2W11A

Structure of the l-2-haloacid dehalogenase from sulfolobus tokodaii
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
206
structure length
206
Chain Sequence
b'PRGSHMIILAFDIFGTVLDTSTVIQEFRNKQLEYTWLLTIMGKYVEFEEITKITLRYILKVRGEESKFDEELNKWKNLKAYEDTKYLKEISEIAEVYALSNGSINEVKQHLERNGLLRYFKGIFSAESVKEYKPSPKVYKYFLDSIGAKEAFLVSSNAFDVIGAKNAGMRSIFVNRKNTIVDPIGGKPDVIVNDFKELYEWILRYK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 2-HALOALKANOIC ACID DEHALOGENASE
publication title Biochemical and Structural Studies of a L-Haloacid Dehalogenase from the Thermophilic Archaeon Sulfolobus Tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
total genus 87
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2w11A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2w11A01
5AM3A 4MUMA 3I6BA 2FUCA 3U26A 3SF0A 2R8XA 4XQ0A 2AUTA 4Y2RA 1CR6A 2G0AA 1ZJJA 4F72A 4NWIA 2JGAA 1Z4LA 3L8FA 5AVTA 1L8OA 1O08A 2YN4A 3ZWDA 5ALJA 3KDPA 3SHQA 2YMLA 4FE3A 1Z4OA 2C8LA 3N07A 5AW8A 2IYEA 2BDEA 4BBJA 4MWOA 4L6AA 4JDPA 2OA0A 2C88A 4EX7A 3EF0A 4UM7A 1Q92A 3N5KA 4Y2SA 1RMYA 2FUEA 2BY4A 3N1UA 2WM8A 3ZU6A 2NO4A 2I33A 3ET5A 3I28A 5ALTA 2EAUA 2WHEA 1VJRA 3OCXA 2HF7A 3D6JA 3DV9A 1LVHA 3QUTA 4GIBA 4NV0A 1ZD2P 2G07A 3N28A 5ALFA 1RQNA 4B6JA 3WGUA 1RPZA 5ALEA 5AKYA 3AR5A 3R9KA 5AVUA 3B9RA 1O03A 2C8KA 5AKIA 3AR3A 2CFSA 2MU2A 2P69A 4Y2VA 4YGYA 2B1RA 3QGMA 3ZW7A 4KX3A 4J2TA 3OCZA 2RBKA 1QYIA 4KNVA 3F9RA 2HEGA 4QQFA 3EPRA 4Y2UA 5ALYA 1N9KA 1QQ5A 2R8YA 3KZXA 2HCFA 5ALKA 2ODAA 4C4TA 4ZEXA 5AKLA 3ZTYA 1S2OA 1L7MA 4J03A 4KN8A 4G9BA 2WF9A 3ZVNA 3GYGA 1ZD4A 5AESA 3ZX5A 3NAMA 4Y2XA 5ALVA 1Z88A 5A3SA 5AVRA 3ZVLA 4Y3UA 5AW5A 1XVIA 1NNLA 4UW9A 2P11A 3R4CA 1ZD5A 1RLOA 1JUDA 4DW8A 4DCCA 5ALNA 1Z5GA 2HO4A 3W5CA 4ZEVA 1ZD3A 1TE2A 3A1EA 3L0YA 5ALDA 2P9JA 2I6XA 2NYVA 1U7OA 3WKAA 3QX7A 3MMZA 3SMVA 3EF1A 2DQSA 5JJBA 3OTQA 2G09A 1U02A 2I34A 2YJ4A 2ZBGA 2FPXA 3AR6A 4G63A 5FP0A 2AGVA 3AR2A 4UU0A 2OYCA 4Y2YA 3WK6A 3I1YA 1KYTA 3WK7A 2ZBEA 3B9BA 5AKGA 4Y2TA 5AW7A 1J97A 1F5SA 3U13A 3NUQA 4NAVA 2HSZA 5AK5A 1VFPA 2G08A 2C4NA 4GXTA 1T5TA 2FI1A 4CNQA 3E58A 3ESRA 5ALGA 1AQ6A 2AMYA 3UM9A 2I54A 3IRUA 3U7EB 5ALOA 4KYTA 2B1QA 1K1EA 3NIWA 4BNDB 2G1AA 2MU1A 2R8EA 3PCTA 4CE6A 3A1DA 5ALZA 1L8LA 3BWVA 2EATA 4RESA 5AW6A 5IT4A 3QU9A 2ZXEA 3L1VA 4QJBA 3WGVA 3U7HB 4BYGA 4UMFA 4DWOA 4E88A 4HYTA 5AM4A 1YNSA 5AW0A 3EWIA 4NFLA 4C4RA 3ZVMA 3N8GA 2Q4TA 1TA0A 2O9JA 1L6RA 1RQLA 2EARA 1CQZA 2X4DA 4Y2PA 2YFYA 1PW5A 4I9FA 3ZWKA 1ZRMA 1EK1A 2FPRA 4Y2QA 1U7PA 2W4MA 5AI6A 4XPZA 3QUQA 5AK3A 3QNMA 3UMCA 1YV9A 3P96A 3A1CA 3HYCA 1RLMA 5AKJA 1SU4A 4L6CA 2BDUA 3KOOA 2HX1A 3WK4A 3L8HA 3L8GA 4IG4A 3OCUA 3UMBA 2GFHA 4DFDA 3L0CA 4YCNA 5T41A 3DDHA 3L8EA 5A3QA 4CF4A 2AH5A 2B30A 4BEWA 4C4SA 3NRJA 1Y8AA 1SWVA 2YMMA 1Z5UA 5AI4A 1T9ZA 2PQ0A 2ZBDA 3L1UA 4OHFA 3FZQA 3ZX4A 4PNHA 2YJ3A 4NABA 2YJ5A 1Z4PX 3E8MA 4HAIA 3WKCA 3W5DA 4UMVA 3MN1A 1YDFA 3RF6A 3E84A 3SKYA 2FEAA 4FFDA 2I7DA 3WKBA 2HOQA 2HF2A 3J7TA 1XP5A 4KX5A 4BX0A 3S6JA 4UM5A 2MSNA 2OBBA 4KNWA 4ZEWA 1L7NA 3QLEA 3QU2A 4XE5A 5E0OA 3OCYA 3OCVA 2B0CA 2WF8A 2YBDA 2WF5A 4BKMA 4EX6A 4UARA 2D2VA 3AR9A 5AVXA 4AS3A 1WZCA 2C9MA 3QU4A 5ALMA 3WKDA 1N8NA 2RAVA 3QU7A 2JAUA 5AM1A 1YMQA 2RARA 3DNPA 4YH1A 1X42A 2ZOSA 4Y2JA 3WK8A 4I9GA 2OM6A 5AVYA 5AVSA 2YJ6A 3FPSA 2QLTA 1FEZA 2QYHA 3QU5A 5AHXA 4BNDA 1EK2A 3WK9A 1L7OA 5AKKA 2HHLA 4FYPA 5AI9A 3L5KA 2FDRA 4UAVA 4EEKA 3QUCA 3M9LA 4OCZA 5AM5A 2Q5EA 3KBBA 5AVVA 4HGRA 2IOHA 3TLMA 2JARA 1WR8A 4UATA 2GHTA 3E81A 5ALSA 2W43A 3RFUA 3IJ5A 5AK4A 4HGQA 3ED5A 2YMQA 4AS2A 5AW4A 1U2TA 2IA5A 4HGOA 5AM0A 5AI8A 3WK5A 2W11A 2B82A 3B8EA 3BA6A 5AM2A 4YCLA 1IWOA 3U19A 1RMQA 1VJ5A 3NALA 4HGPA 1T5SA 3SD7A 4YIKA 1QH9A 4F71A 3HLTA 5AW9A 4O8CA 4UMEA 3ZTWA 1S8OA 5AKEA 1RLTA 2G80A 2GHQA 2PR7A 3K1ZA 1J8DA 2FPSA 4BX2A 1RKQA 4EZEA 3MPOA 5AVQA 2GMWA 1Q91A 3CZ4A 4EENA 2R8ZA 5AKXA 1Z4MA 3NASA 3IB6A 3MC1A 3QYPA 1TJ5A 2CFTA 2YY6A 3FGOA 1LTQA 3QUBA 5ALPA 2B8JA 3W5AA 5ALLA 4BX3A 1NF2A 1WPGA 4EELA 2ZG6A 1NRWA 1QQ7A 1Z4NA 2NO5A 2WF7A 1YJ5A 1YS9A 5AW3A 5ALXA 3SLRA 3U7GA 2PKEA 1L7PA 1TJ4A 2WFAA 4UU1A 5AICA 5AW1A 2FPUA 3A3YA 5AKZA 3OCWA 5AKHA 2CFRA 2GO7A 1MH9A 3OPXA 3ESQA 1RRCA 3FPBA 4OFZA 1U2SA 2IOFA 3AR8A 2RB5A 3ONNA 2FPWA 4UAUA 2I55A 1TJ3A 3PGLA 5AIAA 2HDOA 4UASA 1RDFA 5A3RA 3ZI4A 3AR4A 5ALWA 5AI0A 2Q4RA 3AR7A 1RKVA 5AI5A 3ET4A 2VKQA 4XOUA 3QXGA 2YMPA 1Z4IA 3M1YA 5ALRA 2WF6A 5ALQA 3W5BA 1RMTA 4OD0A 1XPJA 2B8EA 3UMGA 4RETA 1Z4QA 4CF5A 5AIBA 2CN1A 2P27A 3KD3A 1ZS9A 1RC8A 5AK6A 2G06A 1WVIA 2JAOA 3FM9A 2HI0A 5ALHA 3I76A 4HGNA 3SKXA 3KC2A 3PGVA 4IFTA 1Z4KA 3WKEA 3L0BA 2ZBFA 3DAOA 3CNHA 1SWWA 5ALUA 3FVVA 1RKUA 3L7YA 3VAYA 4AP9A 5IT0A 5AVWA 1ZRNA 5AVZA 4JB3A 3NANA 5IS2A 4BEVA 2IOFK 3U7FB 4YCMA 4L57A 4H1WA 2O2XA 4UMDA 4YIHA 1Z4JA 3R09A 1QQ6A 3ZUPA 1ZOLA 5ALIA 3PDWA 2JAWA 4CF3A 5AW2A
chains in the Genus database with same CATH superfamily
5JNLA 4AY6A 4JMUA 1W5TA 3JR3A 3U44B 4PHGA 1NK9A 2HT6A 4DC0A 5C37A 1Q8KA 3BD7A 4QYWA 2Q50A 2G0NA 5DG7A 4NS1A 2P4HX 3A14A 4AO8A 2OB1A 4CI9A 1FUIA 3A37A 3L1IA 1U1FA 2BDEA 2CXNA 5L3QB 4UM7A 2UUCB 2SICE 5CDTA 1G21E 4RQNA 3PEVA 1KY5A 1BFUA 2XT6A 4IUYA 1EP2B 1WXIA 1M3SA 5DLYA 4DL5A 3N75A 2DB3A 9ICRA 2W58A 3UUEA 3NPAA 1KOJA 5FWNA 1RYHA 3V8EA 2PPLA 4C7MA 4ZYLA 3AW8A 4NQZA 4F4IA 4L07A 1LDMA 1COKA 1BHO1 3FWYA 4I55B 1T24A 3IDSA 4FNAA 2AB0A 1HR0B 1ATZA 4EJFA 1KMNA 1NT4A 2I3DA 2DBQA 4YRAA 4AG6A 1XVIA 5FPTA 1FQWA 3HKZF 1PDVA 2KMDA 4AURA 1R50A 1UBGA 3A1EA 1OBVA 4F3TA 4DF4A 4EJSA 3AGQA 3LC0A 3BQ1A 4ZT5A 4Z53A 4YUVA 3SEIA 4G07A 1ZVKA 4LQ4A 4ZHSA 2HMWA 3KQSA 3BSSA 4C7YA 3BF8A 4O4HA 2FI1A 2REOA 4EHDA 1P1IA 2Y1IA 1P5FA 3ZY6A 1QJCA 2HHCA 5EAIA 1APBA 5EJ8A 2CHQA 5IRCD 5LFAA 4RSGA 3MWDA 4LHSA 1HSOA 1FXUA 3W34A 4XUSA 2W2PA 3F74A 4N47A 3WB2A 3VRHA 1XGKA 4CV1A 2B94A 4Y2QA 4JC0A 4YO8A 1YV9A 2VAMA 3BD6A 1X66A 3F1LA 2AGQA 5T14A 1AA9A 3AF6A 5SY9A 1ADYA 2UYYA 1USVA 3R0XA 3Q7TA 1F51E 4LZGA 5JS2A 2GJAA 3O8CA 1RP7A 4IGAA 3PXAA 3S27A 3FDZA 3RJEA 3VKVA 3DVRX 3D5EA 5FBQB 2BF7A 4ABTA 2A9KA 3PC8A 1JVNA 1DV2A 1PX0A 3SOPA 1Q0RA 4JP1A 1GO2A 1FRFS 5GJCA 3RIEA 1T7PA 2H63A 3ZU5A 3TADC 4C2TA 5DXAA 3N2GB 1TCCA 1KWGA 3LQ1A 3GLHA 5L1LA 2P3LA 1P5ZB 1A2KC 1WL8A 1HI9A 3IAM6 1GZSA 4AC9A 1MO4A 4NM1A 1OREA 3SF8A 4L50A 2W11A 3G5LA 3PEWA 2CXUA 2E1RA 4H7EA 3T7DA 4Q05A 5BQFA 2ID9A 3CE6A 4O8CA 5D84A 3DM5A 1UBRS 1Y37A 4ZOLA 1MRZA 1P9OA 2IZ7A 3S99A 2YTZA 2HLHA 5EQFA 1GCOA 1T6NA 4UAJA 5DXFA 3BRWA 3WLLA 2V7TA 3HR7A 3S1SA 2D00A 4F38A 1OCEA 2JHGA 3EPGA 4W9NC 3S40A 3TPFA 1KFSA 4S0XA 2K4EA 2OCAA 2NG1A 4QO8A 2LV8A 2WSSA 1DC3A 2VN8A 3TNDA 4K03A 2CEKA 5JAQA 3KJZA 4LY3A 2WUGA 1D8LA 2HQOA 3PF8A 1H8HD 1NU6A 3AXSA 3F5FA 5CNIA 3S4YA 4HH4A 4TYPA 3O73A 5B6JA 1J6UA 2V98A 4LZZA 3R7SA 3UMGA 1LGYA 4XX1A 1VQ1A 4S2UA 1OWNA 4COOA 3B78A 1SWWA 5GIOE 8ICUA 2QW1A 3OM0A 2CXOA 3PRJA 1P9LA 4BB6A 3KTFA 1LDGA 4L4UA 4IWYA 2M9NA 1X7HA 3EXEB 3MQ2A 2X6TA 2MR6A 4YRKA 1B6SA 2Q5QA 2FZGA 1LI5A 3FHOA 3ZHCA 4FMDF 4MUFA 1Z83A 3A26A 4ZO9A 5JTTA 3TXYA 3W8FA 3PTZA 1V39A 2QU7A 4DABA 3N2EA 4MV5A 1Q3KA 4BKQA 3A8TA 3GAZA 2IY7A 4D8XA 4O2BB 1F8YA 4V0QA 3F2CA 3ZXSA 1MAUA 5K4LA 4RGVA 1I80A 3WGGA 1DXOA 2XVTA 1WSAA 3KQTA 3QZ7A 4XEUA 2GD0A 1JL3A 4IXMA 4AXXA 1QFXA 2QX9A 1U80A 4B32A 3A32A 4RPXA 4DS5A 5FWDA 3ETJA 1SXEA 4TPKA 4C4XA 3KYJB 2HLPA 2KSQA 2PX6A 3R0QA 4JJ6A 3FTFA 4S12A 1IL0A 4QG7A 2XMSA 3WA7A 3D7MA 3S8EA 5FUQA 3WLHA 4DJDC 5BWMA 1CSEE 1B2RA 2GZDA 2IHUA 5K0JA 2I6XA 2QN3A 1P0CA 5ICMA 1QZ3A 1U2GA 5ITZB 4I55F 3AR2A 3FOZA 4RFSB 1N6KA 4RL4A 3PPIA 3HDJA 4CEIA 5H70A 4XIGS 1GL7A 4UBNA 4D5EA 3QF4A 3F9IA 2ZJ2A 4YACA 4ZK2A 2Y0EA 5KQRA 3B53X 3LWZA 3VX4A 1LKYA 3PNCA 3BB3A 3PUYA 4IY1A 1C1XA 3EHEA 2Z2JA 4IFIA 2UZ0A 4PQYA 5JJ5A 3MTGA 4MWCA 2FRDA 1W35A 1XRSB 4BDSA 1KEEB 1XBTA 3DM9B 2HLNA 1VL1A 4YCDA 1BQ3A 2J6CA 2RMKA 1SBCA 5C5CA 3GUUA 4D4GA 1JWAB 1H23A 2AS0A 1F2TA 1DRWA 2WZBA 3QENA 2O8EA 2GN0A 2A92A 4BFVA 4PF1A 4QW9A 1BA3A 3A2LA 3E9EA 5TJHA 5IN4A 3KLBA 1UWLA 1G8MA 4B87A 4ZU6X 1IPFA 1GPBA 4NICA 3WKCA 1QLJA 5JAOA 4S3MA 3W5IA 2CMKA 1LLFA 4MLDA 1GA4A 1NFRA 4EX6A 1Q16A 2I6FA 5JZSA 1DKMA 4QX6A 4R8LA 2ZTUA 5CVCA 2X4GA 3N2GA 3VU9B 1P8JA 1QTMA 3NUZA 3TJMA 2J46A 1AROP 1VI5A 5DVZA 5HEKA 2WM3A 1VZ3A 1EAMA 3GJ8A 1ZK3A 5EJAA 1XMXA 3VUFA 4S2EA 2X13A 2BRUA 4TN1A 3D4BA 3OTIA 4MVJD 2JARA 4MS1A 4HAOA 3A1NA 1A8PA 2ZR8A 4C3OB 2VT7A 1U2TA 1I3MA 2IEYA 5BWBA 5AWFC 1D4OA 1ISJA 2JAXA 1FNSA 3CVUA 2PBFA 4QNNA 4MPJA 3S2IA 3E5RA 3UPQA 3GK3A 1U1GA 2HU2A 1UJCA 2DL0A 3NWOA 3ZIAD 4Y0VA 4NLZA 4E0DA 2AXTU 4AN0A 1VJ0A 4I2AA 5BR4A 5KYUA 1XU4A 4EB6A 3JY6A 3L0IB 1Q5PA 4PZNA 1QF9A 1L7PA 4W5RA 3OD5A 4J2HA 5HTKA 4HX9A 4RTJA 2I7TA 3HM2A 3P9SA 5CAEB 4RNDB 4OP1A 4KGDA 1R4NA 1DLJA 1EUYA 1SC4A 3O92A 1NKEA 3PNMA 1WHSB 5KFQA 3Q0EA 1EWRA 5JXGA 1VC2A 4KZKA 2OBNA 2V6FA 5KFVA 2C9CA 3K35A 2B8WA 1UR5A 1X2EA 2G06A 4QWBA 3U31A 2Q3BA 4HLCA 2UVVA 3KT8A 4PSKA 1GXSA 3EXEA 4GYYA 3WNZA 3D3NA 2Y0CA 4GOOD 3WYGA 4DGSA 2CYCA 1ZUHA 3SYKA 1MCZA 4I2HA 3ANSA 3M9NB 2IPNA 2ZRDA 3AQFA 2WU1A 5FUVA 4ZAGA 4JGBA 4YRRA 3KT6A 2E21A 1HX7A 4X85A 1E9RA 5EIBC 4MUNA 5DGXA 4YD1A 3EGIA 1Z2CA 2QTLA 1HEKA 5JCJD 1CI4A 1EXMA 1VG1A 1I4DD 4EKDA 1DJNA 4TRMA 1ZIDA 1HA3A 3HDQA 1ACJA 1YZHA 3DV0A 1IYZA 3HRHA 3GUCA 3DXZA 4DFJA 1SXHA 3K9GA 4JOBA 2QROA 2VF4X 1E3JA 5EMMA 5FOUA 4O0IA 2HGZA 2QVGA 3LLVA 1IQPA 4EG1A 3CEPB 4JC8A 4R63A 2EW1A 3USCS 3V2HA 3P2OA 3IT0A 5SZKB 1CUEA 4EZ9A 2ZVQX 5CT8A 4KMOA 4MR9B 5EJMA 2FXIA 1XTBA 1O8CA 4QE3A 3ZLUA 3AVTA 2PUVA 4GEGA 3HZRA 1ES9A 2Z1NA 2PUGA 4UOEA 2ZE6A 7ICFA 4BNYA 5EXSA 4EPTA 1TIBA 3NKLA 3KD2A 2F3UA 3U60B 2SBTA 2W2QA 4YJFB 2CT8A 1L4UA 2MRLA 2HIHA 4Y1RA 4MW0A 4AJKA 3EISA 2K7FA 3OLZA 4Q44A 2WDZA 8ICRA 5C0YA 3DBHA 4Y9RA 3RH5A 1W6RA 4WZBE 1LNZA 2HAEA 3HBAA 3MUEA 5AO9A 1T3LA 3HB0A 1QK4A 3CKYA 4MQLA 2VUTA 5IT4A 3FYDA 3IA7A 1W49A 3GN2A 2BDPA 2AE1A 4R8KA 3EGEA 1H8EA 2I71A 1MO6A 3K9HA 3WO0A 1YJQA 4C3ZA 1PBTA 3L4BA 3KDSE 4LJ4A 3NP7A 3HUDA 4IG4A 3L8GA 2OFPA 4XSVA 3MGBA 1SV0C 3M6ZA 2AI3A 1U8AA 3IQWA 4Q39A 3MD0A 5K7SA 2QGFA 4UHHA 2DRIA 1YJAA 3RUHA 3OKCA 3AYXB 4UM8B 3L1HA 4YRNA 1Y3FE 2XUFA 1D2GA 2X8WA 2ABWA 1N6PA 2W8BA 3U7QA 3J7TA 5ER6A 3OZIA 1VLZA 4DC9A 4RPGA 5KFTA 1IJFA 4I2EA 1NVFA 1ZQUA 4FDUA 4J0HA 4YJGB 1RRPA 3AR9A 7ICPA 1VJTA 2QZZA 1ORDA 4L5JA 1I8TA 4WLFA 1HYQA 4Q9HA 5LOVB 1CF2O 3GCWA 1D2AA 5AVYA 1X94A 1X70A 1XK7A 4EQZA 3V8QA 3V6MA 3WIOA 4NVRA 5CIWA 4Y6GB 5KT4A 3TD2A 5FOTA 4D4MA 1XAIA 3E81A 1XYVA 4Z0TA 1SEPA 4DR3B 3SYLA 1PFYA 4LQCA 3SQNA 4YCLA 2H2AA 1UBLS 9ICIA 5BW8A 2BGTA 4WLNA 1Z5OA 1L6NA 1WDLA 3AEKA 3GJ0A 1QV6A 2FFQA 5LYJA 1Z5NA 3R7WA 2GBGA 5B7PA 4UUQA 5FOVA 2EW2A 5GZ1A 5F7XA 3K71B 2ZBUA 3BIOA 3PCRB 5CAEA 4HSEA 2WAYA 2YKGA 3QFSA 4A2QA 2A9JA 2ZS8A 1FFCA 1GZVA 2QGZA 2Z2IA 4L5YA 4XWYA 3HN7A 1WHSA 3B7GA 3UOWA 1M54A 2OAQ1 5J8YA 3PFNA 3RRMA 1UANA 5BPHA 1Q17A 3TIFA 1H3EA 3ST7A 3GRPA 2Y1FA 2FP4B 1X6IA 4N3CA 2BGLA 3V4OA 3BX1A 2XW6A 4Y30A 1NX6A 3R0ZA 4J4TA 1EUQA 2FZVA 3EEOA 1LBSA 1K6EA 3F4KA 2H08A 4LZLA 2MMGA 3TM4A 1AKMA 1WVGA 4JYAB 5J2FA 2CBGA 3C6KA 3OQPA 4HF7A 4FKMA 2QW8A 2JVJA 1GFZA 1P5JA 3KHUA 3S2EA 4MINA 2O2ZA 3AUJB 4E5MA 3F3SA 4NFSA 4YN4A 3M89A 3UJ3X 1EX6A 1Q0PA 4EYEA 4BEVA 4UUOA 1ZGCA 5A3VA 2JXJA 2DF4B 3Q1LA 3R09A 4BE4A 4IYJA 5TARA 2O0JA 3VKUA 4G25A 2JATA 2JD0A 4BN0A 4WCVA 5FULA 2UKDA 3R76A 2PUEA 4TWRA 1L5HB 5HIAA 4UHKA 1IJBA 5DHUA 2WJAA 1GLGA 1KRPA 2RBEA 2YV2A 3QPUA 2XCPA 3PX3A 5KOHB 4I6EA 5EE1A 1X7ZB 3DS8A 3S2FA 2D3TA 1E3IA 3D0KA 1MSWD 1AGNA 1FLNA 2Z30A 2X8AA 4Z0PA 9ICSA 1XB2A 3F5SA 4UREA 2P90A 1AHNA 3P32A 3RYTC 1ZH4A 1VSTA 3SI7A 5EIOA 1LB1B 2ZIVB 1DKPA 5C8YB 4XJVA 4YJHA 2HCFA 1R6TA 3AKDA 4ZOHC 3DW3X 4Y2GA 5IFKA 3HHPA 1HTBA 3G8AA 4DJEC 1IUPA 3ZVLA 4P7GA 2ISOA 2VTBA 1G21A 1I33A 2P0YA 4XWGA 2ZUDA 4DIKA 2WINI 2F3TA 3WKAA 1FDSA 3WIBA 1UBCA 2QEQA 4KLNA 3U13A 4NZMA 3LECA 2BFNA 4YHBA 4DV3B 2BTQA 2ARKA 3OZ7A 2PQ2A 2I54A 2PZFA 4UE6A 3ASYA 1G1AA 4KIUA 3CONA 3AF2A 3I2FA 4L02A 3A2KA 5HYVA 1F4PA 1P45A 1WMEA 2FZCA 3Q6MA 2IPOA 2BE7A 2BYTA 5DM0A 3RM3A 4C4RA 1AC5A 1GNTA 1X2IA 4AWBA 5BV1A 1DG1G 1C0LA 5DTEA 3K0SA 4N5IX 3Q4GA 2ZB7A 1T1EA 3VR5H 1QZTA 3FWKA 3UO8B 1SU4A 2A9QA 3FWZA 3ZCXA 5DMHA 4N01A 1YCGA 1Q6ZA 4WH0A 8ICZA 2OL4A 5DTMA 5G5GA 2EX4A 5KYXB 3U1VA 4I1SA 4EG5A 3A9WA 1PLJA 1D2HA 3WNVA 1T3TA 2OXIA 5LOVA 3G2HA 1F44A 4NU0A 4DR7B 1PFGA 5LVAA 3NHWA 3AUKA 4C7ZA 1G38A 3SVLA 3RUCA 4GQAA 1KK0A 5B30A 3UB3A 5IW8A 5IABA 2F43A 5DCWA 1POXA 4DMKA 1UJMA 2P0EA 4EEZA 2HB6A 5EOZA 4MVJF 4XFKA 3T5CA 3CP8A 3DQZA 3F5DA 3IYLW 4O25A 1WMDA 1LK5A 2W43A 4G1BA 1L5SA 4BIIA 1NVWQ 4Q4AB 2AVDA 4EY5A 3KQQA 5U1PA 3AYZB 3ILSA 1Z39A 3P1JA 4JP2A 5HOQA 3WXBA 3E0FA 4Q12A 2Y6UA 2RG7A 1N8TA 2ODNA 2PR7A 5JS1A 5JYCA 1RZVA 1N0HA 1N9GB 4TMTA 3F3MA 1E3TA 2O6KA 2R85A 1UT8A 3JQFC 1M8JA 3K9CA 3H2KA 3HKBA 4YMTA 1LQTA 1YKGA 1YZYA 2NP6A 5KDDA 3PI7A 4I4IA 1TK5A 1FNNA 2EC5A 1JMKC 4OJMX 1NSYA 2OYRA 1GTJ1 4QLOA 4C6TA 1U1IA 2WZDA 3SBEA 1H1DA 4UASA 2O3QA 3AFIA 1NDUA 3ZW9A 4UQLA 3WRWA 5FNZA 2PXIA 1Z62A 3KFLA 4O5OA 4C0AC 2VAXA 1JZTA 1J22A 3OSUA 4AQ7A 2YV1A 2AJLI 2BEWA 1S89A 4YXJA 1C9EA 1QE5A 1GCAA 1EFAA 3JPNA 4MPTA 3X2FA 1H2XA 3HEMA 4JEHA 1YONA 2JLZA 3KG2A 1Q46A 3QPAA 1E9SA 1ISIA 1V9LA 5FYQA 4Y2RA 2O1WA 2G77B 5K5EA 5D3QA 4YWHA 1NUUA 4Q7EA 1IN6A 4GI3A 1SKYE 3INRA 1EVYA 2VF8A 3HDTA 3TE7A 4ESEA 1DU4A 2YX1A 4FGSA 3R7FA 1IM2A 4HS4A 3V4ZA 2D6FC 4H1UA 1JW9B 1JBEA 1MO3A 2HNBA 3PEEA 4PL2A 4TLDA 4FYJA 3VOBA 3ZU6A 4F21A 2DLCX 2J7KA 3MIZA 4U4AA 5KDLA 3R75A 1M9NA 1SH7A 1C7FA 2ZIVA 5C8YA 2B3DA 1WO8A 3RTEA 4AP5A 1YS7A 3RV4A 4LVNA 1NW8A 3M2PA 4KX3A 1SKSA 1MVNA 3L7IA 4E7OA 5H7XA 1A9XA 4KG7A 5ALYA 2PKRA 4L85A 3EIQA 5AQEA 4JV0A 3KVNA 1AK2A 4G67A 2ZRQA 1PT9A 4U7GA 2PUBA 5EXDA 4DQPA 2JKVA 1XKTA 2E55A 4YWJA 5AUPB 2HM7A 4BLWA 2BZGA 2DQSA 1TU0A 1T43A 3VBCA 4L8FA 5KFHA 2IH5A 1LBEA 1XFDA 2ALZA 3R74A 2L5YA 2C2ZA 1VFPA 4XTRA 2PX5A 3A2MA 4IXDA 5DM70 5LDGA 1XTPA 2IUUA 1GNQA 4OSOA 2EBFX 5CIQA 3DGFC 3AB3A 2ZSFA 2F3NA 2CNWD 3KV1A 2POQX 1QORA 4UCWA 1T9KA 4BO5A 1XK6A 3EODA 4JCCA 3A11A 3S29A 3ZWKA 2YFYA 4EYIB 5JAZA 1WYGA 4V0KA 3I6QA 4IIFA 3LDUA 4NJMB 1JAYA 5EN4A 4X7BA 4MGEA 4QU5A 1A96A 1N6NA 1T3NA 1LH0A 3N3BC 1CY4A 1Y8AA 1PVRA 1DKNA 2PZEA 3A4MA 1BOFA 2VDOB 2FLKA 5J4LA 5CT5A 1I7QB 1QBKC 2OAEA 5F4ZA 1JJ7A 2OSBA 2YC4C 3LC7O 2O3SA 1JI0A 2HMVA 4L8GA 5BT9A 5TPWA 3T9AA 3RU2A 2ZKLA 4CMBA 3BCSA 4UBOA 3B85A 4BBAA 5FL7D 4MCAA 4WFQA 4DV6B 3KS9A 3L4KA 2V97A 4LMPA 1EGAA 3FPSA 4YP9A 1G3MA 3S81A 5IXYA 3BWYA 2JGEA 1NULA 3NVWA 3WC4A 3JQEA 2OB2A 4P3OA 1WWVA 2AKYA 1FS5A 4KQXA 1ZJMA 4EL0A 1WR8A 1PV4A 3TLEA 3EEYA 3CW9A 4AJLA 1N9GA 2ZS7A 1T5DX 2IA5A 3I34X 1Z8DA 3MCZA 4ZQHA 4R1SA 5BR7A 5I7WA 3KKOA 5DCUA 1JG7A 4IINA 3ZBUA 4HX5A 4J1TC 5LZ5A 4IV0A 2LBPA 4Z6EA 2X8JB 4ALNA 3IB6A 4EVRA 2ZAMA 3FOFC 3QSGA 4HB2A 5CB1A 1TAGA 1G66A 4U2BA 1ENZA 3RAFC 5FUWA 2XMGA 3GEHA 4MJ7A 5FO1A 4G0OA 4FMPA 1I6WA 5A3RA 2X9QA 4O3OA 1YL7A 5GAJA 2PMKA 2VA8A 5AJUA 3RKSA 1FJ2A 4C0QC 3O5AA 1XQ6A 4IIVA 2BKVA 1RWNA 2JAOA 2H65A 5E6SA 2EJWA 1Y9JA 4C7OA 3QNUA 3NT5A 3GZTB 1OPXA 3ZJVA 3TIXB 3OP4A 2ZROA 5D1HA 4PINA 3H1TA 4BO1A 2RGDA 3NDPA 2I29A 4P4UA 4C2BA 1UKZA 3S68A 3NTRA 5K4HA 5EY5B 1S5PA 4M0PA 5DLDA 2RHFA 3HUEA 4F5RA 3DBVO 2IEZA 1WY7A 4X1OA 4OHOA 3HV0A 1BG6A 5CFNA 1TU4A 1YCFA 4P0PA 2OLEA 1C8LA 3WNBA 1YBHA 1RQNA 4IIDA 3R9KA 3CLSC 3PR3A 1EFPA 4B3IA 2VK4A 2YB4A 3K96A 3RNLA 4MB0A 2A1TR 1L7QA 1A8IA 2FPLA 2NRZA 4KNVA 4PCVA 4E08A 4MS4A 4IQVA 4OG2A 1P4AA 3I73A 2ODGA 1D5WA 4DSNA 4QGSA 2HJRA 3MBKA 2QARB 2YX8A 1TQDA 4YJ3B 5FWAA 2ECFA 4W7SA 1TVCA 5KYYA 3C4VA 4ZXPA 5EHXA 1RG6A 2BPGA 2DY1A 1JHXA 3V8MA 2QL9A 3LSTA 3LCCA 3MCWA 4RTPA 3TFRA 1NOJA 4RSHA 2O5EA 3AM5A 3UMVA 4JL8A 2PWPA 3VR5A 4PR0A 4PGFA 3P2EA 4IDQA 3A36A 1Y4SA 4WPGA 3AMVA 3O84A 4EF5A 1Z35A 1QANA 1MA3A 3IV7A 3LE8A 2BZSA 1ODKA 3ISBA 3I01A 1DX9A 1U0FA 1U3VA 1WZ2A 4OUDA 4GSKA 2ALJA 2AOTB 4ITUA 2Q5CA 2QGNA 3CVXA 1UKYA 1ZQCA 3N6RA 2J4CA 3LUHA 5KL1B 3DB1A 4UBBA 5FBHA 4GZ3A 2ZLBA 5M7EA 5JDIA 4WZBA 1SHJA 4MHVA 1RWQA 4F2WA 1PZXA 1EH5A 2CF6A 1E1YA 3A1VA 5IKPA 1L4LA 2CXXA 1YDFA 1A9OA 4QL3A 4E2YA 2C4MA 3M5DA 2VHWA 3K5PA 1PG0A 1V35A 5M3BA 3LWMA 1XVVA 4WKOA 5KNIA 2EQAA 2WF5A 1VBMA 4EG8A 3ZV7A 2FE1A 5LCXA 3EXG2 5AJXA 2Z09A 3TW6A 1MPTA 1KS9A 3A6JA 3GJ7A 2OGWA 2IEIA 4TL7A 4Y2JA 1JECA 5F51A 1YQ9A 4IJQA 1M8PA 1T4GA 3UAXA 1THZA 2OZKA 2XE6A 3UA3A 2BN4A 1J0DA 5L40A 1T5BA 1I5RA 1DRKA 2WSSD 2GHTA 4DLEA 4PHEA 1M6VA 3R7NA 3KT3A 3L0OA 2LDBA 2X8JA 1BVUA 3EFHA 4ASUA 3MNFA 2EBHX 4J3JA 1FW6A 2F8TA 4B7ZA 4BNHA 4M9SA 2VJ4A 4NRDA 4HBZA 5A0VA 2IYFA 2YRXA 1GKUB 5DBOA 3A1SA 1KDZA 1SUEA 1X7XB 1MC1A 4FGUA 2JK1A 4HNRA 1VB5A 3N97B 5TE9A 2ZU0C 4CMEA 2PAAA 4NXZA 1UPHA 3HZZA 2NSHA 2BELA 1UM8A 4HWPA 4RPCA 4MV8A 3UK0A 1GILA 1TZ2A 2Q0QA 4D6PA 7GPBA 5AI0A 2VBIA 1B6GA 5TR9A 1K6JA 2EIHA 4Z4FA 2IX9A 2F48A 3TLBA 4LDAA 2UYHA 5JARA 3TMKA 1RYDA 4IFTA 1K2WA 3GIJA 2NIPA 4P0TA 5ALUA 2P1DA 1YBFA 2BP7A 4FX5A 4G4SP 5IAEA 4FXOA 2RK4A 1P4JA 2OYYA 3LVBA 3BBPA 4BLOA 1OE0A 2VYNA 2FPGA 1U3CA 3TSAA 3CM0A 3FOBA 3TK1A 4A73A 3U3DA 1Y7TA 2AUTA 4XFDA 3EJ6A 5M04A 2JI6A 4ZN6A 3GUHA 4YALA 1NJ6A 4EJSB 4ZODA 5KSWB 2H1VA 5A7FA 2FLLA 1B16A 4UU7A 1VHQA 3ZV6A 1E99A 4O4HB 5JRDS 1DE0A 3OMXA 4G1EB 1DBIA 3MINA 3MWDB 4PLYA 2D8AA 1DTSA 1I6MA 4BMZA 4FCCA 4ND4A 3F3KA 2HA3A 1VP9A 4U8HA 4PU0A 2B1RA 4Y1EA 3THOA 3ENZA 3EEFA 1EX9A 1GG5A 2UZIR 5TQJA 3QBJA 3Q7PA 2ERYA 3SC3A 4YCCA 3LQQA 4CR7A 1OH6A 2NQ8A 3C39A 5K0ZA 3CW8X 1WF3A 4GYWA 3O0FA 2WMOB 5JADA 2DG2A 1QK3A 4PG7A 1GD1O 2DP4E 4K05A 4EHBA 1JXMA 2DF8A 3FDZB 4IKEA 2YJ4A 1RPLA 5FP0A 1SCUA 2BMFA 3D3WA 4OXYA 2KMLA 2ZT8A 3F98A 1HK7A 4XVQA 4TVBA 4M76B 3STTA 3A4TA 3VHLB 5EHZA 4GMGA 3HJAA 5AJVB 5HXAA 4BNKA 2RHCA 2R8RA 2AOTA 1NYQA 4NBWA 1UPFA 1X3SA 2XJ4A 3WL8A 5K0NA 4D6XA 2GO1A 4M0FA 1GTSA 2QTTA 3A7EA 3L3BA 5IJ0B 3MILA 2AF3C 2W42A 4M7PA 1UC4B 2JH7A 2QTRA 2BZFA 3GLHB 3QKTA 2WAMA 4FFMA 4NESA 3AQIA 3SF8B 2Y76A 1ORTA 1ZZGA 1RWWA 3QNMA 4U5XA 3RS2A 4EF6A 1KHHA 4ENRA 2PGOA 4N3BA 1XTRA 2Q0ZX 5F1PA 3IVAA 3R4VA 4ZOLB 4LWOA 2ZSKA 3RI3A 4H4DA 2WPDA 2ZSJA 4Q37A 2I66A 1JHPA 3P4UA 3EYZA 2R1ZA 3IAXA 1GTG1 2WV7A 3OKFA 5JC1A 1EU1A 1XVTA 1ABFA 3E8SA 2FOXA 2O8DA 4R2KA 4ZGWA 1NKTA 1C7ZA 1UIMA 4IPTA 1YZTA 3UMJA 2ZTEA 1LV8A 4KJXA 4LJ7A 2QSUA 5KPJA 4FHCA 1I01A 4H08A 5FHQA 3HE3A 5AKKA 4IO0A 1PR4A 1RAIA 3PWZA 4EY4A 3A06A 4IRXA 3Q1KA 2WWFA 1AZWA 2WSMA 1F0KA 1Q7BA 5AM5A 2GN6A 2H1RA 2Q5EA 2OHOA 2HDWA 3WWCA 4BNUA 1F2VA 2JCYA 4HGQA 3G89A 1S02A 1GR1A 3DEHA 4X61A 3H0RB 4ZKDA 1VJ5A 1X7XA 4XA5A 2F44A 3HY6A 4DY6A 2I4MA 1Z3CA 3T9CA 3TZLA 1DK2A 3SQXA 3T3HA 1X13A 3C3DA 5SY4A 5DGBA 3RU9A 4F06A 4G1UC 3KKAC 5IM4A 2X3FA 3EZXA 4KDRA 4W5JA 1T6BY 4NG4A 1FFYA 4I29A 3ZHYA 5ER9A 4HPJB 5KFSA 3IBCA 3DDOA 1ZR4A 2Z4RA 1Q6YA 3Q88A 3L7DA 2IKSA 3OTHA 5HX7A 3ICQB 1OU0A 1UC9A 4FM9A 2KHVA 3M8SA 1XPOA 2P2DA 3R23A 1EK6A 1TJ3A 3KZ1E 1BHQ1 5J2UA 4BQSA 3EN0A 4ZCMA 2CDCA 1XMSA 1WQ3A 2OBYA 1CZRA 2B6NA 3WGJA 3DQQA 1QUEA 2GM5A 4LOLA 1KSHA 5C1OA 4EKIA 1X7WA 2RGNA 2CUKA 1RC8A 3U09A 2R7MA 1PF7E 5DOZA 1P44A 5IJZA 4HWRA 4XR4A 3FAHA 3HNPA 3NHRA 5G2OA 3T52A 2AX3A 4KOAA 3PR5B 2BLLA 4CT0A 1TCAA 5IZCA 3EGWA 2JVIA 3FRJA 8ICBA 5DH9A 1IXYA 3USES 4LNUB 4KCGA 5F5XA 2WKSA 1XWLA 3GMIA 2PL5A 2JLYA 2GA8A 2ZWVA 1E2QA 3LQ4A 4QQNA 4WQMA 3DMGA 4B6OA 3BTUA 1AHIA 2QQGA 5KHOC 1A9RA 4CEIB 4OL0A 5D8DA 3QF4B 2AQ8A 2CLFB 3TLAA 3NOXA 3BZBA 1JSCA 3IUMA 5CHEA 3CX3A 1LKYB 1KOGA 2B4AA 5FIUA 3NBZC 4JLNA 1XF1A 3IALA 4RV5A 1C1XB 1Z6TA 1TM1E 1PSWA 2SNIE 3BH0A 2OORA 1NA5A 1VMKA 1MAWA 5LA6A 3OE5A 3F3YA 4DAEA 1BNPA 2EIXA 3I0NA 4O4HF 1VPTA 4CQLA 4GVXA 1F2TB 2BUAA 2II6A 1YHZA 3Q3JB 3TTXA 2O8EB 3PFBA 3PFKA 1L7MA 4J03A 1S3SA 2NW6A 4K9RA 3BWEA 3DHEA 3DLHA 1MP0A 4IFBA 1A7UA 4UFNA 4EABA 3EH1A 4O2LA 1H8ED 2O7SA 4TGLA 3P71T 5DB6A 5F5NA 5KJCA 4M9XA 4AZ0A 5D00A 5IJ0A 4K6MA 3VSBA 1U4OA 3ESXA 2OO5C 4IDEA 1PFVA 5ARBA 2I67A 2GJ9A 1HNZB 4EKNB 1Z5WA 5AD1A 4B48A 1HH4A 2XKBA 4H59A 3RYCA 2HMSA 2CDBA 2XA1A 3GH1A 4F12A 3WGVA 8ICGA 2CY0A 1UDRA 1Y42X 4MS1B 5DCLA 3GA5A 3P9QA 4YTEA 4N18A 5JZOA 5BW6B 4BNWA 1OXSC 5AK3A 3TN7A 1IHYA 2E8OA 3HDYA 5DNWA 3JWIA 3IUSA 4LDQA 3R2JA 4DIEA 2YMMA 4OHFA 3ED1A 1A76A 3K9FC 1C3OA 4YP3A 4HTAA 5KL8B 5KYUB 5L9XA 4EB6B 2VTDA 3EVNA 5LZ4A 3QVSA 4LUCA 2PSSA 3TEMA 3TMAA 3NHUA 3RUIA 8ICPA 2D2IA 5DYWA 1J99A 4ACAA 3CZ5A 4JC5A 4KR9A 5KWSA 4B47A 4ND5A 5KOIA 1PCXA 4DQUA 3BQ2A 3DXYA 1PBNA 4ZOLF 2C9MA 1R4NB 2IIPA 5ED0A 4F2SA 3ONDA 3UUWA 1DO2A 2XQFA 5DT9A 4H0CA 4D3XA 3ZNNA 3D6NB 3BE8A 1TAMA 5TMBA 4PLVA 1ZSVA 3BJYA 3BL8A 3GCXA 1YB7A 5JWOA 2ZSDA 1X92A 3EEBA 1GXSB 4TQUS 3R5TA 1HE8B 3RB4A 2O3JA 4LRSB 2BCUA 1YGPA 4IR9A 3BIFA 4G1CA 2V7UA 4MYUA 1RADA 1UP6A 4MIEA 2H6EA 1OLSA 4I1RA 5DKFA 4NU6A 1LXCA 4KLIA 2Y6VA 1MC8A 2WQ7A 2CNKA 3MC1A 3FD8A 4Y1FA 4W8OA 3OLCX 1HNXB 1GPKA 5JHHB 2VZ8A 2P9BA 4K9MA 4XVUA 3U7GA 2GPTA 3DV0B 1BROA 2PT5A 3Q0IA 1RRCA 3WRVA 1LJ8A 2GCNA 2AXNA 3D1JA 4P3NA 5DM60 4TV9A 5MFZA 3NNSA 1KFKB 1NV9A 2A35A 4K4IA 1GITA 1ZMOA 3L8YA 5H82A 13PKA 2WMDA 4RHEA 3UMRA 5G3ZA 2R6ZA 1Z4QA 1VE7A 4KMOB 3GNTA 3C1ZA 2A33A 3E7WA 4CHTA 1KMCA 3L0BA 5HKOA 1CS4C 1DAPA 5FB3A 4LNUA 3T3MB 3R5SA 1LRJA 2V6MA 1DCKA 1Q19A 4R1OA 1LBTA 3BMQA 3QEMA 5B4UA 1NSTA 1R66A 1NXOA 1E0SA 5EPEA 4L2IA 4DA7A 3W9UA 2GEUA 4LZPA 3GG9A 1ZA1A 2WAQF 4XDGA 2E85A 2UAGA 4K9NA 2QJTA 4Y1RB 1FIQA 3QWAA 1WXXA 3WFZA 4MGIR 3HCRA 2C4UA 4ETIA 4DF8A 3KDPA 4YJDA 4YMNA 4BX8A 3DBHB 2KZMA 2D2XA 1DCTA 1RHJA 4MWOA 3CZAA 4QQKA 2NRXA 1G8AA 2UZ1B 3BL6A 3JARB 4JP3A 2AUMA 3CRRA 3IS3A 5DTQA 1YBAA 4NARA 1PDWA 3OOJA 2XITA 2PGJA 4B3JA 2WHPB 3MHTA 3UAZA 3L77A 3MTBA 1YQUA 5BOMA 3GGOA 2HOIA 2YFQA 1YE8A 2H57A 5FLYA 1F06A 2CMFA 3GDHA 4O63O 3EQ8A 3AXTA 1XHFA 3BDIA 2WJZB 3RKUA 1NKVA 1Q0LA 4P54A 4WY2A 3IDOA 2QUZA 4M1QA 3H9JA 4RPHA 3WYCA 4URHA 1YOVA 4HDKA 3UUFA 1GA6A 3ROEA 4YASA 2W8BB 5IVPA 3LUFA 3U7QB 4MNTA 2XY5A 4RQ0A 4H0FA 4EVSA 2ZXUA 2Y68A 2NVBA 3NUQA 2J5XA 3C6YA 1Q3UA 2OHIA 4C7KA 4F56A 2F00A 5GVRA 2DUNA 2V58A 2OPBA 1NLUA 4X1KA 5B3LA 2R8GA 4LYJA 4Z3KA 3L1VA 2H8KA 5INTA 1EVJA 4HP8A 4V24A 2HBLA 4XKJA 3ETEA 5JI3E 4JENA 1CVRA 1L6RA 2FWRA 1F8GA 1ZG3A 2YVQA 1KS2A 3NYRA 3ZH9B 3QX9A 1QE0A 1SL2A 4FFRA 1M2FA 4PX2A 4BE9A 4EGFA 3AEKB 3FVTA 3RU3A 2LTAA 2XCAA 5LYJB 3RWBA 4RTOA 2G8NA 3N76A 3R7WB 2QZ9A 1HFEL 2IYZA 3RC7A 5MN4A 3EPPA 4D7AA 2J4DA 4NABA 1XLTC 5ERGB 4H3KB 3GHHA 2C97A 2CWDA 5HKAA 2G7MC 4OX9Y 2GPAA 4FWIB 5H9VA 4B5KA 5CVTA 4DILA 4HYEA 2X7JA 3SX2A 3HVKA 1Y3BE 2C4HA 1MU0A 1K5DA 5AVXA 1B1AA 5GTIU 4I4LA 4IHKA 4WGFA 1A4RA 3DDNA 5EWJA 1JR6A 2MA1A 4FYPA 1G1MA 1Z36A 4DJJA 4BVKA 2FMUA 1NNUA 3PW0A 2L82A 5IXJA 3ZC3A 2NVWA 2ISCA 3VV3A 2QRPA 3LPNA 1HGXA 5J0XA 3H5RA 3OD1A 4QRDA 5K0LA 2DBRA 1VRCA 3EE6A 4B9AA 3NMUF 5F7JA 4DNXA 1HL7A 5ECGC 5I51A 3HXLA 4E5VA 1WUJS 2ID8A 4TT8A 2RGBA 5G4KA 1PHPA 2QM3A 1MXFA 1RJ9A 4YR3A 4M9RA 4PRKA 1A98A 3TLYA 1VHDA 3T4XA 4DE5A 1TKDA 4ZC1A 4LOKA 1ZR2A 2NXJA 1R6VA 4I19A 4R8MA 3DLPX 1USGA 1NVXQ 2XKKA 1FA9A 5THKA 3HP4A 4CTNA 4O2BF 3DF7A 2JZNA 4P5DA 4B2LA 3S0JA 2OAGA 2H1SA 4QGBA 3FWHA 1Q11A 1LF0A 4OK6A 2DWOA 2O50A 2OGZA 1W9MA 4QJIA 3FUUA 3KX2A 1TAHA 4FC6A 1A3CA 4YJHB 3PNLA 3QE2A 4G9EA 4PX3A 2W2VA 4LDJA 2BCGY 4ZO6A 4F5QA 4C7JA 5FF9A 1TM5E 1INLA 2R79A 3T7SA 2YS6A 2VTBB 4IIEA 4RACA 3KB1A 3WWZA 1G21B 3URKA 2Z8YA 2GD1O 4X8LA 3PBKA 1R7RA 1E2NA 4RDHA 2UZ1A 1J1IA 3JARA 4Z1OA 4L4XA 3BAZA 3RSCA 4P80A 3E7DA 4UE3S 2JFVA 5HHHA 1W34A 4O1MA 2WHPA 2BTQB 1IZ7A 4DOBA 3ZY3A 1OFTA 1QH1A 9ICTA 1QG6A 4R9RA 1ZRHA 1F6BA 1HTWA 2PBRA 2GDZA 1V11B 2IY8A 4EPYA 4MP6A 1Q7EA 2Q1TA 2IWRA 1EUCA 3IESA 2ZRIA 5F3RA 1N25A 3PTAA 5LQKA 2WLSA 4KXFB 3G0DA 2GZ2A 1C7RA 2QTWB 1CDOA 1AKWA 4FQ7A 4KQFA 1OGJA 2VL7A 1PJBA 2DFDA 3LA6A 1GUZA 4JK3A 1O94C 4XWKA 2PTHA 3CB4A 5KFDA 4DSAA 3AI2A 3BEOA 3QP9A 4MVJP 3JAKB 3R20A 1U2RA 2O20A 2FFAA 4BV3A 2OKGA 1MFPA 5CHYA 2VXYA 5K6AC 2VT2A 1O9BA 2AJTA 4FS2A 2C3OA 2WYHA 2F43B 3W8NA 2CFCA 4KK4A 2XGPA 1JLHA 1R74A 3AEQA 2OE2A 3ROMA 3BRSA 1VSBA 6ABPA 3RVKA 3KR1A 5JAUA 3TLXA 3E1KA 3GLFA 2PX0A 1L8AA 2H7CA 1QRSA 3DPIA 3HTXA 3D2SA 1YB1A 1NF8A 2PYDA 1JYSA 3DH0A 1C9NA 3CPSA 4BY9E 4F91B 1Y5IA 3UC9A 4B7CA 2BL4A 4RVUA 3LK6A 3VPFA 1CP2A 3IEUA 5JT1A 2Y1WA 2W9XA 1D1PA 1T9ZA 4LCBA 4KO3S 2F1JA 2NXCA 1YZGA 4HJXA 3HKBB 1DPGA 2WA1A 2C9BA 2H2GA 4ZDKA 2R96A 1KDHA 5F7OA 3ZZMA 1R8JA 1C8BA 1ACLA 4M8LA 3GELA 2IZ0A 2Y1OA 2Q3JA 4MW9A 5JU5A 1D0SA 3A6GA 4ZYZA 2MIIA 1DAHA 4C6TB 4KGXA 5LYJF 4KLSA 5J2BA 1FZQA 2OUKA 2XTNA 1KE1A 3GGSA 3SHOA 1VCOA 2V54A 1Z17A 1TMKA 4WFIA 4FYMA 1BPDA 3LW8A 2Q9AA 1I3KA 2CFOA 1H69A 2HHLA 1Z19A 5EP3A 1K7CA 5H83A 4UAVA 4HGRA 2BEWB 4Y67A 2VQDA 4BFTA 5EVCA 2HVHA 4EPWA 1B4FA 4DGQA 1P0PA 3PQDA 4X24A 2DFLA 2P9HA 2D13A 2EG5A 3NHKA 4AUEA 4JUBA 1SOUA 1MX3A 1SVSA 3J81j 5DQHA 3NAGA 1U7DA 1XCJA 2Q3FA 3VFDA 1DXYA 3VO1A 4GC9A 1FMFA 3R5FA 4RKRA 2CLCX 3K1YA 2IBKA 3GIMA 3QVLA 3RBDA 5ALXA 5EJ9A 3LXRA 3N0VA 4H7IA 2PFKA 3TUJC 3EPJA 4KXMA 1YHYA 2Q8QA 3L3FX 2PBZA 1WMFA 4B2PA 1W59A 4UPDA 5EP4A 3QPBA 4UAUA 4PSUA 1PZFA 3HLKA 2WKRA 3L43A 3BGVA 4PZUA 4B3HA 4U7CA 5AJWA 3F5MA 4OJYA 3H6HA 2WEKA 2Q7OE 3G8DA 3AT1A 2BPCA 4G1VA 4NCXA 2H16A 1IXZA 5AIBA 1UKBA 4V2IA 2PV7A 4G86A 2JJ2A 1PUZA 2C4TA 3EPHA 2GPNA 5CFMA 1N2OA 1XDWA 2QSZA 1A9XB 4ZRMA 1GRNA 4TWIA 5B1HA 2NUPB 5GTDA 4UMDA 1QQTA 4AKEA 4EUFA 3V4LA 4N7MA 3OQHA 3LCMA 1KO1A 2HN9A 3NGLA 4LYFA 4ZTUB 4W1SA 4H0NA 2OOSA 2FWNA 1WBDA 2XCTB 3L8FA 3KO8A 1G4HA 5ITWA 2HH9A 3DLCA 1S4MA 1ZNQO 3IOMA 1V11A 1F12A 2OMEA 5DM4A 1N33B 4ZU3A 5KT2A 2WT4A 4JDPA 3I72A 2I5HA 4MTCA 3RB3A 3LDAA 1KDVA 4PGGA 1SFRA 3KTDA 5T4BA 1ORRA 1KAOA 1NTRA 1B8UA 2PX3A 4YFKA 1AQLA 1WDWB 1ZHHA 1N36B 4JNCA 5C51B 1FX1A 3VR5D 4Z3DA 1XFAA 1ADBA 3RRNA 3ZE8A 1JN3A 5FUYA 2XDWA 4FOPA 4B9EA 1EDBA 4QHTA 1AUXA 3UT5A 4NMLA 4MKIA 4HPXB 3JAKA 5A4DA 2UU9B 2R11A 3QNWA 2FZWA 2KI5A 3C7DB 4UE2A 4NXNB 2EQ5A 2WFMA 4OM8A 3BMCA 5B58T 4AYXA 1K7XB 3QZ8A 4XGKA 1W25A 1N7JA 4FFVA 5TPWB 2OCGA 3DKIA 3TXAA 2Z5LA 5KB3A 5AUNB 2BWJA 5JXIA 1JN0A 1U8CB 1EWYA 2G6BA 2FEOA 2A9PA 5LOVF 3ZIDA 3LPMA 4RZIA 4HHEA 1U1CA 1KJWA 1XXLA 3UCEA 1ZGJA 1VE3A 4UZSA 3N8GA 2P9QA 4KN4A 3L8ZA 4OQLA 1J8VA 1DC7A 2PRKA 3Q10A 5CH3A 3RU7A 3MTAA 3FTPA 2GFHA 3L0CA 1NFFA 3PE3A 1VKHA 5IDQA 5E4FA 2AH5A 2B30A 1R37A 5AR1A 1A04A 3K4PA 4N54A 4IF6A 4ZAXA 3KYBA 2MSEB 1EDOA 1OH8A 1C8KA 1YU6A 3MN1A 4MYTA 1EUDB 4I7EA 1W4ZA 3K5IA 1UMBA 4HBGA 4GG1A 2X42A 3SU8A 2Q3DA 4ASUD 3OCVA 4ARBA 4MRVA 1WDKA 4OATA 4RQ3A 4YG2A 4EY8A 4JA2A 2D7DA 4J7CA 2VI5A 4Q7MB 1GQFA 1JDUA 4HNQA 5CW1A 2RBGA 1NQ5A 4G4SO 4IKOA 1Q44A 5CTJA 4EHNA 4QAQA 3DLTA 1AY0A 5A2GA 2VJOA 3BD8A 3WBKA 4I8IA 2W2NA 3O93A 6Q21A 3V7KA 5E6SB 1CLUA 3G17A 5DN9A 1NNI1 4C7OB 3BWDD 1DCFA 3HBFA 5FORA 5CLGA 1KEKA 1F4VA 5MGBA 2GPYA 2E2WA 1J24A 3OZEA 1M5TA 2GN2A 1U3DA 1EWTA 3EBLA 1KBQA 1JJBA 3EVBA 2QIPA 1S01A 4N41A 1YIDA 4YJKA 5ALPA 1FSPA 2DYKA 3L40A 1P9WA 1K7FB 2JLUA 3WLJA 3JATA 1L5OA 3TM5A 4QIWC 4YT4A 4KITB 4B74A 3T4EA 4YR7A 5AKZA 1Y3CE 2QTCA 3PHBE 4FNOA 2XT0A 1TCUA 5FD8A 2VYND 4P0PB 2HADA 2GCOA 2I1VB 1IRIA 2VTVA 1O4WA 3AR4A 2H0AA 1FU7A 3IPCA 2I6UA 1CJBA 3BHMA 5HSGA 1Z4IA 3T7CA 1EFPB 4KFTA 2NUPA 5BV0A 8ICMA 3I1JA 4KWTA 3NAZA 1BOOA 2J30A 3A9SA 4KMSA 8ICNA 4MS4B 3ZYCA 1U0JA 4UXIA 1XQYA 2Z2KA 1U28A 621PA 5AJHA 2Q9CA 4WOBA 5LJLA 3AWDA 5C8YF 4ZMRA 2X5KO 2VDLB 5CK5A 5KYYB 4FN5A 1YS4A 3KXKA 4W9RA 2B37A 2ZSIA 1UBFA 2HHHB 1ORHA 4I9HA 1GVHA 4WN9A 4C88A 1PU2A 4C8OA 3MS4A 4ALJA 5EQTA 3T8YA 2F17A 2NNWB 3PC6A 5AVTA 5CVDA 2HA2A 3C5CA 5DJ5A 1Z0DA 2WB1F 4ILKA 2FQYA 5J29A 1PUJA 1SQ0A 3GLKA 1G8PA 3C1OA 1IOZA 1XWIA 1QRDA 3DEAA 2W93A 3A6DA 3KZMA 1ZJYA 3Q15C 3N5KA 1NJ8A 4ZWNA 3CFYA 3LVQE 1FIUA 4X63A 5CFPA 2OGUA 3FCAA 3CSUA 4TS4A 2HF7A 2NV2B 4QXRA 3TRJA 1QNLA 1M6EX 3OT5A 1C41A 4OUDB 2BMVA 2C2OA 1CBUA 1G9TA 4JXJA 2GJ4A 2PWYA 2ZPTX 4EBCA 1GP2A 4TSFA 2V4ZA 1ZN7A 4LBYA 2XDYA 3UH1A 2I76A 1W6UA 3B1WA 4LTNA 4WZBB 3EY4A 3HX0A 3WL3A 2ZIUB 4NU5A 3HWTA 1IY8A 5KWEA 1T4BA 1CJVC 4JGGA 3CS3A 1C50A 1VLBA 3BJZA 4DW8A 1RLOA 2G6TA 2QRZA 3UBTA 3WGIA 2Z2YA 1RBMA 3NDRA 1MT3A 4EP1A 4ZPJA 2XBUA 5EERA 2IC5A 4NJEB 3I1YA 3M33A 3Q9UA 2XQKA 1E61A 4QHSA 4BV9A 4PC7A 4XIYA 1U9JA 5HIIA 3QYAA 2D5IA 4AQDA 5DLFA 2H9AA 5K05A 2CD9A 1D2CA 2EDAA 2WPDD 3DFMA 4QVKA 5D3MB 1WULS 2HBMA 5JZBA 2B92A 5HZMA 3E35A 2AR7A 1Z2EA 4N6OA 5TC4A 2PVPA 4HNAB 5I3CA 4D0NA 1S7GA 3F97A 1EWKA 3ZNQA 4I50A 2ZAGA 4JLUA 1M6VB 1Z34A 2QRUA 4E4TA 4KQ9A 2RAUA 3EUAA 5CD1A 2KVCA 4PHFA 3CCCA 2DWPA 4TTTS 2J6UA 4PHDA 3L6RA 5C1IA 1NW7A 3HVHA 5G0UA 4GXNA 2IQ5A 5BSRA 4CT5A 1MGOA 4R1QA 1EUDA 2EVWX 2QV7A 5LQAA 3PHIA 4IH1A 1W4CA 4LAFA 3FZQA 1XL0A 2QWXA 4C5AA 1ZP6A 2D8MA 3VO2A 3MCUA 4MCIA 3B38A 4B40A 1ZN8A 1Q0HA 3DLAA 3CF4G 2KV2A 1JR3A 4R9NA 5IAOA 3GFPA 2ID4A 4DXHA 1I36A 3RAPR 3JQ9C 1I14A 4AS3A 2VSFA 4I27A 1EWVA 1YMQA 2H5JA 4URVR 3RS3A 1RJFA 2LZ0A 4BIMA 4J1NA 3NVMB 1TT5A 5JY1A 3N7SC 3OMWA 3VHQA 3F4BA 1HPLA 2RGCA 4D9BA 4TT3A 5I01A 3WAKA 5CDSA 2BJVA 5T6MA 2Z8ZA 1GV1A 1C4KA 1MAAA 4ZVQA 1JLRA 2OQRA 1R6DA 1QDUA 2PJZA 3WRXC 4RQ1A 3BH7A 5CU7A 2BP7B 4NEGA 1L7AA 4TRJA 2D1TA 1FW8A 3UWPA 5B12A 4HN9A 3A28A 4C01A 2HW8A 1QOZA 1VRWA 4OGKA 3UJ7A 4U9UA 1E6LA 2FPGB 1TZKA 4F5DA 2XNCA 4R54A 3P9KA 4M1ZA 2HZBA 3D81A 2C29D 1MD9A 1ZXXA 4KN5A 3HCNA 4RZHA 4PPGA 4ZT2A 4IS3A 2LNDA 1PJCA 1YC5A 1SXJC 2I0FA 1BNOA 4URXR 5MN6A 3MINB 2WG1A 4QWWA 2Z1DA 1HFJA 5LU9A 4EG0A 3ET4A 3PXDA 1G8HA 2QTZA 4HWSA 4OQZA 1UMCA 4WKGA 1TAUA 3K0AA 1TYEB 5FBWB 1DRUA 4ECUA 1NFQA 4WZAE 4N9QA 5L51A 4OI1A 1HF3A 3KC2A 3S1LA 5I5GA 2VJQA 1FMJA 2XMZA 2B1GA 4KDCA 4AZ3B 4JQOA 3OWXA 2X40A 3NBQA 1J42A 2A14A 3IDQA 2CD7A 1JTFA 4IQ4A 1J07A 2Q3EA 5DFAA 3AMZA 1UADA 1W5FA 3FYSA 1M5UA 1E1LA 1SCUB 1TYZA 1E5QA 3D3WB 4I1UA 4JWKA 2VH2A 1G7SA 5ALJA 5FQOA 1Y9EA 1FUYB 3ZGXA 5HDBB 3U40A 3ZE1B 5JROA 3RHZA 2OZPA 3HJNA 5LKRA 5EHNA 4FQ8A 1GKIA 4BO9A 3UWMA 1C4WA 2A5LA 2QXUA 5FCDA 3TOSA 3O1JC 3C4QA 4KLTA 3PO4A 2ZIUA 1G19A 5J9FA 1VDMA 4I81A 3V97A 1Q1NA 4NIMA 2F7SA 5DDMA 4BPBA 3BWBA 4O0MA 1KETA 1X87A 1KGDA 1G2QA 5LP6A 5HK9A 3H9BA 4EJ0A 3OJFA 4RNOA 1ESEA 1ODFA 4NJEA 1UPTA 3I9MA 2J33A 1YO6A 2HO4A 3QWBA 2OZLA 1QHEA 1UWVA 4GT1A 2BFMA 4AMVA 3MMZA 2PM8A 4YRDA 3USZA 4C4OA 4ZARA 2BFPA 3W9BA 1CUZA 5D3MA 2O8DB 3H1PA 1R10A 5DPMA 4HNAA 2Y0BA 3WHKA 2JCGA 3L9XA 3HYSA 1IBRA 4F84A 2QQEA 4HDAA 3UXPA 3V7JA 4YMIA 3GFQA 2NXWA 1FUUA 2FFJA 2B5OA 1Z75A 2J85A 2GQ0A 4ECVA 5KFLA 1FLAA 4BGIA 4JBLA 4OQYA 3DBOB 1FLVA 1A6SA 4MVJG 2CBXA 4MK4A 1BYIA 1C20A 1DP4A 1PL8A 1Z26A 2QE6A 4N3NA 3Q8RB 1O0SA 1OC2A 4YP5A 3F6YA 3TQCA 3RRJA 3PFFA 3T7KA 3UKDA 5K8IA 3PZPA 3IVGA 4D4KA 1AMOA 7MHTA 9ICWA 1OR8A 2EU8A 5EEHA 2Z56A 5G02A 3GRFA 3F8WA 3RVRA 1N2XA 3C2MA 1Z3IX 5J2UB 1BU5A 4RIGA 3TX2A 4YH1A 2K5UA 4F2DA 1DS6A 2YRFA 4HQNA 2WA2A 4YR9A 3MGAA 1NVEA 5FPSA 1ADFA 3IC5A 1YULA 4JR1A 3GF4A 1JEJA 2BMEA 1X7WB 4ETWA 1P7ZA 4MP3A 4YX9A 1KK1A 1TKCA 1SQFA 3SR6A 2GVNA 3E7PA 2FDXA 1UOQA 2FR8A 2XRYA 5JNRA 2R751 3VC2A 2DPGA 1NE7A 1EHIA 1T0IA 3R7AA 4BNTA 5K2MA 2PO7A 4M9HA 4QATA 4E15A 1XD2B 3DW1X 2BMDA 1LJUA 2ZRLA 1NN1A 3BD9A 2O8FA 2ICAA 4NEHB 3AO0B 3PUKA 4YP1A 3AM9A 3AFOA 3A1TA 4QRHA 4QLAA 4X3PA 4IUCS 4XFJA 4BLSA 4JI0B 2D1QA 3PXXA 3D1VA 4Z6DA 2XYHA 1KEJA 2YWHA 3GRYA 4M9NA 4P2GA 3I04A 2A4KA 2YWDA 2CMHA 4HSGA 1JFVA 4ZALA 2UYQA 2NU7A 3E9QA 3OIVA 1OTHA 2IXBA 5KVVA 4DM7A 2Q29A 3ZD7A 1E58A 5LA6B 1X86B 2HHWA 4AZ3A 5FPKA 2ZYUX 1DRVA 2X0FA 2CEAA 2WB2A 2NZUG 2Z4TA 5HR7A 1SKYB 4CQLB 4ZRNA 3SYTA 4F46A 3GLFE 2VKTA 1Z68A 4R81A 2W9CB 1V7ZA 3FH0A 4ZTZB 4YJ3F 4DDTA 1RTTA 3LWLA 1VI2A 1S0OA 2J6HA 2AJCA 3AIOA 3D6FA 4ZAFA 3C6MA 2YWRA 3AB8A 4RU9A 4RQAA 1FFWA 4OQPA 4DDWA 1EGHA 4CM4A 1R0CA 4AZ0B 5FFMA 2R65A 3N07A 1K66A 4CR6A 2FYTA 4D3FA 2EJCA 2I7XA 4DLWA 4JLAA 5EXEA 4IS2A 1V9PA 4M9JA 3RYCB 2I1WA 3ADKA 1H2WA 1GAWA 1GSHA 1JHRA 1ZD2P 5ALFA 5F76A 4QFDA 3QLJA 2PX2A 5DX1A 3OOSA 3GEGA 2QT1A 1IHDA 3Q8XB 4FW8A 2CV0A 3NCTA 4JKYA 3UWSA 4BMCA 3MW8A 5IIJA 4MKXA 3RVSA 3EVFA 4BN4A 2JB9A 1FYFA 2ODAA 3TLCA 1E2FA 1KIFA 1PJ8A 2ZKIA 3R6LA 1C3OB 4KLUA 3HPOA 1CQJA 4R0VA 1JIIA 2FSPA 3UHAA 3NATA 2FE4A 3Q72A 4J3FA 2QKQA 3PEUA 5B5SA 5DO9A 1NHGA 5J0PA 2GYYA 5H02A 2B8NA 2FLVA 3DOHA 4R1UA 3LKDA 2FWMX 4EY7A 3GRRA 2BONA 5E38A 4RF3A 2GKOA 2XGMA 4P4OA 3P0HA 4XM1A 2O6HA 2ZIAA 1VA5A 4NYIR 3HY3A 2JZCA 2VOEA 4E33A 1CQPA 4PH5A 1BN7A 2Z9CA 2GWSA 4MJXA 2DETA 2EP7A 1TA0A 1K3FA 3EXG1 1XPUA 2XYGA 5ICSA 3B20A 4BHTA 1CFJA 2AKEA 1ZQKA 1ISRA 4BCCA 3HPRA 3CF6R 3OLWA 4B3GA 1OLSB 2IMWP 4UEWA 5DTIA 2AK3A 1R8QA 3ZDBA 5AI4A 4DFKA 1N6OA 4G0MA 1GPMA 1QRUA 1J5EB 1ZJWA 2AQHA 2QL7A 2I65A 1ITZA 5DLGA 1AE1A 4BMXA 2R68A 2P91A 2F9FA 1FE8A 3IEKA 3LDHA 3NKFA 5ES3A 2B0CA 5KVSA 5G1OA 4YAGA 1JE0A 5KTMA 2LIPA 3GT3A 1EIZA 1F6WA 5JSHA 4TV9B 2PKWA 5CNMA 5IM4F 3IAHA 2PSDA 3ITEA 2P6OA 3VNSA 5KFJA 1GGEA 3HA3A 2DUYA 4KPUA 4I14A 2WABA 4GMDA 4R0NA 2PL3A 3IP1A 3UJ8A 4GMKA 2D5AA 2IE0A 1XD2A 3NV7A 2Z7JA 2R4TA 4NL9A 1C3VA 3H9UA 1YR2A 2QRVA 5J2UF 2GUGA 1SO8A 5B66U 4Q03A 3K9QO 1EKXA 3BMQB 3QEMB 2FXVA 5CUQA 2ILTA 5HE9A 3L1KA 1EI9A 4EGQA 4L2IB 5T3UA 3SQIA 3BS5A 4F3CA 3GYBA 4PZ9A 4AKGA 1ENPA 3X1ZA 5BXYA 1NWHA 1JRPA 4H9GA 3KU1A 2W37A 4I9UA 3NOQA 4H6VA 1Y1KE 1XUOA 4QU9A 4DR5B 4G3IA 1GFSA 2EFYA 1KERA 5EWEA 2BFCA 1U2EA 4HR7A 4A0FA 4IQ0A 2WJ6A 4XX0B 2JS7A 1PFKA 1MA7A 2PI5A 1UMKA 2YH2A 2HJGA 2X76A 1D2RA 2QTNA 2IPXA 4NLKA 3KZVA 5C7LO 1EJ0A 3CURA 2R6DA 2ISSD 2J4FA 1G8JA 4GZ6A 1XP8A 4OI2A 5B37A 4CV2A 1SNYA 2W9CA 1TC2A 4GXRA 3Q3HA 3LD9A 2BZ0A 3PFGA 1P80A 4UTXA 3DEJA 2GJKA 4ZHQA 2JIPA 2IXFA 4YDQA 1M1ZA 3B3GA 3LHFA 3EUFA 4J6EA 2AMLA 5KKAA 1E20A 4LF7B 5LA6F 2JAWA 3WS7A 3D2BA 3SEFA 1YOVB 4HDKB 2O54A 4EDHA 3MJDA 5HNKA 4I5FA 2RDJA 4COKA 5KAMA 4JJ4A 5JJLA 2JANA 1F0YA 3B2QA 5C5JA 3AL3A 3D7LA 2IU4A 1U5BA 1KDYA 4I46A 3IIKA 4X1KB 4IMRA 2JIZA 4M1TA 3C3CA 5ALEA 2RGWA 4B4DA 4Y7CA 2MU2A 3KEMA 4FBLA 1CEYA 4XAQA 4C6RA 3BZCA 2VJ5A 3PC4A 3PFIA 2CXHA 3H1BA 3PIDA 5FPQA 1VLHA 3R0IA 1PIWA 4XRHA 3SC6A 3TVDA 1NQOA 2REXB 3GIWA 3PIRA 2LMRA 3SHVA 4KN8A 4D3YA 3M7DA 4Y3UA 4Z9BA 1ABBA 1P4SA 4ZCLA 5FAXA 4JV5B 1CK4A 1SBIA 4N48A 2GNAA 1D4FA 1T4CA 4JJKA 1CB0A 5K3OA 3EA4A 7ICSA 2A30A 2CXRA 4QG3A 4ND3A 3HMKA 4WN3A 3WMRA 2ZWIA 4UXJA 2WVAA 2YVLA 3P97A 5I9BA 5EWJB 4ZQBA 3SLKA 3ZR4B 3U7HB 3KOWA 3NWJA 1R0WA 1UOEA 2JCSA 2JH8A 5G41A 3GGDA 3HXTA 1Y3IA 1NN3A 1GN9A 2JASA 3KQUA 4PIMA 1T25A 4P53A 5GZ6A 2A7QA 2WV9A 1UZAA 2GUWA 4DXAA 3L8EA 4HL6A 1ZQRA 1ZXBA 1Z5UA 1RIIA 5KOJA 5G4KB 3W4KA 2RB4A 3A4LA 2OXOA 3IP5A 3PJEA 5I7VA 1RJ9B 5BOVA 3KCQA 5CPBA 1Y7HA 2C5GA 1RYFA 1PTKA 4R64A 3WKBA 1K8ZB 1YRLA 2GRJA 1X8LA 5DBEX 2HQBA 1U04A 1CRWG 3LBYA 4OGWA 3WGZA 4DLTA 4QXAA 1IEQA 5A2QA 4L1KA 5E3IA 2O2YA 3TNJA 3OBBA 2PZJA 1Y63A 1K6XA 1RLUA 1Z15A 5THQA 2VG8A 1C0KA 4QREA 5AQ1A 1D1QA 2A8YA 3AG5A 2WJ3A 1PZGA 1H9AA 4UATA 4TV9F 4IQUA 1N0IA 4X6UA 2A1UA 1KAHA 1T9CA 3HL0A 3C85A 1E5VA 4HADA 2J3HA 3VR0A 3EWNA 4DDKA 2BM9A 3A6ZA 4E2FA 3R3YA 1YVPA 5DQGA 1LDEA 4AFNA 3ZZ0A 2Q0XA 3ISTA 3ORSA 1L4GA 3R0JA 3KKQA 2PNJA 2GPJA 3IAUA 4XX0A 4KFCA 3Q12A 2JJ2D 2ZYDA 3TRIA 1N32B 3MWKA 4EPVA 4LXXA 4QJ3A 3AERA 2ZB2A 4IHJA 3NH6A 1BA2A 5A0TA 4B8YA 1G16A 5FTNA 4LXYA 3VAZA 4U5QA 5KIAA 2DKOA 1U2SA 2JAQA 4ZTBA 1QH1B 4IGFA 3H83A 1T9HA 4D42A 4ZPXA 5FBZA 1ZKMA 3VDRA 5AXBA 2Z5VA 4KLMA 1HDXA 1SU6A 1EUCB 4Q21A 1ZJ4A 4EJMA 5JAIA 3P0EA 3MERA 1OLXB 2YZ2A 4YAOA 3SHFA 1QKKA 3M6AA 1I7SB 1JILA 1IUKA 1D7OA 3AGPA 3IUNA 2EXXA 1P4HA 5AVWA 1BXRA 2XB2A 3SQDA 1NAIA 7ICGA 3AP1A 3WLMA 1O54A 5I9MA 1CZOA 4FW9A 4AWAA 3QYJA 2XMPA 2BSQA 2NYAA 1TEZA 3O74A 3LF2A 3ISVA 4J9MA 4HQRA 1XTIA 1YB5A 1EM8A 4F8YA 4UVEA 3FPEA 5FPHA 4MMXB 4CDMA 2ORVA 3E8XA 3NXKA 4I1OA 1W96A 4QODA 4WZAA 1NJFA 3AEXA 3C74A 5LUBA 4JBHA 3K1JA 1JR3E 3SYMA 2OZVA 4BO3A 4ZOEA 5LD2B 4EO7A 1N3BA 4GOMD 3R8XA 2AU0A 4ZMBA 3AEQB 3UATA 4C7BA 4BO8A 1B42A 1R27A 5ENDA 1A8HA 4B31A 1D8YA 1ZQOA 3GLFB 1LS6A 2XNHA 2WIGA 4HAZA 4BJ5A 5YASA 3FTDA 4IDOA 2Y0SC 3VAAA 1V5EA 5TQ2A 4A6EA 1LPNA 3P2MA 1KPIA 1KDPA 1KGSA 2VJKA 3PNQA 4DAOA 4Q4HA 1LRKA 4IIYA 4GQIA 1XJQA 1ZK1A 1DQNA 1N5RA 2FPXA 1ZAYA 3DE5X 1OW3B 1PR1A 2VDVE 4NBSA 4ICIA 1FX0A 5COBA 2XNJA 4P4MA 3IVCA 3KQHA 1Z13A 5IAKA 3VVLA 4PV7A 4MROA 1S5LU 5HFAA 4X44A 1UAYA 2DBZA 4EBFA 4UTPA 2B35A 1ONOA 3GZ4A 4JI4B 4R1LA 3I9OA 3CRW1 1RRMA 4B44A 4RTLA 3OX3A 4IMIB 4RTMA 2HA7A 4KQKA 4UBLA 2EAOA 2DUJA 5L53A 3HRDD 4FKZA 1EXVA 3C0KA 3R6WA 4KI7A 1W48A 1AXGA 1BEUB 3UMBA 3BFVA 4BWYA 3TSYA 1BWQA 4OYYA 1XQ9A 2NVUA 1GZ4A 5IH7A 1U9CA 1FDVA 1CF9A 4WBSA 5DLQC 2OVFA 4UQOA 4DUYB 3KSDO 3TZQA 3CLUC 3TGLA 1PFWA 3DPSA 2OC9A 9LDTA 1YVEI 1RYRA 3KQOA 3WHIA 1NG9A 2VDQB 4QULA 3T0GA 2P35A 2OV4A 4XZ3A 4EI2A 1FEZA 3HI4A 4YVFA 1HWYA 1L7OA 3CRZA 4WX2B 5D7NA 2Y1JA 2A9RA 4CMAA 1DJQA 4ZAYA 3D2AA 4DA9A 3EWAA 4BRSA 2YMQA 2P2ZA 5J5VA 4CCAA 2IH2A 3DHNA 4R98A 3RADC 3MMNA 3IPRA 4ED9A 5AW9A 3ZTWA 3MGIA 2WWWA 3FF4A 1NJ2A 3V1TC 2BCQA 2P4EA 2FLWA 3PSHA 3IXMA 4BLRA 1CU1A 4K8OA 2I91A 3QJ5A 1SUDA 4GLBA 1WPGA 2FVYA 3L0DA 3M6MD 3OIFA 3I5YA 5DU2A 5KTKA 5T8KA 2AC7A 4M8IA 3BPSA 4JXZA 1D03A 1FSSA 2QF7A 3M6UA 1KZHA 2QYSA 1ECCA 3LT5A 3BSYA 4QPDA 1OLXA 1TPZA 3RFTA 4FO6A 4C21A 4MW6A 4WZZA 1ND5A 3B7WA 5J23A 2D0PB 1GO3F 3ROXA 2FMIA 4Y8VA 3TJRA 3QE4A 3ZXIA 2HUPA 4K2AA 2PXHA 1DEAA 2AVNA 5UKDA 3NGDA 1JQBA 4ARUA 4CFZA 3W7AA 2B3TA 4XSHA 1VYHA 3I52A 3ON5A 1S0MA 1RT9A 2FF7A 4QZBA 2C28A 1W94A 2O3RA 1FFBA 3UT5B 4UTNA 1EEHA 4FVTA 3KIPA 1IWPB 4NHOA 1ZQMA 2VNHA 4XWOA 1JR2A 2P2NA 2IU6A 3WMFA 4IQWA 3HU1A 2H3HA 3F67A 4MKGA 4QWCA 3BMCB 4KQHA 4PY2A 3WGQA 1N5XA 5GONA 1GU0A 4MW5A 4U63A 4TSFD 1ZQ1A 3VDMA 3ROQA 3OM8A 4XOIA 2CHFA 2FW1A 4X65B 1EZ4A 4FHGA 4ZU1X 4HDMA 1NYRA 4WI1A 4DSZA 3FRHA 3MRXA 2QMHA 5BOLA 3WLTA 2CL7X 3R7BA 1SC6A 3UQ0A 3VVCA 3EXHC 4QU8A 3SWWA 4BQPA 3TXXA 3Q85A 4J8PA 1NC3A 4WINA 2IXDA 4Q6BA 4F3KA 3N28A 3WGUA 1JKIA 5F73A 2C2EA 1YF3A 3VOAA 4XYEA 3RBZA 2P69A 4YVZA 2GR9A 3ZLTA 4IVPA 4KI0A 2VA2A 3TYXA 5DLPA 4I6JA 3PUWA 3H4TA 4GM1A 4Q4LA 2A5JA 2ZXIA 3UJBA 3IBTA 1CIPA 3KDAA 3QKSA 1XV5A 5B2FA 2Q28A 3JPWA 2RHHA 3N39C 3LL7A 4EDFA 1GDDA 2XCUA 2YL2A 2JG3A 2EZ8A 4HCJA 2O23A 5IKXA 4QSHA 2QPAA 2C9ZA 5EJEA 4MRMA 3GIKA 3AHFA 1UMBB 2AA3A 1VKNA 4BGVA 1KI4A 2B9EA 2G7ZA 3VV2A 4RV4A 1V45E 3TGWA 2XR1A 5CB4A 2ZIEA 5CEFA 5LNK1 4OHYA 4FR2A 2Y0PA 1OROA 3STVA 2NTVA 2UVUA 1L4NA 1QCCA 4YRZA 1E2PA 1LV7A 2HJSA 3MJ4A 4NZ9A 2YINC 4JHXA 2OWEA 4F3RA 1N6HA 1JR3D 2XBMA 2VR1A 1BMFA 4GI5A 4K81B 2JIDA 3SBDA 3VA7A 2H1WA 1ZITA 1N8KA 3RIYA 4HTFB 4I9FA 1YZUA 2GXUA 2XH8A 1Z0ZA 2QR5A 5A06A 3DTVA 3PXEA 4N40A 4TT3D 3DEKA 1XEWX 3DSRA 1NPDA 4C0KA 2FRXA 3DMHA 1CG6A 3BORA 1Y1SA 3HCEA 3HB5X 2ENWA 3PL1A 3ORQA 3JATB 4MPPA 3NHYA 1LLCA 4U7TB 1PNTA 4XWAA 1AIPA 2BI7A 3ZV5A 1JNXX 5DDIP 1UCVA 3HRIA 2R84A 3CUEF 2GCOB 2EZ4A 3OZGA 3I3SR 3DP7A 4CQJA 4YCJA 3KETA 3IIIA 2JLRA 2QY6A 2GXAA 1V43A 4JEIA 3K1RB 1L5UA 3GJ3A 3NUGA 2RDMA 3LHKA 3D2NA 5MDHA 1P17A 4JD5A 5TRTA 3F8TA 6NULA 4J91A 5D6OA 3FJ1A 3PNPA 3CC8A 4W5NA 3OQOA 1ONNA 3PB3A 3W77A 1JKJA 3ADDA 3ZK7A 4WN9B 1K86A 5IBRA 4OOFA 3UGKA 5IXSA 3QUBA 3W2TA 1ACMA 4HQKA 4UUPA 2X1VA 2FVXA 4TOIA 1OA0A 2C54A 2O7QA 2C99A 5AICA 3DE7X 3ONEA 3ZLVA 1Z0UA 4GPEA 1ZQZA 1T0UA 1ESNA 5A4AA 1E2MA 1U7UA 1EVZA 3BCUA 3M1IA 4FS8A 3ENWA 1NBOA 2F2TA 1SCBA 3EOAI 4YLGA 3W78A 1DZIA 1X8JA 3DLIA 3MYYA 2R48A 3UB4A 1KYZA 5ETJA 3ZGOA 1LS1A 4NDNE 4GR5A 1GCIA 1FQOA 2IBMA 4D26A 4XARA 1C4XA 2WSLA 2VH5R 4H3SA 4D9IA 3V7YA 4CTKA 3K3PA 2X2EA 1GPUA 1XA4A 3WJ1A 1SHUX 1K2VN 4G5QA 4ELUA 2QHXA 3ANMA 4YYEA 2LKDA 1MIOB 1J8MF 5TJ9A 5BW4A 2ZYHA 4XQ0A 3ZCUA 2HWYA 4EKGA 2ORED 2JFBA 3CXUA 2TSYB 5L9AA 3OQMA 2WIBA 2YHSA 4GPTA 4I4TB 4K3UA 3INNA 3RJKA 3TF5A 1GLVA 2CVHA 3JZMA 1R0ZA 2I2FA 2PFQA 1LPPA 3VZRA 1WBJB 5AK0A 9ICEA 1KDRA 1XRQA 2YHAA 4QUEA 3ET5A 3W7BA 3ZHXA 2XEXA 4X9XA 1ZGBA 3FRIA 3ZV4A 3K70C 4J2OA 2J3IA 4IOLA 3F6BX 4I50B 4YRGA 2XRMA 4E31A 5ITVA 5CLLA 2WRZA 2ONYA 3HSSA 1IULA 1V8OA 2YZ7A 2GCPA 1WUYA 3RB0A 2J7PA 1VDZA 4MUBA 5ALKA 3H7AA 2D1FA 2KFZA 2ODWA 3FKSA 1SKRA 3ESAA 4AJIA 5LNK6 2X0JA 1Z5PA 4DCCA 1KXJA 3EZ2A 3Q3CA 4W5QA 2N0SA 1K27A 5ALDA 3G88A 5HE8A 4QQRA 2CK3A 4GMXA 4WACA 2QAGA 3F0TA 1CB7A 3GEIA 5CCEA 1Z28A 3AQ4A 1WV0A 4XQ8A 1SKAA 1Y98A 3OLQA 2EX0A 4GOLD 3EAQA 5DCYA 2AN3A 4ZZ0A 1JPUA 5AMXA 1R9GA 3IRUA 1TT5B 4FFBB 3WL5A 3BB1A 1XMJA 2GETA 4HH1A 4QZFA 3LP6A 5FV4A 4HTFA 4XYLA 1TDJA 3IO5A 1E9VA 3V5NA 2D3DA 3BM5A 1JNYA 4LKOA 2D8CA 2X5NA 4O3MA 3VX3A 4POAA 4EA7A 5IUJC 2FZKA 2W9MA 4RTNA 4BVFA 2H85A 2IPLA 1HT0A 3Q40A 1OVMA 3ZVRA 4YRQA 3GJTA 3T5AA 3QUQA 1HT3A 1UK9A 3GV0A 4H7JA 2O2CA 1IB0A 2J31A 1MZVA 4XYBA 2Y9PB 2VHJA 3AHHA 4AROA 3DLBA 5B58C 2BCRA 1E89A 2HO5A 2HWKA 3ETCA 4RADA 2ZCUA 4W8HA 4INPA 3HK2A 3STYA 3UK1A 1EHCA 1L5LA 1F4LA 2YJ3A 5I9LA 1LWNA 4HAIA 4OQFA 4NR0A 3ZD8A 3SFTA 1XZPA 1L7RA 5EZ5A 4HNVA 1XHLA 4C7XA 3NH9A 4PFJA 3F90A 4WBNA 4C80A 3OJSA 5E6UA 2WFLB 3TBFA 3UHFA 3B36A 3D4NA 4MF8A 2G70A 1Z73A 1O6FA 4E07A 1PR5A 1XZKA 1UMCB 4QBFA 3K0AB 1DG3A 2Q2VA 4Z9YA 4OFWA 3VZSA 1KYVA 1V95A 3LIIA 2JEIA 4F11A 4M0LA 1E9BA 1NBME 4CUJA 1ED1A 3CIOA 4YT8A 3MJSA 3GNLA 3DB2A 5IK2A 1KR5A 5EE9A 1J23A 4BX9C 1WVMA 1EJBA 1H2AS 1PTJC 1R6XA 3IM1A 4UMEA 4OF4A 1BD4A 4ISBA 4A0HA 4R2JA 5J5AA 3OVMA 5CVEA 5KT3A 2VNSA 1WB6A 3A9TA 4CWAA 2I9PA 3I9NA 4PAGA 3RC1A 1FDIA 3FYUC 1JFFB 2EWMA 7ICQA 2QN2A 1N5WA 3HFJA 1OXVA 4GKKB 2XEDA 1Y9DA 4MDFA 1RDFA 1E9CA 1UK8A 2WHQA 2C95A 5EIWA 1HFWA 4CLOB 4KH0A 1VBFA 4E5YA 3IDAA 4CTOA 3DFIA 3L04A 5C1DA 1TKRA 1OA1A 4BP8A 5K03A 4V39A 2A84A 3TR5A 4LS3A 4GWLA 4Q9AA 3NIBA