2W11A

Structure of the l-2-haloacid dehalogenase from sulfolobus tokodaii
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
206
structure length
206
Chain Sequence
PRGSHMIILAFDIFGTVLDTSTVIQEFRNKQLEYTWLLTIMGKYVEFEEITKITLRYILKVRGEESKFDEELNKWKNLKAYEDTKYLKEISEIAEVYALSNGSINEVKQHLERNGLLRYFKGIFSAESVKEYKPSPKVYKYFLDSIGAKEAFLVSSNAFDVIGAKNAGMRSIFVNRKNTIVDPIGGKPDVIVNDFKELYEWILRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-HALOALKANOIC ACID DEHALOGENASE
publication title Biochemical and Structural Studies of a L-Haloacid Dehalogenase from the Thermophilic Archaeon Sulfolobus Tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 87
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2w11A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2w11A01
3WK9A 3OPXA 5AVSA 3QU4A 2RB5A 2JGAA 5AM4A 3L8HA 4EX6A 2FPWA 1Z4OA 2Q5EA 5AKIA 2ZBFA 1ZOLA 1Z4LA 2FPSA 2O9JA 4UM7A 4UMFA 5AVVA 2BDEA 4RESA 4Y2JA 3N8GA 2I55A 3ZI4A 2BY4A 1Y8AA 1LTQA 3WKBA 4KN8A 1EK2A 3ZX4A 2CFRA 3OCYA 2ZBGA 4BNDB 4DFDA 1CR6A 1Z5GA 4KYTA 1QQ6A 4BNDA 3E58A 3OCXA 5FP0A 3QGMA 5AM1A 2HF2A 3QU2A 1J97A 2ODAA 2JARA 1SU4A 4E88A 2B30A 4Y2YA 2B1RA 5AW0A 3UM9A 4DWOA 3L8EA 2OM6A 4AP9A 2EARA 3ZU6A 3MN1A 3OCVA 2R8XA 4AS3A 3U7FB 3IJ5A 2YY6A 1N8NA 2HDOA 1MH9A 3SMVA 4Y2XA 2G80A 2I6XA 1SWVA 1Z4JA 5AVYA 1IWOA 3E8MA 5AW3A 1QH9A 2B8EA 5JJBA 4L6AA 4JB3A 1RMYA 2HI0A 2Q4RA 2HSZA 2NYVA 5AKGA 3K1ZA 3QX7A 3UMCA 1RMQA 2AMYA 1ZJJA 4IG4A 2AUTA 3M1YA 3NAMA 1U02A 3OTQA 3U7GA 5AI8A 3QU5A 4UMEA 5ALGA 3PCTA 5IT4A 1Z5UA 3WGUA 3DDHA 3QNMA 2G0AA 3FZQA 3A1CA 2FUEA 2WM8A 1Q91A 1RKVA 2IOFK 5AW6A 5ALZA 3ZWDA 3AR5A 1RQLA 3SKYA 4KX5A 5IS2A 3I28A 2R8EA 3WKAA 2C9MA 2EATA 3EF1A 3ET5A 2YMLA 1N9KA 2W11A 3MC1A 1RKUA 3QUQA 2HEGA 1T5SA 5E0OA 2WF5A 3PDWA 3TLMA 5ALQA 3HYCA 4F72A 1O03A 1L7PA 1KYTA 2ZBEA 4YH1A 2AGVA 2G09A 1ZRNA 3QUCA 3CZ4A 3EWIA 4Y2QA 3KDPA 2FPRA 2BDUA 4UMDA 3SF0A 3DV9A 3EPRA 1L7NA 1FEZA 4GXTA 4F71A 1X42A 1YDFA 3WGVA 3NIWA 4Y2PA 3I6BA 1LVHA 1U2SA 1Z4IA 2FPUA 2AH5A 1J8DA 1RPZA 2ZG6A 5AHXA 1XVIA 3NASA 5ALYA 2O2XA 3ESRA 5AW5A 5AVZA 3DAOA 2YFYA 3N5KA 3OCWA 5AKXA 4NAVA 4EZEA 3SD7A 4Y3UA 1YS9A 4EELA 5AVWA 2YBDA 1PW5A 4L57A 3HLTA 2D2VA 1TE2A 1TJ3A 3U7EB 3MPOA 3RFUA 3N1UA 4CF3A 1QQ7A 1ZS9A 3W5CA 2YMPA 3R9KA 2B8JA 5ALSA 3A3YA 5AVTA 2W43A 3WK7A 3L8FA 2HCFA 2JAWA 3ZWKA 2C88A 3IB6A 3ESQA 4AS2A 1ZRMA 5ALJA 2YJ6A 2C8LA 3AR2A 3AR8A 4L6CA 5ALXA 3RF6A 1Z4QA 1T5TA 1WVIA 3W5AA 5ALFA 4BYGA 3OCUA 5T41A 3QLEA 1TJ5A 2QLTA 2IA5A 5AIAA 4HYTA 4RETA 2G1AA 5AIBA 2JAOA 3SLRA 1K1EA 4B6JA 2ZOSA 2OYCA 3F9RA 4UU0A 3E84A 1YNSA 4DCCA 1AQ6A 2YMMA 2PR7A 2MU1A 4BX2A 4CNQA 4G63A 3ZVNA 1L7MA 5ALKA 5AK3A 3OCZA 4UATA 3DNPA 3NANA 5IT0A 4NV0A 4JDPA 4NABA 1WZCA 3SHQA 3I1YA 4HGRA 5AKYA 3NRJA 2WF8A 3R4CA 5AK4A 4UMVA 5ALMA 3KC2A 4ZEXA 3U19A 5AM2A 1QQ5A 4DW8A 3PGVA 4FYPA 4YIKA 3QU7A 2YMQA 4H1WA 1CQZA 4G9BA 2B82A 4XOUA 3L1UA 1RKQA 2QYHA 2P9JA 3GYGA 2FI1A 3L0CA 2YN4A 5A3SA 5ALHA 3P96A 1VJRA 5AESA 1S2OA 4EEKA 1NNLA 3L0YA 2HHLA 4MWOA 4UW9A 1RC8A 2C4NA 3PGLA 5AKHA 3E81A 1U7PA 3A1DA 3L5KA 3QUTA 5AM3A 1XPJA 2GHQA 2B0CA 1Q92A 3UMBA 3ED5A 1YMQA 3ZTWA 1Z4KA 2OA0A 2G06A 1JUDA 3KBBA 2YJ5A 1RRCA 1RLTA 2WF9A 5AKEA 2ZBDA 3SKXA 3A1EA 2I54A 4C4RA 1RDFA 1ZD3A 3WK4A 2FDRA 3ZVMA 2FPXA 2R8ZA 3AR7A 2VKQA 5A3QA 4OCZA 1L8OA 5AVRA 3U7HB 4YCLA 3ZTYA 2RAVA 1L8LA 2MSNA 4CE6A 5AVUA 2EAUA 5AKJA 3KD3A 3N28A 4NWIA 2YJ3A 4OD0A 1WR8A 2I34A 4FFDA 3U13A 3WK8A 1EK1A 2HX1A 5AI6A 3FPBA 3IRUA 4XPZA 5ALRA 3WKEA 2JAUA 3FVVA 3ZW7A 5AK6A 5A3RA 2IOFA 2P27A 2CFTA 4OHFA 5ALIA 1XP5A 3W5DA 5AKKA 1YJ5A 4YCMA 2OBBA 3B9BA 4CF4A 4O8CA 3BWVA 4I9FA 5ALWA 3WKCA 2RBKA 3ZUPA 4UU1A 4NFLA 4IFTA 1TJ4A 3M9LA 1RLMA 2B1QA 4PNHA 2NO4A 5AI5A 2NO5A 4BX3A 2CFSA 2R8YA 1NRWA 4KX3A 4FE3A 2MU2A 3N07A 4C4SA 4HGNA 2IOHA 3EF0A 3ET4A 3CNHA 3NALA 4Y2TA 2P69A 4ZEWA 5AW7A 4Y2SA 3L7YA 3VAYA 4YIHA 3FM9A 4CF5A 2G07A 2GHTA 2Q4TA 3AR6A 5AM0A 2YJ4A 1L7OA 5ALVA 4GIBA 3ONNA 5AKZA 2FUCA 1F5SA 3J7TA 2WHEA 5AI9A 3BA6A 5AI4A 3UMGA 4MUMA 3WK5A 4J03A 4UARA 4I9GA 1SWWA 5ALTA 4YCNA 4OFZA 4YGYA 4HGPA 4UAUA 3WK6A 4BEVA 4C4TA 4Y2UA 3QXGA 4BEWA 1WPGA 4Y2VA 4KNVA 2IYEA 2HOQA 3S6JA 4HGOA 1Z4PX 2WFAA 5ALNA 3QUBA 2X4DA 3L0BA 4KNWA 4ZEVA 2W4MA 2G08A 3U26A 2HF7A 4QQFA 5AW8A 3FGOA 5ALLA 2P11A 5ALOA 3I76A 1T9ZA 1ZD5A 3AR3A 3B8EA 4UASA 4HGQA 5ALEA 3ZX5A 5AKLA 2RARA 5AVQA 1S8OA 2HO4A 3AR9A 2GO7A 5AICA 2I33A 3NUQA 2GFHA 4HAIA 2ZXEA 3WKDA 1ZD2P 5AI0A 3R09A 2GMWA 1QYIA 1Z4NA 4XQ0A 1VFPA 3ZVLA 4EENA 1U2TA 1Z88A 3QYPA 1ZD4A 1U7OA 3D6JA 5AW2A 5ALUA 2C8KA 2CN1A 1O08A 3KOOA 4EX7A 1YV9A 3B9RA 4J2TA 2I7DA 3L8GA 5AW1A 1RQNA 5AW4A 4XE5A 2DQSA 4UM5A 1TA0A 3W5BA 1L6RA 2WF6A 3MMZA 3QU9A 3KZXA 2PQ0A 5AW9A 5ALPA 3AR4A 4BBJA 5ALDA 4Y2RA 2PKEA 1VJ5A 1Z4MA 3L1VA 4QJBA 2FEAA 5AM5A 3FPSA 1RLOA 4BKMA 2WF7A 4UAVA 5AVXA 4BX0A 1NF2A 5AK5A 1RMTA
chains in the Genus database with same CATH superfamily
4TV8F 5B3AA 3CZCA 4ZJYA 2YZNA 3H7IA 3T3IA 2H07A 1DRUA 1U0SY 3E0XA 3KQNA 4P0TA 3EH1A 1FNSA 1TVMA 4PGGA 2CYCA 4UNPA 1M1ZA 1BDJA 3TIGA 1HTWA 2EDAA 3L7NA 4ZZ3A 3PV0A 3E9ZA 5C1IA 1DEOA 1YS6A 2V96A 3QPCA 2NXCA 4CMKA 4PR3A 5K05A 3EJ6A 3O1IC 4DHEA 4NP6A 2C31A 3CVXA 3SFZA 1MENA 4IDFA 1CW2B 4P08A 5MFZA 3CZRA 2BKUA 5EY5B 2YHIB 4M7WA 5B6IA 5EQFA 1S2MA 3C3PA 3B36A 5IJXA 1W59A 5C7OO 2OD2A 2ZSDA 3A9VA 3UKJA 4XM2A 3ZE0B 1XMQB 1QOPB 3V46A 3ZE8A 4TMFA 1NMQA 1PWEA 1XU7A 1SRRA 4PSUA 4E1AA 2QX4A 1XMOB 2WE7A 3FPAA 3LF1A 1WMSA 1MORA 2R6DA 3DO8A 3VYUB 1SNYA 3PVXA 2N0SA 4L5BA 1ITZA 2H00A 4UZEA 1B0UA 3GZ4A 5J2BA 4JT9A 3UT5A 3GIKA 2WD9A 2QE7D 3TIXB 4JQZA 1T29A 4A1OA 3QKSA 4LWQA 3BH0A 3NG1A 4BX9C 4GE3A 2BT4A 3KJXA 3FZGA 3HCWA 3C3WA 4UFNA 3GLKA 4J4TA 4CLOA 4EBDA 4CF7A 4YQEA 3AK4A 1MAVA 4I2EA 4OYYA 3Q7QA 2KLHA 2D06A 3F2CA 4HAZA 2OLKA 3D43A 2XRYA 5U4QA 3HB5X 3ZNPA 4NCJA 3MBIA 1AQNA 3P2IA 4FOPA 3S2SA 1V3VA 3JQBA 3K2IA 3ADPA 1NI5A 4BLPA 4TTPA 3F90A 1Z2EA 3DH0A 2FEOA 1BQ4A 1F48A 3VRHA 1Y4DE 3LGSA 3UWMA 1B43A 2FW6A 2PS9A 4YA6A 3IAM1 4NMXB 4W5JA 3HR4A 2CT8A 4O3RA 5JW6A 4MEJA 3R7NA 4P3OA 4YV2A 3QI2A 1KXJA 1WSWA 5I4CA 5KQPA 1I3NA 3O0FA 4H31A 1FX1A 1HR0B 3QY9A 5INTA 3C5HA 1O5TA 3EXG1 2V4ZA 2HD4A 4KQ1A 1BO6A 2NSYA 4NCKA 1L2TA 3GVCA 3KSAC 4KQMA 1YRYE 1KMHA 3QBVA 3U7IA 4FFLA 1EDDA 5IMSA 5KOYA 2AA3A 2ATVA 2WJYA 4RNMA 1Q1QA 3LUAA 4QW8A 5C80A 5DMXA 4KVFA 2HDNB 1PJ3A 5L3QA 1NSTA 2C3PA 4L9WA 3K0EA 1ZN7A 4C3ZA 5GOTA 2ODWA 4QOEA 4Q02A 2BC9A 1OREA 4DDVA 3S29A 1GKYA 4DDMA 2WKWA 3QVTA 5D3ZA 3PRJA 1OQAA 3ONNA 1DC3A 4B76A 4P58A 1G60A 1IEWA 1H6CA 2YUTA 1KL7A 2IYXA 2OYSA 4PYIA 3SS9X 4F85A 1XRNA 1R15A 3E3LA 1G0NA 1JALA 4LRWA 3GJSA 1RXYA 1W6UA 5ADWA 4UNIA 4AJJA 1Z07A 1M2OB 3I6ZA 9ICUA 2CNOA 1E2NA 1ZQNA 2HO4A 1O77A 4XJTA 1HV8A 1BU8A 1PT9A 4P8RA 1PEYA 2HQOA 3B6ZA 3EJWA 1Y8ZA 3W6PA 2NSLA 2WF6A 4G56A 4KKXB 4BFSA 1J5PA 1QRUA 4HUTA 1PJSA 4P0QB 1ZI9A 1CE8B 5AK5A 5DX1A 2E4WA 3GRVA 2XO7A 3HYRA 3BX1A 2VPZA 1FBTA 4OHUA 2JEOA 3OPNA 1T6XA 3ADOA 1UAGA 1SKYE 4OFWA 1QGOA 3OQBA 5BYKA 2H1SA 2JL1A 2IP2A 5ED0A 5BRAA 3BFJA 3T9FA 4ZOLF 3PX7A 3DOFA 2GCGA 1Y1QA 4NL9C 2GILA 1IRIA 1VE6A 3NVWA 5H81A 5JO9A 4I5EA 1EVEA 1Q14A 2EX0A 1E2GA 3UF0A 1BX1A 1QYDA 3M7IA 4F3NA 5HHHA 1V7PC 2OXOA 1J22A 2C2YA 3O3CA 3QNMA 3RTEA 4RSRA 1EK5A 5JNTA 2YMLA 1DKRA 2DQZA 3AONB 4R8VA 4I4TA 1QAQA 2J0QA 4LRXA 2PWZA 3GUHA 1Q3UA 5HIIA 3JVDA 3NM6B 1E6LA 2OY0A 5C4MA 2BUCA 1GGJA 1L7QA 1I2BA 3EDQA 5CA1F 1N57A 1PTJA 1CP3A 5JPIA 3F2BA 5CDYA 2BGNA 5CVEA 4EPRA 2C7GA 3H2BA 3Q7EA 2HWYA 3VM6A 3F96A 3TB6A 4FFBB 3W5CA 2G25A 4W9RA 4RNDB 2NU7B 2VJDA 5KNDH 3MJTA 5L1KA 2P6NA 1BWRA 3RSLA 3VOAA 4J0GA 5HS6A 3D3EA 4D99A 1CPYA 3TVDA 1CD5A 1OTXA 4HWSA 1MO2A 1AQJA 1G63A 4K86A 4BNUA 2HKIA 1QK5A 2Q6KA 1OFGA 1TK2A 3HVHA 3IBSA 1DBWA 1NBME 4X0EA 5REQB 3F5SA 4FLMA 4XFDA 4KVZA 4BYMA 4X5VA 1P44A 1A9OA 3U49A 10MHA 3KTOA 4Q93A 4DLYA 3OPYI 2Y0BA 1VTKA 2BFEB 5JRJA 1K4KA 2CXPA 2ZTCA 3EBLA 4MR7A 5BV7A 2J9ZB 4EF4A 1UMCB 2IPXA 1BGVA 1FVFA 2V59A 4DNPA 5IWCA 1A1SA 4JU9A 2P66A 1NQTA 1PN3A 2NVOA 2Q8NA 2C5FA 1KO7A 3MAAC 1WDWB 3NIFB 2W6OA 3G8YA 1L5ZA 2R8ZA 2WFLA 4JV2A 5DNEA 5A3QA 5EG5A 4BMPB 3WHIA 1GA1A 1VFNA 1ZN9A 4NAHA 4ODIA 4D80A 4A0GA 2UZ1B 3ZCVA 5IJAA 4BNHA 2VDWA 2QVZX 3ECAA 2RIRA 4AWBA 4DPMA 4O2AA 4JT2A 2QZJA 1SR8A 2HMYB 3SEQA 2ERYA 3A3OA 3W2TA 4I1SA 2HC9A 1XU9A 1BE8A 4AF7A 3VBEA 2DUJA 4K26A 4KR2A 1MQ8B 3DHYA 4L28A 4DUPA 3H97A 5P21A 1D4FA 4PW0A 3K9CA 4TS9A 1C0PA 2CZGA 4D8WA 4EABA 3EF0A 2GZAA 4Y2SA 4AN1A 1K3TA 2X15A 2GEBA 2QVYX 4HHEA 3TMAA 2Q07A 4ZREA 2F7SA 4B9SA 4R5HA 4JT8A 2WQ6A 5CM2Z 4YCNA 5B2ZA 1JXAA 2QYOA 2OWOA 3MB5A 4ZCLA 2Y0CA 1HKUA 4BGEA 4BHTA 3ZG6A 2CLCX 4QICA 2ZIUB 4JC5A 2G71A 3JQ8B 3TBKA 4O4IA 2O1XA 4CEJB 5THQA 3QVXA 5K4GA 2JANA 1OYVA 1PEAA 1EFVA 4RW0A 2ZE7A 2SICE 1DRVA 1XVUA 4FXPA 4IJUA 2AJQA 3FPFA 2E1RA 1C8BA 2KB0A 4EYHB 5AW2A 3IT3A 3HJRA 4HYKA 4LRSB 2WYVA 5HF9A 3RYIA 2F3NA 1ULAA 1JBKA 2WWVD 4NSNA 1ZWLA 1AUPA 2OV4A 4YRDA 4XWWA 3G6VA 5DM2A 1MB2A 4D45A 4E1BA 3DOOA 1XTQA 4Z4FA 2NZ8A 4FKMA 3WGTA 4RZSA 1Z1BA 1GHTA 4D9MA 5CLIA 3Q0EA 2IS4A 5JNWA 4OHCA 1UIRA 5A6VA 4RAOA 5K0SA 4NJEB 3UMRA 1NF8A 1UT6A 5CPFA 4IIHA 4E88A 5AFSA 2C07A 4EB6B 2BAGA 2GN6A 1P9LA 1R4ZA 521PA 4QYIA 1GGHA 4OXRA 4BO3A 3DTNA 4TUSA 4LNUB 1RYSA 4D96A 3RYHA 2W93A 4RSHA 5F98A 5HMMA 4DPLA 1YONA 1D8TA 3EEIA 4OKIA 4J75A 3NBYC 1BNCA 2YB1A 1RP1A 4BTEA 1UOPA 5IHXA 2VZLA 4LDPA 3L3BA 121PA 4PC1A 1H2ZA 4YT5A 2XI4A 3Q85A 2UVWA 3E82A 1O0SA 4QQKA 2AQ8A 2VVTA 4JQCA 2PXIA 2LM4A 1XKXA 1WHSB 2ABWA 1PUXA 4RA9B 5LP6B 3DDSA 5BVGA 1XQVA 9ICOA 5GGXA 2OV3A 2ZM6B 4QNRA 3JAWA 4HNGA 3SJZA 3NHUA 2NSHA 4GVPA 3OUTA 1OBVA 1ZL2A 4C0JA 1OBOA 3DO5A 2PJUA 3GDWA 5KSZA 1I6LA 4E33A 2YFYA 1M74A 3QFTA 2CBZA 4B7AA 4MDYA 4UUQA 1PYDA 1EEXB 4CF3A 2AXNA 4B4DA 3MD0A 1ZD1A 2V55B 4KQ6A 1E0DA 2RKOA 3FR7A 5J63A 3V7NA 4HX5A 4EA9A 1F2UA 1NXWA 3ESAA 8ICWA 1L9XA 4CMIB 2G5PA 4QTTB 2R1VA 1IQUA 4PO1A 3FCSB 1FMCA 2VWPA 1FFSA 3E3NA 1I4OA 3WGMA 3H8MA 3NANA 1XLTC 1YZYA 1IXRC 1OBFO 1KGDA 4KRGA 5DNWA 3S5UA 3QBEA 1Q7GA 1A2QA 1JJ7A 1U7UA 1RG6A 1CXZA 2DQYA 1KS2A 2QXTA 1QUEA 1FFHA 4R16A 3VVBA 4IM7A 1JAZA 3M8RA 1BWPA 5E6UB 3INGA 5TVGA 3F2IA 2NXNA 4WNYA 4FIDA 2J3KA 4A6PA 1Z75A 4CQMD 3GILA 5JUMA 2EJVA 2FMQA 5EP4A 3ANMA 4S1VA 2K4HA 3HFGA 5DWQA 4QWMA 4HADA 3E5MA 1XQWA 1VLQA 1TAHA 4O3QA 2Q5CA 2PH7A 1NZFA 5HFAA 5L3VA 1NVFA 1ZC4A 4XRRA 4IFTA 4CI9A 4Y8VA 2AMJA 2JFOA 2ZI4A 3NHJA 4IJWA 4INAA 4C4XA 5BQOA 5IEBA 1E1YA 2FMUA 4KX3A 2V5AA 1RFGE 2GK4A 3EVAA 3OLVA 4ES6A 5HW0A 4FHDA 3SIWA 4S1OA 2Z9DA 3JQ7A 5ITSA 2XC9A 4N3AA 3C5GA 4TTQA 3UA4A 4TKVB 1G3UA 4ISBA 3WIDA 4TWAA 5AOBA 1O96A 3SYLA 1Q0ZA 3ZZTA 3OURA 3I76A 5T6MA 4M8LA 4KACA 2VT2A 2DFNA 1KDYA 1PSZA 2A4MA 1L7XA 1YQGA 4YP5A 3Q8LA 2BLNA 1T5BA 4A92A 2R44A 4FC6A 4D9KA 1N4AA 3CPJB 1LK0A 3A1SA 2VQ3A 4TWBA 4N7BA 4W9NC 4JMUA 2JNWA 3LY7A 1KYWA 5ALDA 2Y1KA 4KO2S 1NVWQ 1Q0TA 1VBFA 3PSTA 4P5PA 2FYTA 3R9WA 4Y6GB 5H3HA 1R0ZA 2J6HA 8ICTA 5IKOA 4GXQA 4P93A 2GK3A 3QTTA 1XL1A 4IIXA 3LKDA 4JL6A 3OC0A 4LSMA 2C0CA 2XMGA 4MS4B 1GO2A 1DE0A 3L9WA 5JXGA 1CUYA 1DIAA 5J2DA 2KZZA 3RANA 2FZGA 1JE0A 5ER6A 1DOQA 1TMKA 2VUUA 1DIHA 2J5BA 1M34E 2ALZA 2BI8A 2X42A 4CR6A 1JDJA 2FUKA 4X1YB 3GY0A 3SQXA 3RE1A 5B2EA 1YT3A 4TXJA 4CQJA 2RAPA 2HXSA 2ZYDA 7ICTA 3WFZA 1RKBA 4S35A 4N8DA 1NOJA 3P0IA 4B2IA 5C0YA 1E9CA 4QRDA 2XB6A 2GZSA 3EPPA 1HEIA 4CL3A 3R74A 3BHJA 1P5JA 3M70A 3SBEA 5LOVB 4C6TB 2G5HB 3H9EO 3S4YA 2XB4A 1UIMA 2QRVA 4MYCA 2A57A 3V4LA 2B78A 3WTCA 2ZIWB 4LHWA 1BMFD 3QPDA 5A7GA 1EUQA 1BHSA 1RTKA 3I34X 2LCFA 2L18A 4K9RA 2PSSA 5U1PA 3ILYA 3ZIDA 4KLOA 1PDOA 5ECYA 3HLTA 2I6QA 4PG7A 5TVKA 1FQOA 3BQ2A 3A6DA 3OD1A 4TPKA 1Y34E 1YL5A 2I6UA 1ZRSA 2V65A 1UPTA 4BLOA 3G5UA 5AVTA 2I87A 2J9XB 2AN4A 1EK0A 2PT9A 2RKBA 3ESQA 3K9QO 3ZK9A 1XD8A 1C7EA 4M86A 1X80B 4UXHA 3RV3A 2IA5A 4L8LA 1IUPA 2XODA 3KQPA 5TGTA 2AGQA 3L4BA 3GLUA 1COOA 2ZYIA 2MU1A 2IDJA 4QASA 3NNNA 4MQEB 1GSHA 1JG4A 1YC5A 1Z0SA 3U2QA 4IRDA 3QOXA 2BHRA 3BK2A 4HWRA 3GFKB 4H1WA 3AEQB 2XBLA 4JLAA 2VEOA 3EVBA 4HH4A 3B3FA 1XCGB 2WIAA 3E9DA 2YIMA 3ICVA 1KOJA 1UKVY 1B16A 3GLTA 4B85A 4LMPA 1DKNA 2QN1A 2JVJA 1JVBA 2IZ6A 4OAOA 1AQIA 3TZBA 4O4JF 3WK4A 2SKDA 4N5HX 1ZQJA 4R01A 2G17A 3B38A 3KR2A 1N8KA 4NM1A 1THGA 4UNSA 1DC7A 2BCUA 1SOUA 4KXYA 2B4AA 3A9RA 3HO6A 4LYDA 4BJ6A 2XGOA 3TZEA 4CZ2A 1Z3CA 1Z5NA 1T8PA 2K89A 2IZ1A 3A7EA 1ZQGA 3IFSA 4RZQA 2FMSA 1NVGA 4Z2AA 3L4JA 3WIBA 1H6BA 1J2MA 4Z9YA 1WXXA 4MJXA 5BWOA 3D8SA 2XI9A 4WKBA 3QF4A 1U3VA 1PWHA 1BJRE 2O48X 1TU0A 4YJFB 3V3KA 4FBTA 3EXFB 4DMUB 1WB4A 3EY9A 2GO1A 2O3QA 3L7YA 4YIHA 1B15A 3HEAA 1FS5A 3IQGX 4UC0A 1J1IA 5WRFA 1YKFA 3PR1A 1TGYA 3CEMA 4DYVA 3WL7A 2GLEA 2WR8A 1EP2B 1XTVA 3G5MA 1HF3A 1BW9B 2ZU6A 5BWMA 3V8BA 4US8A 3UAVA 1AKUA 5D01A 2XGMA 5A1JA 5D51S 4RZXA 1VCIA 5CVUA 4B6EA 3F1LA 4AF6A 2GCEA 2AX4A 3O2SB 1XHFA 2RHMA 1D2CA 1ZUWA 5HF5A 1LPNA 1RIIA 1Q19A 1SG0A 3IOYA 3KOOA 5JBIA 1RJDA 3T99A 1DQPA 2PIDA 1ECFA 5JIBA 3GUUA 4BFYA 2MAXA 3W9BA 1BKSB 2BMAA 5IINA 4KWCA 2UUOA 3H3XA 2UZIR 1NJGA 5BN3A 2R6FA 2O3TA 3EVFA 5TE9A 3H1AA 4Q7EA 2DBZA 1YI0A 4DSFA 2CW5A 2KFZA 1XV5A 2RHTA 4CKZA 2SKCA 5AM4A 2AIRA 2I78A 4XYEA 1YOBA 3QRWA 1DK3A 3ZE6A 2C9DA 1VLZA 4ROSA 2PTHA 2CVOA 1Z0KA 4J9RA 5GV7A 4FGKA 4UB4A 4XX0A 1DRWA 1BQ3A 3O21A 3MN1A 4JU8A 5F4BA 4MF2A 4Y9RA 1EHYA 2KM1A 2ZYRA 4KMOA 4U7JA 2GEFA 2MT9A 1WB5A 1N5LA 1ZDMA 1WB6A 3W5HA 1LQ2A 1DMSA 4OM8A 5AKGA 1NVVQ 2EZUA 4MYHA 1QHHB 3CURA 5T7BA 2VDRB 1ZJJA 3W7AA 4Q9AA 4FQ5A 4FSHA 3TAQA 1A9XA 3I0MA 5AR1A 1T2VA 5ENZA 3KYDB 2AV6A 3PLRA 4MO2A 4R3NA 3ROPA 1QGAA 3KPVA 3Q6IA 3CN9A 4RFVA 4P33A 3T8YA 1A5BB 4L3WA 4HXYA 1P4GA 2D2EA 4CUKA 3IQFA 5FUQA 1COKA 2ET6A 3QG1A 2BP7B 3EZFA 2P4EA 3D59A 3FZNA 2HMVA 4ZVRA 1QRRA 1R6XA 1GKIA 1KJJA 1G8HA 3AT1A 2QLLA 5DTIA 3CWCA 4YBZA 5CP2A 2ZI5A 2A0KA 3MJRA 2I9GA 1HURA 3KZIU 5DGDA 1TK9A 1WXWA 1DWQA 3KDAA 4CKXA 1ID1A 1E3SA 3UJHA 4FFPA 3VU1A 1X38A 8ATCA 2VYCA 5CEJA 5EN4A 2IP1A 1EFRD 3PPIA 2HBKA 2EKLA 1QHEA 3AN1A 1W5AA 4CM4A 1JHAA 3F9RA 2XUDA 1ACJA 3Q0IA 6REQB 3OCZA 2RI6A 5DHTA 1UOQA 4WJZA 4B40A 2XXAB 2A5LA 2VF4X 1PQYA 3MTDA 5B3KA 2Q6VA 2H3HA 3ADBA 4N7MA 3SS7X 1D7AA 1MG0A 2O2GA 4RL4A 3WZLA 5KAMA 3BKXA 1NN1A 2XGSA 2QIOA 3K6SA 1E7MA 2OKCA 3S55A 1KWGA 4RTPA 3QUTA 5DLPA 3PZBA 3ZHVA 2JIZD 3IBCA 2ZBUA 4OIMA 2Z98A 3PKJA 1RLTA 4ZCRA 1YIAA 1DAPA 4KE8A 5E8RA 1SUBA 2OR3A 2A5FA 1XRPA 5JNVA 4KGXA 4GLFA 5J8YC 2I29A 4XX1A 3LC2O 2OV8A 1E4VA 4QDOA 4HNAB 1IBLB 2NU9B 3VR4H 3DGFC 4F97A 3GWZA 1EXNA 5LD2C 3W7BA 3I9OA 1CRZA 3AKCA 5DCLA 4QTXA 1QRAA 4YV7A 3U7JA 4GLOA 4MKIA 1UDWA 4MQMA 4Y30A 5FA5A 4A9AA 2ZSAA 3GNSA 1YCFA 1KRXA 2WJGA 5IDWA 2XA2A 3E5RA 2ZROA 3TNLA 3GLIB 3A3NA 2L17A 3RBXA 1OT5A 2HCJB 4MS3B 4MMXB 3V4VB 1HK7A 3V1UA 4U7WA 2XYRA 1ZQPA 4F3KA 2APJA 3KIPA 3K9GA 1NNEA 1JAXA 3RREA 1JU4A 3W2GA 5E9WA 2IDKA 4ZZ2A 3K0CC 3LT5A 2WJIA 3C97A 4WA7A 3IIMA 1JIVA 4M9JA 1EAMA 4ALKA 4GMGA 1NF9A 2ODTX 4BQOA 1QLWA 1LFAA 4Y9TA 2QD4A 3OWHA 1KF0A 4FT2A 2DQSA 3MR3A 4B75A 4PFJA 1U1FA 1U0HC 1IVYA 1T34A 1Z34A 2V7TA 3B20A 2Y4OA 4IXWA 4ZCSA 2FG7C 4LYFA 1OYWA 3SC6A 3FYUC 1YKSA 4KVAA 1JH9A 4QG3A 2GJKA 2OCGA 3B89A 2BY4A 3VAZA 1ORVA 4BNDB 1BGWA 3NVZA 4REQB 5G1PA 5C1OA 4EA7A 1L7EA 4EMTA 3DL4A 4M4SA 1SD1A 4GI1A 3S8YA 1ZK1A 1YRAA 2BTQA 5CHEA 5K09A 3JWHA 1ZR4A 2GWHA 2Q3LA 3HCNA 1SWVA 1YUMA 3N0RA 4B9TA 2WD7B 2R2GA 2Y6VA 1TK5A 1O95A 2E1EA 1RE1A 2YBEA 3GFPA 3BBLA 1D8BA 4JR2A 1ESDA 3RASA 4BJ5A 3RBZA 2NQTA 1XK6A 1P2VA 3QQ5A 2FWPA 2YVLA 3TFOA 3P9NA 2CNDA 1NVVR 2EIHA 3LQYA 4B3RB 2A5GA 3RC7A 3NR2A 2YV3A 2NUBA 4GI3A 4N3NA 4NY1A 1KVQA 3CCCA 3HO8A 4HDSA 4B32A 3JATB 3H9BA 1EI9A 2ON6A 4MUNA 5E3JA 3N7PD 4PQRA 1FXWF 1U2QA 1E8DA 1NN3A 3K1AA 2W8BA 2PG3A 3TMKA 1S8FA 1JR2A 3C70A 4NBWA 5G0TA 1LKYA 9ICWA 1S02A 3PE6A 1C80A 4ZH4A 4BEJA 2V7EA 1NIPA 2HK7A 3FMGA 1LWNA 1XF9A 5J2TA 4UJ5A 3DFMA 4EY4A 3E4DA 1E94E 1WMBA 3VYTB 1C0IA 5KMGA 3P8ZA 1XXHB 3I6IA 1CP2A 1R0LA 1U7WA 1UBNA 2VH5R 3R23A 4C0AC 4O2BB 5AIAA 4NYMQ 1WLYA 3NRBA 2ERXA 3DE4X 2R5NA 4WKPA 4WK4B 3RG8A 2XUIA 1MN6A 2AQHA 3BT7A 1DWPA 4FTWA 2WWWA 3TJMA 1YIOA 3R4CA 4B83A 3FG9A 3PK0A 4Q1CA 4DA9A 1QQ5A 1DQNA 5JAMA 1N5MA 1Z0DA 1X9GA 4J90A 3TLGB 1Z7YA 1NJZA 4EG1A 4MWOA 1ODFA 3A4YA 4M9GA 1U7PA 2R1ZA 1KKXA 1KU0A 2EV9A 3OKPA 1B73A 3NETA 4O0MA 3P2YA 5KC8A 5LZ8A 1K5DA 1M72A 1TYCA 2FMIA 4DLLA 1G1AA 2PBZA 2VK4A 4I5FA 1E2UA 4KITB 4HNRA 2IX9A 2W3SA 3H83A 3FRJA 1KFBB 1UBGA 4YD1A 2RJNA 1P3Y1 1P1KA 4PYQA 1Q7TA 2BEVB 1XJ0A 1NVKA 4PZPA 4OHFA 4UXJA 1T2EA 2IPNA 2JC3A 2C5BA 4LCEA 3DYBA 2I3DA 4IXTA 1ZHFA 4ID9A 4DEZA 1Y8RB 3OQPA 5F2NA 3UOAB 2HMTA 2IFTA 4HEQA 4AY6A 4KLTA 1D09A 1DT5A 3FA2A 2VAMA 2JLVA 5H16A 3FFBA 2PRKA 4BE9A 4GD3Q 3NH9A 1N8SA 5JXHA 1M2FA 4NIMA 3KAPA 1V5WA 2BQUA 1PHRA 2X58A 3ML1A 3OCJA 5CH3A 1FDIA 3VPFA 3O4FA 4O3SA 1RWWA 2QMQA 5F77A 1C29B 1AN9A 3EMVA 3O03A 3MINB 5BSMA 3RSGA 1E8MA 3F53A 4QZHA 1QCZA 5LNK6 4Q48A 3OZDA 5KYXB 2OUKA 2A8YA 1QZXA 2QTLA 1YK1A 3UG6A 5G3YA 1DG1G 3VOBA 1QIFA 1Z13A 1U6KA 4PVDA 4Z0HO 1E60A 2VJQA 3VR5A 1YR3A 1A95A 3SYKA 2JH1A 1JLKA 1Z6TA 5L3SA 2FZ4A 4C6SA 2EXXA 2C2MA 4Z6DA 4C43A 4FPXA 4MRRA 3L84A 5BO5A 4LJ9A 4KLLA 1JXQA 1RXIA 2WIDA 1UBMS 3O0TA 4MA4A 3SXPA 2J7PD 5BVHA 3AVVA 4AN0A 2FWMX 1ZQWA 1H8ED 3SG0A 1RXCA 4AWXA 3TDNA 1KDOA 4DBZA 4UUOA 5M3BA 3NFRA 4GT1A 4XPIB 1JHXA 5CFPA 1PI3A 1U65A 4WBNF 1YS1X 4R71A 5TY0A 4CKEB 2FNAA 4KO4S 3HABA 2XKBA 3Q72A 4HRVA 3R3XA 2O8VA 4R54A 2UKDA 2GFQA 4YMTA 5HJ7A 2BD0A 5JNLA 5B53A 4IIFA 1X8JA 4NF2A 2VWQA 1UPBA 3M1YA 5J0XA 4BB0A 3ZLJA 1AT1A 1R8YA 2C4UA 5LWHA 4MQUA 4KN4A 3QW4B 4KX5A 2DB3A 3FPCA 2CKDA 3ZXUB 3K72B 3GLHE 3G0CA 3DMHA 3B1XA 3Q8PB 1ESNA 3CF4G 2AZXA 4L72A 4S3MA 2O0HA 4IBOA 3AL3A 3TE7A 3GEDA 3A9CA 1DBSA 1PWYE 3G7SA 5I01A 4RPYA 4IUBS 3MJVA 1JTVA 3RLFA 3R5JA 2D2IA 5FI3A 1JFLA 2JJ2A 1O8BA 3WR5A 3NASA 3DAOA 3OCWA 3H84A 3IA7A 3L8MA 4RQ6A 2I62A 3CLSD 3T7JA 3ZZUA 4O25A 3AHDA 5CFRA 2FEWB 5AT1A 5JBQA 3C16C 4ZVNA 2AK3A 3PC8A 2A30A 5JAUA 2RGDA 3VZDA 4C9BA 1Y48E 3JQAA 2H4JA 1I30A 3GX1A 2RC6A 1RCUA 1M1NB 1Z22A 5AMXA 2JIOA 4ZAXA 3IOMA 2F3UA 4ZQGA 4NYMR 1NHWA 1ZW1A 1XHLA 2PH1A 1XL0A 3H5VA 3ABOB 2EIXA 2QB5A 5EXPA 3DS8A 5GM1A 3F78A 4J0HA 1C81A 4B6FA 3KZ1E 4P0PA 1U04A 4TS4A 3G02A 3Q9NA 3SGLA 3E81A 2XCQA 4BB6A 2JGEA 3R8XA 5CB8A 2ZB2A 5C18A 2QUIA 2QLBA 4F2GA 4N12A 1TA9A 2WM2A 1IN5A 3WNDA 1L8OA 3U81A 1O9BA 2B6GA 2QRPA 1KQGA 4MR9A 3V42A 3FLEA 3DAYA 5KWSA 1PD0A 4K5QA 4F93B 2Y0SC 2O05A 2CLMB 3VU9B 5KYNA 4TV9F 4GQAA 3ZCQA 2PPLA 4JV1A 1YUBA 3AB8A 3X2SA 4MIOA 2ZIXB 4EMSA 4D3XA 1OLSA 3AQ4A 4CF4A 4CM1A 1NQVA 5FWDA 1C1YA 2YCBA 2ATXA 3KV1A 4GBJA 5IXJA 3TJZA 5J2EA 4YUAA 2ZIAA 1RW4A 4IEIA 4KE7A 3IEIA 1LA2A 5FPYA 2ZTLA 1NRWA 2YVQA 5TQJA 5FL7A 3K4HA 3ZIAA 1I5OA 1NXVA 1XAJA 1EXVA 1YVRA 3AUTA 1O1YA 3ZDEA 2UUCB 2EKBA 2GHIA 5AKZA 1AQYA 4HCJA 5KFCA 5CBKA 4N82A 3SV4A 2WWIA 5I8ZA 3KUDA 4XD7D 4QZBA 1PK1B 3RBDA 5MN5A 1A4RA 4WY2A 4UHKA 1QR2A 2V4UA 3DC2A 2UYQA 2HCBA 4GE0A 4H2DA 1NYRA 3C8ZA 3COYA 4ZV7A 4KGZA 4CQMB 2XITA 2XNCA 3R09A 3H1GA 5DM0A 3GDXA 2XCUA 5DOVA 3L1HA 5CHGA 3FHTA 3GU3A 1MFPA 3N2ZB 1JEOA 2JAPA 4R0NA 4I50A 2ZYWX 2Q1UA 3SEIA 2HWUA 1FFXA 2KHVA 3ZHXA 3JXEA 4GOXA 3GN1A 4IVPA 2DXIA 4E0BA 2W54A 4HAXA 5EWFA 5JROA 2BKEA 2F76X 3T38A 3LPNA 5M2QA 5EOVA 3GQBA 3BQ1A 4MPRA 1HFKA 1MXFA 4GYKA 2JIMA 1QFXA 3SR0A 3A25A 3U7QB 4DIOA 2PFNA 1QO7A 1EK2A 4OUDB 1F6WA 3E1KA 1C7QA 3ORRA 4N0DA 2XZLA 2YJZA 1G6OA 4H1TA 5H70A 4RVUA 5C7LO 4FIZA 4FHEA 1JHDA 9ICIA 1UFQA 2LYHA 1VG0B 4P6VF 4RE6A 1NX6A 2BMVA 5ESXA 1WWUA 3EDCA 3IQWA 4LQLA 3N7UA 4BVEA 1QUFA 3P7MA 1CS0A 4UD2A 1JI7A 2E37A 2W11A 1OLUB 3KJGA 3TSYA 4YMWA 3G2KA 5ALQA 5K8TA 3ABQB 1GQYA 1HXHA 1PEKE 3SQOA 2ZBEA 2JD0A 1GUFA 3LQ1A 4DFMA 5K5EA 3ACBA 4MFAA 4YPVA 3PPXA 3NIWA 1LI5A 1UQRA 3IEPA 3EZ6A 1QGDA 3A36A 4QC2A 1SXIA 4X24A 2AH5A 1YZFA 2JLBA 2GA8A 1T1JA 1UADA 3AV3A 4U2GA 5H7XA 4FR5A 5A9SB 5DIZA 3MTIA 2OGUA 1ZA1A 1E99A 4HH0A 5TLSA 3HA5A 3NYQA 4G1MB 1NTRA 2X0EA 2W8ZA 3UXPA 2ZUUA 4Q7MB 1Z6AA 2AJCA 3QLEA 3UW3A 1JFTA 1DKQA 1PL7A 2PMZF 1E58A 3ED1A 2RK6A 5EZQA 5DDYA 4R4JA 4PZUA 1WDMA 3LPLA 3LVRE 4M76B 4XB2A 5BT9A 1O87A 1O58A 2A1JA 4D8VA 1DXSA 4Q3KA 3IPCA 4IV5A 2QM3A 4CDMA 2RGEA 4EJSA 1EESA 3HKBB 3SBXA 4FLFA 3TVTA 1X8LA 3D6UA 5CK4A 1U3GA 3BDAA 2GBLC 4M46A 5IBCA 1WG8A 3IEKA 4MPPA 4UNNA 4X1KA 1GGNA 2EERA 4GM1A 3FOWA 5L7TA 4ON9A 3RGWS 3BZBA 1VYVA 2DZDA 4L4YA 3BHNA 1UMBA 2Y99A 1S5LU 4W7HA 1EM8A 3AEUA 3GFRA 5EKDA 1XC9A 1XQ6A 3SCZA 5CEEA 3QA3E 3E0QA 1T3GA 1G8MA 4Q66C 4N5DA 3HGTA 3RRJA 5JBNA 1MW8X 5A04A 2QQ0A 1NX9A 3LLMA 4NL4H 1E92A 1I4WA 3LQQA 5E9JA 1SUAA 2FUNB 2D3WA 5LYJB 1KDZA 1J2RA 1IHUA 5EIWA 2CDBA 4NPCA 2SNIE 4AJKA 2PFKA 3M82A 3TKAA 1NQOA 1XDSA 2AFHE 2L2QA 4Q16A 1A8PA 2QTWB 1H65A 2H5EA 4LG1A 3AUUA 5TQ2A 4BO1A 3K9FC 2XT6A 4ZRNA 3M6AA 1UMDA 5DSXA 4J9SA 2P8SA 1CVLA 2W6QA 1GNVA 2FX3A 4G1UC 4S2UA 1RC1A 3D2AA 4E21A 4O4LB 3UB3A 4QQNA 2OAQ1 4W5OA 2Z3ZA 4FWIB 5AICA 1L4LA 3ZQUA 3KQOA 1JS1X 2VNIA 3A1VA 3S8EA 2VWGA 4OOFA 2AWOA 2H1RA 4KR7A 1D9FA 1N32B 4JYCA 1R50A 3RB6A 5F1YA 4J2TA 1RQNA 1ZD9A 1V5GA 3CW2A 1ZVJA 1TRKA 4H6VA 1X8KA 4GOOD 3Q8MA 2AFIE 3A2MA 2BM0A 1UDCA 1VIDA 4HRAA 2LXNA 2RBEA 4E6EA 3A10A 2M6SA 5C0OE 2BRUC 3WL4A 3FDJA 5KFWA 4Y2JA 1OFUX 2VT7A 1XPRA 4MRNA 3M6FA 4DLWA 4JV5B 3C48A 4TVBA 2FMXA 5LA6B 4E2ZA 2EF1A 3NBAA 1PGQA 1GUYA 6LDHA 4INPA 1LPSA 1FIQA 3M8SA 4INOA 1X1SA 3FFAA 3RI3A 3MW8A 3HUTA 3D6FA 5KG3A 5KWIA 2G1JA 2RRDA 1OBHA 4NQRA 2AJ8A 3LD9A 2KK0A 4KV7A 2A1UA 4OVKA 3IP3A 3H4MA 3NTLA 4BC1A 5JCXA 5LPNA 3CS3A 2TYSB 2X2PA 2NTEA 1KEEB 1U3CA 2JIRA 4ZVVA 2G67A 4OLBA 5GIOE 5FUMA 3TDMA 1XZLA 4B1FA 2JG3A 4EY7A 5DQHA 1QCYA 1WW2A 3NORA 1QVWA 1IM8A 5P8WA 3UY4A 1VXRA 3LTEA 1JJFA 1ZRNA 2FKAA 1P8AA 4C0LA 5LBIA 1HPLA 4NTZA 4OU5A 7ICQA 4JS0A 1M2HA 1L7NA 1VSUA 5JU5A 4CMAA 2G5TA 1UODA 2FGJA 4F5YA 4G0XA 3KWJA 4Z4QA 3NOVA 4QU8A 2O2XA 3U1BA 1W0JA 3BJRA 3BIFA 1G18A 3MCAA 2F67A 2AG5A 1DRKA 1JU3A 1LF0A 3RAEC 3FDZB 1Q1EA 5J0WA 4EKNB 1W5EA 2AOXA 1ADCA 1ISHA 3H8JA 5EWEA 2QRUA 4MGKR 4MQFA 1B93A 1BXRB 1E2QA 2VK2A 4G8CA 1Q1NA 1UEXC 2W03A 3D8RA 4LCBA 2OGTA 1ULZA 4IYJA 1QH8A 4HYQA 1EVLA 1W30A 2QJOA 1GRQA 5C3UA 1HQDA 2GSWA 4UBLA 2BZ1A 3OQIB 1ZVVA 3M3HA 4AYBC 2IYUA 4E5PA 5KFDA 4HQFA 1XPJA 3AF2A 4AJIA 4C6RA 3ED5A 3QVJA 2YZ7A 1HYBA 1N2GA 2BSXA 3N2KA 4YASA 3DQPA 1ZM7A 4AL4A 4XRHA 3MDCA 2XGJA 3AG5A 3CVUA 5FO0A 1U6IA 1JIXA 4PLZA 2Q28A 4QJFB 4RTQA 1QS0A 5DTEA 1DL5A 4COKA 3ZTYA 4IY1A 2XRZA 3E8XA 4I6EA 5K3AA 3RVOA 1L5KA 4HN2A 4KVGA 2Q41A 1JR4A 1H4SA 4U5XA 5IBRA 4M0CA 4M1SA 4DL3A 4TRMA 2VTEA 4J1TC 5TS2A 1VKHA 4A5SA 1P9NA 2VYFA 3QZUA 1ZXLA 4AURA 5F23A 4TRJA 5GQSA 1AQUA 1XDDA 2VHWA 1J2TA 3EMKA 2WLSA 3NT4A 2HFJA 2ZQZA 4DXDA 1Q0UA 2HPZA 1GTSA 4EG5A 2GXSA 4NK4A 1V7QA 3A32A 4IDHA 2C2EA 1B6RA 3HXKA 3C5CA 3VO2A 3RYCA 9MHTA 1WUIS 5FV4A 4QUIA 3EA4A 3AWIA 1RYRA 1Q46A 1IM4A 5F9MA 3ETDA 4D4JA 4LX8A 4A4DA 1L7BA 4AY3A 1XMIA 1ZJ6A 3HUUA 4IC9A 4IJ6A 2YW2A 2VSNA 1RVDA 2EFYA 5LKRA 5BMVB 3JQFA 3MGHA 2OP1A 1JSLA 3UJCA 3CF0A 4UPDA 3KVOA 2WJZB 3VZPA 3WKDA 1B8UA 1P0IA 1PTJC 4GGOA 3FMPB 1HLDA 2OBXA 1U7OA 3T5JA 4ZCTA 4DBLC 3Q5EA 2XNHA 1SULA 1UPXA 3IIKA 2M6LA 3KZXA 1KNXA 2UUAB 4J0QA 1X39A 1Z4MA 1PDVA 4P1ZA 4ERNA 2YXLA 3EW9A 1XYYA 3F47A 4EX6A 2OZKA 5CCXA 4YECA 3R3YA 2CD9A 1MB9A 4IRMA 3B1ZA 1DP4A 5LBTA 2QYSA 3FTEA 2QD3A 1H8HD 3AV0B 1N6RA 3GNQA 1U80A 5K0ZA 4RLFA 1E5TA 2ZWVA 1ZBQA 1Z12A 4FDTA 4LVOA 5FUVA 4YYZA 4LBVA 1Z7BA 2ZGVA 4Q3NA 4RKYA 4HUJA 2Q3FA 3ND8A 2ZUFA 1NLYA 4OLAA 3AERA 4CW7A 3AXSA 1VRWA 2O5RA 4IR1A 3LJKA 1IEXA 4G0WA 3CTPA 2WAXA 3ICCA 5J4VA 1B7GO 2V8BA 1S0MA 3IDQA 3T7IA 4I99A 1SCKA 3UWPA 1DV2A 4ZXFA 2BIFA 4L4SA 3FOZA 5C81A 3DBLA 2NZ2A 1RU3A 1TIKA 3MWEB 3IVGA 2VS1A 3VPDA 3KJIA 3MRVA 4YH1A 1DB3A 4ITRC 3OECA 4OHWA 4YJ3B 4UEQA 5CT4A 2X9GA 4NXZA 3KUUA 3WNBA 2J4DA 4A6EA 2YWCA 2XD4A 2HVIA 2ZG6A 2HSJA 2VH2A 2H16A 2GF9A 4O8ZA 1JA1A 3QXJA 5DKWA 2I6GA 5DP2A 2HA4A 1ZCAA 4YD2A 1TVKA 4KXNA 1XDBA 1TYBE 2O57A 3AP1A 2QJWA 3NQ41 5KFOA 1OYYA 3H3FA 2O8DA 3WRXA 2W9BB 3CF6R 4KMSA 2F2AB 4NEGA 2ISSD 2QLTA 3RTAA 1FJGB 4KL8S 2QUBA 1CUDA 4NE2A 4P54A 3K20A 1RWBA 3V00A 4YUWA 2KOBA 3UG7A 1XO1A 4N5MA 3QVSA 4PQGA 3W2FA 4HFRA 3TACB 4M0DA 5JAHA 2C2WA 4DJJA 4J16C 1K63A 3PGVA 3DZCA 3GELA 3BWMA 4LF9B 1H3NA 1D1PA 3P9XA 2X14A 1TK3A 2D5BA 2KKVA 1BXGA 2YOHA 4DNQA 4QLBA 5EWLB 4EUFA 3HPOA 2GZ1A 3EPJA 4YG2A 3KLPX 5K0EA 4F4DA 4ZYUA 3TPCA 1B8NA 3M6XA 1G6KA 5LP6F 1JHYA 2VK1A 2H7XA 4KG7A 3V48A 3CVVA 3CWZA 1JPJA 2QW1A 1BROA 3T4XA 4Q1FA 5LCXA 4BZQA 2BONA 4QSHA 5FTWA 3WYNA 4L9SA 1YCDA 2NYRA 5C5JA 2JH3A 1MGPA 2H3IA 3OY2A 4WOPA 5FA6A 2Y0EA 3OESA 2GYUA 4NZOA 5J59A 2P4QA 1RLJA 2MA1A 2YNMA 1SXEA 4FGJA 3BD9A 2JFQA 3NRWA 4PYRA 1G8PA 4BVGA 2W6CX 1XAGA 5EXEA 3DE5X 4U0JA 3JSAA 4B33A 4F1KA 4MHOA 1GG5A 1JDBC 4KQGA 3KHRA 4DV4B 2WK1A 4QGAA 5GZ6A 1WF3A 3UJ6A 2FP3A 4PZ0A 5KQGA 3ZXYA 1I3CA 4ESVA 2DPJA 1TCVA 2OESA 2KJ8A 4NOJA 4F0JA 3URMA 2M32A 5CT8A 4PNEA 1ORDA 3CT6A 1AZWA 4PC3A 5HJ5A 2PKWA 4XGKA 4ECRA 1Y5IA 3TD6A 2FR1A 3DLAA 4IQ4A 4UOZA 4OJOA 2PSDA 1S0OA 2NO9A 3QH4A 1T1IA 3WHPA 2W58A 4Z3OA 1V9PA 2PGAA 4CODB 1OFIA 4KIWA 2GJ4A 5JS6A 2CF6A 2CV0A 2Z2ZA 3OZAA 1HUZA 2E4VA 4F8EA 3KB1A 1SURA 4N5NA 1B22A 1BCRA 3IPLA 2OQRA 2QY9A 5A3VA 3GBPA 5F3WB 5FULA 4BNJA 3HXQA 3RR8A 5NLLA 1RYZA 3EIFA 2A0FA 1KTIA 2GD2A 5E1MA 4AMYA 5BWCA 1V8DA 3Q6NA 1JFRA 1HQYE 4G01B 4ALLA 4DIFA 1T0IA 1ZQQA 2D1FA 2QRLA 2HSZA 4D4LA 3OEYA 4LV5B 1SB3C 4ELUA 1E69A 4TURA 5KNBA 1LS1A 4XB6B 3RH4A 3PCRB 4KJXA 2E8MA 3FNFA 1GPDG 1OE0A 2JIPA 1R0KA 1H85A 1YVUA 3KB8A 5HEKA 3JSXA 3H0LB 1Y5NA 3L1KA 4BE7B 4NENB 5J9FA 3FWPA 4N39A 2JGLA 3AF0A 3BB1A 3V6JA 3K92A 4PO8A 4MNTA 3K2BA 1KJ9A 4RKRA 2ZSHA 1T8YA 5EIOA 2WRZA 2DE0X 3QVGA 4E46A 3T1OA 4I8DA 3VSCA 4WFKA 4MW0A 1IZ0A 4H0FA 3UOWA 5CGZA 3YASA 3A3YA 2IDZA 3CZ5A 3FW1A 5TQVA 3R7FA 5JRTA 4JC0A 4FMCB 2LIPA 4GKBA 4IQTA 1LFDB 1QP4A 3TZQA 1X77A 3BK7A 3QOYA 3RRHA 2PH5A 3CR7A 5CXQA 1BE6A 1FJ2A 2GBIA 1E9SA 2K2QB 4L02A 5G1OA 5ALKA 3QZ8A 2AI1A 4UBOA 3L7KA 4A73A 4LYYA 3QJGA 4RY9A 2VSQA 3C1OA 1CLUA 2J0VA 4FR2A 4Y0NA 4RT3A 1ZJ5A 4J4HA 1BCSB 1YQDA 4LJLA 1CJKC 2JF0A 3CLTC 1UZAA 1J06A 1V8BA 1EQ2A 4RXTA 1J23A 3W6OA 5DGIA 4C5BA 4L08A 3HXTA 1YFKA 2EYQA 1Z4KA 3WIEA 1GSIA 1XR3A 5LOVF 4S0ZA 3E05A 4WXEA 1LSOA 3UV6A 3PW7A 4TSKA 2WB1F 1NURA 4HZGA 2MSNA 1OH6A 3DAPA 2ACEA 3ISCA 3N2EA 2CVFA 5K6TA 2C59A 5BSKA 2HAEA 4TV8A 1DTWB 4XIFA 3OJ0A 5IAKA 4IHQA 1I3LA 1A2BA 4FP9A 4PG5A 1KBZA 3HA7A 4HXGA 2WB2A 3G85A 3HWSA 3DPIA 2CDAA 4XIIA 4XUEA 3SZUA 3BJMA 1PL6A 3PUIA 2GUGA 4QOFA 3WJ1A 2CWDA 1N75A 3OWOA 4PN3A 3PW2A 2VNKA 4DCTA 3VHLB 4YHBA 2BF4A 2WWGA 2X2OA 4FS8A 4IVQA 2RJ3A 2H65A 2HLDA 4TKUA 4X90A 1ZMRA 2HIMA 2WPDD 5CYPA 3KAKA 4C30A 4K40A 2B4TO 4D57A 4GLBA 4WESB 1KH2A 2OC9A 1EE2A 3L0BA 3QVVA 3I45A 4E30A 5FX2A 3AP2A 4QQFA 2DC1A 3FBGA 3LXUX 4F8JA 2YHBA 1JEYB 4YCXA 1N2OA 3NWPA 4BU0A 2J0UB 2P79A 2P62A 3NDBB 2ZXEA 3PJDA 4DLUA 4A16A 4DSIA 1FXSA 3H5TA 4OHMA 2RQ5A 4YV1A 1XBTA 2IZ7A 4DSUA 4W8HA 1X6JA 4FXOA 3FI0A 3WFJA 1ZMTA 4QPDA 4KWEA 2O8NA 1K6JA 4M36A 2FLPA 3A2KA 4BKOA 1BKYA 1Z45A 4XQGA 3R6GA 3EIXA 1CUIA 2H1IA 2AI2A 3I23A 1LPAB 5KVQA 2CMHA 1NW6A 2XA1A 3DQQA 3ND6A 1ZK2A 4TUYB 4IGEA 4H1VA 3HDHA 3W4IA 4ER7A 1T2UA 2ODAA 1FNNA 4Y2YA 4DR6B 5AYVA 2I7TA 1MRZA 2QM7A 5LZ2A 2O8EA 1QC5A 1NJ5A 2AVNA 1PIWA 2HBQA 3C39A 4PYJA 1NPYA 1RQRA 3NX4A 1KZHA 3AI7A 2H1VA 3IIEA 3TM4A 4WCFB 3MCZA 1U2GC 4AJNA 3LGAA 1MJGA 3CYMA 1BHO1 3AIKA 2X0IA 2PT7A 4JI3B 5KT6A 2GYVA 3SAJA 4K3VA 4DAEA 2ZTVA 4YMMA 2B69A 4M9XA 1Q0HA 3H5NA 1N5RA 3LPDA 4YXWA 1R2QA 4LE0A 2GPJA 4X3OA 3HY3A 1JU9A 3V5NA 4IHAA 4V2UA 1LI7A 3UUFA 4F1JA 4LZGA 2GCNA 3AL0B 1G9SA 4HJXA 5TDHA 3HYCA 4IS2A 5IC4A 4E5MA 2XF2A 4EHLA 5FWXA 1WNFA 3BPSA 3SS8A 4H7PA 4ZCPA 3U60B 1TQ8A 1DEAA 1M2VA 3BEDA 4DG9A 1Z0FA 3F3YA 2YXDA 3GA5A 4E5SA 4YCCA 1R9MA 3ZBQA 1J5XA 3S2ZA 4TLLB 5EP3A 4DL6A 5JAOA 1N0IA 2LW7A 3FWYA 1YS9A 2H2DA 1JHRA 1T3NA 1I6KA 3PT9A 3GHYA 3PYXA 3UMMA 1EBBA 5SZHB 1ZCBA 2C7PA 3T5HA 4RABA 1CUAA 3NRZA 3V7YA 3O94A 1YR9A 3RKSA 5J29A 3PJEA 2OO5C 1H1LA 3E3MA 2O20A 1G0OA 4HDMB 5A5VA 3DPSA 3NHKA 3FRIA 3NJRA 2VHEA 2P78A 5AK4A 3V7UA 5K0NA 2DGDA 5I48A 1OXUA 1R64A 4DFKA 4XDYA 3GYGA 4D3FA 2IBMA 5GZ3A 2WY2D 2Y1WA 3IH5A 1QP8A 1TZBA 4Q3CA 4ECZA 3DZBA 4FHZA 1GILA 3PTAA 3GGJA 3ZHZA 3KXDA 3CSUA 2GBPA 4DLAA 4EF6A 3LOQA 4HQNA 3GJ7A 1C3LA 3DAHA 1OXKB 3DL0A 2CUKA 1GKUB 1NI4B 1Y6QA 5AK6A 4RZHA 4ZXPA 3EC7A 1VI5A 1QTRA 3PFHA 3FDXA 1CZOA 1XJWA 3GV0A 1ZIXA 1IN7A 4TMTA 3BWVA 4ZVKA 3EF3A 4HAUA 4LY6A 3PXCX 2HHJA 1RR6A 4YUXA 4C4PA 5A2GA 4ZOLA 4EG0A 1V8ZA 2GKSA 4YK7A 3HJUA 5DBGA 4EZBA 4KLGA 4ZTZB 4KNYA 3F5MA 4R65A 4RY0A 1FTNA 2XGGA 1EGAA 1TJNA 1P3JA 2OCEA 3V4FA 1M10A 3U4QB 2OEHA 4FGLA 1L4EA 1EXDA 2WBLC 2XUQA 4P7FA 3S40A 1AVTA 3D4IA 3TRJA 1TB4A 1U47A 1V2HE 1C3OB 1PF7E 4OBWA 3EGVA 1ZWKA 7ICGA 2VF5X 4MF8A 2GAAA 2PQ2A 2OENG 4D9IA 2DUMA 5HP4A 1MJGM 5DVZA 2GBCA 2ZE8A 2J59A 4R84A 5BW6B 4P2BA 2N75A 1C2TA 4QZVA 5JS1A 1DADA 2JFZA 3ORFA 3MS7A 4YN4A 1M76A 4B3DA 5TPZA 3MRSA 2H1WA 4P84A 3HY6A 3AZOA 2J3JA 4ZVPA 3U09A 1VPVA 3IQXA 3HJAA 2O2EA 5CA1A 1GSOA 4TTTS 3E3OA 2QTCA 4JNKA 2RP5A 1Z7WA 1Z4OA 3FXAA 3HK2A 2FPSA 4ARBA 3KU4A 5HG0A 1NJ1A 3GPDG 3QKRA 3NS1A 5JWOA 3WLMA 4QWCA 2PLWA 1ZNQO 1SL1A 4PGQA 4GXRA 5DTJA 2UVRA 4NCXA 2ASDA 2JGMA 1AKQA 5C5CA 1KOFA 2YOFA 1FS4A 3SQWA 4KLCA 3IMFA 4RIHA 4GKVA 1D6SA 2YRFA 2I03A 4ZCQA 4DDHA 3I2HA 2FUEA 4DE5A 1KZ7B 4B3CA 3CJQA 1XRSB 1I2ZA 4B2LA 3DB1A 2C2DA 4V0LA 1IFXA 2ZSJA 4YMGA 4ONEA 1FY2A 3H1EA 3KKPA 4OQZA 2NV0A 3CH5A 1PK9A 1EP1B 4YR9A 2NADA 1SQFA 3F6BX 2C2XA 2QWXA 2OKGA 2JHDA 5DGXA 4C2BA 3SF0A 3DV9A 4NZNA 2XMBA 4QBGB 4P3PA 3I6BA 3R6DA 4RGBA 1GCOA 1O5OA 3N4MB 4A6XA 2KVCA 1MV8A 2BE9A 2QTVA 4B71A 4RUKA 1S8NA 3W78A 3FKSD 2J6BA 3HEBA 1T9BA 3CR3C 2WU3A 2F62A 2DPLA 1F8UA 2HJGA 4XIGS 5IIIA 3RFTA 1A97A 2JR5A 4BO0A 2GEKA 1TX4B 4AY4A 2FRVA 2PLRA 1M34A 2JKVA 4PWZA 2MTBA 2C8LA 5BOVA 4UAZA 2Z2IA 1AF4A 2HA3A 3EG9B 4AJPA 1X1BA 5E3IA 4YWHA 2JMGA 4ER0A 2JAOA 5BYBA 4R63A 1ORWA 3CEJA 1G21B 3B3AA 1MV5A 4DC1A 3M9XA 5J4YA 2W2PA 3OTWA 3RIYA 5KREA 1FP6A 3KXKA 5FBWB 3VKHA 4AZ3B 4HMPA 2WHRA 1DKLA 5FPTA 3B53X 4DWVA 1KN5A 3D4PA 4H3HB 4LDZA 4F56A 3DDWA 5AKHA 2CXQA 4TRNA 2CNNA 1YMQA 4XTRA 2ECKA 2WI8A 2MMGA 1NW9B 1LEHA 4MVXA 4POOA 3EGXA 4F4IA 3JQ6A 1T7PA 2P6PA 4YTEA 2HHSA 3UATA 5SZKB 4BJ3A 4B8ZA 4XDHA 4RGYA 4RACA 1EFTA 2FXIA 3X1KA 4N4AA 3R3WA 5A5FA 1U28A 1E6WA 3U7RA 4YRBA 3RT9A 1VPDA 5HQ3A 2JAUA 2P5TB 4LW8A 4UE3S 3BIWA 3OHBA 3DMTA 2Z30A 2ZJZA 2W9CA 3T5AA 1IJKA 1SUCA 1H1DA 3U4AA 3V80A 1GL6A 3KQVA 5A4FS 3GJRA 1JKIA 2GX6A 4QLOA 4XCXA 1GV0A 3BXOA 3DTVA 2CV2A 4B74A 5AXAA 1G5QA 2IOHA 4PAQA 4O2BF 1JMYA 1SELA 1CUWA 3T54A 5HOEA 3M81A 5FJIA 3AEVA 5I45A 4OFXA 5D8DA 3B1FA 3ZBTA 3JYOA 3E9CA 5K6RA 4IZHA 3GEBA 1ZC3A 1KVUA 2CK3A 2PUGA 4TKMA 3V1MA 2X0KA 3ZU2A 1M67A 2BMJA 4ZN6A 3AQIA 5JYDA 4LJSA 4BLTA 1OFUA 2YFQA 2HXGA 5ALNA 4G3XA 4ACBA 3KTFA 2OMEA 2IIBA 3GRKA 1E96A 1SXQA 4XGQA 3CO5A 2SECE 3GRCA 3KT0A 2W3RA 3O4GA 2OORC 4F2PA 1YOVB 3UANA 4XQ0A 3USZA 1NZBA 2UZAA 5KSOA 3D6JA 2E18A 3PFBA 1T8RA 4UM5A 2E4ZA 1QO9A 3X1WA 2PY6A 2WZQA 3FYDA 2C96A 3KWFA 2XEDA 4GZ3A 2G9VA 4B46A 2KIWA 9ICHA 3UOGA 5IWAB 1URJA 4I14A 3NH6A 4GVXA 1W75A 4FZVA 4FNMA 3KE8A 1G20A 2CLEB 3PQDA 2W6JA 3L8HA 4KI0A 1QHXA 4A6DA 2C5SA 4QBTA 4XYLA 4L50A 4G89A 2JXJA 4UBIA 2Q1TA 2HWWA 1YJQA 1W19A 3RU3A 1TZMA 4IKEA 3EXEA 1LRKA 1RM4A 4DQIA 2BISA 1YMUA 2JHPA 2IYYA 2RHGB 4EFLA 4DV1B 4FGWA 1KQNA 3DFZA 2C8VA 4CBVA 1K6IA 2P0EA 3HB0A 4CTJA 4DUGD 2R6JA 3TF5A 5A0FA 1LSJA 5LQAA 4ZVTA 1J09A 2O5EA 1HNXB 3PR5B 3I32A 5LLTA 1TYDE 4HL6A 2QN2A 2CDCA 4AKSA 3M34A 3OTOB 9ICEA 4I2FA 3OX1A 3T9CA 3MC1A 1DX4A 3CLRD 1USWA 3S70A 1M6VA 1FRFS 3V4ZA 4X85A 2EZ9A 4E2YA 3SK0A 2PO5A 5KTRA 3DDOA 3KNZA 1U1EA 1J0EA 4ZTUB 2BEUB 2VG8A 3IS3A 2NZVG 1JJIA 4GXKA 5KYGA 1BEEA 3BXZA 2BFDB 1P8JA 5KAPA 3V4SA 4OI4A 1GP2A 1H6DA 3PGXA 1ZITA 4XCQA 4TSRA 4MRMA 4DQPA 1U1CA 3HDJA 1X0VA 4RU1A 4KQXA 5BOLA 2YQ4A 4YMSA 3DEYX 4FT4A 5K45A 3UB2A 3HLYA 4GW3A 2B8JA 1DWOA 1SV0A 2LTAA 5BYJA 1PGPA 3HJCA 2MHCA 4MWGA 1KDTA 4DTIA 2FPIB 4RGVA 2ZSUA 2AN1A 4O3MA 1WCLA 3KSBC 1CQPA 5EL0A 4EGJA 2XWQA 4DQQA 4XIYA 4AJOA 1XMSA 2XOKD 3GLFB 4DCCA 4D0RA 2FK8A 4MI3A 2Z5VA 4QYMA 3B3GA 2V5UA 5E4TA 5TMBA 2Q1XA 4O3OA 5KNCA 4R1OA 1WO8A 2WPNA 2G76A 5BPHA 4MWCA 1FYWA 3MGVA 1JN0A 3GLIE 4QNLA 1NUAA 2G1UA 5K01A 3GEGA 2EHJA 4M8IA 3SMQA 5JO0A 1DNPA 4DSJA 5EHQA 2I1WA 1Y3BE 1TO1E 1QO0A 3OAAA 2HHXA 4JOCA 1US8A 1NU8A 3NZEA 4H08A 1JUDA 3NGDA 4AP5A 2C83A 4Q1DA 5I9MA 1ZQAA 3U16A 2UXDB 4EYSA 1J90A 1PR1A 2AQKA 5JMOA 4JVNA 4F04A 3WAGA 2H0AA 1E0AA 5CX4A 3H4TA 4NH4A 4PHCA 1YR2A 2HA5A 4II7A 5AOAA 2JFYA 2CJYA 2JJQA 4ZU1X 2J33A 4Q4AA 3N8NA 1YR1A 4PL2A 1AD2A 4JEIA 2NO4A 3O8CA 1HEYA 3GG2A 4HDRA 1U8YA 3IKTA 1KA9H 2X3UA 4BFUA 1ISIA 4LFCB 1F0PA 4YT8A 4KLQA 2PZ8A 1ZP6A 4OP2A 3N87A 4C7OA 1GPH1 2Z6UA 2PT6A 1VPEA 1MA3A 4A8JA 4AULA 5BW8A 2GZ3A 3T3DA 3MTEA 2Z8XA 1M1YB 2XUHA 2Q8PA 4R1MA 1PJ4A 1QH1A 3PVCA 1U5BB 5LNK1 4WFJA 1KI6A 2VH1A 5GADl 1SB8A 2E8OA 1H0RA 4H1UA 5KG4A 2ZWOA 3MTQA 4QD3A 1JQ5A 1KHHA 1T2FA 5FFNA 4XCVA 1I4LD 1VFPA 3OMXA 1U2TA 1USIA 1D4ZA 4NCNA 1P0QA 5CA0B 3N2GB 5FRDA 3EXHA 1R88A 1IIRA 1XTBA 1RYNA 3ESCA 1TRHA 5E6RB 5ITVA 3RHFA 3GARA 1GN9A 4JP3A 3U80A 3EAGA 1A76A 4TYQA 5A0VA 1E7WA 1Q44A 2CLDX 1TMOA 1JTFA 4OV6B 3PC8C 1SCQA 2M2IA 3KSMA 1FW8A 2XX3A 2H7VA 1YH3A 1ZGGA 5ITZA 2OZVA 2RHBA 1PVRA 3ISVA 3GFSA 5HDBB 1RXUA 2WYHA 2F55A 1OZ0A 1SXHA 2QV7A 3D2SA 1K89A 1E1QD 1XCPA 8ICKA 4Q1VA 4QQRA 4JUIA 1ZJZA 1XXHE 1QCKA 1WM1A 2O07A 1IHXA 1EJ0A 1P39A 2HRZA 1ZQRA 1F14A 3QKWA 3JWIA 3WVNA 1MQAA 3F9IA 2O1SA 1F0NA 3DMRA 1YL7A 3GXBA 3UENA 4RQ1A 1P1BA 1GL7A 4YUVA 3RS7A 2AGPA 1X8XA 3EXG2 3R5FA 4OJ6A 4H6PA 2QV0A 2RHJA 2EEPA 1NJ8A 4P4SA 1K9SA 1YZUA 3F5AA 1BPDA 4PXAA 1QYWA 1UJNA 1I6WA 5KG6A 2FMFA 4WXRA 5BWLA 2QT1A 5HBGA 1F3LA 3AHGA 4R68A 2CHFA 1UA0A 1A4UA 4O4JA 3MT7A 2ZJ7A 3HQ4O 3ZZ0A 3TFRA 1P0FA 3KS9A 1W35A 3SI7A 4RENA 4QT0A 5B37A 5I3CA 3HCEA 3D6HA 4LEIA 5KJ1A 5UKDA 3Q87B 4GM0A 1G2PA 1A88A 3C3AA 4C29A 4AVYA 1ZU4A 3LUBA 5AUNB 1DUVG 1ANKA 4QXQA 1CRWG 2OYYA 3N1UA 1QQ7A 4LDQA 4HQKA 4UB2A 1GVHA 4N9QA 3FLAA 4O1HA 2FFJA 2V4MA 1U3DA 2YJ6A 5IM4F 2VR1A 2A9OA 3H75A 3RF6A 4I7EA 5TF0A 4BP9A 5CM8B 2QMEA 2YXBA 1LU9A 4DMCA 4DG5A 1IWPB 4XFJA 4DA8A 5EPEA 2GYYA 4N3BA 3OFNA 1TT5A 2H2WA 1G7CA 2PWPA 1RXVA 1UUFA 3L77A 2YMQA 1HETA 1SVSA 3WISA 3RIGA 1YQTA 3DPUA 2PYDA 2UXBB 4R5MA 5B6JA 4Q18A 3VZRA 2PJDA 3C1UA 4S04A 4REOA 1NY6A 2CCGA 5T3YA 1YRWA 1WEHA 1KI1A 3IQEA 5IDVA 3TZHA 4GX2A 1J8MF 2FE4A 4I46A 2FDCA 3LUHA 4GI5A 3V8VA 2ZS9A 1OJLA 2UYHA 3OZBA 4UBCA 4JJEA 1MAAA 1ZM2A 1W2GA 5K3FA 2JASA 4G1FA 2P9YA 4RD4A 4WV3A 4YI5A 4EJ0A 1PS9A 2CLIB 1QTNA 1C8LA 3H2SA 3WLNA 4RA6A 1UDBA 2ONYA 1KKLA 2FPGB 1BRMA 1M5RA 3MWGA 4MWSA 4DLKA 1JXOA 2X9LA 3UFBA 4X84A 2M0NA 2CJWB 5T3UA 5ADUS 2P69A 3JQBC 5E7IA 2HT6A 3BVPA 1C1HA 3PHHA 3EMBA 1W94A 1FVHA 2ASJA 3IQDB 1LS6A 2NO0A 2H5XA 1KQFA 2FP4A 2W9AA 4YUYA 3K4GA 4IDBA 4Z4EA 2NO6A 1U81A 2EYUA 1YQQA 1OF1A 4WXMA 3UAYA 2RDIA 4UASA 3MIZA 3X1DA 5F1OA 1P74A 3I05A 3D6VA 1M0EA 3D5EA 3KALA 4AD8A 4BXOB 1UQUA 3ETGA 4JIMA 5K1ZA 4DA0A 5J4HA 4RJ2A 1V43A 1YTLA 3M6LA 2NUTA 2HWKA 5EZ5A 3LP5A 3TCKA 3OGUA 4I2AA 1G19A 3QVUA 4NAUA 2BM1A 3K0KA 4UPVA 2EAOA 1T43A 3GIJA 5ANRB 5ERXA 2Z4TA 1OFHA 3LWLA 3OT5A 4JWKA 2PV0A 2C3MA 3HP6A 2EBWA 1YB2A 1OAKA 1KARA 4KTTE 2FDXA 4LVNA 3JASB 2WUGA 3K0BA 1ADYA 4MUGA 2JGNA 3LVWA 3V7KA 1HQKA 3L8EA 2HU2A 1GZSA 2HRRA 3OBBA 4EIWA 5LYJF 2ZUBA 4TTIA 3UJ8A 2B2XA 3IHQB 1E1RD 5A71A 4M1ZA 3VSAA 4EJSC 1Y6RA 3QHQA 1E4EB 2A3RA 3GQVA 1RMYA 4KUHA 2P6RA 2ZE6A 1UPAA 5IC5A 1YS7A 1V8FA 3LYSA 1TIPA 4F8RA 1EMDA 2CXNA 4WE3A 3JAKA 3BMQB 3MJEA 1ZUHA 3ZKAA 1A5SB 4O4LF 5KX5B 1E2LA 2I7XA 2NGRA 1Q74A 1SJ9A 2O7NA 1J0BA 1F4PA 3TUIC 2EQAA 1HE4A 1T25A 5JFOA 2I9KA 4NY8A 4K9DA 2FPRA 4UMDA 3M6WA 1HGXA 2O0LA 2ONKA 2P0YA 4RQ5A 3KAJA 1TYEB 2YN0A 1ZGHA 2GERA 3GT0A 3EXIB 1BDBA 4PO9A 2HREA 4JVOA 3EA5A 4GP6A 3ADKA 3LVFO 2VXYA 2IBKA 5FWYB 4HTAA 1ZW6A 1VL8A 3GP8A 4TT3A 1VDZA 2B7CA 2VN8A 4OSEA 2BBSA 4LFBB 4KQFA 5KFEA 4LBZA 1NK8A 4TN5A 2B4RO 2Q0SA 1U8FO 2GR9A 2ZIVA 1ES9A 4PX9A 1TAQA 5HTKA 1Q0PA 2ASVA 4QBKA 2HT1A 4HQ0A 3N0WA 4OQMA 4QL3A 1R9NA 5ILGA 1N1EA 3VO8A 4ZIRB 4BRZA 1UXIA 5FFFA 4F92B 4HFNA 5TQ0B 4XWOA 2PE5A 3ZS9A 1RLIA 4D8YA 4N0EA 2OXRA 1QV6A 1RPNA 3FUWA 2ZJ0A 5LZ9A 4UKDA 3GLHA 3DOUA 1S4QA 3G5AA 5JADA 2XWPA 3LSTA 1AHNA 1I32A 3PA6A 1PUJA 4QXPA 4C0QC 1A5ZA 3W9SA 3E9RA 1RYFA 4YGXB 5L8VA 5FJJA 1XZFA 1XFAA 3JPWA 3RROA 3N2IA 1H42A 1FO4A 8ICGA 2W2LD 2F3RA 2C03A 3KD3A 1EVYA 3WFIA 5A4KA 1CY2A 4CKWB 1YF3A 3OU2A 3KKZA 3MUOA 3KR0A 1E79A 5CD9A 2I9PA 3ETNA 3GVHA 2IS6A 1WJGA 4E07A 3ALRA 4LF6B 3JQ9A 2CUNA 2H3FA 4U02A 4I2IA 3KZKA 5D46A 4MAMA 3CUSA 1V25A 3JTMA 5IANA 1PSDA 3ZW9A 2BFBB 2XNDA 2IIVA 5K9ZA 4DF4A 1E6UA 4OQXA 3OX2A 3SSMA 3ASZA 3DSRA 4HAVA 2CE7A 1K97A 4V39A 2GD0A 4KXWA 2Z2JA 4TLBA 1L6NA 4PZCA 1YQUA 4ZPJA 4JLPA 4JFRA 5CVJA 3U62A 4OGWA 3QXXA 2FOXA 1TM5E 4OSPA 1KZGB 1V1RA 2XMCA 1BVRA 3CKYA 4X5OA 4CIYA 3VTFA 3F49S 4XW2A 4ADSG 4JJIA 3KHTA 4AMBA 4F21A 4CFYA 4JGIA 3G7UA 1AO3A 1G5TA 4OO1J 2QI9C 5SYAA 4PZLA 1RIFA 1EVZA 2QIPA 4OYRA 5TX7A 5BXYA 2CHUA 3AUYA 2UDPA 3UK0A 4E5UA 1N0WA 4OK6A 3BWEA 2Q6TA 4J0KA 1XT6A 5LQMA 3AEKA 3ZZ1A 2C2BA 3QHPA 1FXWA 2R6ZA 4Z1MD 1D0SA 2X0FA 5F9NA 5B3LA 3T0GA 2KPOA 1OV4A 5KSWB 5ICEA 1GDHA 3WLAA 4KE9A 1QFYA 3TZCA 3ANYB 1VKJA 4PEVA 2QD2A 4BKPA 2FPMA 3NHSA 1QNLA 3ND7A 2YR0A 1BYUA 1EH5A 2JAXA 4ZU6X 4EQ6B 1K0UA 4US2R 2X40A 1E0KA 1BD4A 4YRGA 4HPXB 4O4HB 3VC1A 4IYRA 1GAXA 2H9YA 2VNSA 3K0HA 1EG7A 3NIGB 5I7AA 1V97A 4GMHA 2LKDA 1RI4A 4Z53A 2Z4SA 4LXIA 2EC5A 2Y1XA 4N7RA 1XFDA 1Z4JA 5I9LA 3GJYA 3L18A 2BFPA 2XOXA 1Z5WA 1F2TA 2JFXA 3M6IA 3T3GA 5MHTA 3PUKA 4WMLA 3WV5A 3BMCB 2XKAA 5FO1A 4IDCA 1K8QA 2GPTA 4LZLA 2ZRQA 1UKYA 4C89A 1IPHA 4KN9S 4MV9A 4N3CA 5TZVA 2BTOA 2HK6A 2DEUA 2BPOA 5FUBA 4C0ZA 1NV8A 4DMRA 3LQ2A 4RY2A 4BKUA 4PAOA 1ZJNA 2UV8A 1XMPA 2XICA 3FCEA 2X4GA 3T9EA 4I27A 2E4AA 3U5TA 2IKSA 1W4BA 4MI6A 1T24A 5GJWC 4MJLA 1S2IA 3DM5A 5DBBA 1ODSA 3REQA 2W37A 5HILA 4DWIA 2W6ZA 5HS4A 2J31A 1G8YA 3VH2A 5FFMA 4ND8A 3H1FA 4H7IA 3KXLA 3PX4A 4AYXA 2DF4B 3U3MA 1NKEA 2RCYA 3G2NA 3EQZA 3AVYA 1Q57A 1DINA 2H06A 3PUZA 2BFFB 2QNRA 1E3JA 1BFUA 3D8BA 4J2HA 5KNBH 2ADOA 3V2GA 2H2HA 4BZPA 4QOSA 5U4XA 4BRWA 2Q9BA 1GTZA 4QBFA 3W90A 5J0YA 1ZCZA 1NKTA 1ZQCA 3ZWYA 4X1OA 4TWIA 5LZ7A 4BIMA 4ARCA 4UMVA 1H2HA 1BE0A 1GQRA 3U4CA 4PTYA 4PPXA 1CQWA 4H18A 1UR5A 4RXMA 3VDXA 3WB0A 2W2KB 1RZ3A 4K81B 3QU7A 2DTDA 2BHNA 5D3KA 1Y81A 1RZTA 1NK5A 1YVEI 2QM8A 3ZYCA 5JHHB 1VE9A 2TMDA 3B5JA 1KKUA 1L4GA 3FYTA 4US9A 2VYVA 1HWYA 5CBPB 4J94A 1ZH8A 3DHWC 4UBNA 1V71A 4U3JA 2YJ5A 5JSZB 1HUOA 1RQGA 1KJWA 3OOWA 4X1IA 4YJ3F 1RWKA 3DWFA 4BNNA 3B6MA 4RTNA 1E7QA 3HYSA 3JRXA 1KIMA 4BB9A 3B1YA 1QLNA 3RUHA 2XZTA 2WJ6A 5L7YA 1IUNA 3LIIA 3C3BA 5CHYA 3OCCA 2KP7A 2DWPA 1GPNA 1KAGA 3ITEA 1RI2A 3PP8A 3LHFA 4QJIA 3O82A 1OKKA 2EP7A 2UYOA 4U1RA 3ZDBA 3X43A 3MBYA 4UU1A 4DOAA 1V8PA 3ENKA 3EOZA 3TQIA 2EGUA 1E2IA 4D4IA 4ED7A 3QIAA 4M0MA 1D0IA 2MUTB 1AXGA 4CIDA 3U9TA 5HE9A 4HGNA 1TU4A 4WBNA 3RU7A 3ESYA 2ENWA 4JYBA 3DLHA 1K27A 4EO7A 3FM9A 2HOFA 3MOGA 3HSKA 3FUCA 4BO6A 1QPBA 4M7PA 3ZH2A 2NVUA 3SX2A 2QG4A 1OZHA 1GU0A 5HKBA 2PSEA 4QDKA 5EYPB 3PSPA 4D4HA 1R0BA 1A7JA 1VJGA 4Q1EA 4U4AA 5IIJA 3UA3A 3IXQA 1ZMXA 1KZYC 4P7BA 4LBWA 4YAKA 4JELA 4RFSB 1YZKA 1LW6E 1EFPB 2EU8A 3U4DA 1QCCA 4RLSA 3TEFA 1P73A 2EL7A 4Q9JA 5F5LA 4P9NA 4QTZA 3HJNA 1TJYA 4YCBA 1WWKA 5DO9A 3MGBA 4GYJA 3LOUA 3LKBA 4E32A 2ZATA 5EWMA 2QJFA 5CB6A 3EWSA 1NU6A 1OCEA 3RFAA 2YB4A 4BWJA 1JYFA 2TSYB 3VYSB 3WRXC 1W9MA 1OIVA 1VMAA 2H52A 4MSUA 4HTFB 4CN9A 3G2OA 1ZK0A 2R85A 2EZ4A 1IY1A 2VCYA 4N03A 4DCPA 3B1WA 1Z39A 3GP5A 1D2AA 1XDWA 1SGGA 2AFHA 4CQLB 4TM8A 3AHFA 1FVXA 1L4KA 3RYFA 3IJ5A 3WWOA 5IRCD 2DUYA 1ZO8A 2V7UA 1UBOS 3K32A 4RDHA 1G16A 3GZTB 4Z7OB 1U90A 5HR5A 2JIQA 2J46A 1HBJA 1QKIA 1A9YA 5IM5A 3B52X 3O9ZA 2VHTA 3RRYA 3C8MA 3P9SA 3W3AA 4FYMA 4ZOAA 3D7MA 3OPYA 1W46A 2PIAA 3JD0A 3ZJ5A 3UK7A 3KCNA 4EHFA 3FWZA 8ICPA 1XX6A 5H82A 2AEJA 5TGZA 4JD5A 2QU7A 4GMKA 1SVIA 1YB4A 2Y0DA 3EIEA 2ZR8A 1G17A 1QX3A 3W2HA 4UNRA 2AFIA 2IF2A 5JS2A 2IYRA 3DKVA 3LE8A 4NYIQ 4W8OA 4ZMRA 2XW6A 3H5LA 1QOQB 2EP5A 1VKNA 1Q17A 2TECE 4PAGA 1PO7A 4LI3X 1X42A 2B99A 2Q3CA 5A7HA 1PZXA 3R0QA 1OVMA 4PPQA 4BNGA 4ZMSA 4FHCA 3PO4A 3KQLA 1G3MA 4TV9A 4BMNA 1X2IA 3ZY3A 3DVAA 4L57A 4K6OA 4C7BA 3UWSA 4JJ8A 5JNRA 5G4KA 3FCUB 3O31A 4CEIB 1VHQA 1JVSA 4LJYA 2HCFA 1PKXA 3GJ6A 1LQUA 3QI7A 1NBMA 4ZO9A 4PX5A 1HFEL 1Q1BA 5KTQA 4HVCA 2I4NA 5B58C 1NK4A 4IGFA 2BDTA 1VGQA 2EW2A 5AK3A 3DJYA 1N92A 3HP4A 4WIAA 1GCAA 3N0TA 4RMNA 3EHEA 2JJ1D 4D9FA 2V6BA 3L1UA 4PYLA 2OYRA 1G55A 3TI0A 1W4AA 2XPCA 3BQ0A 1GR0A 1SZCA 4MTLA 4ED2A 1W44A 3BKWA 3DZFA 3W6ZA 4B7UA 4WLVA 1P45A 1BRTA 3L7AA 1T8EA 1STOA 1Z8NA 4DR3B 3N8HA 1HL7A 3H0KA 4YHHB 2UVPB 3PW0A 5B1EA 1CUJA 4LYEA 4YCLA 4UDOA 5KWJA 4WJ3B 2OPBA 1UZMA 5BPCA 1CQIA 2COKA 2ECQA 5AI6A 4X93A 4HX2A 1T15A 3N2NA 3RVKA 3TL2A 3VFDA 5JPCA 3I09A 1J0XO 4KR3A 1ODTC 1QORA 1LKZA 3N5CA 2OBNA 3QBJA 3FPKA 3DHVA 1NXTA 2GRUA 4FMCF 1X40A 4FJ0A 2CNWD 1VHTA 4QODA 2V3CC 3L4BC 4DR5B 4ZOBA 4AAYA 1VG9B 1POXA 3MA0A 3C6ZA 2NVWA 3RH6A 3B6KA 1SIWA 4LKRA 2OPHA 4ALJA 2ZUVA 4Y6OA 2Q5FA 1BPXA 2JLRA 3S28A 3TQQA 3HVRA 3PMNA 2B25A 3OG9A 5DWVA 4CUJA 4AM8A 2C1ZA 1XTPA 3NHYA 3WWDA 2Q5JA 3NTQA 4G1BA 3L41A 1X13A 3ECSA 1ZVKA 4M04A 5F2OA 4ZI5A