2W11A

Structure of the l-2-haloacid dehalogenase from sulfolobus tokodaii
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
206
structure length
206
Chain Sequence
PRGSHMIILAFDIFGTVLDTSTVIQEFRNKQLEYTWLLTIMGKYVEFEEITKITLRYILKVRGEESKFDEELNKWKNLKAYEDTKYLKEISEIAEVYALSNGSINEVKQHLERNGLLRYFKGIFSAESVKEYKPSPKVYKYFLDSIGAKEAFLVSSNAFDVIGAKNAGMRSIFVNRKNTIVDPIGGKPDVIVNDFKELYEWILRYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Biochemical and Structural Studies of a L-Haloacid Dehalogenase from the Thermophilic Archaeon Sulfolobus Tokodaii.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Hydrolase
molecule keywords 2-HALOALKANOIC ACID DEHALOGENASE
total genus 87
structure length 206
sequence length 206
chains with identical sequence B
ec nomenclature ec 3.8.1.2: (S)-2-haloacid dehalogenase.
pdb deposition date 2008-10-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13419 HAD_2 Haloacid dehalogenase-like hydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.240 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 Putative phosphatase; domain 2 2w11A02
3.40.50.1000 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HAD superfamily/HAD-like 2w11A01
2YMLA 4BNDA 5AKLA 3OCXA 3OCYA 5AVQA 2VKQA 4OD0A 5ALVA 2HCFA 2G09A 2OA0A 1Y8AA 4E88A 2I33A 5AW2A 3L1UA 2O9JA 3DAOA 5ALHA 4OCZA 3WK9A 1L7OA 4OFZA 1RKQA 4YGYA 1SWWA 4XPZA 2FPWA 4UMEA 4BNDB 5AK6A 3WK8A 2D2VA 4BX3A 3R09A 4XE5A 3SMVA 4KN8A 1PW5A 5ALMA 2B1RA 3MMZA 4Y3UA 4YCMA 5AVUA 3AR6A 3FPBA 1KYTA 4DW8A 2MU2A 1T9ZA 3FVVA 5AW9A 5AVSA 3PGVA 2NO5A 3ED5A 3U7GA 2ZOSA 1VFPA 3ESQA 3FPSA 2O2XA 1QH9A 5AI4A 2PQ0A 4FFDA 1VJ5A 2AUTA 4UAUA 1N9KA 2FPUA 3I1YA 3W5DA 3U7FB 4YIKA 4HAIA 4UASA 3IB6A 2MSNA 2HF2A 2YMMA 1WZCA 3SLRA 3ZX5A 1XP5A 3EF1A 4OHFA 3EWIA 4CF3A 5AESA 2GFHA 4C4RA 5AI8A 4DFDA 4ZEWA 5A3QA 3ZUPA 2EAUA 1L7MA 1IWOA 2JARA 4G63A 5AM3A 4Y2SA 2IOFK 5ALWA 4YH1A 4MUMA 1WPGA 4CF4A 3L1VA 2QYHA 3M9LA 2HDOA 1TJ5A 3EPRA 3SKXA 4XQ0A 1U2TA 1K1EA 4JB3A 3AR5A 2EARA 5AVTA 3HLTA 1TE2A 1O08A 2CFSA 2HOQA 3QU9A 5AKIA 5AKEA 5ALOA 3SF0A 2RAVA 3QUBA 2R8YA 3B9BA 3NALA 5AW6A 4HYTA 2FEAA 5ALZA 3I6BA 1NF2A 3WKEA 3AR3A 2ZBDA 4F71A 4HGQA 3ZX4A 5ALPA 4EENA 1QQ5A 4Y2RA 1RKUA 2HSZA 5E0OA 3OPXA 2JGAA 2AGVA 4MWOA 4BEVA 2IA5A 3MC1A 5ALGA 1Z4PX 3ZI4A 2YJ6A 3R9KA 4L6AA 3W5CA 3KBBA 4J2TA 2G1AA 3QXGA 5AI0A 3W5AA 3ZWDA 4YIHA 1RPZA 5AVZA 2G08A 2FPRA 1S8OA 4Y2TA 2PKEA 1EK2A 1L6RA 1RLTA 2HO4A 3J7TA 2OYCA 4QQFA 4Y2UA 4O8CA 3ZU6A 1Z4LA 2IOFA 3PGLA 4I9GA 1RQLA 1XVIA 2WFAA 3NRJA 4EZEA 3DV9A 3IRUA 4KNWA 3L0BA 4EEKA 4NFLA 1JUDA 3RFUA 3HYCA 5ALUA 5ALTA 4UM5A 3QU5A 2YN4A 4HGNA 2ZBFA 2MU1A 1YV9A 1QYIA 1U02A 4KNVA 3ET5A 3E8MA 3A1DA 3QUTA 4Y2XA 1ZD2P 5AM0A 3WKBA 3S6JA 5AK4A 3WK6A 4ZEVA 5AKXA 3I28A 2Q4TA 3WK7A 2YFYA 2HI0A 1YMQA 1LTQA 2P69A 2I34A 2C8KA 3GYGA 1FEZA 4GXTA 5AM4A 3KDPA 5AI9A 1YS9A 2I7DA 3I76A 3QLEA 1ZD3A 3OCWA 3L0YA 3L8GA 1SWVA 4IFTA 2P9JA 2C9MA 3A1CA 4AS3A 4BKMA 3M1YA 1X42A 2GMWA 5ALYA 4Y2JA 2IYEA 2B0CA 4KX3A 2BY4A 3QX7A 3NANA 5ALDA 1Z4IA 2C8LA 2BDEA 3BA6A 5AICA 4HGRA 1YJ5A 2R8XA 5T41A 5AIBA 1Z5GA 5ALFA 3CZ4A 5AKGA 2HF7A 3BWVA 1QQ6A 1N8NA 1ZS9A 1ZD5A 3MPOA 5AVVA 1RMYA 1F5SA 4RESA 1U7PA 1CQZA 1Z4NA 3L0CA 3SKYA 3QYPA 2B82A 3KC2A 5AVXA 5ALEA 1J8DA 3AR8A 2GHQA 1RLOA 1QQ7A 2AH5A 3K1ZA 5ALIA 3QU2A 5JJBA 3MN1A 5ALLA 1VJRA 5AHXA 3L5KA 4XOUA 1LVHA 5ALKA 1Z4OA 3EF0A 4H1WA 4Y2QA 1RMTA 2C88A 3OCUA 3U7EB 3L7YA 1Z4MA 3P96A 4UU0A 3WGUA 2CFRA 1U7OA 1RMQA 3QUQA 2RARA 2QLTA 3N07A 3OCZA 1Z5UA 4DWOA 3WKDA 3ET4A 2W11A 2B8JA 4HGOA 1RQNA 5ALSA 4AS2A 3AR4A 4KYTA 2WHEA 2OM6A 2ZBEA 4J03A 2B1QA 2P11A 1RDFA 3ZWKA 4DCCA 2HHLA 2ZBGA 2G80A 3UMBA 3FZQA 3WKAA 5AM5A 2W4MA 3IJ5A 5ALXA 5AW5A 5AW0A 5AIAA 4NABA 2HEGA 3QNMA 1L7NA 3PCTA 3KOOA 2NYVA 3WKCA 2YY6A 5AKKA 3L8HA 5A3SA 2ZG6A 1XPJA 3N8GA 1J97A 1MH9A 1CR6A 3QU7A 3DDHA 3PDWA 2IOHA 4QJBA 4AP9A 3E58A 3SD7A 2Q5EA 5AK3A 1Z4JA 4NV0A 4EX7A 1ZD4A 1ZRMA 3TLMA 4L57A 5IT0A 2CFTA 4EELA 5IT4A 2JAUA 3KD3A 4I9FA 3ZVNA 1Z4KA 2I55A 1ZOLA 5AKYA 3U13A 1S2OA 2WM8A 2OBBA 3E84A 2I6XA 3U26A 2JAOA 3WK4A 2CN1A 4ZEXA 2WF6A 1U2SA 3FGOA 1TA0A 3UMCA 1L7PA 4NWIA 3AR7A 2EATA 4L6CA 3ZVLA 3L8EA 3W5BA 4BX0A 1RLMA 4CE6A 5AVRA 5ALJA 4BBJA 3QUCA 3B8EA 5ALQA 2ZXEA 2YJ5A 3L8FA 2C4NA 2DQSA 4CF5A 1SU4A 2R8EA 3OTQA 4JDPA 5AW3A 4UM7A 3E81A 3VAYA 4UMFA 2RBKA 3UMGA 4CNQA 1L8LA 1ZJJA 1YNSA 3ONNA 5AM1A 5AW8A 1ZRNA 4UW9A 2YBDA 2FDRA 3WK5A 2P27A 3AR9A 3QU4A 4Y2PA 3UM9A 1Z4QA 5AVWA 2B30A 2R8ZA 1TJ4A 4FE3A 3NAMA 1Z88A 2Q4RA 4UARA 4UAVA 1Q91A 3ZVMA 1TJ3A 2YJ3A 2W43A 1NRWA 3N5KA 4RETA 3U19A 4BYGA 2RB5A 2JAWA 3A1EA 2ODAA 2YJ4A 3FM9A 3QGMA 5FP0A 4KX5A 3NASA 2FUEA 3DNPA 4UMVA 4C4TA 3ZW7A 5AW7A 5AK5A 1RKVA 2FUCA 2WF9A 4C4SA 4YCLA 2B8EA 3R4CA 4NAVA 3D6JA 4YCNA 1RRCA 5AKHA 2YMQA 1RC8A 4UU1A 4Y2YA 2GHTA 3ESRA 5A3RA 4F72A 5AW4A 5AVYA 2I54A 3SHQA 4UMDA 3OCVA 5ALNA 3ZTWA 4IG4A 3F9RA 2GO7A 4BX2A 3B9RA 4GIBA 2WF8A 3ZTYA 3N1UA 5AKZA 4BEWA 5IS2A 5AI6A 1WVIA 4PNHA 2AMYA 3CNHA 3NIWA 1T5SA 4B6JA 2PR7A 5ALRA 2FI1A 2YMPA 4EX6A 1NNLA 1EK1A 3RF6A 1WR8A 1Q92A 3WGVA 2WF7A 3KZXA 2WF5A 1L8OA 3AR2A 2G07A 4UATA 2X4DA 5AM2A 2NO4A 1O03A 2FPSA 2HX1A 3U7HB 4G9BA 1YDFA 4HGPA 5AKJA 5AI5A 1AQ6A 2BDUA 3N28A 1T5TA 3NUQA 5AW1A 2G0AA 2FPXA 4FYPA 2G06A 4Y2VA 3A3YA
chains in the Genus database with same CATH superfamily
4KLIA 2QRJA 3BSWA 5EE3A 1WP9A 4AG5A 3OCYA 3I73A 1V41E 1TQ8A 1I4TD 3CEAA 3E9YA 3S0JA 3T9FA 4DHWA 4EHKA 3KXIA 4G5QA 4TLEA 9ICVA 2JIOA 2VXBA 1UODA 1F9EA 4GXNA 3ZV5A 1CG6A 4C0QC 1AKUA 4D9KA 1YKSA 2I33A 1E3QA 1KK3A 4FFNA 4OLJA 2YOGA 5AHKA 3OZCA 3S8EA 3S29A 4AB1A 4YR3A 3HNRA 5F5XA 4U3JB 3P9XA 3T94A 1KYQA 1Z3CA 1T0PA 4XVUA 3GNSA 2CVZA 2PMZF 1RPNA 1HZZA 3E2PA 3NRCA 1T1SA 4ZQFA 3ZY3A 2AEEA 4G67A 4XPZA 3FTEA 4AAYA 4BQNA 1F4VA 2UVPA 1V7CA 2VLBA 3IUPA 4L4RA 3T1OA 3DVQX 4X92A 3IJPA 4EPTA 4LZLA 1P1BA 1T2VA 2O8FB 4BFTA 3P9QA 1THGA 2X1HA 3TANA 5LZ7A 3H3JA 4EY8A 4R16A 4URUR 4XYEA 2XQJA 4LCBA 5T6BA 1CY4A 2XZDA 2QRLA 4DUYB 4OBEA 1XX6A 1EUZA 4CTNA 4FS2A 4BUGA 7REQB 4M9ZA 1UBEA 4BWVA 2G04A 2Y1WA 1B6RA 5B6IA 1T1GA 2XWSA 3T4PA 4E1BA 4ED3A 2VATA 3IXMA 3UV7A 4GM4A 1UOOA 3HBFA 1PFGA 2R6DA 1XNHA 1F0NA 4RXTA 4UDXX 5HJ7A 1JG2A 1HDGO 3HBAA 3QITA 1M1YB 1VJ5A 1E3EA 2I7VA 4RV4A 4YP5A 2XZOA 1VZ3A 2ZB8A 3F6CA 3GZNA 2NM0A 2PBLA 3R3HA 5CP2A 1JEQB 3HYTA 4B8YA 2OK7A 4I9UA 2J5RA 3CLSD 2WM3A 2XA2A 2HBLA 1HL3A 1WZCA 3WRYC 5M04A 4H59A 3HM2A 3CNNA 5J9FA 2VIIA 1EDZA 1KMHA 2GF0A 4MA0A 4D9BA 1X7DA 5CXSA 3SZGA 4B7ZA 4RORA 1LXCA 4NXZA 2C5HA 4F3KA 1IN1A 1QSYA 4G63A 1X19A 2W6JA 1YMUA 1FO4A 4ZK2A 1NULA 1NXWA 5LMNB 1NMEA 1O5IA 2IRWA 3PDHA 4A36A 3H65A 5JHHB 1RJ9B 2R8IA 3LM8A 1TZBA 2AN4A 2FWPA 5DLPA 3LWZA 4NEQA 2BUCA 3OBBA 1XUOA 2E37A 2AQKA 1EIZA 1RHJA 2J9FA 4O4JA 1IUNA 2G6BA 3RFTA 2A2ZA 5B5EU 2XYVA 3SSAA 3IEIA 1DQPA 2EHJA 5JUMA 2NU9A 2BRUC 2CDCA 2IYAA 1EHIA 1SC1A 2DPHA 2H48A 1PP4A 2CFSA 4Z54A 4ZOLA 4DQQA 3D1LA 3D8BA 2L17A 1DRUA 2OD2A 1O96B 5FWXB 4FR0A 2FP4A 2B0JA 1T4CB 1XZ8A 3AN1A 4UNQA 1G64A 2P35A 3LIPA 4HDCA 5SZKB 4ARAA 1P3DA 3C2MA 2YWCA 3C4VA 1IPFA 4RQMA 3QVVA 3S7TA 4F2HA 3NHZA 4HG2A 2XYPA 3HA3A 1JHDA 1SHLA 5AHWA 3E0FA 2BKVA 3AJEA 2BM9A 3KEMA 5FBQB 4F71A 5EZSA 3TQRA 2RCYA 3E3MA 3SX0A 2JIMA 1UM9A 4Z6KA 3HXKA 2EEZA 3UC5A 4TURA 2XY7A 1UP6A 2WJHA 4ZO6A 4F4IA 5A2QA 2RGNC 3DOOA 1G7SA 1B6TA 4QZCA 1G3RA 3MC1A 2YWHA 4BZQA 3WMRA 1K8XB 2HHXA 3UK7A 2CXTA 4E6PA 5LZ2A 2LHTA 4H3KB 4C5AA 3FNBA 3H17A 4TVKA 5C4MA 4NBWA 2PS3A 3R76A 5KOJB 2PX0A 1ZQWA 5JDIC 3OCJA 2O8VA 4NARA 2RHWA 5M5BA 1UOEA 1DC8A 1O95C 2G40A 3GAAA 3JARB 4XWYA 3TQSA 2IU4A 2Y05A 4Q1CA 5CTJA 3ERCA 1MA0A 3N0TA 2HBRA 2ZLBA 3I32A 3OPNA 5HE9A 2UDPA 1R7RA 4CTOA 4D26A 1AGNA 3QY0A 3H11A 3J7TA 4ETIA 5BYBA 5LA6F 1PGPA 1YFKA 1TZMA 4B9UA 2RCNA 4BNIA 3OQ1A 1P18A 1D2EA 1FVHA 3G49A 5CXUA 1BN7A 3ZW8A 1PDOA 1WXGA 3H87A 4OJLA 2AGOA 1OIVA 3L77A 3PQEA 4MW6A 5TPZD 3RDPA 1JHUA 4D3ZA 2W9AA 1SXGA 1KS9A 1P0MA 1K5OA 3RB3A 3DVLA 1OV4A 1ZGGA 3NYRA 5M2QA 1NX6A 3BIJA 1P5RA 3O7MA 3F1LA 4TYQA 1JZTA 4R8MA 2IT1A 3IAS1 4BC0A 1WMEA 3FPLA 4AULA 4DIEA 2ZBFA 1TA4A 4AJLA 4WLUA 4L72A 4DEVA 2YS6A 2X1MA 4NXNB 2RHHA 1JHZA 3A6FA 1S9DA 2E4WA 3W4KA 4Z4QA 1DAPA 1CFZA 1PSWA 2VK1A 3JYQA 1QQTA 1YZHA 1BU5A 1XTBA 3RRHA 3PNCA 1KL9A 2GKOA 4FBLA 4HEHA 4JZYA 3RSFA 3B3JA 3ZQKA 1RYHA 2R62A 3MJCA 3SXUA 2QRUA 2Y0PA 3THXA 4ZTZB 1AB5A 1YU6A 4B3CA 1PQYA 2B25A 3N7PD 1W75A 4CQMD 4EQZA 2D6FA 4KMOB 3ABIA 3CXUA 3VXKA 1XZKA 2IUSA 4M22A 4GFJA 3BMOA 4RIFA 2A14A 2CNLA 3K96A 5F4BA 4NCBA 1XAJA 4I2AA 3I76A 2I7XA 2QQEA 3BZUA 1SURA 4C21A 3QLEA 1V43A 3L8GA 3I05A 1W85A 1B16A 3P5BA 7GPBA 2O8EA 3GIDA 1TXGA 3IV7A 4KG7A 4N54A 4NZPA 2NRVA 1YFZA 3EIQA 4G0QA 4GDMA 1RWMA 2C04A 4XWOA 3WAJA 1I4EB 1REQA 2HIGA 2B2CA 3IBTA 3NANA 5BWNA 1N2HA 2E3TA 2ASJA 1PK7A 4NJ8A 5HOEA 3PX7A 4LF6B 2EX4A 4RM3A 3T06B 4ODIA 1MABA 4AJ4A 2NGRA 1T15A 2VA3A 1XFAA 2Y1CA 2ZB2A 2NRTA 4G37A 3L7BA 4RA9B 4WK4B 3NIBA 3LFHA 3UT5A 4J1TC 4ZAGA 1I30A 1NUAA 4G84A 4YLYA 5JNLA 4ZA2A 4KITB 1ZVMA 2OL4A 3I4LA 3CO5A 2ZIWB 3TOVA 1F1BA 1B23P 2A1JB 4A10A 1QDEA 1RQ2A 4GQAA 4QUKA 4X00A 2VJ4A 2PZLA 3STHA 1NK0A 4YMSA 1WSBA 2XCOA 3K4GA 1O9BA 4QOHA 3NG1A 1NAHA 1Y37A 1ENPA 1WWUA 3K9WA 3AR8A 4AO7A 4BN4A 1X86B 2B5WA 3A6JA 4CIWA 3L7NA 4A6EA 5I01A 3B1WA 1OBFO 2XUZA 1P2TA 3FVQA 3QZUA 4ZO4A 4AX4A 2M9NA 4JC5A 4UQPA 4AY2A 1QO9A 3L5KA 2HA5A 4KFTA 4RHXA 3RC3A 3D31A 1CE8A 4YJ2F 4JLSA 4LY3A 4GOJA 1E1DA 1LGYA 4KW7A 5FL7A 4IJMA 1XMJA 4O6VA 3U7EB 3ZJVA 3PC8C 1Z4MA 5AJWA 4PWZA 2B61A 4IXMA 4A6XA 1L5YA 2WV7A 2CVQA 3ZTTA 3T7RA 3UCFA 1IIRA 1OTHA 1XEXB 1QCKA 3COJA 4MHSA 4ZOLF 3FTDA 1LUAA 3L9XA 3IQDB 2YIVX 1E1CB 3CINA 2VHTA 3FZNA 2RGWA 4XSVA 4KO2S 4OFXA 1KVQA 1JXLA 1XZFA 1RQNA 3BMCB 3OGUA 4FUTA 4TKMA 2QRVB 5FUMA 3TW8A 1CEQA 2H4ZA 2BGTA 2I5PO 3OE1A 4TQ9A 3SLKA 3ZXSA 3QJYA 4EGFA 4XUEA 3EMKA 5FYQA 2JI6A 2C3YA 2BFFA 1MQSA 5H3CA 3P27A 5B1YA 3BGSA 5CURA 5H83A 1J90A 5BN4B 4CRXA 4E5PA 1O1YA 1O2DA 1S8NA 1FYXA 4EGSA 4ECQA 2GBCA 2R7NA 4ZGGA 5IF3A 1FFVA 1JIIA 2NO7A 2XDAA 1YB5A 3VPXA 1VMEA 1T9AA 4E08A 1XVUA 5AIAA 2F1HA 2QAJA 1YDWA 1XTJA 1Z35A 2CLMB 1H65A 3CC8A 2HEGA 3H42B 1JS1X 3I9NA 3PRJA 4U5XA 5KNCD 3ER8A 5G0UA 5F64A 3GLHB 2QSUA 2JKZA 1KAOA 1EP2B 1EVIA 3OX4A 1D1PA 1T4CA 3PHBE 4Q4CA 4QQRA 5JH7F 2P78A 1VYHA 4Q21A 2P4EA 6NULA 1JALA 5KSZA 1W49A 2D4HA 7ICPA 1CDOA 1OZFA 2FSVC 4YRDA 4MINA 5ADVA 3RB4A 2PUFA 3ISDA 3EULA 4MQFA 3VDXA 4DSIA 4LXQA 5EQTA 5SV2A 4H7JA 4CPDA 4Y1RA 5BSWA 5HKAA 2WOOA 2XNHA 1L3CA 1ZUD1 1OX5A 2YDYA 3G7NA 3LX8A 3N2NA 4FDUA 3NEJA 3ZNPA 4HSGA 2V3CC 4Z5XA 2YWBA 3JYOA 2ZJYA 4FU0A 4WDRA 1W73A 3L8YA 1LW6E 3TQCA 4CT4B 5MFZA 4N76A 3A6HA 3ANMA 2JEZA 4K88A 1XS9D 4J76A 2D1FA 2HV9A 4M0UA 3EQ9A 4LF5B 4FMCB 2RAPA 4OQZA 9ICKA 2ZUCA 1BNOA 5IINA 1S96A 2JJ1D 4D4MA 2UVRA 1Z2DA 2BISA 3HU3A 3VZSA 4ECYA 1TD1A 4F56A 3DUFB 4LDAA 3BD8A 3NBXX 4JVNA 3A70A 3NDIA 3SQOA 3O94A 4QUBA 5CYFA 2R751 2DY0A 5CB1A 4MEJA 3T9EA 5IF9A 2QE7A 4DWJA 3UC9A 2C5FA 1D2CA 2GRJA 1XCPA 3UQ2A 2ODNA 1CUDA 2ZJ7A 2QJFA 4YRFA 3CUEF 2XJ4A 2ZI3A 3J81j 2QVBA 1SVSA 4HDSB 4OQMA 4ZEXA 4RY8A 4Q4JA 3WMGA 2I03A 1EI9A 2L42A 4P81A 1XPRA 3WV4A 5F9FA 1N61A 1F38A 3V7LA 3JQ6A 5G4LA 2XCTB 2RGDA 1QOPB 3OT5A 4BRSA 3RBVA 4GX5A 1U2DA 1EVYA 2QDXA 4IQGA 1LK7A 4DXHA 2XYHA 3LXRA 4JBXA 3PTZA 4KRYA 1BHO1 5BW6B 3W8EA 2UVWA 2PUJA 4IICA 3ZQ4A 3L05A 3F74A 4KUHA 2ATVA 3JVUA 3T9DA 1DL5A 5HIIA 1PJCA 2M6SA 2EFYA 2B2NA 4NCAA 1HNXB 3G9QA 4QVIA 1O77A 2CHFA 4Y1RB 4Q1BA 3R6GA 5KBYA 1FJ2A 2FRDC 2PDAA 4BECA 3G2PA 3OQNA 1A2QA 3JPWA 5H9VA 3ZGVA 4LXTA 2C7VA 2Y1JA 2D7CA 4YDRA 1HYQA 3OM0A 1KOJA 4MF2A 5CYPA 1KBZA 4NEHB 2Y9PB 1BVRA 1W93A 2PKWA 3HGTA 1QFMA 4NDAA 2J46A 2O1XA 4D9NA 4A1FA 2QTVA 3CVVA 3ECAA 4NLNA 2DH6A 4D3DA 5MHTA 2R2AA 1UBFA 2XBUA 4GC5A 4L27A 2D0PB 2IW1A 2QMUA 2GM4A 4DMUB 2O0MA 4EBCA 1IJEA 3CWCA 4KB5A 3R6TA 2JCVA 1RHMA 2PVCA 3QVGA 5KSYA 5IM4A 1N2OA 5K9ZA 4K05A 4UAVA 1P0FA 4TS9A 3GRZA 2W43A 4X62B 2BFDB 5LOVF 1CS4C 2OECA 1RBYA 4AK9A 4D9EA 4DT1B 2O8FA 5I7SA 1JKMA 1SG9A 3L40A 1Z22A 2VRCA 4F85A 2D1SA 3GWGA 2XSZA 3ME5A 4JL8A 2F8LA 2LDBA 4YJGA 5D5QA 1U3FA 2G1UA 4YUYA 4Y30A 2ZRCA 2V96A 3NASA 2JNWA 3FI0A 2IXGA 2P90A 2Y8EA 2ZYGA 3LECA 4NQRA 4RH3A 5CK4A 1TZ2A 5IFKA 1OCEA 4J0GA 2PFPA 3A0UA 3DLIA 1PR1A 4NX2A 4XWGA 1RRGA 3WLJA 1AHNA 1FK8A 2P2NA 3CE6A 1ND5A 3RIXA 3WLPA 1SK9A 3HFSA 2QV0A 1BDMA 2X9QA 3QVXA 4HDNA 4XB2A 4JR0A 4I29A 1C8KA 1TC2A 1KAEA 1KOGA 4PTYA 1H22A 2QG9A 5DN6A 2E48A 4NMLA 1SUAA 2F3PA 2XTAA 1WF6A 2BMDA 1SBNE 3WGZA 1FY2A 1Z5ZA 2D5AA 1BZYA 1OHHA 3BL5A 4WKGA 4HZUB 4RUKA 3U3OA 3HMQA 4PZDA 1I5OA 2CHEA 1K8YB 2POQX 1CRLA 2MSLA 2RH4A 2KOBA 5JQWA 3C21A 1COWA 3D2AA 2HSEA 2WY2D 1OBHA 8ICQA 2B7LA 2ARKA 1X8KA 1RWXA 2W6JD 1EZ4A 1CUZA 2VNJA 2WD7B 4IVQA 1G2IA 1V47A 2FKAA 5EIBD 3ZTYA 3QWAA 4L5CA 3FDXA 3OT4A 3WISA 4Y6PA 2O52A 4EYQA 1FZTA 3C3XA 4INOA 1PQUA 3ZU5A 3BOSA 2A6PA 1QSLA 3Q5EA 4P7FA 7YASA 1TUIA 3R5SA 4TX1A 1B2RA 4KPUB 4PRKA 1VKZA 5HWSA 5I4BA 1DRWA 1M2VB 2V74B 3KXKA 5DBFA 4U9HS 3W79A 4KQ1A 1MJFA 4H7KA 1Q92A 4EZIA 3WGVA 3OCCA 3P0FA 2ZB7A 4E30A 1KI6A 1NBOA 3TR5A 4H18A 4UATA 1SUWA 2VZEA 2MT9A 2VTDA 4BQEA 2V6BA 5JXJA 1UPXA 1GYPA 2P4HX 4F5ZA 5K4HA 1Q57A 1AHPA 2DQNB 4XDHA 5KT3A 4P3PA 4GXIA 1U47A 1G7RA 2DSTA 1JQKA 1RXVA 1EQAA 1KDPA 2JGMA 3G7UA 2IDJA 3A6LA 3NAZA 4R84A 3UWDA 5KU1A 2Y1LA 2R8HA 1KFSA 3BGDA 3HPQA 1KKLA 4K2AA 4TSFD 5KFEA 4ER7A 3N28A 3V55A 3THRA 2QM8A 4DA6A 2XC9A 1ZQSA 2ETVA 3CH7A 3G0IA 4FYJA 4FYPA 4JOBA 1KZGB 4OH7A 4Y18A 1HUQA 3G79A 4QDUA 4ZI7A 3S1SA 2VP0A 3KRTA 3DEJA 1JRPA 5TARA 3L07A 4P8RA 3OCXA 4PZPA 4E46A 4AUKA 4ZCMA 2BUBA 5JR3A 1C3OB 3X44A 4AMUA 4ZCSA 1ZZGA 3OZEA 4J2HA 4CN9A 1RJ9A 4C6TA 4CFYA 1UPFA 4DQIA 1C9NA 1KMQA 1T3GA 1R0RE 1CZUA 1DWQA 1YVEI 2QNBA 4QO8A 2B4KA 1X2EA 4FZMA 1T43A 2EFEB 1JQJC 1E5QA 1Z7EA 2RHOA 2XPCA 3C70A 3GDOA 3K9NA 4NCJA 4G1CA 4GSKA 4OCZA 1ZM9A 2CXNA 2ZJFA 4LNUB 4OFZA 3LS2A 2PL1A 2QAIA 4ECXA 3CIOA 4JJKA 3A4LA 4AMBA 1UJ2A 5DM60 3NYIA 3F6BX 1AKYA 1MC5A 4DS5A 1F06A 2VBGA 2WE7A 2VO1A 3AF3A 3FVRA 1GKYA 2XUQA 3IESA 5EWJB 1X1EA 3E70C 3KAPA 4RKRA 4NM2A 3CLUD 5AVSA 2NUPA 3GLVA 4LDZA 4LRXA 2M2IA 4F5PA 3DNMA 4Q1DA 2DKZA 4YUAA 2DL0A 3EAGA 4LSMA 2O6LA 1T5DX 1N2EA 2HWKA 2QN2A 2Z09A 2JS7A 1ZQVA 4NLCA 5EWGA 1NYLA 2WBLC 4JJ4A 4RH0A 3U4DA 4F38A 3KSRA 2F8SA 3LRXA 2O6HA 5J23A 4M38A 4UAUA 2XWJI 3PVCA 2PG3A 2Q1TA 3BQTA 2GBFA 4RELA 3U7FB 2G1PA 3EEOA 1E1LA 4KN6A 3NWJA 1R9NA 3EDRA 1BHSA 3NTVA 2BR3A 3PYXA 1ELOA 2QVCA 4ALKA 2IYSA 4D0RA 2OOKA 3LT5A 3N4MB 2ZYAA 5G41A 2AI1A 3F5QA 5EFOA 4ERNA 3MFIA 3LXMA 5COAA 2XUHA 2W42A 4YRRA 3I34X 5THXA 3KETA 5LMZA 4URYR 3IT0A 1H2AS 2KBEA 1W0CA 4MMXB 5IM4F 3DBLA 1E61A 3HC7A 1ZXLA 3IVXA 4HSEA 4KYIB 4TV9A 4ZVUA 4BFSA 5HG0A 4OHVA 3K70C 1H4QA 2OGZA 3WBKA 3UHJA 3HA5A 4HYEA 3HVKA 1NOJA 4OHWA 2GEFA 2WNHA 3ER9A 3R8FA 3QY9A 2XGJA 8ICZA 3COYA 3DLAA 3QVUA 1K1EA 2VN8A 4E09A 5IC6A 3W6UA 3T1NA 5DRYA 3RNLA 1B6GA 2G17A 3HLTA 5FRDA 5TX7A 3LPCA 3VZRA 4M6WB 3FUTA 5DTJA 8ICAA 2WYVA 4WKOA 4A91A 4ZYWA 4L3VA 4C78A 1MDBA 2FG5A 2N1BA 1BDHA 3MXOA 2R84A 3L0PA 4M2YA 1KZ9A 3FHLA 3LE8A 1QS0B 3PR2B 1V16A 2GK7A 5BOMA 1L6NA 1W76A 3T7SA 1HUOA 2P3OA 4BO5A 2QMEA 1VB5A 1F0KA 1U94A 1NZDA 1YZ3A 3VKFA 5D3KA 1LPAB 4IHQA 5FFFA 4DGQA 2FW1A 3LUCA 3AJDA 4Y2RA 2ZRPA 2QM3A 3LT4A 3UAYA 4FEGA 4KQMA 5BQ3A 4BLSA 4MCHA 4JK1A 2H2DA 1OVMA 3HYLA 1MENA 1H1DA 2PRYA 1UH5A 3ROFA 1PJTA 3OF5A 3VSEA 3QEOA 3ER6A 4DXAA 1ZQPA 3PUKA 1XGKA 3KBBA 1NK4A 2EP7A 2JJ2D 2K7ZA 4J2TA 4P33A 1T3QA 3PWSA 3IQIX 1BGWA 4HATA 3EQ7A 4I55A 5ER9A 2PBZA 1E0SA 1LB2B 4TMYA 4UC0A 4UTVA 1WETA 4Y9TA 4XLZA 4B4DA 3GU3A 3IOYA 3ZNNA 1B4FA 1SBTA 2Q6LA 4W6ZA 3IL2A 1N62A 1OT5A 1DDGA 3OPYB 1NW8A 4UVDA 4UCFA 3NONA 4X3PA 3M9MB 3DFZA 3NVDA 1EK2A 1ZJ4A 4N7MA 3RODA 5EJFA 4BP3A 3QV1A 5CHEA 8GPBA 1A7JA 3DDOA 4LMRA 4NJMA 4DZZA 4F3RA 4ZVVA 1N4AA 1FTQA 4JB8A 1BD4A 1W581 1ADBA 1H0KA 1UZLA 1HSZA 3JD2A 4ENTA 4HZUA 3ZWWA 2QUHA 3TQHA 3HWX1 3QYAA 2PTHA 1U8YA 1XVIA 1YS6A 2REOA 3JWEA 4GOLD 4CNBA 5ILGA 2ASEA 3L7IA 3F5SA 3IRUA 2OUKA 3RCBA 2A0FA 3W2IA 4ASUD 5TF0A 1SC3A 5EGSA 4G1EB 4QZDA 1P9OA 3E7PA 4XUDA 1D2NA 1RTTA 1FFCA 3TX6A 3VM6A 1TYAE 3R3YA 2X5NA 3SJ7A 5EIEA 4JEMA 5TPZA 1YIOA 1ZO8A 4UCWA 1V1MA 3ICOA 4OH1A 1PTJA 3IIIA 1CF2O 1Z0UA 1VKJA 1VL2A 2K5UA 2QW1A 3ADKA 3CF2A 5DNDA 2Q07A 2FU5C 4D9CA 3SAGA 2C95A 3L6EA 3MTEA 1E6MA 2C2GA 1H42A 1BU8A 2FW8A 3AFHA 5KTYA 4IMRA 5ERYA 5I5GA 2CB0A 3I2IA 5J2IA 1TW3A 1WXDA 2B78A 4Q9AA 1U3TA 4DLEA 4NJEB 4JQYA 3K0FB 1Z8FA 1TVMA 1W1IA 3FNQA 1E6EA 2KV2A 2Q2OA 3KDPA 1BEEA 1UAGA 3C3WA 3LL7A 1WW3A 2QL5A 1YS9A 4YJFA 1YR3A 3ABRB 3R7FA 3SFZA 4BB0A 3NVZA 5JAMA 2FEMA 4XGKA 2KG5A 5A7FA 3CH5A 3OCWA 2CL0X 2FZ5A 3IMGA 2IIPA 3RH0A 4IJ5A 3HR8A 5K6RA 3KB6A 3KR2A 3Q9NA 1S10A 1M33A 4QGGA 5KT6A 4JBYA 4CL0A 1LH0A 4E5SA 4YCSA 4LVSA 1XBTA 1XALA 1Y1KE 1YR2A 2BW0A 4K0RA 1HKHA 4G5YA 5TQ0A 2WG0A 3SZLA 3VVBA 4UBOA 1CUHA 1G5FA 2RHMA 1FPMA 3PC7A 3ZDBA 4RNMA 1QV9A 3BA6A 4OXNA 1IZ7A 2C4KA 2HEIA 2W4QA 3PCRB 4KZKA 4ZO8A 1POWA 1UXOA 3MWJA 4GZ3A 5SZHB 1UA0A 2XB9A 3F5AA 2V6FA 1EINA 4RZHA 1NPDA 1EBFA 3BD9A 3UJ3X 2WJVA 5KYNA 3HVIA 2VDMB 4BFVA 2Z2IA 4URFA 2J3LA 2WIDA 3A6ZA 4CGYA 4E4TA 5F77A 2Q2VA 1SVMA 1TVEA 4G8DA 5A6SB 1F5SA 4ZCTA 3C1AA 4NY1A 1OYYA 2ERXA 1BFUA 2PRJA 2G8LA 3LX5A 4B43A 5HCUA 4RD1A 4ZWNA 1J8DA 3V7WA 1NP6A 4EKEA 2XOKA 1P0CA 1A8QA 1QQ7A 3AY6A 4ZHQB 4HTFA 5IKOA 2YQZA 1M2KA 2RH9B 4U9IS 1M34E 1RPLA 4DF8A 2GESA 1ZK3A 5B1DA 1NONA 1SPXA 3VPFA 1Z19A 2Q3CA 3RRJA 1DXQA 2CC2A 1V8OA 2PX8A 2RH5A 4Z4HA 5HHTA 3PV8A 2EGUA 3L1JA 1UM8A 4MKXA 4N5IX 3A9UA 3GJ4A 4Y1GA 2ZPTX 4GZLA 1QE5A 2O48X 1WUKS 3QYJA 4EUEA 4MKHA 4RMGA 3PJFA 1VBNA 2RGRA 3BTVA 3C3AA 3PQ4A 2FX5A 4URVR 1UMKA 3RTAA 2EANA 2P9TA 5JAHA 2Y2VA 1SMKA 4MLDA 1RRPA 4BNGA 2RHGB 4IX9A 3RTEA 3PHJA 4DWOA 5EWFA 4EL5A 3BT7A 2OHGA 4MS4B 4MMYB 3DWEX 3NT5A 1ODKA 3OZ7A 3ON5A 1GQQA 2X9VA 1IDN1 4FS1A 3OPMA 1SXHA 3QFHA 4B6QA 3R24A 4Z9XA 3LUHA 3F5MA 1XU4A 3QVSA 3FHTA 1NRJB 3R3XA 1PEKE 3ETEA 5KVSA 3LYSA 4N39A 4YR9A 1EGMB 3H40A 3ZWAA 1EB8A 4DAEA 2KICA 4PXAA 3BRWA 4EKIA 4R71A 2FPIA 2QX4A 2W4MA 2C54A 3G2JA 4IHAA 4LZZA 3PLRA 1NR1A 4UVHA 1IL0A 4PZUA 3AKDA 4X95A 1XPOA 3EYZA 1FX0A 3AHCA 1SVKA 4P31A 2QV7A 3WNDA 3EGXA 2A9JA 3G2OA 1J42A 1J9EA 4XVCA 1E1NA 4G81A 4LJ9A 2HLDD 4WKBA 2LKDA 2HBJA 3NTXA 4QXOA 5HJ5A 1L4YA 1WD7A 4YAUA 3H05A 4R01A 3I9FA 1Y4AE 3KJXA 4LSGA 1YUMA 2E0IA 3KOWA 4UZFA 3RUAA 3SEZA 4R05A 2H16A 3ND9A 5DP2A 1IK4A 3RYTC 3SQIA 4ARVA 1ZXBA 3IP3A 9ICIA 1J23A 1NOKA 4KGXA 4PS1A 5IZ4A 1KMHB 3BFKA 1I7DA 1BKYA 4ECUA 2X3FA 1JFRA 1WPXA 4RHYA 2YCLA 1COZA 3K70D 1GR0A 4N3AA 2DLCX 4CIAA 5PNTA 4Z49A 4BB6A 4KLCA 5DSZA 2AZDA 3I9KA 4S2EA 3UPDA 1PS8A 4GPZA 2VK8A 3EUFA 5T4HA 4NOKA 5KFSA 3PKZA 2JA2A 1L5FA 2E4ZA 3Q2IA 4P93A 1N8TA 3LHDA 1VE3A 2C1EA 2J9FB 3TECE 3V4RA 2JIZD 1JYFA 1N2BA 1SD1A 4JOSA 3WGLA 2R5WA 8ICVA 3HS3A 4OJYA 1G1AA 4QBTA 1C7FA 4TUYB 4ZV9A 4PM4A 4DR7B 2XHZA 2WAYA 1T4BA 3BWEA 1T1EA 5EOZA 1Z7BA 2FDXA 5JDCC 4YRCA 5KQSA 3DMGA 3E9RA 4OQ4A 1P1IA 4NWIA 2IODA 4KDCA 4EJ0A 1LB1B 2CV2A 3ZKAA 3GJRA 3N8DA 4TLDA 3G13A 4D9JA 1KWKA 3K71B 2WSSA 1I1QB 2CD7A 3ONFA 3QPBA 4HDRB 1XCGB 3AZPA 4BVLA 1QV7A 1OX4A 2P9YA 1MRSA 1DOAA 1N5KA 1FW6A 2V4ZA 3CKMA 2P7IA 3DXXA 4G1BA 4ZVRA 1HF3A 1LDBA 1SA0A 5FEUA 5JTIA 2KLBA 1NHGA 3B8EA 4DSAA 3P52A 5BRAA 4L76A 1R9GA 1V26A 5A3VA 4WIAA 5CB4B 4LJ7A 3ZHTA 2Q1UA 1CZRA 3OTQA 1ZN2A 4RZSA 3IVAA 4S1WA 1CC1S 3W8DA 4JX9A 5GZ6A 4B09A 3GZJA 3E81A 3OKAA 3UJ7A 1Y6GA 2N0SA 5IH3A 3OZWA 5EMKA 4UM9B 3BF8A 4AJHA 4CZ2A 2BM0A 4L5AA 3JWJA 3LFTA 4JV1A 3N9IA 4IDPA 2P6RA 1E2UA 4X45A 1LK0A 4E5YA 1VLJA 5T8KC 1GG9A 3I83A 2O7NA 4UAYA 1Q77A 2C2XA 1TFUA 2NADA 3JQ9C 5LLTA 5AW8A 1DPGA 3EXFA 3CE9A 4D8XA 5AJXA 3K70B 2YBDA 3T6KA 1T5OA 5PGMA 2JLUA 3CJQA 1KAMA 2EZXA 2O3QA 3LC7O 2WWRA 4K9LA 1VRVA 1F8GA 1NL3A 3K94A 1Q44A 1L1FA 4I2CA 4N0PA 1Z8HA 3WLMA 2HHAA 3IELA 5DKFA 3S5UA 4DNFA 2C7QA 4ZT2A 2EKPA 3K9GA 4BMZA 2Q6VA 2WPNA 2O5RA 1ISRA 2E21A 2UUOA 4GUDA 4IDEA 3G6WA 4PHGA 3WYCA 4BFCA 2JH1A 1NMXA 4KFUA 4OEHA 3RB8A 4DLSA 1FDVA 1B73A 4HLUC 1ZGBA 4C2BA 4UTNA 3UYLA 1SRRA 9ICAA 3G7SA 1SQFA 3UAWA 2FETA 3C5CA 4MK4A 2QTZA 2ZUVA 3FM9A 3SN6A 3UTCA 4Q6WA 3CISA 4GWKA 4INPA 1E2FA 1IXYA 3WLLA 1NW3A 1N0VC 1KJQA 3H6HA 1DB3A 1UC8A 2O2JA 1E94E 3D8TA 1F3LA 4N0DA 3EEYA 4NICA 3T0IA 4AZSA 3EZXA 1J8YF 2JGKA 1AKQA 3AEKB 1Z68A 5KHLB 1YDMA 1JLMA 1T1JA 2F43A 4B7CA 3MA0A 3EIHA 1YVRA 4HDMA 4L02A 4AO8A 1PNRA 1ESEA 2BPCA 1E3JA 4QVGA 1HLFA 1W0KD 1DG1G 1D4ZA 4FNMA 4FMCF 1OBCA 1DIBA 3PW7A 1T8WA 3M8RA 2D3TA 1SVLA 3ETDA 3RU9A 4M9SA 3O8QA 5BQOA 4BNYA 4UTXA 4FNOA 3H9QA 3W6NA 4F96A 3SBEA 5FPYA 5L3QA 5AW4A 1YL5A 1XRLA 2IXDA 2W00A 1X7ZB 2ZJ4A 3FKQA 2HRZA 1Z7YA 2I54A 4ENVA 3RYCA 4F1WA 3WFIA 5L1LA 3EISA 3PGJA 4QRDA 4RGQA 4S1PA 4UKDA 2QP4A 4WCFC 5M29A 1ACJA 7ICEA 1L4BA 4ML3A 5FQNA 4HXEB 1H3EA 5KFQA 3F9RA 1MQ3A 3VVLA 1HDXA 3PIIA 3GLIE 1RR6A 4FMDF 1WPQA 4Y0NA 4B32A 4BZZA 2QX9A 4I1VA 4OHRA 1QKJA 2OBXA 4Y6RA 3Q0EA 3UQ0A 2JLQA 2NUTB 3CRXA 2WB4A 5DLQC 3GMIA 2VH1A 3ZGLA 3CNOA 1WABA 4BQRA 1KSHA 1QVAA 4CLOA 1DGJA 1U98A 2VDOB 1ZYUA 2C4HA 3PX4A 2E18A 4II7A 5AVJA 5JWHA 4RBNA 1C4WA 3AVPA 1LNSA 2FR8A 2JAPA 5H0IA 1T5SA 2VG8A 4Z9YA 1E5XA 3CX3A 2Z2KA 4OYRA 5JLJA 1PUXA 3EWSA 4RJTA 5C5JA 2QRGA 4D5GA 3DV2A 3J80A 5KTQA 2M98A 2GK4A 2F67A 2KMDA 2A9PA 3E27A 4V1CB 2J5BA 1ZZEA 2FX3A 5EIXA 4C9BA 4YR0A 3O3NB 4CXMA 2HJHA 3DSRA 1WV1A 2RDJA 5ITVA 4OXIA 4WCDA 5HQ3B 2O7RA 1N32B 5DJ5A 2A1UA 1C0EA 1M1ZA 1VBMA 4O4LF 5BO5A 5KI6A 2XXBA 5P8WA 1W34A 2F77X 1ADCA 1XE3A 3TXXA 4EHHA 2Q3BA 5K8LA 2J9GA 3QEJA 5LLDA 1H6AA 4GLJA 1UBMS 4I2JA 2XTMA 2BBOA 2XIQA 3CGWA 2IYWA 3DOUA 3RJJA 4LHEA 3FUUA 1AQ6A 2C2BA 4PYRA 3TARA 3H7IA 1IUPA 3KR0A 1OSNA 4C0ZA 2OV1A 2EAMA 4G2TA 4MICA 4RV5A 2X9GA 4PZ9A 3KUXA 2INGX 4PG8A 2PUCA 3H6GA 2XNDA 4XQ9A 3AETB 4AKTA 2ORIA 1TM3E 4G85A 3REFA 2H1CA 1AA9A 1YRWA 4FLEA 3H5WA 4DOMA 2ADMA 2JZNA 1EFPA 1PLLA 2W8BB 3ZIDA 5JCJD 1SBYA 2UU9B 2TS1A 2G09A 4J1TA 3VO2A 5HJEA 3ZHCA 1QJCA 2ZIUB 5G0WA 5DG7A 3UB2A 4C2TA 1RRVA 4GEGA 4ND1A 3ETHA 5IC5A 2JFBA 3WK9A 3QIAA 3V2UA 4PX2A 2PX2A 3OH8A 1ZQBA 3OOHA 1EP9A 3V7KA 1FSSA 2HA7A 4MS1A 1J39A 5EPOA 1P33A 4CEJA 4IKOA 2HHQA 5HS4A 4OX9Y 1Y3CE 2UXDB 3TJRA 2I4MA 3O3MB 1NVGA 3HCWA 4J1QA 1R66A 5DTMA 3WGHA 4LVOA 4CLXA 4DR6B 2ORWA 3AF0A 4FEYA 2NX2A 2HUPA 1IJBA 2ACKA 3QQPA 1NQAO 1QTIA 3T52A 3W04A 1C7IA 1QYXA 4B82A 4WXPA 2JLSA 1HE3A 1U1EA 3FVVA 3HJEA 1XTVA 2HPVA 3HY6A 2RC5A 5LBUA 2O8CB 4QPDA 4TMVA 5KVQA 4URHA 3KKMA 4FGKA 1E18A 5THKA 5GV7A 2O2IA 1PZGA 1VFPA 4G26A 4WZAE 4EOGA 2G9QA 4YROA 1ODFA 2FB9A 3AGQA 1XNSA 4IEFB 3SIXA 3UHOA 4A27A 1WP4A 5LU8A 3D6VA 5BNZA 2JJQA 2J6IA 4MIOA 2HIMA 2XBLA 2B4RO 3FYSA 3PVZA 5G1PA 1KR2A 4IMPA 2W2LD 4CCYA 4DKJA 4JASB 3N2KB 5I7FA 2Z98A 1L5OA 5IMBA 2XV1A 3J7AC 2MUTB 4FR2A 3K20A 2OCGA 4BNZA 4Z2AA 3PEUA 1Q8KA 5AI8A 2NAFA 2QSYA 4A73A 3LWDA 4PZOA 1X1AA 1SCAA 1W44A 3C8MA 1ORIA 5K3BA 4CQLB 3BS7A 2GGSA 4B46A 1ZXIA 4C7ZA 1UKYA 4QOEA 4E1VA 1VIDA 5HOQA 4NLLA 2FDCA 2JKYA 4EPRA 2JPDA 4GD3Q 5MGNA 2XY5A 2ZSJA 4M87A 1S0OA 3ENKA 3GR6A 4A8EA 4O3QA 1J5PA 3RBAA 5BUQA 1USVA 1JU3A 1MT0A 1RAEA 1Z15A 2H52A 2H3EA 1WZEA 4J9OA 1TV9A 2I3BA 3GLTA 3ITEA 2L69A 2HDOA 3L0ZA 2ZJOA 3F7OA 3N59A 3DEZA 1FRQA 4K6OA 2W70A 5ICSA 3LBIA 2ZUUA 1V5EA 2NO0A 3I4FA 4WSOA 3M9OB 2E49A 3F9IA 1O8BA 4Q8FA 4K8RB 1V5FA 4JI8B 4H0CA 2I76A 2OHVA 2Q6OA 4EVQA 1SCDA 5IX8A 2OHHA 3GEIA 2XEDA 4FCTA 4ZAYA 4CU2A 4B35A 3RS4A 1I51A 4IDQA 2WFMA 3GRAA 4WAUA 1C50A 3IDWA 2W2QA 3FMIA 1AURA 3B9BA 3MCUA 5J2FA 3AKZA 1D09A 1QRAA 4F91B 4UNSA 2GZ3A 4JKOA 4HYTA 4ED2A 3W4IA 4QUEA 3IODA 4IQUA 3F3MA 1ZOPA 4D4KA 3WKEA 2AOWA 5IBPA 2Z30A 2VJNA 4HGQA 3TQTA 3FHOA 4EENA 3PPXA 1A9ZA 2JGRA 3LI2A 1PFUA 2FTKE 1F2TA 3K5PA 3SQNA 3PNQA 3IQGX 4LKOA 2OAEA 1U28A 2D6FC 2GYUA 4AS1A 1VIYA 2ZT6A 4JHLA 3E22B 1P5JA 3SSOA 2AXNA 3BYZA 4B79A 5JRTA 2ODEA 3F8TA 5GJVC 4L6AA 2ZDQA 4DLXA 1M9NA 2P6OA 5ESRA 4RPIA 1FP7A 2H17A 3OPYI 2XZLA 1QV6A 3C8ZA 3DD5A 5FPQA 1RHUA 3M8KA 1NA5A 3K6SB 2E4AA 3TNYA 4DQXA 5KVCA 4WASA 5D7NA 4J9NA 1L5MA 1EX7A 1G2PA 3HACA 1JNYA 1H4SA 2BCEA 4FLMA 5ABPA 8ICSA 2E9SA 1ZQCA 4N7BA 9ICEA 4BX9C 1E2EA 1WSDA 3QXHA 2HVIA 2J3MA 3KPUA 2IOFA 1XG5A 4LJAA 1RRKA 5DNUA 1DJLA 2JF0A 1IUOA 1MW9X 3AYXB 3W90A 1TEZA 1R3UA 3RUCA 1KEJA 1RD4A 1U80A 4FFWA 4X64B 4GZ6A 1ZU5A 2R79A 5J2KA 3HYCA 4ITUA 1R5NA 4ERXA 1QRTA 4KR7A 3KTQA 2Y27A 3D43A 3K3PA 4O2BA 1RTKA 1OF1A 4FDAA 4UNNA 1H2BA 5U1PA 3SC2A 1FCJA 2ACEA 4P4OA 4LDRA 1BYIA 4J7XA 5KTNA 4CYMA 3BD7A 1WWVA 4UHKA 2F8TA 4KE7A 5ER6A 1DAHA 4EVRA 4M0FA 1BKDR 3JPTA 1BOOA 1SBIA 1THMA 3NFRA 1KFDA 4MUIA 4RVFA 1P5FA 3WXMA 1HORA 3AF6A 3C6YA 2Q4TA 1P9RA 5FKJA 3V8NA 4H3HB 3WADA 3H1PA 1LQUA 4US0R 4QRIA 5HFJA 3DDCA 4RD2A 4RAOA 4XD2A 1NVBA 1SHKA 2J3EA 2CF6A 1QVWA 3TADC 3RQIA 5B3JC 5CVCA 3MILA 3OJXA 2PMDA 1ZQZA 1S3FA 1DWOA 1JTVA 5AM4A 1FP6A 1Y9AA 2C8JA 2F00A 2IUFA 3B6ZA 3M3PA 3M6LA 3PUIA 4L8GA 5CB4A 4PV7A 5BN5B 3MYRA 3LDHA 3CSDA 2P0EA 3EB9A 3LKVA 4D0SA 5F35A 1EJ2A 1ZESA 5CCBA 1FRZA 4UEKA 3AUAA 1RJEA 3B20A 4LMBA 2Z8YM 3AVVA 4HQLA 4FDLA 1JPVA 3I3OA 4AT1A 3AOEC 5JSQA 3DXZA 1RYYA 4MP3A 3TD6A 1NUTA 1RM3A 2AI2A 1JAXA 1HY3A 1WDWB 2XA1A 4FI3F 4RYLA 5C80A 2FYTA 3ZW9A 4OL9A 4BBAA 1KGSA 4IWXA 4RK6A 2J85A 4MQ6A 2AJTA 4GOKA 3OQVA 4ZIRB 3KT0A 3FMOB 4FKZA 3DVRX 4LPSA 4Z51A 5JALA 1RXYA 1QVRA 1UOPA 2ATXA 3OT1A 3WBJA 4PPQA 4ZGBA 2PIAA 2PBRA 1ZVQA 4ACOA 3ST7A 5JXIA 3P0IA 1L4UA 2RGAA 5KDDA 3DB1A 1XCOA 3RFAA 3WSWA 1YQWA 1N6OA 3OURA 4ZT3A 1ZS9A 5BNIA 5SZJA 2XMGA 5G5GA 3ND5A 5AUNB 3LGXA 1VRWA 3MB5A 1N57A 1P74A 2R47A 1ZQNA 2VHZA 3F8WA 3L0CA 2ZBQA 1LDYA 2VSYA 1AM4D 4WJZA 1M5UA 2A9VA 1N2CA 3MMXA 4ZVSA 5HDQA 1SL1A 1KC3A 4ZYTA 5I8ZA 1XEAA 1UK8A 3B12A 4XYGA 1DT3A 4EYGA 2UV8A 3I01A 4UB5A 3B78A 1RCUA 2RHTA 3UW1A 3DDZX 1FLVA 3L7CA 1TCBA 3GFFA 4C4ZA 4XOUA 3IEVA 3H5OA 2XI4A 4RY2A 1S01A 2GASA 5J0WA 5IDYA 4MEXA 2H9AA 3OEYA 3TGPA 1D1QA 1CZHA 4QT0A 2ECQA 2RGCA 4UBLA 5IBRA 1G8SA 2D0IA 4MGKR 4Z0PA 1D2RA 5T64A 5DN6D 1DEAA 4HNVA 3C7DB 3PFGA 1LVGA 1IJKA 1J6UA 3MIZA 1BE6A 2GCPA 4HQOA 3BEDA 2ZJAA 2AK2A 2P9HA 4HQNA 2QL9A 1R6DA 2DP4E 2VQ3A 4E2ZA 2J0VA 5KNLA 1YI8A 3INYA 4AG3A 3N07A 3LMKA 4RK5A 4W4TA 1MIHA 3KT3A 1TU0A 1RM6C 2HA4A 2IPMA 5DH9A 3UEOA 5AVQA 2VPQA 4UE3S 2J3QA 3LUFA 3GD7A 1FBNA 4NAUA 4W8GA 3UT6A 1U0OC 4J9UE 4YAKA 1J09A 4RMNA 2UKDA 1U6IA 2OO3A 1E66A 3ZWKA 5LVAA 3HJHA 2GM5A 4KAXA 4PYNA 1AE1A 2P2GA 2PXIA 1V8DA 5LQUA 3TNJA 3U2QA 1CFJA 3EBLA 3OY7A 2J0SA 1Q7GA 4JSRA 4LY0A 4RUAA 2OYYA 1IYZA 2FMXA 3IJ5A 1KOLA 3SJUA 1V35A 3MCWA 4AZWA 2GAJA 3AIOA 4ENSA 4M1YA 5E2IA 3RPEA 2BFCA 3ZYZA 3ES9A 1NJGA 3PXAA 3JQAA 2CNWA 1Q16A 1TYZA 2FEOA 2IYLD 2NXCA 2ZTHA 4K8OA 2GXQA 1GZ7A 3LKDA 4JWTA 4R3NA 1AUXA 4QNLA 1ZQEA 1QUEA 1S8AA 1AXGA 5ES3A 1HO3A 2HIHA 4KUEA 5EHIA 5IH7A 1KYWA 4M53A 4HNHA 4LZWA 3COVA 4M21A 4N01A 3LA8A 1XO0A 1ZNQO 4KWTA 4LJ8A 4PLPA 5EMJA 1QFSA 4EB8A 2OB2A 3KHGA 5ILOA 5EE5B 4Q3OA 4KLJA 3GCGA 1T3LA 3EJWA 4HLUA 2GTPA 2WTUA 2RHFA 1PE0A 1GVNB 2AR9A 1EA7A 2I8AA 5T3YA 4OHZA 2BFBB 2I3GA 4EPVA 4MUKA 2F1IA 2ZAOA 4HCJA 4NMWA 4OMFG 4B45A 5DHSA 3I9JA 2CKMA 3VVMA 3EY9A 4OHBA 3GP8A 2I55A 4QUHA 1BRMA 4HTAA 4TWBA 3VV2A 1GO3F 2FWMX 2A5GA 3EH1A 3AUOA 2X22A 2REQA 1RAHA 5MN5A 3RSHA 2VF2A 4NU0A 3EYAA 5C0OE 5FULA 5LB2A 3V9AA 4UCXA 3BGVA 4JI0B 5ICFA 3HY3A 1Y63A 1WG8A 1UWCA 3CF0A 3OD1A 3K35A 5DEOA 4B2LA 4TN1A 3MELA 3RC8A 2BFOA 1NLZA 8ICPA 2AJ8A 4OU5A 3M49A 3LQ2A 2ID8A 2QQFA 5FUYA 4O0LA 3T95A 4RQ1A 2IXAA 2J7KA 3K53A 4ECSA 1BCSA 4JVLA 2J30A 4XGQA 1Y9ZA 1PD1A 2XH8A 4YN4A 1UXKA 3UJ8A 5KX5A 1NK8A 3T1YB 3BAZA 1PVVA 2QY6A 3JQRA 1JQ5A 1HKUA 3CX4A 4P08A 1E2PA 2JFZA 1T2CA 1PV2A 4D9IA 4IXTA 4G5FA 2E82A 3RARA 4QOGA 5INTA 5CCEA 5IT5A 2Y0BA 1E9VA 2PKQO 3P0RA 3DVAB 1JLRA 4RTPA 4RTOA 4PJ0U 3DJYA 4F45A 1P7CA 3PHLA 1AKTA 5EZYA 1U9ZA 1UANA 3BE6A 2O3SA 1USIA 1W0JD 1U0EA 4F4ZA 1VXOA 2Y1GA 2NSYA 2IEBA 1R8XA 4GP6A 3L8FA 4M1SA 4QTUB 13PKA 3FJYA 3WNZA 2LUOA 2R1UA 1YTUA 5JOQA 2H1FA 3CX7A 4J0QA 4AG6A 2WK1A 4EAQA 1O94D 1NJ8A 2BJHA 4I2HA 2BMEA 3MWKA 5F7ZA 1XSNA 3RHFA 5EJ6A 1JLKA 3GRKA 2X4GA 1UPTA 3PJRA 1Y3FE 2RBKA 3ZGXA 4M3NA 4F3CA 3R9XA 1Y3DE 3DTVD 3Q7PA 4WA7A 4ZMBA 4X41A 2UUPA 4Y6GB 1E32A 2CJWB 4NNPA 2QYSA 3I23A 2XTZA 1NUPA 3GH3A 3KVRA 4MHVA 5FFMA 4CKZA 1AKNA 3WK5A 1HOXA 1CUWA 1PRYA 3KM0A 1KP9A 3WZ2A 4MR9B 4Y2PA 3RBZA 1C9KA 5I9TA 4Q05A 3VO9A 1EAMA 3DTVA 4K1XA 5JBQA 2R8ZA 4Q7KA 1K06A 4TTVA 2OWEA 1U48A 4YLGA 1MPXA 3OKPA 3A06A 3PNMA 2DGDA 2QG4A 2VDRB 1HA3A 1X2IA 3E5MA 5CPBA 5BSTA 3RABA 1NKBA 3FGNA 4L07A 5AJVB 3H19A 4MGZR 3EOZA 5KYUA 3JATA 3TTXA 4QUGA 3SQXA 1OFTA 2XQKA 2UXCB 1C1HA 3NTQA 4XA5A 2MYNA 1H9CA 5EIFA 2OLKA 3E4CA 4FP9A 2VL7A 1RWOA 1DGSA 1SZDA 4QFMA 3G8YA 5FP0A 1CHDA 4KX5A 3LHSA 4QRHA 1Y8QB 3AIMA 2F3TA 4W5JA 4A4DA 3ZW7A 4ARZB 3LDFA 1DCTA 4ARCA 1RAGA 5FOWA 1P1RA 721PA 4O2RA 3EVEA 1JVNA 4N7RA 4X63A 3QBVA 3VTZA 1B8NA 3G1UA 2I87A 2VH2A 4UZEA 4Q9LA 5DNWA 3QE9Y 1MXHA 1V8FA 5ADHA 3TNFA 3LSTA 2X13A 3MIIA 1RRCA 4BVEA 2OFFA 2R68A 1CWUA 4PRZA 4YCXA 2JBWA 3T7KA 3IO3A 2CWDA 4EJFA 2P7HA 2QT0A 2WNIA 2B37A 3HXLA 2AF4C 3I58A 5EP4A 2IS6A 3WR5A 4D5EA 1QSSA 2NT3A 1MH1A 2BCJQ 4RE6A 3RUHA 2LIPA 1H6CA 1H38A 2RKOA 3FAHA 1D5CA 3OQBA 1NVVR 1VJCA 3MZ0A 5EKDA 3I37X 3ANXA 2QPTA 4A3SA 3CUTA 4I5IA 5KVAA 3BB1A 1VQ1A 1PJQA 3BMXA 4HGZA 1U4SA 3B6EA 5A0FA 4RIEA 2A7QA 3L8DA 3QKUA 4HN2A 4MITA 1MEJA 1WVIA 2IYRA 1FVXA 1V7ZA 2OCXA 2RGUA 2ZVDA 3ROGA 4ARSA 1J8VA 4HL6A 1TZKA 1E98A 2Y77A 2AWOA 5KL8B 3TX2A 5DBCA 4ED0A 1DAOA 3HBNA 4JD5A 1C80A 1KL7A 4M76B 1KTIA 4M7RA 2O8CA 4X44A 1QDUA 5IAOA 2X0JA 2ZJ6A 3VKWA 2CBGA 4KREA 1TJYA 3ZHRA 3ZDYB 4C01A 4MUNA 1XQ9A 2WB1F 3CNLA 3H3XA 1F2UB 1CIPA 3I5XA 1R4NB 2IDZA 1V45E 4OQXA 2I6SA 3D3WB 1QKIA 1M6YA 4AY6A 3D5QA 4RVNA 4C4YA 2XMSA 4MAMA 4P98A 1LRLA 2YWJA 3EW7A 3UWPA 1NBME 4MEYA 5KG3A 1JE1A 3DE0X 4MUXA 3F7NA 5C8DA 3T15A 2PRKA 4Z0NA 2UUBB 2X41A 2OAQ1 2QT9A 4ENWA 2CLEB 4Y2VA 2ZZKA 3OY2A 3DUFA 5EGNA 3C2QA 1XVLA 5U4QA 4F2WA 2DF8A 1UT5A 5FIUA 5IIKA 3L6DA 5E6UA 5KAFU 2AYYA 3V4PB 5JC1A 5LD2B 2VDNB 2WFLB 3PRKE 1PZHA 1E9DA 1DV2A 3DYIA 2QJOA 4IY1A 1E7MA 1B3RA 2IBMA 2QVGA 3PNKA 3DBIA 1PJ3A 4OJPA 1U7UA 4HH0A 1FNSA 1UZUA 1EX9A 3L01A 2A9KA 3M6UA 2GFQA 3DWGA 3QLVA 3SIWA 4ENPA 2HHHB 1VBKA 4C7OA 4DNPA 3R1IA 4RD4A 1SWWA 1R27A 4RTMA 1UT6A 2F90A 1CV2A 3WK8A 1DBQA 3ZWMA 2HBMA 1H5UA 1LCIA 3RGGA 4NH0A 4X93A 4DVJA 1ZUIA 2LD4A 3GIWA 3GUCA 5G53C 1KFJB 1RJDA 1DBPA 2WJ6A 2WSYB 3PNOA 3S5JA 5FJIA 1S7CA 2Q45A 4NVRA 4OJMX 2MU2A 4O3RA 1HZJA 2DPGA 2YOHA 5JVDF 1NR7A 2ZIFA 1S4QA 5AW9A 3O4JA 1SU7A 3UKDA 4D8VA 2GCOB 1JLLA 4L4SA 3U37A 1BNPA 4H7IA 4XJXA 1L5LA 1RAAA 2ODBA 1VLQA 3OIUA 4MWTA 3HRIA 2OCDA 2FSSA 1FFXB 1QCDA 1YZ7A 5KAMA 3SDZA 3BDVA 4RQ3A 8ICBA 5GOTA 1E79A 1GGFA 4ED9A 2BFEB 3M9NB 1XTZA 4FTWA 2NW6A 4PONA 1EZ1A 5FBLB 2UUAB 3VC1A 2DLNA 3ASUA 2QGNA 2HF2A 4EGJA 1L8QA 2J9XB 3WRWA 4C2AA 5BN1A 5SYMA 2IYUA 2QBYB 5AXAA 1P2BA 1TYCA 1A88A 3K9QO 3LC1O 3H8WA 1F6BA 1LFAA 1UOQA 2Y68A 3D2BA 3JRXA 3T0GA 5A03A 4DFDA 1GQ2A 5I9IA 3PNVA 3JAMA 4QLOA 5K8JB 3NB0A 1Y4UA 1EB9A 2A30A 2MINA 2H4WA 3EN0A 3STYA 3VI3B 4C22A 1OFIA 4U7CA 5DQGA 2IITA 3QK7A 1SULA 4PVCA 2O6KA 4ED6A 1KAGA 4OQDA 4PFQA 2WB2A 3Q0TA 3JQPA 1U0RA 4DRXA 1E0DA 1K6IA 2QYHA 3THXB 1QBKC 3I5UA 3M9LA 3D0OA 1RWPA 4Y9UA 3GZFA 4LC0A 5BT8A 5KFRA 2VPWA 3K4HA 1FU8A 3SY8A 1RKBA 5I7HA 2JIBA 4TTRA 4NZMA 4CEHA 4JB3A 3KPVA 3UVEA 4LQDA 1CDZA 1DKNA 1W5AA 2Z2XA 2GKGA 2CLKB 3B9JA 3PFIA 4FWIB 4R51A 1YRHA 4YAJA 1SC6A 1UDRA 3NEAA 4B34A 1QHGA 4PY2A 3M6AA 1FL9A 4CCAA 4OGLA 3A4VA 4DDHA 4AKSA 2H9YA 1RBZA 1SBHA 3AM9A 4AZVA 2HT1A 2JLVA 3UMJA 5HZGA 2GTIA 4RZIA 1QG4A 1L7QA 3B36A 2V6MA 4LYEA 3FYHA 4OX9B 3I04A 4NU8X 1CVLA 2WKPA 3BJIC 1JHQA 1GFSA 1KMIY 3I6BA 3RJMA 4CM9A 3KYDB 3WQHA 1OAOC 3VR5A 3MMPA 1CVIA 2HQOA 3EIWA 4GHWA 3ZX4A 4RQ0A 3PJEA 4RMHA 3ICXA 1MAHA 1ZQ9A 2XF8A 2GS9A 2J6SA 1CS0A 1R0WA 1ZWLA 3AIIA 3OI7A 2OV2A 1M1UA 2BR4A 4C6SA 1INLA 1P39A 2QSJA 3HNPA 3MT0A 4FGSA 5HCIA 4BJ6A 4V0ME 1ESCA 4TMTA 3SV3A 4WGFA 4X90A 1SKMA 3ZI4A 5FOSA 1JIKA 1GV0A 1SOAA 1G0NA 1NF3A 3MBYA 1OUMA 1CZLA 3RD5A 3U7JA 4FYXA 4CL8A 4LFAB 3KU1A 1A96A 2QNIA 4NS1A 2E55A 5CBPA 5IAKA 1U3VA 1Z73A 3E5NA 1V71A 3OX3A 4WVLA 1MA7A 4IZOA 1IH8A 2ZI7A 3JZFA 2P67A 1GUYA 1RBMA 1SXJC 2XE6A 1P17A 4HNUA 3KNZA 2YFKA 3OHBA 1APBA 2OXCA 4B0OA 1T3TA 4I0WB 3PD7A 4PGGA 1OLSA 3MHPA 4MWSA 1NUHA 3ICVA 4FGUA 4XDZA 2HZBA 3AXTA 2Y93A 2BEUB 3FUXA 2F2AB 4N8SA 2GEKA 4LOHA 4WNAB 4YDHB 5CFPA 5GTDA 4G09A 2VP2A 1RRMA 3HYNA 5E4JA 5JAZA 3LAWA 3UBTA 3NBZC 2ILTA 5JCOA 2GPSA 4EZEA 4A5SA 1Q74A 1EK5A 2RHJA 1DTWB 1GQFA 4V0OA 2XNCA 4KBYA 1DBRA 3UT0A 4BQQA 1ZQ1A 4C4AA 1W19A 3L6CA 1LKZA 4ER5A 4N0EA 3QVMA 3SJZA 4X1IA 4DV6B 2DKFA 3HWTA 2QW8A 3UJDA 2C98A 2EJBA 1U04A 2PKQP 4C8NA 2XMDA 4U2BA 3WWZA 4BMPB 2B6NA 4WINA 1Z0IA 1NQUA 2JEOA 4DM3A 1VL1A 3E8MA 2K8AA 2E85A 2CRXA 3K0CC 1WXQA 3C3KA 3CZQA 4LRYA 3BHIA 1NX9A 8MHTA 1L4LA 3BWMA 3WK6A 3FA2A 3GPDG 5AKXA 5CW1A 1YJQA 2ZRBA 4EPXA 1IG0A 1MQ2A 3HU5A 1N6KA 4I2FA 1X0VA 4AIIA 2VFAA 1UZMA 1LDMA 1TEVA 1Z0AA 1U9JA 3ZV6A 2PUDA 3MABA 4Z99A 4UREA 3ILXA 5FLYA 1RPAA 3GDFA 3QVKA 1L3SA 2IJGX 2ZQYA 1SUSA 2QR5A 2WJAA 4EBDA 1ZJZA 3JCZA 2AG8A 4EFLA 4HAWA 4RO0A 4HMOA 4R1NA 3KWLA 5JAUA 1CUEA 1E3IA 1GKUB 1TCCA 5CHYA 5BNFA 2BTQB 2ZRAA 4R83A 5CU7A 3HU2A 2B0CA 5D46A 1UAAA 2NIPA 4DKXA 4P82A 1LC0A 2RGYA 2WVJA 3H9CA 3GJZA 1VLBA 4XIYA 3GA5A 2NVBA 2I2FA 3AIKA 5BSKA 4UD6A 1YE8A 5B57C 4OBWA 2J8ZA 4KXMA 1XDUA 1OH6A 3R0IA 2W9CB 3FWYA 3G5MA 4KGZA 3HXOA 4ECWA 2O4UX 2RHRA 4R7ZA 3PQ5A 2WIKA 4P80A 3UFXB 3OFNA 4RQUA 5DB4A 4EY6A 4JJZA 5EP3A 1JLHA 1ZD5A 1U6KA 1UJNA 4EZ9A 1DBWA 2WA1A 4PX5A 3GVIA 5KTOA 2JFXA 4KODA 1WEHA 5E1DA 4H6PA 4IUYA 1CQZA 2VK4A 1YGPA 3G59A 4TN5A 3T3IA 5FPKA 3I2KA 4YN3A 1VYTA 3QYPA 1M2JA 3OOEA 1E2KA 4OKSA 1JH8A 2R6R1 3S40A 1E9CA 2GVDC 2JIDA 3SJCA 3P97A 1PJAA 3P4UA 1HDCA 1NKSA 2GPTA 3AC0A 4Y7DA 4E7OA 4CIBA 2UZ4A 2I6GA 2YYAA 3O1JC 1I5EA 1DAMA 5A0LA 2VJ5A 1AXRA 2ORVA 3EY4A 4LF4B 5BSHA 2K4PA 1DK3A 1V9SA 3NHLA 4DMHA 5BURA 3ANYB 4DIMA 1IONA 4R69A 1G59A 3PD0A 2Z1NA 3AVXA 1SN7A 2CVHA 1J0BA 2WSIA 3DMTA 3LQKA 3PC3A 1Z0KA 1KPIA 5HR5A 3AUKA 1NJ6A 1G3UA 1QLJA 5KWIA 2C29D 4C4PA 4C8LA 1HDEA 2CFRA 5CJ2A 1NKVA 2BLNA 1N48A 2J32A 3IURA 3PRYA 1G9XA 3TH5A 2QXYA 1JECA 3QUQA 4YEDA 4YRKA 5FWNA 1MMFB 5KB3A 1S7GA 5J1SB 3FLEA 3BS5B 1CETA 2XUDA 1SCIA 2MSCB 1BEZA 1PR9A 3N6VA 3RVRA 2W37A 4KKVA 4ZC1A 1BCRA 3GYBA 3SBXA 1ORDA 1YULA 2I4RA 4EW2A 2XI9A 3VZQA 1ECGA 2ZYRA 3FMVA 3FYDA 4BGVA 4QSMA 2W9CA 1KU6A 3JQBC 2OM6A 2WHEA 1RE0A 3BQMB 3IT1A 5B7QA 3RR2A 3GIJA 1W4BA 3OM9A 2B8WA 1R5OA 4CIXA 4N5DA 3D7RA 2K4HA 1CS0B 2IU0A 1T9CA 1SZHA 2C2RA 2LW7A 3DM9B 5EPEA 4P4GA 2I29A 2G80A 3OO0A 3NETA 2NWQA 3M70A 5J58A 1Z29A 4EMBA 3AF2A 3IHQB 2HM7A 1S02A 4J2OA 1CPYA 4S04A 1NP7A 3ECCA 4NECA 4FIDA 1EFRD 1OAAA 2E1FA 2R6AA 3KLPX 4NABA 2GUGA 2YWDA 1IPEA 1P0QA 3SOZA 3P32A 2JGDA 4D3FA 2DMRA 4OJNA 2XBMA 1Q7BA 2ZUEA 1D0IA 4GMDA 3BZCA 3M4ZA 3PZRA 5CT9A 4YQZA 1PLJA 2J4FA 5A3SA 3DZBA 4I5DA 3HABA 4WOCA 1HQKA 3B3QA 2ZIUA 4UU8A 3ZYCA 1Z56C 2VK2A 3CT6A 3A27A 4CJXA 1U2QA 4ZCIA 3GLFE 3P0EA 1L3TA 3V42A 2KKVA 2BBSA 2B9VA 4FONA 3FLAA 4OO1J 5K0EA 1ZRMA 4MR8A 4JJ7A 1ISFA 1US8B 4F46A 3GAFA 4UFOA 1Q0UA 2FGKA 1IBKB 3M6KA 3SFTA 4F3YA 1KEVA 4Q93A 4ELUA 3ZPXA 2Q5QA 4Q9NA 9ICCA 4I6EA 4RJIA 3T7AA 1X7GA 1WWKA 1ZOLA 1WB5A 1YZQA 2IYQA 5HIMA 4EO7A 4ZI7F 1BMTA 1K66A 2WIAA 3BORA 2WYIA 2CNBA 3W2TA 3WLNA 5KINB 2IH5A 4DC0A 1FB5A 1DWUA 4ETNA 5CLFA 4BIMA 2V0GA 5UKDA 2QLJA 1BJTA 1L4HA 2VSQA 4N9WA 1DRGA 2B99A 4B33A 4DJ5X 3RH6A 5F98A 5KYYB 1QF6A 2VQ6A 1L9XA 1G2QA 2NTVA 3RLIA 4PPGA 3U7RA 5JI3E 4FYVA 4TXLA 2I2XB 1VDVA 4FZRA 4DO9A 3SGLA 4DLZA 1DOZA 1USWA 4UE2A 1IHXA 5H70A 2O14A 4B0PA 2OVBA 3FNGA 5LNK1 1ANKA 2NUAA 4J94A 2FRXA 4Z0HO 2DJ5A 4I7EA 4I3GA 4IR9A 2B1IA 2BL4A 4BBJA 1WD5A 1MDFA 4NH4A 3KU4A 4YALA 5IIMA 3MWLA 1C3XA 4U7JA 1A9OA 1XEXA 1SU4A 4CBVA 1EFVB 1A8SA 1IE3A 1N7IA 3OVMA 2H00A 4IP0A 5J4HA 3GXBA 4F5NA 1RYNA 5GVRA 1WCNA 7ICQA 4YCJA 3T7JA 2PNJA 1JR3D 3EPPA 4S1OA 4B83A 5B55A 4JYZA 1CCWA 3OLCX 2QMZA 1V9LA 4LC9A 4HWOA 4OAOA 4ACBA 8ICJA 2W6PA 5KOJA 3FYCA 3RAXA 2BGGA 2BE7A 2FSHA 2JAXA 3HKBB 3DBRB 2BCVA 4WQMA 5CJJA 1MAWA 3J81k 2CLOB 1BQEA 4HRXA 4MQUA 1XTKA 4U00A 1IY2A 2JA1A 1A9XA 5GTHU 4CV1A 1X66A 1AVTA 2H1LA 3UPQA 5FI5A 5JDIA 2H31A 1QIMA 1ADJA 3IHLA 4TV9F 2AJDA 2WWIA 1ZHHA 2BONA 4FBMA 4JR1A 4XTCS 2FCRA 2I78A 2Y0SF 1M54A 4EGQA 4C6TB 1E7SA 3G2KA 2QQ0A 2EV9A 5B6PA 4JUZA 3OAAD 3T5TA 1Z13A 3HKZC 1PFYA 4YVZA 1S0UA 2PGXA 3R3SA 4G5XA 4KWEA 4EHJA 3FCSB 4ZGWA 5B66U 2VSOA 4JYCA 4PX9A 3H86A 1KKMA 1Z82A 5HR7A 3KKPA 5DG9A 5LU9A 1XKQA 1W5FA 4LVCA 2XVMA 3TE7A 1K4MA 3U80A 2VJCA 4C4TA 5KQGA 2ZWMA 1GGVA 4IH1A 1Q3KA 3NGDA 2H8GA 1OZHA 1PQ4A 5FTMA 1W6UA 4LJ6A 5KFZA 3COPA 1CJBA 2D2FA 3MSCA 4LHZA 3HTXA 4DA4A 1I3LA 3TOSA 1P9WA 1TTPB 5J63A 5FBVB 4YCNA 3EPHA 8ICRA 1BS2A 3SQLA 4DJAA 5EZ6B 4LXUA 5BV1A 3UKOA 2OCLA 1IN6A 2JRZA 1BMQA 4MPJA 4IIVA 2Y1OA 1ISMA 2WDPA 5A3RA 3NH9A 3ZGYA 5IG2A 3BN3A 3THVA 3T3OA 3GGGA 1ZJ6A 4DS4A 1M2HA 2IV2X 2NNLD 2ZIXA 4XX1A 5I45A 4UMDA 3C4QA 3EPIA 4NL4H 4OJTA 2O1WA 4JYPA 3AU6A 1ZINA 4GMXA 1QGYA 2MDTA 4KP7A 4OO3A 1IXSB 1ODJA 3AF1A 5J0XA 2R85A 3FIUA 4QIWC 2WKWA 2Q0HA 4I55F 1CR4A 2I2DA 1D0SA 1XF9A 1DO2A 2ZS7A 3Q98A 4GC6A 3TKLA 1Y7PA 4BLQA 5P21A 1M0TA 5KNBD 3I9V1 3DOCA 1JT9A 2HTFA 4YUZA 2FLPA 2PV7A 4TTSA 5BNTA 5HHHA 1SOMA 3MF4A 1OA1A 2A4KA 4LXIA 5D8DA 3TMYA 1Z00A 1D5WA 5FO1A 2YXEA 4UDNA 4RPXA 3H2JA 1G55A 3C8HA 3L46A 4KQFA 4RA9A 1CD5A 4EUNA 2AMFA 3NC0C 4UM8B 1DKRA 4DQPA 1FYVA 1QX3A 1UQTA 4IV0A 4MGYR 4BVJA 4F8YA 3R6DA 2BHNA 5ENZA 2JZBA 3K72B 4I9HA 2PK3A 4BLTA 4ECEA 1DRVA 4D4LA 1TB4A 4P34A 1SV0C 4H3SA 3K9CA 3SYKA 4IJQA 2GB4A 3ELUA 4OB6A 2OB1A 3RRBA 3UJ9A 1W9HA 4EG1A 5ISMA 5CD1A 2XVYA 1VE5A 2DF4B 2D7JA 2VNAA 2D0OB 4JT4A 4XSHA 3VZPA 2J0EA 4TXJA 4G9BA 3VGPA 1CY8A 4AD8A 1SIOA 2IEYA 4FLFA 4KN5A 1IIPA 5HEKA 3K0HA 2B7BA 4JCOA 3BERA 4EDFA 4F11A 5AI5A 3HCOA 2XY6A 5J0PA 2ZSAA 4JXKA 5GTIU 1YBVA 1UXJA 1QLWA 3ELWA 3IKVA 1JDTA 4IIJA 1GPJA 3CXRA 3JVVA 4S3MA 3NUGA 2FMPA 5EQFA 3VA7A 1U3GA 3CZMA 3W3ZB 5IJ9A 1FJHA 3QF7A 3ZU3A 4H9GA 4D44A 1SXEA 8ATCA 2BI8A 5I7WA 1BX3A 2G8NA 5CDHA 1DELA 2VKQA 1GL7A 1G8PA 1OROA 3KSMA 2Y1IA 4J4TA 4ZODA 5K8CA 4UEQA 1QIKA 3IBYA 3CEPB 4N82A 2QTMA 4OGGA 3NZEA 5LN1A 1YS1X 4TYMA 1NFFA 2V8BA 1VA4A 1QZXA 2BMAA 1BJRE 1P19A 1JTEA 1Q5PA 1SKBA 2AOUB 2AW3A 2YIDA 2R8GA 3LPDA 3SR4A 1BDIA 3AEUB 2I3DA 4JVOA 2DGZA 2G25A 2KX7A 1OFUA 5DKWA 2ZJ3A 2DHRA 3LT0A 2Z5VA 3JD1A 2BCSA 3PHCA 4BRUA 1G7TA 1X6IA 1WXWA 3ADCA 2DE0X 4MWBA 1GNRA 2QRVA 2Y67A 1B0AA 3JWHA 4AVYA 2HCRA 1DX9A 2J9YB 4ZZ0A 1F7UA 1IZYA 1L5NA 2PFQA 1EE2A 8ICMA 4PGMA 3LT1A 3QE0A 4Y3UA 4UBCA 3BK2A 4DYVA 4RT2A 1RP7A 4FS3A 1QZTA 2BFAA 1X8JA 4K46A 4GVXA 3EXEA 1SL2A 6REQB 1JDNA 1ZCAA 4I36A 5B1SA 5MF6A 3T5JA 2ODPA 3LTNC 3U4QA 2OG2A 1E6CA 2UVPB 3RR7A 2ZOSA 3PGKA 3PT9A 4MO2A 2R6HA 4OQQA 1MNQA 1K1SA 4Y1EA 4ZCRA 2ACWA 2QY9A 3TTUA 2CDRA 2CVPA 3K0EA 4F3NA 4MS3B 3EARA 4RDCA 4BO6A 1RCTE 1X87A 9ATCA 3Q7RA 1QVZA 1UFOA 3JQCA 3WI7A 1E2MA 1PNVA 2C4VA 3H2BA 3SZRA 1AKWA 4Q15A 4ZZ3A 1MPTA 1PT6A 2B92A 3V48A 4AECA 2PS9A 3PPIA 4JNKA 2E8OA 4OLAA 1SHJA 1WYGA 4LK3A 3RHSA 3KEFA 1PKEA 1XZDA 4Q4AA 4FBGA 4O2AA 4A15A 1AIPA 2GN2A 2HTEA 3BE5A 1U1CA 3CSSA 1HYGA 1VP9A 2YYZA 2JDIA 2GH1A 3IUEA 4XDYA 5K0JA 4XD7D 2MSKA 2EAUA 4L85A 5L53A 3OU6A 1VIAA 1VE7A 2QLMA 3B89A 5AM3A 3FPAA 3WIBA 2ZZMA 3X1MA 1Z2EA 1YT5A 4CT0A 1N2XA 1Q0SA 1D1SA 2OT3B 2YHSA 4JCCA 2HHTA 3KFXA 5J0YA 4M8KA 1KRXA 2O0JA 5HQJA 5IIIA 2AZTA 2AG5A 3IMCA 4JIMA 1XNJA 1OI3A 1R15A 1UDCA 1F6WA 3WLEA 2IIBA 2FRVA 2JFPA 4XKJA 4GMGA 3LNCA 4EHLA 2TMGA 4J3JA 2E2WA 2QROA 1K3TA 1CNEA 4ESOA 4L0CA 2DLDA 3G3EA 5EIBC 1JJIA 5DNAA 1O08A 3N7SC 1VSTA 1U3DA 4ILKA 3QLUC 5F7XA 3MB8A 4BO2A 2A7XA 1ECJA 4ZOBA 1TUBA 2WMNB 1C9YA 1OXUA 2NZUG 1BPBA 2WC1A 3RBXA 2V7EA 2YHUA 4UU7A 4O4LB 1TK9A 1XKTA 2P91A 5C2JB 4JI7B 2WHPB 3CTPA 1PJ4A 5L3QB 3IKMB 4BUZA 1E2IA 3H5RA 2IQ5A 3AP3A 4X91A 3FB1A 5CP8A 4ZU3A 2JGAA 4ZAFA 1CEYA 4TUSA 4BS9A 3HNOA 3L7AA 4BEVA 2WWYA 2OXEA 2OP1A 2IXBA 3GBSA 4LYYA 1JQBA 1QCYA 2COUA 3FUVA 4PZ0A 5KTKA 4TKVB 2ZCJA 1T9GS 2HK9A 2LV8A 4FN5A 1XMPA 3IV9A 1A8HA 2G1AA 3QKIA 5TNXA 2HNBA 5K45A 1SM4A 2LCIA 4ADSG 4FOLA 3OX2A 4HFNA 3AVUA 3AFGA 4JLAA 3ZC3A 2VNKA 2ZR7A 1DQYA 8ICWA 2X2OA 2P8JA 4XIGS 4A6DA 5FL3A 1Y7LA 1NURA 2R2GA 1A1VA 1YONA 2HO4A 2NVOA 3PHHA 3T9BA 3HDGA 2QARA 3O2QB 3GJXC 4O8CA 1GIAA 4F4KA 2BLLA 2EXXA 3C3JA 2O57A 1GTJ1 3L41A 4NOLA 3SF8A 5GZ1A 3GDGA 2C20A 1ZC3A 3ORFA 1QAMA 5HM8A 2DBVO 2FF7A 4UBJA 3EFHA 3IBCA 4YCCA 3COWA 2OBYA 4ER6A 4GL2A 3W2FA 1QC5B 1AV7A 4WKPA 3VX3A 4WV3A 4CEIA 3E6AA 3GAZA 2QB0B 5ESXA 2ZFUA 1ETUA 4OHCA 5HK8A 5EP2A 3H11B 4IINA 3RC1A 3UIEA 4BAZA 3KJGA 1Y42X 1OB2A 5M3BA 1KYXA 3OIFA 5F7OA 1NOIA 2SKDA 4HUQB 4Q7LA 1O9GA 2WQ7A 2KIWA 1DAGA 3NHRA 4N18A 1XQ1A 3ESAA 4ARZA 3ZK7A 4LE2A 5J2DA 4Y2XA 4FW9A 1ZD2P 2DFDA 4JBHA 4XFKA 1ZFNA 4XQEA 1SFRA 1NU6A 1P1CA 3WKBA 1A4UA 1Q95A 5F1YA 1PWEA 1HZZC 3BIOA 3DPUA 4KIWA 2BF4A 5F7JA 1NQWA 1VGVA 4GGMX 3KKLA 4I1YA 4QTXA 5K51A 1C4KA 2C5LA 3TLEA 2FVYA 5FUXA 1JBEA 2N3ZA 2XYRA 3ADOA 3LVBA 1VHQA 3NTRA 4D9HA 2XICA 1E1RD 2Q8NA 2PJUA 2W93A 4HRAA 4PQEA 1XZLA 3OQIA 2C2MA 1IFXA 3SR3A 3TNLA 3MCZA 2C00A 2XCRB 4JMLA 3VO1A 3LTEA 2A3VA 1ZMOA 2Y99A 2ANCA 2M9MA 4DL2A 3LLSA 3N7UA 3EWAA 1C8VB 3O31A 5BQ5A 3V1LA 1SV0A 1C30B 4ALLA 1S3IA 5BYAA 2W90A 4B4VA 1IIBA 4HD8A 3D3EA 4MVJP 4ED1A 4H7EA 1B00A 3EVAA 3UAVA 3P9KA 3G02A 1DEKA 4QREA 3TLGA 2HFKA 3DNFA 3GLGB 3PA8A 5ALYA 1GNVA 2EYQA 1G8JA 3EG9A 5IYZB 2W9BB 4F5DA 2PLWA 4F84A 4KX3A 2A1JA 4OQEA 4CKBB 3DOHA 3FNIA 2G5PA 2PNFA 4EJ2A 2BDEA 4MWEA 2WUGA 4YONB 5T41A 4DQDA 1GT91 3LC0A 4NYMR 3QX9A 4X84A 3HKEA 2RIRA 1U1IA 2Q5HA 5C53B 5GZ3A 1W48A 3C7TA 4CQMA 1PNTA 1GL6A 1PG5A 3IGFA 5AJYA 3WGOA 1T2AA 1AKEA 1J2RA 4G97A 1WHTA 1CR1A 4HH4