2W11A

Structure of the l-2-haloacid dehalogenase from sulfolobus tokodaii
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
206
structure length
206
Chain Sequence
PRGSHMIILAFDIFGTVLDTSTVIQEFRNKQLEYTWLLTIMGKYVEFEEITKITLRYILKVRGEESKFDEELNKWKNLKAYEDTKYLKEISEIAEVYALSNGSINEVKQHLERNGLLRYFKGIFSAESVKEYKPSPKVYKYFLDSIGAKEAFLVSSNAFDVIGAKNAGMRSIFVNRKNTIVDPIGGKPDVIVNDFKELYEWILRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-HALOALKANOIC ACID DEHALOGENASE
publication title Biochemical and Structural Studies of a L-Haloacid Dehalogenase from the Thermophilic Archaeon Sulfolobus Tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 87
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2w11A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2w11A01
1VJRA 3L8GA 3BWVA 3NIWA 2HF2A 5AW0A 5AI0A 2ODAA 5ALOA 3ZVLA 1FEZA 2WF5A 4Y2QA 1U2TA 3W5CA 2HCFA 2G1AA 2AH5A 2Q4TA 2FI1A 1RDFA 2IOFA 3QUBA 4F71A 4CF4A 3QGMA 3CNHA 2I55A 2PR7A 1RMQA 3QNMA 3ZTWA 2ZBGA 3U7FB 5AKJA 2RAVA 2I33A 1RQNA 5AKGA 3EF1A 3AR9A 2HO4A 3L1VA 1L8OA 4QJBA 2WF6A 1T5SA 4FE3A 2B30A 2YMMA 2HHLA 4DFDA 3KBBA 1ZOLA 5ALHA 4CNQA 4YIKA 3KOOA 3FPSA 4GIBA 3M9LA 2GMWA 2OM6A 4YGYA 5ALDA 5ALLA 1QQ5A 4HGOA 1O03A 3WK4A 3OCUA 4B6JA 2AGVA 1TE2A 5ALSA 2W11A 3U7HB 3NRJA 1TJ5A 4L6AA 1S8OA 1WVIA 5AK4A 4HGNA 2R8YA 4UM7A 4XPZA 5AW9A 2CFRA 4FYPA 5IS2A 4J2TA 5AW6A 5AW2A 4BYGA 3A1CA 2IOHA 3EF0A 3QU4A 4L6CA 2YFYA 3U13A 3J7TA 4KN8A 3E58A 5FP0A 4RETA 5ALWA 2B1QA 2WFAA 4UU0A 2B8JA 1L8LA 5A3RA 4Y2XA 5ALYA 3P96A 4C4RA 5AW1A 5ALJA 4NWIA 2OA0A 2C9MA 1YV9A 2JARA 3ONNA 4Y2YA 4BBJA 1RPZA 2C4NA 5AW7A 1EK1A 1Z4LA 5AW3A 3SLRA 1SU4A 2PKEA 4UMVA 3OCWA 1TA0A 3W5BA 3OCYA 2B8EA 3E81A 4C4TA 1Z4JA 4YCMA 1YMQA 2BY4A 1CQZA 1Q91A 2NO5A 5IT4A 2RBKA 3QU5A 4HGRA 4HGPA 3NAMA 3QU7A 1J8DA 1ZD5A 3MMZA 2HOQA 1L6RA 1XPJA 3L8HA 3ED5A 5AW5A 2BDUA 3L8EA 3PGVA 3ZW7A 4NFLA 5A3QA 1RMTA 3U19A 2FUEA 1NRWA 3AR4A 3SKXA 1NNLA 4UU1A 1F5SA 3A1EA 5AVVA 2QLTA 3ZVNA 4CF5A 3PCTA 3SHQA 3OCXA 3OTQA 1EK2A 5AIBA 2HDOA 4UW9A 3WKDA 2I7DA 3NANA 2FEAA 1ZD3A 3R09A 3ZX4A 2HX1A 4XE5A 2YY6A 4EX7A 2P9JA 4XOUA 1L7PA 2JGAA 5ALQA 2VKQA 1U7PA 1KYTA 4YCNA 4Y3UA 3MN1A 5ALNA 4E88A 2YMQA 1ZRNA 3WK6A 4BEWA 2B1RA 4UATA 3KC2A 4NAVA 3QXGA 2HSZA 3E8MA 2HEGA 2ZBDA 1RC8A 2FPXA 2NO4A 3UMBA 5ALRA 4AS2A 3QU9A 4UASA 1U7OA 5ALFA 3N28A 3RFUA 3HLTA 1ZRMA 2IA5A 5A3SA 2FPSA 3E84A 4MUMA 2G80A 4OCZA 3WGUA 2P69A 4UMFA 2RARA 2MSNA 1RQLA 5ALTA 2NYVA 5AM0A 2HF7A 2Q5EA 2GFHA 3IJ5A 4YH1A 4CE6A 3DV9A 1QH9A 3I76A 3ZI4A 1RKQA 2YJ5A 3KDPA 3L8FA 4BNDB 1WZCA 3U26A 3WK5A 1RKUA 1Z4IA 5AKYA 5ALXA 5AI4A 2P11A 2JAUA 3GYGA 3MPOA 2DQSA 3R4CA 3ESQA 4AP9A 2GO7A 1VFPA 2OBBA 3OCZA 2BDEA 5JJBA 3TLMA 1ZD2P 3AR8A 3ESRA 4EEKA 3I28A 4EELA 1K1EA 4KX3A 2HI0A 5ALVA 5AVTA 2I54A 4KYTA 3R9KA 3VAYA 3L5KA 4FFDA 4UARA 3WKBA 3UMCA 2AMYA 4HAIA 3PDWA 2FPWA 5AVSA 4BNDA 2EATA 4UMDA 2JAWA 3I6BA 1X42A 3DDHA 3L1UA 2D2VA 5AI6A 4OFZA 1XVIA 4JDPA 2I34A 4IG4A 2MU1A 1QQ7A 4GXTA 3FPBA 3EWIA 5ALEA 4Y2VA 4DCCA 1Z4QA 4L57A 5T41A 4BX3A 5AKKA 2YBDA 3ET5A 3UM9A 3QYPA 3FZQA 2PQ0A 1T9ZA 2MU2A 3OPXA 1L7NA 5AVZA 2EAUA 2CFSA 3DNPA 4ZEXA 3QLEA 3F9RA 4G63A 5ALZA 4YCLA 5AVQA 3QX7A 1N9KA 5AKLA 4AS3A 2G0AA 4OHFA 1Q92A 5IT0A 3ZWKA 4F72A 5AHXA 1ZJJA 3L0YA 3U7GA 2FDRA 4ZEWA 2QYHA 4I9GA 3WK8A 3IRUA 5AM3A 5AESA 3OCVA 4HGQA 2R8ZA 1T5TA 2AUTA 2WM8A 2GHQA 1YS9A 2YMLA 1WPGA 4CF3A 4Y2RA 4QQFA 2YMPA 3B8EA 1ZS9A 3WGVA 5AKXA 1SWVA 5AW4A 2G08A 3A3YA 2B82A 3BA6A 3K1ZA 3WK9A 2YJ4A 2ZXEA 2G07A 4I9FA 4Y2PA 3B9BA 3RF6A 2O2XA 5ALPA 2ZG6A 4Y2UA 5AM5A 4BEVA 4HYTA 2ZBEA 3IB6A 3AR3A 1RRCA 1XP5A 1YJ5A 3A1DA 1LTQA 5AVUA 5AM1A 1L7OA 4YIHA 3SMVA 1O08A 5AKZA 1QQ6A 2EARA 3QUTA 2YJ3A 3ZUPA 2WF7A 4IFTA 5AI5A 1Z5GA 4O8CA 5AK5A 3W5DA 3U7EB 1JUDA 3NALA 3SF0A 1N8NA 1Z88A 4EZEA 4EX6A 2W4MA 2O9JA 3MC1A 1Z4KA 2G09A 3AR7A 4BKMA 4BX2A 3W5AA 2WF9A 5AKIA 4DWOA 5AK6A 3N5KA 4J03A 4NABA 4DW8A 1IWOA 1RMYA 5AVRA 3KZXA 2C88A 5AW8A 5AI8A 1NF2A 1Y8AA 5ALUA 3FGOA 1TJ4A 3L0BA 4JB3A 4UAUA 1RLOA 2C8KA 2RB5A 3QU2A 4PNHA 3WK7A 2R8XA 3KD3A 1AQ6A 5AICA 2P27A 5AM2A 3WKEA 3HYCA 3ET4A 4NV0A 1PW5A 2X4DA 2OYCA 3AR6A 3NASA 2CN1A 5ALGA 1Z4PX 1LVHA 2YJ6A 4Y2SA 2FPUA 1Z4MA 4UAVA 4RESA 1MH9A 4KNWA 5ALMA 5AM4A 5AIAA 4ZEVA 3N1UA 1TJ3A 3FM9A 2CFTA 2WHEA 1Z5UA 3SD7A 1J97A 2R8EA 3SKYA 4UMEA 2WF8A 1L7MA 2Q4RA 4BX0A 3M1YA 3NUQA 4Y2TA 3D6JA 1WR8A 5AKHA 3AR2A 1RLTA 3QUQA 5E0OA 1S2OA 3ZWDA 3PGLA 5ALKA 3WKAA 2C8LA 4EENA 4Y2JA 2ZOSA 3I1YA 4XQ0A 4OD0A 4C4SA 3ZVMA 4KNVA 3N8GA 2B0CA 3QUCA 2FPRA 2IYEA 2W43A 1SWWA 1Z4OA 5AKEA 3CZ4A 2IOFK 4G9BA 3AR5A 1VJ5A 4UM5A 1RLMA 3L0CA 3S6JA 2ZBFA 3DAOA 2I6XA 2YN4A 1QYIA 2G06A 2JAOA 1YDFA 3FVVA 5AVXA 4H1WA 1U02A 3N07A 5AVYA 3ZX5A 2FUCA 5AVWA 1Z4NA 3B9RA 2GHTA 3EPRA 3L7YA 4MWOA 1RKVA 3ZU6A 5ALIA 3ZTYA 1U2SA 3WKCA 1YNSA 5AI9A 1ZD4A 1CR6A 5AK3A 3UMGA 4KX5A
chains in the Genus database with same CATH superfamily
3OE7A 4R5HA 1V7ZA 2NO1A 3NKLA 2IXDA 1T4CA 3DE7X 1AM4D 5ER9A 4LX8A 5B4TA 2ZTEA 3BF7A 4F45A 4MA4A 1LDYA 3OOEA 4YFYA 1Y1QA 4PAWA 4UHBA 1BCSB 2CMFA 1NJGA 4RL6A 3B3FA 4DFDA 1OI4A 5IUNC 5GY7A 2NX2A 4FGUA 1VG0B 2J7PD 1RRPA 4BNFA 3FKQA 1ISMA 3NRJA 1CUSA 2HBYA 5CA1A 1QFYA 3HZOA 1ADGA 2YWDA 2PUCA 3TXYA 3A9WA 1Q0QA 2FMSA 1XEAA 3OTOB 5ALWA 4KDFA 3A27A 1RQ2A 3TLCA 3O5AA 2OMKA 4U6SA 4BO2A 4LJ5A 1KY4A 2ZWVA 3BHJA 1XC9A 2Q8QA 2VR1A 3IPAA 3CZ9A 3M9OB 1C9MA 4MVJD 3WJ1A 2B35A 1SB3C 2X7XA 1UBEA 1C7ZA 1ZH8A 4ND6A 1DJMA 4R54A 3NIFB 2V54A 4HMPA 1KQGA 2NSYA 2WPNA 2OWDA 1ZBDA 3BORA 1MIHA 3GV0A 1ZRNA 3KC2A 1RC8A 1S0NA 3PL1A 8ICBA 3H2GA 1WHTB 2PY6A 3H97A 4G2NA 2JFXA 1IDN1 4BP8A 2MYNA 4NZZA 3SJCA 1OH6A 4DSEA 1T4DA 1NXQA 4LZAA 3FJYA 1YI8A 2KE7A 2WUDA 1IBLB 4DN6A 2OMEA 3HB0A 4GP7A 4MUFA 1BCRA 2PX8A 1JEQB 1XPOA 3ZIDA 4DWWA 3DKPA 4OQEA 4RDXA 2JJYA 4L9AA 4N3BA 2C7OA 4E4RA 2P9TA 5H5JA 1JMVA 3PRKE 1BJKA 4LUCA 1P8JA 4F5OA 3AOGA 1WXWA 1XLWA 1L3UA 3A6LA 4EJFA 3DGEC 3DR5A 1X38A 3O82A 1U7TA 2C9ZA 3VAZA 2XMCA 1BNPA 4K9LA 2LWIA 5A4KA 1I80A 5LVAA 1HLDA 2ATXA 3S81A 3K6KA 5AJUA 1X7YB 2AOTA 2NUPB 3O3CA 1K7XB 4QPNA 1MNQA 4TYMA 4KSBA 5JOQA 3JQ7A 1C4OA 3Q7RA 2F1OA 4Z0TA 5EJ8A 4QZVA 5DB4A 3UW3A 4C0JA 1PJCA 1C1YA 2WZDA 1CJUC 4O4IF 1X0XA 4XJTA 2NSJA 4ZVTA 1DKLA 4D9NA 2P77A 4L5AA 2QB0A 1L3TA 3W5DA 4OH7A 1A04A 1ZK0A 1PVQA 5SY9A 2DFLA 1Z15A 4E5DA 3ED1A 4CCAA 4F4WA 3KJFA 4OMUA 2XBUA 3AKZA 1K5HA 5LSAA 3JCZA 1K3FA 4FWBA 3DOEA 3IR6A 1BS2A 2G70A 4BNIA 4K6MA 3IALA 2HHJA 3ZU3A 4JUZA 4QG7A 2PUGA 1R15A 2P5SA 1E1QA 1KMQA 1JS1X 2ZIVB 4JNCA 1FRNA 1XHEA 3JWEA 2KJ5A 4CUJA 2I6SA 2PS0A 3N0RA 3NWJA 4Q4AB 4F4FA 2O4UX 1SZDA 1P2SA 3SU8A 1XC7A 4ZCRA 1DADA 4X3PA 1O5OA 3N7SC 1GQFA 1U1EA 2LD4A 5C8YB 8ICGA 4R31A 4BPBA 2ZT6A 1VJ5A 4FDLA 2G9ZA 2Z6QA 2OHIA 1W93A 2VDRB 3ACBA 3PW4A 1AS2A 1QQTA 3MMSA 2CJXA 3TANA 4OI2A 2QZ4A 2PKYX 2PUFA 2X0EA 1E6WA 4ZV7A 1AGXA 1L9KA 4CIWA 3GJZA 3C2LA 1N56A 1U98A 1M1UA 1DTWB 4XM0A 1T0IA 4LOKA 2DQNB 5A9SA 3AWIA 1GIAA 1KZ4A 4ED7A 3W7VA 4HN9A 1H9AA 2CXUA 2OQIA 5KEIA 1D6NA 2XB9A 3LU1A 2JIMA 4G23A 5JBIA 1SUAA 4YJ2A 3VFDA 1OLXB 4IJKA 4JR0A 1WJGA 1TI7A 3I04A 4DNOA 4C89A 1AXGA 2E4AA 4A9AA 4RJKA 3KG2A 4HGNA 4O3FA 4D99A 2YHUA 4TXHA 1UBUS 4BTLA 2FOLA 3C8ZA 4I8DA 3AHIA 2OVBA 4HG2A 5EIHA 1YQEA 2G0NA 4UBCA 4BMOB 1LJ8A 4IHJA 1F2TA 4HUTA 2E8NA 3HRHA 1I5RA 3CKYA 1AZLA 1DWQA 1JI3A 1SCDA 2KIVA 5AW7A 1X7XB 2WU4A 1Z4LA 3N87A 1OXUA 3O9VA 1T0UA 2FYTA 2JH9A 5EEGA 3VRHA 3HY4A 1M7HA 2WJWA 1UXKA 4E30A 1HXHA 4BKOA 3JU3A 3ETCA 4GOXA 4D82A 1M1YE 9ICUA 3ICEA 2XVTA 4QHTA 3ZVNA 1VBFA 4YX9A 4OV6B 4CKEB 3IPCA 2VUSA 2JLUA 3MB8A 3DDNA 2CCKA 2Q5CA 3ZQJA 4OQFA 2XGQA 1KIMA 1R5OA 1JLRA 5JMWA 1A3CA 1LBHA 3EYAA 3CJQA 4MOWA 5JT1A 1BQ3A 1FUYB 2GN6A 3Q0EA 5CP2A 3W8RA 3IBFA 3GDOA 3I3OA 4K1XA 4YRMA 4EEYA 2NYVA 5KREA 5BXYA 2FMIA 3GFTA 4KWHA 5JPIA 1MZPA 4RQ0A 3E48A 2NV0A 1WXHA 3HRDD 3WLPA 3ESQA 4FJ0A 4GE0A 2GEDA 4U6NA 1W5BA 2Z8YM 1QBKC 2Y1EA 3VVMA 2ZPAA 3OPYI 4TVSA 3C3AA 4JZYA 1F14A 5KFMA 3UMCA 3UQZA 4PLVA 4JMLA 1G4AE 2WYIA 4AJKA 3NR2A 5ICCA 3DBRB 3RDPA 2OFWA 3B2EA 4OHWA 1DEOA 1Y82A 4BO0A 4F3RA 5CW2A 3HYNA 1REQB 4U7GA 4WUTA 2QXYA 2P41A 4DLYA 1PR9A 1U11A 1DT3A 4HQLA 4BYMA 2FDRA 2FG7C 2VATA 4I5GA 2YDYA 4BO7A 4NEQA 4HLUA 3RC2A 4DABA 3QPDA 3PU6A 5BPFA 2PSHA 2CV0A 2GD6A 3GA5A 4OGGA 7ICJA 1XZAA 4OU4A 4IC9A 3DDUA 1A98A 4MIKA 1IU9A 3SPXA 3FUUA 1YCHA 4UPDA 3OQOA 4PHCA 4IGKA 2EARA 2O2SA 3BE4A 2WF7A 5D3MA 1JDJA 1I51A 1R50A 2IQ5A 2X6QA 4GFJA 3ROEA 1X3SA 2XHEA 1RM3A 4FZ3A 2O0KA 1I5OA 1Y1LA 2ZCVA 4Y9RA 4F6LA 2H92A 3R0JA 5DHFA 2O8BA 4FONA 3W1EA 2GA9A 2E4XA 3CRMA 1X1AA 2VP2A 3BFPA 1SH7A 4FHEA 3PF8A 1G7TA 3UGJA 5BV7A 3KL4A 4BAZA 3HKEA 5AXDA 2Q28A 5FPKA 2JLRA 3JQGB 1RM4A 1L1FA 1EHIA 3L0DA 4BFZA 4B4UA 2CVFA 3BH7A 3CNEA 4F92B 2WJ6A 2DQKA 2CNNA 3DPUA 3RU7A 5CIYA 4BMXA 1BROA 3RBEA 2AC2A 5BSEA 5J3JA 2Z2YA 4NPHA 3S2ZA 1GL3A 3BIOA 3RJGA 4GXRA 3WL7A 1N1DA 3RABA 4HNVA 2M32A 4ZDIA 2V9PA 3JWHA 4D4HA 4QGHA 1Z7WA 3EPRA 3L79A 1WP9A 1QUFA 5ESDA 4AKTA 2VYFA 5JO9A 5JG7A 2OFXA 1JQLB 3A11A 1Z2PX 2VDPB 2VQEB 1A5ZA 4J9PA 2GEJA 1LUAA 4B44A 2JLZA 1BJRE 3HZZA 4IW3B 3MJEA 4AROA 3ZS8A 4NYJR 4FE3A 2OKGA 3IDWA 1CQJB 1ZOLA 3MWEB 5HZGA 4UBBA 1YQ9A 1QOPB 1ZK1A 3LI2A 1DBRA 3AEUB 4FR5A 3LO8A 1EFLA 1K88A 2B4AA 1R27A 2ZR8A 1N1MA 3UTDA 4MQ6A 2YXNA 5LBIA 1M6NA 1Z5ZA 4UEWA 3W7AA 1KI7A 3B12A 1J2NA 2IPOA 5CVJA 4GXNA 2VPPA 2HJHA 4H08A 5J4KA 3VOAA 2GLXA 3MIZA 2FRDA 3MXOA 2IPLA 1L8AA 5JEEA 4GI1A 1B2LA 7ICTA 2BDUA 2QJTA 3DZIA 2GN0A 4QO7A 1TVEA 3CUKA 1VSTA 1MVOA 1H65A 3UW1A 5K9ZA 2HHVA 5FJJA 1R4NB 3GEIA 2ASDA 1VJGA 5DMHA 4HH4A 3CRRA 2NO7A 3Q9LA 3E9QA 1ZN7A 2ONYA 4MUJA 3QXGA 1R64A 2ZSFA 2FPXA 3VQTA 2VSOA 3I5XA 2JLQA 2KW5A 3NHFA 2HU8A 2PGLA 2DECA 4YDSA 4QW8A 4NBKA 1TK5A 4AI6A 1MO3A 4DDHA 4DMCA 3RFTA 1NMYA 2ZSAA 3HABA 5A6VA 4CF6A 3LTEA 1M6HA 3FCOA 3L5KA 4H1UA 4Q9KA 4Z0HO 3SDBA 2ZYDA 4F5QA 1QPGA 2QLJA 1FLAA 1BMQA 3P27A 4N03A 3JR7A 3NV9A 5FIUA 5E9WA 5CLGA 1ZQMA 3EWIA 4A91A 2J5QA 1O2DA 1YC5A 2XOKD 3MRSA 1E2NA 1UAYA 3EGXB 4BCDA 3OTHA 3SXJA 4DREA 1OXJA 4O4JA 5EIEA 1K1QA 5GONA 5JH7B 3PJRA 1WW8A 4UAJA 2IBTA 4NSNA 4P6VF 3TEFA 5J40A 1KK0A 4YB8A 1VLZA 3X1KA 1EM6A 1Q0RA 3RROA 1Y9JA 5KOJA 4P54A 5JLJA 4YEDA 1RW4A 4ITRC 2IDJA 2PEYA 5GVSA 1LK5A 2XD9A 2BFCA 1JFSA 3MOSA 4QUIA 3O4JA 2HLDA 2DLNA 4DQXA 3ZV3A 2D1SA 1LDBA 2FPGB 5JADA 2C3PA 3VMMA 5IMSA 2IL1A 1ZI9A 1XO0A 1ARZA 2VI5A 5ECDA 3LYHA 1LPBB 2JFGA 2C7PA 3KCQA 3V6JA 2W9CA 1WETA 5EIWA 1WXFA 3LUDA 4B9NA 3WSWA 4KYVA 2Z04A 1A71A 2DP4E 3DOCA 4EF5A 4QYWA 3NBQA 1FFWA 4XDHA 4DA7A 3WKEA 2ZTVA 4ZIRB 4ITVA 1PUZA 3EPLA 1HI9A 4ER6A 3TXXA 2CXPA 2TSYB 1Y89A 2YWEA 4QHSA 9ICWA 4A8JA 1WR8A 3Q8XB 3B9PA 5IYZB 1Z2EA 4DJJA 3WKAA 4IQ8A 2JJMA 2HMTA 4DJFC 3K0AB 1FVXA 4PPFA 4AJ2A 4EKIA 3CF0A 3ZD9A 4B9SA 1Z6PA 5A1JA 3ROQA 3WXBA 3I2KA 2PANA 2ZBFA 3DHNA 3HNRA 1KAOA 1SKYB 4GKBA 3AGQA 3B9RA 5CLFA 3LKZA 1W0KA 1U2SA 5J63A 2CVZA 3S5JA 3OQMA 2BCGY 1H9CA 4RDHA 1P8AA 4G8JA 2XGJA 2DHEA 4CKCA 5IKXA 3IVRA 2XE4A 3II6X 4B81A 5IXYA 2JS7A 4ER3A 1UMCA 4DLXA 4M7OA 4C6HA 3PXCX 2IYLD 2PTGA 5AKGA 5JYDA 2YV2A 1IQUA 5A5FA 5J5VA 9ICPA 1RAAA 4CNQA 4Q1AA 5F5LA 1ISPA 4ENQA 4ZCPA 2CNBA 2Z2IA 1FP2A 1QS0A 3HDTA 5F1KA 4C0LA 2Q6OA 2QARA 2C2DA 3C3WA 1DIOB 1RRVA 2RI6A 2KM1A 3TLXA 3GJ3A 4JQYA 5KG6A 2HMSA 4G26A 4OJPA 1EH5A 2Z3ZA 5CNJA 5BPCA 3B78A 5A7HA 3SQOA 2QSYA 4XASA 4C6TB 3I9LA 1NKSA 4KAJA 2EERA 5CB0A 1F6WA 1EUYA 4BGIA 1YK1A 5M7EA 1YGPA 3EE6A 2R60A 3SJUA 2JK0A 1HORA 3FLEA 1J8DA 5CB1A 4EW1A 3NVYA 2QRVB 4JSTA 4WK2B 1ZICA 4EVSA 3Q5DA 2PBRA 3NHUA 5D01A 4MKZA 3FOBA 1UZMA 4PGXA 3ND9A 1VOTA 3EYZA 4Q02A 4URXR 3EEIA 1TVAA 4I9NA 3ZDBA 4KDEA 1QIDA 4RUKA 3OPQA 5IKPA 1U2QA 1DQSA 5KFXA 5MGNA 1EWQA 3FZGA 4DMFA 1GPYA 1IM4A 3KUCA 3LCUA 4N82A 4IXNA 5JATA 1M5TA 3AP3A 5JU6A 1IOWA 2NRWA 3RC1A 4UHDA 2ZGVA 5IT9A 1YRLA 3U0VA 5JJLA 2HTEA 1I0ZA 1KJNA 1LPAB 3O4RA 4GP6A 5L3QA 3O7WA 1OC4A 3PGXA 3DT9A 3ICOA 1GAWA 1P2BA 1Y3AA 2ZYWX 4NBNA 4CW7A 1CR4A 1JHXA 5I7UA 3EXEB 3DKVA 1RPLA 4QUJA 5HRUA 2QTFA 4BGUA 5J2HA 1W48A 3NX4A 1GZUA 4QOIA 2VT7A 1BO6A 3IVGA 2NACA 4IXDA 2EYQA 4M9CA 4Q4HA 4ZI5A 3BL8A 4V3BA 3GAMA 4IS7A 2ZUUA 2HXGA 4HZUB 5KFIA 4DR7B 1H2HA 3PQ3A 1NVBA 2NPFA 4B34A 4N3CA 3LAWA 4OJLA 4UOZA 3EFOB 1ZQZA 3D2AA 3R20A 5FTMA 3RBXA 4X1YB 5HGXA 2PH1A 4IWXA 4LJRA 2VZ9A 3MINB 2QD5A 5JDIC 1IUOA 1GNPA 2ZRHA 3IVCA 5C4MA 2IVFA 2WIJA 1E5TA 4U9IS 2X1VA 5EWMA 2I6TA 3KBOA 2JGEA 4DWIA 3QUSA 3AH8A 4GLFA 1CUAA 2VVTA 4AF8A 3P0JA 3NHWA 1AKQA 3TSWA 4OIFA 3L4EA 3LXUX 3LRPA 1ZCZA 1E9AA 4WFQA 2EU8A 3STWA 5H4GA 1O6GA 3ZDRA 3BJIC 4UMEA 4PLWA 4AWXA 5TISU 4EGCB 4TYNA 2GPYA 3KYIB 2FSHA 3TAUA 4HWSA 5JV5A 1GADO 1II8A 1W4CA 1ML4A 1Q1GA 4KTTE 3AR5A 4AKIA 5JXWA 1HWYA 3PFHA 2PD4A 2RGDA 4QVIA 4YTEA 4BWMA 3WIOA 1RWXA 3F3MA 4KWTA 5E95A 3CLSD 1Z4NA 5H82A 4GVXA 1Q8KA 5FUVA 4RVFA 4PZPA 5T6MA 3PDJA 3O2NA 3WWEA 3L7KA 3MEQA 2YXPX 3UJ9A 4S2UA 3FDXA 2C84A 5KFWA 1T2VA 4IUDS 5A4DA 4YN3A 3EZ9A 2H3HA 3OQ6A 3MGCA 2YB4A 4BGEA 1KR5A 4W1QA 3K35A 3OTGA 3E70C 5CA1F 3LP8A 3I62A 2PYDA 1OJ7A 2RGBA 3HFJA 3V1KA 5F77A 2ZJYA 4TV9F 4YNBA 3UWDA 2XE8A 5CFLA 1KK2A 1KVSA 5T64A 3ACCA 1DJLA 2AC7A 5EERA 2VNAA 3SFTA 1A8QA 1ZAKA 1IJKA 3HH8A 3LUBA 2IYTA 4EBBA 5AW2A 4ITUA 1AHHA 1FNBA 3PX7A 2AUNA 2ZWPA 3E58A 1ZK4A 3D6HA 1GPH1 3UJCA 3LK6A 3KR0A 5BW5A 3BQ2A 8OHMA 3THWB 3O3MB 1C3XA 1JLKA 3C1TA 2N75A 2YZNA 2PTHA 4OSPA 2ZZNA 2Q3MA 4M46A 2K4MA 1NYLA 1Y7TA 3BGVA 1JDSA 2JV3A 1LB1B 5DW0A 5DX8A 1D4AA 7MHTA 1XPJA 2BEUB 5IRCD 5I3ZA 4RA6A 2F00A 3DMTC 4DLKA 4Z49A 4XOUA 2D3TA 1Y5NA 4B7UA 3GFFA 3EXFB 2PZFA 3C7AA 2Y93A 3AIMA 4PFJA 5ERXA 1VJDA 4ZO6A 1KEJA 3T7KA 3ESZA 1G4UR 2WTBA 3QVKA 3QVVA 2BBWA 5G4LA 3RSFA 4DRYA 2HMAA 1XSNA 3JV7A 2UYOA 1UPUA 4O4LB 4EBFA 1L5QA 1RKQA 3ADOA 2B25A 5EJ9A 2G8NA 2HBLA 3PIIA 2G5PA 4BNYA 1ZHHA 3BTSA 4QM7A 1K4KA 5EVCA 1HLFA 3TVTA 4F60A 3A10A 8ICKA 1QCCA 2XGOA 4B6FA 1PVOA 1JEEA 3A0HU 3IIIA 3D4PA 5ABPA 4H0CA 5E4TA 1OILA 5F98A 3GLGA 3IR5A 1NRXA 5J1TB 2ISSD 5T41A 5J0RA 4IZOA 3D2QA 2G9RA 2OFPA 3KSZO 2H1IA 3FNBA 3DNPA 2X42A 3V8VA 1VCNA 4ISBA 2J08A 5LQKA 1MJGA 4MRRA 5EZ5A 3ND8A 2HU5A 1HTWA 1YA8A 2O0MA 2WQ7A 1VZ3A 3K9FC 2CK3D 1IXZA 3CNNA 5GIPE 1IJBA 2UZIR 4OQPA 4KSYA 3K9CA 4IO1A 3PXGA 4RVDA 3OQPA 1LTHR 2V6FA 1N9GB 1LRJA 3GRPA 3VJMA 4LY6A 3RE1A 1C1DA 3D5QA 4ZVRA 2B7LA 3ZV4A 5GGYA 4BKRA 2DOKA 3CMMA 3VC1A 1QFXA 3S28A 4B73A 9ICGA 1ZRHA 1MEEA 3WL3A 2C99A 2WJZB 2XDYA 5IANA 5AK5A 3BFVA 3L4BA 5FO0A 4TKZA 4F2GA 5CMLA 4BAUA 1TTHA 2UVPA 2ZUEA 1U3TA 2A67A 1I9CA 2QUIA 4DW8A 3IDQA 2ZJZA 3CBGA 3I34X 4NBVA 2XCRB 1Y9ZA 4JLSA 4AVYA 5BMOA 2BKUA 3WI7A 1TDJA 4ZEMA 1TUBB 4HTFB 5UKDA 3OBBA 3CPJB 1I9GA 2GK7A 1PR5A 2E87A 4IM7A 5ALGA 1UDRA 4QSHA 4HLDA 1HR0B 1IHUA 3TGWA 4JROA 4A8EA 1C14A 4KKVA 5B7GA 2OSVA 2X40A 4X45A 3IUSA 5EGSA 4IMPA 5KTOA 4H0NA 3UV7A 1E4EB 3RUAA 3U9LA 1A9XA 1Q1NA 2QPTA 2QOEA 2F9LA 4JT4A 1Q7CA 2VPYA 3ZS9A 3HZRA 2FV8A 4XJXA 4Q1CA 3L92A 3V4SA 2YDXA 1VIVA 2XUDA 3X44A 4IEFB 4O3OA 3AG6A 4QDXA 4QREA 1Y3HA 1R6VA 3GCWA 2FWJA 4TMWA 1JHAA 4KN7A 4MJXA 1PSZA 2JFWA 1ESNA 1L4EA 4MK4A 1B0ZA 1X94A 2J0UA 2BFOA 3QY9A 2PMDA 2XWPA 2DBQA 3KZ1E 1XNRB 3RFXA 2OORC 4YJ2F 2RRDA 4F71A 3BFKA 3MJRA 3RYHB 4F2SA 3K09A 4ZYZA 1NJYA 1OTXA 2AJLI 4DE5A 4BLVA 1NJ2A 3EJ6A 2WF6A 2IXFA 1FZQA 3I64A 2FLKA 1L7EA 4ZAYA 1O03A 1MJNA 3GFRA 3M3PA 2AJQA 1LK0A 1YB4A 4KO1S 4MFAA 5IINA 2J3QA 4IHJF 2QVZX 4XI9A 5F9HA 2W6JD 1QHFA 2AQ4A 4J2TA 4PAQA 4INAA 3V5NA 4C04A 1K75A 2YFYA 4PPQA 5FAKA 3GPLA 3OAAD 2B8JA 2HW8A 5ALYA 1P29A 5JDCA 4K26A 3ONNA 1FB5A 2WUEA 1XR3A 4CLXA 1MIOB 5AVKA 2FNAA 3AJAA 1ZH0A 5FOQA 2G77B 3KHLA 1L1EA 2JJQA 3RAFC 1PG0A 1GITA 5DI9A 4FIZA 1UEXC 3WS7A 4KGVA 4V02A 1F12A 2QD4A 1RLIA 3IIKA 1TD9A 2YHIA 3EXHB 2ZVPX 4E5YA 4JEIA 2A7XA 4M9XA 4E33A 5DM0A 2OO5A 2JNWA 3AG5A 2CL7X 5K8IA 4US8A 3JS5A 4M1ZA 2CNWA 2HHHB 1OV6A 1YIAA 4MV4A 1VLJA 1TW3A 2VNSA 1LKZA 4JNKA 4AP5A 1U0LA 4IZIA 4TMTA 2PRIA 2IA5A 3U61B 4WK4B 4LYYA 2PXAA 3GCZA 5BSMA 4P2GA 2Q9UA 4FN5A 5AVOA 1MGOA 4ERXA 1Z4IA 2C2KA 2FVYA 4F56A 3O21A 2GILA 3G8YA 3WIBA 4K9NA 4RNDB 3SIRA 3NHMA 3N0TA 2CLOB 5ITWA 4Y2VA 3FCUB 1Z63A 3C3BA 4NC9A 3VSBA 3RB6A 1RFGE 3V7UA 4JP1A 3AL3A 2Q9CA 3HA5A 1N6HA 2Q2NA 3NVDA 3UUEA 2QY9A 3BXPA 2ZCUA 1TF7A 3LQRA 4RELA 5FBRB 4ZEWA 1IAVA 1XELA 1NUAA 1ZIPA 1KMCA 1ORDA 3B20A 1QCZA 1E5XA 4CT5A 2W2TA 5SZKB 1RPAA 2ZQYA 3DOUA 3HSKA 2B82A 3KUUA 3S1AB 1QH8B 1BAPA 1U8CB 2BM8A 5EE3A 4RJTA 4YQFA 3NAQA 4H4CA 4KQEA 3ETRA 3CUUA 2Q3LA 4QZGA 1P61B 4EMSA 1GGEA 1N3YA 3FNEA 1U47A 1NBEA 3AN1A 4NMMA 621PA 1YZ3A 1LBSA 1P6QA 4BRUA 1YJAA 2IPMA 4UTOA 5ICFA 3I09A 3AR7A 3ZD8A 1SVMA 3G0GA 2WF9A 1JP7A 2BKAA 3WX0A 5ILGA 2R1ZA 5JRZA 1XK6A 3AETB 3GEBA 4QBGB 3UZUA 5AYVA 3KVRA 1OZGA 4Q66C 3OPYB 4GQBA 4O0MA 1QRSA 1JWBB 5C5CA 3M2TA 1COWA 1E6EA 2NU6A 3GLFB 2LYHA 2YJTD 2RJ3A 3G49A 1E63A 4ZT6A 4D4LA 2X9NA 1CRXA 3SYZA 2PUBA 1HSOA 4GKAA 4B8YA 4ARUA 4IRUB 4IDPA 5A4IS 2DWQA 3P94A 2VF4X 1ZGJA 1BJTA 2QRNA 1N60A 1GZ6A 3D7SA 2LW7A 4AJ1A 1U90A 4UVHA 2EG5A 4EGAA 4XA8A 3QXJA 3BH0A 3P97A 1NVDA 3KU4A 4YUXA 2D0IA 3GJRA 3FPLA 5TNXA 1K6JA 1M2KA 1TU4A 3IJEB 4TTVA 2OCPA 1USKA 5DM2A 1NQTA 4LQ4A 4OM8A 4CV1A 4DYDA 4OA8A 4IY1A 5KG2A 1XCLA 1J49A 1U0RA 1I4WA 1GDTA 4JV5B 4M9SA 1MQSA 1IEXA 2IS4A 4BUGA 3GZFA 1UUFA 4A7PA 3QMVA 4Q3AA 5DLQC 1TEXA 4LGMA 1S0VA 2VT3A 5KT3A 4DT1A 2HXYA 2C07A 2C5BA 3KT3A 2A0KA 3UATA 5JHGB 3HBJA 2OV1A 4LOHA 3KVYA 3AL0C 2RDMA 2X8BA 1GZ3A 2GYUA 2OOSA 3DEHA 1VJTA 3QTTA 3FF1A 2HCTA 2OA0A 4BMDA 4BBJA 1UM9A 1MPXA 3SZMA 4QZBA 5JAUA 4XFDA 2BONA 2FPIA 4QAQA 1XTIA 4N54A 4MYRA 4P0PA 4HGPA 2R6HA 1TZKA 2ROQA 3RS5A 3DB2A 3X1WA 4RMHA 1SCKA 5ISMA 1U0OC 2PX3A 3QLVA 2WIAA 1AKUA 2QD3A 1NWHA 2I7CA 2JIZD 3P9YA 3RIMA 4NJEA 3NONA 1JB9A 1C7QA 1NBMD 4L7QA 3AB7A 4MRSA 4JFAA 4YQZA 4RCZA 3KPWA 3DLCA 3LFTA 2Y2VA 2FQ1A 1PWZA 4XWAA 3ZTTA 2OBYA 3UAZA 1Q3UA 2W9AA 2D2EA 1UM8A 3I39X 2QAIA 3D8BA 4YH1A 1XIVA 1ZQIA 4OYYA 5FLEX 5JO0A 1I2CA 1KXJA 2V0GA 4PS0A 3ROZA 2JLYA 3T5AA 8ICWA 1R5BA 4FI3F 4GU5A 5FULA 1ZC4A 5LQMA 1B6SA 2WB4A 3HRIA 4PWYA 1SMKA 2XBMA 4O1HA 3QEOA 1O8CA 1OFTA 2ORVA 4DMGA 4GXQA 3V80A 1Z37A 4ZOCA 3A2KA 1ADJA 4KR0A 4R0NA 1BU5A 4H1VA 3HB7A 4HCJA 4UJ3A 4O4JF 5CHGA 1WS6A 1A9OA 1TLFA 2WKPA 4NEGA 5BN1A 1EUDB 4MKIA 4PVDA 3TADA 3AEKB 3VPHA 4BC0A 4RPJA 2QUKA 2H4HA 2EYUA 7ICLA 3TKLA 1YR3A 5CEEA 5K8TA 2WA1A 4KLQA 2MSLA 1DK2A 9ICRA 4GBED 4F93B 1UXJA 1E58A 5ICSA 4LTDA 3NB0A 3QWBA 2YJ4A 2QK4A 5BY2A 4DANA 1T6XA 3Q8QB 2CL0X 1EGMB 1SC1A 3A1DA 1I3OA 5HKKD 1JIXA 4IIVA 2FB9A 4EGJA 4UB4A 4W5QA 1BHO1 5FB3A 3GB9A 3V7WA 1DELA 3B6IA 5HMMA 3M83A 2OP0A 2R5FA 4NTZA 3A06A 3K70C 1ZQXA 3NGXA 3REOA 4HJXA 1H0KA 1L5GB 1U5CA 2K4PA 4ODIA 3UB4A 1Z6AA 3FJ1A 3BTUA 3EAGA 3I2YX 2UVVA 3GLKA 1V7PC 4B2IA 4MYSA 1CS4C 3PC3A 2WJJA 3RWOA 4JVLA 5T4EA 4IJ6A 5CTJA 2C2YA 2PEZA 4TV9A 4ZVQA 4ZEVA 3CPHA 3E2PA 3IQGX 1EFHA 1W6RA 2QRGA 4C3OB 1DUVG 3CX6A 1S8FA 2BHRA 5EMKA 1ZA2A 2HMUA 1WSWA 4NYMQ 3WGJA 4OQXA 3MD0A 3UAVA 3DO8A 2IITA 5TPZD 3W90A 1QIEA 4OUKX 3RJ5A 1W88A 2VLIA 1TUGA 5A0LA 2JGDB 1UJMA 4LJLA 5FA6A 3Q85A 4BECA 2GLTA 3F6SA 5J9FA 4NAHA 1ZPDA 2C28A 3N2GB 4YAIA 4MWOA 4BIIA 1VGQA 1DV1A 3WB0A 5JCXA 5GPBA 2C8JA 5JFGA 4HEA1 1F20A 4JV0A 4ICAA 5JS2A 4WCDA 4ECUA 4F4ZA 4UQOA 5C5JA 3E53A 4C20A 3BL5A 2W54A 2PR7A 2W4QA 2VUTA 2F9MA 5A9RA 1JEOA 4QBFA 4YMMA 2ZS7A 3O0TA 1Q7TA 4TURA 5BSHA 1ECJA 3E3LA 3RCBA 2GM5A 1TU0A 1Y7PA 2NV3A 1T8PA 4JV1A 4GR9A 4E1BA 3GRAA 1OFUA 3BVPA 3OIFA 4HFJA 2XNSA 2OZKA 3VI3B 2AK2A 1NW6A 2C9MA 4KIJA 1AOXA 3N7RC 3SR3A 2HTFA 4ZT7A 3MTBA 5IZ4A 4RSHA 4F2DA 1SXJE 1VHTA 3AQIA 4X9XA 5GV7A 5AW5A 5KFEA 2J3EA 3T9DA 2O2HA 2W3SA 1I33A 2GFQA 4B4VA 5L95A 2I7DA 3ZE2B 2I62A 1N5MA 1TPZA 2XDQB 2UDPA 2X76A 3CXRA 4CV3A 5LFAA 1HNNA 2XKJE 5ALRA 4AS2A 4I7EA 4J9SA 1JHRA 4E03A 4ZVLA 3KLOA 5CT4A 4RPIA 2ODGA 1WMFA 5DCUA 1EAMA 2JLSA 4HB4A 4CE6A 4R4JA 1VMDA 2WJPA 2QMQA 2VDOB 2QMEA 1WABA 1N2CE 1KYIA 4L5BA 1GLVA 4GNRA 3ND5A 3U3XA 1J0EA 2VWHA 4V0LA 1EGAA 3UB2A 1PJ3A 2JGMA 4TZTA 3B1KA 2OHHA 4DGSA 3UXPA 1L4LA 3D8UA 2D8CA 3MBIA 3LQ4A 1HBJA 2ZI6A 3GJXC 2XZTA 2WSSA 1PS8A 2I3BA 3VSEA 5JCOC 2NAPA 1K8QA 4G36A 1GU7A 5HDQA 1XNJA 3UXHA 2BMAA 3PEFA 1D2EA 4F4HA 1CUGA 4Q3CA 2F64A 2PO5A 4FOLA 3G17A 5EXPA 2UZ0A 1SVSA 4S0XA 5M34A 3JZIA 3VKWA 1NK5A 1OBFO 3GLHA 2JAPA 1B00A 3ER8A 4YP7A 3HR8A 1WD5A 2YMPA 3K9WA 3B8EA 2XODA 3DYIA 3FF4A 1SQ5A 3PFNA 4FFOA 5L4NA 4MV7A 4BDSA 1V39A 1K9SA 3DEYX 4DADA 4EJ6A 2IDZA 3PSIA 2ZR9A 1TQDA 3TE7A 1SVWA 1D2GA 1II0A 1NY5A 1GKUB 2DJIA 2NUAB 4KO8A 2ZWIA 2K8AA 4UE3S 1COOA 4BX2A 1G8FA 4IHAA 3QYAA 2WSLA 4MTCA 1LPMA 4HX9A 3R3HA 4PXAA 1FYEA 2KB0A 4KXYA 4RAQA 1XGKA 5C53B 3LQ2A 4BMCA 1T3TA 1C9DB 1ZUNB 1O0BA 4EW3A 1QF7A 1MOSA 2FE1A 2Z2KA 4WK0B 3NWOA 3E2MA 1K0UA 5J0TA 4HRXA 3BQNB 4QDUA 3DL2A 3PXDA 3ZHXA 1EQUA 1UQRA 3THXA 1E5QA 3C43A 4MRVA 5IZCA 3CRZA 4PJ0U 4PN7A 3SR0A 1GRNA 2GZSA 5B58C 1UKVY 2VPTA 1KI6B 4IGAA 3JQBA 3A6HA 4ON9A 2B0CA 3M9XA 3CX8A 2HNAA 4U7CA 1GVHA 1GAEO 2DETA 3OKPA 2Z3VA 521PA 3WWPA 1R9MA 4W5JA 1G2PA 3SZRA 2AZMA 2PJDA 1C7FA 5KG7A 4JEUA 5AUQA 4BXOB 2ID9A 5ELLA 3VGJA 1OX5A 3SXPA 3WKCA 1AMNA 2KE5A 4FU0A 1VRCA 1AKWA 3K8OE 1Q0UA 1PR6A 1EFTA 1JDZA 2ZCJA 3V32A 3V3KA 2J1LA 4OQNA 3CNHA 5DGTA 1NW9B 1ZIXA 5BWMA 1NJZA 2P4EA 1U0EA 4ND8B 3U4MA 3CBQA 5NULA 2WJGA 1LLUA 5TJ9A 2CB0A 3GUHA 3H6GA 3NBZC 3SXUB 2HK7A 4ZI2A 3EVDA 3HVUA 1Y8QA 3E1KA 1ODLA 1O95A 4RZIA 4Q37A 1G8KA 1M8JA 4PTZA 4MLZA 1G0OA 2GZAA 4M2LA 2BFEA 1JIKA 1D1PA 4N3AA 4CM8B 3ICPA 3CPSA 3TRFA 3PW7A 1PK1A 3A4NA 3TW8B 1BHSA 4L72A 4C0AC 4MSUA 2VP9A 3CUWA 5J29A 2QIOA 4J4HA 3T1OA 1DXOA 2Y8EA 4G9GA 3L6UA 3O93A 2Z4SA 4JJ4A 3IURA 3WRWA 1Q14A 1YZLA 4YRFA 1GU1A 1V35A 1I24A 4RK4A 1G5TA 1WCWA 3JPRA 3HLYA 1NT2A 2JIBA 4FZRA 2CDBA 3DQPA 4EFLA 4X61A 5K0ZA 3I8OA 4MR7A 3JPSA 4R01A 3NHYA 1F3LA 3P9ZA 3PVXA 3ITNA 4C80A 1Q12A 1AKYA 3L2OB 4FKMA 4CKYA 4LVUA 2OL4A 3A6JA 2NRTA 3WK5A 1QG6A 1XYVA 1DAGA 4FINA 1AKMA 2EDUA 3HU2A 3FPGA 1F6DA 1XTRA 3RJJA 1W87A 2G9UA 4BLTA 1RABA 1BCSA 4V0QA 1U1GA 1VG1A 2EQ5A 4N41A 1RE1A 3H1AA 4CEHB 1ISHA 4OMDA 2BP7B 3AF0A 4JELA 4AG6A 3GV8B 3D4NA 3RSSA 3K71B 5BUQA 1VPTA 4O5EA 1JLSA 4L22A 2QUZA 5CFPA 2ODPA 3BWCA 3AJRA 1XAIA 2PCLA 1RYMA 4R9RA 2HIMA 4GMKA 1WY5A 2AFHB 4FSDA 4KMOB 2Z1MA 4R51A 4LBZA 3RRNA 3EDYA 1LH0A 4GQAA 1YQUA 4YRKA 4QQFA 4I2CA 3KJZA 9ICIA 1AY0A 4ZEOA 4C5CA 4RK7A 2B5OA 4DPLA 3BRWA 3VZDA 3FH0A 2PI5A 4WN9A 2H51A 3WWDA 2HREA 1CUIA 1JR6A 4YJFA 4EB6A 3KT0A 5G4KB 2NTNA 2HIAA 1CJTC 3KFUF 1J8QA 3ZNOA 2XMPA 2PXXA 4MF8A 4S05A 4IS3A 1WHTA 5FPTA 5EP1A 5JJ5A 4BLWA 3RIXA 5AK0A 2Q41A 2WTEA 5HW0A 1G5IA 4LQLA 3WGZA 2BMDA 4Z53A 3AI7A 1KFTA 1S77D 3GQCA 1OI2A 1P4AA 2RGNC 4F7DA 3NHZA 1PW5A 4KXUA 1DJPA 1EU1A 3CRXA 4FS3A 1JEQA 2FW9A 3HK2A 3SAGA 1NUSA 2RB4A 1AZTA 2FR1A 5HIAA 4RE6A 3Q1LA 3V6KA 4IUCS 5EXDA 5CH5A 3CR3C 1JDNA 2DFVA 4UM9D 4QU0A 4RD3A 4Y2JA 3DCJA 4JC5A 4W9NA 1E3IA 2P0AA 1N0IA 1PZHA 1K92A 1MT0A 1QORA 4D0SA 2OECA 3QE4A 3C8UA 2FG5A 3I9FA 1M6EX 3GFQA 2C3OA 4HDSA 2AN9A 5JAZA 3FVVA 4QXRA 2R4QA 5KYTA 3TWOA 3NOVA 4PC7A 4S12A 1Z16A 3ZX5A 8GPBA 1JFFB 3ETHA 2QBYB 3T9EA 4XD7A 3DOFA 2CXHA 5T8KC 8LDHA 3GG2A 1X7YA 1LC3A 1NXOA 2NUPA 5EI5A 4G9EA 1JR4A 5FUYA 2BI7A 1HE5A 4DLRA 3QGMA 5IF3A 4MS4B 2P2ZA 4UHJA 4CMAA 2FMXA 2PLRA 2J0SA 1N6RA 4KO2S 3UKOA 2JI9A 3I1JA 1Y33E 1GA4A 2GWSA 3UT6A 2O2IA 3Q10A 5G5HA 1ZQOA 2G5TA 1Z0SA 2AGVA 3SP1A 4E15A 1G291 5B53A 3P2EA 4NDNE 1LNSA 4IV8A 5G2OA 2O06A 4EATA 4J7UA 5HFJA 2WAYA 4C0BA 3VC2A 3BE8A 2NLOA 1QP8A 3CVVA 4WY2A 1H2FA 3EB9A 5E6SB 1SIWA 2P4QA 2ZIVA 2W98A 2QL9A 5FTKA 3VR4H 3HDGA 3ABSB 4HHEA 4Q4AA 4BP9A 2VF7A 3A4IA 3KHHA 4AQ7A 1GUZA 4F50A 4Y6SA 1AT1A 5KB3A 4JOCA 1FU8A 3D7MA 5C8YA 4NU5A 1JROA 1FS5A 5TMBA 1DS6A 3M1LA 3EUAA 1HZZA 4KV7A 1SQ0A 2CVHA 2QTBA 3HG7A 2J6IA 1I7LA 3FTNA 3ZE6A 5EJFA 3MGGA 3D7NA 1W36D 3WL4A 3AM4A 1DTWA 1LS6A 3FPEA 4U2DA 3ZWQA 4EECA 3NLLA 2H2AA 1RWKA 1SU6A 3JPTA 3DD1A 2KIWA 3L8FA 3QMMA 3ESXA 1T9GR 9ABPA 4UVGA 3HL4A 5F9LA 5JWHA 4BTVA 1QIHA 1Z5PA 4EELA 4UFOA 2QMOA 5EZ6B 2V8OA 3TAQA 1OLXA 1I4TD 5KG0A 2FZ4A 1X42A 4AG5A 1PX0A 4YAUA 4F0JA 3QX9A 3PD7A 2WVAA 3SZ3A 4GL4A 1W4LA 1K3TA 3EEOA 4DMHA 3A1TA 1TVCA 3ICVA 1PR1A 3GVIA 1Y6QA 1X7XA 2GSDA 1PO7A 1UXGA 1TIKA 1DQZA 2GB4A 4FHFA 4KEAA 5ITVA 4CRWB 4AIRA 1JKXA 5TT0A 4CF3A 1XNSA 1J8MF 5U9CA 3OE4A 1ZS9A 1X9XA 1XKQA 4RS3A 4EI2A 4DXHA 2O8EB 1YCFA 5JEDA 3QWFA 2R7KA 4QPCA 1W25A 1M0TA 4BFUA 2JEZA 1DC3A 4CKEA 4Y6GB 1CZHA 3D0QA 4I2VA 1UCVA 1H1TA 4TL6A 1W94A 3A05A 1THGA 3CZQA 4FZNA 3GIMA 2CUZA 1NVKA 3C8HA 2SKCA 1GNQA 3DT8A 4MAFA 3FCSB 9LDTA 5EHNA 5T4FA 3CUYA 1S9FA 4V0NA 2EW8A 2IF0A 4RE5A 3AM1A 4F8JA 1VKRA 5T7BA 5FWYB 1KE1A 1V2HE 3I6QA 1R5NA 1W85B 3IPRA 1M8FA 2WWXA 4D8WA 5H3CA 1Y3FE 3AFIA 3I2FA 1NN1A 1XZPA 5IFLA 1QZ3A 2W9MA 1G6OA 3HA7A 5KOIA 3H1EA 2UUPA 5FV7A 2JKVA 4NCXA 3ZCUA 1IHDA 2VJCA 2OCXA 2ZB8A 3K5IA 3PSPA 1DGJA 4WJKB 3RK1A 4RZUA 2WNSA 5KYVA 1H69A 3DBRA 1XT6A 3EC7A 3VPFA 4A6XA 1R2QA 3GFOA 2CWWA 4GI2A 2W2LA 3SS8A 4EW6A 1QF9A 2Y66A 2XUGA 3BE6A 3FHOA 4DIOA 2KYRA 1NP3A 3IX7A 3PI6A 3PUKA 1YDFA 3E7FA 4FQ7A 3TIFA 4FNOA 3LH5A 3P5BA 2QDKA 2JZBB 4I2DA 4I1SA 2W58A 3VO8A 1IM2A 2QTVA 4N5MA 1TEVA 3WWCA 1NMEA 4K3VA 4FS1A 2FMHA 2LYAA 3DDSA 4HUJA 4Q1DA 2F67A 1PKXA 1E2QA 1V43A 5KNLA 2QD1A 2TECE 5J58A 1DQRA 3WYCA 4JI2B 1FLNA 4J7XA 5D1NA 4OKSA 3GPDG 5TRTA 2DR2A 2PXIA 2QZSA 3GAAA 4ENRA 4HDMB 4QOGA 4ZREA 1XD9A 1XA3A 1TZJA 3LT0A 3HV0A 5E1BA 1SCBA 3RFVA 4GPBA 4MVWA 4QTUB 4WINA 1XTBA 5FT9A 1OZ0A 4YN4A 4J49A 1DT5A 1OBCA 1DAKA 5H8WA 1TC1A 4KAFA 1I5EA 3HYSA 1MG5A 1GO2A 1I0IA 1C4XA 5KYWB 1ZWKA 5JS6A 2OBXA 1QPZA 4LHZA 2HFKA 3R5TA 3TR6A 2H31A 2PSFA 5H02A 1H4QA 5M04A 4DFMA 1CY7A 4Y0VA 2PKEA 5B3JA 2V0CA 3FWKA 4A2CA 2JFYA 4KFUA 4F5DA 1GKYA 2VK8A 3FPJA 1K7FB 4PXYA 5HK8A 2ETXA 4RZ2A 3GQVA 3L8HA 1HMPA 4CR6A 4EM6A 1XTQA 2EFYA 3KJXA 4D3SA 1JQJC 4J1TA 1TJPB 2HBZA 1BQEA 3T54A 3L82B 3HU5A 4GHWA 4KBYA 4WKPA 3K4PA 1IY9A 3MN1A 1U3GA 4NAVA 5ES4B 4CLDA 3BXEA 4WUVA 3M8RA 4FUTA 2BLNA 1IN6A 4MZXA 3EPPA 4UB1A 3D3WB 3AQFA 2ZRJA 4LF8B 3L1KA 3AXSA 3I76A 4NXZA 3NP9A 4JWNA 5LQNA 4Z6FA 1PV1A 1IPHA 4QOEA 2I1LA 1GP2A 121PA 1AN0A 3C3KA 3RWBA 1CQJA 3KPJA 3B6MA 1UBOS 3V72A 3MWEA 3PUJA 5AUNB 2WIKA 4IRCA 1K5PA 3BK7A 2WAAA 3PE3A 1X74A 2AF3C 2AKEA 1LXCA 1KPHA 1U0SY 1F5NA 1NBIA 1TCUA 4H3SA 5BWNA 3QZUA 4E2ZA 7ICUA 1ECWA 1ZVMA 4EHNA 4OJQA 2BUCA 1I6LA 1KJYA 1CI4A 3NHRA 4WZAB 3M89A 1NPTO 5G3ZA 1WDTA 2B0JA 1UK7A 1JILA 5SYMA 4XWKA 4ZHSA 5J2EA 3EXIB 1U9ZA 3KLPX 1DBSA 2PZJA 5EWEA 4C03A 5I4IA 4QD3A 2FMUA 4DS4A 2BKXA 4ZDJA 1T3ZA 2AUTA 2W9BB 1YXMA 4R3WA 3LQYA 1UPAA 1V4BA 1CX9B 3AVVA 4G5RA 5L3ZA 3AJEA 2J6HA 4ZT5A 5DM4A 1GKIA 4HYTA 1URPA 2P65A 1R4NA 2C2BA 4WOCA 2I7TA 2GNAA 3KFVA 5L6MB 5EKDA 1WKVA 2DWPA 3HJFA 4RC9A 2RIPA 3VOTA 2F3RA 3HCAA 2UYQA 5LYJB 4HI0E 1MABB 4EK9A 3CEMA 3FTCA 1WSDA 1U7HA 2ODNA 1O94A 2J6SA 3QI7A 1KNQA 1B3BA 4MO2A 3DDOA 3BCHA 4XWOA 1M2OB 1EG7A 3WK7A 4UFNA 2FRXA 4BUCA 2A1UB 1PWXA 3W2IA 5JECA 2HF8A 1GHTA 5FXMA 2HPZA 4MGEA 4KTQA 4DEVA 4BFXA 2XUJA 4DDVA 4DL4A 2AEEA 2OBLA 2O8FB 4ZCMA 2L2QA 5DB8A 1V26A 4TGLA 3ZLTA 2JLBA 1XU7A 1DUIA 1A8IA 1TXGA 5K6RA 4CMHA 3UAWA 1POWA 3G2HA 5BN4B 2AG5A 3GZNB 2DPLA 3S2UA 3EGXA 1QYDA 4DQQA 4WGGA 3RUCA 2PRKA 1XMSA 1BVRA 3OOSA 1GFSA 5AD1A 4EFMA 1N78A 4DL7A 1D2MA 5T14A 1DHRA 1JSLA 3VISA 1JJIA 1V95A 2A78A 3E0XA 5GOTA 1VPDA 3BXFA 1KAQA 2VJDA 1G3MA 1BKDR 1JQEA 3IESA 2EGGA 4QZCA 2YINC 3DULA 3UGKA 1TYAE 2N1MA 3PEVA 3WB2A 3LC2O 2IF2A 4FYHA 4HOYA 2REXB 1C4KA 2C4KA 2I55A 1PQUA 4DHEA 2JBAB 3DA8A 2ZUTA 5CH3A 3EVEA 4OYLA 2BFNA 2FPGA 2IW1A 4IRDA 4N39A 2PH3A 1XCPA 2R6AA 3UCEA 4P5PA 4KLSA 4ACOA 2O8VA 4TTRA 2DPIA 5F1PA 2P3SA 2AF4C 3MK31 5BWCA 2I8LA 1DE0A 3ZZNA 1H2AS 5DBFA 4D0RA 3UJAA 3DZDA 4KQMA 4ZIRA 2QTAA 2MYUA 4GWGA 5IEJA 5DXFA 4C8LA 4IX1A 3ZC3A 1ZSNA 4RD4A 4L74A 4GDFA 1EFVB 3AEVA 1JAXA 1OAAA 3KVNA 3NH6A 3IBYA 3TRDA 4KO4S 1ZISA 5IYZA 4V24A 1MAVA 3K0AA 1WPQA 4JI6B 1ANKA 3CLSC 2PUHA 4JVSB 3O3NB 2C42A 4MCIA 1E2DA 1MC8A 4BFVA 2Y1CA 2DL0A 2ERCA 4H35A 2E1EA 1OWPA 2K4IA 2YWHA 2C83A 1NVFA 1NURA 4FKBA 2PIAA 1YF3A 4H15A 3CH7A 3LV8A 5JD6A 3U1BA 3HL0A 4ETNA 1E3LA 3D02A 3QKTA 4HXGA 3WGOA 1UQVA 3L0PA 4OBXA 1RNLA 4DSZA 3DNMA 3M6VA 3LQQA 3WP0A 2FR8A 1SULA 4LOLA 3LZ6A 4NOMA 3QBTA 2NO6A 2C2GA 4WXYB 5IVHA 4V03A 1Z0JA 4YBZA 4ZHQB 3PC6A 5JRTA 3OA2A 3HVJA 3G2IA 1YT3A 2X6RA 2LGJA 2ZRKA 1JG4A 2AQ0A 2H2HA 5DEIA 5SZJA 2PV0A 4CCSA 1E3SA 4D3FA 1D7OA 3BRSA 3WLJA 5IFKA 5J0SA 2GJSA 4EHJA 2CYCA 5AKKA 3QYPA 4Q05A 1O77A 3R3WA 4N0DA 1GTG1 3BWYA 4B6PA 3TUJC 3EFBA 1Z7GA 4C6TA 4Z4IA 2RI0A 3ZWKA 1CYDA 4GNKA 4LY9A 3NOOA 4KHPB 2I78A 2H1SA 3VR6A 5COBA 4F46A 1U6KA 5I4BA 2ZJ2A 4BJ5A 3RVSA 1WWVA 2QRVA 1IOZA 1CB7A 1XROA 4PHEA 1E2PA 3EGWA 5B58T 1W9MA 4WKGA 5IJ9B 4JBIA 1RRCA 1XP5A 3NNNA 5ANRB 3R8CA 2DR0A 1R3DA 1LJLA 1SCAA 1QSLA 1Y34E 3HHPA 5LXTB 3VTFA 1Q1ZA 1IEQA 3Q7EA 4K46A 1N6OA 4HAOA 1IXRA 4W4TA 4RQBA 2OCBA 2G09A 2G9VA 5ARBA 4JYBA 4KR6A 5EJ7A 5AXBA 4GT1A 3W6UA 4WNCA 1XEXA 1ODIA 3CT6A 4G0OA 2XI9A 2I2FA 3A58B 3K9GA 4JB3A 5ARDA 3VXKA 4IOJA 2O5RA 3A9VA 3VPGA 4Q34A 1L4HA 4BAGA 1K4MA 4EVRA 2CVQA 2CXTA 1H3NA 2QR3A 1W0JA 1BDJA 4RVHA 1N3IA 1AKRA 3H19A 1S2GA 2YQ5A 1WV0A 1ULAA 3W04A 1T5HX 1ZITA 2VXBA 5FFNA 1KOFA 3EXEA 3LBFA 2QJOA 2FPRA 4XQGA 4ASUA 2Y0CA 5JSKA 1PYOA 3RT9A 4RHYA 2HWWA 3WVNA 3N8KA 1B0UA 1ZM3A 1JXOA 2R7AA 1UC4B 1MQ8B 1ZXIA 5CNIA 2VP3A 2KD1A 1UL1X 3UA4A 2HDHA 4HZUA 2BSAA 2QU8A 2OAP1 1YJQA 1N75A 2IZOA 2V4MA 4U7PB 5J2AA 3EFOA 3UXMA 3VTAA 2TYSB 1T26A 5HQJA 4X1YA 1G2IA 4WZBE 1W44A 1RP7A 1YOVB 2F1KA 2I3ZA 9ICQA 2YXEA 1RQNA 3IQDB 3AM3A 4YO8A 3PHBE 5F64A 3ZDDA 2C9DA 3KFLA 4TRMA 4G5OA 2GJKA 1YD7A 2R5WA 3OJXA 1R0XA 3DC2A 3WDMA 2GCNA 1DK3A 1WY7A 2QNIA 3K6SA 3N58A 1AUPA 4C4RA 4S1TA 2C8VA 3PUXA 1QH0A 2J9RA 5E4JA 3AMVA 3MELA 3BZWA 1ELOA 3I2JA 3E81A 1B4FA 4EHFA 2R4TA 3PW0A 4TLEA 4DV1B 4XGIA 1T5BA 3USES 4NZYA 8ICJA 3DC7A 2H17A 4MCAA 3TZHA 1MVNA 2FUEA 1X9HA 1TK0A 2AGQA 3CLTD 3U7QB 3GRCA 2R87A 1VL2A 1DG1G 4RPCA 2VDJA 3DAYA 3FDIA 1QSYA 2AZTA 4P3YA 3HJCA 4J9QA 1KPIA 3C3JA 1YQDA 3CIOA 2WQZA 3QVWA 3GDWA 1W30A 2EJWA 4F9GA 3EZFA 1L4NA 1OLSB 4R63A 3QEMB 4RZXA 1P2VA 3N86A 1YZNA 1GG8A 3KAJA 2AOUB 4JQOA 3MPOA 3BE5A 3IEUA 3R4CA 4Q24A 1X86B 4FPXA 3L7LA 2HPAA 1XZDA 1X1SA 4E5NA 1D9FA 2ZITA 3FGZA 2ZYTX 4YAEA 5ALVA 4K0RA 4FYMA 4U39A 4J1SA 1RYSA 3QVXA 1A76A 2PFNA 4JJKA 4OQ4A 4RH0A 2WDZA 1Q0HA 3AX6A 4J0QA 5ALEA 2QLLA 4PYMA 1QQAA 1YB2A 2AZDA 2YV5A 3R0VA 2Z1DA 1LQUA 3O2JA 3THWA 2KZMA 4M3NA 1SNYA 3AI2A 3BZUA 3MWLA 3ODGA 2B8TA 1WPGA 4O1IA 4QQ8A 1P0MA 5CX4A 2BEUA 4BVEA 2A9PA 1CCWA 4E4TA 4LHWA 4PLYA 5K3BA 4KMRA 1CSEE 1QAOA 5K45A 3T5PA 5FUBA 3C3MA 2MINA 2GA8A 4YAKA 4CJXA 4MP6A 1IBSA 3L84A 1E6CA 3BWEA 4NQZA 3EXFA 2H57A 3NALA 1V6CA 3HVKA 3DO6A 4ELTA 2X22A 4QZHA 3TAHA 5F4BA 1NM5A 3X1ZA 1VZ2A 1KR2A 4DY6A 1SV0A 4WRRA 4ROTA 1EI9A 1BPEA 1NVWQ 1SRRA 2UZ4A 4O4LA 1RLOA 3BJYA 1N36B 3OKCA 2P3LA 5AO9A 2WTXA 3WG9A 1JHUA 4LMRA 2PO7A 4Q12A 3GZJA 3FC4A 4U4AA 3MA0A 4ECWA 5CYOA 3UQ0A 2JCVA 2O48X 4DAOA 4KLEA 3MUFA 1YJXA 4BVAA 4PL2A 1MB4A 3V8EA 4W5HA 2Q4RA 4QLOA 3OQBA 5F9FA 1TO2E 1UMDA 5FOSA 3RNOA 1UT8A 3GT7A 4NPAA 3ICWA 5DSTA 5JCJD 3EEBA 4GR4A 4CUKA 2QLFA 4QVKA 4M7PA 4GH5A 4J9MA 1XTVA 3VBCA 1MT3A 2ZSKA 2CHGA 1J1IA 1KGDA 4J3JA 3FMFA 3T5MA 1A97A 2AL7A 4BMNA 5B66U 1S76D 1YL7A 5KNCH 2PKQP 4Q16A 4PYKA 3VPXA 5P8WA 3O84A 1UP7A 1IRXA 3MJDA 2GZRA 5A3VA 4TMFA 3L7IA 1N9GA 1OAOA 4UUOA 4DV7B 7ICIA 1PN3A 2QVGA 3ELYA 3FSGA 1Z82A 3GNLA 2IHBA 4M88A 1TUEA 3QUBA 1QYXA 5LP6C 4UFPA 2MSKA 1BX0A 2I33A 2EZUA 2XUZA 2YMMA 4H31A 4MFCA 1OVGA 1CT9A 4R2WA 3IBGA 2DEUA 1J0XO 3S27A 2ZT5A 3CEPB 3F46A 4HGOA 1XMQB 1RHUA 3B38A 4NMWA 2VHYA 2AG1A 1FSPA 1ADFA 1YHZA 2ERXA 4IOKA 2Z6AA 1YZKA 4KMSA 2ZTMA 3FHLA 3BD9A 4HTFA 1CUZA 1D8TA 1FFUA 5KNBA 5ITZB 4F1WA 4H3KB 4P81A 2JARA 3P19A 4D8UA 4D25A 4MF2A 5FI1B 3DV0B 3LA8A 1VJ0A 3W5BA 1AV6A 1U9LA 1J22A 4I4IA 3OHSX 2IEDA 3NT5A 3RQIA 1Z7EA 1E4EA 5C8YF 3B7GA 1AQJA 2QJWA 1GUBA 4JBNA 5KFKA 3E1SA 1IPEA 2I9KA 4M04A 3L8MA 1R1DA 2H16A 3DF7A 2QLTA 2FSPA 5JD5A 2O6HA 3C3DA 2BRUC 2BR5A 3O03A 1BN6A 1S3SA 2I7XA 4E3ZA 4BNKA 1JRLA 2XRMA 3OEED 2VQ6A 3B9QA 1OIXA 3VKHA 5KWJA 4W5RA 3GIKA 4M8KA 4MGIR 1H0HA 4BMSA 4EH1A 5C4GB 3ONWA 3FDFA 1HKHA 3QLUA 2ZE8A 3B48A 4C4YA 2V9WA 4LOIA 4DA4A 3R3ZA 3JVUA 4CKBB 3A0BU 1ZWLA 3SYKA 3JALB 3HWTA 1M1YB 3L1JA 4K1LA 3S0JA 4GVLA 4QOSA 2X13A 1WZCA 2HVHA 3RYHA 3RKUA 4AP9A 5DOVA 3TD9A 3FNGA 2AJCA 3ZE1B 5H1YA 1OFHA 4LXTA 3WLLA 2YYYA 1L5FA 2I4RA 3RVRA 4YP3A 4WCFB 4OU5A 2HV8A 4HDNB 2Y9PB 2E37A 4GLXA 3RUFA 1HG1A 3IUNA 3S1SA 3B0YA 3SHVA 2CXSA 3LP5A 4YPOA 4HSGA 1P91A 2FSFA 3I61A 1U31A 4M0FA 4TT3D 4A26A 4RKQA 3IOBA 4FGZA 2VK1A 4HN2A 3ZWVA 4EUHA 2ZPUA 4R41A 2QB5A 5ERYA 3Q9NA 2IDMA 2AFRA 2YS7A 2WM8A 2BAGA 3H0EA 3WQQA 4EB8A 4ZKEA 3V8MA 1BPZA 4RV9A 3SQNA 3ABQB 3FBWA 4UD2A 2NSHA 5CYFA 5BSKA 5HIMA 4G1MB 3EXHA 4RQMA 3OURA 1LRLA 4IRKA 2HRQA 3RSLA 4KFRA 4PZOA 1GDDA 5LDDC 3CR8A 4D4IA 3PX2A 4HP8A 2R3SA 1JUDA 1IG0A 4H6PA 2CD9A 2CNDA 2PMWB 1D6JA 4R68A 5KNDA 2PFGA 2C88A 1JA0A 5AI8A 4EY8A 4JENA 4ELUA 4CV2A 3B3JA 3KLMX 2BTQB 1H2BA 2PR2A 4DILA 4WY5A 1VE7A 5L8VA 3TZBA 1T2CA 3K2QA 4AJLA 4ECZA 1CERA 5FF9A 1Z5OA 3TQRA 3EBOA 3M0EA 1DKQA 3T7TA 4YV1A 5BNFA 4QICA 3SD7A 1ZCJA 4UTPA 2A0UA 3OJSA 4P4NA 1SB9A 9ICAA 4LRUA 1E2IA 1O6BA 4AUEA 3LZCA 1LV7A 5H59A 2G67A 1DARA 4QIWF 4L0MA 7ICQA 2A3VA 2W8KA 5DHAA 2QTHA 4KZKA 1Y1KE 1PT5A 1ZH4A 3WYBA 2CLDX 1NI4A 5I8PA 5I4CA 3SM3A 5FDFA 2VJYA 1T3QA 2XKKA 5DGCA 2IYNA 3BERA 4QBHA 5KAIU 1R88A 3HTXA 2PKXA 5EINA 4LBYA 1GO3F 1NNI1 2X19A 3CVUA 3S1AA 4LECA 1QH8A 3C5HA 1XCMA 1FYXA 1K7EB 3ESYA 3F5MA 1QE5A 1X8LA 5KDOA 2ZFUA 4PW0A 2P75A 1ZHOA 2QL7A 4WGFA 1XSPA 3O91A 5F9NA 1UC9A 3MMXA 3V4OA 5EIFA 2B30A 4R2HA 2PPVA 1AZWA 4DL3A 3MT8A 3IDAA 3RYCB 4WZ6A 1FNDA 4LI3X 1YUBA 1QGUB 1RXEA 3ZQ6A 5EZQA 4XVQA 4NAUA 5CJPA 3AETA 4TXLA 2RC6A 3OPYA 3VTKA 4RA9B 1KQOA 1ZINA 1Z5WA 1Q19A 2CWDA 3GLFA 6Q21A 4I81A 3LWMA 4RBNA 1GGKA 4M0CA 4QSMA 2C98A 4RSGA 1XF1A 1E6MA 3ZHYA 1EWKA 1WNFA 4W9MC 1IVSA 5HILA 3T3PB 4CQJA 1PFGA 2B7BA 4FBLA 3PJDA 2E4UA 5HFAA 4LYHA 4QDTA 1SIBE 3PHIA 3AFGA 1LEHA 4PU0A 3GVPA 5F4ZA 3PCTA 2DUWA 1A4RA 4MEJA 2KJ8A 3H3JA 4MQUA 4BQFA 3PTLA 3VVLA 3C15C 5FOWA 2AXNA 4IGIA 2YOHA 1DCKA 2OLJA 3WSTA 3ITDA 3N28A 5KQRA 2WPDD 4TKLA 2DHQA 4GI7A 1SOAA 4UBIA 3SYLA 2A6PA 5COAA 2V7EA 1IIRA 4CXMA 2DVMA 4S1PA 2X4LA 2BJWA 1DFHA 4NRDA 3TQFA 1ZZGA 5FR1A 1BXRB 5FUWA 1JWLA 3VAYA 1YBMA 5IAAA 5FWXB 4C4AA 4AJ4A 4P4SB 2ZULA 1UMBB 2ZBVA 2D7CA 3L1UA 2LIVA 4LRQA 4JS0A 1AKNA 1KQNA 2V4ZA 4MQFB 4JGGA 3WLEA 2H7VA 4TXMA 3GEPA 4US2R 2Z30A 2OXCA 3G13A 3R6GA 5JWRA 2CDCA 5KFCA 2HWYA 4HH1A 1FUIA 2F17A 3I6ZA 2G76A 1FQJA 4QX6A 3PY8A 2BM1A 2MWMA 1LV8A 2R97A 4YXFA 1UBMS 3AHHA 1VHWA 4WFJA 2Y0BA 4KN9S 1GTJ1 4N47A 3MS2A 1QVZA 3DVRX 2O54A 4PZDA 2O3SA 2RHWA 1X1CA 4KXMA 5DCWA 2WZCA 3LVQE 3OLCX 3HJGA 3LRXA 1KTIA 4MRAA 2H8GA 3WGIA 3MC1A 3AV3A 4ZAGA 5CCEA 1JFVA 3SI8A 3LJKA 1V41E 1JZTA 3CEAA 4R8VA 1WB9A 4RVCA 6PFKA 4C01A 2L19A 2XVYA 1QR6A 2VN8A 2NXCA 2ISCA 1M67A 3BMNB 3O95A 4YASA 1RHKA 1N0HA 2I6FA 2JZCA 4JYCA 4NMLA 3DE4X 4LI0A 3QM1A 3CQ9A 3FG9A 5KFRA 4O08A 2P6RA 4TWRA 4FNAA 3ABZA 2KBFA 1A69A 1IEWA 3MYRA 5IF9A 1ED1A 2R7LA 4EI8A 3PC8C 3H4MA 4RQUA 3FHJA 3MPUA 4TYPA 5B1HA 2XECA 3ZXYA 1D4ZA 2XIDA 3K0FB 5JH7F 3KWLA 1E2GA 5FI0B 3OEHD 4YLGA 1EUDA 3UCXA 3I2HA 2PMZF 3BOSA 3U3OA 3AEKA 1P2TA 4XYEA 4D9IA 5IULC 1CR1A 5CX1B 4YMNA 1RVDA 2IS2A 1G8GA 3ZCXA 1IHOA 5LD2B 4A1OA 4IFIA 1E5LA 3T0IA 5EOZA 4PL1A 2OESA 1GNSA 2XTMA 3QV1A 3HT3A 1HDRA 2XWBF 4HFRA 5H3HA 2W8BA 1CVIA 1WMAA 1BWRA 3OKFA 1U0TA 1W76A 2EP7A 3ZTWA 4AKEA 4WEOA 2ZBPA 1L8OA 4NR0A 1LGYA 2JD2A 2PN1A 5KT7A 2QZ9A 1I4EB 2K8BB 4NL4H 3GDHA 2HSDA 2WZBA 4E2YA 2WC1A 5B1EA 2ODEA 1FNSA 3NGMA 1UODA 4R2XA 1R37A 4R9SA 5C46F 5FBLB 2ZXIA 1LF0A 1EUZA 4OAPA 4TXJA 3PZPA 5AHRA 4PQYA 2D1QA 4G07A 3E0FA 4UU8A 1R4MB 2IHZA 4PC3A 3AVPA 4JVMA 3PA8A 2HM7A 4YS6A 2QB1A 5HTOA 5IYZF 3VI4B 4DFPA 3OZDA 1Z2DA 1FW6A 4G65A 1DC4A 1BW9B 4N8EA 3AP1A 1Y80A 1WZUA 2HIHA 3AJDA 3IOMA 4ZA2A 1CS0B 4RPZA 3H9BA 1QP7A 2I1QA 2WHRA 3C41J 4KLUA 3OIYA 2O8CB 2VXCA 1QYRA 2JGDA 3ZX4A 2VWQA 4BZXA 3VCBA 2PWZA 3AF2A 3RC8A 4MVJE 2AKYA 3CEHA 5JI3E 3N2GA 1EJ2A 3PQEA 2W70A 4GX5A 1T3HA 1U7WA 1YFZA 1ZQKA 3C39A 3OKAA 1KRHA 1HLPA 4G84A 2JANA 3I3SR 2RARA 4ZCSA 3MWKA 3SZLA 3I5UA 5ECWA 2C22A 3KFXA 2BQ3A 2JIRA 4EL5A 1XJCA 4M1OA 4MUYA 5ALXA 2V7GA 4GEKA 3GD7A 3R5XA 2GKGA 3C1ZA 1K1EA 4XWTA 1S2LA 5EKTA 3G5UA 4MROA 3MD9A 1YWGO 1RYNA 4KQ1A 5CK5A 2K87A 2V7PA 4RORA 2E89A 4XB1A 4TTJA 3OLVA 2RGGA 3E5MA 1HQCA 1ZIOA 3TR0A 1V5EA 3WL6A 1V4VA 1C8BA 1KZYC 1IRIA 3V7FA 3DTVD 4HEQA 3INTA 3GGPA 1NQOA 1HOTA 3ZGXA 2CNLA 2O20A 4YP5A 4RJLA 1PDWA 1HYHA 5H9VA 4IH4A 4L4XA 4G4GA 3N7UA 5HMLA 3AM9A 2YV3A 4HPWA 3N8NA 1XZCA 1OHHA 3HEMA 1J0CA 1MOZA 5DV9A 3X1DA 4AYBF 2B8NA 1T9BA 5G1PA 1UBFA 5AM5A 2E3TA 2CKDA 3GWZA 4HH0A 4C6RA 1Z0ZA 1RWOA 1EE9A 5B1YA 1AMUA 4XIYA 2XDQA 2XTZA 5T3UA 4ZK6A 2LXNA 1D8LA 1NVVR 2VSNA 5F76A 1DC6A 4HBGA 5AKIA 1GZ4A 4ZICA 1L5HB 2A5LA 4YJGB 1KS2A 4YMVA 3IILA 2GZHA 1L1QA 1UBNA 1R9JA 3TX6A 4FGKA 1OX4B 1RI3A 2Q3CA 3TQ1A 1MAWA 3LQ1A 8ICMA 1VE6A 4DIBA 2PGNA 1ND6A 1JE0A 3GVCA 1NASA 2B7CA 3GRRA 1I94B 1PT6A 3ZQ4A 2ATIA 1TTTA 1RBYA 3DAHA 3KLNA 4GRAA 3Q8KA 3JVEA 1N2EA 3PI7A 3CP8A 4Q7EA 4A0QA 5BXQC 4IIJB 4WBSA 2O2GA 3AR2A 4ZOLB 4DQ0A 1V5IA 3I01A 1Q7GA 4UQLA 4GBGA 4LTMA 3TYXA 3E9MA 1ST3A 4I2HA 3UK2A 4NDZA 4EZIA 3HCFA 4ZRMA 2W43A 2EWWA 2WT4A 3MSXA 4ENSA 1E5VA 1Q74A 1O5IA 4PG6A 2RH9B 5KHOC 3NJ8A 4CNBA 1IPFA 2NOAA 5GTIU 1K6IA 3PR2B 1HEIA 1NVGA 2IIBA 1L3CA 3QIAA 5AI9A 3N4MB 3P4UA 4UB2A 3NTVA 2EBHX 1NHGA 1ZZEA 1F6BA 4MI1A 3PIRA 3M4NA 4XM2A 1K7SN 5F1OA 2SECE 1WSBA 3V6HA 2EF1A 2NUAA 1DFGA 1ULSA 2HSWA 4L8VA 4EHIA 4QJ3A 2VRCD 5DT2A 2GMWA 1EDBA 2V58A 3E9NA 1QPBA 2WABA 5BV0A 5JW6A 5JROA 1Z35A 1HUZA 3F1KA 1X1QA 4EVIA 4KREA 2B2XA 1U2GA 4GPZA 4JV2A 3NYIA 3G1WA 3QU4A 4I2EA 1ZUNA 2C04A 2O7NA 3V8QA 1ZQRA 4C07A 4C2AA 1WQ1R 2UYHA 5DP1A 3F73A 1XA4A 5IEBA 4UB6U 2EZYA 3AU6A 3CKKA 3MW8A 2PSEA 3OOHA 4PX2A 5DBEX 4DJTA 1I3KA 4CMJA 2NMVA 1HT3A 3ONVA 2R6JA 1ZQBA 4DSKA 3U17A 1H94A 1T5DX 3ZLJA 2V7XA 3P9QA 1KI6A 1QGOA 4Y9UA 4LN1A 1RJ9B 3I2GA 2O5EA 4X3CA 1YNOA 3ISTA 2VPWA 1ZQ1C 2MSCB 1F8UA 3ISDA 5EJAA 2R00A 2M9NA 1JAZA 4L5JA 1VL6A 4I50B 1VL8A 3ZJ5A 4TKUB 5ALNA 2JAHA 4BXOA 1YASA 3TL6A 3F78A 3MAGA 3K5PA 4L0QA 5FFFA 4XRRA 3IKLA 4YRCA 2F8SA 1L9XA 1YS2X 4NU8X 3ILHA 5CEFA 4V0SA 2IWHA 1M34B 3QTBA 3DKIA 4CKXA 4KR2A 4ND8A 1IONA 3TLMA 1KBOA 3K1RB 2HZBA 4MGZR 5KKNB 4JLNA 2PK3A 3UJBA 2L18A 4B40A 2IC5A 4EAAA 5I9LA 2CD7A 3SXUA 2HOIA 2PA0A 1FDIA 3TFRA 4M83A 3E03A 1VKNA 3J81j 1KEUA 3WJ2A 1WZIA 3ECAA 3O73A 2CLMB 4G8BA 3JQ9C 3OJCA 1LFAA 4BBAA 2PT7A 1NE2A 2CFSA 4CM8A 4R9UC 3DWIA 4EGSA 2QTTA 4PG5A 5FKJA 2YASA 4B3XA 3U4CA 2CFCA 4RL4A 4KUGA 4CKZA 3TW8A 2BDTA 3OFNA 3T1QA 3I5MA 4XUCA 4I5EA 4MICA 3B2NA 2IODA 1REQA 4ECSA 4YCCA 1E94E 2XX3A 2XRZA 3KKMA 4FT4A 2QT9A 1DMRA 2VRBA 3HU1A 4R1TA 4AF7A 4FZJA 1Z2AA 1XZNA 4ZYYA 1NLUA 5EUBA 2Z1NA 2PGXA 2QE6A 3BIXA 3IIJA 2V65A 2QTRA 3H11B 2GAIA 3T9AA 4DSTA 2IXTA 2HJ9A 1IOVA 1JXLA 1O7JA 3AL2A 4O4LF 1UPXA 1XK7A 1ENOA 3U48A 1OQAA 1MAHA 4TUPA 4KR7A 2CZGA 3X3HA 1P2UA 4GE3A 1G16A 1PZMA 2LIPA 4OO3A 2EZ4A 3J80A 3W3AD 2P2YA 3IMCA 3RS2A 4JI3B 5BN3B 1M8KA 1YZ6A 3QV2A 1LVHA 4N6NA 3BICA 3MCAA 1TF5A 2HMYB 2NTJA 5ES3A 3T38A 4CEHA 4BIMA 1B16A 3D6TB 1OKKD 3OX1A 1ADYA 3CB2A 3GCDA 3JQGA 4EENA 4U7FA 4ZQBA 1NX6A 4MW1A 1KC1A 1T8WA 1H42A 3G89A 1NTRA 4HQ6A 3V9AA 1N2ZA 8ICQA 4B9UA 4BB5A 4FMDB 4Q8FA 4RTJA 2AFHA 1WXXA 2DCMA 4KMOA 5FBVB 1PLKA 5EP3A 2O2ZA 3BQ9A 4JK1A 1N6IA 1XKTA 2XY7A 2ZRPA 4KX5A 3RGWS 2WUWE 2Q0ZX 4FHZA 2Y4OA 1N7HA 1U9CA 3GJ7A 5ALOA 5IAJA 1UOPA 4LGVA 2G1AA 2D1RA 1QIIA 5LJIA 3F0TA 3I52A 4LJYA 3OJLA 2NRZA 3RBDA 5G4KA 3B13B 1Z26A 4UTRA 1P3DA 1VA5A 1EQAA 1DX6A 4BMVA 2EQYA 2OVFA 4R2JA 2PX5A 2D1YA 5K8JB 3LUHA 1BKYA 1ULUA 2VRWA 1D5CA 3MCVA 5KCMA 2WYUA 2UXDB 1Z6XA 4GYWA 2B61A 1SXEA 4Z9BA 3AQEA 4ZXFA 1AKEA 2BCQA 2NIPA 1XDBA 3AEUA 3KYDB 4MWSA 1SU7A 4CCWA 2IPXA 1R4AA 5HKBA 2W90A 1BD3A 4BJ3A 1X1TA 3T1NA 3ZU5A 1KKLA 3V4RA 3GUZA 4HNUA 3IA7A 3E27A 6AT1A 4YUYA 4ZGWA 3C3PA 5I7AA 3WBKA 2RBKA 1IG3A 4C0QC 4NECA 1KI9A 1LCIA 4PCUA 4C0KA 3H17A 3EWNA 1SO8A 1PBNA 4Y1EA 3UTCA 5BQFA 1SOUA 4AU1A 4CTOA 1ICIA 1NVTA 1OFIA 1P7DA 4FB4A 3UMFA 5TEWA 2J8ZA 4MW4A 1JFFA 1NZDA 4Y0NA 4CF7A 2GLEA 3HUUA 2I2CA 5DQIA 1KI3A 1TO1E 4WNIA 5DE3A 3R0QA 4GAEA 4U7DA 3KU1A 1CJMA 5KKCA 1S2DA 3RFAA 2A1IA 4DB2A 5KQGA 4RVOA 4UUQA 4MS4A 4EA6A 3IE0A 2X6TA 5TZVA 3WNCA 3WFIA 2GSWA 4IVRA 3LYUA 4GICA 2Q6TA 4O3NA 5HVNA 2SKEA 1QDEA 1GZVA 3RK4A 2GAJA 4MVCA 5HWSA 5E79U 3REFA 4CDMA 4OGLA 2ZE5A 3TI9A 1UJCA 1QFJA 3OF5A 4ED2A 2EWVA 4D9KA 1TKBA 4LDJA 2WVGA 1EJ0A 2DPYA 2Y9MB 4AXBA 4D56A 5CDGA 1N34B 3ZGLA 1ES9A 4I36A 5E6SA 3IRUA 1F0MA 3KKPA 3ALRA 5D6NA 4TTIA 5DDIP 5IVDA 3ULKA 2ZTUA 5CBKA 4F5NA 4PR0A 2DBVO 4Q21A 5JH7A 4B2PA 2Q5IA 3EDMA 1IBKB 1PL7A 2O2XA 3NBXX 3NP7A 1BDMA 3DLBA 4ED0A 2P5YA 4KPFC 1OZFA 4GLBA 3QJ5A 2RG7A 1VBMA 4M0EA 1JU3A 2F8KA 1QCYA 2P9BA 4O8CA 3KO8A 4G56A 2XRFA 2RAFA 1Z6ZA 2LV8A 1EX7A 4UEKA 1GGMA 1A7JA 2QPLA 1OD6A 4RQAA 5DTRA 3UKDA 3HKZF 2QROA 4EYOA 2HMXA 3QU2A 4PNHA 4BPRA 1JKMA 2CLSA 3C3XA 2CN1A 5CIWA 5DN9A 3LHDA 1G42A 1KL7A 1M66A 2FEXA 1T6BY 4RESA 4Z1MD 2B94A 2O7VA 3QHQA 4JJ6A 3EGCA 3OQNA 3MMNA 1B8NA 5DBBA 1PV4A 3EXG1 2BHSA 1G6Q1 1PNQA 4YP1A 2XVAA 3RSOA 2VT2A 4EYEA 5U1PA 1PL8A 1MQ9A 4G0NA 4GPEA 3V3TA 4DEYA