2W0TA

Solution structure of the fcs zinc finger domain of human lmbl2
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
43
structure length
43
Chain Sequence
GSGSEPAVCEMCGIVGTREAFFSKTKRFCSVSCSRSYSSNSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LETHAL(3)MALIGNANT BRAIN TUMOR-LIKE 2 PROTEIN
publication title Solution Structure of the Fcs Zinc Finger Domain of the Human Polycomb Group Protein L(3)Mbt-Like 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 4
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2008-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.160 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2w0tA00
2L8EA 2W0TA
chains in the Genus database with same CATH superfamily
1P9ZA 1BMOA 2OD1A 2E73A 2E5RA 2SGPI 4UXIA 3FC3A 2WVJA 1FARA 1FAQA 2JYYA 1BUSA 2UZ3A 1RFHA 1ULNA 1MJBA 1V1HA 3KY9A 5JHWC 2GIVA 3UGDA 5FUXA 2GKRI 2QQEA 1CE3A 1U5KA 2CJSC 1WTJA 2KCXA 2OU2A 2X3TA 2JA1A 3VDPA 1AN1I 1CHOI 1X4SA 3SGQI 2B8TA 1MJ9A 1IW4A 2ELIA 1X74A 2ARPF 2N1AB 1IY5A 2WCYA 2PQ8A 4OVOA 2WGCA 1Y1CA 3R5CA 2YQPA 3TO9A 2SGDI 9WGAA 3HH2C 4HGUA 3R5DA 2DB6A 1ULKA 2KMRA 1CSOI 2XRCA 1CT4I 3UGIA 1KBFA 4E1RA 4AMLA 2ERWA 2NU3I 2NU0I 4SGBI 5EX0A 2JW6A 2ORVA 2V1CC 3MEKA 1TBOA 1ULMA 1R79A 5E3PA 1Z2IA 2YUUA 1VDDA 3PDNA 2X52A 2DKVA 3GOXA 3R5BA 1OVOA 2RIJA 2KMPA 5E3RA 7WGAA 5EX3A 3UEJA 1HJAI 1R0RI 2F3CI 2ROWA 1LR9A 3FSYA 3UFFA 3FSXA 1YU6C 2B0UC 1HPTA 1SGNI 2ODDA 2SGFI 2JZMA 4L9MA 2L7XA 4MPIA 1H0ZA 2J87A 2W0TA 1OMUA 5E3QA 2A20A 1NXUA 3QTLD 2NU2I 5CCLA 2QPOA 1TOTA 3E2IA 5J8CA 1SGPI 2M5XA 2FNFX 1UHAA 1CT0I 1TGSI 3R5AA 3OXGA 1K7TA 3VDUA 5HQ8A 2GKVA 4B6DA 3E59A 2CWFA 2V53A 3B4VC 1FY7A 3VE5A 3UEYA 1HDLA 3OVOA 2BUSA 2N71A 2OZUA 5HI7A 3UGLA 1HEVA 1Z7KB 1KBEA 1LR7A 2DIPA 1CGJI 2N52A 3D00A 1TIHA 1YTPA 5FUVA 1XBTA 5J8FA 1WKXA 4UXJA 3TO6A 2NU1I 1PTRA 1TURA 2RC4A 3SEKC 1CGII 1SGRI 3TOBA 2OVOA 1S20A 1WGTA 3UOEA 1PTQA 1N13A 2LUYA 2QQ0A 2SGEI 5DAEA 4A24A 4E1PA 4JCVE 1SGQI 1PCEA 1M8BA 5FUWA 5CCMA 1P9GA 1Y8FA 3TJQA 4FKDA 1FYBA 1SGYI 1MJAA 1IY6A 2LEOA 5FUYA 1OMTA 1K7VA 1DS3I 1TBRR 1PPFI 2CWHA 2JXDA 1V1IA 1Y1BA 1WGCA 2LB7A 3BJIA 1XX6A 3OXLA 4WP4A 1MT1A 3SGBI 3TOAA 1DS2I 2V1CA 1KMAA 3QWPA 2SGQI 1CT2I 2KMQA 4UXHA 1TBNA 2ENNA 2P6AC 2UVOA 4DNCA 2VRWB 2L8EA 2KMOA 1UUCA 1UVFA 1NUBA 2QQCA 1SGEI 1SGDI 3RU0A 1W3SA 1LR8A 2N17A 1XA6A 3TO7A 1PJUA 3OXFA 1TUSA 1W4RA 2CWGA 1UVGA 2GKTI 1OYVI 2K9HA 2QQDA 3OL0A 4GI3C 2GVIA 2ORWA 2Y0MA 3CXLA 1M8CA 1TBQR 2J9RA 1K7UA 1Q9BA 2NU4I 2ENZA 3QAHA
chains in the Genus database with same CATH topology
1BMOA 2E73A 2E5RA 2SGPI 4UXIA 3FC3A 2WVJA 1FARA 1FAQA 2JYYA 1BUSA 2UZ3A 1RFHA 1V1HA 3KY9A 5JHWC 3UGDA 5FUXA 2GKRI 2QQEA 1CE3A 1U5KA 2CJSC 2KCXA 2JA1A 3VDPA 1AN1I 1CHOI 1X4SA 3SGQI 2B8TA 1IW4A 2ELIA 1X74A 2ARPF 2N1AB 1IY5A 2WCYA 1Y1CA 2YQPA 2SGDI 3HH2C 4HGUA 2DB6A 2KMRA 1CSOI 2XRCA 1CT4I 3UGIA 1KBFA 4E1RA 2ERWA 2NU3I 2NU0I 4SGBI 5EX0A 2JW6A 2ORVA 2V1CC 3MEKA 1TBOA 1R79A 2YUUA 1VDDA 3PDNA 3GOXA 1OVOA 2KMPA 3UEJA 1HJAI 1R0RI 2F3CI 2ROWA 1LR9A 3UFFA 2B0UC 1YU6C 1HPTA 1SGNI 2ODDA 2SGFI 2JZMA 4L9MA 2L7XA 1H0ZA 2J87A 2W0TA 1OMUA 2A20A 3QTLD 2NU2I 5CCLA 2QPOA 1TOTA 3E2IA 1SGPI 2M5XA 2FNFX 1CT0I 1TGSI 3OXGA 3VDUA 5HQ8A 2GKVA 4B6DA 3E59A 2V53A 3B4VC 3VE5A 3UEYA 1HDLA 3OVOA 2BUSA 2N71A 3UGLA 5HI7A 1Z7KB 1KBEA 1LR7A 2DIPA 1CGJI 2N52A 1TIHA 1YTPA 5FUVA 1XBTA 4UXJA 2NU1I 1PTRA 1TURA 3SEKC 1CGII 1SGRI 2OVOA 1PTQA 1N13A 2LUYA 2QQ0A 2SGEI 5DAEA 4A24A 4E1PA 4JCVE 1SGQI 1PCEA 1M8BA 5FUWA 5CCMA 1Y8FA 3TJQA 4FKDA 1FYBA 1SGYI 1IY6A 2LEOA 5FUYA 1OMTA 1TBRR 1DS3I 3D00A 1PPFI 2JXDA 1V1IA 1Y1BA 3BJIA 3OXLA 1XX6A 3SGBI 1MT1A 1DS2I 2V1CA 1KMAA 3QWPA 2SGQI 1CT2I 2KMQA 4UXHA 1TBNA 2ENNA 2P6AC 2VRWB 2L8EA 2KMOA 1UUCA 1UVFA 1NUBA 2QQCA 1SGEI 1SGDI 3RU0A 1W3SA 1LR8A 2N17A 1XA6A 1PJUA 3OXFA 1TUSA 1W4RA 2QQDA 1UVGA 2GKTI 1OYVI 2K9HA 3OL0A 4GI3C 4OVOA 2GVIA 2ORWA 3CXLA 1M8CA 1TBQR 2J9RA 2OD1A 2NU4I 2ENZA 5EX3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8E A;  2W0T A; 
#chains in the Genus database with same CATH topology
 1P9Z A;  1BMO A;  2OD1 A;  2E73 A;  2E5R A;  2SGP I;  4UXI A;  3FC3 A;  2WVJ A;  1FAR A;  1FAQ A;  2JYY A;  1BUS A;  2UZ3 A;  1RFH A;  1ULN A;  1MJB A;  1V1H A;  3KY9 A;  5JHW C;  2GIV A;  3UGD A;  5FUX A;  2GKR I;  2QQE A;  1CE3 A;  1U5K A;  2CJS C;  1WTJ A;  2KCX A;  2OU2 A;  2X3T A;  2JA1 A;  3VDP A;  1AN1 I;  1CHO I;  1X4S A;  3SGQ I;  2B8T A;  1MJ9 A;  1IW4 A;  2ELI A;  1X74 A;  2ARP F;  2N1A B;  1IY5 A;  2WCY A;  2PQ8 A;  4OVO A;  2WGC A;  1Y1C A;  3R5C A;  2YQP A;  3TO9 A;  2SGD I;  9WGA A;  3HH2 C;  4HGU A;  3R5D A;  2DB6 A;  1ULK A;  2KMR A;  1CSO I;  2XRC A;  1CT4 I;  3UGI A;  1KBF A;  4E1R A;  4AML A;  2ERW A;  2NU3 I;  2NU0 I;  4SGB I;  5EX0 A;  2JW6 A;  2ORV A;  2V1C C;  3MEK A;  1TBO A;  1ULM A;  1R79 A;  5E3P A;  1Z2I A;  2YUU A;  1VDD A;  3PDN A;  2X52 A;  2DKV A;  3GOX A;  3R5B A;  1OVO A;  2RIJ A;  2KMP A;  5E3R A;  7WGA A;  5EX3 A;  3UEJ A;  1HJA I;  1R0R I;  2F3C I;  2ROW A;  1LR9 A;  3FSY A;  3UFF A;  3FSX A;  1YU6 C;  2B0U C;  1HPT A;  1SGN I;  2ODD A;  2SGF I;  2JZM A;  4L9M A;  2L7X A;  4MPI A;  1H0Z A;  2J87 A;  2W0T A;  1OMU A;  5E3Q A;  2A20 A;  1NXU A;  3QTL D;  2NU2 I;  5CCL A;  2QPO A;  1TOT A;  3E2I A;  5J8C A;  1SGP I;  2M5X A;  2FNF X;  1UHA A;  1CT0 I;  1TGS I;  3R5A A;  3OXG A;  1K7T A;  3VDU A;  5HQ8 A;  2GKV A;  4B6D A;  3E59 A;  2CWF A;  2V53 A;  3B4V C;  1FY7 A;  3VE5 A;  3UEY A;  1HDL A;  3OVO A;  2BUS A;  2N71 A;  2OZU A;  5HI7 A;  3UGL A;  1HEV A;  1Z7K B;  1KBE A;  1LR7 A;  2DIP A;  1CGJ I;  2N52 A;  3D00 A;  1TIH A;  1YTP A;  5FUV A;  1XBT A;  5J8F A;  1WKX A;  4UXJ A;  3TO6 A;  2NU1 I;  1PTR A;  1TUR A;  2RC4 A;  3SEK C;  1CGI I;  1SGR I;  3TOB A;  2OVO A;  1S20 A;  1WGT A;  3UOE A;  1PTQ A;  1N13 A;  2LUY A;  2QQ0 A;  2SGE I;  5DAE A;  4A24 A;  4E1P A;  4JCV E;  1SGQ I;  1PCE A;  1M8B A;  5FUW A;  5CCM A;  1P9G A;  1Y8F A;  3TJQ A;  4FKD A;  1FYB A;  1SGY I;  1MJA A;  1IY6 A;  2LEO A;  5FUY A;  1OMT A;  1K7V A;  1DS3 I;  1TBR R;  1PPF I;  2CWH A;  2JXD A;  1V1I A;  1Y1B A;  1WGC A;  2LB7 A;  3BJI A;  1XX6 A;  3OXL A;  4WP4 A;  1MT1 A;  3SGB I;  3TOA A;  1DS2 I;  2V1C A;  1KMA A;  3QWP A;  2SGQ I;  1CT2 I;  2KMQ A;  4UXH A;  1TBN A;  2ENN A;  2P6A C;  2UVO A;  4DNC A;  2VRW B;  2L8E A;  2KMO A;  1UUC A;  1UVF A;  1NUB A;  2QQC A;  1SGE I;  1SGD I;  3RU0 A;  1W3S A;  1LR8 A;  2N17 A;  1XA6 A;  3TO7 A;  1PJU A;  3OXF A;  1TUS A;  1W4R A;  2CWG A;  1UVG A;  2GKT I;  1OYV I;  2K9H A;  2QQD A;  3OL0 A;  4GI3 C;  2GVI A;  2ORW A;  2Y0M A;  3CXL A;  1M8C A;  1TBQ R;  2J9R A;  1K7U A;  1Q9B A;  2NU4 I;  2ENZ A;  3QAH A; 
#chains in the Genus database with same CATH homology
 1BMO A;  2E73 A;  2E5R A;  2SGP I;  4UXI A;  3FC3 A;  2WVJ A;  1FAR A;  1FAQ A;  2JYY A;  1BUS A;  2UZ3 A;  1RFH A;  1V1H A;  3KY9 A;  5JHW C;  3UGD A;  5FUX A;  2GKR I;  2QQE A;  1CE3 A;  1U5K A;  2CJS C;  2KCX A;  2JA1 A;  3VDP A;  1AN1 I;  1CHO I;  1X4S A;  3SGQ I;  2B8T A;  1IW4 A;  2ELI A;  1X74 A;  2ARP F;  2N1A B;  1IY5 A;  2WCY A;  1Y1C A;  2YQP A;  2SGD I;  3HH2 C;  4HGU A;  2DB6 A;  2KMR A;  1CSO I;  2XRC A;  1CT4 I;  3UGI A;  1KBF A;  4E1R A;  2ERW A;  2NU3 I;  2NU0 I;  4SGB I;  5EX0 A;  2JW6 A;  2ORV A;  2V1C C;  3MEK A;  1TBO A;  1R79 A;  2YUU A;  1VDD A;  3PDN A;  3GOX A;  1OVO A;  2KMP A;  3UEJ A;  1HJA I;  1R0R I;  2F3C I;  2ROW A;  1LR9 A;  3UFF A;  2B0U C;  1YU6 C;  1HPT A;  1SGN I;  2ODD A;  2SGF I;  2JZM A;  4L9M A;  2L7X A;  1H0Z A;  2J87 A;  2W0T A;  1OMU A;  2A20 A;  3QTL D;  2NU2 I;  5CCL A;  2QPO A;  1TOT A;  3E2I A;  1SGP I;  2M5X A;  2FNF X;  1CT0 I;  1TGS I;  3OXG A;  3VDU A;  5HQ8 A;  2GKV A;  4B6D A;  3E59 A;  2V53 A;  3B4V C;  3VE5 A;  3UEY A;  1HDL A;  3OVO A;  2BUS A;  2N71 A;  3UGL A;  5HI7 A;  1Z7K B;  1KBE A;  1LR7 A;  2DIP A;  1CGJ I;  2N52 A;  1TIH A;  1YTP A;  5FUV A;  1XBT A;  4UXJ A;  2NU1 I;  1PTR A;  1TUR A;  3SEK C;  1CGI I;  1SGR I;  2OVO A;  1PTQ A;  1N13 A;  2LUY A;  2QQ0 A;  2SGE I;  5DAE A;  4A24 A;  4E1P A;  4JCV E;  1SGQ I;  1PCE A;  1M8B A;  5FUW A;  5CCM A;  1Y8F A;  3TJQ A;  4FKD A;  1FYB A;  1SGY I;  1IY6 A;  2LEO A;  5FUY A;  1OMT A;  1TBR R;  1DS3 I;  3D00 A;  1PPF I;  2JXD A;  1V1I A;  1Y1B A;  3BJI A;  3OXL A;  1XX6 A;  3SGB I;  1MT1 A;  1DS2 I;  2V1C A;  1KMA A;  3QWP A;  2SGQ I;  1CT2 I;  2KMQ A;  4UXH A;  1TBN A;  2ENN A;  2P6A C;  2VRW B;  2L8E A;  2KMO A;  1UUC A;  1UVF A;  1NUB A;  2QQC A;  1SGE I;  1SGD I;  3RU0 A;  1W3S A;  1LR8 A;  2N17 A;  1XA6 A;  1PJU A;  3OXF A;  1TUS A;  1W4R A;  2QQD A;  1UVG A;  2GKT I;  1OYV I;  2K9H A;  3OL0 A;  4GI3 C;  4OVO A;  2GVI A;  2ORW A;  3CXL A;  1M8C A;  1TBQ R;  2J9R A;  2OD1 A;  2NU4 I;  2ENZ A;  5EX3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...