2VZWA

X-ray structure of the heme-bound gaf domain of sensory histidine kinase dost of mycobacterium tuberculosis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
146
structure length
146
Chain Sequence
GKLDATLRAIVHTAAELVDARYGALGVRGYDHRLVEFVYEGIDEETRHLIGSLPEGRGVLGALIEEPKPIRLDDISRHPASVGFPLHHPPMRTFLGVPVRIRDEVFGNLYLTEKADGQPFSDDDEVLVQALAAAAGIAVDNARLFE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROBABLE HISTIDINE KINASE RESPONSE REGULATOR
publication title 2.3 A X-Ray Structure of the Heme-Bound Gaf Domain of Sensory Histidine Kinase Dost of Mycobacterium Tuberculosis.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 34
structure length 146
sequence length 146
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2008-08-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01590 GAF GAF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2vzwA00
4IJGA 4Q0JA 1MC0A 3BJNA 4ME4A 2VZWA 5HPFA 5HL6A 2XROA 3OBFA 3NHQA 3KO6A 3VV4A 5DFYA 2G7UA 3E98A 3CITA 5HPIA 3MMHA 2O9AA 5HSQA 4O01A 3KSFA 4E04A 2B18A 3ZQ5A 4ETZA 3MF0A 4YOFA 2O9BA 1ZTUA 2W3GA 2W3DA 2VKSA 2OOLA 2W1RA 2ZMFA 2XSSA 4FOFA 2M7VA 2QYBA 2LB5A 2K31A 4G3WA 2W1TA 2M7UA 4EU0A 3O5YA 4O0PA 4YNRA 4GW9A 4O8GA 5L8MA 3G6OA 2KLIA 5DFXA 4EUVA 4ZRRA 2W1TB 3CI6A 3S7QA 4MN7A 3DBAA 3IBJA 2GX5A 4GLQA 3W2ZA 4DMZA 1VHMA 5I5LA 2HGVA 2W3HA 4MMNA 5TJJA 4ETXA 5C5KA 3IBRA 3EEAA 3NOTC 3OOVA 3C2WA 3KSHA 4RQ9A 3MQ0A 4G3KA 2O9CA 2O99A 5AJGA 3KSIA 2W3FA 4MDZA 3S7NA 4Q0IA 4MCWA 1YSPA 3LFVA 4QPRA 4DN0A 4LRZE 4IUHA 3TRCA 2Y79A 5LBRA 3E0YA 4R6LA 1MKMA 5K5BA 2IA2A 3HCYA 2Y8HA 4BWIA 1YSQA 4Y5FA 2K2NA 1TD5A 3S7OA 2O0YA 2W3EA 4Y2FA 1TF1A 4IUKA 4Z1WA 4CQHA 1F5MA 3NOUC 4Y3IA 2LB9A 4LRXC 4R70A 2XRNA 2VJWA 4Q0HA 3K2NA 2KOIA 1STZA 4LRYC 3RFBA 1YKDA 2VEAA 4G3VA 4PAUA 3R4KA 3NOPC 3D3OA 3S7PA 3KSGA
chains in the Genus database with same CATH superfamily
1K25A 4K08A 1LL5A 1LI9A 3NY4A 3G4PA 3D72A 1E25A 5EVIB 1PRQA 2PAVP 3VOLA 1VQQA 1LSWA 5E2FA 1S1YA 5J4EA 3ZQ5A 4ETZA 2ZOIA 5CECA 1EROA 3PAEA 2W3GA 3MBZA 4QB8A 3TG9A 4HQAA 2ZC5B 4QJGA 5EVLA 1GHMA 3SZTA 1NY0A 5CHUA 2VGLS 4OONA 4N9KA 2P04A 3RTYA 1FCMA 1NYYA 1YQSA 3IHAA 1AWIA 4FTXA 3MFXA 3SS4A 4MMNA 4XUXA 3HLBA 3EEAA 4HJ3A 4LGWA 1VB6A 1CEGA 4Y0UA 2ZMVA 1XJ2A 3UPPA 4MDZA 3SOIA 4DN0A 1K56A 1YMXA 1DJBA 2Y2JA 1N9OA 1N4OA 2WGVA 4HH2A 3IX4A 4NETA 4II7A 1CEFA 1ZG6A 4Y2FA 1F5MA 2JKGA 3HLFA 5KIZA 1D06A 5FQMA 3PYPA 1JTDA 1XJ4A 1ONHA 3U4LP 1BLHA 1IKIA 1XX2A 2VV8A 3ICYA 2A24B 3F1PA 4MNRA 3FPVA 3UPNA 3OBFA 5FA7A 5FDSA 3GSGA 1Y54A 3RJUA 2JE5A 1SCWA 2Y2MA 3FC7A 2Z6DA 2EX8A 2H10A 4KZBA 4HP9A 3ISGA 1L0EA 2FFFB 2MJ6A 3ITAA 2HDSA 1U60A 4HOIA 3BFFA 3WWXA 3ZG5A 4ZRRA 2GX5A 4QWOA 5M18A 5BOHA 1VHMA 1NLYA 1Q2PA 3HL9A 4GN2A 5HD3A 3IWOA 3TSGA 3MQ0A 3T1SA 1LHYA 3E2LA 4PM8A 5GLDA 1KVLA 4KZ6A 4X68A 1E3UD 2YKFA 2PYPA 1FCOA 1UWPX 4MN5A 1UWNX 1FILA 3TRCA 3G2ZA 4HJ6A 1IKGA 1MKMA 2BG1A 2G2WA 1K55C 1ES4A 1BLSA 4F94A 4R1GA 2X71A 3MQOA 3VP3A 4Y5FA 4HBUA 3HUMA 3FWLA 1T1CA 4MBFA 1D1JA 5IT5A 3O88A 5TBMA 1TS7A 1GCEA 2JBFA 5A8BA 4WM9A 5JYPA 2IWDA 4D2OA 3TE8A 5FAPA 4E3NA 3JVVA 2XDMA 4PM6A 4DE3A 2P9VA 2XF3A 2E8JA 3LUQA 4HIAA 3CWFA 1MC0A 3L9KA 4FCFA 1F9IA 1T1BA 4BLMA 1EW0A 3LI8A 1BLCA 3F1PB 3M2KA 1K6RA 3LR0A 1T19A 2PU4A 3QP1A 2ZLYA 4Z9QA 3W8KA 1IELA 4N1HA 4HY8A 1ZTUA 2ZQ9A 2W1RA 4JGOA 2M7VA 1S6RA 3KYZA 4EUZA 4LV3A 4JBFA 5DKKA 3TOIA 5A90A 3HJKA 1D7EA 3A3JA 5KSCA 2NUTC 1CI9A 2ZBBA 4MN7A 3DBAA 2Y59A 3FG8A 5I5LA 5J7EA 3TW8A 4OKPA 3IHBA 4E6XA 3LR3A 1XPBA 4BL3A 3UB6A 3MR0A 1RP5A 4LPZA 3MFDA 1MKIA 1DJCA 3T4TA 1FSYA 5F5YA 1K57A 1S0WA 2HV1A 1WYCA 4HESA 4OPRA 3GR2A 3NDGA 4JF4A 4OPZA 4NXFA 4CQHA 4N1XA 4R70A 3LICA 4QU3A 3DWZA 3QNCA 3LIDA 4WZ5A 3UDIA 5TBMB 5FQQA 4P6BA 3E4QA 4EW7A 2PT7A 3OPLA 2OLVA 4NKPA 5AQAA 4KG2A 1N9BA 2D01A 2P9VB 3N8RA 4PM5A 2ZC4B 1PI4A 1XKZA 1W63Q 3NHQA 4NXGA 3WS4A 5A91A 2G7UA 1H8MA 1CJFA 1OT6A 3HLCA 1SKFA 4KZAA 2XEPA 5E2HA 4ID4A 1RGZA 2V2FF 4LV2A 4S2IA 5FEFA 5CRFA 4X25A 5HW3A 3GRJA 5EOEA 2XQZA 2K31A 4GD8A 3IWQA 4JXWA 3PBNA 3LGOA 2INWA 5HWTA 1YLTA 1YAXA 2WAEA 4BL2A 3FYZA 3T50A 1N9NA 1QMEA 4KG5A 4X56A 2Y2OA 4S2OA 3OOVA 4GHIA 5CGXA 3N8LA 5CGSA 4BD1A 3HUOA 1TDLA 1TS0A 4WMCD 3LFVA 4FD8A 2JKRM 1PWCA 4CLCC 2QKPA 2Y79A 1PYYA 1BZAA 2OWHA 3H82A 4NK3A 2Y8HA 3EQUA 5GLBA 4I38A 3A3EA 5FI7A 2EX2A 2V0UA 4DXBA 4AFIA 1JTGA 5CGWA 3HREA 1CF0A 1HVBA 3MQQA 1TDGA 1K0KA 1H0MA 2VEAA 2EX9A 3FZCA 4ME4A 4EV4A 3IF5A 4IEDA 4YFMA 4KZ9A 1EWZA 3T4SA 5FQKA 4PKYG 4A5RA 1FCNA 1IYSA 3G35A 5GHYA 2L4RA 2J7VA 3IH8A 2ZL1A 5HPIA 2PDRA 2E8IA 3SW1A 4QHCA 2Q9MA 1TS6A 2WAFA 1JWPA 4HHDA 3W4PA 1WA9A 2OSUA 3O87A 4GOGA 2W1TA 2ZC7A 2QZ6A 2PBYA 1XXMA 3DTMA 1F2KA 1FQGA 2KLIA 2WGWA 4EUVA 4Q8IA 2H0YA 2W3HA 3LIAA 3IF6A 2ZMAA 4UA7A 5GLCA 2ZQDA 2PRFA 1C3BA 2PYRA 5EVIC 3CMZA 2Y2QA 1P0ZA 4GHIB 3S4XA 3N8SA 3OLOA 3S22A 3MKEA 1XJ6A 5K5BA 1BT5A 2XLNA 1BYWA 4BMWA 3EEHA 1BLPA 4P0MA 3H82B 4L9FA 3E4PA 3OPHA 1MBLA 1OT9A 4Y3IA 4WBGA 2LB9A 2BASA 4P87A 2HJ9C 4OOYA 3TJZC 2R9XA 3PBOA 1IFQA 3QHYA 5KMWA 1E4DA 4U3TA 4LFUA 2OAP1 4IJGA 1ACFA 1YT4A 4E3IA 3UE1A 5FSRA 1GSVA 5D3OA 5FQ9A 1FSWA 1ES2A 4GZBA 4R3AA 3MMHA 1GHIA 2ZC3B 1NJ4A 2ZL1B 2ZMFA 1SDNA 4X69A 4O0PA 4LV0A 5I94A 4WZ4A 5AQBA 5EV0A 2W1TB 4DJ3A 2BLSA 1YLPA 3LR4A 2P74A 1OJGA 1PW1A 2V9AA 2WGWB 2PR5A 2XD1A 4X6TA 3B42A 1LLBA 3MZDA 2X02A 3IF6B 1FOFA 1LT0A 5EUAA 3S7NA 4I39A 4MCWA 4BENA 4WEKA 2J3WA 4LRZE 4PHTA 4HP4A 2DMWA 2Z2MB 4WMCA 4HBTA 2L0WA 3BFGA 3K3DA 2EA9A 1XGJA 3KX0X 5TR7A 3UB9A 3IX3A 2H0TA 1P9WA 4ZJ2A 2HP5A 2KDKA 3MXSA 4Q0HA 1TEMA 3C30A 3ZGAB 2Y2KA 3PXPA 4BBVA 2V8CA 1G6AA 3NOPC 5EM1A 3DAVA 4OLGA 4U0XA 1PWDA 5M19A 4NG2A 2XGNA 3IS2A 1L2SA 4LV1A 3CJMA 5HPFA 1CQAA 1LSXA 3B3XA 4HEFA 1DP9A 5FASA 1ODVA 2WADA 1S67L 3V50A 4EWFA 3OCNA 4ARZA 4B4ZA 2O9BA 5IU1A 3HLGA 3AGDA 4EEUA 4OOLA 2HPBA 4OQ0A 4Y15A 2ZQCA 2M7UA 4XXRA 5L8MA 1ALQA 3DTKA 4LCLA 3T4JA 5TGFA 3VP1A 4BD0A 4DE2A 5GHZA 3S1YA 1OTDA 3FV7A 4JF6A 4MBKA 3KSIA 2Y2HA 3LEZA 2A2LA 1CK3A 4KUOA 5AQ9A 4EESA 5L09A 4FH4A 5AVEA 2J80A 4UEYA 2VA0A 4CLCD 4UA6A 3S7OA 4EQ1A 2JKTI 4Z1WA 1G5UA 3A0VA 4E3MA 3EWKA 2GZAA 4DRTA 1K55A 3LIFA 1IYPA 2JN7A 2KOIA 2HDQA 2UWXA 2QWSA 1K4EA 3T1RA 3KSGA 3T1QB 4Q0JA 4JPMA 2XA7S 3LO7A 4IBRA 1W8YA 2Y2IA 4KZ8A 4WLAA 4E3LA 4WYYA 4EERA 3PAGA 3P01A 5DF9A 2Y2PA 3IS2B 3ITBA 4KQDA 3SH8A 3ZVTA 1HD8A 2W0NA 2C6WB 5HSQA 3KSFA 4ZBEA 1VETA 1J3WA 4Y0TA 5CHJA 4CJNA 4YOFA 3MF0A 2UV0E 4OOMA 1NLZA 2H28A 3R7WA 3CG5A 3W4OA 1XP4A 4ARZB 2LB5A 1NZUA 4KG6A 3A0SA 4YWZA 5L07A 2R78A 4YNRA 3QP4A 3P09A 5CEBA 1K6SA 2BTFP 2WKIA 5HAPA 3Q82A 3SS5A 5F82A 2HGVA 5E2EA 3BFDA 1K4FA 3IBRA 3WS5A 3KSHA 1MWUA 5DTSA 3ZG8B 3DTIA 1PFLA 4M3KA 3T4KA 3BY8A 4KQQA 4Q0IA 3UDFA 3VP4A 1TS8A 5EVID 1KDSA 2GJ3A 3VFHA 3ZCZA 3T4LA 5HAQA 3QP8A 1SHVA 3ZVWA 2W27A 4P6ZS 5F83A 3GVBA 2L1MA 3P98A 1GSWA 3DWKA 1ZG4A 3BQAA 1K54A 1L0GA 3PBRA 3NOUC 2EFUA 4X53A 5IS1A 3RXXA 2PHYA 4R4RA 2QMIA 4BBUA 3IWIA 1IEMA 4ZTKA 1KE0A 4KZ4A 2J9OA 4G3VA 4I5SA 3V3RA 3UB7A 2IWCA 2VZWA 2VGLM 3E2KA 2XROA 1NZOA 5L2FA 5F1GA 1WE4A 1ES5A 3BQ8A 3EOIA 4JKTA 4KZ7A 5EPHA 3JPUA 3LY4A 2O9AA 4FUWA 3LIBA 2B5RA 2XFTA 3JVUA 4K91A 2XD5A 5CTNA 1VETB 4FOFA 4IVKA 3R7WB 3VP2A 2M1CA 3B33A 3BFEA 5DF8A 2Z6CA 5KSHA 2B02A 3NBLA 5C5KA 1MWSA 3CPTA 1BTLA 4UAAA 3N4IA 4RQ9A 1G68A 2ACGA 4EBNA 3D9YA 3A3FA 3G2YA 2W3FA 5FATA 4LCMA 3PBQA 4M4XA 3CZDA 4H8RA 3Q1FA 2EX6A 2QJ7A 1NRJA 4Y13A 2A49A 1XFNA 3NJAA 3VE4A 1QMFA 1KE4A 2W3EA 3FPWA 2P7JA 4L9GA 3BEBA 3ZG7B 2A3UA 4DE0A 5EECA 3GV9A 5HDDA 3V67A 2XRNA 2VJWA 1E3UA 2B95A 4FH2A 1XJ3A 4EBLA 4ZJ1A 3G32A 4HH3A 3ZFZA 1MZUA 3A3IA 2ZC6B 1KGEA 2FZ0A 2OV5A 3C7UA 1EI5A 3NECA 1G6OA 3P7NA 4B4XA 1ZC2A 2J8YA 2V1BA 2PD8A 4MBHA 3O5YA 4GW9A 5AQ7A 4O7DA 4O8GA 5FDHA 3ULFA 2VX8A 4KENB 4C3QA 3CI6A 4S2NC 3A3DA 2V20A 2KX6A 1YLJA 1VEUA 2XA7M 1NRFA 5GHXA 3NOTC 3V5MA 4NXBA 1KOUA 3HVFA 3CPTB 2O99A 4JXGA 1X0OA 2HDRA 4E3OA 2J3TC 3CHWP 5G18A 1OTEA 3WS2A 1ONGA 3E0YA 1PZPA 2WUQA 4OPQA 2XR0A 3BRMA 1H8YA 1YSQA 2O0YA 3EGDC 2V1ZA 4S2LA 1CI8A 5A92A 1KDWA 5FQJA 3OCLA 3WS0A 1STZA 4ZJ3A 1OTBA 3F1OA 3DW0A 4N92A 3GDIA 4GNUA 4BBTA 3CUEC 5F6AA 3MXQA 3K3CA 2DCFA 5G4YA 2HF6A 5HX9A 3MZEA 5DVAA 2YKHA 5HL6A 4QD4A 3UDXA 3AGFA 4R3BA 3EGXC 5CERA 5M1AA 3CLOA 3BYDA 1PI5A 1Z6FA 3F1NA 4QY5A 5KZHA 1XFQA 4E04A 5DJUA 2B18A 1ESUA 1OPXA 4U0TA 2ZM8A 2ZQ8A 1RCJA 2ZD8A 4D60A 3IXGA 2I72A 4S2MA 3ZG9B 2AVXA 2RCXA 1MXOA 1IYOA 4GS9A 2GNXA 4X1MA 4EQIA 1OTAA 1O7EA 3H7WA 3VMAA 1VEUB 4EBPA 2QHKA 2CC1A 1P97A 1OTIA 2IWBA 2FH5A 1Y28A 4R23A 1MWTA 4EXOA 5AVFA 2VGKA 3Q7ZA 2QPNA 2PU2A 1H5XA 1JVJA 5HARA 5FI2A 1NWZA 3UMEA 1T18A 3KYQA 1DY6A 3HLWA 3OZHA 4C75A 2EXAA 1O07A 2Z2LB 4N9LA 3MZFA 1YM1A 3C8CA 3C38A 5CHMA 3VOZA 3I7JA 3UNWA 3OC2A 3VFFA 3A0RA 3F1OB 3BJNA 3B47A 2JKRI 3LR5A 1ES3A 4QY6A 3VV4A 2XK1A 3MS6A 3E98A 4GB7A 1F98A 2WK0A 4XT2A 4F3LA 4O01A 1K38A 2HDUA 3AGEA 4Y0OA 3GTCA 1I2SA 4OVDA 1IOUA 3F1NB 2OOLA 2WZXA 3G34A 4G3WA 5EE8A 3M2JA 4RX3A 4CPKA 3BM6A 2Q9NA 3S7QA 3OPPA 3IBJA 2NUPC 5FEGA 2JHEA 2WZZA 4Y17A 3VOYA 4I3JA 5CXWA 3RH8B 2JC7A 4ZAMA 2EWWA 4GS9B 1ZHHB 2O9CA 3WS1A 5HFOA 1YLZA 4DXCA 1GHPA 3PR6A 1YSPA 3H7WB 4UHUA 3Q81A 1DP8A 1KGFA 4L9EA 4WUJA 2K2NA 1LL8A 4PKYA 2VK3A 4PM9A 3MKFA 1L0FA 3V3SA 4R4SA 2K7SA 4UQIS 5FAQA 3ZNTA 3K2NA 1NXYA 3O3VA 1KVMA 3LI9A 3UE6A 1I5QA 4DKIA 3D3OA 3NDEA 5FAOA 3PHYA 3ZG0A 3T4OA 3LIEA 1L0DA 3C4PA 1P9RA 1XGIA 4WL9A 3M6HA 3NIAA 2V0WA 5DFYA 3IH9A 5DTTA 2C5WB 3HBRA 5J3WA 4ZDXA 1W63M 3SS3A 4UA9A 3JYIA 4XT2B 4F3LB 2XSSA 3E4OA 3Q07A 1PIOA 4I3AA 2ZOHA 2HP9A 2VGJA 4IBXA 2R9WA 4S2JA 4OLDA 4DMZA 5TJJA 5CEDA 2VV6A 5G4ZA 2OLUA 5IHVA 2J9PA 3MXRA 4KZ5A 4JXSA 4RVAA 3IXBA 3QP2A 4X55A 3QP6A 2DNSA 5LBRA 1LI0A 4OPYA 1AXBA 2RL3A 3RXWA 3HCYA 1A0KA 3FKWA 2J3TD 1SZVA 2X01A 3BLMA 1FR6A 4XUZA 1TD5A 4DDYA 2Y2GA 3UPOA 4MEZA 2WKEA 5CTMA 1GA0A 3IXHA 4KQRA 3H9WA 2EFXA 1OJ5A 3LEQA 4OP5A 2QJ5A 3CAXA 2ZM0A 3C5AA 5JYOA 5FI6A 1PNEA 1PW8A 5E2GA 2JCHA 3PBTA 5HWVA 4ESPA 5HAIA 1Q2QA 2CMNA 4R3JA 1W79A 2PBDP 4GKUA 3EQVA 5HWWA 1SKOA 4L0LA 2ZQ7A 3QP5A 5EOOA 5FL3A 1S66L 2V8FA 3PBSA 5EM0A 4X1LA 1ZKJA 2JKFA 3M6BA 3MJQA 5J8XA 1IYQA 4OQHA 5HDSA 4PPRA 1V9YA 1BSGA 1GSXA 4B93A 1V9ZA 2Y2NA 3G31A 3C7VA 1YLWA 3L7HA 3ZNYA 2Q0OA 4C6YA 1Y4OA 3G6OA 2XFSA 4KUKA 3SH9A 3KYEA 1K54C 1DRMA 4H6JA 3W2ZA 2WGIA 2Y91A 4K0WA 4OQIA 4DE1A 1JWZA 1XA1A 4ETXA 1W5DA 1ERQA 1HTZA 4JLFA 4EETB 3UO9A 1K57C 1FR1A 4MN6A 3VP0A 1YPRA 2Y55A 4KQOA 1BUEA 5DTKA 4E3JA 1Z09A 1JWVA 3O86A 1KE3A 4K0XA 2IA2A 4WZ5C 5L10A 5F1FA 1MPLA 4PM7A 4FSFA 2WKPA 4JXVA 4IUKA 4KZ3A 4WN5A 2ZM2A 4LRXC 2EWVA 3VE3A 3SH7A 3VSLA 4LENA 5F68A 3NCKA 3T4QA 3IXDA 3UY6A 4LRYC 3N6IA 3R4KA 3WRTA 2HJEA 5CX7A 4WELA 4RX2A 1M40A 3U2AA 1WYBA 3C4OA 5E43A 3HJIA 4CLCA 4CLCE 2PR6A 1S4SA 1RGYA 4RA7A 4GDBA 1JNUA 2WKRA 4I3IA 1SKOB 1YMSA 1TVFA 4OH0A 1SDEA 2D02A 2DRWA 5MC7A 2W3DA 2VKSA 3W4QA 1H8ZA 2QYBA 3GMWA 3HUNA 4WF0A 3IQAA 1T1AA 3BECA 3UE0A 1L3LA 1W7FA 1MY8A 4UQIM 5GLAA 1ESIA 5DJTA 2ZJ9A 3HLEA 2HP6A 3D4FA 3LCEA 4IVIA 4OP8A 2I9VA 5FQIA 3ZDJA 1HZOA 3NULA 4H6JB 4JGPA 1YLYA 3LYXA 4S2NA 2ZQAA 3GQZA 5HD5A 3N7WA 5AJGA 1H3QA 1K56D 5DKLA 1S1ZA 2G2UA 4IUHA 1UGUA 3BLSA 4R6LA 3UMDA 3IX8A 3Q7VA 5A93A 3BY9A 4WEJA 4OQGA 1BULA 3T1XA 4BJPA 2WKHA 4BQMA 2Y2LA 3UB5P 4B88A 3ZHHA 1PWGA 3QNBA 2HZ5A 1N9LA 1YKDA 4PAUA 3OPRA 3GECA 4MLLA 4NEED 1W8QA 3S7PA 5EVIA 2VV7A 4P85A 4NXEA 4GJ4A 5HZHA 1NYMA 4DF6A 1HLUP 4HI4A 3UE3A 3MSHA 3KO6A 3CUEA 4S2KA 1OMEA 5EFWA 4CLCB 3CITA 2EXBA 4YINA 3ZYTA 3V39A 1LL9A 3IT9A 1LSVA 3PTEA 3VSKA 3G30A 1DP6A 1ERMA 3T12B 4PMAA 5EVEA 4Y7PA 1J9MA 4RYEA 1PZOA 4DJ2A 5HDCA 4EU0A 4GCZA 4EEPA 2OAQ1 5F69A 2JKTM 3IF6C 3UN7A 1GA9A 5DFXA 4GLQA 1S4RA 4HJ4A 5TFQA 4S2PA 2Y4AA 4GD6A 4E3KA 5HL1A 3UB8A 4P6ZM 2OWJA 4DDSA 4JF5A 5DF7A 2H5SA 2XH9A 3C2WA 3DTEA 4LLOB 4IHQA 1DJAA 2FFYA 3HLDA 4JGRA 4G3KA 2V1AA 1G28A 4JGQA 5GL9A 2PD7A 4QPRA 1FIKA 3NI9A 3BFCA 1M6KA 5U47A 1MWRA 1XA7A 4R38A 3BW6A 3WRZA 4B9OA 2P08A 3BWLA 4BWIA 1VM1A 3Q7VB 1I2WA 1TF1A 2WKQA 1KGGA 3LY3A 3FKVA 4E6WA 2GDNA 2VLGA 3RFBA 2WYXA 2A24A 3NC8A 4R0QA 4GDNA 4HNBA
chains in the Genus database with same CATH topology
3PHYA 3T4OA 4K08A 3LIEA 4I5SA 4ME4A 3UB7A 1P9RA 2VZWA 2VGLM 4WL9A 3D72A 2XROA 3T4SA 4PKYG 3BQ8A 3EOIA 3VOLA 2L4RA 2V0WA 5DFYA 1LSWA 5HPIA 1S1YA 2PDRA 2O9AA 5J3WA 3LIBA 5J4EA 3ZQ5A 4ETZA 3SW1A 1W63M 1TS6A 2ZOIA 4XT2B 2W3GA 3JVUA 4F3LB 4HHDA 2XSSA 4FOFA 1WA9A 4HQAA 3E4OA 2W1TA 2VGLS 4I3AA 2ZOHA 3R7WB 2P04A 3RTYA 2M1CA 2KLIA 4EUVA 3B33A 4DMZA 2Z6CA 5KSHA 3MFXA 2W3HA 2B02A 4MMNA 5TJJA 5C5KA 3LIAA 3EEAA 2VV6A 5G4ZA 4HJ3A 4RQ9A 1VB6A 2ZMVA 1XJ2A 2PYRA 2W3FA 1P0ZA 4MDZA 4GHIB 3PBQA 4M4XA 4DN0A 5LBRA 3OLOA 2QJ7A 1NRJA 1N9OA 1XJ6A 5K5BA 4HH2A 1XFNA 3HCYA 2J3TD 3NJAA 4II7A 1BYWA 4BMWA 3VE4A 3EEHA 1TD5A 2W3EA 4Y2FA 3FPWA 3H82B 4L9FA 2P7JA 3E4PA 4L9GA 1F5MA 1OT9A 4Y3IA 5KIZA 2LB9A 2BASA 3H9WA 2HJ9C 1D06A 5HDDA 3V67A 1OJ5A 2XRNA 2VJWA 3TJZC 2QJ5A 3PYPA 3CAXA 3PBOA 1IFQA 1XJ4A 1XJ3A 3PBTA 5HWVA 2OAP1 4IJGA 4HH3A 2CMNA 1MZUA 2VV8A 3ICYA 2A24B 3F1PA 3EQVA 5HWWA 2FZ0A 3FPVA 4L0LA 3OBFA 1GSVA 5FL3A 1G6OA 1S66L 4R3AA 3MMHA 3P7NA 3PBSA 3FC7A 2V1BA 2Z6DA 4HP9A 2PD8A 2ZMFA 3MJQA 2MJ6A 5HDSA 1V9YA 1GSXA 3O5YA 4O0PA 4B93A 1V9ZA 4GW9A 4O8GA 4HOIA 3ULFA 3G6OA 2VX8A 4KUKA 4ZRRA 2W1TB 3CI6A 4DJ3A 1DRMA 2GX5A 4H6JA 3W2ZA 1VHMA 2KX6A 3LR4A 1NLYA 1OJGA 2V9AA 2XA7M 2PR5A 4ETXA 5HD3A 3NOTC 3B42A 4EETB 3MQ0A 4NXBA 1KOUA 4MN6A 2O99A 4KQOA 1LT0A 1X0OA 3S7NA 2YKFA 2PYPA 4I39A 4MCWA 2J3TC 4WEKA 1UWPX 2J3WA 4LRZE 4MN5A 4PHTA 1OTEA 4HP4A 1UWNX 3TRCA 2DMWA 3E0YA 4HJ6A 1MKMA 2IA2A 2L0WA 3MQOA 3K3DA 2EA9A 1YSQA 4Y5FA 2O0YA 3KX0X 3UB9A 4FSFA 2WKPA 1T1CA 3EGDC 4IUKA 5IT5A 4WN5A 5TBMA 1TS7A 1P9WA 5A8BA 4LRXC 2KDKA 2EWVA 3VE3A 5F68A 3OCLA 3T4QA 4Q0HA 3TE8A 3C30A 1STZA 3JVVA 1OTBA 4LRYC 3F1OA 3PXPA 3GDIA 4BBVA 3R4KA 2HJEA 5CX7A 3NOPC 4WELA 3LUQA 4BBTA 3CUEC 5F6AA 3MXQA 3K3CA 4HIAA 3CWFA 3U2AA 1MC0A 5G4YA 3IS2A 2HF6A 3HJIA 5HPFA 2YKHA 5HL6A 4CLCA 1F9IA 4CLCE 1LSXA 2PR6A 1DP9A 1ODVA 1T1BA 1S4SA 1EW0A 3LI8A 3EGXC 1S67L 3CLOA 3F1PB 3OCNA 1JNUA 2WKRA 4I3IA 3LR0A 3F1NA 1T19A 1XFQA 4E04A 4ARZA 5DJUA 2B18A 1OPXA 2D02A 2O9BA 5MC7A 4HY8A 5IU1A 1ZTUA 2W3DA 2VKSA 2W1RA 4JGOA 2M7VA 4EEUA 2QYBA 3KYZA 4WF0A 4OOLA 1T1AA 5DKKA 2M7UA 3HJKA 1D7EA 5L8MA 4UQIM 3T4JA 2NUTC 5DJTA 2ZBBA 4MN7A 3DBAA 3FG8A 5I5LA 5J7EA 3TW8A 4GS9A 2GNXA 2I9VA 1OTAA 3LR3A 4H6JB 4JGPA 1OTDA 3H7WA 3LYXA 3UB6A 2QHKA 3MR0A 5HD5A 5AJGA 1H3QA 3KSIA 1P97A 1OTIA 5DKLA 1S1ZA 4LPZA 2A2LA 4IUHA 4KUOA 4EESA 3T4TA 1UGUA 2FH5A 1Y28A 4R6LA 3UMDA 5AVEA 5F5YA 3BY9A 4WEJA 2J80A 4UEYA 2HV1A 4EXOA 5AVFA 2VA0A 4CLCD 3S7OA 4EQ1A 2JKTI 4NXFA 1NWZA 3UMEA 4Z1WA 4BJPA 1T18A 4CQHA 3KYQA 3A0VA 3EWKA 2GZAA 4R70A 3LICA 3LIFA 3LIDA 2JN7A 2KOIA 5TBMB 3C8CA 3C38A 1N9LA 1YKDA 4PAUA 3E4QA 3GECA 3OC2A 4NEED 2QWSA 4EW7A 2PT7A 3S7PA 3KSGA 4NKPA 4Q0JA 2VV7A 2XA7S 3A0RA 3F1OB 4NXEA 2D01A 4WLAA 3BJNA 4GJ4A 4EERA 5HZHA 3B47A 3P01A 2JKRI 4HI4A 3LR5A 3UE3A 5DF9A 1W63Q 3NHQA 3IS2B 4NXGA 3KO6A 3VV4A 4KQDA 3CUEA 2G7UA 5EFWA 2W0NA 1H8MA 3E98A 1OT6A 3CITA 4CLCB 1F98A 4XT2A 4F3LA 5HSQA 4O01A 3KSFA 3ZYTA 1LSVA 3MF0A 4YOFA 4OOMA 1DP6A 1NLZA 2H28A 1IOUA 3R7WA 3F1NB 2OOLA 4ARZB 4DJ2A 2LB5A 2K31A 3A0SA 5HDCA 4G3WA 4EU0A 4YWZA 2R78A 4GCZA 4YNRA 4EEPA 2OAQ1 5F69A 3PBNA 2JKTM 2INWA 5HWTA 1YAXA 5DFXA 3S7QA 3IBJA 2NUPC 4GLQA 3T50A 1N9NA 1S4RA 4HJ4A 2JHEA 2HGVA 4I3JA 3IBRA 3RH8B 3UB8A 4P6ZM 2OWJA 3OOVA 3C2WA 3KSHA 4GHIA 4LLOB 4IHQA 2EWWA 4GS9B 4JGRA 4G3KA 1ZHHB 2O9CA 3T4KA 2V1AA 3BY8A 3PR6A 1G28A 1TS0A 4JGQA 4Q0IA 1YSPA 2PD7A 3H7WB 3LFVA 4QPRA 2JKRM 4CLCC 2QKPA 2Y79A 1DP8A 1TS8A 2OWHA 4R38A 3H82A 3BW6A 2GJ3A 4L9EA 4WUJA 3T4LA 2P08A 4B9OA 2Y8HA 3BWLA 4BWIA 2K2NA 3EQUA 2W27A 1LL8A 4P6ZS 4PKYA 1TF1A 4I38A 2L1MA 1GSWA 2WKQA 3BQAA 2V0UA 3PBRA 3NOUC 4AFIA 5IS1A 2PHYA 2K7SA 4UQIS 4BBUA 3K2NA 2VLGA 3MQQA 3RFBA 3LI9A 2VEAA 4G3VA 3UE6A 2A24A 3D3OA 4HNBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IJG A;  4Q0J A;  1MC0 A;  3BJN A;  4ME4 A;  2VZW A;  5HPF A;  5HL6 A;  2XRO A;  3OBF A;  3NHQ A;  3KO6 A;  3VV4 A;  5DFY A;  2G7U A;  3E98 A;  3CIT A;  5HPI A;  3MMH A;  2O9A A;  5HSQ A;  4O01 A;  3KSF A;  4E04 A;  2B18 A;  3ZQ5 A;  4ETZ A;  3MF0 A;  4YOF A;  2O9B A;  1ZTU A;  2W3G A;  2W3D A;  2VKS A;  2OOL A;  2W1R A;  2ZMF A;  2XSS A;  4FOF A;  2M7V A;  2QYB A;  2LB5 A;  2K31 A;  4G3W A;  2W1T A;  2M7U A;  4EU0 A;  3O5Y A;  4O0P A;  4YNR A;  4GW9 A;  4O8G A;  5L8M A;  3G6O A;  2KLI A;  5DFX A;  4EUV A;  4ZRR A;  2W1T B;  3CI6 A;  3S7Q A;  4MN7 A;  3DBA A;  3IBJ A;  2GX5 A;  4GLQ A;  3W2Z A;  4DMZ A;  1VHM A;  5I5L A;  2HGV A;  2W3H A;  4MMN A;  5TJJ A;  4ETX A;  5C5K A;  3IBR A;  3EEA A;  3NOT C;  3OOV A;  3C2W A;  3KSH A;  4RQ9 A;  3MQ0 A;  4G3K A;  2O9C A;  2O99 A;  5AJG A;  3KSI A;  2W3F A;  4MDZ A;  3S7N A;  4Q0I A;  4MCW A;  1YSP A;  3LFV A;  4QPR A;  4DN0 A;  4LRZ E;  4IUH A;  3TRC A;  2Y79 A;  5LBR A;  3E0Y A;  4R6L A;  1MKM A;  5K5B A;  2IA2 A;  3HCY A;  2Y8H A;  4BWI A;  1YSQ A;  4Y5F A;  2K2N A;  1TD5 A;  3S7O A;  2O0Y A;  2W3E A;  4Y2F A;  1TF1 A;  4IUK A;  4Z1W A;  4CQH A;  1F5M A;  3NOU C;  4Y3I A;  2LB9 A;  4LRX C;  4R70 A;  2XRN A;  2VJW A;  4Q0H A;  3K2N A;  2KOI A;  1STZ A;  4LRY C;  3RFB A;  1YKD A;  2VEA A;  4G3V A;  4PAU A;  3R4K A;  3NOP C;  3D3O A;  3S7P A;  3KSG A; 
#chains in the Genus database with same CATH topology
 1K25 A;  4K08 A;  1LL5 A;  1LI9 A;  3NY4 A;  3G4P A;  3D72 A;  1E25 A;  5EVI B;  1PRQ A;  2PAV P;  3VOL A;  1VQQ A;  1LSW A;  5E2F A;  1S1Y A;  5J4E A;  3ZQ5 A;  4ETZ A;  2ZOI A;  5CEC A;  1ERO A;  3PAE A;  2W3G A;  3MBZ A;  4QB8 A;  3TG9 A;  4HQA A;  2ZC5 B;  4QJG A;  5EVL A;  1GHM A;  3SZT A;  1NY0 A;  5CHU A;  2VGL S;  4OON A;  4N9K A;  2P04 A;  3RTY A;  1FCM A;  1NYY A;  1YQS A;  3IHA A;  1AWI A;  4FTX A;  3MFX A;  3SS4 A;  4MMN A;  4XUX A;  3HLB A;  3EEA A;  4HJ3 A;  4LGW A;  1VB6 A;  1CEG A;  4Y0U A;  2ZMV A;  1XJ2 A;  3UPP A;  4MDZ A;  3SOI A;  4DN0 A;  1K56 A;  1YMX A;  1DJB A;  2Y2J A;  1N9O A;  1N4O A;  2WGV A;  4HH2 A;  3IX4 A;  4NET A;  4II7 A;  1CEF A;  1ZG6 A;  4Y2F A;  1F5M A;  2JKG A;  3HLF A;  5KIZ A;  1D06 A;  5FQM A;  3PYP A;  1JTD A;  1XJ4 A;  1ONH A;  3U4L P;  1BLH A;  1IKI A;  1XX2 A;  2VV8 A;  3ICY A;  2A24 B;  3F1P A;  4MNR A;  3FPV A;  3UPN A;  3OBF A;  5FA7 A;  5FDS A;  3GSG A;  1Y54 A;  3RJU A;  2JE5 A;  1SCW A;  2Y2M A;  3FC7 A;  2Z6D A;  2EX8 A;  2H10 A;  4KZB A;  4HP9 A;  3ISG A;  1L0E A;  2FFF B;  2MJ6 A;  3ITA A;  2HDS A;  1U60 A;  4HOI A;  3BFF A;  3WWX A;  3ZG5 A;  4ZRR A;  2GX5 A;  4QWO A;  5M18 A;  5BOH A;  1VHM A;  1NLY A;  1Q2P A;  3HL9 A;  4GN2 A;  5HD3 A;  3IWO A;  3TSG A;  3MQ0 A;  3T1S A;  1LHY A;  3E2L A;  4PM8 A;  5GLD A;  1KVL A;  4KZ6 A;  4X68 A;  1E3U D;  2YKF A;  2PYP A;  1FCO A;  1UWP X;  4MN5 A;  1UWN X;  1FIL A;  3TRC A;  3G2Z A;  4HJ6 A;  1IKG A;  1MKM A;  2BG1 A;  2G2W A;  1K55 C;  1ES4 A;  1BLS A;  4F94 A;  4R1G A;  2X71 A;  3MQO A;  3VP3 A;  4Y5F A;  4HBU A;  3HUM A;  3FWL A;  1T1C A;  4MBF A;  1D1J A;  5IT5 A;  3O88 A;  5TBM A;  1TS7 A;  1GCE A;  2JBF A;  5A8B A;  4WM9 A;  5JYP A;  2IWD A;  4D2O A;  3TE8 A;  5FAP A;  4E3N A;  3JVV A;  2XDM A;  4PM6 A;  4DE3 A;  2P9V A;  2XF3 A;  2E8J A;  3LUQ A;  4HIA A;  3CWF A;  1MC0 A;  3L9K A;  4FCF A;  1F9I A;  1T1B A;  4BLM A;  1EW0 A;  3LI8 A;  1BLC A;  3F1P B;  3M2K A;  1K6R A;  3LR0 A;  1T19 A;  2PU4 A;  3QP1 A;  2ZLY A;  4Z9Q A;  3W8K A;  1IEL A;  4N1H A;  4HY8 A;  1ZTU A;  2ZQ9 A;  2W1R A;  4JGO A;  2M7V A;  1S6R A;  3KYZ A;  4EUZ A;  4LV3 A;  4JBF A;  5DKK A;  3TOI A;  5A90 A;  3HJK A;  1D7E A;  3A3J A;  5KSC A;  2NUT C;  1CI9 A;  2ZBB A;  4MN7 A;  3DBA A;  2Y59 A;  3FG8 A;  5I5L A;  5J7E A;  3TW8 A;  4OKP A;  3IHB A;  4E6X A;  3LR3 A;  1XPB A;  4BL3 A;  3UB6 A;  3MR0 A;  1RP5 A;  4LPZ A;  3MFD A;  1MKI A;  1DJC A;  3T4T A;  1FSY A;  5F5Y A;  1K57 A;  1S0W A;  2HV1 A;  1WYC A;  4HES A;  4OPR A;  3GR2 A;  3NDG A;  4JF4 A;  4OPZ A;  4NXF A;  4CQH A;  4N1X A;  4R70 A;  3LIC A;  4QU3 A;  3DWZ A;  3QNC A;  3LID A;  4WZ5 A;  3UDI A;  5TBM B;  5FQQ A;  4P6B A;  3E4Q A;  4EW7 A;  2PT7 A;  3OPL A;  2OLV A;  4NKP A;  5AQA A;  4KG2 A;  1N9B A;  2D01 A;  2P9V B;  3N8R A;  4PM5 A;  2ZC4 B;  1PI4 A;  1XKZ A;  1W63 Q;  3NHQ A;  4NXG A;  3WS4 A;  5A91 A;  2G7U A;  1H8M A;  1CJF A;  1OT6 A;  3HLC A;  1SKF A;  4KZA A;  2XEP A;  5E2H A;  4ID4 A;  1RGZ A;  2V2F F;  4LV2 A;  4S2I A;  5FEF A;  5CRF A;  4X25 A;  5HW3 A;  3GRJ A;  5EOE A;  2XQZ A;  2K31 A;  4GD8 A;  3IWQ A;  4JXW A;  3PBN A;  3LGO A;  2INW A;  5HWT A;  1YLT A;  1YAX A;  2WAE A;  4BL2 A;  3FYZ A;  3T50 A;  1N9N A;  1QME A;  4KG5 A;  4X56 A;  2Y2O A;  4S2O A;  3OOV A;  4GHI A;  5CGX A;  3N8L A;  5CGS A;  4BD1 A;  3HUO A;  1TDL A;  1TS0 A;  4WMC D;  3LFV A;  4FD8 A;  2JKR M;  1PWC A;  4CLC C;  2QKP A;  2Y79 A;  1PYY A;  1BZA A;  2OWH A;  3H82 A;  4NK3 A;  2Y8H A;  3EQU A;  5GLB A;  4I38 A;  3A3E A;  5FI7 A;  2EX2 A;  2V0U A;  4DXB A;  4AFI A;  1JTG A;  5CGW A;  3HRE A;  1CF0 A;  1HVB A;  3MQQ A;  1TDG A;  1K0K A;  1H0M A;  2VEA A;  2EX9 A;  3FZC A;  4ME4 A;  4EV4 A;  3IF5 A;  4IED A;  4YFM A;  4KZ9 A;  1EWZ A;  3T4S A;  5FQK A;  4PKY G;  4A5R A;  1FCN A;  1IYS A;  3G35 A;  5GHY A;  2L4R A;  2J7V A;  3IH8 A;  2ZL1 A;  5HPI A;  2PDR A;  2E8I A;  3SW1 A;  4QHC A;  2Q9M A;  1TS6 A;  2WAF A;  1JWP A;  4HHD A;  3W4P A;  1WA9 A;  2OSU A;  3O87 A;  4GOG A;  2W1T A;  2ZC7 A;  2QZ6 A;  2PBY A;  1XXM A;  3DTM A;  1F2K A;  1FQG A;  2KLI A;  2WGW A;  4EUV A;  4Q8I A;  2H0Y A;  2W3H A;  3LIA A;  3IF6 A;  2ZMA A;  4UA7 A;  5GLC A;  2ZQD A;  2PRF A;  1C3B A;  2PYR A;  5EVI C;  3CMZ A;  2Y2Q A;  1P0Z A;  4GHI B;  3S4X A;  3N8S A;  3OLO A;  3S22 A;  3MKE A;  1XJ6 A;  5K5B A;  1BT5 A;  2XLN A;  1BYW A;  4BMW A;  3EEH A;  1BLP A;  4P0M A;  3H82 B;  4L9F A;  3E4P A;  3OPH A;  1MBL A;  1OT9 A;  4Y3I A;  4WBG A;  2LB9 A;  2BAS A;  4P87 A;  2HJ9 C;  4OOY A;  3TJZ C;  2R9X A;  3PBO A;  1IFQ A;  3QHY A;  5KMW A;  1E4D A;  4U3T A;  4LFU A;  2OAP 1;  4IJG A;  1ACF A;  1YT4 A;  4E3I A;  3UE1 A;  5FSR A;  1GSV A;  5D3O A;  5FQ9 A;  1FSW A;  1ES2 A;  4GZB A;  4R3A A;  3MMH A;  1GHI A;  2ZC3 B;  1NJ4 A;  2ZL1 B;  2ZMF A;  1SDN A;  4X69 A;  4O0P A;  4LV0 A;  5I94 A;  4WZ4 A;  5AQB A;  5EV0 A;  2W1T B;  4DJ3 A;  2BLS A;  1YLP A;  3LR4 A;  2P74 A;  1OJG A;  1PW1 A;  2V9A A;  2WGW B;  2PR5 A;  2XD1 A;  4X6T A;  3B42 A;  1LLB A;  3MZD A;  2X02 A;  3IF6 B;  1FOF A;  1LT0 A;  5EUA A;  3S7N A;  4I39 A;  4MCW A;  4BEN A;  4WEK A;  2J3W A;  4LRZ E;  4PHT A;  4HP4 A;  2DMW A;  2Z2M B;  4WMC A;  4HBT A;  2L0W A;  3BFG A;  3K3D A;  2EA9 A;  1XGJ A;  3KX0 X;  5TR7 A;  3UB9 A;  3IX3 A;  2H0T A;  1P9W A;  4ZJ2 A;  2HP5 A;  2KDK A;  3MXS A;  4Q0H A;  1TEM A;  3C30 A;  3ZGA B;  2Y2K A;  3PXP A;  4BBV A;  2V8C A;  1G6A A;  3NOP C;  5EM1 A;  3DAV A;  4OLG A;  4U0X A;  1PWD A;  5M19 A;  4NG2 A;  2XGN A;  3IS2 A;  1L2S A;  4LV1 A;  3CJM A;  5HPF A;  1CQA A;  1LSX A;  3B3X A;  4HEF A;  1DP9 A;  5FAS A;  1ODV A;  2WAD A;  1S67 L;  3V50 A;  4EWF A;  3OCN A;  4ARZ A;  4B4Z A;  2O9B A;  5IU1 A;  3HLG A;  3AGD A;  4EEU A;  4OOL A;  2HPB A;  4OQ0 A;  4Y15 A;  2ZQC A;  2M7U A;  4XXR A;  5L8M A;  1ALQ A;  3DTK A;  4LCL A;  3T4J A;  5TGF A;  3VP1 A;  4BD0 A;  4DE2 A;  5GHZ A;  3S1Y A;  1OTD A;  3FV7 A;  4JF6 A;  4MBK A;  3KSI A;  2Y2H A;  3LEZ A;  2A2L A;  1CK3 A;  4KUO A;  5AQ9 A;  4EES A;  5L09 A;  4FH4 A;  5AVE A;  2J80 A;  4UEY A;  2VA0 A;  4CLC D;  4UA6 A;  3S7O A;  4EQ1 A;  2JKT I;  4Z1W A;  1G5U A;  3A0V A;  4E3M A;  3EWK A;  2GZA A;  4DRT A;  1K55 A;  3LIF A;  1IYP A;  2JN7 A;  2KOI A;  2HDQ A;  2UWX A;  2QWS A;  1K4E A;  3T1R A;  3KSG A;  3T1Q B;  4Q0J A;  4JPM A;  2XA7 S;  3LO7 A;  4IBR A;  1W8Y A;  2Y2I A;  4KZ8 A;  4WLA A;  4E3L A;  4WYY A;  4EER A;  3PAG A;  3P01 A;  5DF9 A;  2Y2P A;  3IS2 B;  3ITB A;  4KQD A;  3SH8 A;  3ZVT A;  1HD8 A;  2W0N A;  2C6W B;  5HSQ A;  3KSF A;  4ZBE A;  1VET A;  1J3W A;  4Y0T A;  5CHJ A;  4CJN A;  4YOF A;  3MF0 A;  2UV0 E;  4OOM A;  1NLZ A;  2H28 A;  3R7W A;  3CG5 A;  3W4O A;  1XP4 A;  4ARZ B;  2LB5 A;  1NZU A;  4KG6 A;  3A0S A;  4YWZ A;  5L07 A;  2R78 A;  4YNR A;  3QP4 A;  3P09 A;  5CEB A;  1K6S A;  2BTF P;  2WKI A;  5HAP A;  3Q82 A;  3SS5 A;  5F82 A;  2HGV A;  5E2E A;  3BFD A;  1K4F A;  3IBR A;  3WS5 A;  3KSH A;  1MWU A;  5DTS A;  3ZG8 B;  3DTI A;  1PFL A;  4M3K A;  3T4K A;  3BY8 A;  4KQQ A;  4Q0I A;  3UDF A;  3VP4 A;  1TS8 A;  5EVI D;  1KDS A;  2GJ3 A;  3VFH A;  3ZCZ A;  3T4L A;  5HAQ A;  3QP8 A;  1SHV A;  3ZVW A;  2W27 A;  4P6Z S;  5F83 A;  3GVB A;  2L1M A;  3P98 A;  1GSW A;  3DWK A;  1ZG4 A;  3BQA A;  1K54 A;  1L0G A;  3PBR A;  3NOU C;  2EFU A;  4X53 A;  5IS1 A;  3RXX A;  2PHY A;  4R4R A;  2QMI A;  4BBU A;  3IWI A;  1IEM A;  4ZTK A;  1KE0 A;  4KZ4 A;  2J9O A;  4G3V A;  4I5S A;  3V3R A;  3UB7 A;  2IWC A;  2VZW A;  2VGL M;  3E2K A;  2XRO A;  1NZO A;  5L2F A;  5F1G A;  1WE4 A;  1ES5 A;  3BQ8 A;  3EOI A;  4JKT A;  4KZ7 A;  5EPH A;  3JPU A;  3LY4 A;  2O9A A;  4FUW A;  3LIB A;  2B5R A;  2XFT A;  3JVU A;  4K91 A;  2XD5 A;  5CTN A;  1VET B;  4FOF A;  4IVK A;  3R7W B;  3VP2 A;  2M1C A;  3B33 A;  3BFE A;  5DF8 A;  2Z6C A;  5KSH A;  2B02 A;  3NBL A;  5C5K A;  1MWS A;  3CPT A;  1BTL A;  4UAA A;  3N4I A;  4RQ9 A;  1G68 A;  2ACG A;  4EBN A;  3D9Y A;  3A3F A;  3G2Y A;  2W3F A;  5FAT A;  4LCM A;  3PBQ A;  4M4X A;  3CZD A;  4H8R A;  3Q1F A;  2EX6 A;  2QJ7 A;  1NRJ A;  4Y13 A;  2A49 A;  1XFN A;  3NJA A;  3VE4 A;  1QMF A;  1KE4 A;  2W3E A;  3FPW A;  2P7J A;  4L9G A;  3BEB A;  3ZG7 B;  2A3U A;  4DE0 A;  5EEC A;  3GV9 A;  5HDD A;  3V67 A;  2XRN A;  2VJW A;  1E3U A;  2B95 A;  4FH2 A;  1XJ3 A;  4EBL A;  4ZJ1 A;  3G32 A;  4HH3 A;  3ZFZ A;  1MZU A;  3A3I A;  2ZC6 B;  1KGE A;  2FZ0 A;  2OV5 A;  3C7U A;  1EI5 A;  3NEC A;  1G6O A;  3P7N A;  4B4X A;  1ZC2 A;  2J8Y A;  2V1B A;  2PD8 A;  4MBH A;  3O5Y A;  4GW9 A;  5AQ7 A;  4O7D A;  4O8G A;  5FDH A;  3ULF A;  2VX8 A;  4KEN B;  4C3Q A;  3CI6 A;  4S2N C;  3A3D A;  2V20 A;  2KX6 A;  1YLJ A;  1VEU A;  2XA7 M;  1NRF A;  5GHX A;  3NOT C;  3V5M A;  4NXB A;  1KOU A;  3HVF A;  3CPT B;  2O99 A;  4JXG A;  1X0O A;  2HDR A;  4E3O A;  2J3T C;  3CHW P;  5G18 A;  1OTE A;  3WS2 A;  1ONG A;  3E0Y A;  1PZP A;  2WUQ A;  4OPQ A;  2XR0 A;  3BRM A;  1H8Y A;  1YSQ A;  2O0Y A;  3EGD C;  2V1Z A;  4S2L A;  1CI8 A;  5A92 A;  1KDW A;  5FQJ A;  3OCL A;  3WS0 A;  1STZ A;  4ZJ3 A;  1OTB A;  3F1O A;  3DW0 A;  4N92 A;  3GDI A;  4GNU A;  4BBT A;  3CUE C;  5F6A A;  3MXQ A;  3K3C A;  2DCF A;  5G4Y A;  2HF6 A;  5HX9 A;  3MZE A;  5DVA A;  2YKH A;  5HL6 A;  4QD4 A;  3UDX A;  3AGF A;  4R3B A;  3EGX C;  5CER A;  5M1A A;  3CLO A;  3BYD A;  1PI5 A;  1Z6F A;  3F1N A;  4QY5 A;  5KZH A;  1XFQ A;  4E04 A;  5DJU A;  2B18 A;  1ESU A;  1OPX A;  4U0T A;  2ZM8 A;  2ZQ8 A;  1RCJ A;  2ZD8 A;  4D60 A;  3IXG A;  2I72 A;  4S2M A;  3ZG9 B;  2AVX A;  2RCX A;  1MXO A;  1IYO A;  4GS9 A;  2GNX A;  4X1M A;  4EQI A;  1OTA A;  1O7E A;  3H7W A;  3VMA A;  1VEU B;  4EBP A;  2QHK A;  2CC1 A;  1P97 A;  1OTI A;  2IWB A;  2FH5 A;  1Y28 A;  4R23 A;  1MWT A;  4EXO A;  5AVF A;  2VGK A;  3Q7Z A;  2QPN A;  2PU2 A;  1H5X A;  1JVJ A;  5HAR A;  5FI2 A;  1NWZ A;  3UME A;  1T18 A;  3KYQ A;  1DY6 A;  3HLW A;  3OZH A;  4C75 A;  2EXA A;  1O07 A;  2Z2L B;  4N9L A;  3MZF A;  1YM1 A;  3C8C A;  3C38 A;  5CHM A;  3VOZ A;  3I7J A;  3UNW A;  3OC2 A;  3VFF A;  3A0R A;  3F1O B;  3BJN A;  3B47 A;  2JKR I;  3LR5 A;  1ES3 A;  4QY6 A;  3VV4 A;  2XK1 A;  3MS6 A;  3E98 A;  4GB7 A;  1F98 A;  2WK0 A;  4XT2 A;  4F3L A;  4O01 A;  1K38 A;  2HDU A;  3AGE A;  4Y0O A;  3GTC A;  1I2S A;  4OVD A;  1IOU A;  3F1N B;  2OOL A;  2WZX A;  3G34 A;  4G3W A;  5EE8 A;  3M2J A;  4RX3 A;  4CPK A;  3BM6 A;  2Q9N A;  3S7Q A;  3OPP A;  3IBJ A;  2NUP C;  5FEG A;  2JHE A;  2WZZ A;  4Y17 A;  3VOY A;  4I3J A;  5CXW A;  3RH8 B;  2JC7 A;  4ZAM A;  2EWW A;  4GS9 B;  1ZHH B;  2O9C A;  3WS1 A;  5HFO A;  1YLZ A;  4DXC A;  1GHP A;  3PR6 A;  1YSP A;  3H7W B;  4UHU A;  3Q81 A;  1DP8 A;  1KGF A;  4L9E A;  4WUJ A;  2K2N A;  1LL8 A;  4PKY A;  2VK3 A;  4PM9 A;  3MKF A;  1L0F A;  3V3S A;  4R4S A;  2K7S A;  4UQI S;  5FAQ A;  3ZNT A;  3K2N A;  1NXY A;  3O3V A;  1KVM A;  3LI9 A;  3UE6 A;  1I5Q A;  4DKI A;  3D3O A;  3NDE A;  5FAO A;  3PHY A;  3ZG0 A;  3T4O A;  3LIE A;  1L0D A;  3C4P A;  1P9R A;  1XGI A;  4WL9 A;  3M6H A;  3NIA A;  2V0W A;  5DFY A;  3IH9 A;  5DTT A;  2C5W B;  3HBR A;  5J3W A;  4ZDX A;  1W63 M;  3SS3 A;  4UA9 A;  3JYI A;  4XT2 B;  4F3L B;  2XSS A;  3E4O A;  3Q07 A;  1PIO A;  4I3A A;  2ZOH A;  2HP9 A;  2VGJ A;  4IBX A;  2R9W A;  4S2J A;  4OLD A;  4DMZ A;  5TJJ A;  5CED A;  2VV6 A;  5G4Z A;  2OLU A;  5IHV A;  2J9P A;  3MXR A;  4KZ5 A;  4JXS A;  4RVA A;  3IXB A;  3QP2 A;  4X55 A;  3QP6 A;  2DNS A;  5LBR A;  1LI0 A;  4OPY A;  1AXB A;  2RL3 A;  3RXW A;  3HCY A;  1A0K A;  3FKW A;  2J3T D;  1SZV A;  2X01 A;  3BLM A;  1FR6 A;  4XUZ A;  1TD5 A;  4DDY A;  2Y2G A;  3UPO A;  4MEZ A;  2WKE A;  5CTM A;  1GA0 A;  3IXH A;  4KQR A;  3H9W A;  2EFX A;  1OJ5 A;  3LEQ A;  4OP5 A;  2QJ5 A;  3CAX A;  2ZM0 A;  3C5A A;  5JYO A;  5FI6 A;  1PNE A;  1PW8 A;  5E2G A;  2JCH A;  3PBT A;  5HWV A;  4ESP A;  5HAI A;  1Q2Q A;  2CMN A;  4R3J A;  1W79 A;  2PBD P;  4GKU A;  3EQV A;  5HWW A;  1SKO A;  4L0L A;  2ZQ7 A;  3QP5 A;  5EOO A;  5FL3 A;  1S66 L;  2V8F A;  3PBS A;  5EM0 A;  4X1L A;  1ZKJ A;  2JKF A;  3M6B A;  3MJQ A;  5J8X A;  1IYQ A;  4OQH A;  5HDS A;  4PPR A;  1V9Y A;  1BSG A;  1GSX A;  4B93 A;  1V9Z A;  2Y2N A;  3G31 A;  3C7V A;  1YLW A;  3L7H A;  3ZNY A;  2Q0O A;  4C6Y A;  1Y4O A;  3G6O A;  2XFS A;  4KUK A;  3SH9 A;  3KYE A;  1K54 C;  1DRM A;  4H6J A;  3W2Z A;  2WGI A;  2Y91 A;  4K0W A;  4OQI A;  4DE1 A;  1JWZ A;  1XA1 A;  4ETX A;  1W5D A;  1ERQ A;  1HTZ A;  4JLF A;  4EET B;  3UO9 A;  1K57 C;  1FR1 A;  4MN6 A;  3VP0 A;  1YPR A;  2Y55 A;  4KQO A;  1BUE A;  5DTK A;  4E3J A;  1Z09 A;  1JWV A;  3O86 A;  1KE3 A;  4K0X A;  2IA2 A;  4WZ5 C;  5L10 A;  5F1F A;  1MPL A;  4PM7 A;  4FSF A;  2WKP A;  4JXV A;  4IUK A;  4KZ3 A;  4WN5 A;  2ZM2 A;  4LRX C;  2EWV A;  3VE3 A;  3SH7 A;  3VSL A;  4LEN A;  5F68 A;  3NCK A;  3T4Q A;  3IXD A;  3UY6 A;  4LRY C;  3N6I A;  3R4K A;  3WRT A;  2HJE A;  5CX7 A;  4WEL A;  4RX2 A;  1M40 A;  3U2A A;  1WYB A;  3C4O A;  5E43 A;  3HJI A;  4CLC A;  4CLC E;  2PR6 A;  1S4S A;  1RGY A;  4RA7 A;  4GDB A;  1JNU A;  2WKR A;  4I3I A;  1SKO B;  1YMS A;  1TVF A;  4OH0 A;  1SDE A;  2D02 A;  2DRW A;  5MC7 A;  2W3D A;  2VKS A;  3W4Q A;  1H8Z A;  2QYB A;  3GMW A;  3HUN A;  4WF0 A;  3IQA A;  1T1A A;  3BEC A;  3UE0 A;  1L3L A;  1W7F A;  1MY8 A;  4UQI M;  5GLA A;  1ESI A;  5DJT A;  2ZJ9 A;  3HLE A;  2HP6 A;  3D4F A;  3LCE A;  4IVI A;  4OP8 A;  2I9V A;  5FQI A;  3ZDJ A;  1HZO A;  3NUL A;  4H6J B;  4JGP A;  1YLY A;  3LYX A;  4S2N A;  2ZQA A;  3GQZ A;  5HD5 A;  3N7W A;  5AJG A;  1H3Q A;  1K56 D;  5DKL A;  1S1Z A;  2G2U A;  4IUH A;  1UGU A;  3BLS A;  4R6L A;  3UMD A;  3IX8 A;  3Q7V A;  5A93 A;  3BY9 A;  4WEJ A;  4OQG A;  1BUL A;  3T1X A;  4BJP A;  2WKH A;  4BQM A;  2Y2L A;  3UB5 P;  4B88 A;  3ZHH A;  1PWG A;  3QNB A;  2HZ5 A;  1N9L A;  1YKD A;  4PAU A;  3OPR A;  3GEC A;  4MLL A;  4NEE D;  1W8Q A;  3S7P A;  5EVI A;  2VV7 A;  4P85 A;  4NXE A;  4GJ4 A;  5HZH A;  1NYM A;  4DF6 A;  1HLU P;  4HI4 A;  3UE3 A;  3MSH A;  3KO6 A;  3CUE A;  4S2K A;  1OME A;  5EFW A;  4CLC B;  3CIT A;  2EXB A;  4YIN A;  3ZYT A;  3V39 A;  1LL9 A;  3IT9 A;  1LSV A;  3PTE A;  3VSK A;  3G30 A;  1DP6 A;  1ERM A;  3T12 B;  4PMA A;  5EVE A;  4Y7P A;  1J9M A;  4RYE A;  1PZO A;  4DJ2 A;  5HDC A;  4EU0 A;  4GCZ A;  4EEP A;  2OAQ 1;  5F69 A;  2JKT M;  3IF6 C;  3UN7 A;  1GA9 A;  5DFX A;  4GLQ A;  1S4R A;  4HJ4 A;  5TFQ A;  4S2P A;  2Y4A A;  4GD6 A;  4E3K A;  5HL1 A;  3UB8 A;  4P6Z M;  2OWJ A;  4DDS A;  4JF5 A;  5DF7 A;  2H5S A;  2XH9 A;  3C2W A;  3DTE A;  4LLO B;  4IHQ A;  1DJA A;  2FFY A;  3HLD A;  4JGR A;  4G3K A;  2V1A A;  1G28 A;  4JGQ A;  5GL9 A;  2PD7 A;  4QPR A;  1FIK A;  3NI9 A;  3BFC A;  1M6K A;  5U47 A;  1MWR A;  1XA7 A;  4R38 A;  3BW6 A;  3WRZ A;  4B9O A;  2P08 A;  3BWL A;  4BWI A;  1VM1 A;  3Q7V B;  1I2W A;  1TF1 A;  2WKQ A;  1KGG A;  3LY3 A;  3FKV A;  4E6W A;  2GDN A;  2VLG A;  3RFB A;  2WYX A;  2A24 A;  3NC8 A;  4R0Q A;  4GDN A;  4HNB A; 
#chains in the Genus database with same CATH homology
 3PHY A;  3T4O A;  4K08 A;  3LIE A;  4I5S A;  4ME4 A;  3UB7 A;  1P9R A;  2VZW A;  2VGL M;  4WL9 A;  3D72 A;  2XRO A;  3T4S A;  4PKY G;  3BQ8 A;  3EOI A;  3VOL A;  2L4R A;  2V0W A;  5DFY A;  1LSW A;  5HPI A;  1S1Y A;  2PDR A;  2O9A A;  5J3W A;  3LIB A;  5J4E A;  3ZQ5 A;  4ETZ A;  3SW1 A;  1W63 M;  1TS6 A;  2ZOI A;  4XT2 B;  2W3G A;  3JVU A;  4F3L B;  4HHD A;  2XSS A;  4FOF A;  1WA9 A;  4HQA A;  3E4O A;  2W1T A;  2VGL S;  4I3A A;  2ZOH A;  3R7W B;  2P04 A;  3RTY A;  2M1C A;  2KLI A;  4EUV A;  3B33 A;  4DMZ A;  2Z6C A;  5KSH A;  3MFX A;  2W3H A;  2B02 A;  4MMN A;  5TJJ A;  5C5K A;  3LIA A;  3EEA A;  2VV6 A;  5G4Z A;  4HJ3 A;  4RQ9 A;  1VB6 A;  2ZMV A;  1XJ2 A;  2PYR A;  2W3F A;  1P0Z A;  4MDZ A;  4GHI B;  3PBQ A;  4M4X A;  4DN0 A;  5LBR A;  3OLO A;  2QJ7 A;  1NRJ A;  1N9O A;  1XJ6 A;  5K5B A;  4HH2 A;  1XFN A;  3HCY A;  2J3T D;  3NJA A;  4II7 A;  1BYW A;  4BMW A;  3VE4 A;  3EEH A;  1TD5 A;  2W3E A;  4Y2F A;  3FPW A;  3H82 B;  4L9F A;  2P7J A;  3E4P A;  4L9G A;  1F5M A;  1OT9 A;  4Y3I A;  5KIZ A;  2LB9 A;  2BAS A;  3H9W A;  2HJ9 C;  1D06 A;  5HDD A;  3V67 A;  1OJ5 A;  2XRN A;  2VJW A;  3TJZ C;  2QJ5 A;  3PYP A;  3CAX A;  3PBO A;  1IFQ A;  1XJ4 A;  1XJ3 A;  3PBT A;  5HWV A;  2OAP 1;  4IJG A;  4HH3 A;  2CMN A;  1MZU A;  2VV8 A;  3ICY A;  2A24 B;  3F1P A;  3EQV A;  5HWW A;  2FZ0 A;  3FPV A;  4L0L A;  3OBF A;  1GSV A;  5FL3 A;  1G6O A;  1S66 L;  4R3A A;  3MMH A;  3P7N A;  3PBS A;  3FC7 A;  2V1B A;  2Z6D A;  4HP9 A;  2PD8 A;  2ZMF A;  3MJQ A;  2MJ6 A;  5HDS A;  1V9Y A;  1GSX A;  3O5Y A;  4O0P A;  4B93 A;  1V9Z A;  4GW9 A;  4O8G A;  4HOI A;  3ULF A;  3G6O A;  2VX8 A;  4KUK A;  4ZRR A;  2W1T B;  3CI6 A;  4DJ3 A;  1DRM A;  2GX5 A;  4H6J A;  3W2Z A;  1VHM A;  2KX6 A;  3LR4 A;  1NLY A;  1OJG A;  2V9A A;  2XA7 M;  2PR5 A;  4ETX A;  5HD3 A;  3NOT C;  3B42 A;  4EET B;  3MQ0 A;  4NXB A;  1KOU A;  4MN6 A;  2O99 A;  4KQO A;  1LT0 A;  1X0O A;  3S7N A;  2YKF A;  2PYP A;  4I39 A;  4MCW A;  2J3T C;  4WEK A;  1UWP X;  2J3W A;  4LRZ E;  4MN5 A;  4PHT A;  1OTE A;  4HP4 A;  1UWN X;  3TRC A;  2DMW A;  3E0Y A;  4HJ6 A;  1MKM A;  2IA2 A;  2L0W A;  3MQO A;  3K3D A;  2EA9 A;  1YSQ A;  4Y5F A;  2O0Y A;  3KX0 X;  3UB9 A;  4FSF A;  2WKP A;  1T1C A;  3EGD C;  4IUK A;  5IT5 A;  4WN5 A;  5TBM A;  1TS7 A;  1P9W A;  5A8B A;  4LRX C;  2KDK A;  2EWV A;  3VE3 A;  5F68 A;  3OCL A;  3T4Q A;  4Q0H A;  3TE8 A;  3C30 A;  1STZ A;  3JVV A;  1OTB A;  4LRY C;  3F1O A;  3PXP A;  3GDI A;  4BBV A;  3R4K A;  2HJE A;  5CX7 A;  3NOP C;  4WEL A;  3LUQ A;  4BBT A;  3CUE C;  5F6A A;  3MXQ A;  3K3C A;  4HIA A;  3CWF A;  3U2A A;  1MC0 A;  5G4Y A;  3IS2 A;  2HF6 A;  3HJI A;  5HPF A;  2YKH A;  5HL6 A;  4CLC A;  1F9I A;  4CLC E;  1LSX A;  2PR6 A;  1DP9 A;  1ODV A;  1T1B A;  1S4S A;  1EW0 A;  3LI8 A;  3EGX C;  1S67 L;  3CLO A;  3F1P B;  3OCN A;  1JNU A;  2WKR A;  4I3I A;  3LR0 A;  3F1N A;  1T19 A;  1XFQ A;  4E04 A;  4ARZ A;  5DJU A;  2B18 A;  1OPX A;  2D02 A;  2O9B A;  5MC7 A;  4HY8 A;  5IU1 A;  1ZTU A;  2W3D A;  2VKS A;  2W1R A;  4JGO A;  2M7V A;  4EEU A;  2QYB A;  3KYZ A;  4WF0 A;  4OOL A;  1T1A A;  5DKK A;  2M7U A;  3HJK A;  1D7E A;  5L8M A;  4UQI M;  3T4J A;  2NUT C;  5DJT A;  2ZBB A;  4MN7 A;  3DBA A;  3FG8 A;  5I5L A;  5J7E A;  3TW8 A;  4GS9 A;  2GNX A;  2I9V A;  1OTA A;  3LR3 A;  4H6J B;  4JGP A;  1OTD A;  3H7W A;  3LYX A;  3UB6 A;  2QHK A;  3MR0 A;  5HD5 A;  5AJG A;  1H3Q A;  3KSI A;  1P97 A;  1OTI A;  5DKL A;  1S1Z A;  4LPZ A;  2A2L A;  4IUH A;  4KUO A;  4EES A;  3T4T A;  1UGU A;  2FH5 A;  1Y28 A;  4R6L A;  3UMD A;  5AVE A;  5F5Y A;  3BY9 A;  4WEJ A;  2J80 A;  4UEY A;  2HV1 A;  4EXO A;  5AVF A;  2VA0 A;  4CLC D;  3S7O A;  4EQ1 A;  2JKT I;  4NXF A;  1NWZ A;  3UME A;  4Z1W A;  4BJP A;  1T18 A;  4CQH A;  3KYQ A;  3A0V A;  3EWK A;  2GZA A;  4R70 A;  3LIC A;  3LIF A;  3LID A;  2JN7 A;  2KOI A;  5TBM B;  3C8C A;  3C38 A;  1N9L A;  1YKD A;  4PAU A;  3E4Q A;  3GEC A;  3OC2 A;  4NEE D;  2QWS A;  4EW7 A;  2PT7 A;  3S7P A;  3KSG A;  4NKP A;  4Q0J A;  2VV7 A;  2XA7 S;  3A0R A;  3F1O B;  4NXE A;  2D01 A;  4WLA A;  3BJN A;  4GJ4 A;  4EER A;  5HZH A;  3B47 A;  3P01 A;  2JKR I;  4HI4 A;  3LR5 A;  3UE3 A;  5DF9 A;  1W63 Q;  3NHQ A;  3IS2 B;  4NXG A;  3KO6 A;  3VV4 A;  4KQD A;  3CUE A;  2G7U A;  5EFW A;  2W0N A;  1H8M A;  3E98 A;  1OT6 A;  3CIT A;  4CLC B;  1F98 A;  4XT2 A;  4F3L A;  5HSQ A;  4O01 A;  3KSF A;  3ZYT A;  1LSV A;  3MF0 A;  4YOF A;  4OOM A;  1DP6 A;  1NLZ A;  2H28 A;  1IOU A;  3R7W A;  3F1N B;  2OOL A;  4ARZ B;  4DJ2 A;  2LB5 A;  2K31 A;  3A0S A;  5HDC A;  4G3W A;  4EU0 A;  4YWZ A;  2R78 A;  4GCZ A;  4YNR A;  4EEP A;  2OAQ 1;  5F69 A;  3PBN A;  2JKT M;  2INW A;  5HWT A;  1YAX A;  5DFX A;  3S7Q A;  3IBJ A;  2NUP C;  4GLQ A;  3T50 A;  1N9N A;  1S4R A;  4HJ4 A;  2JHE A;  2HGV A;  4I3J A;  3IBR A;  3RH8 B;  3UB8 A;  4P6Z M;  2OWJ A;  3OOV A;  3C2W A;  3KSH A;  4GHI A;  4LLO B;  4IHQ A;  2EWW A;  4GS9 B;  4JGR A;  4G3K A;  1ZHH B;  2O9C A;  3T4K A;  2V1A A;  3BY8 A;  3PR6 A;  1G28 A;  1TS0 A;  4JGQ A;  4Q0I A;  1YSP A;  2PD7 A;  3H7W B;  3LFV A;  4QPR A;  2JKR M;  4CLC C;  2QKP A;  2Y79 A;  1DP8 A;  1TS8 A;  2OWH A;  4R38 A;  3H82 A;  3BW6 A;  2GJ3 A;  4L9E A;  4WUJ A;  3T4L A;  2P08 A;  4B9O A;  2Y8H A;  3BWL A;  4BWI A;  2K2N A;  3EQU A;  2W27 A;  1LL8 A;  4P6Z S;  4PKY A;  1TF1 A;  4I38 A;  2L1M A;  1GSW A;  2WKQ A;  3BQA A;  2V0U A;  3PBR A;  3NOU C;  4AFI A;  5IS1 A;  2PHY A;  2K7S A;  4UQI S;  4BBU A;  3K2N A;  2VLG A;  3MQQ A;  3RFB A;  3LI9 A;  2VEA A;  4G3V A;  3UE6 A;  2A24 A;  3D3O A;  4HNB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...