2W0TA

Solution structure of the fcs zinc finger domain of human lmbl2
Total Genus 4
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
4
sequence length
43
structure length
43
Chain Sequence
GSGSEPAVCEMCGIVGTREAFFSKTKRFCSVSCSRSYSSNSKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords LETHAL(3)MALIGNANT BRAIN TUMOR-LIKE 2 PROTEIN
publication title Solution Structure of the Fcs Zinc Finger Domain of the Human Polycomb Group Protein L(3)Mbt-Like 2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 4
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2008-10-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.60.160 Alpha Beta 2-Layer Sandwich Wheat Germ Agglutinin (Isolectin 2); domain 1 Wheat Germ Agglutinin (Isolectin 2); domain 1 2w0tA00
2L8EA 2W0TA
chains in the Genus database with same CATH superfamily
1AN1I 3UOEA 1FARA 5E3RA 2F3CI 4L9MA 1CT4I 1R0RI 3OXLA 2OD1A 2B8TA 3SGQI 1CGJI 1M8BA 1CHOI 2K9HA 2KCXA 4HGUA 3QAHA 3PDNA 2X3TA 1OVOA 2ROWA 2V1CA 2NU1I 2VRWB 3TOAA 2N71A 5E3PA 2A20A 2GKRI 4A24A 1PCEA 1XX6A 2WGCA 1NUBA 1SGEI 3HH2C 1CE3A 2ORVA 1TBRR 1V1IA 1UUCA 1MJAA 3R5DA 1BMOA 2GVIA 2QQCA 2RIJA 3RU0A 1RFHA 1H0ZA 2JXDA 1R79A 2M5XA 1CT0I 2LEOA 2PQ8A 5CCLA 2KMPA 1VDDA 2N17A 2ORWA 2SGPI 2CWGA 5EX0A 1YU6C 2J9RA 1SGDI 2N1AB 3SEKC 3VDPA 1Y1BA 2LUYA 1MJBA 5HQ8A 1TOTA 2SGEI 1Z2IA 3UFFA 1ULNA 4SGBI 1TURA 2YUUA 1TBNA 3TO9A 1TBQR 3FSXA 4B6DA 3UGDA 3TJQA 1SGPI 1ULKA 4OVOA 1HPTA 1OYVI 3R5CA 1DS3I 1IY5A 2NU2I 1V1HA 2DKVA 5FUWA 1MJ9A 1CGII 1HDLA 1WGTA 2GIVA 4UXJA 3QTLD 2DB6A 2JW6A 2DIPA 2JZMA 1W3SA 2W0TA 3QWPA 3R5BA 1HEVA 1SGQI 2L8EA 5J8CA 2JYYA 7WGAA 3B4VC 4JCVE 2V53A 2QQEA 1CT2I 3E2IA 2ELIA 2UVOA 3R5AA 2QQ0A 3VE5A 4UXHA 2NU4I 2X52A 5CCMA 1LR8A 9WGAA 5J8FA 2CWHA 1Y1CA 1Q9BA 1K7VA 2YQPA 1K7TA 1K7UA 2UZ3A 3UEYA 2RC4A 1W4RA 2V1CC 4GI3C 1SGRI 3OXGA 1BUSA 1NXUA 1WTJA 1X74A 2KMRA 1TGSI 2QPOA 1HJAI 1SGYI 1YTPA 2B0UC 3D00A 4FKDA 1SGNI 1OMUA 1Z7KB 2KMOA 1DS2I 1PTQA 2WCYA 3KY9A 2SGFI 1FY7A 3OVOA 5HI7A 4AMLA 5FUVA 1FAQA 2ENZA 1UVGA 2FNFX 3CXLA 3SGBI 2E73A 2JA1A 2P6AC 3UGIA 1IY6A 1KMAA 4UXIA 2CJSC 2WVJA 1TBOA 1PPFI 2XRCA 2ODDA 2Y0MA 2KMQA 1IW4A 1P9ZA 1S20A 1LR7A 2SGDI 1XBTA 2GKVA 5FUXA 2LB7A 1M8CA 1UHAA 2OVOA 2E5RA 1Y8FA 1UVFA 2J87A 1CSOI 2ENNA 1KBFA 2N52A 1FYBA 3MEKA 4DNCA 2GKTI 1N13A 1PTRA 2ARPF 1U5KA 1WGCA 2OZUA 2SGQI 3TOBA 2NU3I 4E1PA 1OMTA 2CWFA 2ERWA 3BJIA 3FSYA 1PJUA 3TO7A 1LR9A 3UEJA 3GOXA 1X4SA 1TIHA 1TUSA 2NU0I 1KBEA 3TO6A 1XA6A 4E1RA 3FC3A 1MT1A 3OXFA 4WP4A 5E3QA 1WKXA 2BUSA 5EX3A 5FUYA 3OL0A 5DAEA 2L7XA 2OU2A 5JHWC 3VDUA 2QQDA 4MPIA 3UGLA 3E59A 1P9GA 1ULMA
chains in the Genus database with same CATH topology
1AN1I 1FARA 2F3CI 4L9MA 1CT4I 1R0RI 3OXLA 2OD1A 2B8TA 3SGQI 1CGJI 1M8BA 1CHOI 2K9HA 2KCXA 4HGUA 3PDNA 1OVOA 2ROWA 2V1CA 2NU1I 2VRWB 2N71A 2A20A 2GKRI 4A24A 1PCEA 1XX6A 1NUBA 1SGEI 3HH2C 1CE3A 2ORVA 1TBRR 1V1IA 1UUCA 1BMOA 2GVIA 2QQCA 3RU0A 1RFHA 1H0ZA 2JXDA 1R79A 2M5XA 1CT0I 2LEOA 5CCLA 2KMPA 1VDDA 2N17A 2ORWA 2SGPI 5EX0A 1YU6C 2J9RA 1SGDI 2N1AB 3SEKC 3VDPA 1Y1BA 2LUYA 5HQ8A 1TOTA 2SGEI 3UFFA 4SGBI 1TURA 2YUUA 1TBNA 1TBQR 4B6DA 3UGDA 3TJQA 1SGPI 4OVOA 1HPTA 1OYVI 1DS3I 1IY5A 2NU2I 1V1HA 5FUWA 1HDLA 1CGII 4UXJA 3QTLD 2DB6A 2JW6A 2DIPA 2JZMA 1W3SA 2W0TA 3QWPA 1SGQI 2L8EA 2JYYA 3B4VC 4JCVE 2V53A 2QQEA 1CT2I 3E2IA 2ELIA 3VE5A 2QQ0A 4UXHA 2NU4I 5CCMA 1LR8A 1Y1CA 2YQPA 2UZ3A 3UEYA 1W4RA 2V1CC 4GI3C 1SGRI 3OXGA 1BUSA 2KMRA 1X74A 2QPOA 1TGSI 1HJAI 1SGYI 1YTPA 2B0UC 3D00A 4FKDA 1SGNI 1OMUA 1Z7KB 2KMOA 1DS2I 1PTQA 2WCYA 3KY9A 2SGFI 3OVOA 1FAQA 5HI7A 5FUVA 2ENZA 1UVGA 2FNFX 3CXLA 3SGBI 2E73A 2JA1A 2P6AC 3UGIA 1IY6A 1KMAA 4UXIA 2CJSC 2WVJA 1TBOA 1PPFI 2XRCA 2ODDA 2KMQA 1IW4A 1LR7A 2SGDI 1XBTA 2GKVA 5FUXA 1M8CA 2OVOA 2E5RA 1Y8FA 1UVFA 2J87A 1CSOI 2ENNA 1KBFA 2N52A 1FYBA 3MEKA 2GKTI 1N13A 1PTRA 2ARPF 1U5KA 2SGQI 2NU3I 4E1PA 1OMTA 2ERWA 3BJIA 1PJUA 1LR9A 3UEJA 3GOXA 1X4SA 1TIHA 1TUSA 2NU0I 1KBEA 4E1RA 1XA6A 3FC3A 1MT1A 3OXFA 5JHWC 2BUSA 5EX3A 5FUYA 3OL0A 5DAEA 2L7XA 3VDUA 2QQDA 3UGLA 3E59A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L8E A;  2W0T A; 
#chains in the Genus database with same CATH topology
 1AN1 I;  3UOE A;  1FAR A;  5E3R A;  2F3C I;  4L9M A;  1CT4 I;  1R0R I;  3OXL A;  2OD1 A;  2B8T A;  3SGQ I;  1CGJ I;  1M8B A;  1CHO I;  2K9H A;  2KCX A;  4HGU A;  3QAH A;  3PDN A;  2X3T A;  1OVO A;  2ROW A;  2V1C A;  2NU1 I;  2VRW B;  3TOA A;  2N71 A;  5E3P A;  2A20 A;  2GKR I;  4A24 A;  1PCE A;  1XX6 A;  2WGC A;  1NUB A;  1SGE I;  3HH2 C;  1CE3 A;  2ORV A;  1TBR R;  1V1I A;  1UUC A;  1MJA A;  3R5D A;  1BMO A;  2GVI A;  2QQC A;  2RIJ A;  3RU0 A;  1RFH A;  1H0Z A;  2JXD A;  1R79 A;  2M5X A;  1CT0 I;  2LEO A;  2PQ8 A;  5CCL A;  2KMP A;  1VDD A;  2N17 A;  2ORW A;  2SGP I;  2CWG A;  5EX0 A;  1YU6 C;  2J9R A;  1SGD I;  2N1A B;  3SEK C;  3VDP A;  1Y1B A;  2LUY A;  1MJB A;  5HQ8 A;  1TOT A;  2SGE I;  1Z2I A;  3UFF A;  1ULN A;  4SGB I;  1TUR A;  2YUU A;  1TBN A;  3TO9 A;  1TBQ R;  3FSX A;  4B6D A;  3UGD A;  3TJQ A;  1SGP I;  1ULK A;  4OVO A;  1HPT A;  1OYV I;  3R5C A;  1DS3 I;  1IY5 A;  2NU2 I;  1V1H A;  2DKV A;  5FUW A;  1MJ9 A;  1CGI I;  1HDL A;  1WGT A;  2GIV A;  4UXJ A;  3QTL D;  2DB6 A;  2JW6 A;  2DIP A;  2JZM A;  1W3S A;  2W0T A;  3QWP A;  3R5B A;  1HEV A;  1SGQ I;  2L8E A;  5J8C A;  2JYY A;  7WGA A;  3B4V C;  4JCV E;  2V53 A;  2QQE A;  1CT2 I;  3E2I A;  2ELI A;  2UVO A;  3R5A A;  2QQ0 A;  3VE5 A;  4UXH A;  2NU4 I;  2X52 A;  5CCM A;  1LR8 A;  9WGA A;  5J8F A;  2CWH A;  1Y1C A;  1Q9B A;  1K7V A;  2YQP A;  1K7T A;  1K7U A;  2UZ3 A;  3UEY A;  2RC4 A;  1W4R A;  2V1C C;  4GI3 C;  1SGR I;  3OXG A;  1BUS A;  1NXU A;  1WTJ A;  1X74 A;  2KMR A;  1TGS I;  2QPO A;  1HJA I;  1SGY I;  1YTP A;  2B0U C;  3D00 A;  4FKD A;  1SGN I;  1OMU A;  1Z7K B;  2KMO A;  1DS2 I;  1PTQ A;  2WCY A;  3KY9 A;  2SGF I;  1FY7 A;  3OVO A;  5HI7 A;  4AML A;  5FUV A;  1FAQ A;  2ENZ A;  1UVG A;  2FNF X;  3CXL A;  3SGB I;  2E73 A;  2JA1 A;  2P6A C;  3UGI A;  1IY6 A;  1KMA A;  4UXI A;  2CJS C;  2WVJ A;  1TBO A;  1PPF I;  2XRC A;  2ODD A;  2Y0M A;  2KMQ A;  1IW4 A;  1P9Z A;  1S20 A;  1LR7 A;  2SGD I;  1XBT A;  2GKV A;  5FUX A;  2LB7 A;  1M8C A;  1UHA A;  2OVO A;  2E5R A;  1Y8F A;  1UVF A;  2J87 A;  1CSO I;  2ENN A;  1KBF A;  2N52 A;  1FYB A;  3MEK A;  4DNC A;  2GKT I;  1N13 A;  1PTR A;  2ARP F;  1U5K A;  1WGC A;  2OZU A;  2SGQ I;  3TOB A;  2NU3 I;  4E1P A;  1OMT A;  2CWF A;  2ERW A;  3BJI A;  3FSY A;  1PJU A;  3TO7 A;  1LR9 A;  3UEJ A;  3GOX A;  1X4S A;  1TIH A;  1TUS A;  2NU0 I;  1KBE A;  3TO6 A;  1XA6 A;  4E1R A;  3FC3 A;  1MT1 A;  3OXF A;  4WP4 A;  5E3Q A;  1WKX A;  2BUS A;  5EX3 A;  5FUY A;  3OL0 A;  5DAE A;  2L7X A;  2OU2 A;  5JHW C;  3VDU A;  2QQD A;  4MPI A;  3UGL A;  3E59 A;  1P9G A;  1ULM A; 
#chains in the Genus database with same CATH homology
 1AN1 I;  1FAR A;  2F3C I;  4L9M A;  1CT4 I;  1R0R I;  3OXL A;  2OD1 A;  2B8T A;  3SGQ I;  1CGJ I;  1M8B A;  1CHO I;  2K9H A;  2KCX A;  4HGU A;  3PDN A;  1OVO A;  2ROW A;  2V1C A;  2NU1 I;  2VRW B;  2N71 A;  2A20 A;  2GKR I;  4A24 A;  1PCE A;  1XX6 A;  1NUB A;  1SGE I;  3HH2 C;  1CE3 A;  2ORV A;  1TBR R;  1V1I A;  1UUC A;  1BMO A;  2GVI A;  2QQC A;  3RU0 A;  1RFH A;  1H0Z A;  2JXD A;  1R79 A;  2M5X A;  1CT0 I;  2LEO A;  5CCL A;  2KMP A;  1VDD A;  2N17 A;  2ORW A;  2SGP I;  5EX0 A;  1YU6 C;  2J9R A;  1SGD I;  2N1A B;  3SEK C;  3VDP A;  1Y1B A;  2LUY A;  5HQ8 A;  1TOT A;  2SGE I;  3UFF A;  4SGB I;  1TUR A;  2YUU A;  1TBN A;  1TBQ R;  4B6D A;  3UGD A;  3TJQ A;  1SGP I;  4OVO A;  1HPT A;  1OYV I;  1DS3 I;  1IY5 A;  2NU2 I;  1V1H A;  5FUW A;  1HDL A;  1CGI I;  4UXJ A;  3QTL D;  2DB6 A;  2JW6 A;  2DIP A;  2JZM A;  1W3S A;  2W0T A;  3QWP A;  1SGQ I;  2L8E A;  2JYY A;  3B4V C;  4JCV E;  2V53 A;  2QQE A;  1CT2 I;  3E2I A;  2ELI A;  3VE5 A;  2QQ0 A;  4UXH A;  2NU4 I;  5CCM A;  1LR8 A;  1Y1C A;  2YQP A;  2UZ3 A;  3UEY A;  1W4R A;  2V1C C;  4GI3 C;  1SGR I;  3OXG A;  1BUS A;  2KMR A;  1X74 A;  2QPO A;  1TGS I;  1HJA I;  1SGY I;  1YTP A;  2B0U C;  3D00 A;  4FKD A;  1SGN I;  1OMU A;  1Z7K B;  2KMO A;  1DS2 I;  1PTQ A;  2WCY A;  3KY9 A;  2SGF I;  3OVO A;  1FAQ A;  5HI7 A;  5FUV A;  2ENZ A;  1UVG A;  2FNF X;  3CXL A;  3SGB I;  2E73 A;  2JA1 A;  2P6A C;  3UGI A;  1IY6 A;  1KMA A;  4UXI A;  2CJS C;  2WVJ A;  1TBO A;  1PPF I;  2XRC A;  2ODD A;  2KMQ A;  1IW4 A;  1LR7 A;  2SGD I;  1XBT A;  2GKV A;  5FUX A;  1M8C A;  2OVO A;  2E5R A;  1Y8F A;  1UVF A;  2J87 A;  1CSO I;  2ENN A;  1KBF A;  2N52 A;  1FYB A;  3MEK A;  2GKT I;  1N13 A;  1PTR A;  2ARP F;  1U5K A;  2SGQ I;  2NU3 I;  4E1P A;  1OMT A;  2ERW A;  3BJI A;  1PJU A;  1LR9 A;  3UEJ A;  3GOX A;  1X4S A;  1TIH A;  1TUS A;  2NU0 I;  1KBE A;  4E1R A;  1XA6 A;  3FC3 A;  1MT1 A;  3OXF A;  5JHW C;  2BUS A;  5EX3 A;  5FUY A;  3OL0 A;  5DAE A;  2L7X A;  3VDU A;  2QQD A;  3UGL A;  3E59 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...