94B 5FUZL 4P46A 1FG2B 4ZPVA 3V6BR 1WFTA 4OFIA 3B9KB 1XF4B 3POHA 4HULB 4JKPL 3ZOAA 4KHXL 4NZDA 4ZFFB 5I1DB 3ARYA 1O5DT 3ET9F 3WD4A 3VA6A 4NQVB 1CZTA 1L7IH 1ZE3C 3QDHA 4D9QD 1X5FA 2GUOA 1LWRA 2CMRL 1W9SA 1HSAB 3QDMB 3FCTA 5F6IB 1DDHA 5FGBC 4QRQB 3EO1B 3MPCA 3P1IA 1NGWB 3D87B 4LYRA 4K55A 5D2LF 5INCB 1P7QB 5CZVL 4PV9B 3BPOC 2EE2A 1PYWA 1YEEL 3KPTA 1JNNH 3MXVH 5HGGS 3VXOB 4DOHB 3MUJA 4DKEL 4HS8H 3CLFH 1EJ6A 2ADFH 4XNMB 1IC7H 3C9NB 4HUWA 2GJ6B 4NQTA 4QWWC 4ODSH 4KROC 2NR6C 4APQA 4QLLA 4BQ9A 1KT2B 1S7WA 1ZJAA 2X7LB 2VM9A 3AZSA 2HTKC 3QG6B 5EU5B 2NY6B 1KT2A 1E15A 1GJWA 4S1RH 3WKNA 1S5IH 4ZS7L 3VCLB 3LKNA 1AJ7H 1ETZB 4K94L 3GKZA 1ZHNA 5E9DA 4A44A 4KQ3H 4HWBA 1UJ3B 4POUB 2AJVL 3HNMA 4X4XA 5ILTH 2UZIL 1UM5H 3BXWA 5J1AB 1IGIH 3OXRB 1I3VA 1PZ5B 1HOCA 3LS5L 2JE8A 4NQSB 3HZMA 4H8WH 3RKDD 5KOMC 1SJEA 1A1OB 2NT0A 1NFIA 2ZPKL 1K42A 1QRNA 4ETQB 3QDJB 5HYSB 2Y07H 2WABA 2M8XA 3QQ3A 3BQUC 4ZSOE 4BCEA 5ESQA 2J62A 1R7AA 1UJ3A 1MCIA 1XFPA 1WDRA 4WTWA 2A77H 4M4PA 1FG9C 6TAAA 5T1KB 3F5KA 3ARVA 2RGSA 1Q72H 2ZSVA 5ESVA 2ZSWB 5CBEA 3NTCL 5IMKB 5KSAA 1EO8H 2OS7A 1AGDB 4KJYA 1MHHB 4ET7A 3II1A 1KG0B 2E8YA 4IDLA 5CCKL 1ND0A 1RZKL 5BVPH 5IP4A 2WUBH 1FOBA 3TO2A 1UWEH 4GRMB 1EVUA 2BNRB 1B6UA 2D22A 3LEGA 1I8LC 5AEAA 2DQDL 4MJ5B 2VLRA 3IYLW 4MADA 1E0VA 3IRPX 3PABB 3QSKB 3DMMB 3OGOE 3FHAA 1QSED 3K2UH 3B6SA 2UWEF 4DEVA 3NCFB 1FZJA 3DO7B 1IJ9A 5FKAB 3CC5B 1QBMH 4PRAB 1YMMB 4TN9A 4ZQKA 4ODBD 3GMNB 3ALWA 1J1PH 4JFYA 4RRPG 3WL9A 5FIPA 1PGRB 1YNKL 2X10A 4JFHE 2XFRA 2DAVA 2BVPB 1WF5A 3MLXH 3ZKXB 4CU7A 5E2TL 5ID1B 2WBJB 3ACIA 4U1JB 4GZEA 4QXGH 4NO0A 3L5WA 1VB9A 8FABB 5D8WA 4P02B 1EFXB 3ZDZF 1TVBB 4Z76B 1XIWB 2VZQA 2ZZUT 3HI5H 3UBXG 5EBLB 1JFQH 5JXJA 4HJJH 1MAML 1HHKB 2IWGA 2PBGA 2Y07L 4UV7L 3CZLA 3IJYB 1JGEA 3DX7A 5D2LA 3P2TA 5D7IB 2J88H 3VIFA 2XVNA 5BVJB 3ZR6A 1NWUA 4BFGA 4XBGA 1NC4A 1EIBA 1AGEB 4Z2IA 4S3JA 4HUUA 4UI9L 4JFPA 3DARA 2A74A 1VGKB 3MNZB 3MLWL 1HP5A 4CNIA 4OD3L 3IDJB 2BSRA 1VKXA 3I2GA 2ZJSH 1HXMB 3C6SA 1HJSA 4UOW0 1K85A 4XP1H 1VJZA 3FOLB 2EE9A 5I79A 2CBUA 5EBWB 1RVFL 3PZOA 4HBCH 1W9XA 1WZAA 1V5JA 1KXVA 4ZDHB 4LARL 5FYJD 1T7VA 2MCPL 1J1PL 3RGVB 1MY7A 3CIHA 5I71B 2A3CA 4LEOB 5IVXF 1T0PB 2DYPB 3VIJA 1LO0H 3SGKC 2BFGA 4HUMB 2DSWA 1PEWA 1ZT7A 1DSFL 1DWHM 2FSEA 1J01A 3EYUL 2ZPKH 3SCOA 1U3YA 2YKLH 1MRDL 2D2OA 5IBUB 4MGQA 2YKLL 4LVNC 1W91A 3LB6D 3CHFA 2J7MA 3Q48A 2B1AH 2W38A 5J12B 4U1IA 5E6YA 5A8MA 1QTYT 5C7XL 4HKXA 4BA0A 1IT9L 3CDZB 3H0TB 3P40A 3L5XH 4I18A 3D2UB 3WS3A 5ICZB 1TLKA 4W88A 5GGVY 1SJVA 4DWSB 1WCBB 1EHLH 4ZNCD 3P9MB 4Y4FD 3D3VE 5EIVA 3FQUB 2W9LA 3L3OA 3BPLC 1ONQA 3PL6A 2FDMA 4PYSA 3PHQB 4P2RA 5CEZE 1ZU8A 4AG4L 3IB3A 1KJ3L 4JLRA 5HHVH 2FR4A 2LU7A 2NQCA 3QI9A 3LQZA 5DHVH 3RWFA 5GNZA 5DI8A 4UBDD 1VEPA 2QR0B 1KEXA 5B38B 4X7TB 3VXRE 2AS5M 1UWWA 1UACH 1YECH 4KFZC 1JTPA 4DN4L 2R4RH 1KLFA 4Y19D 2YPVH 1V3IA 3ECBA 1LE5B 4Y89A 3F5LA 1CD9B 5MEQA 3IB4A 4TSCL 4JN2A 5FUCE 5I0DA 2IQ9H 1DYOA 5LCVL 1EDTA 3TO2B 1J5OL 2MKWA 3HAEB 5GGRB 5JXED 5DPNA 2VRKA 2WBJC 4U4BA 2OZ4L 3BJ91 3BXNB 5IMOB 5EZLA 5HBBA 5I8OL 3TONA 4LEXH 1CZVA 1A7BA 4L8BB 1CEOA 3GEWB 1ZT1B 3QFJE 3A0OA 4Q6YA 4QTIL 3HNSH 4XZUB 1EEYB 5A2CA 4HJJL 4MJIA 3WD5L 3BMVA 1JYVA 4JHZA 4PG9A 5DD3H 5D8ZA 2OYMA 1KB5L 1KJVA 1Q9OB 3MCG1 2QSQA 5DO2C 1W2KT 4X8JA 5EPMA 4J28A 2YPKA 1EXPA 4YGAB 1FNFA 1RQ5A 5A2KH 1KR1A 5C3LD 4CADA 4XUTA 1NL0H 1GQJA 1Q6GA 2XHYA 1RZJH 3LKQA 1A7QH 4I1NB 3DLQR 5FK9A 4JFXB 3INUL 5F1IA 3TPUB 4H20H 1CI5A 3KYNB 3WHE1 4BXSV 4FTVA 4WUKH 3BHBB 2GK0A 2BGPA 4YN5A 1BQHA 1QSFD 4MJ4A 4UIMA 3TO4A 1QNOA 2PR4H 3AHYA 5K59E 1QKZL 3QQ4B 5I1LA 1LD9A 1T1XB 4O4YH 4HZLB 1U92B 1PDKA 5CIPH 5F9WB 2TAAA 4G9DB 2WB5A 1FGNL 1KNOA 3CFBB 3HAEH 1I1AB 2GSIB 1CGSH 5GS0D 2BY2A 1A2YB 4AZGA 4XMPH 3MRRA 3NFPB 5AD0B 4B7LA 5D7SH 5GRUL 3C7GA 4L29A 2VSCA 2XUCA 1MHCA 1N2RB 1CL7H 1IILE 4JZ5A 4AT6A 1RJLA 2EO9A 3NIFF 4GIAA 2WMGA 2WUHA 2X4UB 3WUZA 2IANB 3MOAL 15C8H 1NJ9B 3BP4A 3ARED 3W38A 1XH3B 3OKNB 4CVXA 15C8L 3WL0A 1CICC 4MAVA 1MCQA 5CZXC 1W9WA 4RGNC 2WAAA 2B8OT 4LKCA 2W9DL 3SGJA 3MV9E 1CN4A 2EDXA 2D7QA 4Q9BA 2R15A 3QEUB 5GS2H 1I85A 3QFJD 4P7NA 1MEXL 2J4GA 5L8JB 1JUFB 3LHPH 3VGGA 3CMOH 2GT9A 5DWUL 4AC1X 4P3CL 4UTBL 5BVPL 1BMGA 3BN6A 2NXYB 3WH8A 5DXWA 4M80A 4XXDB 2E40A 2AK4E 1T66C 1U2YA 4PTTA 1KN2H 5AG9A 4Y4HB 1WGOA 4X5WA 5H2BA 4K3EH 4Y4KB 3RU8L 3BUYA 3C60A 3KLAB 1EEZA 3VWJB 3AAZA 4PMZA 1EUUA 5DVMA 4PJFE 3L7FA 2VUYA 3Q6GL 1DN0B 3DTXB 5DUPL 4IHOA 3FONA 4OFKA 4V1DA 4TTDD 3VFPB 4POZD 1UM4H 3M1BA 4HIHB 3THML 2DM2A 2YD9A 3NIDE 3OL2A 5DRZA 4NQEB 4W4NA 2Z1SA 5E99H 4M7ZB 3HI5L 3OHXA 3UTPE 4RSVA 4Z8FH 5EWIL 1CXEA 5JORA 4HIIA 3O0RL 3TVMD 4UFIA 1AI1L 4Z7UF 4NIKB 5F7LB 4K7PH 4M5ZL 4AYFA 3U79A 3ARFD 3D2UD 2J7GA 3W53A 2I9TB 3U1SL 4UT6H 3GXDA 3W11D 1EJOH 2FJGB 4BDVB 5BQ7B 4UZGA 4LCWA 4XUNA 3S3PA 4P08A 3E6HB 3WO3B 4NRZB 3JV6A 4CUCA 5GZOC 2YDQA 3OAZH 3KPNB 3MGAA 4C7FA 2DQDH 4ACYA 2VE6A 4PRPE 5LXGH 5F7KC 2J8HA 1AE6L 2NY3B 3CFEB 4QAWA 2A73A 5I8EA 2J12B 5CSYA 5FM4A 1E5NA 4NNXB 3WMBA 7A3HA 4Y19B 4CJ1A 3S7GA 1EHXA 1IKNA 3ARBB 2OX5A 3MO4A 4DKAA 3TPKA 4HH9A 4WO4B 1AXTL 1RIHL 4FQQA 1OY3B 5D70L 4G6FB 5DDHA 1KTDA 1GOOA 2AJYH 3FHQA 5DHVB 2IJ0C 3O6FC 4EUPA 4OJFH 2A9ML 5IJVB 4LLUA 1RIUH 5DVKA 5GGVL 3REVB 1A3HA 5GGTH 1R3KA 3BRFA 5IJRA 1DQDL 1CXFA 4MQSB 1H15A 5EZJA 2WW5A 2GIYA 1KLUA 3AMGA 2WUCH 1RULH 2FJHA 3VXUA 2A9NL 2WUCL 3D18A 5DJYA 1A7RL 5ANME 3ARSA 3DX8A 4PLJD 3PHAA 4QLRA 3UROR 1E72M 1W3LA 2WANA 4NQVA 3F2ZA 1WV7T 1P7QA 5ICYB 3O41B 5DLML 3G6DH 2YRPA 1XH3A 5KSAD 1BJMA 1Q6DA 5DRNA 1T2XA 4MA3A 4R90H 1ITBB 5HHME 1A1NB 2PB1A 1BX2B 1R3LA 3BGAA 3QDMA 1HSAA 5DSCA 3UTPD 3TJEH 1ZS2A 1HK6A 4PTUA 5IGXH 1F6FB 5JXHA 2JIXB 4P8VA 4OCYH 3FFCB 5A2LH 4J4PA 1CFNB 5ENWB 2CKRA 4N9GB 2UWFA 2XIDA 3QAZC 2WP3T 4LIQE 5K9OB 4GW1B 2H26A 2Y6SC 1I1YB 5JBDA 3FN9A 5F72S 3VU2A 4Y4HD 2HLAB 2VZTA 3BEVB 5DRWB 4Q9CA 2AXGA 2HAZA 4JDTH 1F3DJ 1Q9LB 1A6UH 1I9RL 5CGYC 4OYUA 5E8EB 3OGRA 1TVHA 3BPLB 3KLSA 4NUGL 2P5WB 3N18A 2OJEA 1HKJA 1CLZL 5IQ7L 3KPSB 2L7UA 1SVCP 2HFTA 4JVWA 4WHYH 3GSQA 4ZOAA 4IS6B 1NCWH 4ONOA 3TYGH 1BGAA 4KZEH 1CK0L 4HKBA 3OKOA 1S7XA 3RRQA 1EEQA 1MQKH 2PBOA 5IBLD 1UR9A 4QFUA 3ZKSD 2Y6LA 2DLFL 4QPWA 1L9NA 4X9BA 1NDGA 4A6OA 2G41A 4EI5D 2WWCA 4QRRA 3IJ8A 2ADIA 4XC3H 3ULUD 1JE6A 2UWEB 1CNVA 3WHXA 1YPZF 2VZ3A 4ORGB 5SWZB 3BP6B 3BT2L 1ZHLB 4C56E 1ZLVH 1U8OA 4NWTH 4GW5B 3MMEB 1CGWA 1QSEE 3NCJL 4UQ9A 2MPAL 4I9WD 5T33H 3U6RA 2R0KH 1BVKA 3GIZL 1MJJA 5JXAL 2W60B 4YHIB 3MR9A 2ADIB 4BSVB 5L8LB 3E1F1 4K7PY 4J8RB 4N68A 3G6JE 1R3HA 4I4WB 1MUJA 3QOMA 3V4VL 1HN1A 2Q7YA 3K74B 1U8OB 2JF1A 4X6CA 3HUJA 4FQXC 4TOYH 4ZUWB 1HDMA 2HT3D 3MRDB 4NKDB 2QL1A 1GVYA 4NM8H 3X3FL 4WSKA 1ERNA 5LG1A 5DD0L 3BAEL 2F54D 1UKTA 2VH5L 4KZEL 2ORBH 3C5ZA 4PRAA 3RM9A 1FO0B 1JK8B 1QQDB 3HI6H 4D0CA 1OIMA 4LYQA 3T8XA 2EYTB 1YEDA 3SDCB 3NACH 3MUY1 1FHLA 1N3NB 4LRIC 5D7JA 1A7QL 3O2VL 4UDUB 2APVA 3DO3A 3RAJH 3ZE1F 2WM0A 1W0NA 1P6AB 4N1HB 1K3ZA 2WWKO 2FNBA 1JZ7A 2C8NA 4OCRH 1V0KA 1JTOA 3QISA 1RZ8B 4OGYH 4HZ7A 5I17B 1JGEB 3DX7B 2HRLA 5IVXB 4NYLA 5EIQA 3IU4H 5D5MB 5T1MB 2XWTB 1CZ8L 4ZE5A 8CGTA 3HFMH 5SWSD 4G43A 2ITDA 4NCC2 2GJRA 3H42H 4Y5XA 4OV5B 2J6EA 4YDJA 4QRPA 3SE9L 3CKHA 3ZTNH 1IC1A 4XVSH 5J56B 3ULUE 2Z8RA 5J9PA 5E00A 4BFIA 5AZEH 4PTMA 1YUHB 3VG9C 4ERSL 5IQ7H 3UZEA 4NRYA 1U93B 5TE6L 5CEYB 3GRWA 4JFUA 2EIBA 1MIMH 1NGYB 1KBGL 2ICCA 4DK3A 4ACZA 3WN5B 4EUPG 4Q97A 2AXGB 3RUGE 5F88A 1Q0YL 2D0FA 1MFCL 3ILPB 3QHZL 3SOBH 1U8JB 4RCAA 4ENEC 2FWOB 1T6WA 3LN4B 2DM3A 4OLUH 4J27A 4R0LB 3EBAA 4QDSA 4I2XE 2ZCLL 3W81A 1GMMA 3PDOA 5D5MF 3WS6C 4KPHH 5DWUH 1IAKA 3H9SE 5LQBH 4ODSL 4Q6IA 3T3MF 1ISYA 4QRTA 1TFVA 1SEBA 2DQGH 5D6CB 1BG4A 2WBJD 3SDCD 1LEIB 3CXDL 5SV4A 4QRTB 4MA7H 2IH1B 1ZBKA 4WIWA 4FQLL 5CBAA 3U36A 5DMGD 3T0VA 3CFKB 4HKXB 1S7TB 4YFLI 2V2XA 5I1JL 3OF6D 1K12A 2NLJA 1HKKA 4GG6A 1KLGA 4MJIE 4D8PA 4CN6A 4ZY9A 1KPVA 1H11A 1EAPB 3D25A 4Z7UE 1FIGH 3FW6A 1UX7A 5D70H 1N0XH 5D9OA 1NFDB 4Q0XH 1OTTC 4KWUA 4OF6A 4XB3A 4NHCL 4JPWH 4PJEB 4HPOL 3PNWA 1OSPL 3MRLA 3IJ7A 4TXEA 2G9HB 1J86A 5DUMH 2Y64A 2XG5A 1LGVA 1A5FL 4IBLT 2V2TA 1J0JA 3WUWG 3OLEA 2CRZA 2PXYB 4H8VA 3BO8B 1F11A 1SM3H 3QPXH 3MCKB 4JQXC 2FX7H 2VTFA 1B4JH 4HC1L 5IHRA 3MMDA 1HHJA 3GI8L 4HC1H 3MV8A 5DUBA 4ZUTA 4JY6B 2CKBH 2HN7B 2V4VA 3NA9L 2B9VA 5FA3A 1RU9H 3VRIB 5LWYH 1MVFA 1UWEL 2DI7A 2FX9L 1PIFA 1GAFL 5HYJA 4TUKL 4DKFH 1OW0A 2R29L 4QLKA 2P5EA 5FO8B 1FCGA 5EU3A 5IBLC 4EQ3A 5IHZB 2CLRA 3LH2L 2IBGA 3QJFB 1FVDB 4NKQB 3X3GL 4NKMA 1ZXQA 3KYNA 4KDTA 1BG9A 5EBLA 3I9GL 1BGGA 3BZFB 5ITBL 3R0NA 4NOBA 1LEGB 1ZLVK 5E8DL 2W1QA 1CLVA 3ES6B 3KL0A 1K8IA 3JWOH 3QNXA 5BWFA 5KEZA 3DSNA 4U1SA 2VKWA 2UV3A 4ELKB 5C7GA 2IG2H 4LASH 3DGGB 5ALBH 1SJHA 1ADQH 3CAFA 3QHFH 1QEWA 3RDKA 1HILB 1T4KA 3TM6A 1U95B 4PJAB 3WLBB 5DN2A 3WJJA 3AMKA 3IDMB 1DLCA 3GH7A 4E42A 4OUOA 3HKFA 4EDWH 1RZIA 3S36H 4HXAL 2VMEA 4J2XA 1FL5B 2YKKA 1U8HA 1LG1A 2GVYA 3TBVA 4PJ5B 3DV4A 1RFDH 3LQAH 4JHAH 4AM0B 4XGZA 5I24A 2ARWA 1GOMA 2WBGA 4JG0H 1AFVL 3EO1A 2OYLA 3T0BA 2DYPD 1NQ6A 4HUXB 3S5LA 1YYMH 3NFPA 1JUFA 4S1QL 2GFTA 2F53E 1JU3A 5GRZA 4RWHA 1HHIB 2R29H 3LSOB 2VNCA 1H4PA 3U4EA 2W65A 3P0VH 5DJ8B 5C0AE 5B3JE 4WV1B 3QXUA 4YO0B 4ZFFA 5I1DA 3WYRA 2OL3A 4CBPA 1X6LA 2NNAB 5ACZA 4TNWF 4GMTL 4PV8A 1C5DA 5FKPA 1FYTB 5T5NG 1FL3B 4OAWB 2DQCL 5MERA 4AYSA 5E8DH 3AAZB 5IB5A 2XZCL 1WP6A 3Q6FB 1MJ8L 3BIKB 2B31A 4F57H 3V6ZB 4XCNB 3WF1A 2K9UA 3T2QA 5JW3L 4J1UA 4HDIB 3ZE1E 4LCIH 2IAND 3BPNB 1T83C 3Q6FA 4GAYA 4DGIL 3SDDB 2GTZA 4H8UA 4G9FA 1UXWB 1E4IA 4YBHA 3IDGA 3OB0H 3P73B 1KTKE 3MRGB 3DJ9A 5A16A 5EIIB 2PI6A 3KPSA 4C4KO 4A3ZA 4MPKA 1U8LA 1B1YA 2K7QA 1C8PA 4KRPC 4FLOA 4FQJL 4NC1E 1XF2A 3SGDH 3VFTB 5KS9A 4FMKA 1HNFA 1WZKA 4ZENA 5F7DB 2WMHA 2CKBL 1IKFH 4U5IA 5D2NC 4OD3H 3T1FA 2ZCKL 5MEQB 4R8WH 4UNVA 2MQ3A 5DQ9B 3NGBC 3O4LD 4JFEB 1KF9B 2VDRL 2R2EA 5B3NA 4Q6IC 1M7XA 1OCQA 3QCVH 5IMMA 2R2EB 2YPVL 3BDYH 1CZ8H 4KQ4H 1A6TA 4LRNH 3RVXC 3MV7D 2CJUL 1RVFH 2HYMA 1S5IL 4ZS7H 2YFZA 3GMRB 2WAGA 3I9GH 4PJEA 5FUZH 3K75B 2P42B 2V17L 4RX4D 4OGZA 2VWEC 3L6FB 1JGUH 1P9MA 3TA9A 1D5BA 5EZIH 4F3FB 4JM2A 1QNRA 1XGUB 5I1LB 5FUIA 5BXSA 3HNTL 4QRPD 2YBRA 4KUZL 3K3QA 4OF8A 4XBEH 5EBGA 3AS3A 1FNHA 3GRWH 5IMOA 4BH7B 5IHUL 2ZOXA 3X13B 3V4UL 4UTFA 3A23A 3V0VB 3FT2B 3PV6A 2HJKB 4UQCA 2AV7A 4FTVB 3TYFB 1AGFB 4F79A 2HA1A 3DPBA 4MNHA 2VZUA 5CYYA 1XGTB 2BRRL 4OLXH 1KLUB 4OGAD 2ESVA 5C0AA 2WKLA 5I23A 3VFMA 2BERA 3KLHC 4G3YH 1MJUH 2YPKB 4L8CB 5HGBB 1R5WB 5FKAA 5HHMB 3MV01 4S1QH 3VD7A 3PGDB 5I8EB 2VMDA 1K9DA 5I1CL 4HKZB 5D7JC 2J8UA 2D24A 2VC9A 3VFNB 1VBRA 3VIGA 4DN3H 1IEBB 4OKDA 2F54A 5DJYB 1E4WL 2DKSA 3D3VB 4CNIB 4GRLA 1JHTA 1X5YA 4Y16A 2NY1C 3HC0A 5C1MB 4UOQA 1J5OH 1JHLL 4HIEA 1TTGA 4KVCL 4H1LG 4TOQA 3IXAB 3MUGB 5J11B 1JHJA 3B2UD 4LEXL 4Z2HA 4HG6B 3SUUA 1BX2A 4DAGH 4P7RA 4W50A 3H3BC 4E42B 1UWXH 4X6DE 4M5YH 1IARB 4XBEL 3O81A 3FB7B 1FLRH 1I3RA 5HDBF 2W91A 4W6YB 1A0QH 3WF3A 5C0CD 2BBAA 4PLOB 3T3PF 1OSPH 4ODUA 3ABZA 1TZHB 4NBYB 3MRNA 1J0ZA 1P5VA 1SJEB 2AMGA 4NN5C 1ESWA 3REWB 2B2XL 1U8IA 4NFDA 4X7EC 3SY0A 2R69H 3NGBB 3SDDA 4AK1A 5FYLH 5CKAA 2JF6A 3KNBA 5E2UH 2OSWA 3VIOA 2RFXA 1HH6B 1VPOH 4HS8L 3CLFL 3MLWH 3KLAA 3C60B 2X89A 3UYRH 1AO7A 4NSKB 2GSJA 4M48H 5GIRA 3VWJC 3VGAC 1HJUA 3FONB 5CIPA 3MUHL 1KIPB 5F1KC 2HMIC 3PZMA 1YEFL 3NFSL 3R0MA 3IAGC 1JIBA 1IAII 2MNUA 2P48B 1E71M 2ATKA 2J5LC 3JUGA 1ZSDB 2HWZL 1W99A 4I0CC 4PRHD 1W0VB 2MCPH 2ZSVB 4JM2F 3O6FB 2PYEB 5DURD 1EGJH 4TNVK 1P84J 1HIZA 3WH7A 4JY4A 1S9KC 2ZXAA 5HYSA 2G60L 5CIPB 4AQ1B 2QMJA 1IGYA 3JZ7A 3ZL4H 1UY1A 2PW1B 1PBGA 5FL0A 3TJHC 3KS0H 4U1MB 4U6VH 1JPFB 1IT9H 3HE7D 3RNKA 5DRXA 4F2MA 5B4XA 1NFDA 2CYGA 1YMHB 1OP5K 3AM8A 4XRCA 2NTSP 1OGSA 4HBQA 2PYEA 4HZ6A 4CU6A 3B9DA 3L4TA 4OUEA 5KG9B 3LE0A 4Q58C 1T66D 2HVJB 3VJ6A 3QPQC 3NBNA 3UJTL 1A1OA 2VXTL 4BJLA 3OV6A 2VDML 2CNCA 5D2NA 2BNRE 5BOPA 2FIKA 5CCKH 1WK0A 5F7EL 3VH8G 3HR5A 5M7QA 1VGEL 5H37H 1U91A 3S96B 2ZG2A 5E8OA 3S3SA 4N1CA 3GXFA 4J3SA 4M1GL 1PKQA 4KRPB 1REIA 3VFUB 4Z7NE 4WVRA 1NEZA 3UTTB 1BBJA 4C56A 4LCWE 1BFOB 1QFWL 3PV7A 1JWUB 3QWQB 4GBXA 4NO2B 1FO0A 3CVHH 1T1YB 4KI5E 4MCZB 3SJVB 3SKNA 3STZA 1YNKH 3X11B 3HJRA 4LQRA 3D3VD 4GRMA 1QSZA 1CFSA 1RMFH 3CC5A 5TDOB 2P5WE 4XPHL 4N8VG 5EOCH 3BW9B 3LS5H 2UYLA 1DDHB 1DSFH 2EDJA 4YDKH 2AJYL 3I6KB 5LKNA 1BPVA 5DHYB 4R4ND 4LASL 4OLZL 5F9AC 1N64H 4ONFH 1AGCB 2XXCB 1AKJD 3SDAC 3X12B 1MCLA 5F1IB 4QRPB 4N8CL 1BD2E 1NGYA 4M1CD 1LO3H 1XGRB 3FRPG 1R5WA 3VGFA 2J1TA 2AVGA 3IFOA 3NH7L 1I9IH 2R1WA 4MA3B 4JRYE 2H6PA 1LDPH 1HJWA 4PMDA 4W4ZA 4FTVD 3GTNA 1E4MM 5D1QA 3QO1B 2AEPL 2AKRB 1CPUA 4PJCE 4KRTA 3PG2A 4P2QE 3ZQ9A 3LPWA 3DX6A 5JZ7D 2PTTA 4AIOA 3IDIB 1AY1L 4WFFD 3SN6N 5E9DB 3TBYB 3VGHA 2EIDA 4ZPVB 2VIRA 3P0VL 3MUIA 3FTGA 1CT8B 2QQOA 5BV7H 4YAQA 4WF7A 3SURA 2FD6H 3I85A 3LKRA 1E6RA 4F15B 1F90L 3GNRA 1G7HA 5BCAA 1HH9A 2NY0C 1RAMA 2D4DA 1LE5A 4GT7A 2GUOB 1J0IA 3PP4H 4TNWK 1IAMA 3AIVA 4FQXD 2CKBB 3TESA 2G2RA 1B2WH 3FMGL 3HNSL 4P59L 1S9VB 2A3BA 4OTXL 2I27N 3QH3A 2A6JA 1T3FB 5LAXA 3H0TA 4QXUH 1F4AA 5TF0A 3C6LB 4XI5C 1FL3A 5T3XD 3VXMB 3BQUD 3K7UA 5CJQL 5D93C 5JW5B 4JZJC 1OLZA 3N12A 4R2GB 2BFVH 1P9MC 2CUIA 1TA3B 3QQ9D 1Y0LA 4PGCB 5BJTA 4N0UE 1W3HA 4HS3A 2RAMA 4H41A 2DQEL 2V6HA 3RPKA 4F7TA 5B4MC 3QG7H 5TFSH 3WF0A 3EO9H 3DXAB 4L8BA 2CGRL 3PQYA 1NDGB 3CIQA 5I1CH 1OAQH 1OD3A 4QRRE 3MACL 4PJIA 5D1XA 5D9SA 4Z2GA 1QKZH 2AK4B 4ORGA 5SWZA 3F8UB 5IB4A 4FTVE 4N8VA 3MRKB 4M7LH 4B5EA 1E4KA 5IK3A 2QPUA 3RWCB 4DM1A 4OCNC 5MI0C 2DLGA 5DI8B 3SE8H 4C59B 3UCQA 1X3DA 4WU7A 4LHQB 5CGYD 5ALCL 2D7PA 1UR4A 2CKSA 1E28B 1QSEB 2VITA 2ZUNA 4UDUA 4ALAH 2X9XA 4AH2B 4HH9B 3TIEB 5DD0H 1E28A 4HUUB 1XR9A 2R1XA 4PPTA 2HG5B 2W9EL 1H49A 3I6GB 1FDLL 4JR9H 4F8TA 5TDPB 3Q1SH 3CUGA 4HHAA 4XNXH 5IFHH 5DS8B 2BOCA 2ED8A 5BXTA 2UY5A 3LHPL 3BQUA 4XZUG 5A40E 1IFHH 3K1KC 4QOKB 5JW4M 2D3LA 1FZJB 2XRAH 3RWIB 1NCAL 3EO9L 3QEUA 5I2IB 1CE1L 4LVOB 4OGYL 4YR6A 5JR2A 3SQOH 1F97A 4ZDHA 4PUDA 1TCMA 1OT2A 3EDKA 1FH5H 3S5LB 1UA7A 1JWMA 5EO0B 2A83B 1CFTB 5JPNA 1X4XA 5HHPA 5I9QC 3S37H 4KVCH 2VQUA 2P45B 1OOAA 1K6AA 1I8LA 1HHKA 3EHBD 2AJZB 2VB5A 1MFEH 1GCFA 2FECI 5IMLB 5FA4B 2Q1EA 2Z91B 4P2QB 3D3VA 4ZO8A 4XMPL 1SDDB 3CFBA 1AXTH 1RIHH 2KPNA 1GJUA 1HT6A 3MRBA 2R2BA 5CZKA 4FRWA 1VA9A 2D7OA 3VIPA 3ARUA 2X05A 3WLBA 1D9KD 2OJZL 1K8DA 1UY2A 1YEHH 1A0QL 1FE8L 5HI3D 5FGCB 3VFVA 1NLDL 4BELD 5HDOA 4DWSC 4PLJC 1FNGB 4JFFB 4QRUB 4XX1E 1UYWH 3QO0B 5C0DA 4YHYC 3TBVB 5KVEL 1OWQA 4DZBB 3PZUA 1OVZA 1QRKA 5LGJA 1ZLWK 1XYZA 4K3DH 1ZLUH 4I0KA 1MCCA 3RAJL 2W9DH 4L1HA 3KPLA 4MA8H 5IBUG 3PP3K 4YNYA 1CFNA 4MAYD 5ENWA 4LBEA 1HSBA 4DWHA 3WSQH 4Z95L 3LKNB 3REWA 4AY0A 5C0CA 2WUBL 1P4LB 5EN2A 2PWEA 4RE4A 3PTMA 3QULA 3W39B 1GGBH 3RY5A 4WNQB 4JPKL 3UZQA 1MHEB 1SQ2N 4Z18A 3FQWB 3OPZH 4U0QB 4B16A 1CU4H 1XCTB 1VAHA 4O02L 4ZAKC 4M62H 5DD5H 2HP4A 4GPNA 2XPGA 1CLCA 2XY2A 3IXTA 4PRBA 3DYOA 2X4TA 4IEFB 3RIAF 1P4IH 3DRTA 4NQCB 1YQVL 4YWGL 2FB4H 2BMKB 2LAAA 4X5XB 2VERN 2H41A 1X7QA 3O6LH 1JD7A 4OOZA 5CBAB 3TA3D 4H8WL 2DTSA 4P0DA 3VFSA 2VLRD 2EEAA 3RWJA 5BZDB 4NZUH 3A7QA 3GBDA 5C0EA 4HAFA 4XCYB 2BV9A 2AW2A 5DQ0A 3T0EC 4MNQD 1C7TA 5AYUL 4M7JL 1DBAH 1NANH 4PRBB 1KELH 1S7RA 4M7JH 2P7TB 3LOWA 3AXIA 4RMRA 4EOWH 5IEHB 5F7DA 3CFIC 1MREL 2FJGA 5B38A 3TIDA 5IFHL 4X7SH 3OQ3B 2N7AA 3W0KA 2ZX5A 4WFGE 1UWXK 4WCYL 5IF0A 4LAQH 1DVFA 5FV2A 1U3HA 4FHBD 2VT0A 5DLMH 5I73B 2FGLA 2CITA 3JV4B 2D03H 4UOJA 1ZS8A 4KK5C 5CJ8A 3RZCC 3VFUA 1HQ4B 3IVKB 3QCUL 1LWHA 3WMCA 1VGEH 3V0VA 1GAFH 3PHSA 3BP7A 1WZMA 1WZLA 4GXUN 4NP4H 5FK9B 2YL5A 3E3QE 3PL6C 4MA7L 4NHUA 5HHOA 2HRPL 5B8CB 2NW2B 2BOBA 4OT1H 4DVRH 4DTGH 1OAXL 4J6RL 3EDEA 4XPBH 5IYYA 4PMXA 4JFSA 5F1SA 1KFAL 4L3EE 1A4JA 3Q6GH 5A2JH 5F7WC 4CVUA 1EXUB 1FFOB 2QKIB 3JV6B 3H9SB 4NQDB 3T4YA 1LO0L 1DQQB 4FZEL 3U0WH 3B6SB 4PJ5D 3WQWA 3GSNA 4LLYA 3OKNA 1VFFA 4PJHB 1RIUL 1DBJH 3OR6B 4OTXH 2EPKX 4U6YB 1DBJL 2H45A 1KPUA 4YHLH 5C08B 2XWJA 4Z8FL 1UKOA 3GK8H 5E70A 4LCCB 5CJXC 3HMXL 32C2A 4RGOL 3GK8L 3AOFA 2DF3A 1FH8A 2FATH 4G42B 1R3IL 2IMNA 4KTYA 4TSBL 5EORH 2D31A 1UQSA 4ZFZA 1O7SA 5C2UB 2O9OA 1JXKA 1WAWA 5C0AD 4PB9H 3SCRA 5H2BB 5LWYL 4HZLA 4P4KA 1QSFA 4PB9L 2AXHA 1PX4A 2AEWA 1AY1H 4K8RL 3GJFK 4LPCA 4GLRH 4HG4K 5FYLD 5AYIA 2BC4B 3UPRA 4P00B 2CHOA 4BFIB 4DN4H 4YFDB 5IBTL 2R4RL 2X9WA 3GBNH 4XH2A 1HXJA 1GOWA 1LK2B 3MGOA 5DJ0A 2J8OA 2BK8A 1G94A 2C7FA 3VO0A 2VN4A 4GW5A 4FF5A 1XGYH 1MI5E 5B21A 4PRHE 5KW9L 2ZX8A 4YIQA 2DLHA 4RRPA 4P2CG 4LARH 5HY9B 1SEBB 4RZCA 1ZLSH 4PLNC 2FZ3B 4TTGA 1L0PA 3WF2A 3VXMA 3PJSB 4FQ1H 4RFOL 1AVAA 1OIFA 1A6AB 5SWQB 2QQJA 4X9GA 1TZHA 2NY3D 4M1DL 3L5JA 3SCQA 5E8PA 1JI6A 2DYPA 3CUPA 3W6LA 1IZKA 1BLNB 2ORBL 1AXSA 3VDCA 2QQKA 4OZGE 2WWDA 5F89A 4MDOA 3WS6A 1RH9A 3M8OH 2ESVD 2ZOLA 3GMPA 2QSVA 1FBIH 1QFOA 3WO4C 2NY7L 2J77A 4XCYA 1UCBL 3C5ZB 3ACHA 2EPOA 4F8QA 2XKSA 3ZJ7A 2EH8L 1KEGL 1ZVHA 2WXDM 3QCUH 3AUVA 4FXLA 1H8SA 4KJYB 3SBWC 3ULSA 4X6CB 2ZKHL 3L3OB 4MNHB 4AD2A 3H9HB 2ZKHH 1EPFA 1ZLWH 1H3PH 4NC0B 1H5BC 1HVXA 1AQKH 3ESVF 3ZJ6A 4W70A 1ZANL 4OCSH 3RVTC 3QDJA 3TT3L 2IAMA 3GBLA 2UZYB 1DCLA 4LDEB 2HTKD 4HF5H 3RI5F 2V5SA 4PCTA 1T83A 5C6PB 3BGMB 3T0ED 1R3KB 2HFGL 1VACA 3TEUA 3UYOD 3K8LA 3MMEA 1P7HL 2E33A 4X8JB 5EPMB 4LHUA 4Q9QL 3GSRB 2VLMD 3P9LB 4H0HB 4PJXF 3EAKA 3LZFH 3QJFA 5TE6H 1A3LL 4EI5A 9CGTA 4JFHD 4KHXH 5HYJD 3F12A 2BVPA 2O9TA 1LMKA 4K7FA 5I75B 4JPWL 1FHDA 2YD2A 5CHNA 3CZ8A 1CK0H 1IC5L 1T04A 4OF0A 5E8OB 2XQXA 1Q0XL 1T1YA 3SJVA 1QR4A 1CLYH 4MB1A 4L9DA 5GS1C 3KYMA 5ELIA 1TTUA 1T04B 2PQSA 3CFCL 1MFAH 1ZWIA 1HIMH 2I5YH 3MLYL 3OLGA 4S1DC 1ZT4A 5KANI 4GO6B 2AQ3A 2AABH 3TA3A 5DHYA 2MQ0A 1UB5B 1LL6A 4XTRD 4F58H 4J3VA 3VKKA 2XNAA 3VXMD 1RP8A 1S7UB 3RGHA 3L95B 2DQHH 1CDIA 4ZOBA 2NYYD 3BH8B 2YUZA 1U58B 2ZUSA 4HJ0C 4R26L 3W9EA 3WQ8A 1YEJL 1R3JA 4GAJL 4GBXB 4NJAL 5C09E 1D5MA 1JZ4A 5E6IA 4C58B 4XP5L 3RDTB 4P4KB 4ZO7A 5JOEA 3W6MA 3JUZA 4PUBL 4XPAL 5B38G 3T4AA 5J6GB 5MEOA 1Z9SA 1ZA6A 4HLJA 4PYHA 5L2KE 4AZHA 3SE9H 3ZTNL 4G43B 2X2YA 4YBLB 4K9EH 2J1AA 1QEWB 1CDUA 2LE9A 4YDJB 2I60H 3QUXA 3UJIH 4CKVX 5IV2A 4XVHA 4XBGB 4DZ8A 1US3A 3G5XB 2VZSA 3IFNH 4PRPD 1UYQA 5IVXA 4OB5H 4M6NL 5IHBA 4FA8A 3WKML 3L5IA 1NFKA 3MA9L 1I1FB 5E99L 4MAUH 1FNSH 4ODWA 5ERWB 5ALBL 2KL6A 1W0WB 3QIWB 1QW9A 5I1KL 2EICA 5IW1A 3GZAA 4YE4H 2HFEA 3GM8A 5IW6B 3PWPB 5JIPA 5CJXA 3O6KH 3L4YA 4LEOA 4U1KB 3WUEA 1J0KA 5FECA 3D9AH 2C5DC 3SCPA 1ULPA 3RO8A 5E8PB 1HJXA 2PTUA 5SV3A 3MV8D 3BSZL 5SWZE 3KLHD 5CUSL 4G8GD 1WC7A 2PCPA 2DQUL 1PZ2A 2UWEE 2RVAA 2XQBL 2E7BA 2ZX6A 5JA9A 4WY7L 5JHLL 4RDQG 5J89A 2BNQE 4U1LA 1ZBWA 2FZ3A 5KSAB 3VW3L 5TJWK 3IS0X 3MBEB 1J9CT 2YXMA 4W7UA 3KNBB 1I1WA 3QUMH 3GJFA 1KTLA 3TWCL 5C0IA 1ZA3A 2FIKB 4I8DA 4FQXB 2Q8AL 1AP2A 2P5EB 5FO8A 3UJJL 5IKCA 5E08H 1T0NB 1JP5A 4X6CF 2XONA 4YHZH 3S97C 5MHSD 4IIQA 2J6EH 4X99A 3MRFB 5EC1A 5JUEL 3BUYB 3BPCA 1YC8A 2VXUL 3BAKA 4Z0BH 4B3LA 3ETPA 4TVCA 3MRFA 1QP1A 3DUSB 5D9PA 2OR9L 4S11A 3MROB 5DFVD 2QHRH 4JO2L 1W9UA 3ZJKA 5I0ZA 4AL8H 3LS4H 3BOVA 1DWAM 4JFOB 5KJRL 3HMXH 4RWYL 2B2XH 3GXIA 4P9HC 1PMHX 1NUGA 4K7PL 3T0XA 4PMUA 1AMYA 4N42A 3D48R 2H8PB 4GAGL 1N5AA 1WE5A 4JFEE 2BVTA 4PJFF 1T20A 2VITB 5DJ2B 4S0SD 1AGFA 5GGSY 1YEDB 3KYMB 5ABHA 43CAA 4KHTH 1S78C 1G9EA 5D5ME 2ORXA 4FMFA 4PRNA 2OL3H 3PWPD 4NJAH 2ZUMA 4YC2B 2IANE 3KAAA 3NZ8A 1DLFL 2VVNA 3MLTB 3C5SA 4W5UA 5KANG 1H5BA 3G6LA 1NGPL 4EVNB 4HWBH 5D9MA 4ELMA 1CLOL 3T77A 1UWRA 3MV8B 1YJDL 5DUBB 4ZUTB 3ZIZA 4QF1A 4FXGA 2X4NB 3MV11 1QI0A 2IAMD 3VRLE 5HYQB 1JZ6A 1RK0B 5GISL 2P8MA 3GIVB 1Y6MR 3QXWA 1HNYA 2YD6A 3MLXL 1Q94B 1KIRB 5DZOA 4Z7WE 2PNDA 5J7CC 2BCKB 2R9HC 4I2XA 3V5DA 3F62A 4P46B 4D9RD 1WISA 4YHLL 4KROB 2OTPA 1A3RL 3D0VA 4XP4L 5A8OA 4R0LA 1CE6A 1MH5A 2OTUB 5AAMA 1HKLH 2BX5A 2VX4A 2FO4A 3PTQA 1NAKL 3O41A 5FV1L 5HYSG 1KCUL 1KR0A 2AAAA 1S7UA 4UOW1 4XVTH 3SCWA 5ISZD 3WV0A 3CPUA 3LN5A 5AG8A 2A6IB 5KN5A 5GS1A 1VEMA 2Z91A 5AUMB 2MMXA 1PVHA 5GRVL 2V3FA 2NY7H 5D5MA 4E8CA 2VISA 4Z7QE 4JZOB 1RZKH 2OQJA 3RY4A 1FORH 1NGWA 4JG1H 4QLJA 3LIZH 4QRUA 4A41A 3TN0D 3TZVB 2Q7NA 3IANA 1CZ1A 4FZ8H 1JU4A 1NC2B 2VXVL 5M03A 3O9NA 1KNOB 4ODVL 1HH6A 4IOSD 4AZBA 1LNUB 3LH2H 1UKPA 4JFDE 5CWSA 2H2PD 1F90H 3LQZB 2YWZA 1NSNL 3QXTA 3OZ9H 3GSWB 5GGRY 3EGSA 3RVUD 1N6QH 3VD5A 2MQCA 1ZEAH 2ITCA 2VZRA 4FQPA 4YDKL 1JFHA 5CLTA 2ZWZA 2XZCH 4G6KL 3AU1B 1QD0A 1Q1JL 4D9LH 4MHHG 4WTZA 1E6JL 4YIQB 1WCBA 4WHTB 3FO0H 2YRZA 2JCCE 1JAKA 3L6FA 1W9PA 1NLBH 1V8HA 3ARPA 4QHNB 1PYWB 5H8DA 4X0KB 4LCWB 3V4UH 5JBFA 1HWHB 1ZKAA 3WMSA 1K9EA 5CJQH 3GMQA 1JZ5A 4HS3B 3MRGA 2QQMA 4TVSa 1RFDL 3ZE2F 4HEPG 1A02N 4JRXD 4I77H 2DKUA 3OEBA 4QRRD 1JBJA 4H1LH 5DK3A 2VMCA 2VCAA 4JN2B 2V2WB 3NVQA 4HC1A 3HG1E 4D9RE 3TTOA 4WDIA 4M48L 2OMNA 5CINL 5CFHA 4HHAB 4Z5RA 4V27A 3NA4A 4GAJH 1RIVH 4GSDH 4RDQF 3ARTA 5C0CE 5D72L 4EQ2A 2RR3A 4PJFB 5F44A 1YJDC 3L1OL 4V1DB 1NGQH 4Z5RB 4DK6A 1C16A 4N8PA 4NM4H 3SUTA 2NY6C 4LLAA 3T1FB 2VI0A 3EZJB 3NCOA 1RZ7L 2G3NA 2ZP0T 3ZHKA 1RD6A 1CGSL 3KPMA 3TZVD 3PN8A 1I4FA 4KJWD 4IIQC 4JKPH 4ERSH 2D7MA 3RILA 1MCOH 3X14B 5EZIL 5JA8B 2BNJA 3WD1A 3X13A 5MEND 1GOIA 3ACFA 2YPLE 4OM0L 2F8QA 4D2NA 4PJ5A 2HVJA 3CX5K 3VJ6B 2XZQH 3TIDB 4OZIF 5I74C 2XQYG 3OAZK 4KTDH 1UA6H 3VRIA 1CDCA 4QKXB 3OTTA 2ICEB 4NQDA 2X6MA 3ARFA 3MX0A 1LP9A 3S98A 3BZEB 1TJGL 1YEEH 4NZTL 3PXHA 3SDXA 4G5ZL 4F58L 2ZWLT 3BI9X 1VPOL 5D2LB 3V2AR 1W72B 2DWEA 3ULVL 4NHUB 2R0WH 5L88H 1UACL 2IH3B 5E8EA 2YHGA 4TQEL 5D71H 3FQRB 3QUMB 2FLBT 4ODVH 4TRPL 3OR6A 2JFEX 2YLLA 3V95A 5JTWA 2G3JA 5AD0A 5HYIA 4U1JA 2J1UA 4ONGH 1B4RA 1J84A 5KVDH 1FGNH 2GTWB 1HKIA 3JTSB 5IG7B 3MXWL 3WDPP 3D0VB 3V6FA 1ZB5A 2Y6GA 1N4XL 5DSCB 4U6YA 1OGGA 2B1HH 3FB8A 4PF1A 2ESCA 4DAGL 1WSST 4A6YL 1RUQL 1MIML 4RYDA 4PRIA 4D6JA 2QHLA 1NC4D 5J1AA 1R24B 3OG4B 1EO5A 1OT1A 4PP1C 3HC3L 4YDLB 2WIIA 1O7VA 3SPVA 4JM4L 4PJ9C 4U1GB 2W07A 1NL0L 3S6CA 4LCWD 3STBA 4OZHB 3C6LA 3WDRA 5E2VL 2WC7A 1I1YA 4L4VE 1LNUA 4JQXA 1MVUB 1NMBL 3FFCA 3MRHB 2AJUL 5GS3A 1NMCC 4PLKD 1UFUA 1YNLH 3MJ8B 1KEML 3UTQB 4GG6B 5EBMB 3LPGA 4ZSOB 5CP3A 4I13B 4ZFGH 2UY4A 4MDJB 1YEFH 4PV9A 3OGSA 2BNRA 3WNMA 1I7RB 3PBGA 1UY3A 4D1JA 3N85L 3PGFL 1A9BB 3O11A 4H88H 4PY8J 5HHOE 3C9NA 4HUWB 4FK9A 4PMVA 4KVNH 4NN7C 4DXTA 3ZKMD 2AJXL 1M6OA 1MAJA 3B2VL 4V1DD 2ZSWA 1FSKB 1TNNA 1F2XK 1PX8A 4A6YH 1U3ZA 1R8LA 4UBDC 4WFHD 3QQ3B 1CFSB 1JPFA 3PZVA 3JV5A 1JFQL 2EPMX 4QHKJ 1KLGB 4KKNA 4GQPH 5T3ZH 3ZL4L 2ESVB 2CHNA 3LS4L 3I75B 1XF5A 2WSKA 1NFDF 3BIBX 4CUAA 3F12B 4NKOB 2P24A 4GO8A 3E2HB 4M3JA 2J25A 4H1LA 3OXRA 5A2IH 5J6HA 1U8QB 3BE1H 2DMKA 1UG6A 4LSUL 1RZFH 4NJ9H 3WCYA 2AEQH 5I76B 4G5ZH 2JIEA 3L3IB 4BH7A 1B90A 1DBMH 1QYGH 1UYZA 2WAHA 1M03A 1NFIB 1VFAB 4OF7A 3W0WE 4QP0A 1G9MH 2CDFB 2R0WL 3AXLA 3DIFA 4GH7B 4NQDD 5TDOA 2LFGA 4AY1A 1D3CA 4PJEE 3MSGA 3AREA 5SWSE 3WFDH 4AEIH 1H8NA 2CCRA 4UQ2B 2WVTA 1DTUA 1N59A 1OL0A 4K3JH 3THDA 5C8JA 1I7UB 4Y8DC 5F88B 3PWPE 1CICA 3LD8C 4N0CC 4OKVB 5BROA 4FZEH 2V3DA 1HYRC 2BJMH 3SE4C 4KJPD 3HC0B 3A4AA 1MCKA 5IQ9B 4PJGE 4JB9L 3BAIA 3QR3A 1YUHA 5KS9E 2FEEL 2ZUUA 2YMXL 1BP3B 2WNWA 5HGDA 3BZDA 3UPAA 2DEPA 1KELL 4XMLL 4XWGL 3VXOA 3TO4D 4PP2B 3QFJA 4W85A 1CICD 1ITCA 4KRNA 3MRJA 5I15L 3HU7A 2DWEB 4PG2A 4G7VL 1R87A 2VQTA 4ODWB 4RQQA 5ERWA 1F42A 1OAYH 1D5MB 1LG2A 1JCKA 4QOKE 4QHMA 3LN9A 5F93C 5HI3C 2I07B 3VDBA 4WI2A 4LP5A 3LEXB 3CFKA 4U1KA 3SQBA 1NUNB 3W0WB 1WBYB 5EUOF 5F7EH 3OKEB 5I6SA 1TUXA 3MODH 2LTQC 4LXFA 2JELH 5F9DC 3L4ZA 1INDL 4GRLD 5IBTH 3V6OE 3ME0A 5TF1H 3QDAA 5L9DH 2YZ8A 4WHYG 4L9LC 4X6BA 3UR7A 2WQRA 5JXAH 4DZ8B 1W1PA 4GKZB 1E27A 4HCRH 5JO5B 3BKYL 1CT8A 3P30H 1VFOA 1OH4A 5F3HA 1ZHBB 5BO1L 3MLPA 5KAQF 5JXGA 5IWLC 3P30L 5F7NC 2FBJL 2GUYA 5T5NF 4AD5A 2YUVA 3MRMA 4LSPH 4NUGH 4P5MB 4LU5L 4ZYKB 3L4WA 3ULVD 4OFYA 3ZE0F 5JHDB 1DANT 2I9LA 4JVUA 1ZVSB 5IW1B 1ZV5A 1TXKA 5BV7B 4WU7B 1MAMH 4Y2OA 5FUCC 2MOVA 1IEHA 3FO1A 2W63A 5JIIA 3AYSA 3W4RA 1T3FA 1V3HA 1CD1A 1FZKB 3AMDA 3TVMC 5G05L 4W89A 1I7TB 1BZ9A 3ROLB 1V0LA 3N13A 2R23B 3ECBB 1QLRB 3OB0K 3EOYG 3CUPB 5CMAB 4PGEA 1I85C 2GY7B 3QXAB 4JKKA 4MJIB 3NJVA 3VG0L 1KB9K 1MEXH 3R06A 1U8LB 3SO3B 3ZDYF 2DQJH 4D8PB 3HHRB 3CUJA 2QADD 3SCTA 2EC9U 5DT7A 2Q86B 1XHGA 4D3CL 1NM9A 5F6IC 2EEBA 1MCWM 3IJHA 5E2WL 1XD0A 1MNUH 3L3IA 5T33L 2X0HA 1SVZA 3TLRA 5INDB 1JI1A 4M43L 1DL7H 3NABL 3K1DA 3ARFC 5JPMB 1FAIL 5FYKH 4HW6A 2E7LA 4OMDA 1PG7H 3G6JB 4ZOCA 5JNYA 4A4AA 1BGXL 4K23L 2Q86A 5C6TL 2QR0A 1BOGB 2EDBA 1UXSA 1G7MA 4TOYL 4PRNB 1WICA 5GJTL 2OBGA 1XGRA 4Y19A 4HLZH 3OKMB 3DO7A 1BOGA 3VXRD 5I66A 2HN7A 1R5IA 1F5WA 1KB3A 4P4RA 1ZK9A 3B5GA 5DEGB 5ISZE 1FZOB 2R2BB 5AYUH 2XFXB 5JIWA 4LSQL 1FQ9C 2UYLB 4XNUH 5FUOL 1D6VL 3MNVB 3M46A 3HR5B 5C07A 4GBXD 4XNUL 5FUOH 5MENE 2QJDA 3WUBA 3RWGB 1N8ZB 1XF3A 3MJGX 3EYQC 2VOTA 4IPLA 1UM6L 1H3GA 1SYVA 3RUGA 1B30A 4UB0L 1NOFA 3AI0A 5HOSA 1ZOXA 3QEHA 1IFHL 2BCKA 1GNYA 1W32A 3WH5A 1R64A 5AUMA 1NEZB 1NBYB 3QWRD 4YFEA 5F1NA 3C87A 7CGTA 1QRND 3L3HB 2WO1A 4WI6A 5E0QA 3QEQD 4LHSA 2WHMA 2GQHA 3LRSB 4BZ1L 3QDGB 1GH7A 3RWIA 5C0BE 5C0JB 5T1DL 1KGCD 4WNQA 5T5FH 3GBEA 1FC2D 1MFEL 1XNAA 5EZJB 3O3EA 3FFDB 1C91A 5A6LA 3QNZA 4HPYH 4N9OB 3EDDA 2XWBB 3OKLB 2EXYD 3LZFL 4GO9A 4G8EB 3HLAA 5DYOB 4Z2JA 4U6HB 3FO9A 1NBVH 1F3DH 4PJ8D 3AHVA 1MELA 4FNLH 3F6LA 4P5KB 4YHKH 3A21A 2CDEB 4XAKE 2WBKA 3D85B 1LDSA 3TZVA 3HI6L 4NQED 1L0XA 1K8DB 4Z77A 3WENA 2OJEB 1K9TA 2GCYA 2MKLC 4NFCA 5HVFB 2Q87A 3LPPA 3ILQD 1TG7A 4NSKA 5AZ2L 1YHTA 2R69L 3TBYA 3NDYA 2YC1B 1QNPA 2YN3A 1W0WA 3QIWA 2W4XA 5KS9F 2HLFD 4HWUA 4YZFE 3HG1D 4B0MM 2Z9TA 1SJXA 2NPLX 5D9SB 3QUXD 1LO5B 4AIZA 2XTJC 4AAXA 4YJZL 1A64A 1AGBA 1DVFB 2WZHA 1H3XA 4QX0A 5EU7E 2EDKA 1BFVL 2P8PB 5JDJA 3HI1A 5BJTB 4TVPD 4XBPB 4YHOL 4OZFA 1XNTA 4JY4B 3PGFH 2NCMA 1GOGA 4XVSL 3RU8H 1QR1B 5JORB 1S8DB 4MQ7A 1EOKA 1S7RB 3HI1B 5K33A 2ADGA 2VRJA 1N7MH 2VC2L 1AH1A 3DXAD 4HPYL 1HINH 4XXDA 1QNZH 5DRZB 1J0YA 4JKLA 4CDHA 5GGTA 1G5AA 4Y2DB 1OARL 5FGSA 2V2TB 4PRID 4UT7L 4F9LC 4HTYA 2AK4D 1X7QB 5E8NB 3AQUA 2OJZH 3QUZD 2EDQA 3KPRA 3VD9A 4X0NA 2X4SA 4M24A 4EK7A 5JQ6L 1MFCH 2CR3A 4H0IA 3SOBL 1VIWA 4RAUA 2VABA 3QUYB 1VF8A 5ID1A 3RWDA 5MEPB 4V2XA 2GK0B 3O4OC 3WIIL 3GMMA 4RFEA 2XTLA 2FL5B 2B4KA 3MBXH 3IDXH 2AEIT 3RHWK 1V3KA 1DWGM 5EO9A 3C5JB 3L3JB 3O4LB 4LVOC 3SE4A 5CGTA 3EZ8A 1XGTA 4CD7A 5E6ZA 4KK9C 2J7LA 3BEWA 4LCYB 1YNTA 3U7VA 3V52H 5F9JB 3TJEL 4NQEE 3D5OF 5ABGA 2AJZA 4M1GH 1VACB 3F7YA 2EZ0C 4U0RC 12E8L 2XN9D 3U7YL 1HP4A 3GNOA 3OGCA 1UQZA 3FQTA 4F9PA 3F7QA 3O45A 3K80A 4W8BA 4PTUB 5A6BA 4LLQB 3CTTA 3I97A 4K07A 1D5IH 4OV6F 2ZUQB 3GSVB 2J1KA 3HRZA 4AT6B 5F3BA 1PG7W 3O45B 3JWOC 3RL1A 3GHBH 1JPSL 3F7YB 4FN0A 2HT2C 1BQLL 5C71A 5GNXA 2OSLA 1I1AA 1E6ZA 4OGAC 3RUGB 5BRZB 2IH3A 3BW9A 2VH5H 3G04B 1ORSA 3CK0L 1HSBB 3DGCR 3CDGB 4NQXA 1KBKA 3FCTB 4YHGA 4TSBH 5EORL 3TBTA 1GORA 3OAYK 3QRFM 3UESA 4MX7A 4BJ0A 4P5KA 2LAGB 2AGJH 1WT5A 1WWAX 5EOTA 2APWA 1E6XM 1U0QA 3PWPA 3S34H 2GK1A 2Y23A 5FCSH 1XCTA 3G6DL 3QUMA 2ZJSL 2QSCL 2EDTA 4ZE4A 3QG6A 5EU5A 4MA1B 5CPSA 3G04A 2CGRH 4R3SB 1HZHH 2VISB 4XURA 1U8IB 3CSPA 5E94A 4PJ7E 4Q9RH 1CLOH 2GT9B 2NY1D 1CVSC 5DYOA 5I19L 2XA8H 2Q8XA 2LW8A 4XPBL 5KSBB 4KKBC 4MXQC 3TH4T 1R5VA 1CXHA 4P5TB 2E7CA 1IEAB 1I1RA 1JL8A 3NOIA 2D3VA 2XN9A 1C5BL 4X0VA 3CHEA 4LFHG 4W7VA 2XI9A 3A6BL 5D7LE 3HNVL 1AP2B 2XFYA 4QCIA 3STLB 5LCWL 3DETC 2X9YA 4GQ9L 1LEKB 2WVSA 3UG4A 1DQTA 2AQ1A 1QLFA 4LVEA 1OBAA 1FBIL 1E6OL 4IPNB 5C9KA 5ADPH 1I9EA 3AFLA 2WYSA 4D0DB 3MFGB 5ADPL 3FB6A 3O2WL 4D0QA 4BS0A 2DQJL 4KK5D 1BAFH 4P23B 3CH1A 1XF1A 1HJVA 1PSKH 3N11A 4F7MA 3L3GA 1H3PL 2GAZB 1G1CA 2DDQH 4Y5XC 1EFQA 1S7SA 1OF3A 4Z6AT 2DQGL 4WUUE 4P3DA 3FZUC 1EXUA 1FFOA 1DUYA 1ZANH 3HFML 4OCSL 5T1DH 4LSRH 4PRWA 4LRNL 2UWEA 1CGYA 2FHBA 5C0GB 3OAUL 4LPXA 1YY8B 4LHJB 1F4WH 2XTJB 1NDMA 2JEQA 2E31A 1NOWA 1NAMB 1F3RB 1IAIL 3RJQB 3ZKQD 2QTEA 2ZEZA 3IFPB 4NCDA 1GZQB 4JFPB 2WQ8A 3ZE2E 1K4DA 2V5DA 1OINA 5FHAL 4J8RA 4X98B 1N3NA 2ZEXA 1NP0A 4OSUL 4MTVA 1A6WH 5ABEA 2H32A 4PJGF 1ADQA 1R3JB 2X4QA 1OM3H 3UP1A 4X4YB 5EULV 3IFLH 2I5YL 4WGVB 3P4OA 3TT1L 3W24A 3IDNB 4WJXA 2AJSL 4XC3L 5T3XH 3T04D 4NDMA 5IHZA 5MHSE 1E0OB 1D5ZB 4DOHE 1FC1A 4UQ2A 5JHLH 1E4JA 2EIZB 4PJDF 5DMJB 4KRMB 5TQ0H 5KSVB 1YMMA 5EH1A 4DKFL 3ULVF 2VDQH 5DK0B 2WZ8A 4FQLH 1TVHB 1D9KB 1K8IB 2C7UA 3KR3H 2GK1B 1CXIA 5EO1B 4NM4L 3CSYA 5L2KB 4H04A 1XCXA 4NT6B 1MVUA 4UIMB 4EDXB 3MNZA 2GDUA 2DB8A 1GYAA 3QCTH 5IFAL 2E3ZA 3AROA 4IS6A 1T4KB 2DI8A 3MU7A 4UQEA 4YWGH 5C2BH 5AZEL 3HZKB 1IAIH 3CHDA 1MFBL 5E0FA 1I1FA 2EBNA 2DL2A 1H0DA 1INEH 5FYJE 2JIXD 5FOJA 3O3DB 1F6LL 3MREA 4HGWA 4RMUA 1W72H 1X5GA 2A6KA 2R1WB 3N1FC 4NZJA 2E27H 4X6DA 3L3DA 4MS8D 1NCCL 5CILH 3S88H 3OA5A 3TFKD 1GU3A 1CYGA 4NUJB 3EYOB 5L0QC 2AKRA 4PRDA 3T2NL 3UTTE 2Z4FA 2CKBA 2E6JA 5ITFB 1G7LB 3UZVB 2EXOA 1EO7A 1G6VK 1NMAL 2DQUH 1FYHB 2H3NB 7FABL 4UAPA 1HI6A 4GW4A 1OW0C 3FQNB 3SCSA 4PT6A 3P4MB 3BXNA 3O6FD 5DURB 4KHTL 3MFFB 4U3XA 5GQBA 1TJHH 3S4SA 4ZTOL 4W8JA 4XPTL 1E4WH 1X6NA 5IB1A 4QY8A 3QUKA 5BQ7A 3LKPB 5D6DC 1I3GL 4XCEA 4M81A 1KPVB 3OB8A 4UZSA 5E5RB 4G80B 3O4OB 3S96A 1QRNB 3NCMA 4HS6A 4XI5D 3U0TB 4A3YA 2A73B 4R97B 3AHZA 1NMCB 3LRHA 4DEPC 3QUYA 2VABB 2CLZA 1UY4A 5DVNA 4WLCA 1OQOA 3P0YL 5E7FA 2XOTA 1I9JL 1INQB 4HK3J 4OFVA 2ZEYA 2JK5A 4UFJA 3FO0L 1N6UA 4KXZH 2DSVA 4EZMA 5HI4D 1FVDA 3AIEA 2Y5TA 3IJHB 2ICWB 4P5YA 4MAZA 3JV4A 1JMZA 1JZ8A 2JEPA 1CWVA 3I3BA 4S2SB 2J88L 4KKBD 4MXQD 3C5SB 1PBYA 1M05B 4QHLB 3BLPX 1X4YA 2C0HA 3REVA 1UD8A 4P3DB 1DBML 3QIUC 43CAB 2Q8BL 3N1PC 3C5ZD 1S3KH 2WC4A 4XCCL 3RWDB 2F5BL 3BH4A 3BX7C 3CU1A 4PJDA 1JRHH 3L9RB 3ARDB 5IFTA 3N9GH 2BXYA 4XB8A 4OD1H 5I73C 2YD5A 2PXYA 3RBSA 1KJMA 4G8FA 1V02A 1BQHG 5DQDH 4YBQC 1YJDH 3BIAX 3PUHA 1RK1B 1UGNA 4YZFF 4DFHA 2XFXA 3SBWA 2W66A 3SJVE 1K4DB 2I24N 4PJDB 2F61A 4ZODA 1H5VA 4HOWA 2HJLA 1A6UL 1I9RH 1R5IB 5DTFA 4WW2B 4X9YA 3VIKA 4I9WE 1HILA 1BQLH 2OWWA 4A2LA 2RGMA 3Q5TA 3C60C 1FG2A 4CMHB 1TMQA 2VDKL 1P4LA 3FO9B 5EN2B 2V3GA 3MKKA 1Q6FA 1H0DB 3W26A 4RGMC 2BSTB 1JYXA 3EOTH 2XWBA 3OKLA 1U8NB 2E5EA 1I3RB 2VDLH 4UNTA 4CDGC 3C8HA 5I8CA 2CRMA 1AR1D 2ZX9A 4XXCA 4QNPF 4UFMA 1FORL 1BPLB 4L3EA 4PJCB 4U6XB 2C7UB 4OD2B 3VMOA 4PJHE 4YPGB 5C0JA 4PGDB 2R4SL 3HCVB 1J8HA 3IDYC 3V0WL 3WFDL 4AEIL 3DUUA 4GKSB 4LCUA 1U3HD 3NCJH 3NCYP 3GUTB 4MZ2A 1WJ3A 4DN3L 2CETA 1YQ2A 4N0RA 4O2FA 4LGSB 1W1VA 3OZ9L 3GJFH 2Z92B 3ULVE 5IMLA 1CLXA 1W8NA 1QA9A 2QSTA 4Y4HA 5HI5D 2P49B 1S78D 1KJ2L 5CPQA 4DEPB 1J10A 1JV5A 3O3AB 3O9WA 3IS1X 2V9RA 1ZEAL 4QCIB 1EK3A 1G7PA 2CERA 3FO1B 4OUUB 3IDAA 2WWMD 1N2RA 4L0PA 2VLRE 2JDAA 2QADC 4LGPB 3LCYA 4M93B 3KPRD 1MJJB 4JO4H 4KK9D 2OXGA 3RZCD 2WV3A 1Z32X 2A3EA 4PRPB 5KVFH 2RIKA 2BVUA 1G7LA 1N64L 4ONFL 4P23C 5IMKA 4LCIL 1WZ1H 3DV6A 1DWIM 3UR8A 2XPGB 2YZ1A 1UVQA 1H8OA 4LKCB 3BD5A 1CDHA 3L5XL 5T3ZE 3HC3H 4F7CB 3HAEG 5JLZA 4BA8A 4ZS6C 2KQNA 4F7TB 3RGVC 2O9PA 2ITCB 3EDFA 3FFCD 3W5NA 2RQ8A 1SBSH 5HHOB 3VFRA 5D7KD 3O2VH 2YK1L 4JDVB 1A22B 4KK6C 4Y1AE 4L5FL 4XP9L 4GAYB 3BP5B 3WIFB 3SKOB 4QHNA 1KUMA 4W7WA 3ZTJH 3MZTA 4BZ2H 3QDMD 4TSAH 2CLRB 1A7NL 1S46A 3AIRA 3BP5A 1DHKA 4UR9A 4OQTH 2P5WD 3DUHA 4L4VA 1OAQL 2X4OA 3VFWA 5IT2H 3KHQA 1XF2B 3P11H 2N56A 1OLLA 3PQYE 1K3IA 2WWMC 1FO0L 4LPWA 1WFUA 1ZGLA 1DL7L 1ZBCA 2Z8SA 3WXWL 3ALPA 5SX5H 1I4FB 3DI3B 4NNPH 3ZM8A 1MFDH 3H9HA 3S37L 4K7FB 3QJHA 3DMMA 3KG5A 4HT1H 2J8FA 3ZJ8A 4D6DA 1X5HA 4LSPL 1BYBA 2AJXH 3D18B 4XX1G 5LGHL 2D31B 3QUZB 3ARBA 3D39B 5KSAC 3HUJF 4PJ8A 5CSZB 3WJLA 2WINA 5KZ6A 1L0QA 1WZ1L 3EFDH 3UBXA 4AM0A 5EA0L 5FAAA 2A6DA 4P5TD 3MO1A 3MV9B 4QXTA 3ILQC 4FQCH 3U2SA 2PTVA 3FL7A 3T08A 4Z7WF 3MRPB 2VDLL 2CIIB 4YHPA 2XG9A 1T03H 3RPMA 4AG4H 3W5MA 3WDIA 1EHAA 3ULVH 3RMEA 2AJ3B 1WEJH 3TTSA 1QSVA 1JN6B 1QBAA 2J8UF 1EBPA 4R26H 2YFUA 1KYOK 4GOSA 4Z0XB 3GGWB 1NCBH 3CX5J 4N0CD 5C6WH 2N4IA 3GIVA 3THCA 1OAKL 3MJ7B 1RURH 2PXYC 3IJSA 1YYLL 3OMZA 1LK3L 4GJTB 2ZCHH 3FFCE 4NO0B 5FYLE 4DCQB 4K3EL 5CJ5A 3I6KA 1C90A 1J1XL 5MP6L 5IROA 4WEBL 4GBXC 3EJJX 2VZPA 5ETUA 3DUUB 1N4XH 5ILTL 1FNGA 4JFFA 4YBQD 3R8QA 3RDTC 3K4ZA 2X70B 5A3HA 1HJQA 2IPUG 4P7OA 5F9OH 3PDGA 1JYNA 3L4UA 3MRJB 2FGWH 4JQIH 1NBZB 2IF7A 2FGWL 4JQIL 4EN3D 1TZGL 2O5YL 1CTOA 2RFXB 2YEZB 4MXVE 5H94A 3AM8C 1FLRL 3KHOA 3EFDL 4G8GB 4LSVH 1Q0YH 5D1ZD 5K9OA 1T1WB 5I9QB 1YPZB 4FFWD 2MTPA 4AL8L 4XCNA 2JLLA 2Z31A 3K4AA 1UQYA 2EC8A 5DMYA 3OG2A 1SBSL 4OI8A 3ROOB 2DS4A 1MWAA 3QPXL 3CLWA 4QXWA 1JNNL 3MXVL 1QHPA 5D1QC 1S9WA 1UEYA 1Q6CA 3PXJA 3EYOA 3VXSD 3ULUH 4M4RA 1CE1H 1WEJL 1YPZA 1JNLL 3EYPA 3B3IA 2B5IC 5M5DA 3N9GL 2ICES 5I1IL 1X5KA 3ARBD 1IGTA 1IGYB 4TX6A 1BEYL 1D2KA 4N0YH 5HD8C 4C4KT 1ZTXH 4M62L 5DD5L 4N0YL 3BH9A 3GSOA 1I7RA 1KG0A 4ZFOL 1PLGL 2EDOA 3SUWA 1H3VA 1D6EA 4L9LB 3KEHA 5J6HB 4PEEA 3O3BA 3B2VH 4JZNB 2HTLD 4MQXD 4Z7VB 4Z0BL 5GZNC 3U0WL 1TTFA 5TH2B 4M5YL 4JPVL 3I75A 5ESQB 5GGSB 2IG2L 1A4JB 3FKUS 5FYKD 2Y24A 4XMLH 4XWGH 1DQDH 1RI8A 1KIQA 3GBML 3RGVD 2E32A 3B5HA 3RWEB 3PZ9A 1MHHA 1BQHB 1R3IH 4JREB 4JY5L 1PD6A 3HUJB 1YN6B 4BFEA 4LHUB 3BE1L 2X4SB 3MYZA 3ZLQC 1TVBA 4PTWA 3T4AB 2A38A 1UWTA 2XOMA 5EU3B 3V0AC 1FL6B 1JRHL 5HPMA 1UG9A 1WBXA 3GJEB 5IOPA 5E0CA 3QG7L 3HNYM 2ZUYA 1CDYA 3G5XA 4J23A 4HWNA 5EZLB 2F19L 3HPLA 1AE6H 1MNUL 3VM5A 1AC0A 1A7OH 4XCFL 1IM3B 4ZNEE 3RIFK 4DKDC 5ICYA 3BHBA 3KYOA 4XNQA 3J8F7 5F1NB 3X12A 4DTGL 5FOOA 2XWTA 1WCQA 4RGMB 1IQDB 4YEEA 2J8UB 3M45A 4N5UA 4LPTA 5GRJL 2DRUA 2NW3B 1GHSA 2BJML 3MC0A 3IETA 4CW1B 3U7BA 1RZ8A 3GYCA 1XR8A 3MSPA 4AD4A 4HV8A 3VXPA 1GUIA 4M6MH 1CXLA 5C07B 3SGKA 1E9LA 4D6GA 2O5YH 2G60H 2YMXH 1BM3H 1XGQA 1QFUL 2XSBA 1A3RH 2BXZA 3MRMB 3N0PB 3UTOA 2VAAB 4JFDB 4PJAE 3TNMB 5B8CC 3L7EB 4M7KL 1NCWL 4Q6IB 1ZWIB 2BVQA 2F2HA 3QXDB 3GDBA 3VFOA 5BRQA 1MREH 4P9MH 4Y4HC 4GKNA 2W9EH 1CXKA 3NYDA 5SWQA 3TO4C 3L3DB 1ZVYA 4RIRB 1GHFH 5SWZD 2MFNA 5KSUA 1XCQB 4D6HA 1PEZA 3O3DA 1S7TA 5FFLA 1UYXA 3E3QC 3VG0H 2QQLA 4U3HA 1A14H 3FQUA 1OGAE 1JI2A 3MJ9H 4LLVB 3HMWH 1I8KB 4E5XA 3VINA 1PIGA 3TBSB 4JGMA 3D69B 1JZ2A 4S1DD 4HUNB 2VUOA 1B3XA 1EEUA 1QHZA 4OAWA 4ZXBD 4P5TC 3RWFB 1K2DA 2EZ0D 4KH2A 4CKQA 1S9WB 1AQKL 1DQLL 3IDYB 3VM7A 3T0DA 4JEGB 5KW9H 1DQLH 3PHQA 1K2DB 1GC1H 5C8BB 1ZT7B 3RQ3A 3PWVA 1RHHA 3IIIA 3FQXA 1KCVH 2W65B 5C0FB 4Y4KC 4H8WC 4S0TD 3MRKA 1QLRA 4MA1C 2WVVA 4B50A 5IM7B 1US2A 2QQIA 4XMKH 2ZUVA 3QQ9C 1E1FA 2M26A 4PBXA 4I4WA 3GBMH 5DR5H 1QI4A 2WMFA 5GGRA 4PMYA 2X4PA 4KTDL 1A4KB 1U8PA 1NKRA 4J3OC 4U7KA 4N90E 5FDYA 4WU5B 4WWKD 2GHWB 4UAOC 2DLTA 1SR0A 3ARBC 4E41E 2H8PA 4QHLA 4PJFA 3KXFB 2VR5A 4N1EA 4GZ9A 5SWSB 4JFXA 4G7YH 5JW5A 2GW5A 4LKXB 4JFOA 4UNIA 1M1SA 4M3KB 5C86A 4N5EC 2EKSA 1RPKA 4JFYB 4MDPA 1AD9A 1U8KA 4WK9A 5D1QD 2R0KL 2XGBA 2P5ED 2V5MA 2IXUA 3QDME 2J1RA 1KJVB 1Q9OA 8FABA 4Y2DD 1CR9H 1XR9B 4X9FA 1T6VN 3DBXB 4MB5A 3WUWA 5CP7A 4O58L 3OLDA 4PJAF 2NXYD 3S8WA 4HWEL 1QSEA 3NAAL 2OXHA 1RK1A 4H7VA 3U4BL 1A6TB 3MO1B 3MV9A 3NSMA 4QCEA 3MJ6A 4KKAC 4WW1A 4CD5A 1K45A 1SYVB 3UG5A 4L4TB 4PJGB 4JJ5B 3U46A 2F9BT 3HMXA 5IVXE 3X3FH 2D9CA 2OYPA 3UTSD 2WCAA 1DEEA 1KB5H 2EC9T 4HQQL 1TFHA 4AMKH 3PZQA 4EUPH 4HQQH 4BKLB 3E0GA 3BEWB 4LCYA 4ZO9A 5C0BB 5IQ9A 1A2YA 1S7QB 1TETH 4M61A 1KGYA 4QDRA 4M82A 5I8KH 3H9SD 3N9KA 4HKZA 3ZO0A 4E9LA 1F3JA 3RA7L 1DLHA 3LB6C 4KC3B 43C9B 5C08A 2WMIA 4WHDA 4DKEH 5CWSB 3ZE0E 1U8HB 3MJ9L 4KDWA 1U3HC 4H20L 3WSQL 1K5NA 2LQRA 5IEKB 3IFOB 1IT0A 5BMFH 4FP8L 3SE3A 3WD0A 5E2WH 3RL2B 3GSUA 5DJCA 3UTZA 3GI9H 4P48A 1RURL 3B4NA 3RM8A 2X4NA 1GXEA 1S9XA 3QHNA 2PUQT 4HUVA 1B0RA 5ID0A 3TWCH 1ZJBA 5TGBA 1GC1L 4A2MA 4PD4J 1QACA 4RFNC 1J11A 3OAUH 1UZ6E 2CESA 2BC4A 3UPRB 4LBEB 4UINL 3AYRA 3V4VH 4AIEA 4WENB 4NFBA 1HINL 1KWKA 2I60L 3UJIL 5KN5B 1JTTA 3VXUE 2EO1A 4IJ3B 3P9WB 2JB6B 5DJCB 2XY1A 2CLVB 3T0EA 5J13B 4UIKL 5IB1B 3MCLL 4NKIH 5DZNA 1N0XL 7TAAA 3L3KB 4BYHA 1CQKA 1DE4B 1L6ZA 2XGIA 2G3IA 3ZT5A 2G75A 4HS6B 3F5JA 4GQRA 4GAFB 4U1NB 1AGBB 1BIHA 4F15C 2LABA 3PGCA 3BWAB 3FQNA 3CFDB 4OUUA 4APQB 2OQJB 4JRXE 4I0PD 2YD8A 3VXRA 1HF6A 2ZICA 4G8GA 1RZFL 4NJ9L 2AEQL 3MROA 4AJ0A 2DQTL 5H35B 4UFLA 1KFWA 5KVGL 3VCLA 3WQ4A 3PWNB 4MO3M