2VZSA

Chitosan product complex of amycolatopsis orientalis exo-chitosanase csxa
Total Genus 283
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
283
sequence length
857
structure length
857
Chain Sequence
b'LSVGAAAGNATPIPGYVIQSSAQVSDDSAVSKPGFPTSGWYPVSSRSTVYAGLLQNGKYADPFYSTNMQNVPAAQFSVPWWYRTDLNVDDTSSRTYLDFSGVLSKADVWVNGTKVATKDQVNGAYTRHDLDITAQVHTGVNSVAFKVYPNDPNRDLSMGWIDWAQTPPDQNMGIVRDVLVRRSGAVALRSAHVIQKLNSALDHADLTVKADVRNDSANAVQTTVAGTVAGKPISQTVSLAAKERKTVTFPLVGLDRPNVWWPAGMGGQHRYDLDLTASVGGTPSDAAKSKFGVRDVKATLNSSGGRQYSVNGKPLLIRGGGYTPDLFLRWNETAAADKLKYVLNLGLNTVRLEGHIEPDEFFDIADDLGVLTMPGWECCDKWEGQVNGEEKGEPWVESDYPIAKASMFSEAERLRDHPSVISFHIGSDFAPDRRIEQGYLDAMKAADFLLPVIPAASARPSPITGASGMKMNGPYDYVPPVYWYDKSQKDRGGAWSFNSETSAGVDIPTMDTLKRMMSASELDTMWKNPSAKQYHRSSSDTFGNLKLFGDALTKRYGASANLNDFVRKAQLSQYENVRAEFESHSRNYTDSTNPSTGLIYWMLNSPWTSLHWQLFDAYMDQNGAYYGAKKANEPLHIQYSHDNRSVVVINQTSNAVSGLTATTKLYNLDGTEKYSNTKTGLSVGALGAKATAVTVPAVSGLSTTYLAKNVLTDSSGKEVSRNVYWLSTKADTLNWGGSDWYYTPQSAFADLSGLNNLGQSAVGATANSVAGADGTTTTTVTLKNTSGGRLPAFYVDSKVVDSAGKPVLPVEWNDNAVSLWPGETTTLTAKYRTADLKGSKPSVRISGWNTGTQTVPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXO-BETA-D-GLUCOSAMINIDASE
publication title The Structural Basis of Substrate Recognition in an Exo-Beta-D-Glucosaminidase Involved in Chitosan Hydrolysis.
pubmed doi rcsb
source organism Amycolatopsis orientalis
molecule tags Hydrolase
total genus 283
structure length 857
sequence length 857
chains with identical sequence B
ec nomenclature ec 3.2.1.165: Exo-1,4-beta-D-glucosaminidase.
pdb deposition date 2008-08-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00703 Glyco_hydro_2 Glycosyl hydrolases family 2
A PF02837 Glyco_hydro_2_N Glycosyl hydrolases family 2, sugar binding domain
A PF16990 CBM_35 Carbohydrate binding module (family 35)
A PF18368 Ig_GlcNase Exo-beta-D-glucosaminidase Ig-fold domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzsA05
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzsA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2vzsA04
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2vzsA01
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 2vzsA03
1OAZH 1R3HA 3IIIA 2DD8H 3C5ZD 4PRPE 4O5LL 5LCVL 1JFXA 1F6AB 2BXZA 4MXQC 3MRPB 4HKZA 2P8MB 3UBXI 2OZ4A 3INUL 3C6SB 5C9JB 3BH4A 4K8RH 4DWSC 3A6CH 4U0RB 4AC1X 4C57C 5BWFA 4MNQA 4QYOB 2CLVB 4TTDC 3DX6B 5D7LE 4UIKL 5ABHA 3RNQA 5DPNA 3WH8A 1JNHB 1ZHNA 2QF8A 3AXLB 5E8PB 1FSKC 4LVHB 5I8CB 1EO8H 3FTGA 1E6PA 5ABDE 3VFOA 2CDPA 3CD4A 4X0KA 3BUYB 2AJ3A 3TBWA 2CDGB 4PJ9B 1LG1A 3WN5A 2X8RA 1KEGL 2SEBA 4HK3J 5AAMA 1QVOB 4Q7NA 2AK4A 1A6UL 3JV6A 4DEPC 1UG6A 4KV5F 4E41E 4NQXB 4LMQE 4WSKA 1P4LB 1W1VA 3SDXE 1NC2B 4OGZA 5HHNB 4PJCA 2HWZL 5FKAB 5E2VH 4MWFB 3ZHDA 1J18A 4GZEA 1EGJA 3MV9D 3UMTA 1TQCB 3EO1B 1KXQE 3FMGL 4L4VB 1IFHL 1V5JA 4XWGH 4PV8A 43C9B 4PUBL 4W70A 1RK0A 1OAKH 1V7ML 4FQ1L 1RPKA 2EQDA 4OCYL 4Y4HA 3WS6C 4JY5L 1CGTA 3POHA 4MJIA 3ISWA 4KI5F 4GQQA 4HKJB 2CBUA 2O5ZL 4B5EA 3WSQL 1UH2A 5L9DL 4R90H 2WBWB 4BM7A 3X3GL 4GI9A 1ED3B 5I8KL 4LSVH 3ULVH 2E7LA 2HA1A 3VIMA 4KJPC 4Z0XA 3C5SA 5EU7C 3MNWB 1VGEH 2D0HA 3GM8A 1DWAM 4UT6H 5KSAB 1EFXA 3O3DB 4JPVL 5E8OA 1R3KA 4QRTB 2EIDA 4DEVA 3RY6A 5DRWB 1OD9A 4IRSB 1JU4A 5FCUL 1F02I 1W72A 4PY8J 1JUFA 4G8GD 4JN1L 1CD0A 1EEYB 1X7QB 1AD9A 3O6LH 4S2SA 2V5TA 3OGOE 2BVQA 4U6TA 4YN5A 1IAIL 4P3CL 1W9DM 2ZUMA 4C83A 1I1FA 3MRQB 4FTVA 3T65A 5EU7E 4Z7OF 5ESQA 3QEUB 4R4NC 35C8L 5DUML 3ZE2E 4P7LA 3KXFE 2W0PA 1OW0A 4IRJD 1A22B 2J75A 3ULVE 4LSSH 1BOGA 4H25B 3CFDB 1GVIA 1KIRB 2PUQT 2Q3ZA 4ZSOE 4K7PY 5KVEH 4OB5L 3VIKA 5EB9A 2BS9A 3JXAA 5F8QC 1CWYA 4X7SH 1Q94B 4KVCL 3MUHL 3ZR6A 5IGXH 1N2RA 4OSUH 4QXUL 4U1SB 4JQIL 5IJKA 5IF0A 5DJAA 2H9GB 2D31A 5IESL 1KCUH 4BQ9A 4Z8FH 4AIZA 4Y4FC 4LRNL 1NCBL 1CZVA 3MRKA 4GW5B 2AV7A 3UTZA 4LSQL 4K3JH 5TH2A 5BZWB 1DEEA 3NABL 4EUPH 1LDPH 1G7HA 4C58B 3CH9A 1S8DB 3RMEA 3NSMA 2HJLA 4N5ED 4DWSB 4E41B 1LK2A 5F9OL 4NCC2 4ZAKD 1YYLH 1B0GA 4ALAH 3SDXB 1EAJA 1OAZL 4G8FB 1W9TA 2OQJA 2FIRT 2DD8L 3EB7A 3ARVA 2DH3A 1H5VA 1R3LA 4RWHA 5CSYA 4QTIH 2VKWA 1O7SA 1KGCD 1H41A 5K93A 1FSKB 1JWSB 4WFEE 3ULSB 2PF6A 4QLLA 3HRZA 2XG9A 1IGCH 4K8RL 3A6CL 6CGTA 2P24B 4HG6B 3PXJA 2Y7QB 3DI3B 1W9PA 4LPTA 2V6HA 3FRPG 1WGOA 4DEPB 2X4OA 3ZHKA 3PGFH 4OF8A 4YPGA 1FFNB 1K42A 4W8LA 1XGPB 3M1BA 1EO8L 3LSOB 4NNXA 1BYBA 4MNHB 1YEIH 1ZHKA 3GK8H 1RD6A 3VGBA 3NIGF 3ZLQC 5HHPB 4LLMB 1I1XA 1Z9MA 4BH7A 3WDQA 5EPMA 1O5DT 1U6AH 2I26N 3V5HB 4OD2B 2C3XA 1Q72H 3PWVB 4PJ5E 3KPMA 1KPVA 4HX1A 4WRLA 3BN9D 5E2VL 5FYKH 5JHLH 5IW6A 4OUUA 1A1OB 4IMLA 1FYTE 2ATKB 1A6VH 4HUMB 4N8CH 2VN4A 4XWGL 1L9NA 4W6YB 1G7PA 1FL6B 1OAKL 1T89A 4PB9H 5HDBE 4QRPE 2WW5A 2RB8A 4XBPA 4NWUH 5C0FA 1GGUA 4NRZA 1A8JH 2EYSB 1F6FB 1KUMA 4RL3A 4KKLD 1KWGA 1QEWA 3IANA 3CZGA 2VRKA 2IAND 4XNZC 1U92B 1VA9A 3HAEH 2YN5A 5I15H 3VINA 2BRQA 2D3NA 3QFJE 2K3TA 4Q58C 3VCLA 4W5ZA 2ITDB 5HBBA 4R90L 1BZ9A 4XHJC 4ZSOB 5I5RA 4LSVL 4BZ1H 2GDUA 3ULVL 3H3KA 3BPOC 5F44A 5FYKE 1OOAA 3A4AA 3HAEG 2F5AH 4HUUA 5HGAB 1VGEL 3FCTA 4UT6L 5J12C 4G6AC 1Q9LB 4HJ0C 2VYRE 3B9KA 1EVTC 3FFDA 4CD6A 3MNVA 1OIMA 4UQDA 4LHUD 3S35X 4GLRI 2EH8H 4MD0A 1C12B 5HBFA 1NGZB 4AQOA 3O6LL 1KULA 2HVKA 1JG9A 4NO0D 3HOBA 2KBGA 1NLBH 5IR1A 1RI8A 1CGSH 1PKQE 2AQ2A 3K3QA 2I27N 1HEZB 5F8RC 2C4FT 4OQTH 4O2EB 2A3EA 4U1HA 1KGYA 1KB9J 4OI9A 5CP7B 4R0LC 2Y5TA 4XCFH 3QO1B 1UH4A 2NW3A 1XHGA 3MSDA 2MPAH 3CHEA 4LSSL 1VJZA 4X6CE 1IZJA 3MRMA 4HPYH 4PGDB 5KVEL 2VRAA 1WAWA 2MNUA 4AZ8A 2PW1A 1MCJA 2H26B 2DKMA 2FHBA 2EPKX 3F58H 2GAZA 4X7SL 1DVFA 5FGRA 1NFDF 3QH3A 3W9DB 5IGXL 4OSUL 1OGTA 4UZSA 4WW1B 4HEPG 2DMBA 5IVXE 1KCUL 3ZKND 4Z8FL 1PIGA 3AREC 3GMNA 1ZANH 5EU6B 4NUJB 3MV8E 4HJGB 4ODWB 3SO3C 4EUPB 3EYPA 1ZXQA 1RVFH 1P7QD 4PRDB 2FSEA 4K3JL 2QKIB 4M61B 1I8LA 2NR6C 1LDPL 5C0AA 2DI7A 4JO4H 1HNYA 2GFBA 3AIEA 2YRLA 2BCKB 1UKPA 5GGRY 1YYLL 2AJZA 4ALAL 1MVFA 3BMWA 5DT5A 2FH6A 4FG6D 3B5TA 2A74A 1T0MB 4I0PC 1DQQB 1HIZA 4KKCD 3GNMH 4MB3A 4QTIL 5MEND 3G5VB 4S1SL 1FYTB 3B8SA 2YDSA 2EDDA 1FVDB 1IGCL 2VISB 4DKEH 5EZOH 4GPNA 1VDGA 4QRPB 3WFHA 1XF2B 4WO4A 3E8UH 4MGQA 4LU5H 4G3YH 2E9LA 3BSGA 5SV3A 4WI7A 1J0JA 2A6DA 1EHNA 3RWFA 4IJ3C 4ODTH 3PGFL 4WW2A 5I1CH 4HUVA 1JGVH 1GH7A 2ZUUA 4E42A 5DQ9A 4LP5A 1LE5A 5BW7A 3MACH 1YEIL 3GK8L 3QFJB 3QA3B 4V1DA 5C71A 3ZJ7A 3PWPA 3SDXF 1DWFM 4QOKD 3REWA 3PWLB 3TLRA 3ZO0A 4QGYA 1S9YB 2G2RB 3EFFB 1U6AL 5H37H 1EV2E 3P3YA 4IHOB 5E5RB 3SCMC 3BC9A 2B31A 2YUZA 3MRPA 3N9KA 1Q72L 3L3DB 3RQ3A 1JRHH 2P8MA 4MMXC 2O61A 4M29A 5FYKL 5JHLL 5DYOB 5C9JA 3C6SA 2X7LB 4YDKH 4XNZB 1A6VL 2LU7A 4N8CL 5KOMC 1D2KA 5I1HH 3JXSA 3D69B 2CLVA 3ZSTA 1FCGA 5H37G 3AVEA 4GI6A 3DX6A 3AM8C 4NWUL 1U8KB 1JNHA 4KROC 1FAIH 3H7BB 1G9NH 4JVUA 3AXLA 5E8PA 1IL1B 3AHXA 4YUEH 5FIEA 3HAEB 5I8CA 1PKQB 3WQBA 1M6OB 3BUYA 4PUEA 1C5CH 4PJ9A 1YMHB 5I15L 3H3BC 5J12B 1LLOA 5IB2B 1W91A 5HOSA 1NGPH 1QVOA 2YL5A 3AIUA 3KL0A 1JZ5A 5LYRA 2DL9A 5HHMD 5TDPB 3TYFB 4NQXA 4X6CB 5LG1A 4LNRB 2WWMD 3VO0A 1NC2A 1ES0B 2PO6C 4JFHE 5HHNA 1IGJA 1FZJB 4BZ1L 1BFSA 5FKAA 5A94A 3GBNH 4MWFA 5DA0B 4CJ1A 3M8OH 4Z2IA 2F5AL 5HY9B 3OLDA 2ZEWA 3W5MA 4L4VA 2XQXA 3FXYA 3PGCB 1A1NB 2AAVA 2ZX5A 43C9A 2DSWA 5IVXB 1KIQB 3LEXB 2EH8L 4UQBA 5TJWK 1CD1B 2XVPA 4S3JA 3MV8B 5T5NF 2IUZA 5TDNB 5C9KA 3PWUB 1OSZB 2KD7A 3EMCA 5C0JB 1NLBL 5A2LH 3ZE2F 3O3UN 1CGSL 4HKJA 1HJXA 1T1XB 4OQTL 1HNFA 1KGUA 2CXKA 2QLVB 3ULVF 1JE6A 3ZT6A 5JXED 1FHLA 2PB1A 1AMYA 1FG2B 4XCFL 2MPAL 1ED3A 4KRTA 1C8YA 1P7HL 3OBAA 3AREB 4OTXL 2JCCE 1MLBB 3MNWA 4HPYL 4PRIB 3JWDC 5KSAA 5GS0H 2COQA 4FQXD 4I18C 4OT1H 3O3DA 3I2GA 4QRTA 1QNQA 4XUQA 4U1IB 3F58L 3HEIA 1A7BA 5DRWA 2JIWA 3NCMA 1JGEB 3EDFA 3HNBM 1NFDA 4X9IA 2YSSB 5JNYB 2DIEA 1MQ8A 3O3EB 2Z4QB 1GPFA 2OX5A 1L4IA 1EEYA 4GG8B 1G7JB 4BQ2A 3NDYA 4PRWA 1LGVA 1OINA 4I0PB 1RVFL 4OLZH 1UY3A 4JHOA 3MRQA 1RJLB 3OB8A 2WYSA 3RKDD 2D23A 3PJSB 3BSHA 4JO4L 3WO3B 4IOFC 3QEUA 3HCVB 3BZDA 1U8HB 2UV3A 1UQSB 2NT0A 2BNQE 3QEQE 2XQYK 1NP2A 2JJSC 4D9RD 3CFDA 3CCHB 4QXTB 3C5JB 1KIRA 2YZ1A 3HTLX 3GNML 4NO3A 3TVMB 4C7FA 2J62A 2RJ2A 1HXYB 4JG0H 5C0IA 1UWXK 3SKNB 1Q94A 5AAWA 4DKEL 5EZOL 4AEHH 1NCUA 4U1SA 5D7LA 3E8UL 4EANA 4LU5L 4G3YL 3RU8H 4TX8A 3MJ9H 1X5AA 2CRZA 1IBGH 1Q9WB 4ODTL 5I1CL 4NOBA 4GW5A 3SCMB 1JGVL 2R2HB 3K4AA 4OIFA 2RVAA 3SCNA 3MACL 5BZWA 1CD8A 4CVWA 5DQDH 3TIEB 2W59A 2OMNA 3F65A 1S8DA 3AHZA 1HILB 5KANI 4DWSA 2CPCA 1N64H 4E41A 1GQPA 1PX3A 2DF3A 3AICA 3MBEC 3SDXA 1QPXA 4PRNA 4G8FA 3H9YA 2HTLC 1NGYB 1C8XA 3BPNB 4KROB 5E8NB 4M6MH 1SHMA 1KXQA 1JWSA 1JRHL 3ULSA 2MWCA 5FUZH 4NZDA 3LEVH 3MRFB 5HDBF 1WWBX 2WB5A 4YFDB 2Y8KA 1QI0A 2WMGA 4YDKL 5KTEH 3C09B 2VDNH 2WO3A 5HGHB 1UX7A 2P24A 2ZEXA 5I1HL 4LPVA 2VWEE 4KJWC 2Y7QA 1DP0A 1W0WB 1M71B 3CFCH 1FAIL 1NAMB 2HKFH 1FFNA 1G9NL 5GRUH 1XGPA 1HE7A 2EDBA 5ESAB 3VRLE 4YUEL 5I19H 2PO6B 3LSOA 4FS0A 2HT4D 5JXAH 4U1NB 1L0PA 4RE2A 4MNHA 4JFEE 4ONOA 1C5CL 4MHHG 1UWXH 5HHPA 4LLMA 2A6IB 1NGPL 3QG7H 3O6FC 2XQYG 3MA9L 3GNPA 1MCHA 3NH7H 1ZE3C 5ITFB 2GK0B 3CZJA 3FQNB 3V5HA 4OD2A 2JCCB 3AUVA 4YO0B 2WMFA 3PWVA 1S9XB 5IKCB 3GBNL 2OLDA 1H6XA 5DT1H 3WS6A 4YFEA 4A3HA 3M8OL 4LF3B 2LVEA 3AB0C 2ATKA 3HPJA 4QY8B 3QXTA 1DJSA 1JNEA 1UB5B 1B4JH 1FL6A 2CHOA 3ZDXE 1LL6A 4XNUH 1K45A 4Z7UE 3EZ8A 5GJTH 4U3XA 1CZSA 4WU5B 1UH3A 4L8CB 1QNRA 1HCVA 1U92A 2VDKH 1HNGA 2RGSA 3GMQB 1JGDB 1CXHA 4I18B 5CUSH 3EOBB 3KXFA 2BNQB 3QEQB 4HKXB 4Y19E 4X6CF 5IWLC 1JI6A 1ZWIB 2YIHA 4RSVA 4NC1E 3WELA 4PJHE 4PJFE 2ITDA 4TVPH 4ZSOA 3MRBB 5SWSE 3CH1A 4N0CC 4TSBH 3H0TB 5T3ZH 1UWWA 5HGAA 4D8PB 5C0CD 3TYGH 5GS0L 1Q9LA 4OT1L 5IVXF 4OGAD 3MV11 1E4JA 5EA0H 2EPLX 1NGZA 2FDBP 4LSPH 2K1MA 5F88A 3DJ9A 4PLJC 3PQYD 1QI4A 4CDGC 2YZ8A 5IB5B 4JL2A 1MSPA 2E9MA 4OLZL 1HEZA 1GW1A 4O2EA 4YGVB 1HH9B 2OR8A 2ZUSA 3LEIA 1HX0A 5CP7A 3K2MC 5HD8D 3QO1A 4HIIB 1WFOA 5LJYH 5T3ZE 2Q7NA 3FNDA 5EFIB 5EOCJ 5D4YA 4MJ4A 4WV1C 2H26A 4RYDA 2G8ZA 4JG0L 1QRKA 3D25B 3MQIA 4E0RB 4AEHL 2HN7B 3W9DA 5CEXB 4EE9A 4PN2A 3KNBB 4EDXB 2PTTB 3RU8L 1E4LA 2NZ9C 3MBEB 3MJ9L 1X5ZA 1A3LH 5FOBB 1IBGL 4DN4H 4NUJA 4HJGA 4RDQF 4ODWA 5JIIA 3F7YA 4EUPA 5HHQA 4XXDB 4JFEB 4PG9B 1UG9A 3VU2A 4W68A 4PRDA 3ACGA 5MEQB 2QKIA 4X9YA 5DQDL 3D5HA 3PHAA 4XTRC 1T0NB 2MOVA 1N64L 4HZLB 4OFKA 2WN3A 4H41A 2YOCA 3GJFK 4OKDA 4PJ5A 1T0MA 1DQQA 3WLWC 1QP1A 2VIRB 3QQ9D 2R1WB 2FECI 3E6HA 3G5VA 4M6ML 4MCYA 1FYTA 4F8XA 4W4OA 3BZEB 5FUZL 2ZPKH 1FVDA 3LEVL 4OF5A 1F4YH 2VISA 2WO1A 5KTEL 4QRPA 1XF2A 2VDNL 5FYJU 4OZIB 1XSJA 4UFJA 4M7JH 1CS6A 1BAGA 3WUFA 3QDME 1E1FA 3O6FB 2JELH 2WDBA 2PF0A 3AZSA 3V5KB 3CFCL 1YY9C 2CO7B 2EDEA 3RHWF 3SGKC 2HKFL 5GRUL 1SMAA 3LQAC 3BI9X 5JXAL 5JIHA 5I19L 2EKSB 4MS8C 4OV6F 4APQD 1GCFA 2GJPA 3QFJA 2P46B 4ODHH 2APVA 4P08A 3QA3A 4PJAB 3AB0B 2FEEL 4PJHB 4PJFB 1CVRA 4HXAH 3PWLA 3QG7L 4DTGH 2Y6GA 5I75C 3DYMA 2G2RA 2BY3A 3EFFA 3K2UH 3NH7L 5HYJE 5LA2A 1ODUA 3VXME 4UQ9A 4HFWB 4IHOA 1YJDC 2BX5A 1J9CT 4L4TD 3L3DA 1MPAH 3LRSB 5DT1L 4UQ2B 3KPRE 5DYOA 1V6YA 2X7LA 3EYUH 4NCC1 5C7XH 4ZXBC 1VESA 1Z5LB 2Z93B 4P3WA 5MEOB 3GKWH 1B4JL 4Q7DA 4JL1A 3WH6A 3D69A 2UZXB 1IM9B 1U8KA 4DGVH 3GJFH 4XNUL 5E09A 3IYLW 3D48R 3H7BA 4HWUA 1IL1A 4GZ9A 5GJTL 3HAEA 8FABB 1PKQA 3VWJC 5I18H 2GK1B 1I7UB 4J3OC 1M6OA 4HV8A 1MF2H 5F6HJ 2VDKL 3PHQA 5IW3A 2MSPA 3B5GA 3C60D 1MCNA 5IB2A 5CUSL 2AQ3A 2VZUA 3OZPA 2YC1B 4HOZA 5TDPA 3IGAB 1NGXB 2FHCA 2JCCF 3TYFA 4TVPL 2HYXA 4X6CA 4LNRA 5I1GH 4CVZA 1ES0A 2BNRB 5DTFB 1FZJA 4TSBL 5T3ZL 4P2QD 5E99H 5HY9A 4POZD 3TYGL 4J4PC 3PGCA 1A1NA 4M6NH 1QR1B 2J1KA 4Z2AA 5IVXA 1KIQA 2EXWC 2NYYD 5EA0L 3LEXA 3B6SB 2BXYA 5I8EA 3UJTH 1CD1A 4LSPL 2YD5A 3MV8A 5TDNA 4QLKA 3PWUA 2NX5E 4WEMB 3OEBA 5C0JA 3MMEB 3EBAA 4ZQKB 1T1XA 2QQNH 4XXCC 1KGXA 3RIAK 4WV1B 5F9OH 3OGCB 1FG2A 4PJ7E 3BPCB 4QLRA 2W60A 4ZUSB 2H32H 3U2SB 4NKMB 4ZS6C 1XIWC 1U42A 3VILA 3AREA 1MLBA 1S7UB 5KSUB 4KKAC 3IU4H 2CR3A 5B39B 5GZOC 4U1IA 2ZNXA 1UM6H 3SPVB 1JGEA 4NRYB 3LKNB 1VBUA 5C0BE 2YSSA 5JNYA 5D7IB 1MVUB 3O3EA 2Z4QA 5DQJB 1TZGH 4JDZB 2UWEB 4G9FB 1G7JA 1A3LL 4GG8A 4UUJB 3VGEA 4DN4L 3TH2T 2YKKA 3KYMB 2FO1A 2W1NA 4GBXD 3SDCB 4I0PA 3VD4A 4NI3A 4PP1C 5DDHA 4PMXA 3GXUA 4MD5B 2FX8H 3L3KB 1L7RA 3PJSA 4NWTH 5AYBA 2D22A 3DGCR 3HCVA 2EE3A 5HYJB 3VXMB 1U8HA 1UD2A 4JDVA 1Q38A 4U31A 1T5WB 4QXTA 3CCHA 4QRUB 1NDGA 5E0QA 5JA9A 3KPRB 3UTSB 1J0YA 2XG5A 1K12A 4JAMB 3TVMA 4LHSA 2XFYA 2ZPKL 2VSCA 1ORQB 3ALWA 4LYPA 1F4YL 1HXYA 5GS3A 3SKNA 1T2JA 5F6IC 3SCRA 4LVNB 1H0IA 2X1OA 1UUQA 1U3HD 4M7JL 3VRLF 1DHKA 2CJUH 3UYPA 1QNPA 2DRUA 4LVOC 2JELL 1RUPH 5I75B 4W93A 5F7DA 1BVNP 3W11C 1Q9WA 3VG9C 3SCMA 2R2HA 5FCSH 3GUTB 5B22A 1OTSC 2H6PB 1S5HB 3TIEA 1CFSB 4FXKB 4ODHL 3O6KH 3W53A 1HILA 1NANI 3LKQB 3UAJD 4G7VH 4JHZA 4HXAL 4ZXBB 4DTGL 4P9HC 3C8XA 1TVGA 2ZIDA 3K2UL 3LPWA 1MW2A 3AM8A 4PLNC 1NGYA 2VLKB 3FT4B 5E8NA 4C56E 3VWKC 1E6XM 1URLA 1MPAL 3VWJB 3MRFA 3ZDXF 3FQRB 2J88H 3EYUL 3KVQA 2Y5EA 5C7XL 4Z7UF 5LKNA 3GKWL 4IOIB 4WWKD 3TH3T 4YBQD 1U3ZA 3O2DA 1W0WA 4MYWB 4O4YH 1W9UA 1M71A 4DGVL 5ESAA 1OCQA 2J4GA 3SE8H 2PO6A 4U1NA 5I18L 3DNKA 2EC9T 2QV4A 4LMQI 1MF2L 4PJHF 4PJFF 1ZA3B 2A6IA 4F33B 1QYGH 3D1MC 1KFWA 1DLCA 3VI3E 5ITFA 2GK0A 2DDXA 1ODZA 1JF1A 1XEDA 3U7WH 4P7QA 4KXZI 3RCNA 5I1GL 3UYOD 5EDXA 2JCCA 4ARYA 4YO0A 5C08D 4KU1A 3BIBX 1S9XA 5IKCA 1SFSA 5E99L 2PCPB 4LF3A 5DHXB 4CMMB 4XPHH 3RX5A 2CGRH 4PRAB 4QY8A 3UTOA 4M6NL 1XCXA 1IEBB 1UB5A 3U30C 2WIMA 5C0BB 1KCRH 2BGPA 3AMDA 3CZFA 1EX0A 4NN7C 3WUWB 4HP5A 5ELIA 3UJTL 4OMDA 5A95A 4PBVC 1WFUA 4NSKB 4EDWH 1XIWB 1H3UA 4WTZG 4OZGE 4WU5A 1L9MA 4L8CA 1GJWA 1JPSH 2OSYA 3EMQA 2BZDA 3SKOB 2NY6C 3GMQA 1JGDA 2QQNL 4QX1A 3D3VD 3EOBA 4UINH 5SWZD 2BNQA 3QEQA 4HKXA 3OIHA 1KJVB 5A2AA 1ZWIA 5ACLA 2EDJA 5MERB 5I1DA 3R0NA 4FLOA 1CDJA 3V8CA 2VJXA 3ES6B 1NDMB 4V2CB 1AGDB 2IH3B 4D8PA 3AIRA 3IU4L 3D2UB 1ETZB 1ULOA 2JJTC 3WFEH 4BA8A 2CEQA 1UM6L 4KK8D 1I1WA 3MV7B 3RIFK 1TDQA 5F7FA 1TZGL 1WIOA 1UMIA 5I23A 2JJSA 4Y16C 5IB5A 4ZPVB 4EXPX 3MMWA 3RGVD 1AGFB 5IP4A 4OLXH 1ULPA 3KPSD 4ACPA 3H9ZA 3AHYA 4LYQA 2MCG1 2FX8L 4YGVA 9CGTA 3SHSA 5GGQH 1HH9A 2GUYA 5D8ZA 4NWTL 5A3IC 3BKCH 5F6IB 3SDDC 3HR6A 1HKLH 4HIIA 5T3XD 5E6ID 2GFTA 1AR1D 4LVOB 2CO6B 4R97C 4Y2DC 5GRJH 3E1F1 2X89A 2OTWB 1IILE 3ZE0E 3VG9B 5D4QA 1B31A 1LWHA 2GUOB 3DVGB 5IEKB 3PTMA 3HZMB 3MJ9A 3D25A 2HN7A 3QCUH 5CEXA 2V5DA 2X1IA 3RVTD 2KDGA 4EDXA 1YN6B 1EMTH 4OBSA 2CJUL 4GO6B 2PTTA 5GSVB 3MBEA 1RUPL 2W9LA 5FOBA 3MTRA 2EIZB 2FIKB 5B4XA 4XXDA 4JFEA 3LN5B 1IC7H 4RE3A 3QHNA 3T2OA 5MEQA 4A6OA 4CD7A 1JWMB 3T04D 1T0NA 2DLGA 3O6KL 3VFGH 1HI6B 3QNXB 4G7VL 4HZLA 4BSVB 3FZUD 1Q6FA 5HDRA 2EEXA 3D6GA 4G9DB 1EERB 3EYQD 2W38A 4DUVA 3MJGX 1NJ9B 5CG0A 2R1WA 2KKQA 1NUNB 2KZ1B 3BZEA 1HP5A 3MV9E 3N1FC 5F96H 2J88L 1G0CA 5D1XA 2HFFA 4HZ6A 2Q7YB 1CENA 3ZKMC 3O6FA 3ECQA 2EPOA 4P2YA 3ARBC 3V5KA 4O4YL 2X70B 1Z3GH 4I8DA 4OZGB 3SE8L 1T1ZB 2EKSA 4M7ZC 4LL9A 1D5MB 15C8H 4JO3H 5GRXG 2QMKA 4PJHA 4PJFA 4M3KB 1E55A 1H3XA 1QYGL 4BA0A 1WCGA 1K3ZA 1YMMB 3U7WL 4HFWA 4ACYA 5GGUB 4NN7B 4Z2GA 1M7XA 4L1HA 2OK0H 5KZ6A 1IARB 3LRSA 1OF2B 4UQ2A 4M1GH 4XPHL 4E2OA 2CGRL 1Z5LA 2Z93A 4MDJB 2NY6B 5MEOA 2JEQA 5IHZB 1NFKA 1KCRL 4WGVB 4EQ2A 5HGBB 5FIPA 1RZJC 1PIFA 4KQ4H 1IM9A 4P59H 4LKCB 3NDZA 1WCQA 4AZIA 5ISZD 1UFUA 1RZKC 4EDWL 5BS0B 8FABA 3NAAH 2CBIA 1LVEA 3QHTC 2GK1A 1I7UA 1X5HA 2DIJA 5F1NA 1TE1A 3OR6B 2PYEB 4ZO6A 1JPSL 3PZ9A 5CPTA 2YC4A 4PJ7F 4PSRA 2BDNH 3SURA 5CZKA 2Q1EA 2EPMX 4UINL 2DQJH 2YC1A 2FEDD 2KZWA 3IGAA 3I2KA 3GYCA 3IFLH 1ZHBA 2WP3T 2EIEA 4OZFH 4QCIB 4Z5RB 3AXHA 2BNRA 2Y6JA 5DTFA 2DN7A 1X3DA 1FLTX 4JKLA 3KYOB 4NGHH 3HN3A 4XNXH 4Y16B 2I9TB 3VMNA 1IGYB 3G04B 2IMNA 3S37H 3OF6D 1QHPA 1CDUA 2XHNA 3WD3A 4ZAKC 1LO0H 3WFEL 1QR1A 5FV2A 3GGLA 4L0PA 3F5LA 1ECEA 2BHYA 3B6SA 4BS0A 4OZFG 2J5LC 4FQQB 4DUWA 5IYYA 3SDDB 2YFZA 5CZXC 5FM5O 4YLQT 3RGHA 4R97B 1FZMB 4Y2DB 3LH2H 3MMEA 4OLXL 5CD3A 4ZQKA 2OWCA 4WKFA 4KK6D 4WV1A 1JNJA 2VITB 5GGQL 3BKCL 3BAYA 1WP6A 3OGCA 4QRSB 2Y8VA 1NGQH 3BPCA 1HKLL 3U2SA 4NKMA 2G60H 5JTWA 4PGZA 4X80H 5D2NC 5GRJL 3CFKB 5T1MB 2X4UB 3C7FA 4WEBH 2F2HA 3CMJA 3I97A 5KSUA 1J8HB 4GJTB 3ZTNH 5B39A 3K1DA 2HT2D 3N18A 1ZGLB 3QIBD 3DVNB 1K8IB 3GGWB 3QDMA 3ZO9A 3QCUL 3SPVA 4NRYA 3LKNA 1H8OA 1EMTL 1TTUA 5D7IA 1MVUA 5DQJA 2R69H 1QW8A 1RULH 4G9FA 4UUJA 1IM3B 3WD4A 4MSWB 1YPZE 3KWWB 3KYMA 3U7YH 1NC4D 3L2MA 1SYVB 3SDCA 2V5SA 1IC7L 2OBGA 4B50A 2X41A 1US3A 2J8UE 1N6VA 4MD5A 4RMWA 3L3KA 4XVUD 4AL8H 1AGEB 3VFGL 2YLLA 4WI4A 5HYJA 3T77B 4KMLB 3VXMA 2XIIA 3I3EA 2RFXB 3ACHA 3BSZH 5IQ9A 4KKLC 5C1MB 2B4CH 4QRUA 3ARBB 3T1FB 4H20H 3KPRA 3BYYA 3UTSA 1MNUH 4JAMA 4AZHA 1AKJD 1ORQA 5JMOC 4PTUB 5F96L 1KEMH 1S78D 4M7ZB 3WMSA 4F9PC 1ORSB 1FZOB 2E7HA 3ARGD 2YPVH 5M7QA 4B9ZA 1Z3GL 4AISA 3GUTA 4K3EH 4ZUUB 3RJDA 1NWTA 1MVYA 2AXJA 3AROA 1WE5A 4D6CA 1CFSA 4FXKA 3VI3F 2IANE 15C8L 2C7FA 4JO3L 3LKQA 3O9WC 5F1SA 2WO2A 2APBA 4LHUG 4JKPH 3MV01 4ZXBA 3QPXH 5GIRB 2VXSH 3QI9D 4IRJB 2WUBH 3S96B 1FNAA 4P2RD 2YA2A 5B3NA 5K9KB 3QUMB 2VLKA 3FT4A 2EE9A 2VZTA 2OK0L 2RCSH 4MJ2A 5DVOA 1VADB 2AK4D 2P45B 3FQRA 4M1GL 4W84A 2IWGA 3GBMH 2CR6A 4IOIA 3T0DA 4OYUA 4QXGH 4M81A 2NX5A 4KQ4L 4OZGF 2UUDK 4P59L 2XTJC 2WANA 4PTVA 4QWWD 1K4CB 4CD5A 5FFLA 3NAAL 1JJUA 3SUWA 1DBAH 4UI9L 1BGXH 3Q3GB 2BDNL 1DQMH 3K8LA 4IRZH 4F33A 4P2OD 4ZAKB 4HWNA 2DQJL 5AWNH 1EAPB 4FMFA 3IFLL 3NSXA 1Q6GA 2J5LB 3VMPA 2A6KB 3BDYH 3IXTB 4J1UB 5CSGA 4F9DA 2P5EB 4NGHL 4XNXL 1QZ1A 2XTJE 2YD7A 2EYTB 1OQXA 2PCPA 1NMAH 2X0HA 2APTA 4CMMA 4AMCA 4HAGA 3S37L 4H8UA 4PRAA 3U0PB 2PBOA 1IEBA 1SBSH 1LO0L 4FA8A 5C0BA 1VKXB 4JFFE 1XF5B 1DTUA 3WUWA 4C7GA 3MU7A 1MCFA 3HMXA 1YPZB 4P2CG 5KS9E 1PX8A 4NSKA 3T4AB 3V79C 1EFXD 3SE3A 3UERA 1V3JA 1XIWA 4KKNA 3U7VA 3LH2L 3AYSA 2OYMA 3SKOA 3PG2A 1GC1H 5C6TH 3MLYH 3X14B 1KJVA 3APGA 3S4SB 2FGWH 3ZE0F 5MERA 1NGQL 3EMZA 1J11A 2G60L 4X80L 4AG4A 1V3LA 4J8RB 1NDMA 4WEBL 2J8HA 4KGJA 1AGDA 2IH3A 3ZTNL 1BVZA 1ETZA 3BXWA 4D6JA 1PMJX 4KK9D 2DAVA 4CW1B 1BG4A 3PZVA 3MV7A 3O45B 2R69L 4R2GC 1RULL 2H45A 2AQ1A 4ZPVA 3CTTA 1PEWA 3BAWA 3U7YL 1AGFA 2GCYB 2IANB 1G1CA 4QEGA 4D9QD 2BSRB 4JHBA 2GI7A 2V7NA 1PG7W 5JIPA 2ZXQA 4AL8L 1B4RA 1ZAGA 3BSZL 2B4CL 4F3FB 5HYSB 4H20L 2ZCKH 2GHWB 1MNUL 5J1SC 5LXGH 5EOQH 2GUOA 3HNSH 1KEML 4LHUB 5IEKA 3HZMA 4FZEH 5CGMA 2Q8AH 3EKCA 3ROOA 5JLZB 1YN6A 5A8PA 3O9WB 1VF8A 1QR4A 3S88H 2YPVL 4NJAL 5GSVA 5T33L 1T1WA 1HSBA 3FT2B 3UTPD 2C1PB 2EIZA 2FIKA 4NO0B 1AIFB 1JTTA 3LN5A 5ACMA 4OQ1A 4AENB 4BELD 3P30H 4K3EL 3IKKA 3VIPA 1JWMA 2ICWJ 5M03A 3RILA 2EDLA 4IM8A 1N59B 1HI6A 3QNXA 3P40A 4AT6B 4PT6A 2Q8XA 4JKPL 4BSVA 3QPXL 4QHLB 1JMXA 4W87A 2VXSL 5HHME 2WUBL 1M04A 1JF5A 1KT2B 1LK3H 3BUTA 4G9DA 1G84A 1R7AA 1EHXA 2XTJB 4NNPH 3MXWH 1NJ9A 2RCSL 4FP8H 2CDEB 2XI9A 5EZJB 4LX4A 4JFFB 2Q7YA 4O51B 3GBML 3U83A 2WN2A 5FXCH 5KS9B 2E6QA 4QXGL 1ISZA 5EU4B 2BGOA 2LE9A 5D2LE 5CXPA 1JI1A 4MOAA 2X70A 3SGDI 4OZGA 5EBLA 2WWDA 3BWAB 3JTTB 1T1ZA 2GJ6D 1PZ2A 1GRWA 1UVQB 1D5MA 1DBAL 4DOHB 1BGXL 4A44A 1DQML 1RJCA 1UD3A 4K55A 5I74C 5EIQA 2QQOA 4IRZL 1BG9A 2UY4A 4J3WA 2J7EA 4MVBC 3EYFB 2GW5A 1CGYA 4QPWA 4HCRA 5AWNL 4JPIB 5E5UB 4D71A 5GGUA 1XSIA 5CSUA 4LLQB 3OAYK 3E2HB 2O9RA 2AW2A 1OPGH 4W4NA 3BDYL 5ITBH 3UR8A 3VFRB 4TNWK 1CL7L 1NMAL 1OF2A 4A42A 3DSFH 4W85A 1JVKA 4M1CD 4MDJA 1SBSL 1HHGB 1U8QB 5IHZA 5E56A 5TPWH 1UA6H 2Z1KA 3ZT7A 1A7OH 5JW3H 1V0NA 1OH4A 4LKCA 4XUTA 4JKWA 4ZO7A 3RVUC 2VXUH 5BS0A 3B9KD 3I6LD 4JFUA 1E72M 2DLIA 5LCWL 3OR6A 5LA1A 3ZYZA 1GC1L 5C6TL 2NW0A 2VZOA 3MLYL 2JJTA 3UESA 2ZKHH 3NMEA 4W86A 4KDTC 1UM4H 1AO7D 2FGWL 3C5ZA 1W0VB 4QCIA 4Z5RA 4PMDA 3MLWH 3Q5YA 3C87A 4D9RE 4R2GB 4Y7EA 3KYOA 3ARFC 4Y16A 3GMPB 4CUCA 4OBRA 2I9TA 1IGYA 3G04A 1LP9B 2ITCA 5HYFA 4ONFH 2CETA 3H9SD 1T66C 1YPZF 3B9EA 4FQQA 3SDDA 4LLUB 3NCFB 1LNUB 1Z32X 2J8UF 3KLHD 3OAYH 4LCCC 2YD6A 4Y4KC 3Q5OA 5FOJA 4EIZC 3HA0A 1FZMA 4Y2DA 3O3BB 4ETQB 4HS6B 1DEDA 3LMJH 2GJXB 4JRYD 2VITA 4QDQA 2VCBA 4ZO8A 2XRAH 4OMCA 5HHMB 1P4IL 4QRSA 1E6OH 5FDYA 2GSIB 2JEPA 1R5WB 3U36A 4HIXH 4HG4K 3DX9B 1NWRA 5T1MA 2R0WH 2X4UA 2ZUWA 2Z8RA 1H3WM 4H0HB 2Y6HA 2ZCKL 1J8HA 1SHWB 1YEHH 3PUIA 1IQDC 1J12A 5GGSB 4PTMA 3QXUA 3GSQB 5EOQL 1ZGLA 3DVNA 1K8IA 3HNSL 1JPTH 3GGWA 4XVTH 4FZEL 5DGQA 3UCRA 4F7EB 5D2LB 2Q8AL 2CK0H 2C0HA 3MLZH 3S88L 4NO5B 4Q9QH 4MSWA 3CXHK 4BF7A 3GDBA 4AM0B 1X5YA 3RVWC 1SYVA 1WB0A 3P30L 1LD9B 5TE4H 4WO4D 5ICZB 2Q8BH 1OGBA 5DN2A 1JGLH 1G6VK 1UZ8B 5DHVB 1YC7A 1CI5A 3T77A 3OMZA 4OZ4B 2RFXA 2NTFB 4UFKA 3CSGA 4HH8A 1BGAA 1EH9A 1LK3L 2CKBH 3ARBA 3T1FA 3L4VA 4NNPL 4V2XA 3MXWL 2XYCA 2YRPA 3EAKA 2B2XH 3HE6D 2B5IC 3F7PC 4Q0XH 4FP8L 2IAMD 3MLXH 1DE4B 4O00A 4JPKH 4PTUA 5DFVC 2E26A 2Y07H 1ORSA 3SO5A 3WHE1 2HG5B 1FZOA 1MCWW 2YD3A 5I74B 3H2WA 3FOMB 4EEEA 4M62H 1BMGA 5IHSA 3SQOH 4ZUUA 3AHVA 3A0OA 3IDIB 2Y6SC 4U6HB 3FB6B 4IRJA 2O26U 3LVEA 1I3VA 3NCJH 4MAUH 5HGDB 4ACZB 3CDGB 5DK3A 3U1SH 1UWIA 3ZKXC 5FO7B 3S96A 2GK2A 1NCAH 2NZIA 5K9KA 3QUMA 4XP1H 1D5XA 2QQLH 3BHBB 3EOTH 1OPGL 5ITBL 1VADA 4DM2A 3OJDB 4BQ6A 5C0CE 4N42A 3M07A 3DSFL 1XR8B 5LGKA 5KS9F 1AC0A 1SY6A 3MUZ1 1MPXA 5TPWL 1G9MC 5IHBA 1UA6L 4RMUA 5IJVB 3T0AA 1A7OL 5JW3L 1WZLA 4EVNB 1CZTA 1K4CA 4WTXA 4D1IA 2VXUL 2VB5A 3PQYE 1T0PB 1EXPA 2DQTH 3QXAB 4U4BA 3GSVB 5MEPA 4G8EB 4NQED 3ARFB 4TSAH 4BQCA 3ARDD 3HUJE 3Q3GA 1Z2KA 2EXYC 5H8DA 3UROR 1WVZA 4ZAKA 5EIIB 2ZKHL 3F12B 1F4HA 1EAPA 1UM4L 3BWUC 3EHBD 3QUZD 5D5ME 4N0UB 4QX3A 1BIIB 2W91A 1E73M 3MLWL 1MCLA 2DKUA 2A6KA 3AQUA 1CIDA 1EJ6A 2ZNWA 1JWUB 2P5EA 4J1UA 4LCCB 3VXOA 2EYTA 3EJJX 1YQVH 4J3VA 5JPMB 5FM4A 1MELA 4FQ2H 4PJGE 1BQHB 4ONFL 3U0PA 1MIEH 4QB6A 3X13B 2RGMA 4U3AA 1VKXA 4GINA 1HHKB 1XF5A 1Q0YH 4I1NB 1MQPA 1PBGA 1NQ6A 2WVSA 1YPZA 4U33A 5IROC 3CVIH 4XHQA 3T4AA 3VOCA 3R8QA 4UIMB 2ZXBA 2W0KA 4ELKB 1A4JA 4KAQH 2WMKA 4D94A 1KN2H 4IRSD 2YD4A 3KAAA 5L2KD 3LMJL 5F7LB 1IQDB 2F58H 3V95A 5F9JB 1OLZA 1ERNA 2XRAL 4HH9B 5F1KC 3S4SA 4GO8A 1E6OL 1B3XA 2ZUYA 3CX5K 1UXWB 1KENH 1U91B 3MRHB 4HIXL 2YXFA 5DEZA 1YEDB 3SGEI 2R0WL 2FB4H 4TRPH 3U48A 1HSAB 1YEHL 3PUHA 2MCPH 1U41A 1QTYT 4W89A 2WWKO 1JPTL 4LLYB 3DVFA 4HK3N 1MREH 4XVTL 1H8NA 4CW1A 3TV3H 2CK0L 2PR4H 1PPIA 2ADIB 3MLZL 3O45A 5JW4N 2DOCA 4Q9QL 1C1EH 4YHNB 3QDAA 1WSST 4JHWH 4KKBC 2GCYA 1I9IH 2IANA 5TE4L 2BSRA 4AWEA 2JKXA 2Q8BL 5DJXA 1P5VA 3UJIH 2R39A 2B5IB 1NP0A 1JGLL 2GJZB 4TNVF 4TOQA 5JMOA 1F4XH 1QRND 2FYYA 2EEAA 4LSRH 4F9PA 1BWMA 2CKBB 2MANA 4U7SA 1KIUA 4F3FA 5HYSA 1A6ZB 2CKBL 4N9OB 2OJEA 5HVGB 3VGHA 3WD1A 2B2XL 4DWSD 5C0CB 4L4TE 3C60C 3TBSB 4Q0XL 3MLXL 1NBQA 4JPKL 1V0KA 5D2LF 4LHUA 2Y07L 4TTDD 4WFFD 3D9AH 4GAGH 2ED7A 1D6EB 2QSVA 3L2LA 1G7QA 3K8MA 1LO4H 5FAAA 2C1PA 4NO0A 3ZKXB 4M62L 4POZC 1HJUA 3RWIB 1PY4A 1AIFA 3SQOL 4AENA 4NF7A 3HUJB 1FQ9C 4UQ3B 4PY8I 5CKGA 5I0ZA 5G04L 3VFMA 1N59A 4M7KH 2VXVH 4AT6A 3BAKA 5D5MB 2DDUA 4QHLA 5ILTH 2DIAA 4HMEA 4MAUL 1TCRB 3NCJL 3WS3B 5BVJB 3U1SL 1KT2A 1NCAL 1J1XH 4XP1L 2QQLL 3RX8A 5HPMB 1V7NH 3EOTL 5EN2B 2LTQC 2FRGP 2KL6A 1CF8H 4P2QE 3WQWA 4JZ5A 5EZJA 4JFFA 2J6EA 4O51A 2J22A 2W63A 5KS9A 4RNRB 5EU4A 4P9MH 4Y5XB 1A6PA 4I48B 1PMHX 3BE1H 1PZ5B 3BWAA 3JTTA 4HPHA 4RCAA 2DQTL 1QI2A 5JR2A 4TSAL 4UV7H 4MNMA 1ZLUK 1HOCB 4HF5H 2P5WB 1H5BC 12E8H 3EYFA 5BYWA 4JPIA 4XZWA 3L4UA 3RTQC 4KJPD 4G43A 4ZFOB 4LLQA 4H7VA 3MMDA 3VFRA 1GHFH 2XVGA 3WIFA 1YQVL 3UBXG 3VGAC 1M53A 4FQ2L 5EC1B 2ED8A 5E1HB 1T03H 1HHGA 1U8QA 2V3FA 1MIEL 3SDYH 1D6VH 1FJ1B 2H2PC 1Q0YL 2IFFH 2BC4B 1V0MA 1BJMA 1CTOA 3CVIL 4HS3A 1I3RB 1AXSB 5AY7A 1MCPH 1T7VA 1MCWM 2CUMA 5T1DH 4KAQL 4GG6E 4APQB 2ZSWA 1WJ3A 1KN2L 4JO2H 4O9HH 4R4ND 5I78A 4QLJA 3QWRA 2QR0B 2F58L 3ARWA 5DUPH 5G05L 5JXJA 4HGKC 3FONA 3CZLA 3OG4B 4A2LA 4OGYL 3VIJA 1W0VA 1KENL 1D7FA 1FO0B 3BOVA 2Q6WB 3NIDE 5A40E 3OKOB 5AYQA 4XC1H 2FB4L 4TRPL 2BVYA 3GMPA 4M7LT 4AD0A 4OIIH 1ZA6B 5CPQA 2DLEA 1LP9A 1NBYB 1NQBA 3PHSA 3UEQA 1EZVY 3OJMB 2DYPD 1ZLUH 2MCPL 4AD3A 3Q5TA 3VDBA 5J9PB 2BVPB 1NH6A 1MREL 5A2BA 2CMRH 4Y4FD 3TV3L 2PR4L 4OFYD 5J1AB 5FGCE 4LLUA 1LNUA 3M7SA 1VHPA 3BX7C 1UYYA 1UR1A 4GH7B 1C1EL 4U7MA 2HTKC 4JHWL 1N8ZA 3O3BA 1I9IL 4ETQA 5A6MA 4HS6A 3TOPA 3TTYA 3T0VA 3UJIL 4EOWH 3C60B 4WWKC 4OFDA 2IQ9H 3LKRB 5SV4A 2GJXA 1E71M 4BUGA 1F4XL 4LSRL 3P4LA 5EU6D 2GSIA 1AP2B 1R7OA 4X5WA 1FN4B 1R5WA 2H8PB 3DX9A 1MW0A 4G6KH 1W0NA 2PWGA 4CU6A 4P2QB 2A3CA 4TYUA 5DEFA 5GGSA 2BBAA 3GSQA 4M93C 5D6DC 1MCIA 3D9AL 4GAGL 4LLVB 4F7EA 3W39B 1AXTH 5D2LA 3T08A 4KVNH 1HN1A 4HG4J 4NO5A 5AYUH 1LO4L 2VDPH 3FFCB 4AM0A 1S7QB 4CU8A 1LD9A 5ICZA 3WQ8A 2LTQB 4AH2B 3O3AB 5L2JB 1WIPA 2GIYA 2O5XH 4CN4A 4F15C 2YDQA 1UZ8A 1XGYL 4M7KL 1OVZA 2VO5A 4FXGB 4NBYB 4J3UA 5DS8B 2VXVL 4OZ4A 5CEZH 2RAMA 5SWQB 2NTFA 5ILTL 1AHWC 3IETB 1TFHA 3II1A 5JPNB 2E3VA 1J1XL 3QFJD 3IFPB 5C08E 1DQLH 1V7NL 3QCTH 3HJRA 5D9PA 2DH2A 2WAHA 4FQXA 4RMVA 2DQFB 4GMTH 2V3EA 1CF8L 1DE4A 4S0SD 4FI9A 4OGXH 3OKMB 4CVXB 3UPCA 4PQQA 4P9ML 3ZKSD 2CKSA 1H5BB 3L4XA 3CO4A 5C0DB 3HUJF 3FOMA 4JFDB 5CQ1A 3BE1L 3RTQB 4GG6B 1CEOA 3MBXH 3DGGB 3O11B 1Q9OB 1EJOH 3RP1A 2BNUB 4WI2A 2V3DA 1Y6MR 3HZYB 1JFQH 2J7GA 3TWCH 4UV7L 4NPYB 5D5MF 1G0DA 4U6HA 3D3VE 3WD5H 5C92A 1NOWA 3AC0A 3U57A 4XHJD 4HF5L 5SWZE 4H04A 3SCVA 4Z7QE 4ACZA 5HGDA 12E8L 3T8XB 2D2OA 3O41B 5FO7A 1W3LA 5DF0A 4HWZB 4R7NB 4PJGF 3BHBA 5CZVH 4G6AD 3S2CA 3SN6N 1C91A 3VFTB 1L7QA 3OJDA 4XB7A 4QDSA 1GHFL 5KZCD 4GO9A 5IG7B 3ARRA 2DLTA 3ARYA 3EJZC 3VH8G 1BTCA 1XR8A 1T03L 1WZKA 5JXGA 3SDYL 1D6VL 5FGCB 5E6IC 5AZ2H 5IJVA 3HE7C 1JGUH 7TAAA 4KDTA 2IFFL 4EVNA 3PZOA 4H5SB 3QXAA 1MCPL 3GSVA 4G8EA 4NFDA 5T1DL 3ARFA 2Y6KA 4ARXA 1UY2A 3KPSE 1KN4H 3BAIA 1G7IB 4JO2L 2BERA 4QF1B 4O9HL 1WNOA 1L6ZA 4I9WE 3MV8D 3R4DA 1BD2B 1C5DB 5B3JE 5DUPL 4PRHD 4CDHA 1MCOH 5EIIA 5DSCB 3F12A 2CERA 1YUHB 4M3JA 3D5OF 4LARH 1HXMB 4N1EA 4N0UA 2Y36H 5T3XE 4XV0A 2XPKA 1BIIA 4HGWB 4HOWA 2E9BA 1JWUA 1QD0A 3DUUA 4XC1L 4R27A 4YHPB 4OIIL 3D0LA 4YNYB 1V3IA 5JPMA 2MMXA 2AOSA 1BQHA 1NCTA 4MA7H 3X13A 4WWKB 1G9HA 1RZFH 1HHKA 1K5NB 4PLOB 3WE6B 4TTGA 5A2KH 3NTCH 2CMRL 3ARED 2FWOB 3EBVA 4PRID 4LFHD 4DN3H 4EI6B 3N1MC 1ZT7B 3UR7A 2D0GA 4UIMA 1F4AA 4ELKA 2NR6D 4YX2H 1AQMA 1S9VA 3EZJB 4TUKH 5C0GB 4EOWL 3QO0B 1IQDA 2IQ9L 2VR9A 4OAWB 5F7EH 5F9JA 1D5BB 4YHGA 4HH9A 3A67H 4TSCH 2C9KA 3FAXA 3L3OB 1UXWA 1U91A 4XPFH 1X1NA 4PCTA 4KY1H 3U79A 5JZ7C 4W8AA 4PS4H 4G6KL 3IS1X 3MJ7B 2DSUA 1DR9A 1J05B 1CGVA 2XKNA 3D85B 1HSAA 1FPTH 3SGJC 1S7XB 3LEGA 4Y5YA 3NACH 5DJDB 1AXTL 4F15B 1Z9LA 4CCEA 2QSCH 1JPFB 2ADIA 1PQZB 3CX5J 1ONQB 4KVNL 4UAOC 2XKUA 5ENWA 1AHWB 3C8HA 4YHNA 3RPIB 5AYUL 4NFCA 1DFBH 2VDPL 4IISA 3ALPA 3LV3B 4TUOB 3X17A 4D6IA 4M24A 3U6RB 3C7HA 4PJEE 4XP4H 3D3VB 2GJZA 3TPKA 5SWZB 2O5XL 4LPXA 4POUB 2RHEA 2OLHA 5F9DC 2CKBA 5CEZL 3AY4A 3REVB 4M02A 1JZ6A 3L4YA 2WBKA 4NRSA 3DHMA 3VPLA 4CBPA 1A6ZA 1A21A 4XZUB 2WW8A 3NPZB 1DQLL 3QCTL 4AZCB 3NIFE 5C0CA 3TBSA 3WH5A 3A47A 5ESVB 4GMTL 3U0TB 3L95B 2XWJB 3GSOB 5JQHC 4OGXL 3ILPB 1D6EA 4KROD 1SVZA 5HI3C 5IBLC 3TIDB 4J7RA 2P4AB 3KJ6H 1FORH 4UU9B 3RWIA 3MBXL 3RGVB 1EJOL 3HUJA 4UQ3A 1WDPA 4JFPB 5EBMA 3VH8B 1JFQL 3CFEB 4JE4B 2NXZC 4GXUM 1JDDA 3LB6C 4OD1H 3WD5L 5D5MA 2HVMA 2DS4A 4R8WH 1E56A 3WS3A 1TCRA 4FQCH 2O92A 5E7BA 5E6IB 4J3TA 5BVJA 1EDQA 3CSPA 3HE7B 3HFMH 4LGRB 4ZFGH 3CLFH 1P9MA 1IQWH 3KYNB 4M43H 4NIKB 3EDDA 5HPMA 5CZVL 2D1ZA 5ID1B 1CLZH 2GTZB 4YDIH 4JRXD 2AERT 5C0NC 2E9JA 4P02B 4WLCA 1MFDH 1UT9A 2C3VB 5AZ2L 4RNRA 3MODH 1JGUL 5E24E 4GG6F 4Y5XA 1RZ7H 4LAJH 4I48A 5A43C 1XRVA 4R26H 2BVUA 4JCLA 1QFWM 2Z91B 1PZ5A 4N68A 1MJUH 1HINH 2YD1A 3AIVA 3LCYA 3W0KA 5J57B 4QDRA 4WIQA 1INQB 2YL9A 1KN4L 2WK2A 4GMSH 1XH3B 1TITA 4P5TC 2VERN 5DMKB 3VIHA 1HOCA 4UOW1 5D7JC 1MCOL 3NIDF 3HPNA 1YHTA 2FLBT 3WF1A 2AXHA 1GGCH 3RWHB 4FQIH 4LARL 4ZFOA 2Y36L 3PDOB 3FHQA 3QDHA 5IROA 3KPNB 1PX4A 5GRVK 3L4TA 4XVUC 2BNQD 2YKLH 2LU4A 2HLEA 3CDCA 5DHYB 5EC1A 5JHDB 2ADJB 4MA7L 4ZYKA 1RZFL 3SEEA 1L0XA 4OF6A 5CJQH 5FL1A 3NTCL 5IMLB 1QI3A 3BO8B 3TA3C 1FFOB 1U8OA 3QPQC 4DN3L 4YE4H 1HT6A 1QNSA 5B21A 1AXSA 1VFBB 1U95B 2OZ4H 4E8DA 3OXSB 4YX2L 4APQA 1I1AC 6FABH 4TUKL 3BGMB 5IMKB 1KLGA 3DX7A 4GSDH 3UG3A 1WDSA 2QR0A 1WISA 4KTDH 5F7EL 4AY1A 1TJGH 3A67L 4OUOA 4TSCL 1P6FA 4XPFL 1J7VR 1FO0A 4KY1L 4PS4L 4UAOB 1D5IH 4MDIB 4L4TA 3OKOA 4BQ3A 3V5DB 1ZA6A 3HR5B 1FPTL 2P8LA 4PRBA 2Y64A 3DXAD 1C16B 4MNJA 5J9PA 4XUPA 1I4FB 3NACL 2QSCL 5E70A 5J1AA 3V0WH 3QIWD 4PBWD 3G9VA 1V02E 1BLIA 2IPTH 1DFBL 4YC2C 1CFQB 3K0WA 5KN5B 2XN9B 3C60A 4XP4L 3LKRA 3MR9B 5E5MB 3MBED 3O2LA 4PJDB 1AP2A 2HTLD 4JFED 2H2SC 1FN4A 5AC5A 2H8PA 3CJJA 4WCYH 5K33A 1CIUA 4P2RE 2ZUQC 1KR1A 1TXKA 4P2QA 3O6MH 4X5XB 4MDOA 3HLAB 4P2OC 4MADA 1DUZB 2AK4E 2DSZA 1HJQA 1ADQA 1MHCB 4HA3A 2PWHA 5IEHB 2X4QB 2NXZB 5KAQF 3JUGA 3WIHA 2E40A 4W88A 4JFQA 4D8MA 5HNNA 2J47A 2FNBA 1HHIB 1RUMH 1PDKA 1QLRB 4YIQB 3KJ6L 1FORL 1S7QA 4QDMA 1CFNB 3CU1A 1BQSA 3GSRB 4HS8H 1T7YA 4XPBH 1CK0H 1GYAA 4Z7QF 4AH2A 3O3AA 3O6FD 3PHOB 1VENA 4NHUA 5DS8A 1W72H 4LYRA 5CJXC 4OD1L 5SWQA 2L7UA 4R8WL 4U2ZA 2ZEZA 4FQCL 5CIPH 2VR5A 3IETA 1ND0B 5JPNA 1RP8A 4AZGA 3HFML 4ZFGL 3CLFL 1ZBWA 3IFPA 1IQWL 4M43L 2DQFA 1W9XA 5C2BH 1CLZL 4YDIL 2RBLA 4L5FH 1EOKA 3WIJA 5BXSA 2W94A 1BYDA 3D39E 1MFDL 3H7LA 4CVXA 1KPUB 2CITA 1UWEH 2Z4FA 1XR9B 3MODL 5D7JB 3WHE0 5EFDA 1RZ7L 1H5BA 1TMQA 1A6TB 2Y6LA 5C0DA 4JFDA 5L8KB 3RTQA 4R26L 4GG6A 3DGGA 4GBXA 3O11A 1Q9OA 3JVGC 1MJUL 3UBXA 1HINL 3BYTA 5B3JF 3HZYA 1CICC 5A3HA 4S11A 2C7UB 1SDDB 4GMSL 3KYAA 4NPYA 2Z31C 3P9MB 2BFGA 3I6KB 1GGCL 1TJHH 3T8XA 3MRCB 4Z6AT 4FQIL 4N0CD 5EIVA 3ESVF 2X4RB 3TA3B 2EDXA 2A3AA 3UNPA 4HWZA 4R7NA 4ATLA 3B83A 3ARPA 4MGXA 4OLWH 4QGTA 3BLPX 2YKLL 1O0VA 1I1AB 4BJLA 5A2FA 3SUTA 2BNRD 1HKJA 2ENYA 5CJQL 3ULUC 4PLJD 3OKNB 4N1HB 4EAMA 4U1GC 3S5LG 2JJWA 4HTYA 1BF8A 4YE4L 5EU5B 2VRJA 1RIUH 4H5SA 3GMMB 4ZFZB 1MJ8H 2WMPA 2OZ4L 3TN0D 2V5YA 6FABL 1B3YA 1KJ3H 4D9QE 4QF1A 4GSDL 3K74B 1BD2A 1C5DA 4KTDL 5DSCA 1A02N 1C8QA 1TJGL 1YUHA 4P2RB 1HXMA 1LMKA 3QR2A 2HJKA 1K6QH 1B3ZA 4HGWA 3ULUE 1D5IL 4UDUB 1Q6DA 4P8XA 4YC2B 4D6DA 4YHPA 3UCQA 4YNYA 4KK5C 5E8DH 4JFYB 1DN2A 3IAPA 1SR0A 3STBA 4WWKA 1BPVA 4UQAA 1E4KC 4XNYH 4UAPA 1MY5A 1EDTA 1K5NA 2EDYA 2NZ9D 3WE6A 3G08B 1W9VA 2FWOA 4J2XA 3NSNA 3PUCA 1I3UA 3V0WL 4GAJH 4EI6A 3C2SA 1ZT7A 4AZ6A 4PJEF 2XZQH 2IPTL 3UTPE 2BMKB 5J11C 4FFVD 2ZUQB 4MQXC 4XTRD 5C0GA 3L1OH 2OP4H 3LPGA 2ZX9A 3QO0A 3DV4B 5DRXB 4OAWA 4P2OB 2B20A 4G9FD 1ZMYA 1D5BA 5D6DA 5A16B 5F6HI 3NIFF 3L3OA 3BP5B 3P9WB 4WCYL 5IVNA 3P9LB 4HUXB 3MJ7A 3DVIA 2WC4A 3OLGA 3O6ML 4D72A 1CVSC 4L4JA 2GJJA 5HHXH 5HYJD 4E4PA 4LSTH 1QSVA 3D39B 2HLAB 2VX6A 1S7XA 3QXVA 5HGGS 4J3SA 4AY0A 3W28A 1MEXH 2E9IA 5DJDA 4BJ0A 1JPFA 1HDMB 3LOWA 4FHBD 4RAUB 1PQZA 3KPRD 1ONQA 3UTSD 3DHUA 4HKBB 1EHLH 1OGSA 4X9HA 1AHWA 4WHDA 3RPIA 2HFEB 3CU7A 1GGTA 4MS8D 5IB4B 4CAGA 3WF2A 3LV3A 4TUOA 5IQ7H 3U6RA 5DGRA 2GJ6E 4HS8L 1QOKA 2GY7B 3QUYC 4XPBL 1CK0L 1IGFH 1KTDB 4M80A 3D3VA 1CXFA 5JW4Q 5SWZA 1ZLWH 5CIPB 3OKDB 2WZEA 1KFAH 1W72L 4HHAB 4NCDA 3REVA 1FL5B 3SKUD 4AAXA 4JVPA 2N4IA 1DWJM 2IPKB 4XZUA 4G5ZH 5JBEA 5CJ5A 4AZCA 1VERA 4OIAA 4JQVC 3T0WA 3BKMH 5ESVA 4ZXBD 5C2BL 1CLOH 2XFXB 3L95A 4L5FL 2XWJA 4BZYA 3GSOA 1CICB 3RKPA 5F71A 3ILPA 5EZIH 1JCKA 3CUPB 1UWEL 2VLKD 2Z31B 4WHYH 5HDOA 1TVBB 5A8QA 5LBSH 4U05A 3TIDA 3QZWB 5I66B 2WABA 3VWJD 3B5HA 5ANME 4JB9H 1R85A 4UU9A 1T2QH 1VFAB 3RGVA 3I6LE 1WFNA 4JFPA 3VH8A 5F7MC 3MLTB 3CFEA 1S7SB 1H3PH 2XPGB 2EE6A 1OD0A 4WHYG 1MHEB 2K9UA 5BJTB 3AU1B 3S5LB 5I1IH 5DJ0B 2Y1VA 4XAKE 1TJHL 5E6IA 1AO7E 5I6SA 3HE7A 1JDAA 2JIXD 4IM4A 4QFUA 4U1GB 2ZICA 1JPGB 2GYSA 5ETUB 3DUSB 4J4PD 1NAEA 5ID1A 1BFOB 2GTZA 4OLWL 1OARH 2AVGA 1ZVSB 3VGDA 2EXWD 2WVVB 4Z2HA 2C3VA 3H9SE 3FY1A 2CESA 3RPKA 3LD8C 3I75B 2B9VA 2W92A 4JY4B 3DYOA 2DSVA 2Z91A 3RWCB 1KYOK 1RIUL 3HG1D 3P77A 4X7DC 1MJ8L 5AD0B 4QP0A 5GGTA 2NY5C 1KJ3L 4JAWA 1INQA 2VDQH 1RIHH 4PJBB 4DXSA 1XH3A 3ZDYE 3WXVH 1N5YH 4PFEA 5DMKA 4YH6A 4JRYE 4ENEC 2OXHA 3PP4H 3S36H 2ID5A 3RWHA 5E9DD 3WL0A 2FEEI 3PDOA 5D70H 3A6OA 4N90D 4ZUWB 3WNLA 1K6QL 4QX2A 5EO9B 4KKAD 2CBVA 3KPNA 5IMMB 1FYHB 4HBQA 5J11B 2VCAA 3T4YB 1QKZH 5E8DL 3VFSB 5DHYA 3BGAA 5JHDA 2ADJA 2BY2A 4OV5B 3D18A 2A3HA 3KPLB 2E6JA 3EIFA 4XNYL 5I1LB 1AQHA 4KRUA 5IMLA 3BO8A 3GBLA 1OHQA 1FFOA 5E1AB 4GAJL 3D2UD 3HE6C 2X4TB 1VFBA 1U95A 2XZQL 1UEYA 5JR1H 2GJ6B 3WQ4A 3OXSA 4PJEA 3LS5H 3BGMA 5IMKA 3L1OL 2OP4L 3MV7D 1E0VA 2XZAH 4M1DH 4GRWE 2YUXA 3SGJA 4JJHA 4G6JH 5I30H 2JTDA 2BHZA 1X44A 3QB7C 1YNTB 1A1MB 3FB7B 4MQSB 4PGBB 4MDIA 2YBRB 1CQKA 3RNKB 4XPGH 4R5EA 4JQXC 5DA4A 1TNMA 1SJXA 3HR5A 5HHXL 5TF0A 1UXZA 4G6FB 2WCSA 4LSTL 4PF1A 1N5AA 3QUYB 2UYLB 1OD8A 1P2CB 2CHNA 3JTSB 2BV9A 5BROA 2PNDA 1MEXL 1U8PB 5C0EB 3W11D 1X5FA 5ANMB 2UY3A 5SX4H 1EHLL 3E3QE 4CCDA 1QNZH 1X4XA 1OTSD 3VIGA 1CFQA 1OQOA 5IQ7L 1WF5A 5HVFB 4K94H 5KN5A 3WBEA 3EOAB 1IGFL 4KMTH 3MR9A 4A2MA 4H1LB 5E5MA 3WJLC 2VZSA 3CZKA 2GQHA 2VMFA 3VRIB 1KFAL 4JDTH 1AO7B 2YD2A 4PJDA 1UGNA 3LRHA 3VWKD 2QQIA 4MX7B 2NY1C 3ARDC 4G5ZL 1H3TA 4X5XA 1KB5B 1NCWH 3NBNA 3BKML 5FF6B 3HLAA 1CLOL 1DUZA 2V9RA 3H9SB 1MAJA 1T5XB 1MHCA 3EHBC 1IC5H 3SE4C 2JF7A 5IEHA 2X4QA 1T7XA 1E5JA 5EZIL 1CE6B 4LASH 1XGRA 4LPUA 2B0SL 4A3ZA 3W4RA 1HHIA 3ILQC 5LBSL 1QLRA 4YIQA 1EDGA 1REIA 3OPZH 2V9TA 4JB9L 1T2QL 4X7FC 4OCNC 1MRDH 4YHMH 4XX1E 3TBTA 4NQEE 3GMLB 1JXKA 4JRYB 4K68A 1H3PL 3SCUA 3PHOA 2A2QT 4F8QA 4NRXA 2V17H 4LOUC 5I1IL 1V08A 3L3GB 2E3ZA 3LD8B 4GKOA 3RI5F 2CKNA 4CN6A 1G9EA 5BXPA 2JF1A 1VB9A 2VAJA 1JD7A 3RZCC 1OARL 2C1OB 4TUJB 1GOOA 3V4VH 1YMMD 3MLRH 3SUVA 2CH8A 1KPUA 1XR9A 2ORXA 3OXRA 5D7JA 5CBAB 4JFXA 1A6TA 3HZKB 4RIRB 1HCFX 3WKZA 2BVOB 5D1QD 2NY6D 1M1SA 3B2VH 4GRWB 3F6LA 3ABZA 2C7UA 2VDQL 1RIHL 1NWUA 1UXXX 5KSBE 3WXVL 5L2KE 3AIBA 1N5YL 3P9MA 4P57B 3ULUF 5BS0D 3PP4L 3S36L 3I6KA 4LHJB 1UJ3C 2GT9B 4EI5C 3HKFA 2PYED 2X4RA 3TA3A 5D70L 4ZXEA 2W0FB 3HE6B 5EJZB 3VG0H 2WLZA 1QKZL 2RV9A 2DT3A 1E6NA 4KH2A 3ARGA 2D03H 1PEZA 1GOMA 1V02A 3OKNA 4U6YB 4Y16D 3UC0H 5EU5A 2NQCA 4KXZH 3GMMA 4ZFZA 1VFFA 5JR1L 2FL5B 4PJBF 3LS5L 4LLAA 1BF2A 1OAXH 5TE6H 5A3ID 3EDEA 4HDIB 2WMJA 2XZAL 4M1DL 3SDDD 3BW9B 1W0YT 1QRNE 3QI9A 3QDGD 2XSAA 4G6JL 5I30L 3HNYM 1JYXA 3UZQA 4H0GA 4P2RA 4Y2DD 3O6AA 3TJHC 4Z78B 1MWOA 1M03A 4PMVA 4LBEB 4LPLA 4D3CH 1CFTB 4XPGL 5E94B 2C4XA 4HSQA 1JHJA 5IJRA 5IHUH 4S3KA 2R56H 3TPUA 4JFYA 4RBPH 4B15A 1ROWA 5BV7B 5C7GA 4XCYB 3ACIA 4WFFE 4GW4B 3LMYA 5CD5C 4HBCH 3G08A 3EO0B 5FEBA 3TBVB 5C09E 1J8HD 2EE2A 1K9DA 3RY5A 1GMMA 1FGNH 2AKRB 1QNZL 2I07B 4OD3H 2BMKA 4NQEB 2NY1B 3ARDB 5HVHB 4K94L 2WWKT 3B2UD 1QLEH 4RFOH 2ADGB 5DRXA 3DV4A 4KMTL 3RDTC 4P2OA 5KVMC 4CUBA 5A16A 4JDTL 3A4XA 2WP3O 3QUZB 5EZLB 5F97E 4BQ8A 1A7PH 3BP5A 4M6OH 2G3IA 4TXEA 3IS0X 3P9LA 4G7YH 4HUXA 4U1LB 4JREC 4CRPA 1WFTA 3C9NB 1FNLA 3N1GC 3F62A 1QG3A 2F9BT 1DANT 2IC2A 3P4NA 2NSXA 1NCWL 3D39A 2WZPD 3RWDB 3AFBA 4AZBA 3ZKMD 3MRDB 3FB5B 3GIVB 1IC5L 2X4NB 3ARBD 5FUOH 1HDMA 4LASL 5CJXA 3MJ8A 4RAUA 5T5NG 1XAUA 2WZIA 4HKBA 5EFFA 3DPBA 4AD4A 4YXLH 2HFEA 5IB4A 4HAFA 3OPZL 4DWHA 3OG2A 3OGVA 1MRDL 4YHML 2UVFA 1N4XH 1UCBH 2BOCB 5KSBB 5L2KB 1KTDA 2I60H 2ARJB 3K4DA 2QHLA 3RZCB 2WVUA 5CIPA 5FK9B 3OKDA 1KLUB 4HHAA 4XUNA 3CUGA 1GAFH 2V17L 1LWRA 1FL5A 4GKZB 3QFDB 1JK8B 4DKDC 4OLYH 1IGMH 3GEWB 3T2PA 1EXUB 4H0IA 2IPKA 3M17A 1FBIH 4LGPB 2B4KA 3JVGA 1TZHB 3GTNA 4N0FB 2XFXA 1GOIA 2IGFH 3V4VL 1CICA 3MLRL 4QO1A 1K2DB 3GSUB 3CUPA 1OT1A 2R9HC 4QHKI 2Z31A 1TVBA 3O8XC 4LRIC 3BRGC 1UY4A 5LWYH 2OSXA 3DYPA 1UJ3B 3TJEH 4NRRA 1VFAA 4H8WC 1AQ0A 1QUNA 3ZDYF 1S9WB 3FOLB 3B2VL 1A14H 3Q2CA 3MLTA 4F37K 3ROLA 8A3HA 3VXNB 3NZHH 2XPGA 1QRNB 1MHEA 1XGUB 3HI1B 2O93L 3GNRA 3AU1A 4NQDB 3O2WH 3S5LA 3PZIA 4PY7B 2LS6A 1UQYA 1NGWB 1JPGA 3LPPA 5ETUA 5I1AB 1X5GA 3DUSA 2PW2B 3TFKC 1BFOA 3B9VA 4B3KA 3VG0L 2ERJC 2JFEX 3RPMA 1ZVSA 3NZ8B 2G9HA 4BUHA 2FJHA 4DCQB 2HJFB 4UBDC 2WVVA 4LCWB 4YHKH 5KBNC 5C09B 5CZXD 2D03L 5LGJB 3I75A 4UB0H 1OGAE 2P5ED 4EUPG 5ID0B 3P1IA 5M3WA 4JY4A 3WFCH 4CNIB 3IDUA 3UC0L 2E27H 3RWCA 5IVZB 4GRWF 2J1EA 4YFLI 4WI3A 5TGBB 5AD0A 4Q9RH 4V2BA 3CZUA 2ID4A 3WYRA 4PJBA 1OAXL 1FRGH 3PDDA 4WW2F 5TE6L 2CIKB 2YD8A 4NBZB 1E4KA 5EU6E 3JV0A 1OIFA 4UOW0 4PTTB 2LW8A 2WUCH 4ZUWA 2VLRD 4ZFMA 1KYOJ 4D3CL 3BKYH 4L9LC 2C4FU 3T4YA 5IHUL 3PN8A 2R56L 4GRLC 3VFSA 4P46D 5BRQA 2ZWLT 5FDWB 4XCNB 4OV5A 2DL2A 3KPLA 3VXSB 5I1LA 4L1DA 5DLMH 4HBCL 4W7WA 5E1AA 3UZVB 2ESVD 4GWIA 2X4TA 3TP4A 1BJ8A 1FGNL 4OD3L 2GJ6A 1JZ8A 2OSLB 1QLEL 4RFOL 4ZE5A 3K81A 6TAAA 1TMCB 4KDVA 1LEGB 4Y88A 1WWCA 4GOSA 2CUHA 3NNGA 1A7PL 1YNTA 1A1MA 1E6SM 3FB7A 4M6OL 2W65B 4U49A 2JJVA 4G7YL 2YBRA 1FFRA 3ZYOA 1ITCA 1BVKB 1BJ1J 1CR9H 1U30A 4XPAH 1P84K 2UYLA 1P2CA 3JTSA 1H1NA 2XUCA 1MCQA 2P7TB 1U8PA 5C0EA 4IS6B 5FUOL 1YEGH 4U3CA 5ANMA 4XNMB 3EGSB 3I50H 1ZLVK 3J8F7 3P0GB 2MTPA 4YXLL 2F8QA 2JIEA 3KPTA 4V28A 5K9JH 2EH7H 3DO7B 2YWYA 5JOEA 4NQSB 1N4XL 1UCBL 3EOAA 5FO9B 3O9WD 4JQVA 3GJEB 2I60L 4H1LA 3VRIA 2I9LB 2XOMA 1ZB5A 5DR5H 1AO7A 1GAFL 2PYFB 4NKIH 4JZJC 2Z35B 1IGML 4OLYL 3O8XB 3G5ZA 5HI5C 5LA0A 5A2JH 1FBIL 4JGJA 1KB5A 3BIAX 3C7GA 5FF6A 1ZKAA 5CWSB 2DYPB 1KG0B 2IGFL 1OAQH 2HP4A 3H9SA 1T5XA 4KDWA 1QBAA 3STZA 1OGAB 4B7LA 4Y4FB 2XTJD 3G6MA 1KCKA 2Y72A 3VDHA 3FO2A 5LWYL 2ZX6A 4IIQC 3TJEL 1F3DH 2DWDB 3RHWK 1MY7A 4JFFD 1ZLSH 5KSBF 1U8IA 3IJYB 1W2VA 2APWA 2QPUA 1N82A 3GMLA 1A14L 2IBGA 3IJSB 1WCBB 4JRYA 3NZHL 3W0WD 2EKJA 2ERJB 1SVCP 4JM2C 1SYTA 3LS4H 3UTQB 4PRHE 3O2WL 1NL0H 1XMWA 3ARXA 1ZLVH 3L3GA 3MGOA 3WNKA 4LFHG 3V0AC 2HAZA 1Z6JT 1BBJB 4RZCB 2PXYD 4DEQA 3CHCA 2LU3A 2C1OA 4TUJA 1UHVA 3HC4H 1P1ZB 3WMCA 5GNZA 2YB7A 1MFBH 4Z2LA 4YHKL 2DT0A 5DT7A 3X3FH 5CBAA 4UB0L 1L0YA 2IBZX 3HZKA 4RIRA 3WFCL 4RDQG 4PRIE 5C6WH 4ET7A 2BSTB 2E27L 5C3LD 2J8FA 3NN8B 3M6DA 4W7VA 4Q9RL 4I3SH 1FRGL 3JSSA 4JZOB 1C90A 3QWOB 2V9QA 4GRLB 1BEYH 4NKQB 2EDTA 2EICA 4NKDB 3WDJA 3S3JA 3QNYA 3F2ZA 3VJ6B 5IIEB 2ICWI 3PWJB 1V6VA 1G7LB 1NCDH 1TA3A 2WUCL 1XF1A 2W0FA 3HE6A 3AAZB 3QWRD 1WC7B 3BKYL 1E40A 2IAMA 4WDIB 5HI4C 4TUFA 1JHKH 1ITBB 1RQ5A 4D0QA 1RSFA 4YXHH 4Z7WB 1GHSA 1F6AA 1IJ9A 1CG9B 4R2GD 4U2YA 1BLNB 5DLML 2G4FA 4OOZA 4EQ3A 4U6YA 4R96B 2NY2D 1WZMA 1YY8B 3BQUC 2VLJB 1LF1A 1XF4B 1KPRB 4QYOA 3MOBH 4JQXA 4PB9L 5FGBC 3DRTB 2UY7A 4HDIA 2QADC 1BREA 3BW9A 4MD4B 4DXRA 3DOSA 4KZEH 3O2DH 4WU7B 5FV1L 2G41A 3WNOA 1SG3A 1NAMH 3BPOB 3CVHB 4Z78A 1J1OH 4H2CA 4PEEA 5DJYB 3UX9B 2CDGA 5JBDA 3IDNB 3QWQB 4LBEA 4PGEB 1CFTA 2A6JB 3QUXD 5E94A 5KZCB 3DHJA 3QP3A 3BCDA 4TVCA 5GGVY 1CR9L 1J88A 1RHHB 4XPAL 1F3JB 4HZ8A 1P4LA 1J1PH 1MCSA 4XCYA 3WJLA 3TT1H 4GW4A 5I16B 3EO0A 5L6YH 3TBVA 1YEGL 2CRIA 3X11B 3I50L 1TZIB 3EO1A 4X0NA 4JZJB 3H9HB 2FGZA 1BFTA 2WCGA 1NBVH 1VSCA 2AKRA 2I07A 1A47A 4NQEA 1L7TH 5IHRA 5K9JL 2EH7L 3ARDA 1I1CA 1WT5C 5GS1C 2ADGA 1SEBB 2CRMA 4I2XB 4R0LB 1E1EA 4AQ1B 4PRHB 5A2IH 3UDWA 4MAYC 5DR5L 3QUZA 5EZLA 4NKIL 5C07B 1CPUA 4NOFA 3VW3H 4U1LA 5KJRH 4YHEA 3R06B 3C9NA 4IIQB 3BP6B 3MLUH 5J0BA 1KJ2B 3JWDH 2PC8A 2XNAB 1E9LA 4JRXE 3RWDA 2P42B 3MRDA 2ZSVB 1OD3A 4GW1B 1OAQL 4D1JA 5DZNA 5BMFH 3GIVA 2X4NA 5B4NA 3SOBH 3SO3B 3AXXA 4WI5A 4L8SC 4JX0A 2P1YA 3S9DB 3VXPB 3NYDA 2CXGA 1ZLSL 4D6GA 4IRSA 1QPKA 1DN0B 1RK1B 2BOCA 5KSBA 5L2KA 2DBJA 3WH9A 1NKOA 4LIQH 3RZCA 1X7QA 4MVBD 5FK9A 3AIWA 5A6JA 1ZANL 3LS4L 4YBLC 5L7XH 4JFWA 4GKZA 4XCEB 1NL0L 3H8NA 1JK8A 3QFDA 2JLLA 4BFBD 2V4VA 2NLJB 4NM8H 4XBGB 4XI5D 1EXUA 4TOYH 1FNHA 1K9EA 1LE9B 1TZHA 4N0FA 1DWIM 3HC4L 1JXJA 1QSFB 3UG4A 4H25A 3G5YB 4QHNB 3GSUA 1MFBL 5A6KA 1KV3A 4IJ3B 2CCRA 3RVUD 3X3FL 1V8HA 2X4PB 1UJ3A 4MB4A 1MXGA 3V8OA 1UZ1A 1S9WA 1SJHB 2E4TA 3LEKA 3FOLA 4LIQE 2CDFB 2H9GA 4I3SL 4WY7H 3VXNA 1QRNA 2A0LC 4OCRH 1FVEB 5DO2C 2L7JA 1BEYL 3RRQA 1CECA 2CDOA 3QIWC 3BAJA 1XGUA 3HI1A 3QULB 2FO4B 3N1PC 5HDQH 5JW4R 4PY7A 3ARFD 2NXYC 4FRWA 1NCDL 2G3MA 2ZOLB 4BSWB 1NGWA 3F5KA 3GXFA 4HD9A 4GXUN 5I1AA 2PW2A 4RAVB 4Z95H 1E0WA 3SGDH 2N7BA 1JHKL 1T66D 3NZ8A 5BZDB 1AC6A 5ECUA 4DCQA 4YXHL 1J86A 3DXAE 2HJFA 4MO3M 1ZL1A 2QADB 5C09A 3WEMA 2FJFB 5LGJA 5ID0A 3B4NA 4Y4KD 3SBWC 3VFVB 4MAZA 1QFWI 3U7AA 3ZJKA 1JZ3A 1M7DB 5HYEA 3UP1A 1PZ3A 5TGBA 5I3DA 3MOBL 1S5IH 5AC4A 3DLQR 1KCLA 4OLUH 2J7FA 2CIKA 4P5KB 2DI9A 4ZENA 3P0VH 4KZEL 3A6BH 1T6WA 1MWAB 3O2DL 1KXVC 4F37F 1C08B 1NAML 1AGCB 4PTTA 5T1LB 2UY2A 2XA8H 5D6CB 2XT1B 2D4FA 2FCBA 4JRXB 4LHQB 4P8WA 1NKGA 3S37X 5GS1B 4MZ2A 1W2KT 1J1PL 4XCNA 5FDWA 3VXSA 1CL7I 1X6LA 3TT1L 1A4KB 4WGWB 1X4YA 5AG9A 4FZ8H 5L6YL 3HHRB 3RVWD 3VVGA 1A1OA 2P43B 3KL3A 1KELH 5JIKA 1J0IA 3TO4D 1HYRC 1NBVL 2J79A 1L7TL 2OSLA 1BX2B 4NQVB 4L3AA 1XYZA 4OZIE 3B9DA 4DGYH 1A7RH 3DMMD 2EBNA 3BKJH 2X2YA 1LEGA 4XAWH 2EYSA 5GRZA 3WN5C 1T04B 4L8SB 3VW3L 5F21B 5KJRL 1BVKA 1JI2A 4KTEH 5DFVD 1IMHC 3MLUL 4PJAE 3W9EB 1MQQA 3JWDL 4KRNA 2EECA 5BRZD 5BMFL 5CBEB 2P7TA 1NUGA 4IS6A 1S3KH 2CD0A 3SOBL 4XNMA 3EGSA 2XTLA 5JW4M 4KI5M 4YBLB 4A41A 4UQEA 3RBSA 4P00B 1I1YB 1ZJBA 4N8VB 3DO7A 5I76B 1P5UA 3JWOC 1C12A 4NQSA 2Y6SD 4YEEA 5ICYB 1I8MB 3QOMA 5FO9A 5EC2B 1CLVA 3GJEA 1P84J 4K7PH 4LIQL 3NPSC 1MRCH 4Y4HC 2I9LA 1MHHB 4K71C 3O4LE 1XFPA 2PYFA 5IHLB 5L7XL 3TA9A 2EEDA 3UTTE 3O8XA 4LRIA 2R29H 4NM8L 4AYSA 1KBGH 3TN0C 4M9PA 2JK5B 2V5RA 4TOYL 5DI8B 1Y7VA 3P11H 3IXAB 3BAXA 1BECA 1ZU8A 5IVOA 4OFIA 3DXAB 2PTVA 5CWSA 2DYPA 2J3SA 1KG0A 3I3DA 4NZUH 2VX7A 3OQ3B 5BCAA 2CRYA 1FP5A 1OGAA 4Y4FA 4DVBB 4WUUD 4OFYA 1TTGA 2BNRE 1TZ7A 4PGDA 3QIWB 2ESCA 1V05A 2DWDA 3IJYA 2EXYD 3O0RH 5I9QC 4WW1A 4K9EC 2X1WL 3IJSA 1INEH 1CZ1A 1WCBA 1JFHA 4WY7L 1OTTC 1ZK9A 3CPUA 4OCRL 5EU6A 4GKSB 1XD1A 4JIEA 3UTQA 1SYSB 3BRFA 3ZTJH 5HDQL 3BEWB 4M61A 4FFVC 2YPLE 5DD5H 5B39G 1U2HA 2YHGA 1BBJA 4RZCA 4Z95L 1ZBCA 1OW0C 2BCKA 4FQHB 4NQCD 1W8OA 1DUYB 1VEOA 2P5WD 4ORGB 5HPOA 1P1ZA 3ARUA 4OI7A 2ZUXA 5A6AA 1A9EB 3ZTJG 5E2TH 2E6PA 3HI5H 1U0QA 1V0LA 3IJ9A 1NKRA 2BSTA 1QBLH 3ZKQD 2VMEA 3LQAH 4TVPD 3NN8A 3Q1SH 1P7KB 1F90H 2PQSA 1S5IL 4AEIH 4JZOA 4B9YA 1WZ1H 3QWOA 4GRLA 4OLUL 5D7IE 4NKDA 1WTGT 1WPCA 3WNMA 2UWEE 3P0VL 4G9FE 3A6BL 4HKZB 4NM4H 3VJ6A 3PWJA 5IIEA 1G7LA 1FHGA 3GSNB 1YJDH 1CD9B 2XA8L 3OKYA 4K3HA 4NHCH 4ZOCA 3AAZA 4X6DE 1WC7A 4WDIA 1EZVX 1S9YA 2DQGH 3L5XH 2G3NA 3NUKA 1SJEB 3WBDA 1KOAA 4Z7WA 2WAAA 1FLRH 4RMRA 3HNTH 5GSRB 1BLNA 2JD9A 3VGFA 2ZG2A 3T0EC 3VFOB 4FZ8L 1NMCC 2AJVH 4R96A 4A3YA 4KKBD 1A7QH 3UTSE 1KELL 1NPUA 2ADFH 1YY8A 1PFCA 2VLJA 3TZVC 5HVWA 1GJUA 4F9JA 1XF4A 1KPRA 3AS3A 4CKVX 4FXLA 5EO1B 3DRTA 1P69B 4DGYL 1A7RL 4YGAB 3AMCA 3BKJL 3O4LB 3VNYA 4XAWL 5AUMB 1OL0A 1FDLH 1FAKT 43CAB 4WU7A 3UTTB 5D9NA 5E00B 4R3SB 1EVUA 4EXKA 3CVHA 3GM0A 1UZ4A 1AXIB 2DM4A 5DJYA 4XB3A 1YMHA 3IDNA 4PGEA 2A6JA 2OJZH 1BOYA 1PD6A 3MOAH 2VC9A 4KTEL 2CLZB 1RHHA 3ZYIA 4K7FB 1F3JA 1FGVH 4QAWA 4P5YA 4XPTH 3NPSB 2C3WA 5EBAA 4Y4HB 4V27A 5I16A 1S3KL 4K71B 2VLKE 3X11A 1TZIA 4MJIB 2OTPA 4JZJA 3H9HA 5HHOD 1T89C 2QTEA 4C4KO 4GXPA 4KWUA 3TN0B 2X9WA 4X6EB 3R1GH 3QJHB 4R0LA 1SEBA 4I2XA 5FHAH 4K7PL 2KUTA 1F3RB 1MRCL 4FFZH 1H3GA 2Y25A 3KHOA 2ILLA 4PRHA 1OSZA 4QB2A 1BIHA