2W10A

Mona sh3c in complex
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
60
structure length
60
Chain Sequence
b'LGSVRWARALYDFEALEEDELGFRSGEVVEVLDSSNPSWWTGRLHNKLGLFPANYVAPMM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GRB2-RELATED ADAPTOR PROTEIN 2
publication title Distinct Binding Modes of Two Epitopes in Gab2 that Interact with the Sh3C Domain of Grb2.
pubmed doi rcsb
source organism Mus musculus
molecule tags Hydrolase
total genus 11
structure length 60
sequence length 60
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00018 SH3_1 SH3 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.40 Mainly Beta Roll SH3 type barrels. SH3 Domains 2w10A00
2CH4W 2RMOA 2A36A 5IH2A 2L3SA 4OMLA 4D8KA 5I11A 2ED0A 2YUQA 1QCFA 4JJCA 1AWJA 3EHRA 2CH4A 3I9QA 2SEMA 2CDTA 1ZUYA 2ECZA 4JZ3A 1GCQC 2OAWA 3CQTA 3GBQA 2A08A 2J6FA 2W0ZA 2YT6A 1AZGB 2D1XA 2D8JA 3EHQA 4J9IA 4D8DA 1NM7A 2PNIA 4GLMA 2JM9A 4J9BA 1MV0B 2DYBA 2DL7A 2VVKA 1RI9A 2JTEA 1ARKA 3TVTA 1RLPC 1NLOC 1TG0A 4Z8AA 1V1CA 2PTKA 1E7OA 3H0FA 2CREA 5GJVB 2DVJA 2RNAA 1SRLA 4J9GA 1SPKA 2SRCA 1FMKA 4OMPA 4OMMA 5GJWB 4J9CA 1YP5A 2LJ3A 2O9VA 3UATA 1YWPA 4X1VA 3EGUA 4HVWA 1ZUUA 2RQUA 2EBPA 3NPFA 1FYNA 4QT7A 1TUCA 3VS5A 2J6KA 2AK5A 2CSQA 5I22A 4J9FA 4RTYA 4LN2A 1GCPA 1HSQA 1A0NB 5IHNA 2JXBA 2RPNA 1VYUA 3VS1A 4CC4B 2DA9A 2RQTA 2ESWA 1JXOA 3R6NA 3TSWA 2GNCA 2KXCA 1VYTA 2GQIA 2KRMA 2LJ0A 1U3OA 1YWOA 3I35A 3O5ZA 3LH5A 4J9EA 3SHWA 2KXDA 3UF4A 1ZUKA 4CC2A 4ESRA 2CUBA 1K4US 2BZXA 2EGAA 1PKSA 2EYWA 1WDXA 2I0NA 1WXTA 1X2KA 4AFQC 1AWWA 2KGTA 1ZLMA 2FRWA 1QLYA 2L3PA 1X43A 5L23A 1WA7A 1H92A 3THKA 2V1QA 2A37A 2AKLA 1GFCA 1H3HA 1UE9A 2KRSA 3ULRB 4Z89A 2CUDA 2F2VA 3RBBB 4JZ4A 1Z9QA 2B86A 1K76A 2VKNA 4ORZA 1QKWA 4OMNA 1K0SA 2L0AA 4IIOA 4OMQA 2K9GA 4HXJA 2O2OA 1M3AA 1G83A 3M0SA 1OOTA 1CSKA 1PNJA 2A28A 1T3LA 1BK2A 2K79A 2K6DA 2MIOA 1WXUA 2ROTA 2KNBB 1BB9A 2YSQA 1AWXA 2MCNA 2LX7A 2K7AA 2FEIA 2IIMA 4JJDA 3H41A 2KRNA 5FWCA 2ED1A 2F2WA 2BZYA 2O9SA 1S1NA 1AOJA 1W6XA 3M0PA 2YUNA 3REAB 1JXMA 4DEYA 2AZVA 4OMOA 2AZSA 2J06A 1PWTA 1J3TA 1W1FA 3UA6A 1OPKA 4JPBW 3QWXX 1OPLA 1GL5A 4GBQA 3M0TA 2RQWA 2CT4A 1YN8A 1X27A 2KT1A 2KBTA 2XMFA 1VYVA 1T0JA 1PHTA 1UGVA 1VA7A 2DBKA 2OI3A 3A98A 1Y57A 2YUPA 2C0IA 2W10A 2KYBA 4RUGA 2RQVA 2EW3A 1MUZA 3PE0A 1X6GA 2MOXA 2K2MA 2GBQA 3TSZA 1GBQA 2JS2A 1TUDA 1E6GA 2M0YA 4J9DA 2EVRA 4LUDA 2KYMA 2DL5A 2LQWA 2DF6A 4RTWA 1UDLA 2PZ1A 1QWFA 4RTUA 4A63B 1MV3A 3PVLA 1SRMA 1OV3A 2YDLA 1QWEA 1AWOA 3VS7A 2X3WD 1T3SA 1UTIA 2CSIA 1JU5C 2VWFA 2JMCA 2EQIA 4HVVA 5IXBA 1UG1A 2O88A 2EYZA 3KFVA 1KFZA 4RTTA 5FW9A 1SEMA 3C0CA 2L3QA 1I0CA 1B07A 1SHFA 2HDAA 1K9AA 1SHGA 2EPDA 2DM1A 2LQNA 2HSPA 1AZEA 4EIKA 1AVZC 2EYYA 1NEBA 2NUZA 1RUWA 3FJ5A 2LMJA 1PRLC 1KIKA 1HD3A 3VS6A 5FWBA 1PKTA 2L2PA 1GCQA 2O31A 2RQRA 4ZNXA 1UFFA 2LJ1A 3EG0A 4DEXA 1WYXA 2DL8A 2EGCA 1JQQA 3M0QA 1M30A 1NG2A 4RTXA 4K11A 1UHCA 1CKBA 2ENMA 1UUEA 2RN8A 1PRMC 2FRYA 2GGRA 1I1JA 1OEBA 4AFSC 1LCKA 2LZ6B 2FPDA 2M51A 4J9HA 1WX6A 5ECAA 3IQLA 2DBMA 3NGPA 3M0RA 1KJWA 2LCSA 1ABQA 4F17A 1AD5A 2DLPA 2LP5A 3U23A 4F16A 3QWYA 1G2BA 1BU1A 2EKHA 1H8KA 3UA7A 2ROLA 3ZL7C 1E6HA 1M3BA 3NHNA 3SEMA 2DX1A 4M4ZA 4E6RA 1QKXA 4Z88A 4CC3A 2C0TA 4HCKA 3NMZC 1EFNA 1UJ0A 1T0HA 4FSSA 1WI7A 2GTJA 1ZBJA 4AG2C 2QDLA 3RNJA 1GFDA 4F14A 1IO6A 4AFZC 2P4RA 1JEGA 3VS4A 4R0KA 1NYGA 1U06A 1ZX6A 3EG2A 2DJQA 1NEGA 2DL3A 5HCKA 2J7IA 5IHIA 1KSWA 3VS3A 2BTTA 2LNHB 4IIMA 1WIEA 2KE9A 2KT8A 1UJYA 2FPFA 2KEAA 3VS2A 2NWMA 4CC7A 2CT3A 2G6FX 2F2XA 4LNPA 1RLQC 2EGEA 2E5KA 2J6OA 2RF0A 2X3XD 2KROA 4LUEA 1M27C 2JW4A 4Y92A 1WFWA 2HBWA 4WCIA 2JS0A 1GBRA 3VRYA 1ABOA 1WXBA 3M0UA 2FPEA 2H8HA 3H0HA 1K1ZA 2BZ8A 1M8MA 1NYFA 2DNUA 2K3BA 1AEYA 2HCKA 3I5RA 4RTVA 3EG3A 2DE0X 4LE9A 1XOVA 3JV3A 3VS0A 2DL4A 2J05A 4JJBA 4HVUA 1Z9ZA 2DRMA 2GTOA 1BBZA 5IXFA 2DRKA 2D8HA 1GRIA 1YCSB 1CKAA 4KRTA 4AG1C 1SSHA 1I07A 2JT4A 1WLPB 3I5SA 1JO8A 5EC7A 2YUOA 1NLPC 2D0NA 1HJDA 2DILA 2C0OA 1M3CA 1X6BA 2DMOA 1X2QA 3REBB 2EYXA 1W70A 1UHFA 2HEQA 1U5SA 3H0IA 2ABLA 2FG0A 1UECA 2JM8A 2FO0A 1K0XA 1B3QA 1ZSGA 2JMAA 1Y0MA 2OJ2A 2V1RA 2KR3A 3PVQA 4AFUC 5IHKA 4RTZA 3EG1A 1X69A 1N5ZA 3VRZA 1YNZA 2AKKA
chains in the Genus database with same CATH superfamily
2CH4W 1VQKA 2RMOA 2KY9A 4OMLA 4R56A 5LJ3d 1TS9A 3EHRA 1WZOA 3MHXA 1VUBA 1JBMA 2EJ9A 3I9QA 1KQSA 2FB7A 2CDTA 2ECZA 4M77E 4KGVB 3A8OB 3CQTA 2VGNA 1NZ9A 4ZGDB 2J6FA 1R0CB 3OW2P 3EHQA 4J9IA 2D8JA 4M7DB 3MPUB 1I5OB 4J9BA 4PJOD 5KYNA 2DYBA 2PVOB 2DO3A 5DLOA 4LDXA 2JTEA 3CCMT 5LJ5h 3TVTA 3VV0A 2PTKA 1E7OA 3CCVQ 3H0FA 2CREA 4M78E 2DVJA 4A4GA 4J6YA 1QP2A 4LD9K 2X4WA 3NTKA 1SPKA 1M2VA 1FMKA 2AIRB 1M90R 5GJWB 1WJRA 4J9CA 2LJ3A 1KC8R 5J3BA 1RADB 3EGUA 4FL6A 1VQ9Q 1YIJA 1FYNA 1EX4A 3EAEA 2QAZA 2LT4A 3OYDA 5LJ3h 1TUCA 1NJIU 3DB3A 3MP1A 2AK5A 2VYTA 4FU6A 4RTYA 4F7UA 1GCPA 1HSQA 1A0NB 1SG5A 4OB2B 4M7DD 2RPNA 1VQPQ 4CC4B 1IXDA 3P8DA 3R6NA 2QA4Q 2ZAEA 2GQIA 2KRMA 2LJ0A 3MKDA 1U3OA 1M5Q1 3LH5A 3OMGA 1RL2A 3I55Q 4JS4A 5DLQE 3RUXA 5GAMf 1W2BA 3CCVT 2BZXA 1WDXA 3HFOA 1WXTA 4A4FA 1M1KR 1VIFA 2B8AA 1ZLMA 2FRWA 1X43A 1NJIC 3OS0A 2OTJA 2YLBA 3THKA 1WJQA 2JVVA 2QQSA 2XKOC 2ZPEB 3PIOA 3QJ6A 1VQ9T 4Z89A 4IUQA 1OULA 2CP6A 2BIVA 4LDVA 2EYQA 1QKWA 3FLGA 4OMNA 3OW2S 2R5MA 1X01A 2L0AA 1XTDA 4M75E 1KHCA 2E10A 1CSKA 1XNIA 1NPRA 1BK2A 2K79A 2K6DA 2RA2A 1WXUA 2KNBB 5CKFA 1VQPT 1AWXA 2HNIA 2LX7A 2K7AA 1U8RA 2QA4T 4M7AC 3GP8A 1M2VB 1BI0A 1UGPB 3CMAQ 3I55T 1ZHIA 4RKUE 1AOJA 3CCQA 1OQKA 3HL8A 3OSVA 1IB8A 5CKDA 1KD1R 4FYWB 4C8QC 1W1FA 2LVMA 5GAOn 3QWXX 4F7UB 2P84A 3JB9F 2VUBA 5LJ5e 1YN8A 2KT1A 3MEVA 2KBTA 2XMFA 2E3HA 1M2OA 4IURA 4EPCA 4FW2A 1PHTA 1VA7A 1WQWA 1G8XA 1K8AU 3S3OA 2YRCA 2O4XA 2C0IA 5LJ5j 4RUGA 2RQVA 2QXFA 3PE0A 3VKIA 2MF2A 3M4YA 2GBQA 4PJJA 3L2QA 1R8OB 1WGSA 2ZPHB 3QDRB 4BY6B 2LDMA 1U1SA 2AHJB 5LJ3e 4LUDA 3O8VA 4E7HA 3CMAT 3RKWA 2PZ1A 3NTHA 4HA8A 3A1PA 3JB9G 3GOXA 3OYMA 1OV3A 5CK9A 2V8IA 1QWEA 3OYHA 4C5EA 2X4XA 3JB9H 1K8AC 3OYIA 5GAN2 2KMTA 2JMCA 2EQIA 4BI4A 5IXBA 2EYZA 1KFZA 5FW9A 2RK2A 1BCOA 1FWZA 3C0CA 2JTFA 3WVDB 4J5YA 3BFMA 1SHFA 4PJOF 1SHGA 2LQNA 2HSPA 3X24B 5C6SA 2YRVA 1Q7YU 4JJNK 1ZBXA 2LMJA 1PRLC 2QK0A 1HD3A 5GAOl 2DD5A 2O31A 1Y71A 5I21A 3VYHB 1WYXA 2EGCA 2IPOB 2KAFA 3HKSA 4IUTA 1OI1A 5LL6S 4M77A 2QEXA 1RAGB 4RTXA 4C0GA 3F70A 1CKBA 3INZA 1FXXA 3CXCP 2RN8A 3JCMW 1C0MA 2FRYA 4YTLA 2GGRA 4PJOG 1Q7YC 2O4XB 1TH7A 1XQHA 4RCBA 1VQ5A 1NJIR 3HP9A 3BW1A 1WX6A 3OW2A 5ECAA 2P0PA 3V7SA 2RHXA 2DBMA 1VOMA 3MO8A 3VU3C 4LXCA 3NGPA 4N4HA 5GANg 1ABQA 2DLPA 1YJNQ 1ZSZA 1Q86U 2FYKA 4M78A 5HK0A 1VQOA 1WPYA 5GMKm 1G2BA 3ZEHA 1BU1A 2EQJA 1OX9A 3C4SA 3SEMA 1VQ4Q 4E6RA 1QKXA 2M16A 2E12A 3H6ZA 3J80E 3SD4A 4CC3A 3CCJQ 1ZQ1A 4HCKA 4ELYC 5GAN6 1FX7A 8AT1B 1EFNA 2M0OA 1QQJA 1UJ0A 3LW5E 2HQXA 2LRQA 3EFRA 2GTJA 3D7SB 3L2UA 4ZN1A 3RNJA 1IO6A 1Q86C 4PLLA 4O6JA 2P4RA 2IG0A 1NYGA 4BB7A 1WQ7A 3OYKA 4KULA 3KBGA 4OMFB 4C0DC 2COWA 3OBYA 4LDYA 1YJNT 2KE9A 2KT8A 4PK4A 1TWBA 2FPFA 3CCRA 2DEQA 3A8GB 3MP6A 2KEAA 1BI2A 5IN1A 2CT3A 2G6FX 2JJ9A 2F2XA 1RLQC 2COZA 4QQ6A 4M77B 1YJWQ 1VQ4T 4XK8E 4DOWA 2JW4A 1GBRA 3CCJT 1YI2A 2IVWA 1M8MA 1NYFA 3CXCS 2JNGA 4RMOA 2HCKA 2LTOA 3OYEA 3PMIA 1BI1A 2FZCB 4M75A 4M7AA 2DE0X 3FC3A 2YWWA 4ZN3A 1ZSZB 2GTOA 1D3BA 1K9MR 4M78B 2DRKA 2D8HA 2X9HA 3G71Q 1OYXA 2P0KA 1SSHA 1I07A 4F7UE 1YJ9Q 2YUOA 3CCUQ 1IGUA 4A4HA 3TU4K 1X6BA 1QVPA 4C8QA 2PVGB 4FT2A 5FU7C 2CZ1B 3SWNC 2CZ6B 2EYXA 3L2RA 1VQ7Q 2HEQA 3GLXA 2DVEA 1U5SA 5KYWA 2ABLA 2FG0A 2CKKA 4E47A 3P8HA 2JM8A 3A8LB 2EKOA 2O01E 4M77D 2XICA 5GAN7 1YJWT 2RD1A 2JMAA 4XU0A 5GAN4 2V1RA 1QP3A 4AFUC 3PVQA 1WHHA 4LDUA 2P0QA 2DAQA 1N5ZA 1YNZA 1JB0E 1GXIE 2CGHA 3DB4A 4QVCA 2XHCA 2L3SA 2DTHA 1QCFA 1AWJA 3CCMA 4M78D 1RAAB 2VASA 4JZ3A 1GCQC 4DBFA 3G71T 2EQMA 5L8RE 1Q7YR 3GBQA 1YJ9T 3CCUT 1AZGB 4D8DA 2ZPFB 1QVFP 2LNVA 2LX9A 4GLMA 1M1KU 4J8OA 1VQ7T 3RERA 2BE9B 1ARKA 4LD6A 3M9QA 3QUIA 1TG0A 4Z8AA 1Q81U 1V1CA 3R6OA 4DA4A 3OYGA 4M75B 3E9GA 3ZBDA 4M7AB 2JUFA 4NS5A 3RKXA 5A0DA 2RNAA 1D3BB 2SRCA 3PFSA 4OMPA 1YP5A 2MYSA 4X34A 2O9VA 3UATA 1YWPA 2A3LA 3OYCA 4HVWA 3SDZA 2QI2A 1G3SA 1PD1A 2QG9B 1M1KC 4J7IA 1Q86R 5KYWB 2CSQA 5KYUA 3CCVA 3LLRA 3TQ7P 3TCJA 1Q81C 4A4EA 4LN2A 3WXMB 3S3NA 5IHNA 2JXBA 1WHLA 5EG2A 1Y96A 2RQTA 1MNEA 2D6FA 1KD1U 3CBPA 2GNCA 3HFNA 1VQ9A 5KH6A 4J6XA 2C06A 3M54A 3UF4A 4CC2A 3BDUA 3P8BB 1K73R 2CUBA 2VXEA 2Z0WA 4M75D 1PKSA 2K5LA 3CXCA 4HT9A 2KSSA 4KH0B 1UB4A 3DLMA 4OB1B 3QIIA 1H92A 3V7CA 2A37A 2AKLA 2GFAA 1RABB 5C0MA 2QA4A 1H3HA 1UE9A 1PD0A 3I56Q 2RH2A 3GPLA 4C5GA 2CUDA 1KD1C 2VKNA 3VYGA 1MMDA 3I55A 1UEBA 6AT1B 3OS2A 2EWNA 4HXJA 2E65A 2O2OA 1G83A 4ZTFA 4Y91A 2DXTA 2MIOA 2ROTA 3E1SA 2R5AA 1BB9A 2YSQA 2MPXC 2EJGA 1I81A 2FEIA 2DXCA 3H41A 5KE3A 2KRNA 5FWCA 3PT9A 3OS5A 2RJFA 1VQLA 2ED1A 3E2UA 3CCSQ 1W6XA 5FU6B 4XU1A 2P4TA 2ATCB 4DEYA 3PIPA 2AZVA 2AZSA 4C5HA 4C0ZA 1OU9A 2E1HA 3PMTA 5KYUB 2E64A 4PFPA 3M53A 4JPBW 3META 2H3EB 1OPLA 1GL5A 4GBQA 5GANe 4PL6A 5LJ5f 5KYXA 2QQBA 1UGRB 1Y96B 3I56T 1G3WA 4ANJA 3CMAA 3GNFB 2K3YA 2MK5A 1VYVA 2DEUA 1UGVA 2DBKA 4MZPA 5GANj 4UC4A 3JCMc 2KYBA 5DY9A 1MGQA 2CP5A 2K2MA 2XDBA 5GAMd 3TSZA 5CCAA 2RJDA 2F69A 4J9DA 3CC2Q 2K57A 2CYZB 2DERA 2LQWA 5KCHA 1JJ2A 2DF6A 4RTWA 3JCMf 1Y7XA 1QWFA 2DPPB 3EFOA 2DK3A 3H8ZA 3CCST 1SRMA 3SWNA 2YDLA 4BDZA 3VS7A 2X3WD 1V29B 3C12A 3G7ZA 1JU5C 3G4SQ 2VWFA 3QYGB 4HVVA 2YHTA 2M1HA 5D6XA 4RTTA 4BE0A 4N4IA 1G3YA 1I0CA 3G6EQ 1B07A 1M9SA 2R57A 9ATCB 3A8HB 4DBHA 2GF7A 3Q1JA 2HL5C 3E9FA 4EIKA 5A0GA 4C0DB 1NEBA 3FJ5A 2ZGWA 4C92C 1Q81R 3HHTB 1KIKA 5I2MA 3VS6A 4C92F 1PKTA 1GCQA 2RQRA 5GAMh 3JCMQ 3CC2T 2LCLA 3EG0A 4XTXA 2F5KA 1M1GA 3M0QA 2X51A 4FYXB 3EGXA 5CAIA 3KUFA 5KYXB 2X4JA 4K11A 4M7AE 3BDLA 3X20B 4QVZA 1UUEA 3G4ST 4JRIA 1NPPA 4KUDK 2FPDA 2M51A 4J9HA 3GIBA 1QVFA 4C8QE 4C0FA 4F17A 1AD5A 3G6ET 4C92G 5CQXA 1M1FA 4HCBA 2QGFB 2RB6A 4ZGEB 2ROLA 3BY7A 3NTIA 2KQWA 2DX1A 1FMWA 3M56A 4Q5WA 3JCMX 2C0TA 2QYZA 2ZPIB 1K9MU 2QQAA 3QXEB 1O9SA 1I8FA 4N4GA 1YJNA 1D1AA 4E7IA 1T0HA 4O5VA 3CCLQ 2PVDB 1ZBJA 3CD6Q 1BI3A 1YIJQ 1GFDA 4AFZC 2RI3A 3L2WA 4HCCA 5D6YA 3RDVA 4R0KA 2RHUA 1ZX6A 4XTUA 1VQ4A 4A4KA 4WF2A 1MMNA 1TOVA 3CMEQ 4JUVA 3RMQA 3CCJA 3A5ZB 3FDRA 4B9WA 1WIEA 3ASKA 1UJYA 1K9MC 1OZ2A 5LJ3j 2NWMA 2KK4A 2PQWA 4L59A 4NOYA 4PJOE 4EMKA 5D6WA 4LNPA 1N9SA 3EGXB 1YCYA 4QQGA 3BE3A 2HSEB 4LUEA 1S72Q 4L5GA 3WVEB 4WCIA 4PJOC 2CZ7B 1ABOA 2FPEA 1KQ1A 1D09B 3OB9A 3T9NA 1K1ZA 2DNUA 1O75A 3MCAB 3CCLT 4JRPA 4LE9A 1TU0B 3CD6T 1YIJT 2PUKB 1VQMQ 3LH0A 2DRMA 4N0AC 7AT1B 2HMAA 4KGZB 1YJWA 1GRIA 1YCSB 4KRTA 4AG1C 2JT4A 2RK1A 4MZTA 1AT1B 1JO8A 4B9XA 3VUBA 5CVIA 3CMET 2D0NA 5FRMA 2CZ0B 1BCMA 1C1AA 2Y4XA 3OYNA 2OX7A 1X2QA 2ZPBB 2E4HA 5GAOp 2XDPA 4R55A 3M4GA 4PKCC 1D0ZA 1UECA 1ZSGA 4M7DC 1MMGA 4DQ2A 3G71A 1RACB 3C95A 1S72T 4M7DF 2KR3A 4QW2A 1YJ9A 1MNDA 3MEAA 3CCUA 3JAME 1X69A 1EIFA 1WLPB 5GAN5 2AKKA 3U23A 5I11A 4D8KA 3OA6A 1VQ7A 3JSCA 4JJCA 4J83A 3FIFA 3LYIA 2CH4A 1VQMT 2SEMA 3GNGA 1KK7A 2L5QA 2OAWA 5GMKi 1LNXA 4EMKB 1RAEB 2HAXA 4MDXA 5GMKh 2FZGB 2D1XA 1K73U 1IGQA 3JCMP 4BE1A 2JM9A 1ACMB 3JRZA 4M7DG 2DL7A 3OYYA 2VVKA 1RI9A 2CP7A 3QYHB 2RHIA 1NLOC 4Z02A 2GQVA 2DD4A 1P92A 5GMKl 3QSUA 3MP8A 2DZCA 1X75C 4P5NA 1KQ2A 1SRLA 2MWPA 3EFSA 5CIUA 1K73C 2EBPA 3NPFA 4MDWA 2XDDA 4QT7A 1UGQB 2GFUA 3VS5A 4B6MA 4J9FA 5I22A 5CQYA 2RO0A 4PJMA 4PJLA 1VQ6Q 5GAN3 3VS1A 4KBMB 2DA9A 4JRQA 2ESWA 1JXOA 3TSWA 1VQ8Q 2KXCA 2DYIA 3OYJA 4WTOB 1WJSA 3I35A 3O5ZA 4HKEA 2ZCFB 2DTIA 1K4US 4IUPA 2EYWA 4AFQC 5A2QE 2KGTA 5IAYA 2BKDN 1QLYA 5L23A 4MMKA 2HKQB 3M59A 1PG5B 3JB9J 1GFCA 2R58A 2KDSA 2NUTA 4FM4B 2RHZA 3CC7Q 1Z9QA 2B86A 4AMCA 4ORZA 4HT8A 4IIOA 2K9GA 4PLIA 4PFOA 1M3AA 2RHYA 1W2BP 2A28A 1WHKA 1VQ6T 4NL3A 4F7UF 2RJCA 2VV5A 2XD0A 1TSFA 4X9DA 3QO3A 1VQ8T 1ZA2B 3I56A 1YBYA 4ATOA 1KQSS 2O9SA 3M0PA 4XTZA 2QASA 2YUNA 1JXMA 3QDFA 2VB6A 5CO7A 1PWTA 1J3TA 4GLKA 5J39A 4BY6C 1OPKA 3M0TA 5GANf 4IUUA 1TXQA 4TVRA 1X27A 2CP3A 4PJOA 4BUGA 4FCYA 4EDUA 4F7UG 3CC7T 4DBQA 3V8JA 1T0JA 3X25B 1Y57A 2FZKB 1WHMA 3CCSA 2W10A 3RKYA 3JCMg 1OU8A 1B34A 4E7ZA 2OTLQ 1X6GA 1QVGP 2X4YA 4MMLA 2QDYB 1GBQA 1KHIA 1LOJA 4C8QB 4DOVA 1LVKA 5CR2A 1HYOA 2K4YA 3FB9A 2DKGA 4RTUA 2CS7A 4A63B 3DLLA 3HPWA 3PVLA 1YFNA 4JLIA 5GAMg 2NUTB 1N9RA 1JRIA 1T3SA 2CSIA 2JZ2A 4OP0A 3L1AA 2E41A 5GAOr 3HRSA 1LJOA 4C5IA 2QGGA 4A54A 3J7AF 1YHQQ 1UG1A 2RJEA 2DJZA 1TUGB 1M8VA 3CC2A 3JCMV 3QJYA 4M7AD 1W2BS 1K9AA 2E6ZA 3VJPA 2DM1A 3FJPA 3CC4Q 1R0BG 1AVZC 3X28B 2JOYA 2NUZA 1RUWA 1VQPA 3G4SA 2OTLT 3V8KA 2V8KA 2L2PA 1WNLA 1N8RU 2ZZDA 1UFFA 4C8QD 1D0YA 4XTVA 1HXDA 3JB9D 4DEXA 3G6EA 3MJXA 4PJNA 2FL7A 1M30A 2AT1B 1NG2A 4NL2A 4PJOB 2L8DA 2ENMA 2YLCA 3X26B 3PNWC 1PRMC 2WACA 1OEBA 1I4K1 4AFSC 2LZ6B 1OZ3A 2LC4A 1YHQT 1HK9A 3A8MB 4QQDA 4KUIA 1KJWA 3JCMJ 2LCSA 4CI0C 5I2SA 5AT1B 2LP5A 1N8RC 1RAHB 4OGCA 3EH2A 1QVGS 2M02A 3CC4T 1VQNQ 4XTWA 4JDSA 3V7RA 1H8KA 2E5QA 5AYFA 3UA7A 4QKUA 2G3RA 3ZL7C 3JCMd 4Z88A 2I2LA 1D0XA 4E7SA 8ATCB 1YITQ 3EH1A 4FSSA 1WI7A 4M77C 1VIEA 4AG2C 1U1TA 4M77F 1XJWB 3KXTA 1QCOA 1JEGA 1NBEB 3VS4A 1U06A 2DJQA 1NEGA 2DTOA 2J7IA 2L89A 2YRDA 5IHIA 4JLGA 5LJ3f 3EGDA 2BTTA 2LNHB 4IIMA 1ZSZC 2NUPA 3CCEQ 4M78C 3PGGA 3CCLA 1VQNT 4CC7A 3CD6A 4M78F 1QCNA 2EGEA 2E5KA 2X3XD 3HSBA 3ER0A 3JCMh 4Y92A 4M77G 1RI0A 3CMEA 3VRYA 3TREA 4C92E 3M0UA 2HQEA 5FLXE 3H0HA 4VUBA 2BZ8A 1YITT 2K3BA 1AEYA 2HKNA 2LT1A 3EG3A 3VS0A 2DL4A 2J05A 3S3MA 3OYBA 4HVUA 3ME9A 1Z9ZA 3HTRA 3QG1A 2BUDA 2K5IA 3RR6A 2JN0A 1S72A 4M78G 5EC7A 2XG8D 1NLPC 1M3CA 3HRTA 4JRKA 2LCCA 1VQKQ 3REBB 3MEWA 3CCET 4XU3A 1UHFA 2V26A 3HRUA 1PSFA 2EAYA 1VQMA 1VQLQ 1Q82R 1LPLA 2NYSA 3MEUA 1K0XA 4V2SA 2L3RA 2OJ2A 2D0QB 2A0FB 2DFUA 2GCXA 3EG1A 2D9TA 4RG2A 3VRZA 4ME7A 4FSXA 1WHGA 3URGA 2DXUA 2MI6A 2A36A 4OB3B 4XAXB 5IH2A 3M5AA 3EGDB 5CKBA 5M9OA 3EFOB 4M75C 2ED0A 2YUQA 3OMCA 5FU7B 1EZZB 4AT1B 3SWNB 4M75F 2NUPB 2E3IA 4PNOA 4M7AF 1MMAA 1ZUYA 5CKEA 2DZ9A 1SF9A 2QTXA 1SKUB 2A08A 1QVGA 2W0ZA 2YT6A 4XTYA 1NM7A 3OBWA 2PNIA 4HCZA 1VQKT 1MV0B 4C8QF 1N8RR 3OYAA 4MZMA 4RCCA 1RLPC 3AT1B 2KVQG 4BDYA 1VQLT 1WHJA 5GJVB 2PUOB 1PSEA 4FW1A 1Q95G 2K3XA 2X35A 4J9GA 2HQHA 4M75G 2EQKA 1FMVA 4M7AG 4OMMA 1N6AA 2EJFA 1H641 5HKCA 4ZGJB 3UDCA 4X1VA 1ZUUA 2EFIA 2RQUA 2K2VA 3LX7A 3M55A 4GY5A 3JCMe 1RAIB 2J6KA 5GAOm 3LWHA 4C8QG 4ZTJA 2HZYA 2HL3A 1PC0A 2OTJQ 1VYUA 1G3TA 3UT1A 1DJ7B 2XU8A 1VYTA 1AHJB 2CP0A 5GAN8 4BI8B 3QHSA 1YWOA 4J9EA 3SHWA 3QZ9B 3V8LA 2KXDA 1ZUKA 5GAMe 4ESRA 1C6VX 1Y07A 4FIBA 3PTAA 2EGAA 2I0NA 3OY9A 1X2KA 1AWWA 4OVAA 2L3PA 1WA7A 5GAMj 1VQ6A 3AHUA 4M7DE 2V1QA 1VQ8A 2F1LA 1ZA1B 2KRSA 3ULRB 5FU6C 4KGXB 2F2VA 3RBBB 4JZ4A 1K76A 3C94A 4BE2A 3CPFA 3CCQQ 1K0SA 4OMQA 4E7JA 2WSEE 5KYYA 3CPWP 2LQKA 3M0SA 4FT4A 3FRNA 1OOTA 3S6WA 1PNJA 1T3LA 2OTJT 2MCNA 4CRIA 1PCXA 2IIMA 4JJDA 2F2WA 1I5LA 2BZYA 2FHDA 3CC7A 4LDWA 1S1NA 1IZ6A 2WSFE 3QBYA 3REAB 4EMGA 4BD3A 1M4ZA 4OMOA 3EG9A 2J06A 1PM3A 3OYLA 1X6OA 3UA6A 3QZ5B 3M57A 4BI3A 4D6WA 4J7FA 3RMSA 5IT9E 2RQWA 3OQ5A 2CT4A 3G1JA 4IUVA 1MHNA 1BYMA 1OX8A 2OI3A 3A98A 2YUPA 1TTHB 3JB9I 1KQSP 3CCQT 4J6WA 3TEEA 2EW3A 4IKFA 3OYFA 1MUZA 4II1A 4C92A 2HD0A 2MWOA 2VGMA 2MOXA 2FVUA 4ELZC 2JS2A 1TUDA 3L2ZA 3H9NA 1E6GA 2M0YA 2MAMA 2ZPGB 2EVRA 2KYMA 2VC8A 4E2FB 2DL5A 3CBOA 1UDLA 4E7KA 3LWIA 1MV3A 4EMHA 2MMPA 1AWOA 3RESA 1UTIA 4Y28E 1BKBA 2PU9B 2OTLA 2RI5A 5DM7R 5J26A 4QVDA 5KYYB 2O88A 3KFVA 3RIRA 1RAFB 4X9CA 4JS5A 1SEMA 2XK0A 1SSFA 2DETA 2L3QA 3CPWS 4RG8A 2QEXQ 2HDAA 2EPDA 1AZEA 1JJ2P 3CEYA 2XIDA 2EYYA 2DIGA 3M58A 2E70A 1IREB 1VQ5Q 3GF5A 1BIAA 5FWBA 1YHQA 3DKMA 1G5VA 3EG9B 4ZNXA 1K8AR 2LJ1A 2DL8A 2E6NA 1JQQA 1H3ZA 3E19A 1VQOQ 1V76A 2Y90A 2EQUA 3CC4A 1UHCA 1IRXA 3SB2A 5GANd 4DBRA 1M90U 1I1JA 3NFCA 1QW1A 2LQ8A 1LCKA 1KC8U 2XI9A 3J81E 2K5FA 3IQLA 3N5BB 4C92B 2NLUA 2QQ9A 3M0RA 2V8JA 5LJ5g 5D7UA 4F16A 5GMKe 2QEXT 3OS1A 3QWYA 2CP2A 2DIQA 2EKHA 5A0LA 1IHVA 4A53A 2QTVA 2M9UA 1E6HA 1M3BA 3NHNA 5CKHA 4M4ZA 1VQ5T 5GMKj 4L6V5 1M90C 1IHWA 1KC8C 3NMZC 5FROA 3CBMA 5KCOA 5LJ3g 3CCRQ 5GAOq 1VQOT 2A7YA 4KT0E 2QDLA 1VQNA 4BACA 4F14A 2RM4A 3QKJA 4N0AA 2QQRA 2JTMA 5GANh 1B7TA 5HK3A 3EG2A 2DL3A 4KH1B 5HCKA 2F5TX 3QPHA 4XQ3A 1KSWA 4C92D 1YI2Q 3VS3A 3LGFA 1NE8A 1Q82U 1JJ2S 2YXYA 2H3JA 2HBPA 1YITA 4OGEA 1QMCA 4E7LA 1D1CA 4FYYB 3VS2A 1R77A 5FRNA 2J6OA 2DXBA 2RF0A 4M7DA 2KROA 1M27C 2RI2A 4F04B 1WFWA 2HBWA 3OSSC 2JS0A 1WXBA 2H8HA 1N27A 1F1BB 3CCRT 3CCEA 1Q82C 3I5RA 4XU2A 4RTVA 1KG1A 2WSCE 1XOVA 3JV3A 2KI7A 4JJBA 5IXFA 1BBZA 2COYA 3VUZA 1CKAA 3CPWA 3ZFJA 3I5SA 4OF1A 1HJDA 1YI2T 1UGSB 2VXFA 2DILA 2C0OA 2DMOA 3L2VA 2BE7D 5KE2A 2Y4YA 3SFMA 1W4SA 1BIBA 1W70A 3JCMb 5LJ5d 3H0IA 3CCMQ 2EIFA 3FEOA 4PFZA 1D1BA 4EMKC 2FO0A 1B34B 1B3QA 3LGLA 2OAUA 4OB0B 1Y0MA 3UPUA 5IHKA 1QVFS 4FYVB 3L42A 4RTZA 3UWNA 5HY6A
chains in the Genus database with same CATH topology
2CH4W 2RMOA 2A36A 5IH2A 2L3SA 4OMLA 4D8KA 5I11A 2ED0A 2YUQA 1QCFA 4JJCA 1AWJA 3EHRA 2CH4A 3I9QA 2SEMA 2CDTA 1ZUYA 2ECZA 4JZ3A 1GCQC 2OAWA 3CQTA 3GBQA 2A08A 2J6FA 2W0ZA 2YT6A 1AZGB 2D1XA 2D8JA 3EHQA 4J9IA 4D8DA 1NM7A 2PNIA 4GLMA 2JM9A 4J9BA 1MV0B 2DYBA 2DL7A 2VVKA 1RI9A 2JTEA 1ARKA 3TVTA 1RLPC 1NLOC 1TG0A 4Z8AA 1V1CA 2PTKA 1E7OA 3H0FA 2CREA 5GJVB 2DVJA 2RNAA 1SRLA 4J9GA 1SPKA 2SRCA 1FMKA 4OMPA 4OMMA 5GJWB 4J9CA 1YP5A 2LJ3A 2O9VA 3UATA 1YWPA 4X1VA 3EGUA 4HVWA 1ZUUA 2RQUA 2EBPA 3NPFA 1FYNA 4QT7A 1TUCA 3VS5A 2J6KA 2AK5A 2CSQA 5I22A 4J9FA 4RTYA 4LN2A 1GCPA 1HSQA 1A0NB 5IHNA 2JXBA 2RPNA 1VYUA 3VS1A 4CC4B 2DA9A 2RQTA 2ESWA 1JXOA 3R6NA 3TSWA 2GNCA 2KXCA 1VYTA 2GQIA 2KRMA 2LJ0A 1U3OA 1YWOA 3I35A 3O5ZA 3LH5A 4J9EA 3SHWA 2KXDA 3UF4A 1ZUKA 4CC2A 4ESRA 2CUBA 1K4US 2BZXA 2EGAA 1PKSA 2EYWA 1WDXA 2I0NA 1WXTA 1X2KA 4AFQC 1AWWA 2KGTA 1ZLMA 2FRWA 1QLYA 2L3PA 1X43A 5L23A 1WA7A 1H92A 3THKA 2V1QA 2A37A 2AKLA 1GFCA 1H3HA 1UE9A 2KRSA 3ULRB 4Z89A 2CUDA 2F2VA 3RBBB 4JZ4A 1Z9QA 2B86A 1K76A 2VKNA 4ORZA 1QKWA 4OMNA 1K0SA 2L0AA 4IIOA 4OMQA 2K9GA 4HXJA 2O2OA 1M3AA 1G83A 3M0SA 1OOTA 1CSKA 1PNJA 2A28A 1T3LA 1BK2A 2K79A 2K6DA 2MIOA 1WXUA 2ROTA 2KNBB 1BB9A 2YSQA 1AWXA 2MCNA 2LX7A 2K7AA 2FEIA 2IIMA 4JJDA 3H41A 2KRNA 5FWCA 2ED1A 2F2WA 2BZYA 2O9SA 1S1NA 1AOJA 1W6XA 3M0PA 2YUNA 3REAB 1JXMA 4DEYA 2AZVA 4OMOA 2AZSA 2J06A 1PWTA 1J3TA 1W1FA 3UA6A 1OPKA 4JPBW 3QWXX 1OPLA 1GL5A 4GBQA 3M0TA 2RQWA 2CT4A 1YN8A 1X27A 2KT1A 2KBTA 2XMFA 1VYVA 1T0JA 1PHTA 1UGVA 1VA7A 2DBKA 2OI3A 3A98A 1Y57A 2YUPA 2C0IA 2W10A 2KYBA 4RUGA 2RQVA 2EW3A 1MUZA 3PE0A 1X6GA 2MOXA 2K2MA 2GBQA 3TSZA 1GBQA 2JS2A 1TUDA 1E6GA 2M0YA 4J9DA 2EVRA 4LUDA 2KYMA 2DL5A 2LQWA 2DF6A 4RTWA 1UDLA 2PZ1A 1QWFA 4RTUA 4A63B 1MV3A 3PVLA 1SRMA 1OV3A 2YDLA 1QWEA 1AWOA 3VS7A 2X3WD 1T3SA 1UTIA 2CSIA 1JU5C 2VWFA 2JMCA 2EQIA 4HVVA 5IXBA 1UG1A 2O88A 2EYZA 3KFVA 1KFZA 4RTTA 5FW9A 1SEMA 3C0CA 2L3QA 1I0CA 1B07A 1SHFA 2HDAA 1K9AA 1SHGA 2EPDA 2DM1A 2LQNA 2HSPA 1AZEA 4EIKA 1AVZC 2EYYA 1NEBA 2NUZA 1RUWA 3FJ5A 2LMJA 1PRLC 1KIKA 1HD3A 3VS6A 5FWBA 1PKTA 2L2PA 1GCQA 2O31A 2RQRA 4ZNXA 1UFFA 2LJ1A 3EG0A 4DEXA 1WYXA 2DL8A 2EGCA 1JQQA 3M0QA 1M30A 1NG2A 4RTXA 4K11A 1UHCA 1CKBA 2ENMA 1UUEA 2RN8A 1PRMC 2FRYA 2GGRA 1I1JA 1OEBA 4AFSC 1LCKA 2LZ6B 2FPDA 2M51A 4J9HA 1WX6A 5ECAA 3IQLA 2DBMA 3NGPA 3M0RA 1KJWA 2LCSA 1ABQA 4F17A 1AD5A 2DLPA 2LP5A 3U23A 4F16A 3QWYA 1G2BA 1BU1A 2EKHA 1H8KA 3UA7A 2ROLA 3ZL7C 1E6HA 1M3BA 3NHNA 3SEMA 2DX1A 4M4ZA 4E6RA 1QKXA 4Z88A 4CC3A 2C0TA 4HCKA 3NMZC 1EFNA 1UJ0A 1T0HA 4FSSA 1WI7A 2GTJA 1ZBJA 4AG2C 2QDLA 3RNJA 1GFDA 4F14A 1IO6A 4AFZC 2P4RA 1JEGA 3VS4A 4R0KA 1NYGA 1U06A 1ZX6A 3EG2A 2DJQA 1NEGA 2DL3A 5HCKA 2J7IA 5IHIA 1KSWA 3VS3A 2BTTA 2LNHB 4IIMA 1WIEA 2KE9A 2KT8A 1UJYA 2FPFA 2KEAA 3VS2A 2NWMA 4CC7A 2CT3A 2G6FX 2F2XA 4LNPA 1RLQC 2EGEA 2E5KA 2J6OA 2RF0A 2X3XD 2KROA 4LUEA 1M27C 2JW4A 4Y92A 1WFWA 2HBWA 4WCIA 2JS0A 1GBRA 3VRYA 1ABOA 1WXBA 3M0UA 2FPEA 2H8HA 3H0HA 1K1ZA 2BZ8A 1M8MA 1NYFA 2DNUA 2K3BA 1AEYA 2HCKA 3I5RA 4RTVA 3EG3A 2DE0X 4LE9A 1XOVA 3JV3A 3VS0A 2DL4A 2J05A 4JJBA 4HVUA 1Z9ZA 2DRMA 2GTOA 1BBZA 5IXFA 2DRKA 2D8HA 1GRIA 1YCSB 1CKAA 4KRTA 4AG1C 1SSHA 1I07A 2JT4A 1WLPB 3I5SA 1JO8A 5EC7A 2YUOA 1NLPC 2D0NA 1HJDA 2DILA 2C0OA 1M3CA 1X6BA 2DMOA 1X2QA 3REBB 2EYXA 1W70A 1UHFA 2HEQA 1U5SA 3H0IA 2ABLA 2FG0A 1UECA 2JM8A 2FO0A 1K0XA 1B3QA 1ZSGA 2JMAA 1Y0MA 2OJ2A 2V1RA 2KR3A 3PVQA 4AFUC 5IHKA 4RTZA 3EG1A 1X69A 1N5ZA 3VRZA 1YNZA 2AKKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CH4 W;  2RMO A;  2A36 A;  5IH2 A;  2L3S A;  4OML A;  4D8K A;  5I11 A;  2ED0 A;  2YUQ A;  1QCF A;  4JJC A;  1AWJ A;  3EHR A;  2CH4 A;  3I9Q A;  2SEM A;  2CDT A;  1ZUY A;  2ECZ A;  4JZ3 A;  1GCQ C;  2OAW A;  3CQT A;  3GBQ A;  2A08 A;  2J6F A;  2W0Z A;  2YT6 A;  1AZG B;  2D1X A;  2D8J A;  3EHQ A;  4J9I A;  4D8D A;  1NM7 A;  2PNI A;  4GLM A;  2JM9 A;  4J9B A;  1MV0 B;  2DYB A;  2DL7 A;  2VVK A;  1RI9 A;  2JTE A;  1ARK A;  3TVT A;  1RLP C;  1NLO C;  1TG0 A;  4Z8A A;  1V1C A;  2PTK A;  1E7O A;  3H0F A;  2CRE A;  5GJV B;  2DVJ A;  2RNA A;  1SRL A;  4J9G A;  1SPK A;  2SRC A;  1FMK A;  4OMP A;  4OMM A;  5GJW B;  4J9C A;  1YP5 A;  2LJ3 A;  2O9V A;  3UAT A;  1YWP A;  4X1V A;  3EGU A;  4HVW A;  1ZUU A;  2RQU A;  2EBP A;  3NPF A;  1FYN A;  4QT7 A;  1TUC A;  3VS5 A;  2J6K A;  2AK5 A;  2CSQ A;  5I22 A;  4J9F A;  4RTY A;  4LN2 A;  1GCP A;  1HSQ A;  1A0N B;  5IHN A;  2JXB A;  2RPN A;  1VYU A;  3VS1 A;  4CC4 B;  2DA9 A;  2RQT A;  2ESW A;  1JXO A;  3R6N A;  3TSW A;  2GNC A;  2KXC A;  1VYT A;  2GQI A;  2KRM A;  2LJ0 A;  1U3O A;  1YWO A;  3I35 A;  3O5Z A;  3LH5 A;  4J9E A;  3SHW A;  2KXD A;  3UF4 A;  1ZUK A;  4CC2 A;  4ESR A;  2CUB A;  1K4U S;  2BZX A;  2EGA A;  1PKS A;  2EYW A;  1WDX A;  2I0N A;  1WXT A;  1X2K A;  4AFQ C;  1AWW A;  2KGT A;  1ZLM A;  2FRW A;  1QLY A;  2L3P A;  1X43 A;  5L23 A;  1WA7 A;  1H92 A;  3THK A;  2V1Q A;  2A37 A;  2AKL A;  1GFC A;  1H3H A;  1UE9 A;  2KRS A;  3ULR B;  4Z89 A;  2CUD A;  2F2V A;  3RBB B;  4JZ4 A;  1Z9Q A;  2B86 A;  1K76 A;  2VKN A;  4ORZ A;  1QKW A;  4OMN A;  1K0S A;  2L0A A;  4IIO A;  4OMQ A;  2K9G A;  4HXJ A;  2O2O A;  1M3A A;  1G83 A;  3M0S A;  1OOT A;  1CSK A;  1PNJ A;  2A28 A;  1T3L A;  1BK2 A;  2K79 A;  2K6D A;  2MIO A;  1WXU A;  2ROT A;  2KNB B;  1BB9 A;  2YSQ A;  1AWX A;  2MCN A;  2LX7 A;  2K7A A;  2FEI A;  2IIM A;  4JJD A;  3H41 A;  2KRN A;  5FWC A;  2ED1 A;  2F2W A;  2BZY A;  2O9S A;  1S1N A;  1AOJ A;  1W6X A;  3M0P A;  2YUN A;  3REA B;  1JXM A;  4DEY A;  2AZV A;  4OMO A;  2AZS A;  2J06 A;  1PWT A;  1J3T A;  1W1F A;  3UA6 A;  1OPK A;  4JPB W;  3QWX X;  1OPL A;  1GL5 A;  4GBQ A;  3M0T A;  2RQW A;  2CT4 A;  1YN8 A;  1X27 A;  2KT1 A;  2KBT A;  2XMF A;  1VYV A;  1T0J A;  1PHT A;  1UGV A;  1VA7 A;  2DBK A;  2OI3 A;  3A98 A;  1Y57 A;  2YUP A;  2C0I A;  2W10 A;  2KYB A;  4RUG A;  2RQV A;  2EW3 A;  1MUZ A;  3PE0 A;  1X6G A;  2MOX A;  2K2M A;  2GBQ A;  3TSZ A;  1GBQ A;  2JS2 A;  1TUD A;  1E6G A;  2M0Y A;  4J9D A;  2EVR A;  4LUD A;  2KYM A;  2DL5 A;  2LQW A;  2DF6 A;  4RTW A;  1UDL A;  2PZ1 A;  1QWF A;  4RTU A;  4A63 B;  1MV3 A;  3PVL A;  1SRM A;  1OV3 A;  2YDL A;  1QWE A;  1AWO A;  3VS7 A;  2X3W D;  1T3S A;  1UTI A;  2CSI A;  1JU5 C;  2VWF A;  2JMC A;  2EQI A;  4HVV A;  5IXB A;  1UG1 A;  2O88 A;  2EYZ A;  3KFV A;  1KFZ A;  4RTT A;  5FW9 A;  1SEM A;  3C0C A;  2L3Q A;  1I0C A;  1B07 A;  1SHF A;  2HDA A;  1K9A A;  1SHG A;  2EPD A;  2DM1 A;  2LQN A;  2HSP A;  1AZE A;  4EIK A;  1AVZ C;  2EYY A;  1NEB A;  2NUZ A;  1RUW A;  3FJ5 A;  2LMJ A;  1PRL C;  1KIK A;  1HD3 A;  3VS6 A;  5FWB A;  1PKT A;  2L2P A;  1GCQ A;  2O31 A;  2RQR A;  4ZNX A;  1UFF A;  2LJ1 A;  3EG0 A;  4DEX A;  1WYX A;  2DL8 A;  2EGC A;  1JQQ A;  3M0Q A;  1M30 A;  1NG2 A;  4RTX A;  4K11 A;  1UHC A;  1CKB A;  2ENM A;  1UUE A;  2RN8 A;  1PRM C;  2FRY A;  2GGR A;  1I1J A;  1OEB A;  4AFS C;  1LCK A;  2LZ6 B;  2FPD A;  2M51 A;  4J9H A;  1WX6 A;  5ECA A;  3IQL A;  2DBM A;  3NGP A;  3M0R A;  1KJW A;  2LCS A;  1ABQ A;  4F17 A;  1AD5 A;  2DLP A;  2LP5 A;  3U23 A;  4F16 A;  3QWY A;  1G2B A;  1BU1 A;  2EKH A;  1H8K A;  3UA7 A;  2ROL A;  3ZL7 C;  1E6H A;  1M3B A;  3NHN A;  3SEM A;  2DX1 A;  4M4Z A;  4E6R A;  1QKX A;  4Z88 A;  4CC3 A;  2C0T A;  4HCK A;  3NMZ C;  1EFN A;  1UJ0 A;  1T0H A;  4FSS A;  1WI7 A;  2GTJ A;  1ZBJ A;  4AG2 C;  2QDL A;  3RNJ A;  1GFD A;  4F14 A;  1IO6 A;  4AFZ C;  2P4R A;  1JEG A;  3VS4 A;  4R0K A;  1NYG A;  1U06 A;  1ZX6 A;  3EG2 A;  2DJQ A;  1NEG A;  2DL3 A;  5HCK A;  2J7I A;  5IHI A;  1KSW A;  3VS3 A;  2BTT A;  2LNH B;  4IIM A;  1WIE A;  2KE9 A;  2KT8 A;  1UJY A;  2FPF A;  2KEA A;  3VS2 A;  2NWM A;  4CC7 A;  2CT3 A;  2G6F X;  2F2X A;  4LNP A;  1RLQ C;  2EGE A;  2E5K A;  2J6O A;  2RF0 A;  2X3X D;  2KRO A;  4LUE A;  1M27 C;  2JW4 A;  4Y92 A;  1WFW A;  2HBW A;  4WCI A;  2JS0 A;  1GBR A;  3VRY A;  1ABO A;  1WXB A;  3M0U A;  2FPE A;  2H8H A;  3H0H A;  1K1Z A;  2BZ8 A;  1M8M A;  1NYF A;  2DNU A;  2K3B A;  1AEY A;  2HCK A;  3I5R A;  4RTV A;  3EG3 A;  2DE0 X;  4LE9 A;  1XOV A;  3JV3 A;  3VS0 A;  2DL4 A;  2J05 A;  4JJB A;  4HVU A;  1Z9Z A;  2DRM A;  2GTO A;  1BBZ A;  5IXF A;  2DRK A;  2D8H A;  1GRI A;  1YCS B;  1CKA A;  4KRT A;  4AG1 C;  1SSH A;  1I07 A;  2JT4 A;  1WLP B;  3I5S A;  1JO8 A;  5EC7 A;  2YUO A;  1NLP C;  2D0N A;  1HJD A;  2DIL A;  2C0O A;  1M3C A;  1X6B A;  2DMO A;  1X2Q A;  3REB B;  2EYX A;  1W70 A;  1UHF A;  2HEQ A;  1U5S A;  3H0I A;  2ABL A;  2FG0 A;  1UEC A;  2JM8 A;  2FO0 A;  1K0X A;  1B3Q A;  1ZSG A;  2JMA A;  1Y0M A;  2OJ2 A;  2V1R A;  2KR3 A;  3PVQ A;  4AFU C;  5IHK A;  4RTZ A;  3EG1 A;  1X69 A;  1N5Z A;  3VRZ A;  1YNZ A;  2AKK A; 
#chains in the Genus database with same CATH topology
 2CH4 W;  1VQK A;  2RMO A;  2KY9 A;  4OML A;  4R56 A;  5LJ3 d;  1TS9 A;  3EHR A;  1WZO A;  3MHX A;  1VUB A;  1JBM A;  2EJ9 A;  3I9Q A;  1KQS A;  2FB7 A;  2CDT A;  2ECZ A;  4M77 E;  4KGV B;  3A8O B;  3CQT A;  2VGN A;  1NZ9 A;  4ZGD B;  2J6F A;  1R0C B;  3OW2 P;  3EHQ A;  4J9I A;  2D8J A;  4M7D B;  3MPU B;  1I5O B;  4J9B A;  4PJO D;  5KYN A;  2DYB A;  2PVO B;  2DO3 A;  5DLO A;  4LDX A;  2JTE A;  3CCM T;  5LJ5 h;  3TVT A;  3VV0 A;  2PTK A;  1E7O A;  3CCV Q;  3H0F A;  2CRE A;  4M78 E;  2DVJ A;  4A4G A;  4J6Y A;  1QP2 A;  4LD9 K;  2X4W A;  3NTK A;  1SPK A;  1M2V A;  1FMK A;  2AIR B;  1M90 R;  5GJW B;  1WJR A;  4J9C A;  2LJ3 A;  1KC8 R;  5J3B A;  1RAD B;  3EGU A;  4FL6 A;  1VQ9 Q;  1YIJ A;  1FYN A;  1EX4 A;  3EAE A;  2QAZ A;  2LT4 A;  3OYD A;  5LJ3 h;  1TUC A;  1NJI U;  3DB3 A;  3MP1 A;  2AK5 A;  2VYT A;  4FU6 A;  4RTY A;  4F7U A;  1GCP A;  1HSQ A;  1A0N B;  1SG5 A;  4OB2 B;  4M7D D;  2RPN A;  1VQP Q;  4CC4 B;  1IXD A;  3P8D A;  3R6N A;  2QA4 Q;  2ZAE A;  2GQI A;  2KRM A;  2LJ0 A;  3MKD A;  1U3O A;  1M5Q 1;  3LH5 A;  3OMG A;  1RL2 A;  3I55 Q;  4JS4 A;  5DLQ E;  3RUX A;  5GAM f;  1W2B A;  3CCV T;  2BZX A;  1WDX A;  3HFO A;  1WXT A;  4A4F A;  1M1K R;  1VIF A;  2B8A A;  1ZLM A;  2FRW A;  1X43 A;  1NJI C;  3OS0 A;  2OTJ A;  2YLB A;  3THK A;  1WJQ A;  2JVV A;  2QQS A;  2XKO C;  2ZPE B;  3PIO A;  3QJ6 A;  1VQ9 T;  4Z89 A;  4IUQ A;  1OUL A;  2CP6 A;  2BIV A;  4LDV A;  2EYQ A;  1QKW A;  3FLG A;  4OMN A;  3OW2 S;  2R5M A;  1X01 A;  2L0A A;  1XTD A;  4M75 E;  1KHC A;  2E10 A;  1CSK A;  1XNI A;  1NPR A;  1BK2 A;  2K79 A;  2K6D A;  2RA2 A;  1WXU A;  2KNB B;  5CKF A;  1VQP T;  1AWX A;  2HNI A;  2LX7 A;  2K7A A;  1U8R A;  2QA4 T;  4M7A C;  3GP8 A;  1M2V B;  1BI0 A;  1UGP B;  3CMA Q;  3I55 T;  1ZHI A;  4RKU E;  1AOJ A;  3CCQ A;  1OQK A;  3HL8 A;  3OSV A;  1IB8 A;  5CKD A;  1KD1 R;  4FYW B;  4C8Q C;  1W1F A;  2LVM A;  5GAO n;  3QWX X;  4F7U B;  2P84 A;  3JB9 F;  2VUB A;  5LJ5 e;  1YN8 A;  2KT1 A;  3MEV A;  2KBT A;  2XMF A;  2E3H A;  1M2O A;  4IUR A;  4EPC A;  4FW2 A;  1PHT A;  1VA7 A;  1WQW A;  1G8X A;  1K8A U;  3S3O A;  2YRC A;  2O4X A;  2C0I A;  5LJ5 j;  4RUG A;  2RQV A;  2QXF A;  3PE0 A;  3VKI A;  2MF2 A;  3M4Y A;  2GBQ A;  4PJJ A;  3L2Q A;  1R8O B;  1WGS A;  2ZPH B;  3QDR B;  4BY6 B;  2LDM A;  1U1S A;  2AHJ B;  5LJ3 e;  4LUD A;  3O8V A;  4E7H A;  3CMA T;  3RKW A;  2PZ1 A;  3NTH A;  4HA8 A;  3A1P A;  3JB9 G;  3GOX A;  3OYM A;  1OV3 A;  5CK9 A;  2V8I A;  1QWE A;  3OYH A;  4C5E A;  2X4X A;  3JB9 H;  1K8A C;  3OYI A;  5GAN 2;  2KMT A;  2JMC A;  2EQI A;  4BI4 A;  5IXB A;  2EYZ A;  1KFZ A;  5FW9 A;  2RK2 A;  1BCO A;  1FWZ A;  3C0C A;  2JTF A;  3WVD B;  4J5Y A;  3BFM A;  1SHF A;  4PJO F;  1SHG A;  2LQN A;  2HSP A;  3X24 B;  5C6S A;  2YRV A;  1Q7Y U;  4JJN K;  1ZBX A;  2LMJ A;  1PRL C;  2QK0 A;  1HD3 A;  5GAO l;  2DD5 A;  2O31 A;  1Y71 A;  5I21 A;  3VYH B;  1WYX A;  2EGC A;  2IPO B;  2KAF A;  3HKS A;  4IUT A;  1OI1 A;  5LL6 S;  4M77 A;  2QEX A;  1RAG B;  4RTX A;  4C0G A;  3F70 A;  1CKB A;  3INZ A;  1FXX A;  3CXC P;  2RN8 A;  3JCM W;  1C0M A;  2FRY A;  4YTL A;  2GGR A;  4PJO G;  1Q7Y C;  2O4X B;  1TH7 A;  1XQH A;  4RCB A;  1VQ5 A;  1NJI R;  3HP9 A;  3BW1 A;  1WX6 A;  3OW2 A;  5ECA A;  2P0P A;  3V7S A;  2RHX A;  2DBM A;  1VOM A;  3MO8 A;  3VU3 C;  4LXC A;  3NGP A;  4N4H A;  5GAN g;  1ABQ A;  2DLP A;  1YJN Q;  1ZSZ A;  1Q86 U;  2FYK A;  4M78 A;  5HK0 A;  1VQO A;  1WPY A;  5GMK m;  1G2B A;  3ZEH A;  1BU1 A;  2EQJ A;  1OX9 A;  3C4S A;  3SEM A;  1VQ4 Q;  4E6R A;  1QKX A;  2M16 A;  2E12 A;  3H6Z A;  3J80 E;  3SD4 A;  4CC3 A;  3CCJ Q;  1ZQ1 A;  4HCK A;  4ELY C;  5GAN 6;  1FX7 A;  8AT1 B;  1EFN A;  2M0O A;  1QQJ A;  1UJ0 A;  3LW5 E;  2HQX A;  2LRQ A;  3EFR A;  2GTJ A;  3D7S B;  3L2U A;  4ZN1 A;  3RNJ A;  1IO6 A;  1Q86 C;  4PLL A;  4O6J A;  2P4R A;  2IG0 A;  1NYG A;  4BB7 A;  1WQ7 A;  3OYK A;  4KUL A;  3KBG A;  4OMF B;  4C0D C;  2COW A;  3OBY A;  4LDY A;  1YJN T;  2KE9 A;  2KT8 A;  4PK4 A;  1TWB A;  2FPF A;  3CCR A;  2DEQ A;  3A8G B;  3MP6 A;  2KEA A;  1BI2 A;  5IN1 A;  2CT3 A;  2G6F X;  2JJ9 A;  2F2X A;  1RLQ C;  2COZ A;  4QQ6 A;  4M77 B;  1YJW Q;  1VQ4 T;  4XK8 E;  4DOW A;  2JW4 A;  1GBR A;  3CCJ T;  1YI2 A;  2IVW A;  1M8M A;  1NYF A;  3CXC S;  2JNG A;  4RMO A;  2HCK A;  2LTO A;  3OYE A;  3PMI A;  1BI1 A;  2FZC B;  4M75 A;  4M7A A;  2DE0 X;  3FC3 A;  2YWW A;  4ZN3 A;  1ZSZ B;  2GTO A;  1D3B A;  1K9M R;  4M78 B;  2DRK A;  2D8H A;  2X9H A;  3G71 Q;  1OYX A;  2P0K A;  1SSH A;  1I07 A;  4F7U E;  1YJ9 Q;  2YUO A;  3CCU Q;  1IGU A;  4A4H A;  3TU4 K;  1X6B A;  1QVP A;  4C8Q A;  2PVG B;  4FT2 A;  5FU7 C;  2CZ1 B;  3SWN C;  2CZ6 B;  2EYX A;  3L2R A;  1VQ7 Q;  2HEQ A;  3GLX A;  2DVE A;  1U5S A;  5KYW A;  2ABL A;  2FG0 A;  2CKK A;  4E47 A;  3P8H A;  2JM8 A;  3A8L B;  2EKO A;  2O01 E;  4M77 D;  2XIC A;  5GAN 7;  1YJW T;  2RD1 A;  2JMA A;  4XU0 A;  5GAN 4;  2V1R A;  1QP3 A;  4AFU C;  3PVQ A;  1WHH A;  4LDU A;  2P0Q A;  2DAQ A;  1N5Z A;  1YNZ A;  1JB0 E;  1GXI E;  2CGH A;  3DB4 A;  4QVC A;  2XHC A;  2L3S A;  2DTH A;  1QCF A;  1AWJ A;  3CCM A;  4M78 D;  1RAA B;  2VAS A;  4JZ3 A;  1GCQ C;  4DBF A;  3G71 T;  2EQM A;  5L8R E;  1Q7Y R;  3GBQ A;  1YJ9 T;  3CCU T;  1AZG B;  4D8D A;  2ZPF B;  1QVF P;  2LNV A;  2LX9 A;  4GLM A;  1M1K U;  4J8O A;  1VQ7 T;  3RER A;  2BE9 B;  1ARK A;  4LD6 A;  3M9Q A;  3QUI A;  1TG0 A;  4Z8A A;  1Q81 U;  1V1C A;  3R6O A;  4DA4 A;  3OYG A;  4M75 B;  3E9G A;  3ZBD A;  4M7A B;  2JUF A;  4NS5 A;  3RKX A;  5A0D A;  2RNA A;  1D3B B;  2SRC A;  3PFS A;  4OMP A;  1YP5 A;  2MYS A;  4X34 A;  2O9V A;  3UAT A;  1YWP A;  2A3L A;  3OYC A;  4HVW A;  3SDZ A;  2QI2 A;  1G3S A;  1PD1 A;  2QG9 B;  1M1K C;  4J7I A;  1Q86 R;  5KYW B;  2CSQ A;  5KYU A;  3CCV A;  3LLR A;  3TQ7 P;  3TCJ A;  1Q81 C;  4A4E A;  4LN2 A;  3WXM B;  3S3N A;  5IHN A;  2JXB A;  1WHL A;  5EG2 A;  1Y96 A;  2RQT A;  1MNE A;  2D6F A;  1KD1 U;  3CBP A;  2GNC A;  3HFN A;  1VQ9 A;  5KH6 A;  4J6X A;  2C06 A;  3M54 A;  3UF4 A;  4CC2 A;  3BDU A;  3P8B B;  1K73 R;  2CUB A;  2VXE A;  2Z0W A;  4M75 D;  1PKS A;  2K5L A;  3CXC A;  4HT9 A;  2KSS A;  4KH0 B;  1UB4 A;  3DLM A;  4OB1 B;  3QII A;  1H92 A;  3V7C A;  2A37 A;  2AKL A;  2GFA A;  1RAB B;  5C0M A;  2QA4 A;  1H3H A;  1UE9 A;  1PD0 A;  3I56 Q;  2RH2 A;  3GPL A;  4C5G A;  2CUD A;  1KD1 C;  2VKN A;  3VYG A;  1MMD A;  3I55 A;  1UEB A;  6AT1 B;  3OS2 A;  2EWN A;  4HXJ A;  2E65 A;  2O2O A;  1G83 A;  4ZTF A;  4Y91 A;  2DXT A;  2MIO A;  2ROT A;  3E1S A;  2R5A A;  1BB9 A;  2YSQ A;  2MPX C;  2EJG A;  1I81 A;  2FEI A;  2DXC A;  3H41 A;  5KE3 A;  2KRN A;  5FWC A;  3PT9 A;  3OS5 A;  2RJF A;  1VQL A;  2ED1 A;  3E2U A;  3CCS Q;  1W6X A;  5FU6 B;  4XU1 A;  2P4T A;  2ATC B;  4DEY A;  3PIP A;  2AZV A;  2AZS A;  4C5H A;  4C0Z A;  1OU9 A;  2E1H A;  3PMT A;  5KYU B;  2E64 A;  4PFP A;  3M53 A;  4JPB W;  3MET A;  2H3E B;  1OPL A;  1GL5 A;  4GBQ A;  5GAN e;  4PL6 A;  5LJ5 f;  5KYX A;  2QQB A;  1UGR B;  1Y96 B;  3I56 T;  1G3W A;  4ANJ A;  3CMA A;  3GNF B;  2K3Y A;  2MK5 A;  1VYV A;  2DEU A;  1UGV A;  2DBK A;  4MZP A;  5GAN j;  4UC4 A;  3JCM c;  2KYB A;  5DY9 A;  1MGQ A;  2CP5 A;  2K2M A;  2XDB A;  5GAM d;  3TSZ A;  5CCA A;  2RJD A;  2F69 A;  4J9D A;  3CC2 Q;  2K57 A;  2CYZ B;  2DER A;  2LQW A;  5KCH A;  1JJ2 A;  2DF6 A;  4RTW A;  3JCM f;  1Y7X A;  1QWF A;  2DPP B;  3EFO A;  2DK3 A;  3H8Z A;  3CCS T;  1SRM A;  3SWN A;  2YDL A;  4BDZ A;  3VS7 A;  2X3W D;  1V29 B;  3C12 A;  3G7Z A;  1JU5 C;  3G4S Q;  2VWF A;  3QYG B;  4HVV A;  2YHT A;  2M1H A;  5D6X A;  4RTT A;  4BE0 A;  4N4I A;  1G3Y A;  1I0C A;  3G6E Q;  1B07 A;  1M9S A;  2R57 A;  9ATC B;  3A8H B;  4DBH A;  2GF7 A;  3Q1J A;  2HL5 C;  3E9F A;  4EIK A;  5A0G A;  4C0D B;  1NEB A;  3FJ5 A;  2ZGW A;  4C92 C;  1Q81 R;  3HHT B;  1KIK A;  5I2M A;  3VS6 A;  4C92 F;  1PKT A;  1GCQ A;  2RQR A;  5GAM h;  3JCM Q;  3CC2 T;  2LCL A;  3EG0 A;  4XTX A;  2F5K A;  1M1G A;  3M0Q A;  2X51 A;  4FYX B;  3EGX A;  5CAI A;  3KUF A;  5KYX B;  2X4J A;  4K11 A;  4M7A E;  3BDL A;  3X20 B;  4QVZ A;  1UUE A;  3G4S T;  4JRI A;  1NPP A;  4KUD K;  2FPD A;  2M51 A;  4J9H A;  3GIB A;  1QVF A;  4C8Q E;  4C0F A;  4F17 A;  1AD5 A;  3G6E T;  4C92 G;  5CQX A;  1M1F A;  4HCB A;  2QGF B;  2RB6 A;  4ZGE B;  2ROL A;  3BY7 A;  3NTI A;  2KQW A;  2DX1 A;  1FMW A;  3M56 A;  4Q5W A;  3JCM X;  2C0T A;  2QYZ A;  2ZPI B;  1K9M U;  2QQA A;  3QXE B;  1O9S A;  1I8F A;  4N4G A;  1YJN A;  1D1A A;  4E7I A;  1T0H A;  4O5V A;  3CCL Q;  2PVD B;  1ZBJ A;  3CD6 Q;  1BI3 A;  1YIJ Q;  1GFD A;  4AFZ C;  2RI3 A;  3L2W A;  4HCC A;  5D6Y A;  3RDV A;  4R0K A;  2RHU A;  1ZX6 A;  4XTU A;  1VQ4 A;  4A4K A;  4WF2 A;  1MMN A;  1TOV A;  3CME Q;  4JUV A;  3RMQ A;  3CCJ A;  3A5Z B;  3FDR A;  4B9W A;  1WIE A;  3ASK A;  1UJY A;  1K9M C;  1OZ2 A;  5LJ3 j;  2NWM A;  2KK4 A;  2PQW A;  4L59 A;  4NOY A;  4PJO E;  4EMK A;  5D6W A;  4LNP A;  1N9S A;  3EGX B;  1YCY A;  4QQG A;  3BE3 A;  2HSE B;  4LUE A;  1S72 Q;  4L5G A;  3WVE B;  4WCI A;  4PJO C;  2CZ7 B;  1ABO A;  2FPE A;  1KQ1 A;  1D09 B;  3OB9 A;  3T9N A;  1K1Z A;  2DNU A;  1O75 A;  3MCA B;  3CCL T;  4JRP A;  4LE9 A;  1TU0 B;  3CD6 T;  1YIJ T;  2PUK B;  1VQM Q;  3LH0 A;  2DRM A;  4N0A C;  7AT1 B;  2HMA A;  4KGZ B;  1YJW A;  1GRI A;  1YCS B;  4KRT A;  4AG1 C;  2JT4 A;  2RK1 A;  4MZT A;  1AT1 B;  1JO8 A;  4B9X A;  3VUB A;  5CVI A;  3CME T;  2D0N A;  5FRM A;  2CZ0 B;  1BCM A;  1C1A A;  2Y4X A;  3OYN A;  2OX7 A;  1X2Q A;  2ZPB B;  2E4H A;  5GAO p;  2XDP A;  4R55 A;  3M4G A;  4PKC C;  1D0Z A;  1UEC A;  1ZSG A;  4M7D C;  1MMG A;  4DQ2 A;  3G71 A;  1RAC B;  3C95 A;  1S72 T;  4M7D F;  2KR3 A;  4QW2 A;  1YJ9 A;  1MND A;  3MEA A;  3CCU A;  3JAM E;  1X69 A;  1EIF A;  1WLP B;  5GAN 5;  2AKK A;  3U23 A;  5I11 A;  4D8K A;  3OA6 A;  1VQ7 A;  3JSC A;  4JJC A;  4J83 A;  3FIF A;  3LYI A;  2CH4 A;  1VQM T;  2SEM A;  3GNG A;  1KK7 A;  2L5Q A;  2OAW A;  5GMK i;  1LNX A;  4EMK B;  1RAE B;  2HAX A;  4MDX A;  5GMK h;  2FZG B;  2D1X A;  1K73 U;  1IGQ A;  3JCM P;  4BE1 A;  2JM9 A;  1ACM B;  3JRZ A;  4M7D G;  2DL7 A;  3OYY A;  2VVK A;  1RI9 A;  2CP7 A;  3QYH B;  2RHI A;  1NLO C;  4Z02 A;  2GQV A;  2DD4 A;  1P92 A;  5GMK l;  3QSU A;  3MP8 A;  2DZC A;  1X75 C;  4P5N A;  1KQ2 A;  1SRL A;  2MWP A;  3EFS A;  5CIU A;  1K73 C;  2EBP A;  3NPF A;  4MDW A;  2XDD A;  4QT7 A;  1UGQ B;  2GFU A;  3VS5 A;  4B6M A;  4J9F A;  5I22 A;  5CQY A;  2RO0 A;  4PJM A;  4PJL A;  1VQ6 Q;  5GAN 3;  3VS1 A;  4KBM B;  2DA9 A;  4JRQ A;  2ESW A;  1JXO A;  3TSW A;  1VQ8 Q;  2KXC A;  2DYI A;  3OYJ A;  4WTO B;  1WJS A;  3I35 A;  3O5Z A;  4HKE A;  2ZCF B;  2DTI A;  1K4U S;  4IUP A;  2EYW A;  4AFQ C;  5A2Q E;  2KGT A;  5IAY A;  2BKD N;  1QLY A;  5L23 A;  4MMK A;  2HKQ B;  3M59 A;  1PG5 B;  3JB9 J;  1GFC A;  2R58 A;  2KDS A;  2NUT A;  4FM4 B;  2RHZ A;  3CC7 Q;  1Z9Q A;  2B86 A;  4AMC A;  4ORZ A;  4HT8 A;  4IIO A;  2K9G A;  4PLI A;  4PFO A;  1M3A A;  2RHY A;  1W2B P;  2A28 A;  1WHK A;  1VQ6 T;  4NL3 A;  4F7U F;  2RJC A;  2VV5 A;  2XD0 A;  1TSF A;  4X9D A;  3QO3 A;  1VQ8 T;  1ZA2 B;  3I56 A;  1YBY A;  4ATO A;  1KQS S;  2O9S A;  3M0P A;  4XTZ A;  2QAS A;  2YUN A;  1JXM A;  3QDF A;  2VB6 A;  5CO7 A;  1PWT A;  1J3T A;  4GLK A;  5J39 A;  4BY6 C;  1OPK A;  3M0T A;  5GAN f;  4IUU A;  1TXQ A;  4TVR A;  1X27 A;  2CP3 A;  4PJO A;  4BUG A;  4FCY A;  4EDU A;  4F7U G;  3CC7 T;  4DBQ A;  3V8J A;  1T0J A;  3X25 B;  1Y57 A;  2FZK B;  1WHM A;  3CCS A;  2W10 A;  3RKY A;  3JCM g;  1OU8 A;  1B34 A;  4E7Z A;  2OTL Q;  1X6G A;  1QVG P;  2X4Y A;  4MML A;  2QDY B;  1GBQ A;  1KHI A;  1LOJ A;  4C8Q B;  4DOV A;  1LVK A;  5CR2 A;  1HYO A;  2K4Y A;  3FB9 A;  2DKG A;  4RTU A;  2CS7 A;  4A63 B;  3DLL A;  3HPW A;  3PVL A;  1YFN A;  4JLI A;  5GAM g;  2NUT B;  1N9R A;  1JRI A;  1T3S A;  2CSI A;  2JZ2 A;  4OP0 A;  3L1A A;  2E41 A;  5GAO r;  3HRS A;  1LJO A;  4C5I A;  2QGG A;  4A54 A;  3J7A F;  1YHQ Q;  1UG1 A;  2RJE A;  2DJZ A;  1TUG B;  1M8V A;  3CC2 A;  3JCM V;  3QJY A;  4M7A D;  1W2B S;  1K9A A;  2E6Z A;  3VJP A;  2DM1 A;  3FJP A;  3CC4 Q;  1R0B G;  1AVZ C;  3X28 B;  2JOY A;  2NUZ A;  1RUW A;  1VQP A;  3G4S A;  2OTL T;  3V8K A;  2V8K A;  2L2P A;  1WNL A;  1N8R U;  2ZZD A;  1UFF A;  4C8Q D;  1D0Y A;  4XTV A;  1HXD A;  3JB9 D;  4DEX A;  3G6E A;  3MJX A;  4PJN A;  2FL7 A;  1M30 A;  2AT1 B;  1NG2 A;  4NL2 A;  4PJO B;  2L8D A;  2ENM A;  2YLC A;  3X26 B;  3PNW C;  1PRM C;  2WAC A;  1OEB A;  1I4K 1;  4AFS C;  2LZ6 B;  1OZ3 A;  2LC4 A;  1YHQ T;  1HK9 A;  3A8M B;  4QQD A;  4KUI A;  1KJW A;  3JCM J;  2LCS A;  4CI0 C;  5I2S A;  5AT1 B;  2LP5 A;  1N8R C;  1RAH B;  4OGC A;  3EH2 A;  1QVG S;  2M02 A;  3CC4 T;  1VQN Q;  4XTW A;  4JDS A;  3V7R A;  1H8K A;  2E5Q A;  5AYF A;  3UA7 A;  4QKU A;  2G3R A;  3ZL7 C;  3JCM d;  4Z88 A;  2I2L A;  1D0X A;  4E7S A;  8ATC B;  1YIT Q;  3EH1 A;  4FSS A;  1WI7 A;  4M77 C;  1VIE A;  4AG2 C;  1U1T A;  4M77 F;  1XJW B;  3KXT A;  1QCO A;  1JEG A;  1NBE B;  3VS4 A;  1U06 A;  2DJQ A;  1NEG A;  2DTO A;  2J7I A;  2L89 A;  2YRD A;  5IHI A;  4JLG A;  5LJ3 f;  3EGD A;  2BTT A;  2LNH B;  4IIM A;  1ZSZ C;  2NUP A;  3CCE Q;  4M78 C;  3PGG A;  3CCL A;  1VQN T;  4CC7 A;  3CD6 A;  4M78 F;  1QCN A;  2EGE A;  2E5K A;  2X3X D;  3HSB A;  3ER0 A;  3JCM h;  4Y92 A;  4M77 G;  1RI0 A;  3CME A;  3VRY A;  3TRE A;  4C92 E;  3M0U A;  2HQE A;  5FLX E;  3H0H A;  4VUB A;  2BZ8 A;  1YIT T;  2K3B A;  1AEY A;  2HKN A;  2LT1 A;  3EG3 A;  3VS0 A;  2DL4 A;  2J05 A;  3S3M A;  3OYB A;  4HVU A;  3ME9 A;  1Z9Z A;  3HTR A;  3QG1 A;  2BUD A;  2K5I A;  3RR6 A;  2JN0 A;  1S72 A;  4M78 G;  5EC7 A;  2XG8 D;  1NLP C;  1M3C A;  3HRT A;  4JRK A;  2LCC A;  1VQK Q;  3REB B;  3MEW A;  3CCE T;  4XU3 A;  1UHF A;  2V26 A;  3HRU A;  1PSF A;  2EAY A;  1VQM A;  1VQL Q;  1Q82 R;  1LPL A;  2NYS A;  3MEU A;  1K0X A;  4V2S A;  2L3R A;  2OJ2 A;  2D0Q B;  2A0F B;  2DFU A;  2GCX A;  3EG1 A;  2D9T A;  4RG2 A;  3VRZ A;  4ME7 A;  4FSX A;  1WHG A;  3URG A;  2DXU A;  2MI6 A;  2A36 A;  4OB3 B;  4XAX B;  5IH2 A;  3M5A A;  3EGD B;  5CKB A;  5M9O A;  3EFO B;  4M75 C;  2ED0 A;  2YUQ A;  3OMC A;  5FU7 B;  1EZZ B;  4AT1 B;  3SWN B;  4M75 F;  2NUP B;  2E3I A;  4PNO A;  4M7A F;  1MMA A;  1ZUY A;  5CKE A;  2DZ9 A;  1SF9 A;  2QTX A;  1SKU B;  2A08 A;  1QVG A;  2W0Z A;  2YT6 A;  4XTY A;  1NM7 A;  3OBW A;  2PNI A;  4HCZ A;  1VQK T;  1MV0 B;  4C8Q F;  1N8R R;  3OYA A;  4MZM A;  4RCC A;  1RLP C;  3AT1 B;  2KVQ G;  4BDY A;  1VQL T;  1WHJ A;  5GJV B;  2PUO B;  1PSE A;  4FW1 A;  1Q95 G;  2K3X A;  2X35 A;  4J9G A;  2HQH A;  4M75 G;  2EQK A;  1FMV A;  4M7A G;  4OMM A;  1N6A A;  2EJF A;  1H64 1;  5HKC A;  4ZGJ B;  3UDC A;  4X1V A;  1ZUU A;  2EFI A;  2RQU A;  2K2V A;  3LX7 A;  3M55 A;  4GY5 A;  3JCM e;  1RAI B;  2J6K A;  5GAO m;  3LWH A;  4C8Q G;  4ZTJ A;  2HZY A;  2HL3 A;  1PC0 A;  2OTJ Q;  1VYU A;  1G3T A;  3UT1 A;  1DJ7 B;  2XU8 A;  1VYT A;  1AHJ B;  2CP0 A;  5GAN 8;  4BI8 B;  3QHS A;  1YWO A;  4J9E A;  3SHW A;  3QZ9 B;  3V8L A;  2KXD A;  1ZUK A;  5GAM e;  4ESR A;  1C6V X;  1Y07 A;  4FIB A;  3PTA A;  2EGA A;  2I0N A;  3OY9 A;  1X2K A;  1AWW A;  4OVA A;  2L3P A;  1WA7 A;  5GAM j;  1VQ6 A;  3AHU A;  4M7D E;  2V1Q A;  1VQ8 A;  2F1L A;  1ZA1 B;  2KRS A;  3ULR B;  5FU6 C;  4KGX B;  2F2V A;  3RBB B;  4JZ4 A;  1K76 A;  3C94 A;  4BE2 A;  3CPF A;  3CCQ Q;  1K0S A;  4OMQ A;  4E7J A;  2WSE E;  5KYY A;  3CPW P;  2LQK A;  3M0S A;  4FT4 A;  3FRN A;  1OOT A;  3S6W A;  1PNJ A;  1T3L A;  2OTJ T;  2MCN A;  4CRI A;  1PCX A;  2IIM A;  4JJD A;  2F2W A;  1I5L A;  2BZY A;  2FHD A;  3CC7 A;  4LDW A;  1S1N A;  1IZ6 A;  2WSF E;  3QBY A;  3REA B;  4EMG A;  4BD3 A;  1M4Z A;  4OMO A;  3EG9 A;  2J06 A;  1PM3 A;  3OYL A;  1X6O A;  3UA6 A;  3QZ5 B;  3M57 A;  4BI3 A;  4D6W A;  4J7F A;  3RMS A;  5IT9 E;  2RQW A;  3OQ5 A;  2CT4 A;  3G1J A;  4IUV A;  1MHN A;  1BYM A;  1OX8 A;  2OI3 A;  3A98 A;  2YUP A;  1TTH B;  3JB9 I;  1KQS P;  3CCQ T;  4J6W A;  3TEE A;  2EW3 A;  4IKF A;  3OYF A;  1MUZ A;  4II1 A;  4C92 A;  2HD0 A;  2MWO A;  2VGM A;  2MOX A;  2FVU A;  4ELZ C;  2JS2 A;  1TUD A;  3L2Z A;  3H9N A;  1E6G A;  2M0Y A;  2MAM A;  2ZPG B;  2EVR A;  2KYM A;  2VC8 A;  4E2F B;  2DL5 A;  3CBO A;  1UDL A;  4E7K A;  3LWI A;  1MV3 A;  4EMH A;  2MMP A;  1AWO A;  3RES A;  1UTI A;  4Y28 E;  1BKB A;  2PU9 B;  2OTL A;  2RI5 A;  5DM7 R;  5J26 A;  4QVD A;  5KYY B;  2O88 A;  3KFV A;  3RIR A;  1RAF B;  4X9C A;  4JS5 A;  1SEM A;  2XK0 A;  1SSF A;  2DET A;  2L3Q A;  3CPW S;  4RG8 A;  2QEX Q;  2HDA A;  2EPD A;  1AZE A;  1JJ2 P;  3CEY A;  2XID A;  2EYY A;  2DIG A;  3M58 A;  2E70 A;  1IRE B;  1VQ5 Q;  3GF5 A;  1BIA A;  5FWB A;  1YHQ A;  3DKM A;  1G5V A;  3EG9 B;  4ZNX A;  1K8A R;  2LJ1 A;  2DL8 A;  2E6N A;  1JQQ A;  1H3Z A;  3E19 A;  1VQO Q;  1V76 A;  2Y90 A;  2EQU A;  3CC4 A;  1UHC A;  1IRX A;  3SB2 A;  5GAN d;  4DBR A;  1M90 U;  1I1J A;  3NFC A;  1QW1 A;  2LQ8 A;  1LCK A;  1KC8 U;  2XI9 A;  3J81 E;  2K5F A;  3IQL A;  3N5B B;  4C92 B;  2NLU A;  2QQ9 A;  3M0R A;  2V8J A;  5LJ5 g;  5D7U A;  4F16 A;  5GMK e;  2QEX T;  3OS1 A;  3QWY A;  2CP2 A;  2DIQ A;  2EKH A;  5A0L A;  1IHV A;  4A53 A;  2QTV A;  2M9U A;  1E6H A;  1M3B A;  3NHN A;  5CKH A;  4M4Z A;  1VQ5 T;  5GMK j;  4L6V 5;  1M90 C;  1IHW A;  1KC8 C;  3NMZ C;  5FRO A;  3CBM A;  5KCO A;  5LJ3 g;  3CCR Q;  5GAO q;  1VQO T;  2A7Y A;  4KT0 E;  2QDL A;  1VQN A;  4BAC A;  4F14 A;  2RM4 A;  3QKJ A;  4N0A A;  2QQR A;  2JTM A;  5GAN h;  1B7T A;  5HK3 A;  3EG2 A;  2DL3 A;  4KH1 B;  5HCK A;  2F5T X;  3QPH A;  4XQ3 A;  1KSW A;  4C92 D;  1YI2 Q;  3VS3 A;  3LGF A;  1NE8 A;  1Q82 U;  1JJ2 S;  2YXY A;  2H3J A;  2HBP A;  1YIT A;  4OGE A;  1QMC A;  4E7L A;  1D1C A;  4FYY B;  3VS2 A;  1R77 A;  5FRN A;  2J6O A;  2DXB A;  2RF0 A;  4M7D A;  2KRO A;  1M27 C;  2RI2 A;  4F04 B;  1WFW A;  2HBW A;  3OSS C;  2JS0 A;  1WXB A;  2H8H A;  1N27 A;  1F1B B;  3CCR T;  3CCE A;  1Q82 C;  3I5R A;  4XU2 A;  4RTV A;  1KG1 A;  2WSC E;  1XOV A;  3JV3 A;  2KI7 A;  4JJB A;  5IXF A;  1BBZ A;  2COY A;  3VUZ A;  1CKA A;  3CPW A;  3ZFJ A;  3I5S A;  4OF1 A;  1HJD A;  1YI2 T;  1UGS B;  2VXF A;  2DIL A;  2C0O A;  2DMO A;  3L2V A;  2BE7 D;  5KE2 A;  2Y4Y A;  3SFM A;  1W4S A;  1BIB A;  1W70 A;  3JCM b;  5LJ5 d;  3H0I A;  3CCM Q;  2EIF A;  3FEO A;  4PFZ A;  1D1B A;  4EMK C;  2FO0 A;  1B34 B;  1B3Q A;  3LGL A;  2OAU A;  4OB0 B;  1Y0M A;  3UPU A;  5IHK A;  1QVF S;  4FYV B;  3L42 A;  4RTZ A;  3UWN A;  5HY6 A; 
#chains in the Genus database with same CATH homology
 2CH4 W;  2RMO A;  2A36 A;  5IH2 A;  2L3S A;  4OML A;  4D8K A;  5I11 A;  2ED0 A;  2YUQ A;  1QCF A;  4JJC A;  1AWJ A;  3EHR A;  2CH4 A;  3I9Q A;  2SEM A;  2CDT A;  1ZUY A;  2ECZ A;  4JZ3 A;  1GCQ C;  2OAW A;  3CQT A;  3GBQ A;  2A08 A;  2J6F A;  2W0Z A;  2YT6 A;  1AZG B;  2D1X A;  2D8J A;  3EHQ A;  4J9I A;  4D8D A;  1NM7 A;  2PNI A;  4GLM A;  2JM9 A;  4J9B A;  1MV0 B;  2DYB A;  2DL7 A;  2VVK A;  1RI9 A;  2JTE A;  1ARK A;  3TVT A;  1RLP C;  1NLO C;  1TG0 A;  4Z8A A;  1V1C A;  2PTK A;  1E7O A;  3H0F A;  2CRE A;  5GJV B;  2DVJ A;  2RNA A;  1SRL A;  4J9G A;  1SPK A;  2SRC A;  1FMK A;  4OMP A;  4OMM A;  5GJW B;  4J9C A;  1YP5 A;  2LJ3 A;  2O9V A;  3UAT A;  1YWP A;  4X1V A;  3EGU A;  4HVW A;  1ZUU A;  2RQU A;  2EBP A;  3NPF A;  1FYN A;  4QT7 A;  1TUC A;  3VS5 A;  2J6K A;  2AK5 A;  2CSQ A;  5I22 A;  4J9F A;  4RTY A;  4LN2 A;  1GCP A;  1HSQ A;  1A0N B;  5IHN A;  2JXB A;  2RPN A;  1VYU A;  3VS1 A;  4CC4 B;  2DA9 A;  2RQT A;  2ESW A;  1JXO A;  3R6N A;  3TSW A;  2GNC A;  2KXC A;  1VYT A;  2GQI A;  2KRM A;  2LJ0 A;  1U3O A;  1YWO A;  3I35 A;  3O5Z A;  3LH5 A;  4J9E A;  3SHW A;  2KXD A;  3UF4 A;  1ZUK A;  4CC2 A;  4ESR A;  2CUB A;  1K4U S;  2BZX A;  2EGA A;  1PKS A;  2EYW A;  1WDX A;  2I0N A;  1WXT A;  1X2K A;  4AFQ C;  1AWW A;  2KGT A;  1ZLM A;  2FRW A;  1QLY A;  2L3P A;  1X43 A;  5L23 A;  1WA7 A;  1H92 A;  3THK A;  2V1Q A;  2A37 A;  2AKL A;  1GFC A;  1H3H A;  1UE9 A;  2KRS A;  3ULR B;  4Z89 A;  2CUD A;  2F2V A;  3RBB B;  4JZ4 A;  1Z9Q A;  2B86 A;  1K76 A;  2VKN A;  4ORZ A;  1QKW A;  4OMN A;  1K0S A;  2L0A A;  4IIO A;  4OMQ A;  2K9G A;  4HXJ A;  2O2O A;  1M3A A;  1G83 A;  3M0S A;  1OOT A;  1CSK A;  1PNJ A;  2A28 A;  1T3L A;  1BK2 A;  2K79 A;  2K6D A;  2MIO A;  1WXU A;  2ROT A;  2KNB B;  1BB9 A;  2YSQ A;  1AWX A;  2MCN A;  2LX7 A;  2K7A A;  2FEI A;  2IIM A;  4JJD A;  3H41 A;  2KRN A;  5FWC A;  2ED1 A;  2F2W A;  2BZY A;  2O9S A;  1S1N A;  1AOJ A;  1W6X A;  3M0P A;  2YUN A;  3REA B;  1JXM A;  4DEY A;  2AZV A;  4OMO A;  2AZS A;  2J06 A;  1PWT A;  1J3T A;  1W1F A;  3UA6 A;  1OPK A;  4JPB W;  3QWX X;  1OPL A;  1GL5 A;  4GBQ A;  3M0T A;  2RQW A;  2CT4 A;  1YN8 A;  1X27 A;  2KT1 A;  2KBT A;  2XMF A;  1VYV A;  1T0J A;  1PHT A;  1UGV A;  1VA7 A;  2DBK A;  2OI3 A;  3A98 A;  1Y57 A;  2YUP A;  2C0I A;  2W10 A;  2KYB A;  4RUG A;  2RQV A;  2EW3 A;  1MUZ A;  3PE0 A;  1X6G A;  2MOX A;  2K2M A;  2GBQ A;  3TSZ A;  1GBQ A;  2JS2 A;  1TUD A;  1E6G A;  2M0Y A;  4J9D A;  2EVR A;  4LUD A;  2KYM A;  2DL5 A;  2LQW A;  2DF6 A;  4RTW A;  1UDL A;  2PZ1 A;  1QWF A;  4RTU A;  4A63 B;  1MV3 A;  3PVL A;  1SRM A;  1OV3 A;  2YDL A;  1QWE A;  1AWO A;  3VS7 A;  2X3W D;  1T3S A;  1UTI A;  2CSI A;  1JU5 C;  2VWF A;  2JMC A;  2EQI A;  4HVV A;  5IXB A;  1UG1 A;  2O88 A;  2EYZ A;  3KFV A;  1KFZ A;  4RTT A;  5FW9 A;  1SEM A;  3C0C A;  2L3Q A;  1I0C A;  1B07 A;  1SHF A;  2HDA A;  1K9A A;  1SHG A;  2EPD A;  2DM1 A;  2LQN A;  2HSP A;  1AZE A;  4EIK A;  1AVZ C;  2EYY A;  1NEB A;  2NUZ A;  1RUW A;  3FJ5 A;  2LMJ A;  1PRL C;  1KIK A;  1HD3 A;  3VS6 A;  5FWB A;  1PKT A;  2L2P A;  1GCQ A;  2O31 A;  2RQR A;  4ZNX A;  1UFF A;  2LJ1 A;  3EG0 A;  4DEX A;  1WYX A;  2DL8 A;  2EGC A;  1JQQ A;  3M0Q A;  1M30 A;  1NG2 A;  4RTX A;  4K11 A;  1UHC A;  1CKB A;  2ENM A;  1UUE A;  2RN8 A;  1PRM C;  2FRY A;  2GGR A;  1I1J A;  1OEB A;  4AFS C;  1LCK A;  2LZ6 B;  2FPD A;  2M51 A;  4J9H A;  1WX6 A;  5ECA A;  3IQL A;  2DBM A;  3NGP A;  3M0R A;  1KJW A;  2LCS A;  1ABQ A;  4F17 A;  1AD5 A;  2DLP A;  2LP5 A;  3U23 A;  4F16 A;  3QWY A;  1G2B A;  1BU1 A;  2EKH A;  1H8K A;  3UA7 A;  2ROL A;  3ZL7 C;  1E6H A;  1M3B A;  3NHN A;  3SEM A;  2DX1 A;  4M4Z A;  4E6R A;  1QKX A;  4Z88 A;  4CC3 A;  2C0T A;  4HCK A;  3NMZ C;  1EFN A;  1UJ0 A;  1T0H A;  4FSS A;  1WI7 A;  2GTJ A;  1ZBJ A;  4AG2 C;  2QDL A;  3RNJ A;  1GFD A;  4F14 A;  1IO6 A;  4AFZ C;  2P4R A;  1JEG A;  3VS4 A;  4R0K A;  1NYG A;  1U06 A;  1ZX6 A;  3EG2 A;  2DJQ A;  1NEG A;  2DL3 A;  5HCK A;  2J7I A;  5IHI A;  1KSW A;  3VS3 A;  2BTT A;  2LNH B;  4IIM A;  1WIE A;  2KE9 A;  2KT8 A;  1UJY A;  2FPF A;  2KEA A;  3VS2 A;  2NWM A;  4CC7 A;  2CT3 A;  2G6F X;  2F2X A;  4LNP A;  1RLQ C;  2EGE A;  2E5K A;  2J6O A;  2RF0 A;  2X3X D;  2KRO A;  4LUE A;  1M27 C;  2JW4 A;  4Y92 A;  1WFW A;  2HBW A;  4WCI A;  2JS0 A;  1GBR A;  3VRY A;  1ABO A;  1WXB A;  3M0U A;  2FPE A;  2H8H A;  3H0H A;  1K1Z A;  2BZ8 A;  1M8M A;  1NYF A;  2DNU A;  2K3B A;  1AEY A;  2HCK A;  3I5R A;  4RTV A;  3EG3 A;  2DE0 X;  4LE9 A;  1XOV A;  3JV3 A;  3VS0 A;  2DL4 A;  2J05 A;  4JJB A;  4HVU A;  1Z9Z A;  2DRM A;  2GTO A;  1BBZ A;  5IXF A;  2DRK A;  2D8H A;  1GRI A;  1YCS B;  1CKA A;  4KRT A;  4AG1 C;  1SSH A;  1I07 A;  2JT4 A;  1WLP B;  3I5S A;  1JO8 A;  5EC7 A;  2YUO A;  1NLP C;  2D0N A;  1HJD A;  2DIL A;  2C0O A;  1M3C A;  1X6B A;  2DMO A;  1X2Q A;  3REB B;  2EYX A;  1W70 A;  1UHF A;  2HEQ A;  1U5S A;  3H0I A;  2ABL A;  2FG0 A;  1UEC A;  2JM8 A;  2FO0 A;  1K0X A;  1B3Q A;  1ZSG A;  2JMA A;  1Y0M A;  2OJ2 A;  2V1R A;  2KR3 A;  3PVQ A;  4AFU C;  5IHK A;  4RTZ A;  3EG1 A;  1X69 A;  1N5Z A;  3VRZ A;  1YNZ A;  2AKK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...