2VZSA

Chitosan product complex of amycolatopsis orientalis exo-chitosanase csxa
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
857
structure length
857
Chain Sequence
LSVGAAAGNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 283
structure length 857
sequence length 857
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzsA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzsA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzsA03
3EYQC 1T0NA 2RCSL 5I74C 1CL7H 1CFVH 1MCCA 4V2BA 4NWTH 5INCA 3V0VA 4X7TB 1FV1A 1QSEA 3QUMB 1UXWB 4HIEA 1T83C 3FO0L 1KEXA 3DBXB 3VWKA 2DLHA 4KH2A 4NQEE 3U48A 4H8WL 2VDOL 43CAB 2D03H 3RRQA 1BBDH 4RISH 3QIUA 2XACC 1HH6A 1B3YA 2EYSA 4MNGB 4DUVA 3P30L 4ERSH 5DMGD 4JFFE 4ZFOL 3GXMA 3OLIA 2IQAB 4UAPA 4YGAB 2EYRA 1FH9A 1SY6A 4AH2B 4XZUB 4NCC1 4QTHB 4WY7H 3UTZB 3IJ8A 4HC1A 3VGDA 5JNYB 2FH6A 1J87A 1GZQB 4TSBH 1AXIB 1FPTH 3NVQA 4OCRH 4Y5VC 5E8EA 3BAKA 3DXAD 1PX3A 1FAKT 4LFHG 4P3CL 2VT0A 1TPXB 3BH8A 2VXQH 2ZUWA 2XG5A 3H8NA 1HSAB 1NLBH 3UNPA 4OZ4B 5DT1H 1CFSA 2GK2A 3UEZA 2O9RA 4QCEA 1YEGL 3C6LD 4YFLI 3WD0A 3GGWA 1ZVSB 4UAOB 2BDNL 1I3RB 1Z3GH 1JGLL 5I1CH 4I0PD 3UTTA 1QRKA 1MW2A 4WFFE 4MS8D 3HG1E 3F8UB 4E42B 2AEQH 4ZUVA 1A7QL 3OWEA 2XG9A 3A4XA 4QRSA 4HPGA 4X6CF 1D5IH 1L7TL 5E8NA 2XWJB 1UB6A 1OAKH 4PRPB 1IC4L 4JFYA 1UQZA 3KL3A 5HD8D 2PYEB 4Y2OA 4HV8A 3UPAA 1G6RL 4H1LA 3U4EB 5MEPA 4GXPA 4IRSA 1A4JA 1W9DM 3DLQR 4FF5A 4HBCH 1DN0A 2R1WB 4QFUA 1QBLL 4OOZA 1QFWM 5BMFH 3MRQA 3QXWA 4KRTA 2Y5TA 4H1LH 4Y5YA 4AYFA 1JU3A 4LOUD 4GKNA 3LS4L 4JPWL 1QOKA 4M56A 5C07B 3CHEA 4HX1A 4Q0XL 1X4XA 1RJYA 3EMQA 3S35X 4O2EA 2WVTA 4EI6A 4M61A 1A7PL 2HAZA 1YC7A 4HWBA 3W11C 1E4NA 2YEZB 1XHGA 1TMCB 2R4SH 2BRRL 3WNNA 1VRXA 3AMGA 3VJ6A 1GU3A 3CXDL 5EFIB 1JWUB 3BPOC 1QKZH 5IT2H 4KRPB 1I1WA 2HVJA 3JV4A 4HWBH 2NR6D 3BKJL 3MFFA 1ZT1A 2IPTL 4MZ3A 5FYJL 3PQYB 3A6CL 2ZE0A 3QIWD 4MHHI 1WISA 4UILH 2XFRA 3KZSA 4P59L 2ZNXA 1X5LA 2MCPL 1IT9L 1QFWL 2W07A 2ICWA 5DJZA 5E2JA 1CIUA 5IHUL 1H5BC 3FQNB 3HE6B 3ZHKA 4MAZA 1RJZA 3S6TA 3GIZL 1H0GA 1EEYB 2W0LA 4YDKH 4M6AA 4TX8A 2EH8H 3HC4H 2J5LC 2O9OA 4XP6H 3VGAB 3NFSH 3QXAA 2VDPH 4KQ3H 5DK2A 4JFSA 4EUPA 1FZJB 1UA7A 2FX8H 2Q8XA 2WHJA 3GMOB 4L8CA 3A7QA 3WQWA 3RBSA 4RFNB 1MFAH 2WIIB 4LBEB 1NQ6A 5G04L 5FO7A 1IKFL 5I1LB 2YLLA 1A6WH 4EUPH 1ORSB 5DSCA 4X7FC 1E43A 4WNQB 1E72M 4F79A 1JNHA 4KMLB 3ULUE 3EOYG 2XFXA 3EDKA 2NPLX 4TNVF 5DF0A 4POZC 1WICA 5GS1B 5ECJE 4PJ7E 4P2RA 2CBVA 4QY8B 2ZP0T 3VD9A 3DC0A 5F9OH 1QFUH 3TN0D 1K9DA 4HA4A 4NHCL 4RWYL 4RGMC 4HKZA 3KPRA 4I18C 1RZIA 4HJJL 5DVNA 4YXKL 4CUAA 5DRXB 1YNKL 1S7QA 4X4MA 1R5WB 2RJMA 3B9DA 4G9FD 3NFNB 1HHHA 3O6MH 4MSWA 3AHXA 1V6UA 1LEKB 1W72L 4PJIA 4IRJB 5SWSB 3OLEA 5HGAA 2A77L 4LHUB 1VHPA 4MAYA 4WI2A 4O51A 4H8HA 4R7NB 2IFFH 3THMH 3NCOA 1N6VA 4KGLA 4AD4A 5EBAA 3D69A 4YQXL 2DIAA 5F1NA 4WFGD 3SO3C 4X9GA 3ZMRA 2OR7A 4KQ4L 1EDTA 2E33A 1C5DA 1D9KB 3JTTB 4QHKI 1HYRC 1JZ5A 3WN5B 4F58H 3WELA 3KXFA 1ZTXH 2EECA 3MRKA 4XVTL 3IDIB 3AROA 5DJCB 5C6TL 2ZOKA 1VFBB 3NAAL 2BY3A 4Z2GA 3S4SG 4JRYA 4Z0BH 2NT0A 5JDJA 5E8DL 2A3CA 1IM9D 2WUBH 5JMOC 1EGJL 3WFHB 2VLKD 3ZT7A 1VSCA 3GM0A 4X4XA 1DTUA 5DMIH 4RX4A 3OKLA 3CFJA 1SMDA 1FSKB 4KZDH 1I4FA 3CH8A 5EIYB 2GSGA 5IFJA 3TJHD 1HINL 3FFCD 4PYHA 1AQ0A 1NGPL 2OQJB 3MV7A 3ZOAA 1ITCA 3TO4C 2P44B 1KEGL 5TJWK 3OG4B 4BQ8A 2AP2A 5GZOC 5D2NA 3C7FA 4LFHD 4KK5C 5D9NA 5DFVC 2R56H 5CJ5A 4GQ9L 4F7MB 4J8RA 1U95A 4LP4A 5IESH 3KPMB 1CZTA 1BGAA 3QEHA 4Y4HD 2JIXD 3QWQB 3LE0A 4KHXH 2Y7QA 4FQXA 2YPLE 1R3KB 4MA3A 4X99A 1VBUA 1AXSB 1U8OA 5ID0B 3UG4A 1AIFA 4NO0D 1FP8A 1R3JB 2VLLB 3MNZA 5GGVH 1MLBA 1JPTL 4KMTL 2HN7A 1U41A 1K4DB 3MLXH 5D6DA 3TVMA 1IQDC 5FYLH 1QFPA 1UFUA 3VXUE 1XCTA 3OB0K 5JW5A 3GSXA 2FECI 1Y0LA 4NZTL 3EBAA 4ZUWB 3QUXC 5HHNB 3T2PA 3ZTNH 4IS6B 5F7WC 4P8UA 3M07A 4PJGB 2AJUL 2BNRE 1A1NB 2W87A 1EXUB 4JRXD 3JXAA 5JHDB 3PGDA 5GGRB 3U7YH 2Y6LA 1A4KB 4KMQA 3WD2A 3NA9H 2YPVH 4JKPH 1VESA 3HKFA 3STLB 3U7WL 1BP3B 3JVGA 5EU6E 3CO4A 5I75C 4OIFA 3E8UH 2DICA 3MXWH 2FIKA 1BMGA 3FCTA 1KENL 4XBEL 3MV9E 1G9NC 4O4YH 2RIKA 5DD5H 1HWHB 4P48A 3T77A 5I1EL 3TPUB 4ISVA 4B53A 4OV5A 1P4IL 3MODL 5GGVY 1ZLSL 5DFTA 2R23B 5EZOH 1LP9E 1IGIH 3SUVA 4WEBH 5GRZA 1OF2A 4OLZH 5MEOB 1MUJA 1FQ9C 3BKYH 4D1IA 4K9EC 1QSZA 3DHMA 1AHWC 3QAZC 2ED7A 3OXSB 2WHLA 3TBTB 2KQNA 1Q0YH 3LKSA 2G8ZA 4NPYB 2P43B 3EJYD 1QVOB 5HDQL 4WJXA 3LN5B 4WU5A 3CZLA 2NYYC 4UI9L 2NY0B 1OGTA 1DBAL 3T1FB 1IGFH 5C7GA 2Y6SD 1GOGA 4QT5A 4Y16C 3D0LA 5FK9B 2C3HA 3MJ9H 5CJXC 5HDLA 4P4RB 4JZ5A 1M6OA 1U8PA 3T0XA 2BX5A 4ZZ8A 3FO1B 1T2JA 3HLAB 2CJUH 1MQKL 5E95B 1F11A 4XCFL 4DEVA 1Q38A 5CPSA 5DEGA 2EPOA 3ALFA 4X6FA 2JJSA 4PJEB 3ULUF 2LTQC 3C09C 3D0VB 1QPXA 4PGBA 4ZTOL 4EI5A 1KFWA 1NJ9B 4PJ7F 4QRUB 3SE4C 4P3DB 4NQCE 2YSSB 4AQOA 1R0AH 4KJWC 1DLFL 4Y4KA 2NY4B 4OKDA 4GRMA 4L4VE 1Q4NX 4HH9B 1D5XB 3FONB 5JOPE 4KPHL 5BV7B 4JO3L 5CKAA 2GFBB 5T3ZH 4NM8L 3WKNA 1HE7A 2W65A 3FTGB 3WBEA 2IADB 2FWOB 3ARDB 4RE2A 4W84A 3KPSE 3PUCA 5T3XH 4HWUA 1YEJL 4LSPL 1DLHA 4FFVC 4X5XA 5MEQA 2WZ8A 1C7TA 1OP3K 1JDAA 3BP7B 4Z8FH 2OSYA 4DWSD 5GRVK 4PJAA 3AS2A 3ARVA 3KR3H 4ONOA 4LU5H 5I18H 2J7GA 3LB6D 1IGTA 5LWYH 1DBMH 3FQRB 2BV9A 2OWWA 5IKCA 2IWGA 4O5LH 5DFAA 1R3HA 4OAWB 2HTLC 4TQEH 1UR2A 3BSHA 4P00B 2C9AA 1FNGA 1G01A 1AXTH 2DEPA 1UD3A 1KLUB 1BEYH 2BNQA 4IOFD 1JD7A 4WWKA 3IDXH 1NM9A 4M4PA 1NUDA 1MWAL 1D3CA 5F96L 3LKOB 3FN0L 4PSRA 4W86A 5HGHA 4BJ0A 1ADQL 5I1IH 1VADA 4GAGH 1BGGA 3MKKA 1UR4A 3AREB 2CHOA 2B4CC 4KJPD 5JW4N 1FFPB 5C0FB 4GO6B 1GUIA 3TYFB 4DKFH 1LF1A 3ARFA 1UADC 1HX0A 3HPLB 1W0VA 4DGIH 3L1OL 5AZ2L 1NANH 5D1XB 3BZEB 1QRNE 5FM5M 4UU9A 1ZBCA 3BVNA 5CGYC 5JORA 1ISWA 3QFDB 3JUZA 1WLHA 2DD8L 3PDOB 5JIHA 3AGVA 4FG6C 1TNNA 5B22A 1XV8A 4YBQD 1U8LB 3RIAF 5L0QC 2WVUA 4RYDA 5GRJH 4RGNE 3GIVA 4HK0A 1ZHKB 1TXKA 3RIAK 5FDWA 2QV2A 4JR9L 4LF3B 3FQUA 5EU4A 4U2ZA 2VDLL 3I3BA 4LCWB 2BHYA 3OR6B 2R2HA 1NCDH 4GBXD 4XPFL 2Q8BL 3V4PH 3FN9A 2MOVA 2VR9A 4JO2H 1GGYA 1OD8A 4C56E 1B0RB 1HL9A 5TE4L 5HHPB 5KSAD 2Y9RT 4YBLC 3BXNA 5DVOA 1OTTC 1D7PM 5CD5C 2DLFL 4O2FB 5I1HL 5J6GB 3HR6A 4YK4B 2BJMH 4MLSA 3GUTA 2WWMD 1AD9A 4R4FH 3P9LA 4R26H 5EOTA 3QCTL 5I6XB 4BQCA 1OAXL 1UOKA 1JGUL 4PJHB 3CDGB 15C8L 2I27N 1TJGH 2JELH 1WFTA 4JX0A 1V02A 1C7SA 3BSGA 2W3JA 3LPWA 3BZDA 3NCBB 3ZYOA 5JR1L 2FRGP 1LP9F 1SEBA 5IVXA 4P9HC 3LQMA 4LVNC 1HDMB 3IXAA 5CUSH 2D9CA 5F93C 1KJ2L 3W0WB 4PTUA 3V6OE 4Y19E 4P2QD 3VXQB 5CCKH 4K7PL 2FB4H 3AB0B 3TWCH 1MFEH 4P7OA 2HJLA 5DJAA 1Q6EA 5IFHH 5D7IE 3BKCL 5KVGL 2HYMA 4HLJA 2NY5C 1M1SA 4XCNA 4JFDD 4MA7L 5DUBA 3BO8B 3U0PB 1LDPH 3PL6A 4YC2B 1K12A 1DE4A 1T0NB 1JPFA 4UCFA 2B2XL 3MNWB 1DVFC 1GHFL 4IHOB 5INCB 2DM3A 1HIML 3QCUH 5LA1A 5C2BH 1B0GA 1FV1B 4KUCD 3F5LA 1QSEB 4D9LL 1WEJH 4HIEB 4UT9L 3CVIH 3VWKB 1QPKA 4UQ2A 4KKBD 3VFGH 3IVKB 3QIUB 4OD1L 1HH6B 3ULVE 2EYSB 3RUGA 5KW9L 3WQ8A 4LSUL 3PWVA 2HKHH 2I9TA 3CVHL 2JCCA 4RL3A 5IBTH 1E6ZA 3NDZA 1NCAL 1H6YA 5AY7A 5C0CE 2XVKA 3EO0A 3VW3H 4ZUUA 1GGTA 2FBJL 2AXHA 4UTBL 1CF8H 4NO2A 1TG7A 3CPLA 5I2UA 2V5MA 3BGFB 4HS3B 5E8EB 3MV01 1FCGA 1IAIM 1P84J 2W9LA 3WLWD 4M1GH 5F8QC 4CCCA 3BFOA 2GJ6E 3BH8B 3VFUA 5ALBL 2VKXA 3MZGB 4DN4H 2VDKH 5L7XL 3D2UD 2Y6KA 5F1OB 5I5RA 1FO0L 5FEBA 1C5BL 1CFSB 4NQDA 5H94A 2R4RH 4QXTA 2ID5A 2BVTA 2CXKA 3GGWB 1WT5C 4XC3H 4ATLA 2CKNA 4J1UA 4HFUH 1YYMH 4GAFB 5FUCE 5DD0H 3UTTB 4GRLA 4JM2B 3KEHA 1AR1C 1UMIA 2NQCA 2NY1B 4ZNEE 3WO4C 2ZCLH 4JQVA 1ZHLA 1KJVA 4M3KB 4ZUVB 3DX6A 1VFMA 1RULH 2XXMB 4QRSB 4DW2L 1FZOA 3MYJA 5E8NB 3VXOA 5LGJA 1HHIA 1UB6B 4OLYL 3KS0H 4JFYB 2F54E 5D8WA 4HV8B 4ZSOA 4FS0A 3W2DH 5MEPB 1IAIL 4IRSB 1A4JB 3MOBH 4I5BA 3FRPG 1U58A 1UKOA 4LKSA 1OGAE 1DN0B 1OOAA 5FA4A 1OAYL 4G6ML 2J7FA 1NWUA 3RA7H 3UJJH 4XP5H 3MRQB 3QQ3A 3B8YA 2Y5TB 4Y5YB 2XY2A 2J8UE 4XXCA 3TBWA 4RZCB 4TUOA 4LIQH 3QIBD 2ZX7A 5FF6A 4DM1A 4XWGL 1ND0A 4HX1B 4ZFGL 2BXZA 2FHCA 4HIXL 1JAEA 2PC8A 1RJYB 2HKFH 1ESWA 2EE3A 3H42H 4O2EB 2UWEE 4EI6B 4M61B 1JZ4A 1PIFA 2VISB 4MJ4A 4TRPL 4H88H 5DMJB 3WFBL 1A47A 4TVSa 3VJ6B 1U30A 1NL0H 5A2AA 1ZVYA 4MNQA 3FMGH 1XGZA 4OLXL 2VXUH 2H2SC 4PP2A 5HDOA 3C2AH 4OZGB 3JV4B 4FQJL 1OCQA 1YN7A 3MFFB 4CU6A 4WTZG 5C0ND 2XYLA 1ZT1B 5I19L 3SY0A 5I6SA 3BP5A 3WS6C 3AZRA 5IXEA 3IKKA 2V7NA 4FOMA 3VE0B 3HAEA 3K75B 1IQWL 4JFVA 1J0IA 3LV3B 4L3EE 4M7ZB 3RWEA 2EBNA 3P40A 4EN3A 2DCJA 4TTDC 5IV2A 5DJZB 2ICWB 4LCCC 3FT4A 4FQ1L 4KC3B 5TF1L 1RJZB 2CERA 2DQIL 1G9HA 5E5RB 2QQLH 5AWNL 5IBLC 3OAYK 1JUFA 2CR6A 3QXAB 1D6EA 4EUPB 3LKQA 5TPWH 2OWCA 1MAML 3VOCA 4L8CB 3BKML 3LPGA 3NN8A 5J6HA 5FO7B 3M7SA 1ZA6A 4PFEA 3V6OC 5DSCB 5CAYB 3TCLA 1JNHB 2MQ3A 3RX5A 3WD4A 1FGVL 1VEPA 5F88A 2XFXB 5C92A 3KYKL 2APXA 5C70A 4P2RB 1PEZA 5C9KA 2Z31C 4C58B 3U0WH 4GZ9A 5I8EA 4PG2C 4DM2A 4Y1AD 3TT1H 3OR7A 2NTFA 4HKZB 1QLEL 3KPRB 4MDIA 1RZIB 4PCTA 1S7QB 3S37L 3ARGD 3NOIA 1HHHB 4MSWB 5TFSH 1MPAL 4XTRC 1OAQL 5I24A 1U3HD 4PJIB 1K3IA 5DLMH 3GNRA 4MAYB 4CU8A 1F8TH 3RZCC 2NW2A 4X6EA 2C7FA 3DRTA 5D1ZA 4LARL 4OLUL 4NM4L 2XVLA 4HKXA 4QF1A 3D69B 4RAVA 5F1NB 2EEXA 1BJ1J 2D9QB 3UXFA 3N17A 4NGHH 1C5DB 1MW0A 1N8ZA 2JF7A 3VXSA 1YY8A 1I1AD 3KXFB 5DYOB 3MRKB 4C55A 1WBYA 4LVOB 2ZOKB 2WKLA 5AD0A 1NMAL 1ZLUH 1EHXA 4JRYB 2JJTA 1AJ7L 1SYSA 4P49A 5T5FL 1B6DA 4BSVA 2ZWZA 3SCNA 1QLRA 3GK8L 5GJTH 5F1SA 4XNMA 1FIEA 4AD2A 4Q6IA 4UDUB 1FNSH 4O9HH 3ABZA 4X4XB 2LU3A 1RU9L 3CDFA 3OKLB 3CFJB 4ZEPA 5B38G 3C08H 2GSGB 2X4UA 3KLHD 4E41A 2APVA 2DCKA 1OW0C 3KWXA 1OL0A 3MV7B 2XTJD 2IGFL 5E1AA 4BFIA 4XNZC 5KS9A 1CICB 5IROC 4C7FA 1QD0A 4I0CC 5DC0A 1B90A 1RUQH 3GRWL 1G5AA 4P4KC 1HJVA 3QT2A 3CMOL 1A6TA 5KSUB 2X9WA 4J8RB 4P3CH 1U95B 2Y6JA 4OCMC 2XVPA 4QOKA 1C8XA 3QEHB 1YNLH 1KIUA 2D7PA 3MA9L 4I2XA 5CEYA 1GYAA 3CUJA 2Y7QB 4FQXB 2KPNA 2ZEZA 2ORBH 4MA3B 4X99B 2PB1A 1U8OB 3VM7A 1AIFB 2JJVA 4S2SA 3MNZB 4PGCA 4YAQA 1MLBB 3GKZA 3V7MA 2HN7B 3TVMB 2BDNH 7FABH 4R96B 3ARPA 1Q0XH 1XCTB 1U6AL 5JW5B 3EYQD 5T1DH 2P5WD 1Y0LB 3HNSH 4I9WD 4XUYA 1G6RA 2AK4A 1WIOA 4CBPA 1J5OH 3GSNL 1E28A 3SKOA 1UY3A 1U2HA 1FH5H 4QRRD 4P5YA 2ZUQB 4Z95H 2D4DA 1XF5A 3EYOA 4XH2A 2Y5EA 4HLZH 4PJ5A 2AEPH 2XKSA 1KCRL 2J8UF 4N8CL 4WRLA 5EO9A 1QFOA 3MLWL 4AD1A 1C8YA 2FIKB 3FCTB 5DQ0A 1QSFE 2EIZA 2XN9A 2NCMA 3U46A 4CN6A 2DBLL 2UY7A 1TE1A 1GAFH 4ZAKA 3T77B 1YYLL 1CNVA 1R8LA 1LVEA 4K3DL 2UWEF 2JEQA 2WCAA 2KKQA 3GSVA 3SDYL 4ISVB 1GVIA 4L4TD 3NTCH 3BCFA 1CQKA 5TF0A 3KNBA 4OV5B 4P23A 1GPFA 5EFFA 1N2RA 2ZUYA 4OZOA 1FNLA 1NDMA 1UWGH 1ULPA 1WIPA 3IFLH 1OF2B 4JG1L 3QOKA 3B5HA 3BLKA 4NBYB 1Q9KA 5J13B 3DV6A 4E9LA 3MUAA 1HKLL 3K1KC 3AMKA 2NLJA 3BKJH 4HUXA 4D3CL 3MUY1 3RGVA 3C6SA 3LKSB 2BSRA 1U3ZA 1CZVA 3KJ4C 1H3VA 4LQFH 1GPOL 5CP7A 3QQ4B 3O3UN 5C0AD 2Y2WA 2MQCA 2XJ7A 1EK3A 1OGTB 3CQOA 4OZIE 5AYUL 1BLNA 4QT5B 3D0LB 3NCCB 1F58H 1P4LA 1T2QL 3Q5OA 2J6EH 2XFYA 4AD3A 2YA2A 4M7JH 1M6OB 2VN7A 2Y07H 4WHCA 5FYKD 1CR9L 3MSDA 2FECL 5FGBA 1F11B 4ORZC 3ZT6A 2IG2H 2C3WA 3ILPA 5E2UH 4MXQD 4PUBL 2IEPA 1FP9A 5ETUA 3RWCB 4AEFA 4Z7OE 1LO3L 4X6FB 1HEZA 3S36X 5HI3C 2O5ZH 1DEEA 1ONQB 4EI5B 4FHBD 4W5ZA 4IMKC 2VRAA 4ARXA 3CZJA 2YRPA 4Y4KB 1TITA 3AMDA 4GRMB 4DEPC 1D6VL 1HI6B 3I2IA 3OA5A 4KROC 4ZPVA 4RWYH 4XB7A 2BCKB 4JB9H 3ARSA 1IJ9A 2ICEA 3L7EA 2W65B 4HJJH 3AFBA 3TNMA 1YNKH 3FKUS 1N7ML 2NY7L 1J83A 2AK1H 4PD4K 5C9JA 1DLHB 4X5XB 3I50H 5MEQB 1HHGA 2DQCL 4Q6YA 3Q1SL 3MGOA 4QHNB 2ADFH 4I3SH 5DTFA 4OCXL 5C09E 4XMKH 2EO9A 4HWNA 2ZUMA 2QV4A 3JXSA 4XGZA 3SJVA 4YQXH 5IKCB 5DC4B 3U1SL 1R3HB 5CEZH 1JD9A 1S7RA 1FYHB 1J10A 1FNGB 2IANA 2OM5A 1CZ1A 1PKOA 4MQXC 2BNQB 4NN6C 1EGJA 4WWKB 4Y2DD 1P6WA 3ZM8A 2X4OA 2ZZUT 3NAAH 3H6JA 2WWKT 1PZ2A 2C7UA 4MVBD 2I5YL 1X5HA 1N64H 2FEDD 4PMOA 4XCCH 5HGHB 4W81A 4J6RL 4U5KA 1Q6DA 1DBJL 1BF8A 2MSPA 2UYLA 4RFOL 2AJSL 1JTPA 4LSSH 2VLRA 4M6OL 4XNXL 4AWEA 2ZCHL 3NRUA 4L29A 3CSYA 5GS2H 1B1YA 5GNYA 3ARFB 5L6YL 4QCFA 1AE6H 4MA8L 2UY2A 1W0VB 2ICWJ 3DSFL 3SCOA 1UWWA 4W5UA 4JG0L 5DURB 1Z6JT 1UMHA 4UINL 4UU9B 3BVNB 3ZYJA 5D8JH 5JORB 2A6IA 3T3PE 3ZKND 4JY4A 4PRHA 3THCA 1GL4B 3SDXA 1EMTL 1KC5L 1WC7A 4K8RD 3CSPA 5D9MA 1H9VA 2WBJC 4XXDA 4NC1E 1KN4L 3U30B 2YFZA 1P9MA 3DVIA 1A5FL 4NQED 5BOZG 3MRHA 5F6IB 4HK0B 3BDBA 4NKDA 3O2VL 3QEQE 5FDWB 3FFDA 3FQUB 5EU4B 5M3WA 3L3HB 4JFFD 1IGML 1BZ7A 1NGYA 1JP5A 1YEHL 4R2GC 2WCGA 4PY7B 3VIGA 4A42A 3ZJKA 2NY6C 3C60A 2YMXL 4BM7A 2IUZA 5DMYA 2AJZA 5EORH 4F37F 1FHGA 5IB3B 1G1CA 4CKQA 3ESVF 5DA0B 1WAAE 4LSTL 3BXNB 3ETPA 5ANMA 2Y64A 1U8NB 1NEUA 12E8L 1PMHX 4WO4D 1K6QL 3LRGA 3GUTB 4KRUA 1M4KA 4ALAH 5D7LE 1AD9B 1AP2A 1UB5A 3P9LB 4K3JL 1A7RL 1GXEA 3VIOA 4PV9A 4XBEH 5EOTB 3HC3L 3HNVH 2ZUNA 1S7XA 1WFOA 2VDNH 3BYTA 4W50A 4TNWF 3N06B 3TO4D 5G05L 2BFVH 1W99A 5GZOD 1CFBA 1SEBB 4TOYH 1FE8L 4RDQF 1SQ2N 1JGVH 5DFVD 5IVXB 3L2MA 5DD6A 3HMWL 4TNWK 1RUAH 4WFFD 4BQ6A 2VL5A 3OAUH 3HG1D 4PTUB 1OM3L 1PX4A 1SG3A 1HF6A 3MBEC 1WZMA 4M5YH 4XUTA 1GOWA 5CINL 2HJLB 5DJAB 1K9FA 4XNYH 4M5ZH 4YHNA 5KOVC 3ZLQC 4NQSA 1Q9WA 4XCNB 2WW5A 5IB1B 2RJ2A 1C5CH 4HS6B 4Z7NE 4Z7WA 5IWLC 4O2CA 3PL6B 1D2KA 1DE4B 4OLWL 1JPFB 1LK3L 4X0KA 5EFDA 2Y24A 5FYJU 3BMVA 4OZIF 3TA3A 4WFEE 5HSFA 4NFCA 2ZEXA 3GJFB 3QUXD 4N9OB 2EEDA 4KI5E 4EIZC 5D93C 3BIAX 3VX1A 4ZOAA 4UQ2B 3AXLA 3O3DA 1CGSH 4PRBA 3RUGB 2A83A 4NIKB 3BP6A 3PWVB 2YPKA 1DQQA 1G7QA 1MCDA 4ZO9A 1BYDA 4Z7OF 2I9TB 3PHAA 3IU4L 2FNBA 2JCCB 5ITFB 5CS7A 4PRPE 3UYRL 3ARBC 1A64A 4LRIC 3IFNL 5E2WH 2P48B 4XCFH 2PYEE 1KLFA 3MLSH 5IMLA 3EO0B 1SYTA 3V52H 3SDDC 3VIFA 4ZUUB 5HHMB 3V5HA 2XSAA 4F9DA 4OCYL 1NCUA 3IDUA 4NO2B 4MAUH 3X3GL 2X1IA 2XNAA 2BNJA 5BRZA 2XTKA 3HZYA 5ABFA 2D0HA 2DKSA 4UZUA 5IJVB 4DEQA 4CD6A 3VFUB 4JQXC 5I9QB 4WHYH 4MD4A 4OFYA 4MNLA 3D3VA 5C07E 1EAPB 4KPHH 4X7CC 4JO3H 2Q6WA 3P9MA 2YL6A 4NQDB 5HGDA 1P6AB 1XIWA 3VIPA 3L7FA 5H94B 4G7YL 2OK0H 4OZFG 4QXTB 4PGDA 5A6BD 4X9BA 4AL8L 3MU7A 2XT1B 4RGOL 1H1NA 3C8HA 4LASL 3TZVC 3DX9A 3CUHA 4JDVB 1T89A 4GRLB 2OR9H 2HLFC 4NRZA 3VI3E 1XF1A 2WDBA 1ZHLB 1EJOH 1KJVB 3DX6B 3VTRA 1FZOB 2NYYD 3MYJB 3VXOB 3ARUA 5LGJB 1HHIB 1KGCE 1GSMA 2ZUSA 4KK6C 1MWAA 1PD6A 1ADQA 3ULUD 4ZSOB 3VNZA 4G3YH 4I5BB 1MEXL 3AHVA 5L2KA 4PJ8D 5FA4B 1T7VA 3DX8B 3EFFA 1B4RA 2C1OA 4R3SA 1FAIL 5EOCL 3QQ3B 1I8MA 3FB5A 3L95A 3BIBX 4LKXA 3S34H 1UJ3C 1IC7L 3BUTA 3TBWB 3K77A 2QLYA 4PTXA 3SE8H 1RUKL 1I7ZB 4HUWA 4R8WH 4TUOB 1ND0B 2NY2B 4JREB 4XWOC 4XVHA 3KAAA 3N85L 4AC1X 1UWXK 1OAUH 1BM3H 5B21A 3T3PF 3IAGC 1II4E 1WWCA 5SWZA 1U9KA 4UFJA 3CX5J 1MH5B 4MNQB 2X40A 5DD3L 4U0QB 4PP2B 5JW3L 2FD6L 3SOBL 2XZAH 3BESR 3JWDC 3WXWL 3UJTL 1YN7B 3I3EA 4FFVD 3SY0B 3BP5B 4MB3A 1F4YL 5EIQA 1A3LL 4K3GA 3HAEB 3WF4A 4GG6A 1X5JA 4FXKA 5ACZA 1JRHH 1OD9A 4UQDA 3RWEB 2MNUA 5IV2B 4ODHH 3FT4B 5DRZA 2J7LA 4PN2A 4ATWA 2YDQA 4HJGA 4F15B 2HTLD 1LILA 3RWFA 4A3HA 5GNZA 4NFBA 2YA0A 4S1SH 1JUFB 5CSUA 1D6EB 3EYUH 1WAAF 3LKQB 1RZKL 4LPUA 1UUQA 1MFCL 2W0KA 3NN8B 1RD6A 4JM4H 1ZLVH 5J6HB 2AAAA 4LSRH 2AV7A 4PMQA 3O9WC 3VDBA 2HRLA 3TCLB 4HG4K 5JXJA 1QI3A 2YPLD 5FB8B 1TCRA 5F88B 1C91A 4PMDA 2Y1VA 2J8GA 1VF8A 1C3FA 5L8KB 2E7LC 1KJ2A 1KB3A 4DKEH 1IBGH 5I8EB 5A3IC 2A6JA 2A9NH 2WAGA 3OR7B 2FJGA 2NTFB 3IF1A 3MPCA 5JR1H 3EIFA 5DT5A 3W82A 2ZCKL 5CGYD 4LHSA 3VXUD 2ED9A 4FG6D 4N1CA 4KI5C 1C1EH 1KCSL 3MQIA 2NW2B 4HPOH 4IBLT 4IRZH 2BNRD 4LDEB 4X6EB 5D1ZB 5EUKA 4Z7NF 4NC0B 4HKXB 3S7GA 4QF1B 2GUOA 3ZYZA 4MNHA 4RAVB 2UUDH 1BAGA 5CILH 5DO2D 4KI5F 1N8ZB 3U37A 1AGBA 3VXSB 4UB0H 4PLJC 1YY8B 5EU6D 3SDCC 2HRPL 3MLZH 4AMCA 5I0DA 3MV9D 1KSRA 3A22A 2W1QA 4E5XA 1OF3A 1A22B 1NMBH 3AY4C 5AD0B 3BRGC 3NUKA 1S46A 1SYSB 4BSVB 4N0RA 1QLRB 2BOBB 4XVJH 3U9UB 4PJGE 4Q6IB 2AJ3A 1OTTD 2B0SL 5AG8A 5CD5D 2A3HA 1UWTA 3QIWA 2WC3A 5JR2A 3RZWA 1XEDA 5HVWA 4E41B 2VCAA 4LSVL 4ZNCD 2CITA 1CL7I 3VFRA 1JAKA 4BFIB 5ITBH 4ELME 2X89D 3U4BH 1FO0A 3LN4A 3EO9L 1NWSA 3AS1A 3PUHA 4KDTA 4J4PC 2D31A 4Z5RB 1AMYA 3FQXB 1CFQA 3WQ6A 3UDWC 3I3DA 4I2XB 5CEYB 1Q6FA 2WAHA 2O93L 4J3XA 3STBA 4S2SB 1TVGA 1NLDL 2J7MA 4PGCB 4YAQB 1OP5K 5FYKL 4BELD 2DLTA 4YDVA 3VI3F 3VCLA 2ZXBA 4Y5XA 3VD7A 1SJXA 4RBPH 4F3FA 2DF3A 4KKAD 1UH4A 3VGAC 1DVFD 1G6RB 2AK4B 1Q72L 3LVEA 4PPTA 3TN0A 1FC2D 5DQ9A 3WMSA 4PJ9D 1E28B 3BPNB 3SKOB 4MCZA 1T4KA 2W38A 5F21B 3MCLH 4PS4L 5GGTH 5TE6L 4NQCD 1MFBL 1QNQA 3EYOB 4XH2B 3DROA 4UFLA 4PJ5B 4HOWA 5EO9B 2DDQL 4L4VD 5F3HA 1F4WL 1EJ6A 1ZBKA 4G6MH 5JOPD 2CUHA 2E31A 4WW1A 2PBOA 3OZ9H 5FM4A 2EIZB 3U46B 1N59A 3IU3B 4KRMB 3CDZB 5J1AA 1AGCB 2NT1A 3KPSD 3GI8H 3S88H 3IXTA 4ZAKB 2ED8A 3GSVB 1OIMA 1IGCH 2L7JA 4ODSH 1RPKA 4PJEE 5JBFA 4HIXH 5HHOE 3KNBB 1FHDA 3Q0HA 4W4OC 4P23B 4BF7A 1N2RB 4JKWA 4CCDA 1T80A 1CFNA 2PQSA 1DR9A 5DD1L 1UM5H 1IM9A 2W9EH 1NGXA 4M1DL 3NZHL 1Q9KB 2VLKA 4B7LA 3DV6B 1T0PB 3H9HA 4YHMH 5JW4R 4J23A 5FCUL 1VIWA 1KEMH 2F5AL 1CDBA 3MLUH 2ZOXA 4M7LT 3RGVB 3C6SB 4XAWH 3WN5C 2BSRB 1S7SA 1XGYH 5K9KA 5BVPH 3UROR 3CUGA 3WDPP 5CP7B 2Y06L 5EA0H 3LQAC 3V8OA 5J56B 2HISA 1UWEL 3NFPB 2W91A 1BLNB 1CWYA 2GHWB 4OLVL 4XVSH 2JIXA 3RCNA 5EC2A 5DQDH 1W3LA 2EYTA 1J1OL 2KDGA 3CHCA 1FSKC 2I60L 1K8IA 4L9LA 4M62H 5EU5A 3ILPB 3INUH 4R90L 5ETUB 1QRND 4OM0H 1MHPL 3ULSB 1HEZB 1FL3A 1DEEB 1T5WA 3IS0X 3MRMA 2C4XA 4JDZA 5BJTA 1RIUL 2R69H 5EH1A 3KS0J 4NZJA 1RJLA 1B9ZA 1JNEA 3MO1A 4XNQB 2EPLX 3MJ6A 3OTTA 3V6BR 4RGND 1GH7A 5IMKA 3DOSA 4NQVA 2ICWI 4F9LC 4ZPVB 2RV9A 1GGCH 1QLEH 3KHQA 2ICEB 3L7EB 3TNMB 2VZTA 1VPOH 2DQHH 1OAQH 4OM1L 2H2SD 1CDYA 5DJDA 3SKJH 3LKPA 1DUZB 3ZKQD 1NC4D 1HHGB 2X1PA 2R0KH 5FECA 5EZIH 2OKXA 3MGOB 1KJ3H 2MPAL 1QSVA 4NZCA 1UG9A 3W28A 1UH2A 5IQ7L 2J1TA 4C56D 4XGZB 3SJVB 4ZTPH 1EDQA 2EQDA 4TVPE 2N1KA 5IFAH 1N5YL 3NH7L 4TTDD 2HT2C 1RZFL 4AENA 1S7RB 5LCWL 5I8KH 4QX3A 2IANB 1BGXH 3MUHL 1J1XH 3G6JF 4HXAH 2OL3L 5IBLD 3DIFA 5EDXA 2X4OB 4PJGF 2Z8VC 5LKNA 4W7UA 2DH2A 1P84K 4LCWE 2C7UB 1G7LA 4QRPB 2DDXA 2E9IA 4G6KL 2Z4FA 2EDKA 3G5ZA 1RU9H 3O8XB 2VLRB 3GRWA 4Y19D 4ELMF 4L29B 2JB6A 3NMEA 4NKIH 4Y0GA 3RVWC 4Q58C 1F6AB 1BPVA 1XGTA 4JFZL 4MQ7A 1G7JA 1FVEA 1HOCB 2Z31D 3TJEL 2F61A 5I23A 3GRWH 3B6SA 4XUOA 2A6IB 4JY4B 1AQDA 3GDBA 4PRHB 3SDXB 4QCIA 4PJHE 4PJBB 4CD4A 1WC7B 3UJIL 3QXVA 2GAZA 4XTRD 5C1MB 4MXWL 4XXDB 3ZDXE 3S6CA 3RTQC 1L7QA 3GKWL 1I7TA 3K80A 3WDJA 3RY6C 4HUUA 1KELH 2FHBA 3WS3B 3T8XB 3MRHB 3RZCD 4N0YL 1UR0A 3W0WE 1JNNH 3K4DA 4NKDB 4OF0A 3ULVD 1NX9A 3FFDB 1ZANH 3V4UL 1VDGA 5CSBA 1ZE3C 1BZ7B 3G6DH 5DJ2B 5EWIL 1I9IL 2X0YA 3LRSB 2AJZB 5C0CD 4NT6A 3BT2L 3BP4A 1REIA 5JUEH 3PP3H 1QSEE 4HUKB 3TCXA 3HEIA 5ANMB 2OTUB 1H8NA 4FQQA 2GJ6D 4PRIE 1UWQA 4Z6AT 3OZOA 3EAKA 3MLWH 3D5OF 1AP2B 1CZ8H 1KCUL 1UB5B 4U4BA 2J47A 1P5UA 1NAMH 4PV9B 2NY4C 3REVA 1S7XB 4OFVA 4PJEF 4OGYH 4K9EL 2DYPD 5BV7C 5LBSL 1YYLH 2NX5D 2PO6A 3NYDA 3KYAA 5KANI 3R1GL 3ARDC 4P4KD 3VGGA 5KVFH 5DD6B 3N11A 2GYSA 3S4SA 1U92A 2VL5B 4AK1A 2Z1KA 3L3JA 2I9LA 2D7TH 1E3XA 1AQKL 1GGIL 2DQFA 1MVYA 3QPXL 5ALCH 1U8KA 2HFTA 3GM8A 1HQRA 4YHNB 3QO1A 4KU1A 5I71B 4ODTH 1HKLH 2F54D 2YD1A 1JYVA 1QI4A 1O5DT 4NQSB 1Q9WB 3OKOA 3WXVH 1GQIA 4WEUD 2G41A 1UKSA 4ZXBC 4H20H 4L4PA 4Z7WB 4D3CH 4O2CB 2WABA 1OGAD 2YUVA 4X0KB 2G9HA 4DGVL 4YHIA 4MJ5A 3TA3B 4I0KA 3V79C 1GZJA 4N68A 4YFDB 3MOAL 3UTTE 3T09A 1PLGL 2ZEYA 4PRDA 4K3EL 3QHZL 1Z9OA 5AYUH 3L2LA 5GJSL 1H8SA 2HTKC 3AXLB 1KJMA 3O3DB 3BN9C 3NJVA 2IXVA 1EHAA 2KH2B 4PRBB 1I85C 2WCSA 2ZX6A 3AREC 2YPKB 1DQQB 1G7QB 1PMJX 4LXFA 4JPVL 1MCRA 1TLKA 4Z7VE 1LO3H 5IMLB 1CBVH 4A44A 4DN3L 3V5HB 4F9PA 1MVUA 3EOBB 3T2QA 3MMUA 4XX1E 4DXRA 1RUML 3MLVH 1A6AA 4XB3A 2XNAB 5BRZB 1HYSC 2HP4A 4KTEL 3HZYB 1G7PA 3BD3A 5ABFB 5ILTL 5F97E 5FGSA 1MRFL 3SGKC 1DQJA 1UZ4A 3BEVA 1T6WA 2YBRA 3OKNA 4L3ED 1XGRA 5MP6L 4MD4B 3D3VB 4HZ8A 5K9QI 1TTUA 1PBGA 3P9MB 2F8QA 2VWEE 1XIWB 3DVFA 4XP1L 2NY3C 3L7FB 4PGDB 5HPCA 1JI1A 3CLEH 3IETA 4JPKL 2DAVA 3DX9B 4P2CG 2OTWB 5I8OL 5FFLA 4NRZB 4MD0A 4OZGE 2YD2A 5F7UA 2NXYC 3P11H 4DUXA 3OJVC 3QHFH 4Y8DC 4OQ1A 1MWAB 3VGFA 4QX2A 3WIHL 4TN9A 2FCBA 5C8JA 3F62A 4U6HA 2QSCL 4P7QA 4P2QA 4OF7A 3V9FA 3DX7A 1BYCA 2G3NA 3BPLB 3EFFB 1A14L 5IB4A 4MWFA 4J12A 3N12A 1AVAA 3EYSL 2C1OB 4JFEA 4R3SB 3T2OA 4F2MA 5I6XC 1NFDA 2X09A 1I8MB 4J6RH 3FB5B 3L95B 3PWPB 4KJYA 2CPCA 2HJFB 4JFDA 4ZUSB 4AAXA 4LKXB 4KK8C 2VXSL 5HI3D 3LDBB 4HUWB 4L3CB 4M6OH 5GS0C 4BQ9A 5J1TC 2UY5A 3I6GA 3CUPA 3CXHK 2C3XA 3HUJE 2PF6A 4PJHF 5SWZB 1OARL 2VH5L 3BMWA 3RDTC 2A9ML 4UINH 3ZDXF 4YBHA 2JIWA 5JOFA 5LG1A 5C0EA 2EH7H 35C8H 4QX0A 2DT1A 3ARTA 1QLFA 1R87A 3PE9A 1A1OA 5JA8B 3KPRE 4LHJB 5DZNA 2MHAA 1TFVA 1KN4H 3O9NA 2VZVA 4X4ME 2HH0H 3SCMB 2PWDA 4S0SD 4GG6B 3S37X 2WWKO 3QEGL 4FXKB 4PJIE 4APQD 5ACZB 2G75A 2DWDB 4AG4H 5TGBA 4YXLL 2R0WL 3O2VH 4N9GA 3GSOA 3MXVH 2NXZC 2YWYA 3T0EA 5DRZB 3VXRA 1NUKA 2EDBA 1NANI 4HJGB 3CFCH 1YEHH 2XWBA 3RWFB 5GISH 3EDDA 4NZUL 3W53A 3TTSA 4F7PA 4MQXD 5ADOH 3MA7A 5T33H 3V4VL 5HNNA 1PEWA 4K71B 3EW3B 4AIEA 5HVGB 3QA3A 5IHZA 4ENED 1J8KA 2AGJL 4UTAL 1ISYA 1RUPH 3KXFE 3WQBA 3B9KC 4N0FA 1NAEA 4PBWD 1S9YB 4P9HL 5AZEL 1AQHA 1PG7H 2ARJA 1HN1A 2AV7B 4OF5A 2J7DA 3NNGA 2Z4QB 3AIEA 3TV3L 4YDJA 2XZZA 3PF2A 5B4MC 4JKMA 4ONFL 3WNOA 1K6QH 3QRGH 3QUZC 1UCTA 4MO3M 2VURA 1CDIA 4TSCH 1TCRB 4P7NA 3QUYB 1H4PA 2IMMA 4JFUA 2OI9B 3IFOA 1KJ2B 2NY5L 2UZIL 4YE4L 4PT6A 5E9DD 4W93A 2A6JB 2FJGB 5SX5H 3MV7E 3NACL 1O59A 4YDLB 2DSZA 1FORL 3GTNA 1JHKL 3SEPA 1FC1A 3BWUC 5I66A 1B3ZA 3RVTC 1JPST 3CMGA 3SUSA 4HCRH 5LGKA 5H8DA 3N1PC 4JM2C 2WBJD 3NIYA 3FQTA 5TQ2L 1IARB 5LQBH 5EUKB 1FP5A 4KK9C 3AFLA 4PMVA 4YHOL 1W8NA 1JGDA 1F90L 3HB3D 3G9AB 1E4WL 4CCEA 2AMGA 3QRFM 1YUHA 4MNHB 3QIBA 1JHTA 3FAWA 4MB4A 5C08B 1SM3L 1UC6A 1T1XA 2W47A 1H09A 3VXTB 3UAJC 1NUGA 3OX8A 1KGYA 3T04D 1AGBB 1DFBH 2FX7H 1YQVH 1OT1A 3L3KA 4JM2F 2CKBL 4W4ZA 1H11A 3MMWA 3FHQA 3KLSA 5F7HA 5J06A 2YKKA 1CXLA 1QSFD 3KE0A 3CVHB 1MFUA 4E5XB 1NEZG 3BYYA 5LJYH 2A3EA 3WMBA 3TBYA 3NIDE 1JF1A 1OD7A 4POUB 2F53E 4Z7VF 3LEYH 4V2CB 3UYRH 1LO4L 4OT1H 3PWNA 3QIWB 1IVLA 2J4WL 4XPGH 1IE5A 5D4YA 1P5VA 3VFRB 1UWIA 1B3JA 3OAZK 4WCYL 1FO0B 3VIMA 3LN4B 3SURA 2D4FA 1YC8A 1V6XA 3RKPA 4QWWC 2CUMA 1CT8B 2D31B 1HP5A 4M1CD 1CFQB 1CLVA 3H9SD 3VRLE 5FAAA 5I76A 1LO5A 4PMXA 3X11A 3N1GC 2APWA 1DANT 1MCPL 3ILQC 4MDJA 2ZOLA 4FTVE 3MBED 5KVEL 4M7ZC 3VXMA 2RHEA 1I1XA 3MX0A 1OCWH 5AC5A 4YDVB 3U9PL 1PG7W 5FV2A 5BRQA 4OZGF 1LE9A 1J9YA 3QFJA 3VCLB 4Y5XB 3ISWA 4KVCL 1VFAA 2QR0A 1NAKL 2B5IB 2VUOA 2JD9A 5IOPA 1DWGM 4NFDA 5DQ9B 4Y1AA 2GTWA 4Y4FA 1HVQA 1MHEB 3T2NL 4EQ2A 4MCZB 1T4KB 4ODWA 4HUMB 3O3BB 5JHLL 4S1QH 5DR5L 2R2EA 5TDPA 5I73C 3C5ZB 3A67L 3DROB 3JUYA 2WVVA 3SDAC 5MI0C 2HT3C 4JEGB 3SKMA 1I75A 3ARBD 1QI5A 5A8NA 3K74B 1ZWIA 4WW1B 1FAIH 1V0MA 1BZ9A 1FYTB 5EOCH 1JPGB 1O8PA 1MNUH 5FUOL 1N59B 1KGUA 1UA6L 3ALWA 3L3IA 5J1AB 2VKWA 5SWQA 1SBBA 1RUKH 3IXTB 5J11B 3WE6B 2V6HA 3KJ6L 4KUZH 3HUJF 2E32A 2QQIA 3O2DL 3NGBB 1FIGL 4GRWH 4OBRA 5C09D 3H0TA 2ATKB 2JB5L 1CVSC 1G7MA 4MAYC 4PJFE 5DT7A 5DJ8B 3T1WA 3BC9A 1CL7L 1CFVL 4NWTL 1IM9B 1NGXB 5DD3H 2VLKB 3PABA 3O41A 1TUXA 3H9HB 2F5BH 5E4EB 4PJIF 4KKNA 3ZL4H 8A3HA 2D03L 3Q6FA 2LS6A 1BBDL 5D7JA 3TZVD 1W8OA 3B9VA 3WHE0 1S7SB 4ERSL 5K9KB 5T1LD 3MO4A 3JV0A 2HLFD 3HC0A 5BZWA 5E56A 1A7BA 3A0OA 2O5XH 1YECH 3VFNA 4WY7L 3LMYA 5E2TH 2DT0A 1SVCP 1CIDA 2JIXB 3GMRA 4TSBL 1A6ZA 1FPTL 5EC2B 2AJXH 2EYTB 5JIIA 4WVRA 1K8IB 3UPCA 3AS3A 4DZ8A 4GW5A 1RZKH 4L9LB 2BGPA 1HKKA 4G42A 5EU5B 1MFCH 2VXQL 5GZND 2EDWA 2BNQE 3BZFA 1JZ3A 1FL3B 1CICC 4ODVH 1WQVT 5I1GH 1NLBL 1T5WB 3AUVA 5DT1L 3MRMB 4JDZB 2G60L 4OKVA 5BJTB 4S0TD 1K9EA 3U5UA 1RIVL 5FHBH 1DWJM 1RJLB 2F58H 2AEWA 5CJOL 3WO3B 4QGTA 2XUCA 1Z3GL 4FQXC 5I1CL 1T83A 4HU0A 4NQVB 3QEQD 4JZNA 1RI8A 2AEQL 1UD5A 3FRPA 5E6YA 4BFBD 3PTMA 5DWUL 3TVMC 3FO9A 3MS8A 2UVFA 4M48H 3WD3A 3LKPB 1OAKL 3G5VB 2QMJA 3IDGA 1UCBH 3L5WB 1OGSA 1EX0A 4CVUA 4AW7A 4NO3A 4PY8J 3OXRB 3M45A 5T1MB 1HJWA 1T1ZB 5FXCH 1H15A 2IC2A 2ZSVB 3HFMH 4HBCL 3NCJH 3O2LA 1LNSA 1KWKA 1DJSA 2VABA 3P6BA 3VO0A 3AHYA 5FL1A 3GZKA 4WUKH 2XQYK 5IEKA 5HXMA 4L4TA 4Y5VA 4AENB 4GXUN 4K94C 3KPOB 3UTQA 5D7LD 4UT6L 2E8ZA 4F33A 2ZG2A 1NGQH 3JVGC 4MGQA 4W68A 1E6PA 4CN4A 1XSKA 1G7LB 3ZJ7A 4ESKA 4HXBH 2XPGA 3PV6A 2X7LA 4WTZA 5IEHA 2P8PA 4R97B 3I2KA 1HKJA 5I30H 2WZPD 2WO2A 2A6DA 3G5ZB 4QXWA 1CLYH 3O9WD 2JLLA 1QKZL 2JB6B 5IT2L 2P47B 2VB5A 1X5GA 4RRPG 2JIEA 5C6WH 1NBVL 4XPHH 2JJUA 1JWSA 1V7NH 4GMSH 1XGTB 4YLQT 1G7JB 1FVEB 4LCUA 3OEAA 2WZEA 4UILL 3VRLF 4OV6F 3B6SB 4WI8A 4QCIB 3WV0A 4GG8A 4ODUA 1V02E 1OSZA 4HJ0C 4YEEA 2GAZB 1OLLA 4OUUA 5FKPB 4WFED 3GHBH 3QDGA 4YDKL 4G6JH 4KI5D 5IVXE 2EH8L 4HUUB 3HC4L 3V7AE 9CGTA 5CWSB 1K4CB 3NFSL 2VDPL 4KQ3L 4OB5H 5D70H 5J8OA 1C92A 1HP4A 5FYKH 2FX8L 3F5JA 2GSIA 3HRZA 3WF0A 1TVHA 5EBMA 2GUYA 1MFAL 4PRPD 3AIRA 5HYEA 2PYED 3GMQA 1A6WL 1YMHB 1E5NA 2PR4H 4U1MA 3TJHC 1CDHA 4NT6B 3BP4B 1UZ6F 5IBUG 1Z0NA 1ULOA 3E6FA 3QHMA 4GINA 5F9OL 3NIFE 1QFUL 5MHSE 4G8FA 3EDJA 5DUMH 4MDPA 4BA8A 3MRPA 3WIFA 5C07D 3O6KH 4TYUA 1MCWW 3O6ML 1JYWA 1X5YA 3L5HA 3REVB 5M5DA 4P2OB 3A47A 4MTVA 2JCCE 3D85B 2XY1A 3QI9A 4E2OA 3SCPA 1BIHA 2IFFL 3DVGA 3J8F7 3QHTC 3PNWB 4M24A 2PO6B 3IRZA 3ESUF 3THML 3RILA 2XA8H 4PJFF 4C54A 1T66C 3HMXL 2P49B 4G9DB 4KXZH 5HHME 1EFXA 3VFPA 1BFVH 4ACPA 4J4PD 4KRPD 1U92B 4R6UA 1CCZA 5FGCE 1MLCA 3L3JB 2I9LB 5DD1H 3V6FA 3MRDA 4BK4A 4F58L 2DQFB 3VI4E 1KGXA 4NN5B 4YXHH 1ZTXL 1P7KA 1KGCD 1U8KB 4UQEA 1HQRB 3QO1B 5B38A 5DJ6A 1QZ1A 4ZFFA 3OKOB 5ICXA 2VLME 4Z0BL 3OF6A 2W4XA 2QHAA 2WUBL 2MQ0A 5KSBB 2G9HB 4IUGA 3L4WA 3CFKA 2LU4A 3D9AL 4MJ5B 4WWKC 4YHIB 3RWJA 5DMIL 4KZDL 3BAEH 2WYSA 4M1RA 1ECEA 2ZPKH 3BEWA 1PYWA 4M6MH 4B9YA 1KJMB 1BX2B 1I7RA 1W1VA 5D9SA 1LDSA 2R56L 1ZGLA 4H5SA 4M93B 4JY5L 1BFNA 3GH5A 4DK6A 1R86A 1MY5A 4R90H 4ZSOE 3ARFC 4NCC2 4KHXL 3C9NA 5E8OA 2A6KA 2F8XC 4K8RH 4A4AA 2W1WA 2JKXA 4JFFA 3DETC 4AQ1B 1E56A 3ZHDA 1DUYB 4W7VA 1JXJA 1A6AB 5GGVL 1A1MA 3E3QE 1BD2A 1KQYA 3A23A 1G7PB 4HWEH 1NP0A 4JCMA 5ID1A 4XVUC 3MLXL 2CO7B 5FYLL 2WUHA 2ZX9A 3BEVB 2YBRB 1WTGT 3MTRA 1XGRB 3OKNB 3C7HA 2VQTA 4IRJD 1V3HA 2DL2A 4LHUD 3U30C 3EJYC 4RMTA 1J01A 5FOBA 4LEXH 1H3PH 3ZTNL 1UYQA 4WI4A 3G08A 1XT5A 1WP6A 3D6GA 3IETB 2NZIA 3UR8A 4LYRA 5F9WC 1I9JH 5BXSA 3U7YL 1YY9C 1D9KD 1AGEA 3NA9L 1U8HA 2YPVL 2DT3A 4JKPL 3UTOA 4DKAA 4MD0B 5HHXH 3SCSA 5DI8B 5HBBA 2OL3A 1L9MA 1MF2H 3TO4A 3NH7H 4KY1H 3MCG1 1P69B 3MXWL 1CXKA 1IAOA 5DJ0A 4XV0A 5EUOF 4O4YL 4OFIA 4U3HA 5DD5L 5F9DC 5C8JB 1CEOA 2WC4A 2C4FT 4P2QB 3WUBA 2VXTH 2W59A 3DX7B 1UENA 2J2ZA 1H6XA 1J0KA 5IB4B 4MWFB 3QJFA 1GMMA 4JFEB 3GSWA 3WNLA 4MYWB 4F2MB 5JXED 1NFDB 5EZOL 3CK0H 4KJYB 1XNTA 1IGIL 4JFDB 4WEBL 4IJ3B 2GT9A 4OLZL 4L5FH 4IM4A 3BISA 2CUIA 4UUJA 5ICYA 5CIPA 3BKYL 3L4YA 3I6GB 2VMDA 3CUPB 4LNRA 4DWSC 5IW3A 3QB7C 1Q0YL 2GY7B 2WMFA 4QGYA 5JOFB 4PMUA 5C0EB 1IGFL 1QLFB 2XZQH 2MHAB 4V2XA 2O26U 3GKWH 1WZ1H 3MJ9L 3PL6C 4IOFC 4EVNA 4B50A 4N0YH 4F7EA 3QNZA 3B43A 2G75B 1MCQA 1T6VN 5F8RC 2CJUL 4N9GB 4BSWA 4GQRA 3GSOB 4IMLA 5FYKU 3T0EB 5E8PA 3VXRB 1XAUA 4XPTH 1KB9J 1T7XA 3AXIA 4GKLA 2R2CA 1R24A 1TQBC 3HTLX 2XWBB 1LK2A 2DLEA 3TC9A 1G9NH 2XIBA 1I9IH 2ICES 4F7PB 3MA7B 3NIFF 1U8IA 4PQQA 1XYZA 3QA3B 5IHZB 2UV3A 3VXSE 25C8L 4N0FB 1NQBA 5A6BA 3OKMB 3BSZH 3GJFK 2ARJB 4NJ9L 4YDJB 3LKRA 3NIGE 5T3ZL 1KGWA 3ECQA 4BFEA 1AHWA 2JCCF 4U31A 3S8WA 2HFFB 3OGRA 2VX7A 1PW3A 2EDRA 5JXIA 2LVCA 5T3XL 4YBQC 5I9QC 4LX4A 5TE7H 4IIQC 3RVWD 2H32B 3IFOB 4K9EH 3GMNA 4QXGH 1XGQA 4Z8FL 1INDL 4TVCA 2JF1A 3MJ8A 3ET9F 3KR3L 4OGXH 4LU5L 5I18L 2APBA 4Y16A 1WDSA 3O3EA 1EPFA 5LWYL 1WF5A 1WZKA 2V38A 5CJXA 3L4XA 3VI4F 1WWAX 3EHBC 4TQEL 1DQLH 4OUOA 4F7TB 4Z7QE 3TOPA 1AXTL 3FQTB 3RTQD 1BEYL 3IDXL 4GBXC 1JGDB 3ULUH 1JNJA 5I8CB 1GOFA 4I2XE 2X0HA 5BXFB 3CPUA 3RP1A 1ISVA 2DRUA 3QIBB 4J3VA 1EQCA 4PUEA 4AIUA 1JHTB 4J28A 3SE4A 2NY0D 1T1XB 2IAMA 5KSAC 1GQPA 5FKAA 2CIPA 3OX8B 5I1IL 2DMBA 3L3KB 4GAGL 4UV4H 5K9JH 1L0PA 3WH9A 5E5MA 4G7VL 4DFIA 1UT9A 4Q2ZA 4DKFL 3B2VH 2EE2A 4OBSA 3QHZH 1OP3H 1S78D 3TBYB 4HOXA 2WSPA 1JF1B 2AK4E 4DGIL 4F8XA 3EGSA 1WZLA 3L4TA 4F80A 5HHOD 4AMKH 1KBGH 1GIGH 2VE6A 2NY2C 1A6VH 2UVEA 3GBLA 3PWNB 4S1RH 3RL1A 1CBGA 4LPXA 4PSPA 1SMAA 1U93A 4YO0A 3SBWA 4JPVH 2FZ3A 1BOYA 3VDHA 1NDGA 1RPQA 4WGVB 1CGXA 4GI8A 2NY4D 4PJ5E 1XD0A 3WKMH 5GRJL 1YJDC 2W9DH 1KXTA 4F9JA 2K3TA 3NZ8A 3CZKA 3ARDD 3I6KA 5HYSG 1CXEA 4WHYG 3N0PB 1LO5B 2R15A 3X11B 5I76B 2Z91A 4K7FA 3MRNA 1L7IL 1XH0A 1ED3A 4HULB 4R0LC 4N8VG 2ZOLB 1FA2A 3SCWA 1YDPA 3VXMB 1QPPA 1SFSA 4LPTA 5CEXA 2WMHA 1FL5B 2W63A 1VGEH 3V4PL 4AZ6A 4JO2L 5FYJE 1Q1JH 2DS4A 2X9YA 1LE9B 3RGHA 3N1QC 3QFJB 4F15C 5JBDA 1VFAB 5GGSA 1KTKE 3U82B 1OWWA 5I8OH 3OGSA 3SGJC 3VH8B 3WIHA 4LSDA 5IOPB 3PZGA 5CZXC 2BJML 3ZR5A 1IZJA 1JZ2A 2GTWB 4Y4FB 2B4CH 1VBRA 4R4FL 5B8CC 1HVXA 4QLJA 2UWFA 4AEIH 3EB7A 1M7IA 5IB2A 2GITA 4ODWB 5ACLA 1OPGH 4NO5B 3P4NA 3MOQA 1C8QA 3WIHH 3O2WH 4KDWA 4MA1C 4P9MH 1EOKA 2R2EB 1TJGL 2HTKD 5TDPB 3BN9D 4D0CA 3V5KA 2WVVB 3WLWC 3WFCH 4HGMA 3ARED 3SQBA 2BNRA 5A2FA 3MV8E 3R0MA 4BS0A 3BAYA 3SKMB 1T04A 1CXFA 5CUSL 1ZWIB 1BZ9B 4ZS6D 4LLQA 1IEHA 3MC0A 5CCKL 3JWDL 1U33A 2FB4L 5JPMA 3TWCL 4PJXE 1MFEL 5L8LB 5SWQB 3VNYA 5KVMC 5IFHL 1EHNA 4MMZC 4NQUA 3CLWA 4WTXA 1RVFH 4M7LH 1HYSD 5TDOA 3H0TB 5D71H 1KPVA 4TUJA 1G7MB 1ZHNB 1LDPL 1B2WH 1HJQA 5ENWB 4TVPD 4H41A 3QCUL 1DP0A 4GFTB 1WEJL 3K2MC 2NY3D 3PABB 3O41B 3CVIL 3LD8C 5E4IA 2EDEA 5F89A 5HVFB 3MLRH 4JFWA 5DEFA 3SCQA 2CH8A 3Q6FB 3VFGL 3IJ7A 4TSAL 1XR8A 5D7JB 1EZVY 4PY8I 5GGSY 3FT3A 2PXYA 2HKHL 3CDCA 4UFHA 4LCWD 1ZEAH 3HC0B 3BH9A 1NSNH 2BMKA 4GMTH 4YXLH 5IBTL 2KZWA 1JWMA 1N4XH 4ZYKA 2BVPA 5I3DA 2QBWA 4YWGH 3QXDA 2V3DA 2FGLA 5I1AA 3SJVE 4HBQA 3GMRB 3RKDD 3SPVA 4BXSV 1CF8L 1A6ZB 2IH1A 1QBAA 2GKIA 5B4NA 4DFHA 3FJTA 4UZGA 1ZLUK 4D94A 1FNAA 3CTTA 4OZFA 4DZ8B 4GW5B 4M1GL 4U33A 3NIGF 2IANE 3ECBA 4G42B 5IGXH 3LOWA 1KQZA 2DI9A 4DN4L 3BZFB 2LABA 2VDKL 2O9PA 4ZO6A 3K4AA 1JRHI 3ES6A 4HMEA 1O7SA 1TZ7A 2DJSA 1FLRH 4OKVB 3T0DA 4OZFH 3MBXH 4QRPE 3QDJB 2R4RL 3WJJC 3O4OB 2VITA 5GS0D 5IJKA 4XC3L 1DVFA 5I74B 2XONA 4U0RC 4Z77A 2DSUA 4WSJA 3GNMH 3H3PH 4HFUL 1HCVA 1YYML 4MGSA 2VLRE 5DD0L 3W0WD 4EDWH 1KYOK 2D7MA 3TBSA 1N0XH 4JZNB 2K7PA 3WDIA 4NQCA 1A0QH 2ZCLL 4Z7QF 4CGTA 2WLYA 4ZE4A 1RULL 1URLA 3FO9B 5HYFA 4ACZA 1BWMA 1A21A 3BQUC 3IDGB 5EBGA 4NO3B 3A6BH 3M1BA 3CD4A 4ML4A 3SDXE 4PJBE 3W2DL 2CKBA 1RJCA 4N1EA 5JPNA 4UDTB 2DQUH 1QSED 4W8JA 2VABB 4JGJA 2WV3A 5A16A 5IEKB 3RA7L 4PRID 4XP5L 1X5IA 4Y5VB 5ADPH 1T03H 2PNDA 5FV1L 4X4YA 3ZIZA 3QIUD 2CKBH 3EYVA 4LIQL 4UQ3B 1YEIH 4OF6A 5IMOA 3QCVH 4EQ3A 2CHNA 4GSDH 1NH6A 3RQ3A 4S1DC 2HKFL 3V0AC 5I1JL 2EDTA 3H42L 2ID4A 1ES0B 1BYBA 2XPGB 3PV6B 2X7LB 5LCVH 1L8NA 4H04A 5IEHB 4H88L 2P8PB 1FVCA 1KPUA 1WT5A 4ZAKC 5C6PB 4CADB 5HYJA 5HI5D 5B4MD 4WSKA 1G7IA 3FMGL 3T0AA 2VXUL 1U3HC 2J4WH 3QUZD 5KZ6A 3C2AL 1MI5B 1ORQA 4P23C 3VMNA 1PZUB 4CD5A 5GSRA 4P5MA 1JWSB 1LEIA 1L4IA 2EXOA 2IPKA 4LCUB 1QNPA 1JFQH 2CLRA 1AY1H 2B1HH 5BZDA 2KUTA 2NNAB 1ZL1A 4ODUB 1OTUD 5MERA 1M01A 1OSZB 3GNPA 4AM0A 2BY1A 4OUUB 5FUIA 4O02H 1IT0A 1V0LA 1I1AC 3QDGB 4V1DA 2IBZY 4HIJA 3RVTD 3BWAA 2QQLL 3R0NA 3UTTD 1QRNA 1QG3A 4JM2D 1YEFH 4KK9D 2NY1D 3DYPA 3RVUD 4NDMA 3MBWA 4W8AA 1Y18A 5TPWL 3HRZB 5A40E 1TVHB 2WKGA 3U2SA 5EBMB 3CGTA 4NN7B 2J1KA 3DUHA 1NAKH 3AIWA 1LHZA 4A6YA 3EOAA 4A2LA 2XM2A 4QRQA 4U1MB 4IRSD 3KLHC 4Z7WE 2H26A 5A8PA 3E6FB 1OD0A 4MNKA 1YEKH 2LVEA 4A6YH 3U0WL 3BPOB 1LWJA 1NC4A 4PMRA 3TT1L 1OBAA 3MRPB 3IYLW 2VQUA 3EOTH 2ADGA 2G5BA 1BVKA 4CJ1A 1YPZE 5TFSL 4PJXF 2GY5A 5C8BB 4C56A 1MCBA 2V3EA 1G1YA 1WAWA 4GZJA 5DLML 4HA3A 3DARA 3AOFA 3UMTA 3VIIA 1F8TL 2A0LD 1T22A 3QI9B 5A2KH 5A2JH 4AD5A 4LCCA 4EJ1C 3DVGB 1XZ0A 4PB0H 4QO1A 3GXDA 5E99H 2YDSA 1EFXB 4QWWD 3VFPB 3VA2C 4JFXA 5IW1A 1MLCB 4NGHL 5BRZE 1KIQA 3WJLC 3IJHB 4RMWA 1UD4A 2G2RA 3MRDB 3PZIA 5DJYB 1CU4H 5IK3A 1OIFA 1P7KB 3ILQD 5DMKA 1I8IA 3ZE0E 3D18A 1QEWB 2ZUXA 3WIIH 5B39G 2DB8A 5B38B 5EJ1B 5DJ6B 3D3VE 2VCBA 1CQYA 3FB7A 4ZFFB 5ICXB 2VTFA 2FLRT 5IVOA 5A6LA 1BAFH 2IQ9L 5GJTL 5GNXA 5DK0A 3AAZA 4YX2H 1R5IA 3TNNA 2EIDA 1FNSL 4O9HL 3CFKB 1L6ZA 3RWJB 3MV11 3P4OA 1RHFA 2Z31A 1H3GA 4H8UA 4GW4A 3C08L 3GH7A 1NGWA 3H7BA 2Z1SA 4PG2A 5DVLA 3BEWB 5HY9B 4RGMB 5EN2B 1PYWB 3RHWF 5J3HD 2YG0A 3ACHA 4FABH 5D9SB 2OCFD 1RUQL 4M8UA 3O8XC 4H5SB 4XMLH 4W85A 1BZQK 1EZVX 3SDAD 1M7XA 3RHWK 4Y7EA 3RZCA 1PJ9A 4LGRB 2HT3D 1W9BM 1YNLL 3C9NB 5E8OB 2A6KB 2GK1B 2ORBL 4XP4H 3G5YA 4JFFB 5LXGH 3SO3B 2G60H 1IKNC 4W70A 1ZJBA 4D6FA 5EZJB 1A1MB 2CRZA 1BD2B 5A8QA 1RIVH 2DH3A 3KPRD 2H9GA 4V28A 2YA1A 3PWPE 1NCCL 4PREB 4WW2B 5CJOH 1E5JA 3ULVH 7FABL 4FP8L 1NOWA 1QACA 2V5RA 2BSSA 3CU7A 4LCYA 2X9XA 1Q0XL 4MAYD 4XUQA 3DUUA 5T1DL 3HNSL 5FOBB 4YHEA 4FXGA 4RMQA 4GO8A 1W2PA 5EOCJ 3DHPA 2OYPA 5MENA 3G08B 4L8BB 4X6DA 4RQQA 5DWUH 1J5OL 3SDXF 4PJBF 5SWZE 3I2HA 2HWZH 1DYOA 2WQRA 1FH5L 5DFWH 3MFGB 5J0BA 4Z95L 2W94A 1SR0A 1AGEB 3UBXG 4UT7H 1UM4H 1OW0A 1U8HB 4YHKL 3DWTA 3KXFD 5ABDE 2AEPL 2OL3B 5IROA 4MB5A 3NPZB 2NX5A 4MXQC 2WO3A 3RM8A 5J9PA 1XGUB 2EKJA 4GG6E 1FL6A 1IAOB 2DL9A 2FX9H 5DJ0B 3W5NA 1G84A 1S3KH 4GKSA 4RAHA 1GAFL 4UT6H 3VUPA 2E7BA 1C8PA 2YZ1A 4U7KA 4D8MA 2IJ0C 4NOFA 1GOIA 5KSVA 3KPPA 4U5IA 3NTCL 4RX4D 3CZGA 3LKNA 3HJEA 3K2UH 1MRDL 3PZNA 3GSWB 5D4QA 2F54A 1UWGL 3WY1A 1F45A 3MV7D 4UOW0 4NRSA 5L2JA 3IFLL 1CICD 2GT9B 3DMMA 4E4PA 1QNSA 2VXVH 1OGAA 3POHA 1CLZH 3MANA 3G6AA 3PIQA 3WLBA 2BSED 1MHHA 5CIPB 5ICYB 1H8OA 1M53A 1R3IH 4LNRB 1NBVH 5FIEA 4D0QA 1UQYA 1ZK9A 2X2YA 2J8UA 4JFQA 4P5KA 4FQXD 4PLOB 3RJDA 3HZVA 3RWIA 4LQFL 3L4ZA 4RE3A 2YK1H 4HSQA 1QNRA 4EKJA 1R5VA 2UWEA 4WUUA 3TVMD 3L5JA 3AXXA 1F58L 4GQPH 5C0DA 1F00I 2J6EL 4Y2DC 4EVNB 5EG6C 4M7JL 5HDBF 2Y07L 3GNOA 3KVQA 3GBMH 3TA3C 5J4MA 4F7EB 3QNZB 2VZPA 2BVEA 4KJQC 2JDAA 4BK5A 2ZEWA 4MVBC 1BBJA 4BSWB 4IMLB 5KVDL 6TAAA 2FEDC 1E1FA 2IG2L 4PTTA 2F53D 2XKNA 5DHXB 1CWVA 5E2UL 5E8PB 4BH7B 4P02B 3PTQA 3SUUA 2C5DC 1R24B 1IILE 2O5ZL 1PKQE 3KDMA 4L3EA 3I2CH 1WE5A 3E2HC 4PTMA 5C08E 1GOHA 5L9DH 1QQDA 3GO1H 1U8IB 2EDLA 3N15A 3NSXA 4PV8B 2DTML 1TVBA 5E08H 3AM8C 2FYYA 5B3NA 1YPZF 3H3KA 5EU7C 1E6QM 4ZXLA 4FQ2H 2IBBA 5CJQH 4JB9L 4OF8A 3ZKNC 8CGTA 1QOXA 3BCDA 4NSBA 4J3TA 4KWUA 1JPSH 1AHWB 1J0JA 3UTSE 3L4VA 4HWZA 4K8RC 3VILA 4YNYA 2XIDA 5AEAA 2AK1L 3LEVL 2P8LA 3HMXA 1T21A 3AIBA 3N04A 4FTVD 5DO8A 1CD0A 2FATH 3I50L 3LY6A 5E6IC 5I15H 4JN2A 5KAQG 1TNMA 4GWJA 3GMNB 2ADFL 4I3SL 1XGQB 1G0YR 3MJ8B 4XMKL 1XIWC 4U6XA 1HKIA 4HT1L 4Y16B 3O3EB 3HMXH 4FRWA 4FFZH 3ZKSD 5CEZL 3ZE0F 2ZWLT 3I75A 4HJ0D 4X9HA 4HD9A 3CFDA 3MSGA 4JHOA 4XP9H 3RDKA 4FNLH 2ZICA 4O58H 4HDIA 2R1XA 1UYYA 3HNYM 3SGDH 2Y8KA 2VNCA 4X7DC 3C8KA 2LTQB 3C09B 3GBEA 4P8VA 2VN4A 1P7QD 2I26N 1LGVA 1OWRM 5JXAH 1FGNH 4Q9RH 3E1F1 2IAMB 1N64L 4UV7L 4HKJA 4XCCL 5FKAB 5B3JE 3OJ2C 3U7AA 2P5EA 3OPZH 4WO4C 5LA0A 1FH7A 3D9AH 1AKJB 4KFZC 5E5MB 4LSSL 4RAUA 5KZCB 2FR4A 3FY1A 2E6QA 3HZKA 3BPLC 3WL9B 2VZUA 4Q2ZB 2QADC 4QXUH 1NOUA 1FRGH 3MRJA 2J74A 5D2LA 1AE6L 1HK6A 4ZUTA 3EGSB 3RAJH 1JZ8A 3W5MA 1FG2B 3K4ZA 3HJRA 2VE6B 1UZ0A 5D8JL 3CFEA 3SE3C 2OYMA 5ESAB 2CKRA 3AS0A 4JY5H 3RL1B 4P8WA 1U93B 3DURA 4YO0B 5E0CA 1N82A 2FZ3B 5F7MC 3CNKA 2EDJA 2Z9TA 3BHBA 4Y4KD 4GKZB 1KXTB 1FYTE 2J1SA 1Y6KR 2XG4A 4XRCA 1V0KA 3NZ8B 1T66D 3I6KB 3AU1A 3VPLA 4OTXH 3CUFA 1ZAGA 3UZEA 1BTCA 4W89A 2Z91B 4K7FB 3MRNB 1AD0B 1A9EA 1ED3B 1NC2A 4FFWD 3SCMC 1QO3A 1YDPB 4MDOA 4JKLA 4LEOA 5EORL 1S9XB 3AMLA 4J3WA 5CEXB 2P24A 3X17A 3LRHA 4D9RE 1VACA 3P0VH 5F7NC 3UG5A 4Q22A 3F6IA 5GGSB 1E6JH 4R4NC 3TYGH 5D96C 3RJQB 4GG6F 4XX6A 2BNQD 1UKQA 5E9DA 4WWKD 4ALAL 5DN2A 1E0XA 5GS0L 1M7IB 5IB2B 2APTA 3HNVL 4NHUA 2E9MA 3P4NB 2VDNL 1CG9A 2V2XA 1M7DB 2VDRH 3DO7A 1IC1A 3MCKA 4D0CB 1GC1C 3V5KB 2EDNA 3ZZ1A 2BFVL 3DECA 2WWCA 1LD9A 4TOYL 1BVNP 4HS8L 4OCWH 2BNRB 4BQBA 5L0QB 1JGVL 1F97A 1RUAL 1T04B 3QUYC 4G80A 1U3YA 4L8SC 3OAUL 1KACB 2OI9C 3ARFD 5E1HB 5I1DB 3KYMA 3PP4H 4M5YL 5JPMB 5FOOA 1QNOA 3GSQA 1W9SA 3DETD 4XNYL 3AVEA 1KCVL 1HHJA 4M5ZL 5DRWA 2WP3T 1KCKA 4B9ZA 3MACH 5TDOB 4LRNH 3QP3A 5LA2A 1CGUA 4XVUD 1ETZA 4PRNA 4XPAH 1KPVB 2E6JA 3QJHA 1C5CL 4TUJB 1PZ3A 2GK0A 4N90E 2RGLA 3CZ8A 4RMUA 4N8PA 3RNQA 3MJ9A 2R0LH 4AT6A 2YR3A 4FLSA 1W9VA 3CSBA 1QNZH 1U42A 5F89B 5GRWA 3F7YA 2BC4A 1HWGB 2EIBA 5DEFB 1RIHL 4NRYA 3ULUC 1F4XH 4P5TC 4WKAA 1CGSL 1SVZA 2H45A 3WBAA 3K0WA 1U91B 1YY9D 2PXYB 4PJ8C 3OLDA 2R29H 1G6VK 3BH9B 3TBVA 5E2WL 5GRYA 1JWMB 4JHWH 1J1PH 4ZYKB 2BVPB 5C7XH 3QXDB 1X4YA 5ISZA 3MLSL 3POCA 2J3SA 2V17H 3V52L 4U1HA 5I1AB 3SPVB 4ZOEA 2ZUTA 2EKSA 4I8DA 2IH1B 3H9SA 4LVNB 4OSUH 4MAUL 3DI2B 5FCZA 4HP5A 3X3FL 4EAMA 4GS7C 1E4IA 1JMZA 3MBEA 4OZFB 4NKMA 3ECBB 3H9YA 2HFEB 1H0IA 3HI1A 25C8H 4GPNA 2CSPA 3BLPX 1GGBH 1WCGA 1PGRB 4NJ9H 3ES6B 1RMFH 4EBQH 1NGZA 2QSTA 3UYPA 2H2PC 3LHPH 2EDHA 4BUHA 4Z78A 5IWLA 2OK0L 1XC6A 2ZKHH 2VITB 5A2CA 3Q48A 2EDOA 2NMSA 1PIGA 1DVFB 4KAQH 4GAJH 4Z77B 4LCIH 1PBYA 1XF2A 4HK3N 1FG9C 5F9JA 3TBSB 1INDH 3CHDA 1E55A 2BVQA 2OR9L 5A8MA 4NQCB 4Z9KB 1EJOL 4HUNB 4J3SA 4ACZB 4EK7A 4HMCA 1EHLH 4WV1C 4Y5XC 3ARBA 1X7QA 4LRIA 4P7RA 3M1BB 1NKRA 3PL6D 4G3YL 1OAZL 2CKBB 5B3JF 5JPNB 3SDDA 5D9PA 2W62A 4PJCA 3EMCA 2WAAA 3QWRD 4QHLA 5MHSD 1V05A 5A16B 4YHPA 4IPLA 2FL5A 2W60A 3S34L 4X4YB 5HDRA 2D7NA 3C5ZC 3EYVB 3TLRA 3SE8L 3K3QA 4JQXA 1UR8A 4R8WL 4G7VH 1FBIH 4TUKH 2VC2L 1JJUA 1R7AA 3WFEL 4BUGA 4BSJA 4M82A 1OAUL 1BM3L 2FJFA 2P8MA 5A95A 3CDYA 5M17A 1EO8L 2VM9A 4N5ED 1XCXA 1FVCB 1KPUB 3UG3A 5HHMD 5HYJB 5GIRA 1G7IB 3PG2A 4KV5E 4W8LA 4C83A 5IG7A 1GOMA 1ORQB 5ERWA 2XZAL 2O61B 3D3AA 1JG9A 5GSRB 3BUYA 1WDPA 2VRKA 1LEIB 4UFIA 2IPKB 1FDLH 1AGFA 1EV2E 3WSQH 1P4BH 5LAXA 2J4GA 3H3BC 3REWA 2VLMD 1INEL 1JRHL 2CLRB 4FQIH 5GRUH 1A3RL 3WUZA 2BSTA 5BZDB 4ODHL 5DO2C 3RIKA 3Q2CA 2OXGA 5MERB 4LKCA 4AM0B 3EHBD 4D6GA 1R3LA 3O81A 1L7IH 4V1DB 4NNPH 4RNRB 4HIJB 1E6SM 3BWAB 5A2IH 4S1SL 3GJEA 3EYUL 1UWXH 4H0GA 1K8DA 4NDMB 2J7BA 4X80H 4JZOA 1Y18B 4D9QE 2YLAA 1UJ3A 1JHJA 5D7SL 4JM4L 3ZKMC 1UH3A 3D5HA 4LSRL 4YFLF 3D87B 3O3AA 4A6YB 3EOAB 3APGA 3SHSA 3IIIA 3O4LA 1KN2H 2C3VA 1RK0A 3TF7C 4D6JA 5KSBE 1SJVA 5IR1A 1TTGA 1MSPA 1WCBA 5EZLA 3GXUA 4DKEL 4M6NH 1IBGL 3CIHA 4PF1A 2WVSA 2PTTA 2A9NL 1TZGL 1KG0A 4FZEH 1K42A 1Q94A 1BVKB 1T3FA 3ZSTA 2NY2D 4G8GA 4CKVX 4PBGA 3IDMA 3UO1L 4C56B 3ARRA 4G8IA 1UXWA 1WAAA 3MLYH 4WI6A 1GZPB 4WU7A 3GHEH 5HGGS 3JWDH 1C1EL 1T22B 2B20A 4HPOL 4IRZL 3UESA 2DT2A 3G6MA 3EJZC 1XNAA 1OSEA 1V8HA 1XZ0B 1A7OH 5EO0A 5D7LA 4NBZB 3PDDA 1H3UA 2WIMA 3QNXA 1NEZA 2E7MA 5CILL 3LEIA 2MTPA 4JFXB 5IW1B 1KIQB 4KKAC 1XF4A 2G2RB 3EFDH 4UB0L 3QNYA 5IK3B 1FFOA 3V0VB 3MLZL 1I8IB 5DMKB 3D18B 4YUEH 4UFMA 4PJ9C 1F3RB 1I8KA 3RY4A 5I78A 1NMBL 3FB7B 3AISA 3O9WA 4TSAH 2HVKA 5M7QA 5DK0B 3AAZB 4XVJL 1CECA 1R5IB 1CYGA 2UY4A 1H5VA 4M03A 4AZGA 2EYRB 3P4OB 2Z31B 2E7LA 2VMCA 4GW4B 4CMHC 5CZXD 1NGWB 3KWWA 3H7BB 4URTB 1HZHH 2VAAA 3I97A 4W87A 2HMID 1L6XA 2VVSA 5ITBL 2MANA 2E9LA 1ZVSA 3U4BL 5A6MA 5DZOA 2CMRH 4HMDA 4ZY9A 4H2CA 4OGAD 4EXPX 3RZCB 2BRQA 3D39A 3BAJA 1VAHA 3G5YB 2XWJA 3C7GA 4JFEE 5CFHA 1GJUA 4ZO7A 2AI0H 1FH8A 1F2XK 8FABA 5IHRA 1NFDE 2H9GB 1QI0A 4B16A 2PYEA 3U36A 1CD8A 2GJPA 1A3QA 4UBDC 3AQUA 3SDCA 1ZHBA 3QXTA 2BSSB 1BFOA 3K7UA 2X70A 4LCYB 2F19H 3AY4A 1J11A 3DUUB 2WUCH 5D1ZD 4FXGB 5BRPA 3IDYB 5MENB 4X6DB 1TMQA 3KPTA 2ZJSH 4PTVA 3O6LH 5ECUA 4X0VA 3MCLL 1X44A 5GGTL 4DVRH 2CK0H 5BW7A 3R8QA 4H1LB 1FOBA 4GAYA 3OMZA 2VZ3A 3VRIA 3VXSD 1MCKA 4HUVA 4OD2A 3ARQA 3EBVA 4XNZB 3PGCA 3BE1H 2NX5B 2YEZA 3LSOA 1E4LA 3EZJB 5J9PB 3OZ9L 3IDAA 3Q3GA 3L5XH 4GKSB 4GKNB 1AR2A 4MJIA 1NBQA 3MNVA 4J4PA 4CUCA 2EZ0D 3GI8L 5DK3A 2EDDA 3S88L 1OP5H 3T0EE 3UDWA 3G04A 5E7BA 3VXRE 1E6NA 1VJZA 5KSVB 1IGCL 3KPPB 4ODSL 1FFRA 1ZGLP 1IRAY 3PP3K 2J1EA 3LKNB 4RGNC 5I1JH 1JHLH 3WD5L 4KV5F 2F54B 4P2OC 5IM7A 4FFYH 2XWDA 2W92A 2BNUA 5L2JB 1UM5L 2YXFA 3DMMB 4L3AA 2PO6C 3EUUA 2X1QA 2W9EL 1OGAB 5HHVH 5BOPA 3G6AB 3PIQB 3WLBB 1MHHB 1TA3A 4YHML 3VVGA 2HVJB 1KXQA 1KEML 4QTIH 3MLUL 2RAMA 3SKVA 4UIKH 4JFQB 5JLZA 4QHUA 4O00A 4P5KB 4YHYC 1HNYA 4XAWL 1B3XA 1XGYL 3HZVB 3BZ4A 2QQLA 3RWIB 5BVPL 3RI5F 3F12A 2XGIA 3SCRA 2WQ8A 2BBAA 1HKFA 5EA0L 1R5VB 3D1MC 1P1ZA 4WUUB 4Q9BA 3RI5K 3TGXA 2ARJQ 3BQUD 4XVSL 4B0MM 1LEGA 5C0DB 3RMEA 2OSXA 5DQDL 2BS9A 1JNLH 5DK2B 1OTSC 3WFDH 3PWJA 2B9VA 2AK4D 1K2DA 1BBJB 2VDMH 4M62L 1D7FA 2XKNB 3INUL 3KL0A 1T7YA 4KZEH 4OM0L 2D0GA 5KSBF 3KDMB 3ZYIA 3L3DA 4W4OA 1LEKA 1BVZA 2R69L 2R1YA 2JALA 3CUIA 1T1YA 4M93C 1NUFA 1WKYA 4PJ5D 4QDMA 5GRXG 1EAJA 4DOHB 1MCNA 2VRJA 1PZ5A 1BWWA 1TVBB 4S1DD 1BYAA 1JDCA 1L0QA 1Q6GA 4F9PC 1YQ2A 3IJYA 1GGCL 3PWUA 3DUSA 2AKRA 4ZAKD 1KBBA 1HXYA 1VPOL 2DQHL 4HWZB 3RPKA 1RQ5A 4YNYB 3TIEA 3KJ4B 1T21B 1J88A 2GJZA 5GGQH 3SKJL 5D7IF 5HGAB 4HAGA 4P23D 4JN2B 2R0KL 1KLGA 4O51B 5EZIL 2CETA 1KJ3L 1KPRA 2QSQA 2VL4A 2L0DA 4G6FB 1JI6A 4U6XB 5FYJD 2WPGA 3ULVC 3NCFB 3WDRA 4D6DA 4ZTPL 1FNHA 5HI4C 5IFAL 3TH3T 1DL7H 2X8RA 2W1SA 3GEWB 1TR1A 3I75B 1QYGH 5I8KL 3LQAH 3CFDB 1X9QA 5DGRA 1BGXL 2RGSA 3P77A 3VM5A 2IXUA 1J1XL 4HDIB 4HXAL 3ULVF 4U1JA 3C8KB 4NSKA 4HW6A 3NCYP 3TONA 4LAQH 4LHQB 1UXXX 3LEGA 4RRPA 1VKXA 2K1MA 2IQ9H 4HKJB 3VXME 2GDVA 1MCJA 3MRRA 4W6XB 4NJAH 2P5EB 3MV8D 4HQQH 2DLGA 3P4LA 3MREA 2H3NA 1NOFA 4W6WB 4KXZI 2FR4B 5TQ0H 1I4FB 1MJ8H 1R3KA 3HZKB 3QFJE 2YKLL 3FOLA 4N0CC 4N0UA 4DEPB 1V3LA 4POYA 1AXSA 5IFJB 5ID0A 4F9LA 4KROB 1JBJA 3MRJB 5D2LB 4NKIL