2W0FB

Potassium channel kcsa-fab complex with tetraoctylammonium
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
212
structure length
212
Chain Sequence
DILLTQSPAILSVSPGERVSFSCRASQSIGTDIHWYQQRTNGSPRLLIKYASESISGIPSRFSGSGSGTDFTLSINSVESEDIANYYCQQSNRWPFTFGSGTKLEIKRADAAPTVSIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIBODY FAB FRAGMENT LIGHT CHAIN
publication title Structures of Kcsa in Complex with Symmetrical Quaternary Ammonium Compounds Reveal a Hydrophobic Binding Site.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system/metal transport
total genus 53
structure length 212
sequence length 212
ec nomenclature
pdb deposition date 2008-08-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w0fB02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2w0fB01
3I02B 3WFBL 5EZJA 4FFYL 3IU3B 3RDTD 4I5BB 1QOKA 3IDIB 1FV1A 2NCMA 4Z95L 4CRPA 2HJFB 4GKSA 4NM8L 4YWGL 5CCKH 4R4BA 4PGDA 3SDAA 5EU6A 1J05B 2BVOA 1M71B 4EZMA 3MREB 3I3EA 4DKFL 1BBJB 3MNWA 2VLLA 3QULA 2VN7A 3FFCA 1UYWH 5GZNC 5DRXA 5IB1B 2ZSWA 3VCLA 1MHCA 5ACZB 4KROD 4TRPL 4DGIH 1GL4B 3O6KH 2FB4L 1YEFH 3PHQA 4HWZA 3ULUD 1JRHL 2VXVH 1Q0YH 1EBAA 1PFCA 4UQ2A 3DV6B 4QHUA 1YUHA 1KACB 5KVGH 2HLAA 4LKCB 1MY5A 4NQXA 2LU3A 2YD2A 1QFWM 4UU9A 1G7PA 5L6YL 1K2DB 3T2OA 1X7QA 4Z7VA 2SEBA 5IW6A 5IROC 3JSSA 5C7XL 2FEEI 2VDOH 4LARL 4YFLF 4XRCB 4X99B 2Q76B 5DJXB 2VLKD 3BH8B 3QO0B 4ETYA 1NLDH 1V8HA 4XC3L 2EDLA 2CDEA 3RJDA 1CFBA 2LVCA 4P5TD 3ABZA 2QR0A 1RIVL 5CWSA 3DSFH 3ULVL 1T21A 2P48B 1F4WL 3BX7C 3KG5A 1FFPB 5AAMA 3UC0H 1UM6H 3WDJA 1TJHL 1KB9J 1JV5A 4JDVB 3DVFA 4MB3A 3QDGD 4C4KO 4YHKL 3FOMA 4YFLI 1JJUA 1YMHB 3U7WL 1QBLH 3X11A 1Y0LA 8CGTA 1ONQA 1MRCL 4GFTB 1OSPH 2VZUA 1CD8A 3HE7A 1EGJA 2Z0BA 4DZ8A 1HSAB 4FFYH 4KY1L 2XTJE 1BWMA 2P24A 3MOAL 2FH6A 3DARA 4NCC1 4GS7B 3WIHL 3OB8A 5F1IB 1TVBA 3LV3A 4Z95H 1MJUL 3NIDE 5ITBL 2VLMD 3O11B 4NM8H 4YWGH 3QXTA 1QG3A 3V0AC 3HRZB 2E9IA 2CJUL 2J5LB 5DJ2A 4DKFH 5GS0D 5IJKA 2AEQH 3ZKMC 3MR9B 5SWZD 5HXMA 5J13C 1WT5A 4TRPH 1GH7A 5GRVK 5IHUL 5KN5B 4XVUC 1FVDB 5BJTB 1JRHH 1KEMH 2OQJB 3GBML 1S7XA 3MA7B 4GRWF 3VXOA 1HHGA 3QG6B 4NNXA 4IOFD 1PJ9A 2NX5E 3N06B 1G7MB 4M61B 3S4SA 3MRCB 5L6YH 1UWXH 2X9XA 4U1JB 4EDXA 2AXHA 2P46B 5C7XH 4LARH 2E9BA 2FGWL 2Q20A 1UA6L 1U8IA 3MUJA 4NO3A 1P7KA 4LHUA 4MGXA 5IVOA 3ILPA 1NQBA 3PWLB 4XC3H 2WLYA 3D18B 3WS6A 4ZFZB 1OAYL 3GMOA 4OZ4A 2AK4E 2XTJB 2BOBA 2FWOB 1G7QB 1RIVH 3PQYA 3CFBA 4NPYA 1WCBB 1S78D 1DANU 3ULVH 1I3UA 2FHFA 5EFIA 1F4WH 1QACA 1JF5A 2P5WA 5FDWA 1J87A 1TJHH 4K3HA 1ZWIB 1UG9A 3LQZA 4OZFG 4Y5YB 1A9EB 2C4FU 4YHKH 3RGVA 4EI6A 3CDCA 1JNLL 3U7WH 5E95B 3UPRB 5DK3A 1A7NL 1T0PB 4M4PA 3FT2A 1MRCH 3MRFA 1F5WA 3W11C 3TO4C 1U8LB 2NX5B 2OR9L 1WWBX 4JDZA 4P2YA 4K3DL 1J8HE 3G04A 4ZO9A 2JJSC 4PV9A 1XF5A 3C5ZA 2Q1EA 5H37H 4KY1H 3MOAH 5EZOL 5GRUL 5IB5A 1CIUA 3WIHH 2GSGB 4Y8AA 2PW1B 4KK9D 1T80A 1BOGA 1MJUH 2LTQB 5ITBH 5FFLA 5SX5H 4BSVA 1KEGL 2D7NA 4OFDA 4NN5B 5A2KH 1SBSL 5C09D 3TVMD 3N1MC 4MD4B 4K55A 5I75B 2E7HA 4XWOD 4JN2B 2AK4B 4N1HB 5IHUH 4PGCB 1HNGA 1GAFL 1NFDF 3GBMH 5HHMD 4UT6L 3GUTA 3L6FA 4XVTL 2OS7A 4V1DE 4YIQA 5JO5A 3DUSA 4FTVA 3PWUB 3GMMA 4E5XB 4WTWA 1LO5A 1FO0A 4CW1A 3L7FB 5IM7A 1PAMA 3VXRD 1UA6H 1NDGA 3LKNA 5JDSA 5IQ7L 4Q6YA 1TQCB 4OFVA 1KYOJ 4FQ2L 5I8CB 4K2UL 1J8HB 5E9DA 3M1BA 1OAYH 3OHXB 4JAMB 3HI1A 5IIEA 1FNLA 1XGTB 4XGZA 4P2OA 3WHE1 4WHTA 4N0UA 3QR2A 2MTPA 3Q6FB 3A6CL 4KROC 3VXSA 4EOWL 1ZEAL 4OCWL 2Y5EA 3ULUC 5C6TL 2R69L 3ES6A 2G2RB 3UAJC 2V7HB 1JVKA 3DYOA 4JR9L 4JFFB 3BZDA 1ACYL 4U0RC 3RTQA 1CG9B 1Q9KB 3UTSE 5MENB 5AZ2L 3N85L 1JNLH 4OZGE 3LKQB 3DBXB 4P2RA 1NGZA 5I16A 3ZKSD 3W39B 2OR9H 4MZ3A 1SEQL 2BK8A 2WUCL 5IB4B 1ZMYA 4MD5B 3EYVB 1HI6A 2H1PL 4MJID 5DHVH 5EZOH 5GRUH 3OXSB 5K93A 3FONB 1UB5B 3QHFL 2XN9D 2XWJB 3SQBA 2OTPA 4P5TC 3DVNB 3FMGL 3K80A 3CFJB 2BNQD 2D7OA 1BVLB 1EO5A 1Q9OB 1SBSH 1S7UA 3HAEG 3QFDB 4X4YB 5C0FA 4F57L 2BC4A 3ZTJG 4FFWD 3SE3A 3PUCA 4P4RA 2VZTA 4KRLB 2ZUSA 3QUXB 1GAFH 1OF2A 1WCQA 4UT6H 3M17B 1LK2A 4XVTH 5HVGB 2ESVA 2CKBB 4W6XB 4Q0XL 4Y0GA 5HDBE 5IV2B 3P40A 5EBMB 4K07A 1DBAL 1N7ML 1F8TL 5C0GA 1ZLWK 3F12A 4WO4B 2IC2A 1I3RA 4WGWB 3K4ZA 4MJ6B 4Z0XA 4OD1L 4WI4A 3MV9D 5AUMB 1QR1B 3IKKA 3MMEA 5E6ID 3HZYB 4LLVB 3MSPA 5TE7L 1JZ6A 2VN4A 3GGWB 1NEUA 5IQ7H 3VRJA 3PJSB 5D1QD 5T3XE 4ZUSA 4PR5A 4FQ2H 4K2UH 4IEFB 32C2A 1ZVSA 1OL0A 3CH1B 2A73B 4ELKA 3WMSA 1CE6A 2HVKB 3QUKA 2EO1A 3V5KB 3EKCA 5GS0C 1T03L 4YHNB 4X6FB 4D9QE 4F8QA 4BQ9A 1RAMA 3A6CH 3O3BA 1ZEAH 4OCWH 4X7EC 2D03L 3AUVA 5C6TH 3B6SA 1OGTB 4WFFE 1TNNA 2JK5A 4LQ1A 3O3AA 2I24N 2R69H 3TNNB 4GMSL 3V0WL 1E4WH 1P4LB 2PYED 4JR9H 5KG9A 1ZA3B 5T1KD 4HGKC 3CSYB 1ACYH 1U91A 3UCRA 1KTLA 2OLDA 5AZ2H 5D7JB 3N85H 5E6YA 3QEUA 1MHHB 2ZG3A 2AKRB 1U3YA 4DVBA 3GMNB 4JY4B 2R2HA 1J0ZA 4HJ0C 1YPZA 1T0NA 1SEQH 4NOBA 3DSNA 2WUCH 3G6AB 4PBWD 1D9KB 4OZFH 4XB8A 3W0WA 3WNOA 5IMLA 1KNOB 1AP2A 5KSBA 2VH5L 5CBAB 1VB9A 3BKML 1VCAA 3GRWA 1KULA 2HN7B 3AB0B 3V95A 3FMGH 3T3PF 3ARDB 1J12A 4P57A 3PWJB 2X1XR 1S78C 1UQSA 2X70B 3P77B 3VDAA 3P73B 4HCRH 4E41D 5I1AB 3CMGA 4JJ5A 1TJIL 5D2NE 4EI5A 1KJMB 2CO7B 4FRWA 4F57H 5D1ZA 3MLUL 3A67L 3D0LA 2J8OA 5HYEA 5C07B 3MFGB 2BSSA 4PRBA 2B4CC 4Q0XH 4R7DA 1HSBA 4NCDA 1DBAH 1N7MH 5AD0A 1F8TH 5ESQA 5H94A 1J9CT 1WEJL 5GRYA 1PLGL 2FX9L 3KPQA 2IFFL 4OD1H 1CICA 5KSAB 5C0CA 4R97C 2E6QA 2EDNA 3MRKA 1MCEA 1AR1D 2ZNXA 1XR9B 5TE7H 3PV7A 4Y19E 5LVEA 1CVSC 4JVPA 2RAMA 3WE6A 2JELL 1FRGL 5IUSA 2YXFA 4Y16B 3ARFB 1CI5A 1A6PA 1T03H 3TVMC 5JOFB 5FO9B 4ETQB 1OW0C 4XWOC 2APXA 3MJ6A 1INQB 2D03H 5TE6L 2H26A 4LGPB 3MX0A 3DURA 3V0WH 4GMSH 1T7WA 2XWBB 3RWHA 4L3EE 4JFYA 4EUPA 3ZLQC 1GGBL 4IOIA 2IMNA 3WN5C 1YPZF 4HKBA 4BJLA 5FCUL 4PJIA 4OZHA 1CR9L 4QOKA 5IMKA 2ZUWA 3X3FL 2H8PB 1H5BC 5KSBF 2VLRD 4WI3A 2X42A 3MNVA 1BJMA 3BESR 1MFDL 4L3CB 3EYSL 2L7JA 4WCYL 1NBYB 3BKMH 1G7HB 3Q6GL 3QZWA 5E7FA 1H15A 4PD4K 3V0VB 5KZCD 3IYLW 2YKLL 4Y19B 1EHXA 4JO4L 3O41B 3QJFB 2RJMA 3VFNB 1TJIH 3O2DL 1Z9LA 3MTRA 1VEOA 2YZ8A 3A67H 4GW5A 1T1XA 3U82B 3E6FA 5T33L 3RNKA 1IQWL 4RQQA 3SDAD 5HVHB 3WCYA 5EU6D 1C12A 1P4BL 2X09A 3D5OF 4P2QB 3C60A 5IHLB 2NTFB 3FFCD 4ZTPL 1N64L 2P8MB 2C9AA 3OX8B 1WEJH 4ONHB 2GSIB 1PLGH 2NXZB 4UDUA 3KDMA 2FX9H 5SX4H 4U1NB 3HAEH 4D8PA 3RWFB 4L3EB 3C8KA 3ZTJH 2OJEB 1UH3A 2WV3A 3I6GB 3MCG1 3RWIB 1S7SA 4UTBL 2P1YA 2KKQA 2L7UA 1CYGA 1I1YB 4OIBA 2Z91A 2JELH 1FRGH 1N0XL 2WBJA 1B0RB 15C8L 1VKXA 5D70L 1G7IA 3DXAA 4LAJH 2UYLB 2ITDA 3TA3A 4FFWC 1EEUA 4I4WB 5GSVB 3MRBB 4UTAL 4OZHF 3MRIA 5JPNA 2AABL 3SPVA 3AFLA 3D0VB 1GGBH 3PWPA 5CEZL 5IMOA 3WHXA 4JZJA 1NCTA 5E1AB 5FCUH 4EIZC 1CR9H 1CFQB 2VIRA 5F7LB 1PYWA 4I0KA 1I1CA 4G8GA 1CXLA 5GSRB 5J8OA 3X3FH 4EXPX 3QUMB 3QXDA 5E6IC 3VXQA 3Q1SL 3VFTB 1QO3B 1MFDH 5D2LE 3S5LG 4MJ5A 5D1QC 5F88A 5J6GB 5D9SA 5EU7C 3EYSH 4WCYH 1AH1A 1MFEL 3HRPA 4LCWB 1H3VA 4HIJA 3Q6GH 5HPMA 2W60B 5TDNA 3OKEB 4JKMA 4HMDA 2YKLH 3MXVL 3EO1B 4JO4H 3C5SB 3STZB 1QLRB 1G6RA 1TZIA 2YC1A 1JK8B 3CLFH 2IH3B 4MJ4A 1A22B 1E4KA 1HHHA 5T33H 3KPSB 1IQWH 2ZNWA 4N1EA 1I1AA 3Q0HA 5F70A 1P4BH 5L7XL 5GS2H 1IAOB 1AD0B 4HS8L 4CGTA 4ZTPH 1N64H 5L88H 4YR6B 1L0YA 4PYGA 1WBYB 2IF7A 4NKMA 5FHBH 5HGDA 4LLAA 5JNYA 1HHIB 4I48A 2ZZUT 5ILTL 3MRRA 2F54D 5AYUL 4L4VA 2NNAB 4X80L 4PTUB 4QY8A 1UXSA 4NFDA 1T0MB 3QAZC 4RRPA 3GBNL 4UTBH 3I02A 2FR4B 4GRLB 4O9HL 2MCPL 1JUFB 5FYKE 5K9QG 4I5BA 3JWDL 1N0XH 3BQUD 5D2LB 4JRXE 4Z5RB 3O81A 15C8H 4LHQB 4ZNEE 1KV3A 5D70H 3BD3A 4UNTA 3EO0B 2HJFA 4LHUD 4N8VG 5CP3H 4Y4KB 4PLKD 4LRIA 2NY2B 1J05A 4JRWA 3MREA 1OQOA 2E9WA 2PUQT 4UT9L 3C09B 2PO6B 1AXIB 4JHAL 4U3HA 4RZCB 3SDDC 4NQCE 4KHXL 5IB1A 5DJCB 3PQYD 2AABH 3INUL 5SWSB 5DUBB 4YJZL 1BEYL 5CEZH 1ERNA 3TBTB 2P5WD 3DV6A 3DRTB 2V5TA 4C58B 1OVZA 4MNGB 4LKCA 4CVXB 3LY6A 2E8YA 1LDSA 1AR1C 1K2DA 3Q1SH 4KXZH 3QCUL 4EDWL 1CBVL 5DFVC 3IXAA 5BOZG 3SGKC 4HZAA 5BS0B 5F7EH 1MFEH 4MQXD 2VDQH 3B9KB 4XRCA 5F7UA 3VGBA 4HHAB 4X99A 5JA8B 2Q76A 4PTTB 5DJXA 2A83B 4WFHE 3BH8A 5K9JL 1T22A 3MXVH 3C5ZD 4OCRL 1UWXK 1DQML 5T1LD 4NFCA 1OTTD 2ATKB 3L5WB 3FN3A 4V2BA 4JRXB 1ZGLB 4YDLC 3VGFA 2O5XL 3EO9L 3BO8B 5D7SH 3MACL 2ARJB 4PRHB 2N7AA 4JQXC 5L7XH 1FNFA 4HS8H 4KVNL 5DRZA 2CK0L 5ABDE 1F4HA 3VXNB 3MRHB 5DVOA 3U36B 3S5LB 4JFEB 4NQCB 2I25N 1GGCL 1LE5B 1QSEB 4JJHA 1Q9LB 4CJ1A 1YMHA 4GQPH 4OCYL 4E0RB 5ILTH 4LLMB 4R2GB 2BERA 1HXYB 5AYUH 2QL1A 5DJAB 4FTVD 4X80H 2M26A 4MQSB 5IKCB 2PW2A 3D6GA 3GBNH 4LLWB 3VXTB 5J11B 4O9HH 2MCPH 3JWDH 2VISA 4OB5L 3AGVA 3PNWB 3ARED 4XPGL 4HPOL 3UYPA 5E2TL 1N0LA 2E7LA 1OD9A 1CF8L 3O11A 3BEVB 2CLVB 3LCYA 4UT9H 3SDAC 4JHAH 3MR9A 4KHXH 4P2OD 4HAFA 3WIHA 4HH9B 3INUH 1JF1B 2AK1L 1W8OA 1GOHA 3S96B 1FVDA 3VXSD 5BJTA 2OQJA 1LO0L 3MA7A 4NWTL 4XPBL 5SX5K 3OKDB 2HTLC 1TITA 5F8RC 4MCZA 4TUOB 1K85A 2AXGB 1G7MA 4M61A 5J89A 1UJTA 1WWCA 4UT7H 5JPMA 3BPNB 4KRMB 3D9AL 4XP4L 3QCUH 3UZQA 4EDWH 1CBVH 4K9EC 2AEPL 2XYCA 3MV7E 4N8VB 4P2RD 4HGMA 1U93B 3FQRA 3DGCR 2X4TB 2PYFA 3AS2A 5K9JH 3PWLA 3N1FC 1BZ7B 4OCRH 5KOMC 1DQMH 3BI9X 3W2DL 4OZIB 4NN6C 2FWOA 1G7QA 1FIEA 1WCBA 2O5XH 3EO9H 1RUKL 1S7QA 3HE6C 4LK4A 2NY1B 5HBBA 2C3WA 1TIUA 3MACH 2MHAB 1JRHI 3ULVF 4I0PB 5F6IC 4P23B 4KVNH 5INDB 2CK0H 4EEEA 1ZWIA 4Y5YA 4CADB 4HULB 4K8RD 2DMKA 1A9EA 1GGCH 4Z7QF 1IM3B 4JVUA 4KI1A 4OCYH 2ESVD 1OTSD 3ZT5A 4PFEA 1FN4B 1U8LA 2NX5A 3F58L 5CSZB 1RI8A 4CNIB 3CFKB 4A2MA 2IMMA 4XPGH 4HPOH 5E2TH 2Y1VA 2GSGA 5ID1B 2PW1A 1CXKA 1NGQL 5F1NB 4FQCL 1CF8H 5D4QA 1YYLH 1BVZA 3I50L 2WM0A 2Z31B 2OBGA 3HLAB 4MD4A 3V4VL 1JBJA 4MA7L 4EN3C 5IJKC 5HTSA 2R39A 5DK2A 2AK4A 5B8CC 2AK1H 1R3LB 2YXMA 3I84A 4MA1C 4PGCA 5D96C 2ILLA 1LO0H 2YA2A 4PB9L 3JTTB 2VDKL 4UINL 4NWTH 4PP2B 4WHYG 5HYJE 1KCVL 3RL2B 4D2NA 1I8LC 3E6HA 3I6LD 4HWUA 3WNPA 2AAVA 3PWUA 4E5XA 5CLTA 3SE9L 3D9AH 2R4RL 1MEXL 4M8VA 4XP4H 4P5KB 1KIRB 1HH9B 2ARJQ 3L3DA 1WZLA 3LPGA 3MLSL 1QSFB 2E7CA 4YXHL 4HG4K 1KIQB 3L7FA 4M1GL 3WKNA 2JB5L 3BQUC 3LH2L 5GGUA 1LE9A 2DQGL 5I8CA 4GLRH 5B3JE 4LBEB 3W0WD 1B88A 1J8HA 4PLKC 4L8BA 4X4ZA 4PLOB 4WHCA 3P9MB 4JAMA 3W2DH 1XGTA 4OCNC 1RUQL 3WS6C 2D4FA 2LAAA 1I4FB 1KJ3L 3UJTL 3Q6FA 3V4UH 1U92A 1RUKH 4MVBD 4HXBL 4NGHL 4GG8B 5LGJB 4U7KA 5DD3L 3LEXB 2G2RA 5J12C 2V7HA 1X44A 1EMTL 4PD4J 5B39G 5C0AE 5D1ZD 1Q9KA 3D25B 3WEXB 5MENA 1MI5E 4P3WA 4FQXA 3VFSB 3LKQA 5HYJB 3DBXA 4LVEA 3K7UA 2HG5B 3DIFB 4MQXC 4V1DA 5FIEA 5C3LD 5GPRA 2Q7NA 2R1YA 3F58H 1B9ZA 4QRPE 5MEQB 2GEEA 4LSPL 4MD5A 3EYVA 5EO9B 5DEGB 4C57C 3EBAA 4WWKA 4EVNA 1NUGA 3OXSA 3C5ZC 2CIIB 3FONA 3CAFA 1UB5A 2O93L 2VRAA 1NGQH 1OTTC 5EOCL 3DVNA 4GKNA 4FQCH 3UBXG 3B3IB 3CFJA 3HPJB 1BVLA 5DK0B 3I50H 5JIKA 1RJYB 1Q9OA 3HPLA 1X5XA 1WFNA 3T77B 3T1FB 1WBZB 4N0YL 3QFDA 3V4VH 5E5UB 1GXEA 4MA7H 5F7DB 4XTRD 3LKOB 3O6LL 3SY0B 3QUXA 4PB9H 4UINH 4N5UA 1KCVH 1BD2B 4HCRA 2CKBA 5IV2A 5MI0B 5EBMA 3ISWA 3HS0A 3SE9H 4TTDD 2R4RH 1MEXH 4K7FB 1HHJB 1ZGLM 4MJ6A 3MLSH 3UTSA 4YXHH 1QR1A 5AUMA 1MI5B 5E0QA 4LLUB 3HZYA 4LLVA 3ARSA 3AREC 3LH2H 1CDYA 3EHBD 3PJSA 4N90D 2DQGH 3W5NA 3CH1A 1HHKB 2A73A 3MLXL 2HVKA 2DI9A 3BIKB 3K2MC 1F97A 2V6HA 3V5KA 3VD9A 1QBAA 1RUQH 4JGUA 4UV7H 3EIFA 3H9SB 4JG1H 3MV8D 4YHNA 4P2OC 1M7IA 2BNRB 1KJ3H 4X6FA 3MC0A 3UJTH 4HXBH 4NGHH 1U8PB 5FXCH 3S3SA 1YEKL 4GMTL 1GJIA 3GMPB 5DD3H 3TNNA 1P4LA 1EMTH 3PL6A 1ZA3A 1I9RL 3CSYA 4UMGA 1WGOA 5F97E 5TPWL 5D7JA 1HN1A 4JFXA 1MHHA 1F11B 2AKRA 3VFWA 2G9HB 3GSWB 4TVPE 3C60D 3GMNA 4JY4A 4OLUL 1RJLB 3ARVA 1R3IL 1BMGA 2QSQA 3MJ7A 2GTWA 4LSPH 3MLTA 4TSCL 3VU2A 1D9KA 1KNOA 3ZO0A 3SCMA 2CQVA 4PJ7E 5CBAA 4X9IA 4PIRF 3C6LA 1MFCL 5EOCH 2NY6B 3ARDA 3KLAB 2ITCB 3PWJA 2XIDA 1ZVHA 2X70A 3P77A 2P43B 3GEWB 2X1WL 3ET9F 3P73A 2DLGA 2EC9T 2O5YH 3B9EA 5B39B 4NRYB 4N0YH 1KJMA 2KQNA 2YUXA 2ICCA 4JFPB 2XA8L 3O6LH 4K8RC 4HUNB 1FAIL 4NP4L 3TA3D 4KAQL 1UB6B 3SE3C 5C07A 5C0IB 4H26B 2DQJL 3SGJA 3N1PC 3U4AA 4TVPL 3ZDXE 2XRAL 3VG0L 4LL9A 4PJ5B 4HJJL 1MRFL 1TJGH 5CJXA 3PWPD 1LEIA 2R56L 4YHLL 4RMWA 2EE2A 5I19L 3P3YA 3SDCB 4K23L 4G8GD 1XR9A 4PRIE 4WHYH 5E4EC 1NEZG 1DLHB 1XR8B 1R5IB 5IR1B 1FORL 1FLTX 2BVYA 3OAYH 3MLXH 4PJDE 4N8CL 3HI6L 4AIOA 3ARFA 4LEOB 5AYQA 4ZSOE 2HAZA 1ZLSL 5JOFA 1TQBC 4ETQA 2D31B 1URLA 1EZVY 1BOYA 1VADB 3KXFB 1JZ3A 4O2EB 1INQA 1MCSA 2R9HD 1YEKH 1CT8B 1G7LB 4GMTH 3RUGE 4DCQB 3SE4A 2XWBA 1AXSB 1I9RH 4M9OA 3QPQD 3B5TA 5HDBF 5TPWH 4UUJB 5TQ0L 1YDPB 1I1AD 3O45B 3HHRB 4OLUH 2H8PA 2DBJA 2EDOA 1R3IH 1IGYB 4WUUE 5MERB 4QRTB 1UEYA 4DN3L 4TSCH 4L3CA 5GRZA 1NBYA 4XVSL 3DTXB 4MNQE 4NFBA 1MFCH 4FXGB 3V0VA 4CMMA 1D5BB 5DVNA 3NZ8B 2A0LC 4Y19A 4PRIB 1G7JB 4JCMA 2Q86B 3O41A 4MVBC 3QJFA 4U6XB 5A2FA 1HWGB 2X9YA 5BZDB 2C7UB 3S3PA 1NGYB 1ITBB 1OHQA 4YK4B 5D1ZC 4NP4H 1FAIH 4KAQH 4HIIB 4QKXB 4ZSOB 3V4PL 2NY3B 4P2QA 3B8YA 1AGCB 2DQJH 3BN3B 2NTFA 4TVPH 3MRGA 3MZGB 2P8MA 2XRAH 2FYYB 3OX8A 3VG0H 4ONHA 2GSIA 2V5RA 4HJJH 4XNXL 1MRFH 1F3DH 2N4IA 4NCC2 4U1NA 3RWFA 4L3EA 4YHLH 4HIHB 4ERSL 5I19H 3UTTE 2OJEA 1T04B 4K23H 4JFHE 3ZKXC 3CFDB 3I6GA 1I7ZB 5JLZB 3WJLA 1NCNA 3RWIA 1LO2L 3AY4A 1F3RB 1FORH 1S5IL 4WUUB 1I1YA 3JXAA 5C92A 1B0RA 3CD4A 3L3IB 3HI6H 3RVWD 7CGTA 2P47B 4NZUH 2UYLA 2Z35B 1ZLSH 4BYHA 3LHPL 4MNQB 5CD3B 3BPOB 4HBQA 4XTRC 4I4WA 5GSVA 3MRBA 3MROB 1VHPA 1LNUB 3J8F7 4FQPA 3D0VA 1YC8A 1RMFL 5IMMB 5SX4I 5CJ8A 3KYNB 2Z92B 4TTDC 5TQ0H 2VSCA 4ZOBA 5E1AA 4S0SD 1NEZB 5FOBB 5GSRA 4PREB 3QUMA 2YBRB 3EHBC 1QO3A 5HY9B 4DN3H 3ULVD 4NNPL 5BOPA 1MCWW 1FZKB 5J6GA 5J1TC 5EU3B 4LCWA 3ZE0F 4XVSH 4XXDA 2NPLX 2W60A 1P6FA 4RGMC 3UTTB 4NRXA 3CDGB 3OKEA 4C56B 4FQHB 1KGCD 1AGBB 5DQDL 3SO5A 3EO1A 3C5SA 5DHXB 3CVHL 3STZA 1S7TB 5EDXA 1B4RA 1QLRA 4PRNB 2ADIB 1J5OL 1JK8A 4N1CA 1XGQA 2IH3A 3S35L 4BFGA 3V4PH 3VXPB 3KPNA 3SGEI 1O0VA 1ZXQA 3DO7B 5IFJA 3CVHB 1IAOA 4OUUB 5GGVL 4X6DE 1OLZA 3T3MF 3P2TA 3C60C 4OT1L 4YR6A 1T20B 1WBYA 4R96B 4TN9A 3WL9B 4J3WA 4XNXH 1H8OA 2OXGA 3DUUB 1BFSA 1B0GB 1RUML 2DQDL 2NNAA 1OAKL 1NCWL 1LO2H 4HUKB 4LCIL 4M00A 3BZFB 2FR4A 1S5IH 4GRLA 1JUFA 3ZHKA 4ZYKB 2DM2A 3CFEB 4EQ3A 2PTTB 5DD5L 5D2LA 2IPTL 4G9FB 3S7GA 3N1GC 5F7NC 1NAML 3EO0A 3NA4A 5E8OB 1DQQB 3QEHB 3LHPH 4Y4KA 2V5MA 4OTXL 4RFOL 4QXTB 2EEBA 3JWOC 1CE1L 4N0RA 5IHZB 2J12B 4RZCA 2E27L 2XTJD 2YA0A 4W81A 1NAMB 1ES0B 5DUBA 4PGJA 1RMFH 4G6AD 3ORJA 4X4ME 1MJ7L 3TBTA 3FN0L 3WO3B 4TULL 3DRTA 4J4PA 4F3FB 1CS6A 1XGYL 3PHSA 3R4DA 4LSQL 1YEDB 3ZDZE 3QFJB 1EEYB 2YPKB 1NCBL 1F90L 3RKPA 2ZCHL 4JANB 4KMTL 4NNPH 3BT2L 1C7SA 1KT2B 5JHDE 3B9KA 4P99A 4HHAA 3NGBB 5IEKB 4J3SA 2A83A 2NX5D 5DQDH 3E3QE 4ZFOA 4ZAKB 3CVHH 3UO1L 2I9TB 1U36A 4F7EB 5C6WH 2R9HC 1J5OH 4JRXA 1ZGLA 4DOHB 4ZNEA 1AO7E 3BO8A 3QPQC 4Z0BL 4HUUB 4PRHA 1E4KC 1O7VA 1T89A 3ZDYF 5GGVH 1I1AC 2WSKA 2G60L 4L1HA 3D39E 4OT1H 3VXNA 3MRHA 3U36A 3S5LA 4JFEA 4PJEE 4NQCA 1GYAA 2AK4D 1LE5A 3EUUA 1CFVL 5BXFB 1QHPA 1FBIL 4KXZI 4BM7A 1Q9LA 1IGFL 4E0RA 4NUGL 4LLMA 1RUMH 1HXYA 5DJAA 3MRMB 5D2LF 1H0DB 1OAKH 4U2ZA 5IKCA 1NCWH 1OY3B 4DK6A 1MCLA 4LLWA 2DN7A 3VXTA 1U8QB 5F3HB 3SO3B 4B7LA 1QFPA 3PNWA 5DD5H 1QUNA 1VEPA 4AIZA 2IPTH 4PY7B 4KI5D 4NOFA 1KLGB 3BWAB 5JHDB 1NAMH 3BEVA 4XP1L 4OTXH 4RFOH 5GS0L 2K7QA 2WBWB 1J8HD 1CE1H 2E27H 5C0ND 2CO6B 1JF1A 3QUZB 3JVGC 3S96A 4DKAA 1MJ7H 1AO7B 3FN0H 4TULH 3OKDA 1T83C 1XGYH 4LSQH 4TUOA 5E2WL 1UKSA 2N7BA 3HC4L 4JFFD 1NCBH 1PW3A 3U9PL 1F90H 4FNLL 3EJZD 5MEND 2ZCHH 4KMTH 3FB7B 3KPMB 3BT2H 5J1AA 1PY9A 5CKAA 5TH2A 1I7TB 5GQBA 4WU5B 4N8VA 2WWKT 1JNNL 1U93A 2PKDA 4G80B 3RVWC 1HXMB 3HC3L 2X4TA 4ZXBB 1ZT1B 5IEHB 2GUOB 1BZ7A 3MCLL 3PIQB 4HKXB 3CSGA 5JOPD 2VYRE 1AY1L 3UO1H 4OZIA 4HF5L 1PZ5B 3E8UL 2FJFB 2ED9A 3MO1B 5BZWB 4ZOAA 4M5YL 4AY0A 3HMWH 4CBPA 1VFAB 2CPCA 3V6ZB 2CRYA 2MHAA 4Z0BH 1KN4L 4I0PA 3DJ9A 3ECBB 5A43C 2EKSB 2G60H 3VRLE 2A77L 3MJGX 4G42B 3CSPA 3MBEB 1IM3A 1CFVH 1WBXB 3QUXD 1FBIH 3RWJA 2AJXL 2BHUA 1IGFH 1N6VA 2V7NB 1WUNT 1S9VB 3JV6B 4NUGH 3ULVC 1TVDA 2FH8A 1FFRA 5I71B 3T2NL 5L8JB 5CSZA 4JEGB 2FSEB 3U4EB 4WO4D 1DDHB 2VAAB 3CFKA 1PG7W 4NUJB 2H41A 1R24B 4G6ML 4Q58C 2YWYA 5ID1A 4DUWA 5EBLB 2EDFA 5F1NA 4GS7C 3NIFF 2M2DA 2FCBA 2VLJE 5D7KE 2E7LC 4M8QA 2DJUA 4XP1H 3G6JE 1Q9WB 1OD7A 4XCEA 4BFEA 2ZKHL 5IVZB 3HLAA 5ALCL 3TZVB 4ODTL 3LVEA 2EDWA 1QSVA 4R26L 5EC1B 3K1KC 3MLVL 4JG0L 1QP1A 3JTTA 5DR5L 2OTUA 4PP2A 3GSRA 3UTPE 4U7SA 4NDMA 4WTZG 3EFFB 5E2WH 4F15C 3DMMA 5J9PB 1SMAA 3U9PH 3LKPB 1G0XA 3D87B 4LPUA 2IFGA 4P5KA 1YNTA 3WFDL 1HH9A 5C86A 3D3VB 3BGAA 4KRNA 5LWYL 5D7JD 1QSFA 1MELA 1XZ0B 1TVHB 4HUWB 4LPCA 3EOBA 3U46A 1JNNH 4OZIF 3VFPB 3HC3H 1EO7A 1MSPA 2XACC 5EULV 2XQBL 1CGYA 2VDRL 3MCLH 1YECL 2GJ6E 1D9KD 4LBEA 1MCJA 3V9FA 5ENWA 1AY1H 1J0JA 3P9MA 4P49A 1T1YA 2H2SD 4HF5H 4RA0C 1I4FA 3E8UH 4L8SB 5GIRB 5K9QI 3ARDD 4M5YH 3K2UL 4O2CA 1E6OH 1UM5L 3SDXE 3KNBA 4GG8A 4G6AC 1D6VH 1KN4H 4OAWB 4FABL 5LGJA 4U1SB 2J8HA 4LOUD 1HZHL 4QTHB 3LEXA 1KFAL 3C9NB 2I60L 2A77H 4R9HA 5ESAB 4U6VL 4F9LC 3T8XB 3RIAK 4QNPE 3D25A 4NQEE 3WEXA 1KJ2L 2AJXH 3AVEA 4U1GB 5GGQL 5C07D 5CHNA 4ODSL 3VFSA 4F37K 2G75B 5HYJA 2DTSA 3O2VL 2HG5A 3DIFA 1GRWA 4LRNL 1AGEB 4RWHA 3MRNA 5SV3A 5MEQA 4EKXA 2V2XB 1RY7B 1RZIB 5EO9A 5DEGA 4GLRI 5DJ8A 1FC1A 5KSAD 4G6MH 2CIIA 4UNUA 2XA3A 1NFIB 1DEEA 3B3IA 3HPJA 4XCYB 3V7AE 5DK0A 2LTQC 3OR6B 2OK0L 1RJYA 3T4YB 2ZKHH 1J0IA 1WBZA 4QXUL 5ALCH 3REWB 3MUHL 4Y16D 3RX5A 4NN5C 3ARFD 4Z76B 2EH7L 4ODTH 3VA2C 4Y1AB 3QH3A 3IRZA 4IHOB 5F7DA 5I75C 4R26H 3CFIC 3LKOA 4JG0H 3IDNA 2PF6A 5DR5H 3QJHB 4PS4L 1BD2A 3OJVC 3WLBB 2Q6WB 4NBXB 1IAMA 2R1XA 4LPVA 1EX0A 2EE3A 4TYUA 5C0AA 4K7FA 2ICEA 1KLFA 3WFDH 3L3OA 1HHJA 5LWYH 1KCSL 3RU8L 1BECA 1MI5A 4YAQB 3MRPA 3OB0H 2APBA 3RI5K 4I9WE 4KI5C 1MCOL 3FT3B 4QTIL 5C0BE 2YPLE 4NO0B 2VDRH 1YECH 1HHKA 4LQFL 1TQCC 4R6UA 3BIKA 1G1CA 1U2CA 1MVFA 3FQUB 3H9SA 4YHZL 1RSFA 5EIVA 2QQLH 4NQTA 3RIAF 5C0NC 2GHWB 5MEPB 4Y19D 3KLDA 3K2UH 2W9DL 1UM5H 4FABH 4Y4FB 3I6KB 2GAZA 2OSLB 3GMPA 3OAYK 1KFAH 1C16B 5EZLB 3DV4B 2I60H 3GDBA 3KHQA 3QCVL 4J12A 3Q3GA 4XBEL 2GJZA 1FYTE 4HAGA 2X4PA 5GGQH 2VWEE 5DZOA 2CGRL 1F11A 1ZHKB 3MCKB 4PJXE 2G9HA 4NQDB 3GSWA 4ODSH 4P2QD 5CEYB 3BP6A 3O2VH 5A2IH 3KLHD 4Y5VB 5JIIA 1RJLA 4LRNH 4PJGE 2CXKA 2VABB 2NXZD 1UJ3C 3DHMA 5FYLL 1BQSA 4L3ED 2IH1B 4QHMB 4BFIA 1JPGB 2Q7YA 1AKJB 2P45B 2NYYD 2NZ9D 5GS2D 1RK0B 2CDFA 3KLAA 4XH2A 2FO4B 3L5XL 1O7SA 3GSNA 2YMXL 4CVZA 2OK0H 2YPLB 5ACLA 3S98A 5B39A 4NRYA 3FAWA 4QXUH 1F45A 2EH7H 2NMSA 2FZ3B 4BH8B 5DRNB 1OAQL 1UB6A 5E4IA 1LVEA 4PS4H 1CGWA 3QUXC 5C0IA 3PF2A 4H26A 3VD7A 1CL7L 3L3GB 3QXAA 1MWAL 4H0HB 3T2PA 3WFHA 3RI5F 2NLJB 4PJ5A 2EDBA 1DJSA 3IFOB 5J7CC 4WTXA 2GTZB 1KCSH 2XTLA 2AW2A 3RU8H 1UEMA 4WO4C 1QZ1A 3SDCA 3DRQB 1G1YA 4PJXB 1MCOH 2FBOJ 1VGEL 1XR8A 4QTIH 1R5IA 1ZOXA 3NIGE 5IR1A 4PJGB 4YC2B 4NT6B 1YEIL 4LQFH 1BBDH 1OWRM 3QA3B 1CXHA 5L2KE 3O4LE 4LCWD 1G84A 2VR5A 5FF6B 4LEOA 4PRAB 3WHE0 4YHZH 4DZBB 4RFEB 1Q94B 1NPUA 1VADA 2FL5A 3KXFA 2W9DH 4O2EA 1KPRB 3ALPA 3T08A 1CT8A 1G7LA 1A2YB 4NYLA 1K5NA 1NBZB 5EZIL 4I18B 1JGUL 1J1PL 3QCVH 4XBEH 1AXSA 4F8TA 1NC4B 3MRLB 3VXMB 1ZK9A 4L9LB 5JXAL 3VGHA 4OKDA 5MHSD 4OLEA 2CGRH 2BXZA 4AIXA 1N4XL 3OGCB 3O45A 5D7JC 5FA4B 3WKML 3WIFB 4GAFB 1OSZB 2NY5L 1IGYA 5DTFB 3BP7B 5MERA 1U8NB 5FYLH 5F1SA 4P9HL 1LEGB 2BY2A 1A0QL 4HD9A 1RJZB 4NKOA 4K94C 1D9KC 1D5MB 3LPWA 5EUKB 3DTXA 3IJHB 2EDXA 4HMEA 3NOIA 5CSGA 4RWYL 2H2SC 4FXGA 4G8EA 3MV01 1D5BA 3NZ8A 4Y2DB 3L5XH 4PRIA 3AB0C 1G7JA 4GRLD 3ARDC 2Q86A 3RKDD 2YMXH 5DD0L 3FJTA 4O02L 5BZDA 2C7UA 3EYFB 4EBQL 5L2KB 4LOUC 1NGYA 1A7BA 3VRIA 1EHLL 4N5ED 2Z9TA 3BW9A 4PJDA 2P8LB 3FFDB 4Y4KD 3S4SG 5EZJB 4ZSOA 4Z8FL 5C2UB 2NY2D 5C2BL 1VGKB 4Y88A 5HYQB 3VH8G 4P0DA 2PO6D 1CL7H 5JMOC 43CAB 4YUEL 3RUGA 2FYYA 3SGJC 5GZOD 3MJ8A 4CN1A 5SWSD 3FO9B 3HR6A 4PGDB 5JW3L 4DTGL 4HIHA 3X14B 3C08L 1R5VA 3MNWB 4J4PD 3VCLB 5KSAC 5JLZA 1I7ZA 4YHOL 3DI3B 4Y89A 4GQ9H 1VGEH 4HWZB 2QSVA 4GAGL 1TENA 4WUUA 4ORGB 3RZCB 1YEIH 4ODVL 4QHUB 1K3ZA 4PY8I 5BS0D 5E03A 3L3IA 2HLAB 1ZT4B 4YGVA 4JM2B 3B9KD 1UKQA 2VDNL 4Y16C 2Z35A 3ARFC 2YPVL 4MNQA 5CD3A 1JE6A 1X7QB 4Z7VB 3RJQB 2SEBB 4Z18A 2APTA 5IW6B 3FB6B 4GXUM 4YNYB 1XGUB 5CILL 5FYKD 1TFHA 4MLSA 5IWLA 5EZIH 1JGUH 1J1PH 1LNUA 4JRXD 3NZHL 4LNVA 1MJJB 3KYNA 5F9OL 5JXAH 3ZDXF 4JO1L 3RX7A 4PRHD 5AG9A 1N4XH 1NEZA 5FOBA 3WUZA 1P9MA 4PREA 3WKMH 3VI4E 5AG8A 2NY5H 1LMKA 1T21B 4JFED 2YBRA 4NQCD 4P9HH 4F7TB 1A0QH 1QSED 3GKWL 4AZ8A 1FZKA 3T0XA 4XNQA 1T7XA 5EU3A 2W9EH 3T0AA 4WGVB 4YE4H 4R2GD 1EGJL 1IZKA 3UTTA 4HFWB 4RWYH 4C56A 1I9JL 4FQHA 1AGBA 2VXQL 1U2HA 4OLZH 1INEL 2CH8A 5E94A 5DD0H 1OLLA 1S7TA 3IF1B 4O02H 5A1AA 5CGTA 4EBQH 1ONQB 4PRNA 2ADIA 3HE7B 1EHLH 3VFMB 3Q5TA 5L9DL 3CXHJ 1V3MA 2GY5A 1AI1L 4H8WL 2CUIA 4Z8FH 3DO7A 4WFHD 3PGFL 5C2BH 3DX8B 3GM8A 5HVHC 5GRVL 4NZDA 5FYJL 4YUEH 3WL9A 4LSRL 4FQLL 3GHBL 3BOVA 5JW3H 4OIAA 1UWGL 2NXZC 5JIPA 3DUUA 3C08H 1AC6A 1B0GA 5DC0A 2XPGB 3VD4A 2NYYC 4JCLA 4YHOH 2NZ9C 4KGLA 4TSAH 4GRWH 3WJJA 4QRRB 3BZFA 5TF1L 1EJ6A 3WJLC 3AY4C 4ZYKA 4ODVH 5IT2L 2C5DC 3CFEA 2PTTA 3BKYL 4ZMAT 3N50A 3S36L 5GGSY 2VDNH 1BQUA 3S4SB 2H6PB 2QQNL 5E8OA 1DQQA 3QEHA 4Y4HB 4EDXB 2HKFL 2YPVH 1NCCL 3KYMB 2Q3AA 3VH8B 4QXTA 3PGDB 4L3AA 4KK8D 4LMQE 4XP6L 1FZJA 4PG2A 5IHZA 1HWHB 3B2UC 4OV6F 4ELME 4UBDD 1DQJA 1U8IB 4KHTL 4NO3B 3JTSB 3RPIB 1VESA 1NAMA 3NZHH 1ES0A 3QIUA 2R1WA 2F74B 1I3GL 2CRZA 1DN2A 3DECA 5F9OH 2NY1D 1DANT 4JO1H 4OZ4B 4KKBD 4F3FA 4I0PD 4P23D 3RBGA 2BOBB 3PQYB 1YEDA 1MQ8A 1EEYA 1FZOB 2YPKA 5EFIB 4G43B 2COQA 4JANA 5FDWB 3GKWH 4GH7B 3O2WL 2EYRB 2DD8L 1KT2A 5CIPB 5HYFA 1QVOB 4ZPTB 3LQZB 1EGJH 5JZ7D 2XY2A 5IVXE 3K8KA 2B1HL 4JGMA 5IEKA 1U3JA 1I9JH 1O5DT 3RGVB 2VXQH 3UEZA 2MPAL 4KTDL 2EIEA 4WI6A 1INEH 4RNRB 5EU5B 1WK0A 4LPTA 4X4XB 4BSWB 4LSTH 2I9TA 4DKEL 1F4YL 3QDJB 1BWWA 1A9BB 4S1DD 5KVEL 1AI1H 4H8WH 2IAMA 1IM9B 1QBML 2IJ0C 4HUUA 2BMKA 3PGFH 2APFA 2Z31D 3PV6A 3L3KA 4CU8A 1QRNE 3C87A 5FYJH 3STLB 3OKYA 3LS4L 2A6DB 2L4OA 2LFGA 4LSRH 4FQLH 3CZJA 2C3XA 1N59B 5BXFA 4YHPA 3IFNL 3K0WA 1INDL 4I3GA 4M6AA 3AS0A 5TE4L 3GKZA 2Y7QA 3DMMD 1V7NL 3QIBA 5TF1H 5EOCJ 4KDWA 3P0GB 4GUPB 3GUTB 1JP5A 5IT2H 4GRLC 1QSFD 3BKYH 3CZFB 4MAUL 3RKDC 3S36H 5E24E 4PY7A 4P4KB 1KLGA 3BWAA 5JHDA 2I26N 3B8SA 3NCJL 4FQJH 2QQNH 5F9DC 5EUOE 1LO5B 5IVXB 2HKFH 1NCCH 2DICA 4JGJA 4N5EC 4LLDB 4DKDC 1A64A 5A3ID 1QFUL 4L8CB 3ARUA 4PG9B 4XP6H 4GBXC 2NY2C 1LILA 3JWDC 3C09C 3LKNB 4I3RL 1MCKA 2PO6C 4KHTH 5IFHH 3QUZA 5CP7B 3LDBB 1I3GH 4OF0A 5GZOC 4KMQA 1AO7A 5E9DB 2F8VA 3HUJE 1FIGL 3M1BB 5CIPH 2LVEA 2FBJL 4OM1L 5IIEB 4RGNE 1YQ2A 3IU4L 1DBKH 4J4PC 4N0UB 3ALWA 2EDDA 4MXWL 1QRNB 2R29L 1AJ7L 4R7NB 3FB7A 4MX7B 2VZ1A 3O2WH 5BRZE 2DD8H 4ZO8A 1HCFX 5HYJD 2F5AH 2E7MA 1I7TA 4WU5A 3S35X 4DQOL 3RTQB 1CDGA 3B9KC 4G80A 2ZOKB 1HXMA 5IEHA 1X6LA 2GUOA 1XF3B 2MPAH 4KTDH 1W0VB 3FOLB 3PIQA 3NFSL 3LRHA 1IC7L 2IBZX 3LAFA 4DKEH 1PZ5A 1F4YH 5I16B 5I1DB 3TPUB 5IB3B 4KVCL 1AFVL 1G9EA 5KVEH 3MO1A 4N68A 5BZWA 1XGRB 2QKIB 3X13B 1PY4A 1VFAA 2UUDH 1QBMH 1MCNA 5EUOB 2EECA 3ECBA 3FCTB 1AXTL 2EKSA 4X5WB 1LHZA 1T89C 4G42A 1EUTA 2W0FB 5GHWL 3MBEA 4JFQB 1WBXA 4QYOA 3IFNH 3ARTA 2V7NA 1INDH 1S9VA 1BD2D 5TE4H 3KVQA 4IMKA 3B2VL 2YRLA 4R2GC 4RGNB 1MAML 1V7NH 2FSEA 4P4RB 2NY4C 3U4EA 2AXJA 4KZDL 1I1RA 1DDHA 2VAAA 5J6HB 5J11C 1GZPB 4M9PA 4MAUH 1MI5D 5ISZE 5EBLA 3NCJH 3F12B 3T0DA 1JZ4A 1QFUH 3SQOL 3R1GL 2YUWA 5IVZA 5DZNA 4OFYA 1ITCA 4OBRA 4YDKL 3TZVA 3F7RA 4I3RH 3H9SD 4KWUA 4PRPE 2BNRD 5CEXB 5EC1A 4R0LA 1QFHA 5EIIB 1ZVSB 2MSPA 4ELKB 5FGRA 1F3DJ 5I66B 4OM1H 1M05A 5LGKA 1MLCB 3IU4H 3EFFA 4I0CC 3K81A 2DWDB 1ORSB 4LCCA 3LKPA 3O3BB 2R29H 3QZWG 4U05A 1AJ7H 1YZZA 2HA1A 3D3VA 3BPNC 4KDTA 1XZ0A 1TVHA 1T3FB 4HUWA 5LQBL 4DQOH 2QHRL 1U9KA 1X5KA 3VFPA 5DUPL 4NC2B 3QEUB 3QG7L 1HDMB 3P4LA 2B2XL 4DVBB 1IC7H 4QGTA 1A1NB 5FDYA 1FZMB 1QEWB 4APQB 5K9OB 3D48R 2XZAL 4KVCH 1AFVH 4X9HA 4L8SA 4AEIL 5GIRA 4GJTB 4DAGL 4UBDC 2NY6D 4Z78B 1Z9OA 2IQAB 3OB0K 5D1XB 5I1IL 4ONOA 1CFSA 1QFWL 4JFOB 3G6JA 2NY1C 2W92A 1AXTH 4DGVL 5FV1L 4KKBC 3C9NA 5ESAA 4P23C 1FE8L 3T8XA 2GT9B 1JZ7A 2W9LA 3QBTB 5GHWH 1UQSB 5FHAH 4ZFGL 5C08E 3RIFF 3TO4B 4JJ5B 2RFXA 4NZJA 4X7CC 2G75A 4EI5B 1EDQA 1JWSB 4G9DB 3B2VH 1MAMH 3RVVD 1IGIL 5JZ7C 4PJ5D 2V2XA 4KZDH 5BW7C 3QQ4B 1RZIA 4FXLA 5D7IE 4G6FB 1QKZH 4PRBB 3MRQB 1IC5L 3L3JA 3SDCD 3ULUE 4R7DB 4ZS7L 1HSBB 1HKLL 1YC7A 3CNKA 5FECB 5ESVB 1NFIA 2VITB 4TVPD 5C8JB 1X5IA 4XCYA 3RGHA 3SQOH 1CICB 2XV6B 3GFUA 4I8DA 3R1GH 5C0CB 3T4YA 1VPOL 1I8MA 2GQHA 3MRKB 4CMHB 4YDKH 3REWA 2GJ6A 3KPRE 4XCNB 1X4XA 2Z31C 4Z76A 1FQ9C 1IGCL 4HW6A 1ORQB 3KXFD 4DUVA 5D71L 4M5ZL 1KELH 3QJHA 4X7TB 2VLKE 4OI9A 3SDXA 2Z4QB 2Q6WA 1KB5B 1UGNA 1F3JB 3VI3F 2DQHL 2A74B 2H26B 3OKNA 2HKHL 3ILQC 2BHZA 1ND0B 5C08B 3FB5B 3VWKB 5LQBH 3TYGL 4RDQF 2QHRH 3ETBF 4OI7A 3FT3A 5DUPH 3I2CL 2GW5A 4HKBB 2QV2A 3QG7H 3QDGE 3KPPB 4PJIB 1WWWX 2B2XH 4QOKB 5A3IC 1WSST 5CINH 3D85B 1U8KA 3FQUA 3HTLX 2XZAH 4AEIH 3MNVB 5KSVB 5MEPA 4PRID 5I1IH 1V5JA 2GIYA 3MJ9A 1QFWH 3B5HA 1R6VA 4Y4FA 3I6KA 3RVXD 4DGVH 1C16A 3QZWB 3DV4A 4MD0A 1FE8H 1MUJB 3OZ9L 2D4DA 3Q2CA 3QYCA 3KPRB 3MOQA 1KTRL 4JQIL 3S6CA 1QNZL 2B39A 5TGBB 3O8XB 4RRPG 2LABA 4ZFGH 4OQTH 4YZFE 3MCKA 1ZHKA 2NY3D 4NQDA 5CEYA 4Y5VA 1N26A 3HC0A 3KYOB 4WW2C 1IGIH 4GW5B 2VABA 1MREL 1DVFB 1B2WL 3R06B 4QHMA 1C12B 1CDIA 1AKJA 4ZS7H 1FDLL 4ISVB 1HKLH 5GXBB 3OQ3B 4UDUB 2FO4A 4QLRA 4WFED 2ZG2A 1CGSL 4WUUD 2PN5A 1I7UB 5C0BA 2YPLA 1WZKA 1VPOH 1Q1JL 2UZXB 1KB5H 5I0DA 1U8OB 1OAUL 5C3TA 2FZ3A 4BH8A 5DRNA 1L9NA 3BUYA 2ORBL 1IGCH 4MNQD 4MMZC 2OP4L 5D71H 4M5ZH 1W0WA 1WC7A 2WBJB 5HD8D 3QDME 5JW4M 1WZ1H 1YMME 4JREB 4OM0L 3RWGB 1G7IB 5ANME 3DXAB 2VO5A 1MFNA 3FRUB 4L5FL 2NLJA 5MI0C 2DQHH 3TA3B 2BFVH 3IFOA 2YRZA 3PDGA 2GTZA 2HKHH 4PJAE 1KC5L 5I1GL 3CH8A 3TYGH 4PJXA 4DGIL 2EC8A 3F6LA 4GRMB 2H45A 1PEWA 5DFWH 3U30B 4LASH 4KJQD 3I2CH 4PJGA 1J11A 2DRUA 3WHXB 4NT6A 4JZJB 1GOFA 4JPWL 2ICWA 5EA0H 1PYWB 3GMRB 2BVUA 4OJFL 2ZPKL 3QXDB 3UMTA 5FF6A 4WEMB 1LDPH 3L5HA 4DZBA 3UTTD 4RFEA 1Q94A 3TIEB 4MCYB 4C56D 2R23B 3DO3A 1FSKB 5FYJU 4QHKI 4MJ5B 5F88B 3GK8L 1G6RL 3BVNB 4X8JB 2ZOLB 1A2YA 4BZYA 2X44D 1NBZA 4KKCD 3OZ9H 4CN6A 3KJ4C 1ADQA 1NC4A 3MRLA 4JQIH 4BUHA 1QNZH 1EJOL 4HDIB 4L9LA 3VXMA 3OJ2C 4MB5A 2JB6B 1G6RB 1MNUL 3OGCA 5FA4A 3QDMB 1DBBL 1YMMB 2RHEA 2YC1B 1A4KB 5LGHL 1OSZA 5HDOA 5DTFA 3GSVA 3BP7A 4XHQA 1MREH 2VZSA 5C09E 1HHHB 1U8NA 1RQ5A 1LEGA 1B2WH 3BJ91 4OV5A 1KCRL 2JJTA 1ZVYA 5DI8B 1D5MA 1FDLH 5HHME 4PJAB 5EUKA 1DTUA 3IJHA 5FK9B 1PVHA 1KG0B 1H3PL 4Y2DA 1KIUA 5HGDB 1CGSH 5JNYB 2NY6C 2VKXA 4WEBL 4QGYA 3VMPA 1Q1JH 3MRRB 1CD0A 3EYFA 4F7CB 3BJLA 4L4VB 1OAUH 5L2KA 1OSPL 2OL3L 3A0OA 3O4LA 4G9FD 3BUTA 4AT6A 2P8LA 3FFDA 2BCKA 1EBPA 2ORBH 2LV4A 2OP4H 1CQYA 3VXRE 1IJ9A 3U0TB 1VGKA 5HYQA 5TDOA 4OM0H 2MQ0A 43CAA 1PZUB 2OL3B 4L5FH 1E28B 2V9RA 3FO9A 4PJXF 3RVVC 4J1UA 5BO1L 5FKAB 5EB9A 4PJGF 3X14A 1D5ZB 1KC5H 2AEQL 5D7LE 3RQ3A 4W4NA 3WLWD 5I1GH 4OSUL 3SDCC 3PWVA 3QFJD 4KDVA 4BH7B 1KEML 5DC9B 4OF6A 3MGTA 4YPGB 2EXYD 2WUBL 4ORGA 4XCFL 3RZCA 4JPWH 3LD8B 4OJFH 1ZT4A 4JM2A 2ZPKH 3SE8L 2CRIA 1L6XA 2AXFB 4OKVA 1AGDB 3O4OB 3EDKA 4U3XA 3IXAB 3GK8H 3FB6A 1G6RH 2HT2C 4YNYA 4ZAKD 1IILE 1XGUA 2CDGB 1WAAE 1EK3A 3LRSB 5ADOH 1CL7I 4MJIE 5EWIL 5ICXA 4MXVF 4GG6B 1T22B 1EJOH 1MJJA 1T7YA 1CQKA 2FECL 2NW3B 2P5EE 5F3BA 1MNUH 4R90L 1AHWB 1DBBH 1CU4L 2YD4A 5LGHH 3ZE1E 5DGRA 4Q6IA 2VOTA 4F7TA 4DEPB 1Z3GL 1KCRH 4OFKA 1X5YA 3WDHA 1NGPL 2BY1A 2CUHA 4I1NB 5DRZB 2GY7B 4HFWA 5D7LB 4HIEB 1H3PH 4JRYE 2D9QB 4FFVD 5HYSA 4WEBH 4OLYL 1L7TL 4R3SB 3IF1A 5H8DA 3CU7A 5CZVL 2OL3H 2WINB 3RVXC 2M8XA 5JHDD 3MV9E 2XZCL 2PW2B 1JTOA 3CX5K 3DVGB 4GSDL 1UVQB 2FJGB 3VFMA 4XNYL 4YK4C 1CLYL 1DBJL 2VISB 1II4E 1SHMA 3U6RB 3DX8A 2R0LL 5EU7E 3DROB 2NY3C 2YA1A 2MJWA 5HHPB 1HKFA 3BMVA 2ATPB 2Y23A 5INCA 3QUZD 1QRKA 1RZ8B 4P59H 1XEDA 4YHYB 5BO1H 1AO7D 1DQDL 4YO0B 3U7AA 1U6AL 2XPGA 1MQKL 3FAXA 2IBBA 4OSUH 3H9YA 1MCRA 2DAVA 4JM2F 1P84K 4QRRA 3B9AA 1K8DB 4HUXA 5KVDL 2PYEE 2AQ3A 2WUBH 4XCFH 2CSPA 4Z7VF 2FIKB 1JHTB 3QXVA 3OKKA 4MCZB 1QPPA 3SE8H 4FZEL 4TQEH 2H6PA 5JPMB 3RVUD 4Y4HA 5DO2C 4ZXBD 4J6RL 3KYMA 3VH8A 1X6NA 4JY6B 4JRYB 3PGDA 5FKPB 5GGTA 3BPOC 4OGZA 1JGEB 4EIGB 5HD8C 5CD5D 3FQRB 1EXUB 1F4XL 3DOSA 3JTSA 4XBPB 2PYFB 3RPIA 5EWIH 2F74A 4B41A 1NSNH 4LVHB 4P2CG 4R90H 2W59A 4AEHL 1S9YB 2AJ3B 3QIWB 1CU4H 1EHAA 1P9MC 1FZOA 5KS9E 4TUJB 1S7QB 4G43A 3H7BB 2GKIA 3MBED 1Z3GH 3T65B 4U4BA 4YHML 4KJQC 4ALAL 3SKOA 2EYRA 2HJKB 1NGPH 4PB0L 5CIPA 1QVOA 2W91A 4ZPTA 5FAAA 4XP9L 5HJ3A 3AM8A 1NGXB 3ROOB 2FHBA 3OJDB 5EOTB 2WNGA 4OLYH 4RNRA 4Z7OF 1L7TH 4I3SL 3RZWA 5EU5A 4X0KB 4X4XA 4BSWA 5CZVH 2V2WB 1PKQE 1YN6B 3QDJA 2Q8AH 2X05A 2OZ4A 3U1SL 2XZCH 2K7PA 4GSDH 1A9BA 4M3KB 4DFHA 4KKCC 4XNYH 5E8PB 4QHNB 1CLYH 2P7TB 1DBJH 1IM9A 2BXYA 4PJCE 3RY6A 2YD9A 2R0LH 4OFYD 2XQYG 3TZVD 5ERWB 1H8NA 3STLA 3ZTNH 2C3HA 2A6DA 3CUPB 1N59A 2J8UE 1DQDH 1U6AH 2UUDK 5J57B 1MQKH 4JKKA 2DKSA 4UV4L 5DWUL 5DK2B 1M4KA 3P30L 3K4AA 5KVDH 1ZA6A 1KXVC 4GUPA 3WJJC 3D3VD 4MYWB 3ZSSA 4YBHA 2WWKO 3E6HB 2UVEA 3CZFA 4U31A 4ZUTA 3VFOB 4P4KA 4FZEH 3O6ML 3KYAA 2VNCA 5J3HD 3ZE2E 4YPJA 1FNHA 5IVXA 4J6RH 3RFZC 3L3DB 4LLDA 3SDDB 4L8CA 4PG9A 3RDTC 3OKOB 2BRQA 4P46B 4PG2C 1F4XH 3TCLA 3KWWA 5GGUB 3CIQA 4HQQL 5CP7A 1LE9B 3T0VA 1N2RA 5C0DA 4L8BB 4Q2ZB 3A6BL 2DTML 4LPXA 4PJCB 4F9PC 5ICYA 4AEHH 4C54A 1XGPA 1PX3A 3QPXL 4JKPL 1QR4A 5IROA 5FV2A 1QRNA 1U92B 4UNVA 5HI4D 4Z77B 4R7NA 3OF6A 1DUZB 2YD7A 1WQVT 4YHMH 1L4IA 4X83A 3O3EA 4ALAH 4MX7A 5I8EA 2EXYC 4PB0H 2J8UB 2BDNL 1E4WL 1M7DB 4XP9H 5EU6E 3UTPD 2V9QA 2ZOKA 4UIMB 2H32B 1HIML 2V2TB 3FQTB 3FFCE 1XF3A 3PWNB 5CGYD 1W0VA 1IRAY 3FOLA 4FQXB 4I3SH 5IESL 4ZAKC 3GO1L 1X5FA 3MODL 4HGWB 4V1DB 5I1DA 1CXIA 3U1SH 3TPUA 5IB3A 2R1YB 4CL7A 1T1ZB 2KBGA 1MPAL 3GJFB 1J88A 1K3IA 1XGRA 2QKIA 1Z9MA 3X13A 5EUOA 3BAEL 5KSUB 4WWKB 4EVNB 3FCTA 5EU4B 3TC9A 4X5WA 4GKNB 4M02A 4Y1AD 2W0FA 4RMRA 1BF2A 4OBSA 4JFQA 3HZVB 3S36X 4HCRL 2CKBL 3HPLB 4OCXL 1S7WB 3F7YA 2J6EL 3CDFA 5CZXD 1L7IL 1T4KB 2H9GB 4UV4H 5DWUH 4G6JL 4IIQB 1A8JH 3P30H 5KVFH 2I9LA 5J6HA 5I9QB 5IVXF 4OF3A 1GZPA 4FFVC 3O0RL 3WUWG 1RIHH 5DMIH 3LSOB 4U6TA 3SO3C 1JN6B 5BRZA 1XH3A 4LMQI 3O6MH 5F7MC 3HS0B 2YK1L 2J2ZA 2JLLA 4OIIL 1YEHL 5J06A 1TCMA 4NO0D 1M7XA 3MUZ1 1T7VA 4TPRL 3UTSB 5DRWB 3SOBL 4ACPA 4FN0A 4IM8A 4KK5D 1NMBL 2FNBA 4OZGB 4D0BA 1XT5A 1LO4L 2UV3A 4HQQH 2J88H 5CEXA 1K4CB 5EIIA 4MNHB 3QUZC 4O00A 5T1MB 5EBWA 5I66A 2BSTB 3A6BH 2DTMH 2P44B 4Y4FD 1MLCA 1RVFL 2PXYB 3QPXH 4JKPH 4NJ9L 2DWDA 1ORSA 1M7IB 3QI9B 3QWRA 4JKWA 4POYA 2BY3A 2D0HA 2PETA 2BRRL 1T3FA 3G5ZB 4NQDD 1MY7A 3MGAA 2BDNH 2YR3A 1OARL 2C1PB 3PL6B 4RCAA 4IOFC 3GJFH 4K94L 1NFKA 3VDCA 1HIMH 3RVUC 3H3BC 1JF6A 1YYML 4ZXBC 2QHLA 4JFXB 1HDMA 3VFWB 3LN5B 5IESH 4K3GA 1YA5A 2IQ9L 5EUOF 1A1NA 3GO1H 4M93B 1AKJD 3MODH 1FZMA 1QEWA 3HE6B 4APQA 5K9OA 2NQCA 1E27A 5CD5C 3MJ7B 4Z78A 2GTWB 2F54E 3TWCL 1MPAH 2IQAA 5T3XL 3MLTB 5D1XA 3B9DA 5FYLD 1VFMA 3BAEH 3FHQA 4JFOA 3CK0L 2YPLD 1NFDE 3NA9L 5IW3A 3SCMB 3C6LB 2GT9A 2HH0L 3H0TA 4UB0H 1I9EA 2CKBH 1ZS8A 2UY7A 3HCVB 4OCXH 5HHNA 3MBEC 3TO4A 1AQDB 2FX7L 2J6EH 2G5BB 1L7IH 5H2BB 1JWSA 8FABB 4G9DA 4ENED 3TESA 4G6JH 2Y07L 5I71C 5EH1A 2F53E 4KQ3L 3LQMA 3QQ4A 1EEQA 4OQTA 4JDTL 3O0RH 3MRQA 4AEEA 1KJVB 5FECA 5ESVA 4K7PY 2VITA 2XG4A 2YK1H 5C8JA 4OIIH 3TV3H 1YEHH 4Z9KB 1LEIB 1CD9B 3H9ZA 4TPRH 2DLIA 4EN3B 5ID0B 3SOBH 1NMBH 2LAGB 2ED7A 5EG6C 4XCNA 5I18H 1LO4H 1HH6A 1JNJA 4KK9C 3TZVC 4HMCA 2AJVL 1ORQA 1PD6A 1CD1B 3S34L 3MUGB 3PABA 4X7TA 5F96L 2Z4QA 4H1LG 1KB5A 1RVFH 2MNUA 3UTZB 2DM3A 4NJ9H 1P5VA 1F3JA 2F19L 1NC4D 2A74A 3WUWB 3VXMD 5C1MB 2WWMD 2VKWA 2R2EB 2BRRH 1ND0A 5C08A 3FB5A 4KDTC 1DZBA 3VWKA 1A6WH 1OARH 4S1RL 1KTDB 5D2NB 4K94H 2BVTA 3EDFA 4OGAD 4L29A 4H20L 5J3HC 3NN8B 1YYMH 3B5GA 3QWQB 2DBLL 3KPPA 2F53B 2V5YA 2IQ9H 2ID5A 2YSSA 3D85A 3WFEL 4Z7NF 1FFOB 1QTYT 5KSVA 3GJEA 3TWCH 4Y2DD 4J2XA 3R0NA 5T3XH 5K9KB 4FTVE 4L8SC 3L3HA 5HPOA 4XAKE 3CK0H 3NA9H 4ORZC 2GFBB 2GJJA 1YNKL 2CIKB 1CGUA 2C1OB 2YWZA 5L2KD 1MUJA 4CMMB 1WWAX 1R5WB 3KPRA 2HH0H 2NXYB 2HJLB 1CXFA 5TGBA 3O8XA 4HS6B 4JO2L 1CFNA 2DIBA 2FX7H 3B4NA 1BLNB 3H42L 4U1GC 3K1DA 3CLFL 3FQXB 3KYOA 5FM8A 4HKZB 1DVFA 2Y07H 4KQ3H 3R06A 1KPUB 4JDTH 5CGYC 3E1F1 4YFDB 2A9ML 3VXSE 4YH6A 3MRGB 4ISVA 5L88L 1GGTA 5FHBL 4F33B 3RWEB 1MIEL 1MCBA 1I7UA 3RZCD 5HI3D 4XMKL 1QFWI 4GAYB 1U8OA 3QDGA 2GI7A 1LO3L 4JM2D 1UFUA 2X1PA 3K74B 1JMZA 4ZDHA 2VDML 5I6XB 2AJVH 3VD3A 3S34H 2IGFH 3NTCL 2XKUA 5F96H 3RWGA 3HI5L 2A6JB 5CZXC 3FRUA 2DI7A 3SKNB 3IJYB 2F19H 1A3LH 1V3LA 3V6OE 4P9ML 1NJ9B 4HPYL 2R2CA 5EC2B 4ZG1A 5FGSA 3QUML 4PJIF 4S1RH 4GRMA 1NMCB 2HTKD 3SGEH 4H20H 2DBLH 5K59F 2GCYB 3GMRA 3WFEH 2HFGL 3UTOA 3TIEA 2ESVE 4MCYA 3QRFM 1XF2A 2R23A 4LSUL 4WV1C 2JJVA 4H1LB 5F7EL 1QQDB 3BVNA 2R4SL 4X8JA 3TH2T 3TNMB 3U0WL 2VDQL 4FFZL 4XXDB 1IL1B 1YNKH 2ZOLA 5I8KL 2WMPA 2IWGA 1Z9SA 4NRXB 4IJ3B 3V5DB 4Y4FC 5KAQF 1E4XL 3HE7D 4JY5L 4O58L 4PJFE 4HDIA 4U1MB 4YDJB 4JO2H 2DQCL 2JB6A 4NC0B 1G9NL 2I27N 3H42H 1PGRB 2AV7A 4TUKL 3QDMA 1YMMA 1A4KA 3LKRA 4NO5B 4CKVX 1XGQB 4Y5VC 5ANMA 5D7SL 1FG2B 3KPNB 3BP5B 1NC2B 5IFJB 1KB9K 1SYSB 3TO2A 5DI8A 2A9MH 4PJAA 2JTDA 9CGTA 5FK9A 1KG0A 4QCIA 5FYJD 3EGSB 4QRRD 4OUOA 2VZVA 4OCLC 5I2IB 1MIEH 2A9NL 1OQXA 2XG5A 3D2UB 4XMKH 3CCHB 4HS3B 4F7CA 1LO3H 3CFCL 2RBLA 5CGMA 2VDMH 4Y4HD 4B53A 4OCMC 2OM5A 1A6UL 3GIZL 4ZODA 3U0TA 1F4AA 4M48L 1YPZE 2CLZA 3NTCH 5E2VH 2ZWLT 5GGRB 2KZWA 3HI5H 3TBWA 1DE4B 3W0WE 4QRUB 4PLNC 2OL3A 5FO7A 1MCDA 3MRDB 4YZFF 1E28A 4ENEC 5KSBE 2NW2B 4P9MH 3JV0A 4RMQA 4HPYH 2FEDD 5GRWA 3J7HA 5FKAA 4PJFB 1D5ZA 1CGXA 3QUMH 4EJ1C 4KTYA 1P69B 2MQCA 5B38G 2VWEC 4BH7A 4MDJA 4JPKL 1T5XA 4H1LH 4YPGA 1H3TA 5C09A 2RB8A 3TVMA 3JZ7A 2DLEA 3CGTA 4YC2C 3WSQL 1OW0A 2A38A 4X7FC 5E8NB 2HFGH 2ZCLL 1IMHC 2QQQA 2AXFA 4UT7L 4ZFOL 4DN4L 1AGDA 5D5ME 3W9EB 4LSUH 3RGVD 5FGCE 4RSVA 5FYKL 4O51A 2R4SH 3U0WH 2X7LA 3WIIL 2CDGA 4FFZH 3MRJA 2X1QA 3FQNB 4KRPB 5I8KH 3CVIL 4KJYA 4XMPH 3QDJD 3LRSA 1E4XH 1WIOA 4D0CB 2JJUA 4ZFOB 4I18C 4JY5H 4O58H 3REVA 4GG6A 4O5LL 1IM9D 2NW3A 1FH5L 1L0XA 2DQCH 2BY0A 4M7LH 3VXRA 2WWMC 1G9NH 1S7RB 1AHWA 3LPFA 4TUKH 2AS5M 1BQHA 1SJHB 4PJAF 2ZUXA 3F6IA 2PR4L 1RD6A 1FVCA 4OGAC 4MS8D 3QEQE 4MAYB 3T0EE 4Y7MA 5D7LA 3QDHA 4HIEA 3QWOB 5KANG 3T09A 4OFPA 4CVWA 5DD6B 2A9NH 4Y2DC 2NY5C 4R3SA 4P9HC 1CLOL 5JW4R 3CMOL 3CFCH 2WINA 3HG1E 4P4KD 3TBVB 3DVGA 3AC0A 1UVQA 2FJGA 2LE9A 3DI2B 4NN7B 5D5MB 1W0YT 1A6UH 3GIZH 2X1OA 4M48H 3OL2A 2OYPA 3U6RA 4N90E 4AIZB 3THML 4S1SL 1QHOA 3DROA 4MSWA 5HHPA 1WAAA 4RMUA 1K4DB 5M94B 2ATPA 1YYLL 1RZ8A 3MLPA 4MJIA 3QO1B 1RUAL 4WIQA 3MV8E 3BXNA 5E9DD 4LGSB 4YO0A 3O9WB 4X6BA 2X4SB 3QP3A 3ME0A 2P5EA 5DQ9B 3K8LA 4NIKB 3F5WB 2VTFA 1LP9E 1QRND 1K8DA 4JPKH 3LEVL 2QSCL 2V9TA 5E70A 3OF6D 4CAGA 3JBG7 1JGVL 2G5RA 1OPGL 2DQFB 2FIKA 3PP4L 1JHTA 3U48A 1GZQB 3WSQH 1J18A 5TDPB 1JPSL 5HI3C 1CDHA 2ZCLH 5F9JB 3QEQB 3T0EB 4DN4H 5IFAL 4MZ2A 4JM2C 3RTQD 4HT1L 1WF5A 4XPHL 1JZ5A 3LB6D 2Z8WC 5F44A 4P5MA 1TXKA 3NFPB 4JY6A 4JRYA 5FYKH 5BQ7A 5FKPA 4GG6F 5J1AB 3WIIH 5TH2B 1JGEA 3CVIH 3SKUD 3SKMB 1EXUA 4BQBA 3RNQB 4XBPA 3HG1B 4HXAL 2XZQL 4O5LH 3SJVE 1FH5H 5B38B 4MWFB 3IDUA 4K3JL 2J7LA 3IDYB 1S9YA 2AJ3A 1EVUA 2GK0A 3MQIA 4M7JL 2YHGA 3QIWA 1NL0L 3V4UL 1BFOB 4TUJA 4OI8A 2PR4H 3H7BA 2B5IB 3T65A 1MLBB 3DETD 2HJKA 3D69B 4CN4A 1JTPA 4WRLA 3CLEL 5IBLD 1UT9A 3QISA 4RGND 3OGOE 1NGXA 3ROOA 3OJDA 5GS1B 1OCWL 5EOTA 3RWJB 3MPCA 1LP9B 2DMCA 4X0KA 2PYEA 1CLOH 4UDTB 3OMZA 3CMOH 2V2WA 3PWPE 1YN6A 5DJ6B 4XWGL 1IBGH 3AS1A 5E8PA 1WAAF 3HE7C 4QHNA 2P7TA 3NH7L 5DSCB 1ZANL 5DC4B 5B22A 2W0KA 4WW1B 2FECI 3SN6N 3THMH 4U0QB 4S1SH 5I17B 4XVUD 4XB7A 5ERWA 4NKDB 1MHPL 3BWUC 3MV7B 2UWEE 4M8QB 3BPLB 3CUPA 4WJ5B 1TLKA 5B21A 4XCEB 3F7PC 4JVWA 4YBLB 1ZLVH 5HHVL 1RUAH 3IXTB 1LWRA 25C8L 1RZGB 2XKSA 4G8IB 4PGEA 4H8WC 3SJVB 4O2FB 3I3BA 1NAKL 1WT5C 3QWRD 4U1HB 3LEVH 2QSCH 4LU5L 3MNZB 2OTUB 3GSRB 3UP1A 5KS9A 1OAZH 1JGVH 3PP4H 1OPGH 4NDMB 3TT1L 1F42A 3RA7L 1JPSH 3I3DA 3VFOA 3DMMB 3RP1A 5IFAH 4LGRB 3U7YL 4HT1H 4XPHH 1YNTB 3SDDA 4Y4HC 5M95B 3BHBA 2YD5A 4KGJA 5JDJA 1A3RL 3OPZL 3RWCB 2Z8RA 5A2JH 2E9JA 3EOBB 3U46B 3OKOA 5T5NG 2R0KL 2KUTA 4P46A 2AP2A 2HVJA 4APQD 1WFOA 4U7MA 5IF0B 1HEZB 3VFVA 2VERN 3X17A 4HXAH 5D1XD 5IK3A 2XZQH 1CDJA 4Q2ZA 4C83B 5ENWB 3VFUA 1JFQL 3NIDF 3G5XB 2FEDC 1T1YB 4K3JH 4PJCA 1LD9B 4UV7L 4JG1L 1J1OL 3BRFA 4M7JH 1NL0H 4MB4A 4O2CB 3EYQD 4Z77A 4NBYB 1DUZA 3C8HA 3KNBB 5I8OL 2UWEB 1IQDB 4D0DA 4LF3A 3TO4D 3W9DA 2J8UA 4EI5D 1M7DA 3CLEH 4UIMA 4PRDA 2H32A 2V2TA 3FQTA 1JPTL 1OCWH 3PWNA 1KSRA 3AM8C 4G6KL 4G6FD 4ODWB 3RGVC 5CHNB 1Q0XH 1F2XK 5KW9L 4HGWA 1IAKA 4XWGH 1HK6A 3MRNB 4M6OL 1T1ZA 3GJFA 2QQKL 5I0ZA 3NH7H 4A2LA 1ZANH 3BRDA 3GJFK 1EH9A 5T5FL 5KSUA 4U1KB 5DJ8B 1CICD 2DJSA 5C0CD 3LQAL 5EU4A 3RY6C 2VR9A 3GNML 1DEEB 1MHPH 2VXSL 5DEFA 3HZVA 5HHVH 2O5YL 1S7WA 25C8H 2MKLC 1R3JB 1Z5LB 2EDJA 3SHSA 1SJVA 1T4KA 4MS8C 1FL6B 4TOYL 3QH3B 2H9GA 4NHUB 3H9HB 4WENB 1NAKH 4IIQA 3IDNB 4LU5H 2F8XC 3QNYB 5DA0B 5C08D 3LSOA 2J6EA 3TT1H 1JN6A 2R1XB 3RA7H 3VWKD 1ZLUH 1JI1A 3VGDA 4XI5D 3U7YH 1VDGA 3C5JB 1TJGL 4P4KC 5C0AB 2ICEB 5CJQL 3L3OB 1RURL 2AQ1A 1Z0MA 3VA6A 5DRWA 1RZJL 1A3RH 3OPZH 5F7YC 4QOKD 2XQYK 3VJ6B 3MRPB 4HEME 4OZGA 2R0KH 3TF7C 3D85D 3ULVE 4PJCF 5E99L 4PBVC 3U83A 1DUYB 1K4CA 5E7BA 5DVLA 4QRPB 3UAJD 4MNHA 4GXVL 5T1MA 3LDBC 4Z7QE 1JFQH 1KGCE 2BSTA 3EJJX 1IAIM 2DKMA 3P9LB 2PXYA 3IS1X 1J1OH 2E5EA 4FS0A 4Q7DA 1MCCA 2J8UF 1NGWA 3KPRD 3QI9A 4ZQKB 3B43A 5EO1B 3O8XD 2ZG1A 2FATL 5I8OH 2UY6A 2GAZB 3G5ZA 2DQEL 4RIRA 1B3JA 2C1PA 3Q3GB 2GJZB 1IE5A 4KFZC 1DVFD 1JPTH 4UI2A 3RTQC 2X4PB 3AAZA 2FHCA 3LB6C 4G6KH 1A1MA 4U6HB 3IDJB 3LN5A 4QHLB 4FQIL 3ZE2F 3BP6B 4K71B 2WP3T 5KW9H 4Z6AT 3HE6A 4J8RB 3WV0A 4M6OH 4MA8L 4R8WH 4G8FB 2QQKH 3GSNL 5DJYB 5T5FH 4BFIB 2Q7YB 4POUB 2Z93A 1GGUA 3LQAH 3QEGH 4NO2A 2CDFB 3GNMH 4OLVH 2E8ZA 3PHOA 4XH2B 3K8MA 2HLFD 2IG2L 1KXTB 2VXSH 4KH2A 5IQ9B 3GSNB 4Z7UE 4CVZB 3HCVA 1T6VN 2WBJD 2ZUQB 1A6AA 1JZ2A 1T2XA 1AQDA 2G5BA 2EDKA 1U0QA 3QQ3B 5H2BA 3DETC 4BFBD 8FABA 3DXAD 4TOYH 3BEWA 3WFBH 4JZOB 3LEYL 5IBLC 4RGNC 5DDHB 3FTGA 5J56B 3W5MA 1KPVB 3BMWA 3NPZB 3QXAB 1KJVA 3WFHB 1OTSC 4XVJL 3U79A 1QLFB 4P48A 1DCLA 4QT5B 4OZGF 2NY7L 3NCCB 5CJQH 1RURH 4D9RE 2W1NA 4EN3A 5ID0A 1RZJH 1RHHB 5B8CA 2FB4H 4NRZB 1IKFL 5E99H 1MFBL 1I8LA 4WI8A 2AJZB 1CD1A 2DOCA 2F54A 4F15B 2K1MA 4GXVH 3MUGA 3WXVL 4MQ7B 4ESKA 4ODXA 3UTZA 4UOW1 1JL8A 1NFDA 1A6TB 4NZUL 4PJ7B 5JXEA 3P11L 1X5HA 1MIML 1JWUB 2FL5B 2A6IB 5JORA 3WUWA 3GI8L 3BQUA 2K9UA 2FATH 4HJ0D 1ZAGA 1IEAB 1TDQA 2R2EA 5HVFB 4NYLB 1K5NB 4Z7UB 3HMXL 2DQEH 3H3KA 5I74B 1EA9C 3ARZA 3QDMD 1KTDA 3CDYA 1YMMD 5D2NA 3CPLB 2VAJA 3MXWL 4S10A 1GSMA 1U41A 5FGBA 3NN8A 4KZEL 1EHNA 2FGZA 2F53A 3LKSB 4FQIH 4PJ9B 5ETUB 1FFOA 1ZSDB 5E6ZA 4L8DB 4MA8H 5D72L 4APQC 2BNUB 2NY0B 3GSNH 2Y5TB 4YFEA 5K9KA 4WY7L 4RA3A 4NKOB 3QHTC 5D1XC 2GFBA 5K33A 2R8SL 2CIKA 4L4VD 2C1OA 4G8EB 3DUHA 2DS4A 1R5WA 2HJLA 2IG2H 4KI5E 2ZJSL 1ULVA 4HS6A 5DEZA 4UAOB 2P8PA 3EYQC 3GMQB 1T6WA 3H3PL 4IRSB 1BLNA 4ODUA 2WQ8A 3JWNC 3HZKB 5HGAA 3EW3B 4RISL 5EO0B 2BSRA 4PJDB 1S3KL 3BW9B 3FQXA 4X6EB 3VRIB 3TBYB 3WNLA 4HKZA 4EI5C 3LEYH 1KLUA 3DPBA 3L5IA 1N6QL 1FG9C 1KPUA 5T1LA 5F9WC 1VSCA 4XAWL 1NBQA 5B3NA 4O4YL 4RBPH 4YXKL 4IRJB 1MFAL 5FYKU 3RUGB 4XVJH 3MJ8B 3QNZA 3NPSB 4F33A 4HWBA 3RWEA 2NY7H 5C0JB 1A7QL 1UH2A 2CJUH 3RX8A 5T1DL 4JFFE 1R5VB 5DHVB 3P0VL 1CICC 4GAYA 5MENE 1TNMA 1IKFH 4CMHC 1MFBH 3EOAB 1CIDA 1HINL 3WXVH 5GGRY 2APWA 4YGVB 2A6JA 1HYSD 3P11H 5JOPE 3SKNA 1MIMH 3IJYA 2OXHA 3GI8H 1NJ9A 5J1SC 3AREA 5EC2A 2FGWH 5IHBA 4NNYA 2IADB 4GW4B 3HMXH 3GSUA 1JNHA 1BIHA 3VWKC 4CUCA 3MXWH 5MP6L 4XI5C 2HFFB 2X4RB 1EFXB 4KZEH 1HQRB 3HA0A 2GCYA 3IVKB 2JE8A 2X4QB 5D7LD 4GO6B 2DB8A 2OCFD 4M43L 5D72H 5DMKB 4WY7H 4XNQB 4H1LA 1NH6A 1QQDA 1GIGL 5FO8B 3TNMA 1VA9A 2HRPL 4UILL 1S8DB 1IL1A 2R8SH 3V5DA 3IJSB 2FRGP 2E6JA 1OAXL 2CR6A 1JGLL 3V8CA 2ZJSH 2KL6A 4RMVA 4U1MA 4YDJA 5E94B 1A7NH 1MVUB 4AQ1B 2JKXA 1AD9A 3O8XC 4WWID 3H3PH 1MAKA 1UJ3B 4FXKA 1J7VR 4KKLD 4RISH 1S3KH 4NO5A 4K3DH 1FG2A 1N6QH 1C5CL 4XAWH 4DVRL 1DVFC 3BP5A 1NC2A 3V6OA 4O4YH 1QSZA 1SYSA 4YXKH 1MFAH 5JA9A 5I1EL 1FNGA 2W07A 2P5ED 4FZ8L 1R0AL 3EGSA 1KEGH 2OR8A 1PDKA 2ZSVB 3NCYP 1A7QH 3BGMB 5I2IA 5TFSL 4OZFB 5T1DH 3D2UA 4YDVB 5IW1A 3ARGB 3BP4B 5DXWA 3CCHA 3OKLB 3P0VH 4HS3A 2ADGB 3WO4B 3MBXL 2GYSA 4U33A 1U95A 4F2MB 4I77L 1ZHNB 5HGGS 3MGOB 2MWCA 2HLFC 3ZHDA 1HINH 4JRYD 1Q38A 1L6ZA 2WBJC 5GGRA 3QCTL 4JREC 1DE4A 2HT3D 3BGFB 4QRUA 3MYZA 3MRDA 1OP5H 2WQRA 2W65A 2NW2A 4YHIA 2FD6L 4HG4J 3TA3C 1B0WA 1FZJB 4PJFA 3BH9A 1DQJB 3P4NB 3VE0B 3IGAB 3LOWA 3QIWD 1IZJA 3QIUB 2R1WB 5MP6H 1K8IB 3TPKA 4U6YA 3RBSA 2AEIT 5DURD 3U30C 1JCKA 1CDCA 1HE7A 4AM0B 2DM4A 4JZJC 5E8NA 4X6DB 5I1LB 3OTTA 5HGBB 5C07E 4EOWH 3W9EA 4M43H 5GS3A 1JWMA 2D3VA 2VL4A 4LDOB 3F7VA 1GIGH 1FSKC 4R4ND 5FUCC 2HRPH 2XNAB 4UILH 4RMTA 3FQNA 1FP5A 3ARWA 4D0CA 1OAXH 3VDBA 1JGLH 4YQXL 2VE6B 3LN4A 3AXLB 3G5YB 1FPTL 1S7RA 2DF3A 1SJHA 3NCBB 3HMWL 2IAMB 1C5CH 2H1PH 4DVRH 2BMKB 3QUYB 4XNZB 3QHFH 1A21A 3PV6B 3L3KB 4MAYA 2EYSB 1J1XL 5I1EH 2WK2A 4FZ8H 1R0AH 1EZVX 3QWOA 3PXHA 2CRMA 1TCRB 3NCFB 1P7QB 3H6JA 4IDJL 5TFSH 5DD6A 2IANE 4YHPB 5L8KB 1C1EL 3EYUL 2WIIB 1HILB 3M8OL 2Y7QB 3MBXH 1FYHB 1A4JB 4FP8L 3TBVA 3QIBB 4I77H 1E4XI 5D5MA 3SDDD 4NC1C 3MA9L 3RAJL 1B4JL 3ULSB 1MCHA 4PJFF 3TN0B 5SWQB 3L95B 3G08B 3QCTH 4ONFL 4P46D 5GGSB 1K4DA 4X7SL 3FRPA 3IFLL 1WFTA 4WU7B 3QO1A 1KN2L 1MCPL 2FD6H 4FOMA 4LRIC 2D7MA 3BPCA 3GSOA 1UACL 2KZ1B 3O9WA 4D94A 1H3XA 2X4SA 1DR9A 5DQ9A 3WS3A 4RDQG 5DFVD 4WI9A 3ZE0E 4ZUWB 1IEHA 3F5WA 5D93B 1OT2A 3HAEB 1QPXA 4PP1D 1XCTA 1SY6L 2QEJA 2DQFA 1ZLVK 1GZQA <