2W10A

Mona sh3c in complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
LGSVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2-RELATED ADAPTOR PROTEIN 2
publication title Distinct Binding Modes of Two Epitopes in Gab2 that Interact with the Sh3C Domain of Grb2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 11
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2w10A00
1OPLA 2EGAA 2E5KA 2EQIA 4GBQA 2DL4A 2LX7A 2RQWA 4AFUC 2BZXA 2M51A 2DJQA 3VS4A 2KXCA 1KFZA 2GGRA 4ORZA 1GCPA 1JXMA 2I0NA 1B3QA 1AWWA 2DF6A 2JM8A 4JZ3A 2FPFA 2DRKA 3VS5A 1ZBJA 2AZSA 2A08A 1KJWA 2AKLA 2CDTA 3FJ5A 3LH5A 3M0TA 4D8DA 2NWMA 2EGEA 4J9EA 2C0TA 1JQQA 2L0AA 2PTKA 3EGUA 1SRMA 1SHFA 4LUEA 4Z8AA 1TUDA 1T0JA 3R6NA 1EFNA 2SEMA 1WX6A 2HBWA 1YCSB 1CSKA 1K4US 2K7AA 4CC2A 4EIKA 2NUZA 2SRCA 1HSQA 3EG0A 1SSHA 1WA7A 1GCQC 1X6GA 1ABQA 4LE9A 2BTTA 5GJVB 3PE0A 2DNUA 3RNJA 1WXBA 1X2QA 1X69A 1WYXA 2YUOA 1U3OA 4J9HA 3H0HA 4RTVA 5HCKA 3NPFA 2DRMA 4OMMA 4Z89A 1Z9ZA 1ZUUA 3TVTA 4CC4B 2PNIA 1PRMC 3C0CA 2ENMA 1K1ZA 2DL8A 3UA6A 3PVLA 1TUCA 2C0IA 1GBRA 4JJBA 3EHQA 4X1VA 2HEQA 1PKTA 1KIKA 5IXFA 2YT6A 1BB9A 2MCNA 1UFFA 1UECA 2VKNA 4OMNA 2F2VA 1NLOC 5FWBA 4J9DA 2EYYA 1W70A 1YWOA 1FYNA 2D8HA 4RUGA 2O88A 1UHCA 1S1NA 1UHFA 1NYGA 1UDLA 1OPKA 2RN8A 4J9CA 1GRIA 2K79A 1PHTA 2FG0A 3VS6A 1NEBA 2ED0A 4KRTA 2DMOA 2JM9A 2A36A 1A0NB 2CT3A 1RLPC 1AWXA 3ZL7C 3VRYA 1W6XA 1WDXA 1ZLMA 1RI9A 2LNHB 2JMCA 1N5ZA 1UJYA 4AG1C 2KEAA 1GBQA 2KNBB 2LQNA 2DILA 1T3SA 1GFDA 2FEIA 2FRWA 1VYTA 1NEGA 4ESRA 1KSWA 4AFZC 2GNCA 2DL3A 2L3PA 5FW9A 4AFQC 4GLMA 1X2KA 1X27A 2O9VA 1X6BA 2DBMA 2FPDA 1Y0MA 4Y92A 2JXBA 2L3QA 1UG1A 4ZNXA 1SRLA 1G83A 1YN8A 2EKHA 4R0KA 2AZVA 2DE0X 2JS2A 2ROLA 5FWCA 3UA7A 1T3LA 3VS0A 2CUBA 4DEXA 2O2OA 1K76A 2CH4A 1M30A 2J05A 2V1QA 1QWEA 2YUNA 4RTZA 2VWFA 1Z9QA 4IIOA 3VRZA 2DYBA 1UTIA 2KXDA 2RF0A 3O5ZA 2BZ8A 2FRYA 2JW4A 1AWJA 1RUWA 1I1JA 2K6DA 2ESWA 2V1RA 5IXBA 2LJ0A 1Y57A 2DA9A 2DVJA 4HVUA 1AWOA 1QKWA 1AVZC 2CSIA 1MV0B 2DM1A 1M3BA 1E7OA 4JZ4A 4JPBW 3KFVA 3REAB 1JO8A 2GQIA 4JJCA 1MV3A 2A28A 1M3AA 5ECAA 1G2BA 2FPEA 2EW3A 4RTTA 4F17A 2KRSA 2LJ1A 3VS2A 2EYZA 1AOJA 3SEMA 2X3XD 3UATA 3M0QA 1QWFA 4HVVA 2EGCA 4WCIA 4J9IA 3H0IA 1WIEA 3I35A 5GJWB 2LQWA 1ARKA 2QDLA 2HDAA 2D8JA 1J3TA 3ULRB 3M0RA 1JXOA 5L23A 2X3WD 1B07A 3REBB 2ABLA 2H8HA 4E6RA 1ZX6A 2CREA 3TSWA 2M0YA 2EYXA 3H0FA 4OMOA 5IHKA 1IO6A 2CUDA 1UE9A 4LUDA 2HCKA 1WFWA 2LMJA 2RQTA 4HVWA 3I5RA 1XOVA 3QWYA 3GBQA 2EYWA 1T0HA 3CQTA 1FMKA 2CSQA 3EG1A 2D0NA 2RPNA 2B86A 2YSQA 4AFSC 1QKXA 3THKA 1SEMA 2KRNA 1VA7A 1PKSA 2JT4A 2KROA 5IHNA 1U06A 3EG3A 2YUPA 3I5SA 3QWXX 2F2XA 1ZSGA 2CH4W 1UUEA 2ECZA 2KT1A 3UF4A 3VS3A 4FSSA 1AD5A 4DEYA 1H3HA 4RTXA 1ABOA 4F14A 1M3CA 4J9FA 3SHWA 5IH2A 2RMOA 4LNPA 1AZGB 1TG0A 5EC7A 1AEYA 2JTEA 2KR3A 2F2WA 1UGVA 2K2MA 1WI7A 1YP5A 1U5SA 3PVQA 3RBBB 2YUQA 4Z88A 2J06A 2JMAA 2J6KA 2D1XA 1GFCA 2MOXA 1HD3A 1WLPB 1SPKA 4A63B 2DL7A 1K0SA 2RQVA 1UJ0A 3M0PA 1K9AA 1VYVA 3JV3A 4IIMA 4RTUA 2DL5A 1W1FA 1QLYA 4J9GA 1SHGA 2EVRA 2GTOA 2KRMA 3EG2A 2LJ3A 1WXTA 2JS0A 4HXJA 2DBKA 2C0OA 2P4RA 2CT4A 2MIOA 1HJDA 1E6GA 2YDLA 4JJDA 1NG2A 2OJ2A 2GBQA 1OEBA 1BK2A 3VS1A 1LCKA 1NM7A 1I07A 2EPDA 4QT7A 4D8KA 1V1CA 2K3BA 1H92A 4OMPA 3EHRA 1H8KA 1BBZA 2OI3A 2ROTA 1CKAA 4CC7A 1MUZA 1X43A 4OMLA 3IQLA 1YNZA 2KYMA 1GCQA 2DX1A 3A98A 5I11A 2L3SA 2O9SA 4RTWA 1NLPC 2RQUA 1OOTA 1ZUKA 1M8MA 2RQRA 3H41A 2KT8A 1WXUA 1K0XA 1ZUYA 2HSPA 1JEGA 2EBPA 2J7IA 4RTYA 2K9GA 3NGPA 1M27C 3M0SA 2W10A 4M4ZA 1RLQC 2J6FA 1OV3A 2W0ZA 4J9BA 1JU5C 1YWPA 4K11A 2GTJA 2G6FX 4OMQA 2KBTA 2VVKA 3NHNA 3VS7A 1I0CA 4AG2C 5IHIA 3M0UA 2J6OA 2DLPA 2PZ1A 3TSZA 4HCKA 2LZ6B 2O31A 3I9QA 2FO0A 1PNJA 2KGTA 4F16A 2AKKA 1AZEA 1CKBA 1QCFA 2OAWA 2ED1A 2LP5A 5I22A 2KYBA 1GL5A 3U23A 4LN2A 2BZYA 1PWTA 3NMZC 1E6HA 1BU1A 2A37A 2RNAA 2AK5A 1PRLC 4CC3A 2KE9A 2IIMA 1NYFA 2L2PA 2XMFA 1VYUA 2LCSA
chains in the Genus database with same CATH superfamily
3P8HA 2PUOB 1NPRA 1OPLA 3FIFA 4AFUC 2BZXA 4C92F 5CKDA 4MDWA 1FXXA 3VS4A 4CI0C 2ZPFB 4A53A 1QP2A 4A4FA 5CKHA 1YJNA 1AWWA 1V29B 4WF2A 3INZA 3VS5A 4M7DC 1AHJB 2A08A 2AKLA 2ZCFB 4AT1B 5HK3A 4PFPA 1VQ5T 4D8DA 2EGEA 1JQQA 2L0AA 3EGUA 4BY6B 4O5VA 4KUIA 4LUEA 3RERA 4BI4A 3HSBA 1T0JA 1FMWA 1VQOQ 2CP5A 4GLKA 2SEMA 2HBWA 1LJOA 2HL3A 1YI2T 3CPFA 2KAFA 2RJEA 4PJJA 4A4KA 3MHXA 2P0QA 3V7RA 3L2WA 1YJ9T 3JRZA 1X6GA 2P0KA 2E3IA 2DTHA 3BY7A 2QEXT 2BTTA 3PE0A 4ZN1A 3CBMA 1PCXA 2RK2A 2H3JA 2LDMA 1ZSZA 2EYQA 3PFSA 3EAEA 2KI7A 4OMMA 1ZUUA 2VC8A 1FWZA 4X34A 2ENMA 4M78C 1K1ZA 2K5FA 3UA6A 1TUCA 2GQVA 4DOVA 3EHQA 2K4YA 2CS7A 3L2VA 1BB9A 1WGSA 2VKNA 5A2QE 4OMNA 1TXQA 5FU6B 4J9DA 4PL6A 1W70A 1FYNA 1VQ6Q 2D8HA 2O88A 5CAIA 1YIJA 1TS9A 5KYXB 1OPKA 2RN8A 2L3RA 2VGMA 1GRIA 1PHTA 3QPHA 5AT1B 2ED0A 1D3BB 2JM9A 1A0NB 3VUBA 3ZL7C 2XD0A 3L42A 2HMAA 1JB0E 1MGQA 1HYOA 1OZ3A 2EIFA 4A4EA 1RADB 4AG1C 2KNBB 4F7UF 4KGVB 1GFDA 2FEIA 2IVWA 1DJ7B 3CCEA 1I5LA 4GY5A 1KSWA 4AFZC 4Z02A 1G3YA 2DL3A 3OYJA 5FW9A 4AFQC 3JCMW 4GLMA 1M90U 1X2KA 1P92A 2O9VA 3CCMT 4D6WA 1Y0MA 3CXCP 4EMGA 4F7UE 3MCAB 1UG1A 4ZNXA 4FIBA 2A0FB 5D6XA 2FHDA 1SRLA 3T9NA 2AZVA 1M2VA 2ROLA 3QBYA 2CUBA 4DEXA 3CMAT 1K76A 4NS5A 2CH4A 4OF1A 1NBEB 4DOWA 3KBGA 4J7FA 1UTIA 2RF0A 4PJOA 2M0OA 3O5ZA 3QHSA 3OS5A 2YXYA 1KG1A 2M02A 2K6DA 2ESWA 5IXBA 4M7DF 4RMOA 2NUPA 3OW2P 2DA9A 1B34A 2X4XA 4HVUA 1QKWA 4NL3A 2VB6A 5A0LA 1OYXA 2F1LA 1SKUB 4J5YA 3EG9A 1E7OA 1K73C 4M7DE 1ZSZB 1QP3A 3REAB 2OTLQ 1N27A 1NJIR 3UPUA 4J83A 1MV3A 1KHCA 2A28A 2OX7A 5A0GA 3OYIA 4F17A 1VQMT 7AT1B 3G4SQ 4N4GA 3QO3A 4OMFB 1Q86R 1VQNT 1R0BG 2RI3A 1Q82U 4JS5A 3C4SA 3E9GA 2LQWA 5GJWB 2RM4A 1ARKA 2HDAA 3ASKA 3RKWA 1YJWA 3ULRB 3HRTA 2PU9B 1D1CA 2KQWA 5L23A 2X3WD 1VQLT 2H8HA 3OYMA 4ZTJA 4E6RA 2HZYA 1EZZB 2MPXC 4M78F 4PJMA 2CZ6B 2CREA 1HXDA 2M0YA 2EYXA 3H0FA 1QVPA 4QKUA 3JCMc 2CUDA 2HAXA 1UE9A 2XDBA 3SB2A 1WHGA 2CYZB 1UB4A 3CCJA 2XHCA 4KULA 4M78E 1Q81R 4PK4A 3DKMA 1M1FA 2MWPA 1KD1C 1XOVA 2DERA 5EG2A 2FZGB 3GBQA 3SWNC 2ZZDA 2D0NA 2RPNA 2YSQA 2QDYB 1VA7A 2CZ1B 1QMCA 4AMCA 2RH2A 4FYYB 5J26A 1ZSGA 3JCMP 5LJ3d 4E7HA 2DZCA 4FSSA 2CZ7B 3CCSQ 1AD5A 4DEYA 2E1HA 1M2VB 4A4GA 1M3CA 4II1A 1RAIB 1VQ7Q 1ZA2B 3RKXA 3JCMX 3HTRA 3WVEB 1VQ8A 2VXEA 5EC7A 3LWIA 1R0CB 4Q5WA 5LJ3f 5KYYA 4B6MA 1YP5A 4MMKA 1NE8A 2Y90A 1YHQA 2NUPB 3GP8A 5KE2A 1HD3A 1WLPB 5CK9A 1SPKA 3QXEB 4A63B 1K0SA 1UJ0A 1K9AA 3JV3A 4IIMA 5DY9A 2DL5A 3S6WA 1QLYA 2MWOA 2EVRA 3EG9B 3MO8A 1WXTA 2JS0A 4EMKC 2C0OA 2P4RA 2L89A 1ACMB 1HJDA 3OYGA 2R5MA 1BK2A 3DLMA 1KC8U 2X35A 3VS1A 1MNEA 4IURA 1X01A 4D8KA 2LRQA 4FYWB 4JRPA 5HK0A 1I4K1 3OW2A 1H92A 4UC4A 1D09B 2EJFA 5HY6A 3EHRA 1H8KA 2ROTA 3MP1A 3QJYA 3IQLA 1GCQA 4LDUA 2DX1A 3A98A 1QVGS 2L3SA 2LT1A 2QQRA 2DTIA 2RQUA 5LJ5h 1OOTA 2OAUA 3PGGA 2MK5A 4ATOA 3LGFA 1YJ9A 3C12A 1N8RU 2J7IA 3WVDB 4PFOA 2QEXA 3NGPA 3M0SA 4M4ZA 2J6FA 4OVAA 1G5VA 1OU8A 1M1KU 2G6FX 4OMQA 1I0CA 2HL5C 1VQ4Q 4B9XA 2V8IA 2CGHA 3OS1A 3CC7A 2LZ6B 4XQ3A 2QI2A 2FO0A 1IZ6A 4J6XA 5GANd 1SG5A 1RAHB 5GMKe 4EPCA 3GNFB 2ED1A 1K73R 2LP5A 1C6VX 3MP6A 1ZQ1A 2COZA 1IHWA 4BI3A 1HK9A 1E6HA 4FW2A 1I5OB 3EFRA 2AK5A 1PRLC 4N4IA 1PSEA 5IAYA 2IIMA 3I56Q 3CBOA 3OBWA 5LJ5g 2LCSA 2ZPBB 4MMLA 1G3SA 4CRIA 4E7KA 2E5KA 2EJGA 4XTZA 2RHYA 4GBQA 4FT2A 2XI9A 5CQYA 2GGRA 4ORZA 2I0NA 2BKDN 1B3QA 1XNIA 4JZ3A 1B7TA 3CCUQ 3KUFA 2X4WA 3G1JA 4BY6C 4KGXB 1K8AR 2PUKB 1K9MC 4Z8AA 1EIFA 3CCMA 2BUDA 1WHJA 4LDXA 1EFNA 5GMKi 2DXBA 6AT1B 1CSKA 2HBPA 2O01E 3CPWA 4XU2A 4EMKB 1YBYA 3CC4T 4EIKA 2VV5A 1HSQA 1VQ9Q 3CD6Q 2LCLA 3CMAA 4JRKA 1Y96A 2CKKA 2LT4A 1VQPT 3A8OB 1D0ZA 3QYHB 5GJVB 1VQKT 2DNUA 2XDPA 1X2QA 4PJOD 1WYXA 1F1BB 1U3OA 3H0HA 4RTVA 3HFNA 3NPFA 3JB9D 3CCJT 5KYUB 4Z89A 1Y7XA 1R8OB 1JJ2S 3OYNA 1PRMC 2HKQB 4DA4A 4JJBA 3M56A 2EWNA 3EGXA 2LTOA 2LNVA 5FU6C 3AHUA 2MCNA 1VIFA 1YCYA 1UFFA 1UECA 2AIRB 2E6NA 3JCMQ 3JCMd 5M9OA 5GAN5 2JVVA 1NLOC 1KQ2A 4N4HA 3G7ZA 5KCOA 3VYHB 2XDDA 4LXCA 2WACA 1S1NA 2OTJT 2QGFB 1QVFS 2XG8D 1NYGA 2VASA 4XTUA 4ANJA 2FG0A 3V8LA 3G71T 1NEBA 1OX8A 4KRTA 1XJWB 4XTXA 3RMSA 1M90C 1M8VA 3L2RA 1KQSS 3MEWA 5L8RE 1AWXA 4XTVA 3JCMf 3CC2T 3DB4A 3TCJA 3VRYA 4RKUE 2RB6A 2ZPGB 4LDVA 5KE3A 2MAMA 2XICA 5A0DA 4M7AA 1I81A 1PSFA 1TH7A 1GBQA 3ZBDA 3HP9A 3QDFA 1VYTA 2K5IA 4ESRA 4TVRA 5IT9E 3CCVQ 4MZMA 1N9RA 2L3PA 3BW1A 2P84A 1X27A 4L59A 2FPDA 3URGA 3FRNA 3D7SB 3QUIA 2EKHA 3G6ET 2V8KA 1MMGA 2DE0X 4C92E 2E6ZA 1YITQ 3VS0A 3LX7A 2WSEE 4RTZA 3I55Q 3MPUB 2DYBA 1S72Q 2KXDA 3QZ5B 2FRYA 1AWJA 3TQ7P 1I1JA 2BE7D 3QIIA 3VJPA 5KYWA 5GMKl 2LJ0A 1Y57A 9ATCB 5LJ5j 1D1BA 2XK0A 2DVJA 4C5GA 3VV0A 2CSIA 2ATCB 1M3BA 1WHMA 1ZSZC 3OYDA 1JRIA 3Q1JA 2E65A 3KFVA 2QA4T 4X9CA 5DLOA 3UDCA 5I2SA 1G2BA 2JNGA 2COWA 2O4XA 2EW3A 4RTTA 3OSVA 2KRSA 4FM4B 3VS2A 5LJ5f 2RD1A 4PJOG 4OB3B 3CC7T 2EYZA 2P0PA 3UATA 3M0QA 1QWFA 4IUQA 4HVVA 1YJNQ 5FRMA 3M5AA 3H0IA 4V2SA 2D0QB 1AT1B 4JUVA 3CEYA 3M4YA 1JXOA 3ER0A 1WZOA 3REBB 4LD6A 2ABLA 5D6YA 1K9MR 3LLRA 2FVUA 3HKSA 4OMOA 3PIPA 4JRIA 2I2LA 2HCKA 3OYEA 1IB8A 1M1GA 4M7AB 5FROA 5KH6A 1OU9A 1WFWA 4E2FB 3A5ZB 2V8JA 3DB3A 2EQJA 3QWYA 3CQTA 2AHJB 2CSQA 3VKIA 4AFSC 2HQEA 3THKA 2QQSA 1SEMA 2R5AA 1PKSA 4OGEA 2GF7A 5HKCA 4LD9K 3EG3A 3GF5A 3I5SA 1UUEA 3VS3A 4RTXA 1ABOA 2RHXA 1ZBXA 4J9FA 4PJOC 3SHWA 5IH2A 4LNPA 1AEYA 1D0YA 2YLBA 1YIJQ 4J6YA 3CCLT 4NL2A 3CCQT 1WJRA 3JB9H 3JCMV 1IHVA 1RL2A 5KYWB 4Z88A 5GMKm 2J6KA 1GFCA 1MMAA 2MOXA 4C5IA 2DD5A 1NJIU 1VYVA 4E7ZA 3EFOA 4PKCC 2D6FA 4J9GA 1PD0A 2DBKA 2RI5A 2IG0A 2QTXA 2MIOA 1Q86U 2YDLA 3QSUA 3CCEQ 2LQ8A 1WPYA 4EMHA 2O4XB 1NG2A 1PC0A 3X20B 5FRNA 5CKEA 5D7UA 1NM7A 1I07A 2EPDA 4QT7A 1V1CA 2PVDB 2LX9A 2GCXA 2DVEA 4OMPA 2VYTA 2H3EB 1BBZA 4CC7A 1CKAA 1YNZA 2RHIA 3V8KA 3N5BB 5I11A 2M1HA 4C0DB 3CC4A 1NLPC 1ZUKA 1M8MA 2K2VA 2RQRA 3H41A 5GAMg 2Y4XA 1VQOT 3DLLA 1WXUA 1K0XA 2A7YA 1FMVA 3SDZA 1RACB 4RTYA 1VQPA 3MKDA 2K9GA 2DJZA 3VU3C 1VQKA 2MI6A 1Q81U 2XU8A 2W10A 3OQ5A 1VQ7A 1OV3A 3EGDA 1JU5C 1YWPA 3JAME 5GMKh 4DBHA 2K3XA 5IHIA 2J6OA 4PNOA 4OB1B 1RAGB 3OB9A 4JLIA 4IKFA 1AZEA 1CKBA 2OAWA 2DK3A 5GAOq 5I22A 2KDSA 1BI2A 4BE0A 3U23A 4LN2A 3UWNA 1BU1A 2JJ9A 2CZ0B 2OTJA 1NYFA 2L2PA 4FCYA 3CXCS 1BCOA 4N0AC 2E12A 3G71A 1SSFA 4QVZA 3CCRQ 1R77A 3FC3A 2DL4A 1VQ6T 1Q7YC 3CC2A 2M51A 1YJWQ 3OYFA 4BDYA 2DJQA 1I8FA 1KFZA 3LYIA 1JXMA 4PJOB 3CPWP 2DF6A 4M7AD 2FPFA 2K3YA 8AT1B 3PMTA 2AZSA 3MEUA 1KJWA 3OSSC 3FJ5A 1YFNA 1B34B 2QQAA 3FEOA 3LH5A 3M0TA 3M57A 5GANe 3EFOB 1OX9A 2RJCA 3OW2S 2PTKA 2DXCA 1SRMA 4PJOF 4A54A 1RAAB 4C8QA 3VUZA 5GAMe 1QCNA 2DIQA 3NTKA 1UGQB 4HCZA 1W2BP 1WX6A 3CMEQ 3EFSA 3R6OA 4DBRA 1O75A 4CC2A 3G6EA 2NUZA 2SRCA 1VQ4A 2R58A 3S3NA 1C1AA 2KMTA 1RI0A 4M75A 1WNLA 1GCQC 1ABQA 4HCBA 1G3WA 4LE9A 2HNIA 1WXBA 4YTLA 3M4GA 3A8MB 2FZCB 4VUBA 1U1TA 2JZ2A 2QGGA 4J9HA 2DRMA 4JDSA 4KT0E 4CC4B 1VQ8Q 1UGPB 4IUTA 2PNIA 2EFIA 3C0CA 4E7LA 3PVLA 2RJDA 1GBRA 3A8HB 1IRXA 4QVCA 4OGCA 2HEQA 1PKTA 4PJNA 3F70A 3QJ6A 3EGDB 2QA4A 5IXFA 2YT6A 1YHQQ 3QDRB 1PD1A 5AYFA 2F2VA 5FWBA 4FW1A 5CCAA 1YWOA 1K73U 4RUGA 3RDVA 5GAOr 2MYSA 2E70A 1UHCA 4RCBA 4RCCA 4M77A 4HA8A 2OTLT 1U8RA 1O9SA 3PNWC 3L2QA 5GAOn 5CQXA 3M58A 2ZAEA 2F5TX 1W6XA 3G4ST 1WDXA 1VQ5Q 3BFMA 1RI9A 2LNHB 1N5ZA 4FYVB 2NLUA 2KEAA 2LQNA 2QXFA 3H9NA 4F04B 2QQBA 2FRWA 2HKNA 2GNCA 2YLCA 1YI2Q 4J8OA 1VQ9A 3CD6A 1BI1A 5KYYB 1X6BA 3WXMB 2JXBA 4C92A 5GAOp 1YJ9Q 2L3QA 1K8AU 2QEXQ 4PLIA 4R0KA 2JS2A 1IREB 5FWCA 3UA7A 1T3LA 2XIDA 4M7AG 3GPLA 2O2OA 4C8QB 1M30A 4ZTFA 3M55A 2VWFA 1PG5B 3VRZA 4C0GA 2BZ8A 2JW4A 2RO0A 4R55A 1KD1R 5CKBA 4IUVA 1WQ7A 2FB7A 1QCOA 5C0MA 4DQ2A 1OZ2A 3M53A 4M75B 3SFMA 2RHUA 5GAN8 1AVZC 1MV0B 5FLXE 3CCST 1BIAA 3TU4K 3CCLA 3CCQA 4JZ4A 2DO3A 3QZ9B 4JPBW 1X75C 3LH0A 4KBMB 2DXTA 3MEAA 1VQ7T 1JO8A 3L1AA 3J80E 5GMKj 1M3AA 3H6ZA 1W2BA 2LJ1A 1Q7YR 2LQKA 3JCMJ 2PVGB 5FU7B 2C06A 2FZKB 2X3XD 3GIBA 3GOXA 4MZTA 2LCCA 2XKOC 2EGCA 4WCIA 2RJFA 5LL6S 2HD0A 2DIGA 3M0RA 4M77B 1Q95G 3FJPA 2NYSA 1XQHA 4BACA 1M2OA 4E7SA 3CCMQ 1X6OA 3TSWA 4ZGJB 5IHKA 4XU3A 4M7AC 3J81E 2DYIA 4O6JA 2DZ9A 3OS2A 4OP0A 4PLLA 2LMJA 3I55A 3CMAQ 1PM3A 1U1SA 1VQOA 1JJ2A 4C5EA 1H3ZA 1T0HA 1QKXA 2VUBA 4F7UA 1RABB 1IGQA 2JT4A 1WHKA 4OB0B 2KROA 3QYGB 2ZPEB 3OA6A 1U06A 2YUPA 4LDYA 3TREA 2AT1B 2ECZA 2KT1A 1TOVA 1QVFA 3S3MA 2DD4A 2JOYA 4C0FA 5GAN6 5GAN3 1ZHIA 2L8DA 2E10A 3O8VA 1VQ4T 2YRVA 1MMNA 1KQSA 1Q86C 1AZGB 4XAXB 3X24B 2JTEA 2KR3A 1VQMQ 2DTOA 4FL6A 2K2MA 1VQNQ 3X25B 1UEBA 1IGUA 5CVIA 4PJLA 4DBQA 2J06A 1Q82C 3M59A 2DL7A 1D1AA 2RQVA 3M0PA 2DFUA 1VQ6A 1Y96B 4M7DA 1W1FA 5LJ3h 4JRQA 3I56T 2GTOA 2KRMA 5LJ5d 1N9SA 2X51A 3LGLA 2M16A 1VQLQ 2CT4A 3BE3A 1KQ1A 3FB9A 2OJ2A 2GBQA 1OEBA 2DPPB 2KSSA 1Q81C 2DEUA 4EDUA 2K3BA 3EGXB 3GNGA 3JB9G 4C8QD 3CCUT 4C0DC 3FLGA 2KYMA 1K9MU 2D9TA 4OB2B 2E64A 4FYXB 4RG2A 4FSXA 4Y91A 4DBFA 5I21A 2GFAA 2HSPA 1JEGA 2EBPA 4M75D 3RKYA 3RIRA 1M4ZA 4XTWA 2KK4A 5LJ3g 2WSCE 3M9QA 2EQMA 4M78A 3A8LB 2W0ZA 1VQ9T 4J9BA 3CD6T 2GTJA 2KBTA 4AG2C 3TSZA 3C94A 1MHNA 1VOMA 2QTVA 4HCKA 3PIOA 2JN0A 4PFZA 1JBMA 3RUXA 3EH1A 2F69A 1BI3A 4BI8B 1MNDA 2KGTA 1QCFA 4F7UB 2P4TA 1M5Q1 3PTAA 3A8GB 2KYBA 4M7AF 1GL5A 3SD4A 5DM7R 2BZYA 3BDLA 1BIBA 3NMZC 2RNAA 2A37A 3OMCA 2MF2A 2CP3A 1Y07A 3HL8A 1TU0B 2XMFA 3RR6A 3UT1A 2QYZA 4M77D 3ZFJA 2RK1A 2OTLA 3AT1B 1H641 1WJQA 5GAOl 2WSFE 4ELYC 2EGAA 4M7AE 3A1PA 2EQIA 2LX7A 2RQWA 8ATCB 3OS0A 3G4SA 2E3HA 3P8BB 2KXCA 1GCPA 3HPWA 5GANh 2KY9A 1UGRB 2JM8A 1KC8C 2DRKA 1ZBJA 5GAMh 4ME7A 2CDTA 1M90R 2NWMA 4M7DB 4J9EA 5I2MA 2C0TA 3V8JA 4B9WA 2EAYA 5J39A 2K5LA 1SHFA 1SF9A 1TUDA 2B8AA 2IPOB 1WQWA 3R6NA 2A3LA 4C92D 1YCSB 4C5HA 3CCVT 1K4US 3OYCA 2K7AA 1N8RC 2DETA 5LJ3e 1OI1A 2EJ9A 3EG0A 3GLXA 1SSHA 3BDUA 4JJNK 1WA7A 5CO7A 1OULA 1M9SA 4BUGA 1M1KC 2QQ9A 3RNJA 1IXDA 1X69A 2K57A 1RAFB 3NTIA 5C6SA 3HFOA 4KUDK 1YITT 2YUOA 5GANg 4IUUA 5HCKA 5CKFA 1TTHB 1TUGB 4C8QG 4KGZB 1Z9ZA 3TVTA 3I55T 3JB9J 3ME9A 1S72T 2DL8A 2C0IA 3TEEA 4X1VA 3CCSA 2JTMA 4M78B 3CCRA 1QVGP 1KIKA 2RA2A 1WJSA 2X9HA 5GAN4 4M75G 1WHLA 3MEVA 2EYYA 1Q82R 2X4JA 1UHFA 1UDLA 3LWHA 4IUPA 4J9CA 2K79A 3M54A 3VS6A 1TWBA 2DMOA 3P8DA 3OBYA 2A36A 2CT3A 1RLPC 4XU1A 4L5GA 1K8AC 4LDWA 5CIUA 3ZEHA 2Z0WA 2ZGWA 2MMPA 1ZLMA 2JMCA 2HQHA 1YJNT 1UJYA 4QVDA 4JLGA 1EX4A 3MP8A 3OYKA 2LVMA 2DILA 4P5NA 3CMEA 3CBPA 5GAOm 1T3SA 2RI2A 4Y28E 3JCMh 1NEGA 2DAQA 4M77G 3CC4Q 1LNXA 4QW2A 5LJ3j 1BI0A 3SWNA 1BCMA 2DBMA 4Y92A 3OMGA 1VQPQ 4XTYA 1VQKQ 2DXUA 4C8QC 1G83A 1YN8A 2QASA 2X4YA 1KHIA 5KCHA 4J7IA 2QG9B 1Y71A 4WTOB 1KK7A 5GAN7 4MDXA 4N0AA 3H8ZA 3CCJQ 2J05A 2V1QA 1QWEA 2YUNA 1Z9QA 4IIOA 1N6AA 3JB9F 3X28B 1BYMA 4M75C 3LW5E 1D0XA 1RUWA 3CXCA 2DKGA 2V1RA 4PJOE 4C92G 3KXTA 1AWOA 4BDZA 3JCMg 1XTDA 2DM1A 2OTJQ 3X26B 4E7IA 1G8XA 3OY9A 2EQUA 4HT9A 3G71Q 2GQIA 4JJCA 4J6WA 2FYKA 3E9FA 5ECAA 5FU7C 4EMKA 1VQ5A 2FPEA 3CC2Q 4ZN3A 1YIJT 3L2ZA 1NPPA 2GFUA 1AOJA 4M7DD 3I56A 5J3BA 4QQDA 3SEMA 4BE1A 3PT9A 3C95A 2EQKA 1V76A 4J9IA 1RAEB 1UGSB 1VIEA 1KC8R 1WIEA 3I35A 1MMDA 4X9DA 2QDLA 3MJXA 4M77C 3VYGA 4QQGA 2D8JA 1YI2A 1JJ2P 1J3TA 4R56A 3RESA 5KYUA 1B07A 1ZX6A 1TSFA 3CCET 4FT4A 3CCUA 3S3OA 3FDRA 1IO6A 1GXIE 4LUDA 3NTHA 3G6EQ 2QK0A 1N8RR 2E5QA 1QVFP 1QVGA 5GANj 2E4HA 2RQTA 4HVWA 2YRDA 3I5RA 2CP7A 5GAMj 1KQSP 2CP6A 2EYWA 1M1KR 3OYHA 1LOJA 1FMKA 4A4HA 3EG1A 1ZA1B 2B86A 2VXFA 2E41A 2NUTA 4C92C 5GAMd 5KYNA 2KRNA 3SWNB 4M78D 5IHNA 2HSEB 3QWXX 2F2XA 2PQWA 3JCMe 2CH4W 5GANf 3UF4A 3CPWS 2HQXA 1H3HA 4JS4A 2JUFA 4F14A 5GAMf 2QA4Q 2PVOB 1KD1U 2RMOA 1TG0A 2ZPIB 3HRUA 3E1SA 2F2WA 1UGVA 1NZ9A 4NOYA 4ZGDB 3CC7Q 1WI7A 2FL7A 4F7UG 3E19A 1U5SA 2LC4A 3PVQA 3RBBB 1W2BS 2YUQA 4FU6A 2JMAA 4KH0B 3JCMb 2D1XA 2YHTA 5GAN2 4C8QF 3OYAA 5DLQE 4RTUA 2R57A 1SHGA 3EG2A 2LJ3A 4E7JA 2BIVA 1W4SA 1G3TA 4HXJA 1Q7YU 4RG8A 3CCRT 2F5KA 1OQKA 1QQJA 1E6GA 3EH2A 4C8QE 1YJWT 4JJDA 4M75F 1C0MA 1FX7A 2M9UA 1VUBA 2KVQG 4XK8E 2V26A 1LCKA 4C0ZA 1WHHA 4BB7A 1LVKA 3OYBA 5IN1A 3V7SA 3OYYA 2QAZA 3V7CA 3META 2OI3A 1MUZA 3NFCA 1X43A 4M75E 4OMLA 1LPLA 2BE9B 4QQ6A 2COYA 3CCVA 4M7DG 2CP0A 2YWWA 4BE2A 2O9SA 3L2UA 4RTWA 2Y4YA 5CR2A 3QKJA 3HRSA 2G3RA 2KT8A 4HT8A 4ZGEB 1ZUYA 3CMET 1M27C 5LJ5e 4L6V5 1RLQC 1YITA 4K11A 2L5QA 2DEQA 4M77F 2VVKA 3NHNA 3VS7A 3M0UA 2PZ1A 2DLPA 4KH1B 4E47A 2CP2A 4HKEA 1VQMA 2ZPHB 1QW1A 3JSCA 2O31A 3OYLA 1S72A 5D6WA 3I9QA 5KYXA 1VQNA 2RHZA 3HHTB 1PNJA 4F16A 3CCLQ 4BD3A 3CCQQ 2AKKA 3E2UA 2NUTB 1D3BA 2JTFA 4M77E 4XU0A 2YRCA 1VQ8T 4HCCA 3J7AF 2EKOA 1PWTA 3QG1A 4C92B 3JB9I 3RMQA 2VGNA 4MZPA 4CC3A 2KE9A 3PMIA 1VQLA 4M78G 4ELZC 1NJIC 1VYUA 1YHQT 1BKBA
chains in the Genus database with same CATH topology
1OPLA 2EGAA 2E5KA 2EQIA 4GBQA 2DL4A 2LX7A 2RQWA 4AFUC 2BZXA 2M51A 2DJQA 3VS4A 2KXCA 1KFZA 2GGRA 4ORZA 1GCPA 1JXMA 2I0NA 1B3QA 1AWWA 2DF6A 2JM8A 4JZ3A 2FPFA 2DRKA 3VS5A 1ZBJA 2AZSA 2A08A 1KJWA 2AKLA 2CDTA 3FJ5A 3LH5A 3M0TA 4D8DA 2NWMA 2EGEA 4J9EA 2C0TA 1JQQA 2L0AA 2PTKA 3EGUA 1SRMA 1SHFA 4LUEA 4Z8AA 1TUDA 1T0JA 3R6NA 1EFNA 2SEMA 1WX6A 2HBWA 1YCSB 1CSKA 1K4US 2K7AA 4CC2A 4EIKA 2NUZA 2SRCA 1HSQA 3EG0A 1SSHA 1WA7A 1GCQC 1X6GA 1ABQA 4LE9A 2BTTA 5GJVB 3PE0A 2DNUA 3RNJA 1WXBA 1X2QA 1X69A 1WYXA 2YUOA 1U3OA 4J9HA 3H0HA 4RTVA 5HCKA 3NPFA 2DRMA 4OMMA 4Z89A 1Z9ZA 1ZUUA 3TVTA 4CC4B 2PNIA 1PRMC 3C0CA 2ENMA 1K1ZA 2DL8A 3UA6A 3PVLA 1TUCA 2C0IA 1GBRA 4JJBA 3EHQA 4X1VA 2HEQA 1PKTA 1KIKA 5IXFA 2YT6A 1BB9A 2MCNA 1UFFA 1UECA 2VKNA 4OMNA 2F2VA 1NLOC 5FWBA 4J9DA 2EYYA 1W70A 1YWOA 1FYNA 2D8HA 4RUGA 2O88A 1UHCA 1S1NA 1UHFA 1NYGA 1UDLA 1OPKA 2RN8A 4J9CA 1GRIA 2K79A 1PHTA 2FG0A 3VS6A 1NEBA 2ED0A 4KRTA 2DMOA 2JM9A 2A36A 1A0NB 2CT3A 1RLPC 1AWXA 3ZL7C 3VRYA 1W6XA 1WDXA 1ZLMA 1RI9A 2LNHB 2JMCA 1N5ZA 1UJYA 4AG1C 2KEAA 1GBQA 2KNBB 2LQNA 2DILA 1T3SA 1GFDA 2FEIA 2FRWA 1VYTA 1NEGA 4ESRA 1KSWA 4AFZC 2GNCA 2DL3A 2L3PA 5FW9A 4AFQC 4GLMA 1X2KA 1X27A 2O9VA 1X6BA 2DBMA 2FPDA 1Y0MA 4Y92A 2JXBA 2L3QA 1UG1A 4ZNXA 1SRLA 1G83A 1YN8A 2EKHA 4R0KA 2AZVA 2DE0X 2JS2A 2ROLA 5FWCA 3UA7A 1T3LA 3VS0A 2CUBA 4DEXA 2O2OA 1K76A 2CH4A 1M30A 2J05A 2V1QA 1QWEA 2YUNA 4RTZA 2VWFA 1Z9QA 4IIOA 3VRZA 2DYBA 1UTIA 2KXDA 2RF0A 3O5ZA 2BZ8A 2FRYA 2JW4A 1AWJA 1RUWA 1I1JA 2K6DA 2ESWA 2V1RA 5IXBA 2LJ0A 1Y57A 2DA9A 2DVJA 4HVUA 1AWOA 1QKWA 1AVZC 2CSIA 1MV0B 2DM1A 1M3BA 1E7OA 4JZ4A 4JPBW 3KFVA 3REAB 1JO8A 2GQIA 4JJCA 1MV3A 2A28A 1M3AA 5ECAA 1G2BA 2FPEA 2EW3A 4RTTA 4F17A 2KRSA 2LJ1A 3VS2A 2EYZA 1AOJA 3SEMA 2X3XD 3UATA 3M0QA 1QWFA 4HVVA 2EGCA 4WCIA 4J9IA 3H0IA 1WIEA 3I35A 5GJWB 2LQWA 1ARKA 2QDLA 2HDAA 2D8JA 1J3TA 3ULRB 3M0RA 1JXOA 5L23A 2X3WD 1B07A 3REBB 2ABLA 2H8HA 4E6RA 1ZX6A 2CREA 3TSWA 2M0YA 2EYXA 3H0FA 4OMOA 5IHKA 1IO6A 2CUDA 1UE9A 4LUDA 2HCKA 1WFWA 2LMJA 2RQTA 4HVWA 3I5RA 1XOVA 3QWYA 3GBQA 2EYWA 1T0HA 3CQTA 1FMKA 2CSQA 3EG1A 2D0NA 2RPNA 2B86A 2YSQA 4AFSC 1QKXA 3THKA 1SEMA 2KRNA 1VA7A 1PKSA 2JT4A 2KROA 5IHNA 1U06A 3EG3A 2YUPA 3I5SA 3QWXX 2F2XA 1ZSGA 2CH4W 1UUEA 2ECZA 2KT1A 3UF4A 3VS3A 4FSSA 1AD5A 4DEYA 1H3HA 4RTXA 1ABOA 4F14A 1M3CA 4J9FA 3SHWA 5IH2A 2RMOA 4LNPA 1AZGB 1TG0A 5EC7A 1AEYA 2JTEA 2KR3A 2F2WA 1UGVA 2K2MA 1WI7A 1YP5A 1U5SA 3PVQA 3RBBB 2YUQA 4Z88A 2J06A 2JMAA 2J6KA 2D1XA 1GFCA 2MOXA 1HD3A 1WLPB 1SPKA 4A63B 2DL7A 1K0SA 2RQVA 1UJ0A 3M0PA 1K9AA 1VYVA 3JV3A 4IIMA 4RTUA 2DL5A 1W1FA 1QLYA 4J9GA 1SHGA 2EVRA 2GTOA 2KRMA 3EG2A 2LJ3A 1WXTA 2JS0A 4HXJA 2DBKA 2C0OA 2P4RA 2CT4A 2MIOA 1HJDA 1E6GA 2YDLA 4JJDA 1NG2A 2OJ2A 2GBQA 1OEBA 1BK2A 3VS1A 1LCKA 1NM7A 1I07A 2EPDA 4QT7A 4D8KA 1V1CA 2K3BA 1H92A 4OMPA 3EHRA 1H8KA 1BBZA 2OI3A 2ROTA 1CKAA 4CC7A 1MUZA 1X43A 4OMLA 3IQLA 1YNZA 2KYMA 1GCQA 2DX1A 3A98A 5I11A 2L3SA 2O9SA 4RTWA 1NLPC 2RQUA 1OOTA 1ZUKA 1M8MA 2RQRA 3H41A 2KT8A 1WXUA 1K0XA 1ZUYA 2HSPA 1JEGA 2EBPA 2J7IA 4RTYA 2K9GA 3NGPA 1M27C 3M0SA 2W10A 4M4ZA 1RLQC 2J6FA 1OV3A 2W0ZA 4J9BA 1JU5C 1YWPA 4K11A 2GTJA 2G6FX 4OMQA 2KBTA 2VVKA 3NHNA 3VS7A 1I0CA 4AG2C 5IHIA 3M0UA 2J6OA 2DLPA 2PZ1A 3TSZA 4HCKA 2LZ6B 2O31A 3I9QA 2FO0A 1PNJA 2KGTA 4F16A 2AKKA 1AZEA 1CKBA 1QCFA 2OAWA 2ED1A 2LP5A 5I22A 2KYBA 1GL5A 3U23A 4LN2A 2BZYA 1PWTA 3NMZC 1E6HA 1BU1A 2A37A 2RNAA 2AK5A 1PRLC 4CC3A 2KE9A 2IIMA 1NYFA 2L2PA 2XMFA 1VYUA 2LCSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OPL A;  2EGA A;  2E5K A;  2EQI A;  4GBQ A;  2DL4 A;  2LX7 A;  2RQW A;  4AFU C;  2BZX A;  2M51 A;  2DJQ A;  3VS4 A;  2KXC A;  1KFZ A;  2GGR A;  4ORZ A;  1GCP A;  1JXM A;  2I0N A;  1B3Q A;  1AWW A;  2DF6 A;  2JM8 A;  4JZ3 A;  2FPF A;  2DRK A;  3VS5 A;  1ZBJ A;  2AZS A;  2A08 A;  1KJW A;  2AKL A;  2CDT A;  3FJ5 A;  3LH5 A;  3M0T A;  4D8D A;  2NWM A;  2EGE A;  4J9E A;  2C0T A;  1JQQ A;  2L0A A;  2PTK A;  3EGU A;  1SRM A;  1SHF A;  4LUE A;  4Z8A A;  1TUD A;  1T0J A;  3R6N A;  1EFN A;  2SEM A;  1WX6 A;  2HBW A;  1YCS B;  1CSK A;  1K4U S;  2K7A A;  4CC2 A;  4EIK A;  2NUZ A;  2SRC A;  1HSQ A;  3EG0 A;  1SSH A;  1WA7 A;  1GCQ C;  1X6G A;  1ABQ A;  4LE9 A;  2BTT A;  5GJV B;  3PE0 A;  2DNU A;  3RNJ A;  1WXB A;  1X2Q A;  1X69 A;  1WYX A;  2YUO A;  1U3O A;  4J9H A;  3H0H A;  4RTV A;  5HCK A;  3NPF A;  2DRM A;  4OMM A;  4Z89 A;  1Z9Z A;  1ZUU A;  3TVT A;  4CC4 B;  2PNI A;  1PRM C;  3C0C A;  2ENM A;  1K1Z A;  2DL8 A;  3UA6 A;  3PVL A;  1TUC A;  2C0I A;  1GBR A;  4JJB A;  3EHQ A;  4X1V A;  2HEQ A;  1PKT A;  1KIK A;  5IXF A;  2YT6 A;  1BB9 A;  2MCN A;  1UFF A;  1UEC A;  2VKN A;  4OMN A;  2F2V A;  1NLO C;  5FWB A;  4J9D A;  2EYY A;  1W70 A;  1YWO A;  1FYN A;  2D8H A;  4RUG A;  2O88 A;  1UHC A;  1S1N A;  1UHF A;  1NYG A;  1UDL A;  1OPK A;  2RN8 A;  4J9C A;  1GRI A;  2K79 A;  1PHT A;  2FG0 A;  3VS6 A;  1NEB A;  2ED0 A;  4KRT A;  2DMO A;  2JM9 A;  2A36 A;  1A0N B;  2CT3 A;  1RLP C;  1AWX A;  3ZL7 C;  3VRY A;  1W6X A;  1WDX A;  1ZLM A;  1RI9 A;  2LNH B;  2JMC A;  1N5Z A;  1UJY A;  4AG1 C;  2KEA A;  1GBQ A;  2KNB B;  2LQN A;  2DIL A;  1T3S A;  1GFD A;  2FEI A;  2FRW A;  1VYT A;  1NEG A;  4ESR A;  1KSW A;  4AFZ C;  2GNC A;  2DL3 A;  2L3P A;  5FW9 A;  4AFQ C;  4GLM A;  1X2K A;  1X27 A;  2O9V A;  1X6B A;  2DBM A;  2FPD A;  1Y0M A;  4Y92 A;  2JXB A;  2L3Q A;  1UG1 A;  4ZNX A;  1SRL A;  1G83 A;  1YN8 A;  2EKH A;  4R0K A;  2AZV A;  2DE0 X;  2JS2 A;  2ROL A;  5FWC A;  3UA7 A;  1T3L A;  3VS0 A;  2CUB A;  4DEX A;  2O2O A;  1K76 A;  2CH4 A;  1M30 A;  2J05 A;  2V1Q A;  1QWE A;  2YUN A;  4RTZ A;  2VWF A;  1Z9Q A;  4IIO A;  3VRZ A;  2DYB A;  1UTI A;  2KXD A;  2RF0 A;  3O5Z A;  2BZ8 A;  2FRY A;  2JW4 A;  1AWJ A;  1RUW A;  1I1J A;  2K6D A;  2ESW A;  2V1R A;  5IXB A;  2LJ0 A;  1Y57 A;  2DA9 A;  2DVJ A;  4HVU A;  1AWO A;  1QKW A;  1AVZ C;  2CSI A;  1MV0 B;  2DM1 A;  1M3B A;  1E7O A;  4JZ4 A;  4JPB W;  3KFV A;  3REA B;  1JO8 A;  2GQI A;  4JJC A;  1MV3 A;  2A28 A;  1M3A A;  5ECA A;  1G2B A;  2FPE A;  2EW3 A;  4RTT A;  4F17 A;  2KRS A;  2LJ1 A;  3VS2 A;  2EYZ A;  1AOJ A;  3SEM A;  2X3X D;  3UAT A;  3M0Q A;  1QWF A;  4HVV A;  2EGC A;  4WCI A;  4J9I A;  3H0I A;  1WIE A;  3I35 A;  5GJW B;  2LQW A;  1ARK A;  2QDL A;  2HDA A;  2D8J A;  1J3T A;  3ULR B;  3M0R A;  1JXO A;  5L23 A;  2X3W D;  1B07 A;  3REB B;  2ABL A;  2H8H A;  4E6R A;  1ZX6 A;  2CRE A;  3TSW A;  2M0Y A;  2EYX A;  3H0F A;  4OMO A;  5IHK A;  1IO6 A;  2CUD A;  1UE9 A;  4LUD A;  2HCK A;  1WFW A;  2LMJ A;  2RQT A;  4HVW A;  3I5R A;  1XOV A;  3QWY A;  3GBQ A;  2EYW A;  1T0H A;  3CQT A;  1FMK A;  2CSQ A;  3EG1 A;  2D0N A;  2RPN A;  2B86 A;  2YSQ A;  4AFS C;  1QKX A;  3THK A;  1SEM A;  2KRN A;  1VA7 A;  1PKS A;  2JT4 A;  2KRO A;  5IHN A;  1U06 A;  3EG3 A;  2YUP A;  3I5S A;  3QWX X;  2F2X A;  1ZSG A;  2CH4 W;  1UUE A;  2ECZ A;  2KT1 A;  3UF4 A;  3VS3 A;  4FSS A;  1AD5 A;  4DEY A;  1H3H A;  4RTX A;  1ABO A;  4F14 A;  1M3C A;  4J9F A;  3SHW A;  5IH2 A;  2RMO A;  4LNP A;  1AZG B;  1TG0 A;  5EC7 A;  1AEY A;  2JTE A;  2KR3 A;  2F2W A;  1UGV A;  2K2M A;  1WI7 A;  1YP5 A;  1U5S A;  3PVQ A;  3RBB B;  2YUQ A;  4Z88 A;  2J06 A;  2JMA A;  2J6K A;  2D1X A;  1GFC A;  2MOX A;  1HD3 A;  1WLP B;  1SPK A;  4A63 B;  2DL7 A;  1K0S A;  2RQV A;  1UJ0 A;  3M0P A;  1K9A A;  1VYV A;  3JV3 A;  4IIM A;  4RTU A;  2DL5 A;  1W1F A;  1QLY A;  4J9G A;  1SHG A;  2EVR A;  2GTO A;  2KRM A;  3EG2 A;  2LJ3 A;  1WXT A;  2JS0 A;  4HXJ A;  2DBK A;  2C0O A;  2P4R A;  2CT4 A;  2MIO A;  1HJD A;  1E6G A;  2YDL A;  4JJD A;  1NG2 A;  2OJ2 A;  2GBQ A;  1OEB A;  1BK2 A;  3VS1 A;  1LCK A;  1NM7 A;  1I07 A;  2EPD A;  4QT7 A;  4D8K A;  1V1C A;  2K3B A;  1H92 A;  4OMP A;  3EHR A;  1H8K A;  1BBZ A;  2OI3 A;  2ROT A;  1CKA A;  4CC7 A;  1MUZ A;  1X43 A;  4OML A;  3IQL A;  1YNZ A;  2KYM A;  1GCQ A;  2DX1 A;  3A98 A;  5I11 A;  2L3S A;  2O9S A;  4RTW A;  1NLP C;  2RQU A;  1OOT A;  1ZUK A;  1M8M A;  2RQR A;  3H41 A;  2KT8 A;  1WXU A;  1K0X A;  1ZUY A;  2HSP A;  1JEG A;  2EBP A;  2J7I A;  4RTY A;  2K9G A;  3NGP A;  1M27 C;  3M0S A;  2W10 A;  4M4Z A;  1RLQ C;  2J6F A;  1OV3 A;  2W0Z A;  4J9B A;  1JU5 C;  1YWP A;  4K11 A;  2GTJ A;  2G6F X;  4OMQ A;  2KBT A;  2VVK A;  3NHN A;  3VS7 A;  1I0C A;  4AG2 C;  5IHI A;  3M0U A;  2J6O A;  2DLP A;  2PZ1 A;  3TSZ A;  4HCK A;  2LZ6 B;  2O31 A;  3I9Q A;  2FO0 A;  1PNJ A;  2KGT A;  4F16 A;  2AKK A;  1AZE A;  1CKB A;  1QCF A;  2OAW A;  2ED1 A;  2LP5 A;  5I22 A;  2KYB A;  1GL5 A;  3U23 A;  4LN2 A;  2BZY A;  1PWT A;  3NMZ C;  1E6H A;  1BU1 A;  2A37 A;  2RNA A;  2AK5 A;  1PRL C;  4CC3 A;  2KE9 A;  2IIM A;  1NYF A;  2L2P A;  2XMF A;  1VYU A;  2LCS A; 
#chains in the Genus database with same CATH topology
 3P8H A;  2PUO B;  1NPR A;  1OPL A;  3FIF A;  4AFU C;  2BZX A;  4C92 F;  5CKD A;  4MDW A;  1FXX A;  3VS4 A;  4CI0 C;  2ZPF B;  4A53 A;  1QP2 A;  4A4F A;  5CKH A;  1YJN A;  1AWW A;  1V29 B;  4WF2 A;  3INZ A;  3VS5 A;  4M7D C;  1AHJ B;  2A08 A;  2AKL A;  2ZCF B;  4AT1 B;  5HK3 A;  4PFP A;  1VQ5 T;  4D8D A;  2EGE A;  1JQQ A;  2L0A A;  3EGU A;  4BY6 B;  4O5V A;  4KUI A;  4LUE A;  3RER A;  4BI4 A;  3HSB A;  1T0J A;  1FMW A;  1VQO Q;  2CP5 A;  4GLK A;  2SEM A;  2HBW A;  1LJO A;  2HL3 A;  1YI2 T;  3CPF A;  2KAF A;  2RJE A;  4PJJ A;  4A4K A;  3MHX A;  2P0Q A;  3V7R A;  3L2W A;  1YJ9 T;  3JRZ A;  1X6G A;  2P0K A;  2E3I A;  2DTH A;  3BY7 A;  2QEX T;  2BTT A;  3PE0 A;  4ZN1 A;  3CBM A;  1PCX A;  2RK2 A;  2H3J A;  2LDM A;  1ZSZ A;  2EYQ A;  3PFS A;  3EAE A;  2KI7 A;  4OMM A;  1ZUU A;  2VC8 A;  1FWZ A;  4X34 A;  2ENM A;  4M78 C;  1K1Z A;  2K5F A;  3UA6 A;  1TUC A;  2GQV A;  4DOV A;  3EHQ A;  2K4Y A;  2CS7 A;  3L2V A;  1BB9 A;  1WGS A;  2VKN A;  5A2Q E;  4OMN A;  1TXQ A;  5FU6 B;  4J9D A;  4PL6 A;  1W70 A;  1FYN A;  1VQ6 Q;  2D8H A;  2O88 A;  5CAI A;  1YIJ A;  1TS9 A;  5KYX B;  1OPK A;  2RN8 A;  2L3R A;  2VGM A;  1GRI A;  1PHT A;  3QPH A;  5AT1 B;  2ED0 A;  1D3B B;  2JM9 A;  1A0N B;  3VUB A;  3ZL7 C;  2XD0 A;  3L42 A;  2HMA A;  1JB0 E;  1MGQ A;  1HYO A;  1OZ3 A;  2EIF A;  4A4E A;  1RAD B;  4AG1 C;  2KNB B;  4F7U F;  4KGV B;  1GFD A;  2FEI A;  2IVW A;  1DJ7 B;  3CCE A;  1I5L A;  4GY5 A;  1KSW A;  4AFZ C;  4Z02 A;  1G3Y A;  2DL3 A;  3OYJ A;  5FW9 A;  4AFQ C;  3JCM W;  4GLM A;  1M90 U;  1X2K A;  1P92 A;  2O9V A;  3CCM T;  4D6W A;  1Y0M A;  3CXC P;  4EMG A;  4F7U E;  3MCA B;  1UG1 A;  4ZNX A;  4FIB A;  2A0F B;  5D6X A;  2FHD A;  1SRL A;  3T9N A;  2AZV A;  1M2V A;  2ROL A;  3QBY A;  2CUB A;  4DEX A;  3CMA T;  1K76 A;  4NS5 A;  2CH4 A;  4OF1 A;  1NBE B;  4DOW A;  3KBG A;  4J7F A;  1UTI A;  2RF0 A;  4PJO A;  2M0O A;  3O5Z A;  3QHS A;  3OS5 A;  2YXY A;  1KG1 A;  2M02 A;  2K6D A;  2ESW A;  5IXB A;  4M7D F;  4RMO A;  2NUP A;  3OW2 P;  2DA9 A;  1B34 A;  2X4X A;  4HVU A;  1QKW A;  4NL3 A;  2VB6 A;  5A0L A;  1OYX A;  2F1L A;  1SKU B;  4J5Y A;  3EG9 A;  1E7O A;  1K73 C;  4M7D E;  1ZSZ B;  1QP3 A;  3REA B;  2OTL Q;  1N27 A;  1NJI R;  3UPU A;  4J83 A;  1MV3 A;  1KHC A;  2A28 A;  2OX7 A;  5A0G A;  3OYI A;  4F17 A;  1VQM T;  7AT1 B;  3G4S Q;  4N4G A;  3QO3 A;  4OMF B;  1Q86 R;  1VQN T;  1R0B G;  2RI3 A;  1Q82 U;  4JS5 A;  3C4S A;  3E9G A;  2LQW A;  5GJW B;  2RM4 A;  1ARK A;  2HDA A;  3ASK A;  3RKW A;  1YJW A;  3ULR B;  3HRT A;  2PU9 B;  1D1C A;  2KQW A;  5L23 A;  2X3W D;  1VQL T;  2H8H A;  3OYM A;  4ZTJ A;  4E6R A;  2HZY A;  1EZZ B;  2MPX C;  4M78 F;  4PJM A;  2CZ6 B;  2CRE A;  1HXD A;  2M0Y A;  2EYX A;  3H0F A;  1QVP A;  4QKU A;  3JCM c;  2CUD A;  2HAX A;  1UE9 A;  2XDB A;  3SB2 A;  1WHG A;  2CYZ B;  1UB4 A;  3CCJ A;  2XHC A;  4KUL A;  4M78 E;  1Q81 R;  4PK4 A;  3DKM A;  1M1F A;  2MWP A;  1KD1 C;  1XOV A;  2DER A;  5EG2 A;  2FZG B;  3GBQ A;  3SWN C;  2ZZD A;  2D0N A;  2RPN A;  2YSQ A;  2QDY B;  1VA7 A;  2CZ1 B;  1QMC A;  4AMC A;  2RH2 A;  4FYY B;  5J26 A;  1ZSG A;  3JCM P;  5LJ3 d;  4E7H A;  2DZC A;  4FSS A;  2CZ7 B;  3CCS Q;  1AD5 A;  4DEY A;  2E1H A;  1M2V B;  4A4G A;  1M3C A;  4II1 A;  1RAI B;  1VQ7 Q;  1ZA2 B;  3RKX A;  3JCM X;  3HTR A;  3WVE B;  1VQ8 A;  2VXE A;  5EC7 A;  3LWI A;  1R0C B;  4Q5W A;  5LJ3 f;  5KYY A;  4B6M A;  1YP5 A;  4MMK A;  1NE8 A;  2Y90 A;  1YHQ A;  2NUP B;  3GP8 A;  5KE2 A;  1HD3 A;  1WLP B;  5CK9 A;  1SPK A;  3QXE B;  4A63 B;  1K0S A;  1UJ0 A;  1K9A A;  3JV3 A;  4IIM A;  5DY9 A;  2DL5 A;  3S6W A;  1QLY A;  2MWO A;  2EVR A;  3EG9 B;  3MO8 A;  1WXT A;  2JS0 A;  4EMK C;  2C0O A;  2P4R A;  2L89 A;  1ACM B;  1HJD A;  3OYG A;  2R5M A;  1BK2 A;  3DLM A;  1KC8 U;  2X35 A;  3VS1 A;  1MNE A;  4IUR A;  1X01 A;  4D8K A;  2LRQ A;  4FYW B;  4JRP A;  5HK0 A;  1I4K 1;  3OW2 A;  1H92 A;  4UC4 A;  1D09 B;  2EJF A;  5HY6 A;  3EHR A;  1H8K A;  2ROT A;  3MP1 A;  3QJY A;  3IQL A;  1GCQ A;  4LDU A;  2DX1 A;  3A98 A;  1QVG S;  2L3S A;  2LT1 A;  2QQR A;  2DTI A;  2RQU A;  5LJ5 h;  1OOT A;  2OAU A;  3PGG A;  2MK5 A;  4ATO A;  3LGF A;  1YJ9 A;  3C12 A;  1N8R U;  2J7I A;  3WVD B;  4PFO A;  2QEX A;  3NGP A;  3M0S A;  4M4Z A;  2J6F A;  4OVA A;  1G5V A;  1OU8 A;  1M1K U;  2G6F X;  4OMQ A;  1I0C A;  2HL5 C;  1VQ4 Q;  4B9X A;  2V8I A;  2CGH A;  3OS1 A;  3CC7 A;  2LZ6 B;  4XQ3 A;  2QI2 A;  2FO0 A;  1IZ6 A;  4J6X A;  5GAN d;  1SG5 A;  1RAH B;  5GMK e;  4EPC A;  3GNF B;  2ED1 A;  1K73 R;  2LP5 A;  1C6V X;  3MP6 A;  1ZQ1 A;  2COZ A;  1IHW A;  4BI3 A;  1HK9 A;  1E6H A;  4FW2 A;  1I5O B;  3EFR A;  2AK5 A;  1PRL C;  4N4I A;  1PSE A;  5IAY A;  2IIM A;  3I56 Q;  3CBO A;  3OBW A;  5LJ5 g;  2LCS A;  2ZPB B;  4MML A;  1G3S A;  4CRI A;  4E7K A;  2E5K A;  2EJG A;  4XTZ A;  2RHY A;  4GBQ A;  4FT2 A;  2XI9 A;  5CQY A;  2GGR A;  4ORZ A;  2I0N A;  2BKD N;  1B3Q A;  1XNI A;  4JZ3 A;  1B7T A;  3CCU Q;  3KUF A;  2X4W A;  3G1J A;  4BY6 C;  4KGX B;  1K8A R;  2PUK B;  1K9M C;  4Z8A A;  1EIF A;  3CCM A;  2BUD A;  1WHJ A;  4LDX A;  1EFN A;  5GMK i;  2DXB A;  6AT1 B;  1CSK A;  2HBP A;  2O01 E;  3CPW A;  4XU2 A;  4EMK B;  1YBY A;  3CC4 T;  4EIK A;  2VV5 A;  1HSQ A;  1VQ9 Q;  3CD6 Q;  2LCL A;  3CMA A;  4JRK A;  1Y96 A;  2CKK A;  2LT4 A;  1VQP T;  3A8O B;  1D0Z A;  3QYH B;  5GJV B;  1VQK T;  2DNU A;  2XDP A;  1X2Q A;  4PJO D;  1WYX A;  1F1B B;  1U3O A;  3H0H A;  4RTV A;  3HFN A;  3NPF A;  3JB9 D;  3CCJ T;  5KYU B;  4Z89 A;  1Y7X A;  1R8O B;  1JJ2 S;  3OYN A;  1PRM C;  2HKQ B;  4DA4 A;  4JJB A;  3M56 A;  2EWN A;  3EGX A;  2LTO A;  2LNV A;  5FU6 C;  3AHU A;  2MCN A;  1VIF A;  1YCY A;  1UFF A;  1UEC A;  2AIR B;  2E6N A;  3JCM Q;  3JCM d;  5M9O A;  5GAN 5;  2JVV A;  1NLO C;  1KQ2 A;  4N4H A;  3G7Z A;  5KCO A;  3VYH B;  2XDD A;  4LXC A;  2WAC A;  1S1N A;  2OTJ T;  2QGF B;  1QVF S;  2XG8 D;  1NYG A;  2VAS A;  4XTU A;  4ANJ A;  2FG0 A;  3V8L A;  3G71 T;  1NEB A;  1OX8 A;  4KRT A;  1XJW B;  4XTX A;  3RMS A;  1M90 C;  1M8V A;  3L2R A;  1KQS S;  3MEW A;  5L8R E;  1AWX A;  4XTV A;  3JCM f;  3CC2 T;  3DB4 A;  3TCJ A;  3VRY A;  4RKU E;  2RB6 A;  2ZPG B;  4LDV A;  5KE3 A;  2MAM A;  2XIC A;  5A0D A;  4M7A A;  1I81 A;  1PSF A;  1TH7 A;  1GBQ A;  3ZBD A;  3HP9 A;  3QDF A;  1VYT A;  2K5I A;  4ESR A;  4TVR A;  5IT9 E;  3CCV Q;  4MZM A;  1N9R A;  2L3P A;  3BW1 A;  2P84 A;  1X27 A;  4L59 A;  2FPD A;  3URG A;  3FRN A;  3D7S B;  3QUI A;  2EKH A;  3G6E T;  2V8K A;  1MMG A;  2DE0 X;  4C92 E;  2E6Z A;  1YIT Q;  3VS0 A;  3LX7 A;  2WSE E;  4RTZ A;  3I55 Q;  3MPU B;  2DYB A;  1S72 Q;  2KXD A;  3QZ5 B;  2FRY A;  1AWJ A;  3TQ7 P;  1I1J A;  2BE7 D;  3QII A;  3VJP A;  5KYW A;  5GMK l;  2LJ0 A;  1Y57 A;  9ATC B;  5LJ5 j;  1D1B A;  2XK0 A;  2DVJ A;  4C5G A;  3VV0 A;  2CSI A;  2ATC B;  1M3B A;  1WHM A;  1ZSZ C;  3OYD A;  1JRI A;  3Q1J A;  2E65 A;  3KFV A;  2QA4 T;  4X9C A;  5DLO A;  3UDC A;  5I2S A;  1G2B A;  2JNG A;  2COW A;  2O4X A;  2EW3 A;  4RTT A;  3OSV A;  2KRS A;  4FM4 B;  3VS2 A;  5LJ5 f;  2RD1 A;  4PJO G;  4OB3 B;  3CC7 T;  2EYZ A;  2P0P A;  3UAT A;  3M0Q A;  1QWF A;  4IUQ A;  4HVV A;  1YJN Q;  5FRM A;  3M5A A;  3H0I A;  4V2S A;  2D0Q B;  1AT1 B;  4JUV A;  3CEY A;  3M4Y A;  1JXO A;  3ER0 A;  1WZO A;  3REB B;  4LD6 A;  2ABL A;  5D6Y A;  1K9M R;  3LLR A;  2FVU A;  3HKS A;  4OMO A;  3PIP A;  4JRI A;  2I2L A;  2HCK A;  3OYE A;  1IB8 A;  1M1G A;  4M7A B;  5FRO A;  5KH6 A;  1OU9 A;  1WFW A;  4E2F B;  3A5Z B;  2V8J A;  3DB3 A;  2EQJ A;  3QWY A;  3CQT A;  2AHJ B;  2CSQ A;  3VKI A;  4AFS C;  2HQE A;  3THK A;  2QQS A;  1SEM A;  2R5A A;  1PKS A;  4OGE A;  2GF7 A;  5HKC A;  4LD9 K;  3EG3 A;  3GF5 A;  3I5S A;  1UUE A;  3VS3 A;  4RTX A;  1ABO A;  2RHX A;  1ZBX A;  4J9F A;  4PJO C;  3SHW A;  5IH2 A;  4LNP A;  1AEY A;  1D0Y A;  2YLB A;  1YIJ Q;  4J6Y A;  3CCL T;  4NL2 A;  3CCQ T;  1WJR A;  3JB9 H;  3JCM V;  1IHV A;  1RL2 A;  5KYW B;  4Z88 A;  5GMK m;  2J6K A;  1GFC A;  1MMA A;  2MOX A;  4C5I A;  2DD5 A;  1NJI U;  1VYV A;  4E7Z A;  3EFO A;  4PKC C;  2D6F A;  4J9G A;  1PD0 A;  2DBK A;  2RI5 A;  2IG0 A;  2QTX A;  2MIO A;  1Q86 U;  2YDL A;  3QSU A;  3CCE Q;  2LQ8 A;  1WPY A;  4EMH A;  2O4X B;  1NG2 A;  1PC0 A;  3X20 B;  5FRN A;  5CKE A;  5D7U A;  1NM7 A;  1I07 A;  2EPD A;  4QT7 A;  1V1C A;  2PVD B;  2LX9 A;  2GCX A;  2DVE A;  4OMP A;  2VYT A;  2H3E B;  1BBZ A;  4CC7 A;  1CKA A;  1YNZ A;  2RHI A;  3V8K A;  3N5B B;  5I11 A;  2M1H A;  4C0D B;  3CC4 A;  1NLP C;  1ZUK A;  1M8M A;  2K2V A;  2RQR A;  3H41 A;  5GAM g;  2Y4X A;  1VQO T;  3DLL A;  1WXU A;  1K0X A;  2A7Y A;  1FMV A;  3SDZ A;  1RAC B;  4RTY A;  1VQP A;  3MKD A;  2K9G A;  2DJZ A;  3VU3 C;  1VQK A;  2MI6 A;  1Q81 U;  2XU8 A;  2W10 A;  3OQ5 A;  1VQ7 A;  1OV3 A;  3EGD A;  1JU5 C;  1YWP A;  3JAM E;  5GMK h;  4DBH A;  2K3X A;  5IHI A;  2J6O A;  4PNO A;  4OB1 B;  1RAG B;  3OB9 A;  4JLI A;  4IKF A;  1AZE A;  1CKB A;  2OAW A;  2DK3 A;  5GAO q;  5I22 A;  2KDS A;  1BI2 A;  4BE0 A;  3U23 A;  4LN2 A;  3UWN A;  1BU1 A;  2JJ9 A;  2CZ0 B;  2OTJ A;  1NYF A;  2L2P A;  4FCY A;  3CXC S;  1BCO A;  4N0A C;  2E12 A;  3G71 A;  1SSF A;  4QVZ A;  3CCR Q;  1R77 A;  3FC3 A;  2DL4 A;  1VQ6 T;  1Q7Y C;  3CC2 A;  2M51 A;  1YJW Q;  3OYF A;  4BDY A;  2DJQ A;  1I8F A;  1KFZ A;  3LYI A;  1JXM A;  4PJO B;  3CPW P;  2DF6 A;  4M7A D;  2FPF A;  2K3Y A;  8AT1 B;  3PMT A;  2AZS A;  3MEU A;  1KJW A;  3OSS C;  3FJ5 A;  1YFN A;  1B34 B;  2QQA A;  3FEO A;  3LH5 A;  3M0T A;  3M57 A;  5GAN e;  3EFO B;  1OX9 A;  2RJC A;  3OW2 S;  2PTK A;  2DXC A;  1SRM A;  4PJO F;  4A54 A;  1RAA B;  4C8Q A;  3VUZ A;  5GAM e;  1QCN A;  2DIQ A;  3NTK A;  1UGQ B;  4HCZ A;  1W2B P;  1WX6 A;  3CME Q;  3EFS A;  3R6O A;  4DBR A;  1O75 A;  4CC2 A;  3G6E A;  2NUZ A;  2SRC A;  1VQ4 A;  2R58 A;  3S3N A;  1C1A A;  2KMT A;  1RI0 A;  4M75 A;  1WNL A;  1GCQ C;  1ABQ A;  4HCB A;  1G3W A;  4LE9 A;  2HNI A;  1WXB A;  4YTL A;  3M4G A;  3A8M B;  2FZC B;  4VUB A;  1U1T A;  2JZ2 A;  2QGG A;  4J9H A;  2DRM A;  4JDS A;  4KT0 E;  4CC4 B;  1VQ8 Q;  1UGP B;  4IUT A;  2PNI A;  2EFI A;  3C0C A;  4E7L A;  3PVL A;  2RJD A;  1GBR A;  3A8H B;  1IRX A;  4QVC A;  4OGC A;  2HEQ A;  1PKT A;  4PJN A;  3F70 A;  3QJ6 A;  3EGD B;  2QA4 A;  5IXF A;  2YT6 A;  1YHQ Q;  3QDR B;  1PD1 A;  5AYF A;  2F2V A;  5FWB A;  4FW1 A;  5CCA A;  1YWO A;  1K73 U;  4RUG A;  3RDV A;  5GAO r;  2MYS A;  2E70 A;  1UHC A;  4RCB A;  4RCC A;  4M77 A;  4HA8 A;  2OTL T;  1U8R A;  1O9S A;  3PNW C;  3L2Q A;  5GAO n;  5CQX A;  3M58 A;  2ZAE A;  2F5T X;  1W6X A;  3G4S T;  1WDX A;  1VQ5 Q;  3BFM A;  1RI9 A;  2LNH B;  1N5Z A;  4FYV B;  2NLU A;  2KEA A;  2LQN A;  2QXF A;  3H9N A;  4F04 B;  2QQB A;  2FRW A;  2HKN A;  2GNC A;  2YLC A;  1YI2 Q;  4J8O A;  1VQ9 A;  3CD6 A;  1BI1 A;  5KYY B;  1X6B A;  3WXM B;  2JXB A;  4C92 A;  5GAO p;  1YJ9 Q;  2L3Q A;  1K8A U;  2QEX Q;  4PLI A;  4R0K A;  2JS2 A;  1IRE B;  5FWC A;  3UA7 A;  1T3L A;  2XID A;  4M7A G;  3GPL A;  2O2O A;  4C8Q B;  1M30 A;  4ZTF A;  3M55 A;  2VWF A;  1PG5 B;  3VRZ A;  4C0G A;  2BZ8 A;  2JW4 A;  2RO0 A;  4R55 A;  1KD1 R;  5CKB A;  4IUV A;  1WQ7 A;  2FB7 A;  1QCO A;  5C0M A;  4DQ2 A;  1OZ2 A;  3M53 A;  4M75 B;  3SFM A;  2RHU A;  5GAN 8;  1AVZ C;  1MV0 B;  5FLX E;  3CCS T;  1BIA A;  3TU4 K;  3CCL A;  3CCQ A;  4JZ4 A;  2DO3 A;  3QZ9 B;  4JPB W;  1X75 C;  3LH0 A;  4KBM B;  2DXT A;  3MEA A;  1VQ7 T;  1JO8 A;  3L1A A;  3J80 E;  5GMK j;  1M3A A;  3H6Z A;  1W2B A;  2LJ1 A;  1Q7Y R;  2LQK A;  3JCM J;  2PVG B;  5FU7 B;  2C06 A;  2FZK B;  2X3X D;  3GIB A;  3GOX A;  4MZT A;  2LCC A;  2XKO C;  2EGC A;  4WCI A;  2RJF A;  5LL6 S;  2HD0 A;  2DIG A;  3M0R A;  4M77 B;  1Q95 G;  3FJP A;  2NYS A;  1XQH A;  4BAC A;  1M2O A;  4E7S A;  3CCM Q;  1X6O A;  3TSW A;  4ZGJ B;  5IHK A;  4XU3 A;  4M7A C;  3J81 E;  2DYI A;  4O6J A;  2DZ9 A;  3OS2 A;  4OP0 A;  4PLL A;  2LMJ A;  3I55 A;  3CMA Q;  1PM3 A;  1U1S A;  1VQO A;  1JJ2 A;  4C5E A;  1H3Z A;  1T0H A;  1QKX A;  2VUB A;  4F7U A;  1RAB B;  1IGQ A;  2JT4 A;  1WHK A;  4OB0 B;  2KRO A;  3QYG B;  2ZPE B;  3OA6 A;  1U06 A;  2YUP A;  4LDY A;  3TRE A;  2AT1 B;  2ECZ A;  2KT1 A;  1TOV A;  1QVF A;  3S3M A;  2DD4 A;  2JOY A;  4C0F A;  5GAN 6;  5GAN 3;  1ZHI A;  2L8D A;  2E10 A;  3O8V A;  1VQ4 T;  2YRV A;  1MMN A;  1KQS A;  1Q86 C;  1AZG B;  4XAX B;  3X24 B;  2JTE A;  2KR3 A;  1VQM Q;  2DTO A;  4FL6 A;  2K2M A;  1VQN Q;  3X25 B;  1UEB A;  1IGU A;  5CVI A;  4PJL A;  4DBQ A;  2J06 A;  1Q82 C;  3M59 A;  2DL7 A;  1D1A A;  2RQV A;  3M0P A;  2DFU A;  1VQ6 A;  1Y96 B;  4M7D A;  1W1F A;  5LJ3 h;  4JRQ A;  3I56 T;  2GTO A;  2KRM A;  5LJ5 d;  1N9S A;  2X51 A;  3LGL A;  2M16 A;  1VQL Q;  2CT4 A;  3BE3 A;  1KQ1 A;  3FB9 A;  2OJ2 A;  2GBQ A;  1OEB A;  2DPP B;  2KSS A;  1Q81 C;  2DEU A;  4EDU A;  2K3B A;  3EGX B;  3GNG A;  3JB9 G;  4C8Q D;  3CCU T;  4C0D C;  3FLG A;  2KYM A;  1K9M U;  2D9T A;  4OB2 B;  2E64 A;  4FYX B;  4RG2 A;  4FSX A;  4Y91 A;  4DBF A;  5I21 A;  2GFA A;  2HSP A;  1JEG A;  2EBP A;  4M75 D;  3RKY A;  3RIR A;  1M4Z A;  4XTW A;  2KK4 A;  5LJ3 g;  2WSC E;  3M9Q A;  2EQM A;  4M78 A;  3A8L B;  2W0Z A;  1VQ9 T;  4J9B A;  3CD6 T;  2GTJ A;  2KBT A;  4AG2 C;  3TSZ A;  3C94 A;  1MHN A;  1VOM A;  2QTV A;  4HCK A;  3PIO A;  2JN0 A;  4PFZ A;  1JBM A;  3RUX A;  3EH1 A;  2F69 A;  1BI3 A;  4BI8 B;  1MND A;  2KGT A;  1QCF A;  4F7U B;  2P4T A;  1M5Q 1;  3PTA A;  3A8G B;  2KYB A;  4M7A F;  1GL5 A;  3SD4 A;  5DM7 R;  2BZY A;  3BDL A;  1BIB A;  3NMZ C;  2RNA A;  2A37 A;  3OMC A;  2MF2 A;  2CP3 A;  1Y07 A;  3HL8 A;  1TU0 B;  2XMF A;  3RR6 A;  3UT1 A;  2QYZ A;  4M77 D;  3ZFJ A;  2RK1 A;  2OTL A;  3AT1 B;  1H64 1;  1WJQ A;  5GAO l;  2WSF E;  4ELY C;  2EGA A;  4M7A E;  3A1P A;  2EQI A;  2LX7 A;  2RQW A;  8ATC B;  3OS0 A;  3G4S A;  2E3H A;  3P8B B;  2KXC A;  1GCP A;  3HPW A;  5GAN h;  2KY9 A;  1UGR B;  2JM8 A;  1KC8 C;  2DRK A;  1ZBJ A;  5GAM h;  4ME7 A;  2CDT A;  1M90 R;  2NWM A;  4M7D B;  4J9E A;  5I2M A;  2C0T A;  3V8J A;  4B9W A;  2EAY A;  5J39 A;  2K5L A;  1SHF A;  1SF9 A;  1TUD A;  2B8A A;  2IPO B;  1WQW A;  3R6N A;  2A3L A;  4C92 D;  1YCS B;  4C5H A;  3CCV T;  1K4U S;  3OYC A;  2K7A A;  1N8R C;  2DET A;  5LJ3 e;  1OI1 A;  2EJ9 A;  3EG0 A;  3GLX A;  1SSH A;  3BDU A;  4JJN K;  1WA7 A;  5CO7 A;  1OUL A;  1M9S A;  4BUG A;  1M1K C;  2QQ9 A;  3RNJ A;  1IXD A;  1X69 A;  2K57 A;  1RAF B;  3NTI A;  5C6S A;  3HFO A;  4KUD K;  1YIT T;  2YUO A;  5GAN g;  4IUU A;  5HCK A;  5CKF A;  1TTH B;  1TUG B;  4C8Q G;  4KGZ B;  1Z9Z A;  3TVT A;  3I55 T;  3JB9 J;  3ME9 A;  1S72 T;  2DL8 A;  2C0I A;  3TEE A;  4X1V A;  3CCS A;  2JTM A;  4M78 B;  3CCR A;  1QVG P;  1KIK A;  2RA2 A;  1WJS A;  2X9H A;  5GAN 4;  4M75 G;  1WHL A;  3MEV A;  2EYY A;  1Q82 R;  2X4J A;  1UHF A;  1UDL A;  3LWH A;  4IUP A;  4J9C A;  2K79 A;  3M54 A;  3VS6 A;  1TWB A;  2DMO A;  3P8D A;  3OBY A;  2A36 A;  2CT3 A;  1RLP C;  4XU1 A;  4L5G A;  1K8A C;  4LDW A;  5CIU A;  3ZEH A;  2Z0W A;  2ZGW A;  2MMP A;  1ZLM A;  2JMC A;  2HQH A;  1YJN T;  1UJY A;  4QVD A;  4JLG A;  1EX4 A;  3MP8 A;  3OYK A;  2LVM A;  2DIL A;  4P5N A;  3CME A;  3CBP A;  5GAO m;  1T3S A;  2RI2 A;  4Y28 E;  3JCM h;  1NEG A;  2DAQ A;  4M77 G;  3CC4 Q;  1LNX A;  4QW2 A;  5LJ3 j;  1BI0 A;  3SWN A;  1BCM A;  2DBM A;  4Y92 A;  3OMG A;  1VQP Q;  4XTY A;  1VQK Q;  2DXU A;  4C8Q C;  1G83 A;  1YN8 A;  2QAS A;  2X4Y A;  1KHI A;  5KCH A;  4J7I A;  2QG9 B;  1Y71 A;  4WTO B;  1KK7 A;  5GAN 7;  4MDX A;  4N0A A;  3H8Z A;  3CCJ Q;  2J05 A;  2V1Q A;  1QWE A;  2YUN A;  1Z9Q A;  4IIO A;  1N6A A;  3JB9 F;  3X28 B;  1BYM A;  4M75 C;  3LW5 E;  1D0X A;  1RUW A;  3CXC A;  2DKG A;  2V1R A;  4PJO E;  4C92 G;  3KXT A;  1AWO A;  4BDZ A;  3JCM g;  1XTD A;  2DM1 A;  2OTJ Q;  3X26 B;  4E7I A;  1G8X A;  3OY9 A;  2EQU A;  4HT9 A;  3G71 Q;  2GQI A;  4JJC A;  4J6W A;  2FYK A;  3E9F A;  5ECA A;  5FU7 C;  4EMK A;  1VQ5 A;  2FPE A;  3CC2 Q;  4ZN3 A;  1YIJ T;  3L2Z A;  1NPP A;  2GFU A;  1AOJ A;  4M7D D;  3I56 A;  5J3B A;  4QQD A;  3SEM A;  4BE1 A;  3PT9 A;  3C95 A;  2EQK A;  1V76 A;  4J9I A;  1RAE B;  1UGS B;  1VIE A;  1KC8 R;  1WIE A;  3I35 A;  1MMD A;  4X9D A;  2QDL A;  3MJX A;  4M77 C;  3VYG A;  4QQG A;  2D8J A;  1YI2 A;  1JJ2 P;  1J3T A;  4R56 A;  3RES A;  5KYU A;  1B07 A;  1ZX6 A;  1TSF A;  3CCE T;  4FT4 A;  3CCU A;  3S3O A;  3FDR A;  1IO6 A;  1GXI E;  4LUD A;  3NTH A;  3G6E Q;  2QK0 A;  1N8R R;  2E5Q A;  1QVF P;  1QVG A;  5GAN j;  2E4H A;  2RQT A;  4HVW A;  2YRD A;  3I5R A;  2CP7 A;  5GAM j;  1KQS P;  2CP6 A;  2EYW A;  1M1K R;  3OYH A;  1LOJ A;  1FMK A;  4A4H A;  3EG1 A;  1ZA1 B;  2B86 A;  2VXF A;  2E41 A;  2NUT A;  4C92 C;  5GAM d;  5KYN A;  2KRN A;  3SWN B;  4M78 D;  5IHN A;  2HSE B;  3QWX X;  2F2X A;  2PQW A;  3JCM e;  2CH4 W;  5GAN f;  3UF4 A;  3CPW S;  2HQX A;  1H3H A;  4JS4 A;  2JUF A;  4F14 A;  5GAM f;  2QA4 Q;  2PVO B;  1KD1 U;  2RMO A;  1TG0 A;  2ZPI B;  3HRU A;  3E1S A;  2F2W A;  1UGV A;  1NZ9 A;  4NOY A;  4ZGD B;  3CC7 Q;  1WI7 A;  2FL7 A;  4F7U G;  3E19 A;  1U5S A;  2LC4 A;  3PVQ A;  3RBB B;  1W2B S;  2YUQ A;  4FU6 A;  2JMA A;  4KH0 B;  3JCM b;  2D1X A;  2YHT A;  5GAN 2;  4C8Q F;  3OYA A;  5DLQ E;  4RTU A;  2R57 A;  1SHG A;  3EG2 A;  2LJ3 A;  4E7J A;  2BIV A;  1W4S A;  1G3T A;  4HXJ A;  1Q7Y U;  4RG8 A;  3CCR T;  2F5K A;  1OQK A;  1QQJ A;  1E6G A;  3EH2 A;  4C8Q E;  1YJW T;  4JJD A;  4M75 F;  1C0M A;  1FX7 A;  2M9U A;  1VUB A;  2KVQ G;  4XK8 E;  2V26 A;  1LCK A;  4C0Z A;  1WHH A;  4BB7 A;  1LVK A;  3OYB A;  5IN1 A;  3V7S A;  3OYY A;  2QAZ A;  3V7C A;  3MET A;  2OI3 A;  1MUZ A;  3NFC A;  1X43 A;  4M75 E;  4OML A;  1LPL A;  2BE9 B;  4QQ6 A;  2COY A;  3CCV A;  4M7D G;  2CP0 A;  2YWW A;  4BE2 A;  2O9S A;  3L2U A;  4RTW A;  2Y4Y A;  5CR2 A;  3QKJ A;  3HRS A;  2G3R A;  2KT8 A;  4HT8 A;  4ZGE B;  1ZUY A;  3CME T;  1M27 C;  5LJ5 e;  4L6V 5;  1RLQ C;  1YIT A;  4K11 A;  2L5Q A;  2DEQ A;  4M77 F;  2VVK A;  3NHN A;  3VS7 A;  3M0U A;  2PZ1 A;  2DLP A;  4KH1 B;  4E47 A;  2CP2 A;  4HKE A;  1VQM A;  2ZPH B;  1QW1 A;  3JSC A;  2O31 A;  3OYL A;  1S72 A;  5D6W A;  3I9Q A;  5KYX A;  1VQN A;  2RHZ A;  3HHT B;  1PNJ A;  4F16 A;  3CCL Q;  4BD3 A;  3CCQ Q;  2AKK A;  3E2U A;  2NUT B;  1D3B A;  2JTF A;  4M77 E;  4XU0 A;  2YRC A;  1VQ8 T;  4HCC A;  3J7A F;  2EKO A;  1PWT A;  3QG1 A;  4C92 B;  3JB9 I;  3RMQ A;  2VGN A;  4MZP A;  4CC3 A;  2KE9 A;  3PMI A;  1VQL A;  4M78 G;  4ELZ C;  1NJI C;  1VYU A;  1YHQ T;  1BKB A; 
#chains in the Genus database with same CATH homology
 1OPL A;  2EGA A;  2E5K A;  2EQI A;  4GBQ A;  2DL4 A;  2LX7 A;  2RQW A;  4AFU C;  2BZX A;  2M51 A;  2DJQ A;  3VS4 A;  2KXC A;  1KFZ A;  2GGR A;  4ORZ A;  1GCP A;  1JXM A;  2I0N A;  1B3Q A;  1AWW A;  2DF6 A;  2JM8 A;  4JZ3 A;  2FPF A;  2DRK A;  3VS5 A;  1ZBJ A;  2AZS A;  2A08 A;  1KJW A;  2AKL A;  2CDT A;  3FJ5 A;  3LH5 A;  3M0T A;  4D8D A;  2NWM A;  2EGE A;  4J9E A;  2C0T A;  1JQQ A;  2L0A A;  2PTK A;  3EGU A;  1SRM A;  1SHF A;  4LUE A;  4Z8A A;  1TUD A;  1T0J A;  3R6N A;  1EFN A;  2SEM A;  1WX6 A;  2HBW A;  1YCS B;  1CSK A;  1K4U S;  2K7A A;  4CC2 A;  4EIK A;  2NUZ A;  2SRC A;  1HSQ A;  3EG0 A;  1SSH A;  1WA7 A;  1GCQ C;  1X6G A;  1ABQ A;  4LE9 A;  2BTT A;  5GJV B;  3PE0 A;  2DNU A;  3RNJ A;  1WXB A;  1X2Q A;  1X69 A;  1WYX A;  2YUO A;  1U3O A;  4J9H A;  3H0H A;  4RTV A;  5HCK A;  3NPF A;  2DRM A;  4OMM A;  4Z89 A;  1Z9Z A;  1ZUU A;  3TVT A;  4CC4 B;  2PNI A;  1PRM C;  3C0C A;  2ENM A;  1K1Z A;  2DL8 A;  3UA6 A;  3PVL A;  1TUC A;  2C0I A;  1GBR A;  4JJB A;  3EHQ A;  4X1V A;  2HEQ A;  1PKT A;  1KIK A;  5IXF A;  2YT6 A;  1BB9 A;  2MCN A;  1UFF A;  1UEC A;  2VKN A;  4OMN A;  2F2V A;  1NLO C;  5FWB A;  4J9D A;  2EYY A;  1W70 A;  1YWO A;  1FYN A;  2D8H A;  4RUG A;  2O88 A;  1UHC A;  1S1N A;  1UHF A;  1NYG A;  1UDL A;  1OPK A;  2RN8 A;  4J9C A;  1GRI A;  2K79 A;  1PHT A;  2FG0 A;  3VS6 A;  1NEB A;  2ED0 A;  4KRT A;  2DMO A;  2JM9 A;  2A36 A;  1A0N B;  2CT3 A;  1RLP C;  1AWX A;  3ZL7 C;  3VRY A;  1W6X A;  1WDX A;  1ZLM A;  1RI9 A;  2LNH B;  2JMC A;  1N5Z A;  1UJY A;  4AG1 C;  2KEA A;  1GBQ A;  2KNB B;  2LQN A;  2DIL A;  1T3S A;  1GFD A;  2FEI A;  2FRW A;  1VYT A;  1NEG A;  4ESR A;  1KSW A;  4AFZ C;  2GNC A;  2DL3 A;  2L3P A;  5FW9 A;  4AFQ C;  4GLM A;  1X2K A;  1X27 A;  2O9V A;  1X6B A;  2DBM A;  2FPD A;  1Y0M A;  4Y92 A;  2JXB A;  2L3Q A;  1UG1 A;  4ZNX A;  1SRL A;  1G83 A;  1YN8 A;  2EKH A;  4R0K A;  2AZV A;  2DE0 X;  2JS2 A;  2ROL A;  5FWC A;  3UA7 A;  1T3L A;  3VS0 A;  2CUB A;  4DEX A;  2O2O A;  1K76 A;  2CH4 A;  1M30 A;  2J05 A;  2V1Q A;  1QWE A;  2YUN A;  4RTZ A;  2VWF A;  1Z9Q A;  4IIO A;  3VRZ A;  2DYB A;  1UTI A;  2KXD A;  2RF0 A;  3O5Z A;  2BZ8 A;  2FRY A;  2JW4 A;  1AWJ A;  1RUW A;  1I1J A;  2K6D A;  2ESW A;  2V1R A;  5IXB A;  2LJ0 A;  1Y57 A;  2DA9 A;  2DVJ A;  4HVU A;  1AWO A;  1QKW A;  1AVZ C;  2CSI A;  1MV0 B;  2DM1 A;  1M3B A;  1E7O A;  4JZ4 A;  4JPB W;  3KFV A;  3REA B;  1JO8 A;  2GQI A;  4JJC A;  1MV3 A;  2A28 A;  1M3A A;  5ECA A;  1G2B A;  2FPE A;  2EW3 A;  4RTT A;  4F17 A;  2KRS A;  2LJ1 A;  3VS2 A;  2EYZ A;  1AOJ A;  3SEM A;  2X3X D;  3UAT A;  3M0Q A;  1QWF A;  4HVV A;  2EGC A;  4WCI A;  4J9I A;  3H0I A;  1WIE A;  3I35 A;  5GJW B;  2LQW A;  1ARK A;  2QDL A;  2HDA A;  2D8J A;  1J3T A;  3ULR B;  3M0R A;  1JXO A;  5L23 A;  2X3W D;  1B07 A;  3REB B;  2ABL A;  2H8H A;  4E6R A;  1ZX6 A;  2CRE A;  3TSW A;  2M0Y A;  2EYX A;  3H0F A;  4OMO A;  5IHK A;  1IO6 A;  2CUD A;  1UE9 A;  4LUD A;  2HCK A;  1WFW A;  2LMJ A;  2RQT A;  4HVW A;  3I5R A;  1XOV A;  3QWY A;  3GBQ A;  2EYW A;  1T0H A;  3CQT A;  1FMK A;  2CSQ A;  3EG1 A;  2D0N A;  2RPN A;  2B86 A;  2YSQ A;  4AFS C;  1QKX A;  3THK A;  1SEM A;  2KRN A;  1VA7 A;  1PKS A;  2JT4 A;  2KRO A;  5IHN A;  1U06 A;  3EG3 A;  2YUP A;  3I5S A;  3QWX X;  2F2X A;  1ZSG A;  2CH4 W;  1UUE A;  2ECZ A;  2KT1 A;  3UF4 A;  3VS3 A;  4FSS A;  1AD5 A;  4DEY A;  1H3H A;  4RTX A;  1ABO A;  4F14 A;  1M3C A;  4J9F A;  3SHW A;  5IH2 A;  2RMO A;  4LNP A;  1AZG B;  1TG0 A;  5EC7 A;  1AEY A;  2JTE A;  2KR3 A;  2F2W A;  1UGV A;  2K2M A;  1WI7 A;  1YP5 A;  1U5S A;  3PVQ A;  3RBB B;  2YUQ A;  4Z88 A;  2J06 A;  2JMA A;  2J6K A;  2D1X A;  1GFC A;  2MOX A;  1HD3 A;  1WLP B;  1SPK A;  4A63 B;  2DL7 A;  1K0S A;  2RQV A;  1UJ0 A;  3M0P A;  1K9A A;  1VYV A;  3JV3 A;  4IIM A;  4RTU A;  2DL5 A;  1W1F A;  1QLY A;  4J9G A;  1SHG A;  2EVR A;  2GTO A;  2KRM A;  3EG2 A;  2LJ3 A;  1WXT A;  2JS0 A;  4HXJ A;  2DBK A;  2C0O A;  2P4R A;  2CT4 A;  2MIO A;  1HJD A;  1E6G A;  2YDL A;  4JJD A;  1NG2 A;  2OJ2 A;  2GBQ A;  1OEB A;  1BK2 A;  3VS1 A;  1LCK A;  1NM7 A;  1I07 A;  2EPD A;  4QT7 A;  4D8K A;  1V1C A;  2K3B A;  1H92 A;  4OMP A;  3EHR A;  1H8K A;  1BBZ A;  2OI3 A;  2ROT A;  1CKA A;  4CC7 A;  1MUZ A;  1X43 A;  4OML A;  3IQL A;  1YNZ A;  2KYM A;  1GCQ A;  2DX1 A;  3A98 A;  5I11 A;  2L3S A;  2O9S A;  4RTW A;  1NLP C;  2RQU A;  1OOT A;  1ZUK A;  1M8M A;  2RQR A;  3H41 A;  2KT8 A;  1WXU A;  1K0X A;  1ZUY A;  2HSP A;  1JEG A;  2EBP A;  2J7I A;  4RTY A;  2K9G A;  3NGP A;  1M27 C;  3M0S A;  2W10 A;  4M4Z A;  1RLQ C;  2J6F A;  1OV3 A;  2W0Z A;  4J9B A;  1JU5 C;  1YWP A;  4K11 A;  2GTJ A;  2G6F X;  4OMQ A;  2KBT A;  2VVK A;  3NHN A;  3VS7 A;  1I0C A;  4AG2 C;  5IHI A;  3M0U A;  2J6O A;  2DLP A;  2PZ1 A;  3TSZ A;  4HCK A;  2LZ6 B;  2O31 A;  3I9Q A;  2FO0 A;  1PNJ A;  2KGT A;  4F16 A;  2AKK A;  1AZE A;  1CKB A;  1QCF A;  2OAW A;  2ED1 A;  2LP5 A;  5I22 A;  2KYB A;  1GL5 A;  3U23 A;  4LN2 A;  2BZY A;  1PWT A;  3NMZ C;  1E6H A;  1BU1 A;  2A37 A;  2RNA A;  2AK5 A;  1PRL C;  4CC3 A;  2KE9 A;  2IIM A;  1NYF A;  2L2P A;  2XMF A;  1VYU A;  2LCS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...