2W18A

Crystal structure of the c-terminal wd40 domain of human palb2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
333
structure length
306
Chain Sequence
NLQLVSELKNPSGSCSVDVSAMFWEKEPCIITACEDVVSLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGGKENQFLMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDASVCHKAYSEMGLLFIVLSPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHCAAAILTSGTIAIWDLLLGQCTALLPPVQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PARTNER AND LOCALIZER OF BRCA2
publication title Structural Basis for Recruitment of Brca2 by Palb2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
total genus 69
structure length 306
sequence length 333
ec nomenclature
pdb deposition date 2008-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16756 PALB2_WD40 Partner and localizer of BRCA2 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2w18A00
4CI1A 3K26A 4G56B 4LGNA 3IKOA 1U2VC 3GREA 5GXIA 3MZKA 5EARA 3SBQA 2OIZA 3OL2A 4J79A 4FAVD 3SVWD 2HYEA 2PM9A 3FM0A 4J8GA 5GXHA 4JT5C 5FKTA 4FA5D 2B5MA 3DM0A 5HE3B 4ERYA 1SQ9A 2H68A 2CO0A 1YFQA 4FHLA 4LG9A 4QQEA 2AGLA 3C75H 3AH8B 2G99A 5FKSA 4L3GD 4ZOXA 2I0RA 4CI3A 3AL8A 4A0AB 3IIYA 2P9NC 1JOFA 5IJ7E 3VH0A 4JT6C 4J73A 2O9KA 2Q7QA 3EU7A 2YNOA 3PXTD 4L9OA 3KRWB 1JMXB 4IMMA 3C99A 4J82A 4PC0A 3W15A 2H9MA 3BWSA 3I7LA 3EI2B 3IJ0A 4GGDA 4U7AA 5IT9g 4KFMB 3SHFA 4O3UB 3I89A 1OLZA 2MTAH 5I5JA 2IWKA 5JWZA 3NVNA 3OL2B 2PM7B 2B5LA 4JSNC 4GM3A 4Z8LA 5EM2A 4X61B 3UVNA 3NVXA 5FKRA 2PM9B 3JB9L 4JSPC 2BCJB 3UVLA 5IGQA 2H3XA 2HKRA 4CZXA 4ESGA 4I79A 4HDJA 2H47A 3BG1A 3CIKB 4CI2A 5GMKn 3P4FA 3EI1A 4N14A 2OVRB 3AL8B 5TEEA 2GC4A 2I0SA 3EI2A 4UI9R 3MMYA 2Z2PA 2EBSA 4NSXA 3HFQA 3JZHA 5CXBA 3RRMC 3VGZA 1N6EA 4LG8A 2H6QA 5TDHB 3U4YA 4X63B 5C9ZB 4J77A 3SJLD 3PSCB 3JRPA 3AFCA 4FA1D 2XYIA 1P22A 3OKWA 5B4WA 5EM2B 2AGYA 4CY5A 1TYQC 1XIPA 5EMMB 3ORVD 2HXCA 3OTTA 5K1CC 4O3TB 4TZ4A 1GOTB 5FA5B 5CXCA 3BG0A 3ULEC 5IGOA 2IUPA 4Y5RD 3EI1B 3SBRA 4GQ2P 4BUJC 4R7AB 4A2LA 2P9UC 3CFVA 2AH0A 4A2MA 4FWWA 4O9DA 4EWRA 5CXBB 3PXSD 3N0EA 2H14A 5AFU3 3C5MA 3OKTA 4J8BA 3J80g 2P9KC 2AH1A 4H5JA 4YVDA 2P9LC 4OWRA 3VA6A 4E54A 1VYHC 2P9SC 1N6FA 4A7JA 2G9AA 5HQGA 3UKUC 5A2Qg 4QT8A 4CY2A 3I2NA 3JZNA 4O45A 2UZYB 3I7OA 3IJCA 3V9FA 4A09A 5CXCB 5HYNB 4QL1A 1RI6A 2IAAA 4BH6A 2HJBA 2IUQA 4ES0A 3EWEA 3PVUB 3I8EA 2IURA 4QRJA 2OVQB 4J0XA 5FQDA 3PSLA 5AMSA 4XEIC 4O1QD 5HE2B 4X60B 4FB1D 4CZYA 4CI8A 2I3TA 3ODTA 4XYHA 4GGCA 4J86A 2B4EA 2AGWA 3RN1D 2OVPB 4U1EI 4PBZA 4E54B 3L4OD 3EI3A 2OK4A 4A0BA 2TRCB 2H6KA 1MG2A 4J78A 4Y7RA 4K3JB 3V5WB 3AL9A 3J81g 4JXMA 1U4CA 4A09B 5FKQA 5KDOB 4XYIA 3MKQA 3DXKC 2PBIB 2I0TA 3I7HA 3DWLC 3PE7A 3I7NA 5EAMA 2I3SA 2HJ4A 4D0KA 3EI4A 2YBAA 4ZN4A 4J0WA 1NEXB 2YNNA 5FXYA 5THAA 3KRXB 4PSXB 2CO0C 2IWFA 1K8KC 3PVWB 4J87A 3EG6A 5EAPA 3E0CA 2AGZA 3V7DB 3IJ1A 3JZGA 1FWXA 3SFZA 2W18A 1R5MA 1PBYB 5H17A 4GQ1A 5K19A 3JROA 5EMLB 4PNKB 3EI3B 4A0BB 5H14A 4J84A 2CE9A 1S4UX 2YNPA 2IUVA 3RLMD 4AOWA 2GNQA 4JSVC 4CZVA 2J56H 3RFGA 4K3ID 4ERZA 2HKMA 4JD2C 3FGBA 3SXTD 4CC9A 4IA9A 1K32A 3NVQA 4GM9A 3RN0D 3FRXA 3B7FA 2XU7A 5TF2A 2HESX 5FLXg 2YMUA 3JPXA 5AJAA 2H6NA 3I7PA 1GP2B 1NR0A 3UR4A 1TBGA 1OMWB 4X3EA 2AGXA 1MG3A 5CYKA 2H13A 2CE8A 1B9YA 5IC7A 3I7KA 4J81A 5TEFA 1L0QA 1GG2B 4A11A 4ZOZA 2J57G 4CY3A 1A0RB 2XL2A 3PXWD 4MK0B 4BL0A 3RSEC 5HE1B 4L1QD 3N0DA 2UZXB 5I5IA 4H5IA 4GMBA 2AQ5A 2QXVA 3EMHA 3IIWA 3UKRC 3OW8A 3L4MD 1JMZB 3UVOA 4FA4D 1PI6A 5C2VB 1MDAH 3SCYA 2H9PA 3MXXA 4PXWA 3F3GA 3SWSD 3OKYA 4FAND 5EMJB 3CFSB 4FA9D 5C2WB 1ERJA 3GFCA 4A08A 5GSAA 3RMZD 2Z2NA 2H9NA 3F3PA 1B9XA 4AEZA 3UVKA 5EMKB 1JJUB 5CYKB 4D6VA 2P9IC 3JAMg 4E5ZA 3F3FA 4PSWB 2OK6A 5H1MA 2J55H 2XL3A 4GGAA 4A11B 5EALA 4GZ8A 2Z2OA 2CNXA 3SMRA 4GQBB 1GXRA 4ZOVA 2CN3A 3C9CA 3ZWLB 3MZLA 1N6DA 2BBKH 5SXMA 2P9PC 5I5MA 1SHYB 1XKSA 1PGUA 1QNIA 3OKYB 2B5NA 4L3HD 4A08B 4PBYA 4OZUA 3SLED 2YB8B 3I8CA 4ZOYA 3MKSB 2OJYA 3UVMA 3RFHA 2QC5A 3K27A 3DXMC 1XHMA 3A0FA 4JSXC 4A0AA 3SBPA 4E5ZB 5IJ8E 3SN6B 4GM8A 2CN2A 1Q47A 1PEVA 4CY1A 1SQJA 2H9LA 5HE0B 3EI4B 4ERQA 3DSMA 2GC7A 2PM6B
chains in the Genus database with same CATH superfamily
4CI1A 3K26A 4G56B 3NIDA 1H2XA 5E6UA 4LGNA 3IKOA 1U2VC 3O4GA 3GREA 5GXIA 1I2MB 3MZKA 5EARA 3SBQA 2OIZA 3OL2A 3ZDYA 4J79A 4FAVD 2EIBA 3EQ9A 3SVWD 2HYEA 1M1XA 2PM9A 3FM0A 4J8GA 5GXHA 4JT5C 5FKTA 4FA5D 2B5MA 4G1MA 3DM0A 5HE3B 4ERYA 1SQ9A 2H68A 2CO0A 1YFQA 4FHLA 3ZE1A 1GOHA 4LG9A 4QQEA 5C86A 2AGLA 3C75H 2VDQA 3AH8B 2XDWA 2G99A 5FKSA 2HU7A 4L3GD 4ZOXA 4DNVA 2VC2A 3FCUA 3MUOA 2I0RA 4CI3A 3AL8A 4A0AB 3IIYA 2P9NC 1JOFA 5IJ7E 3VH0A 4JT6C 4J73A 4QAMA 2O9KA 2Q7QA 3EU7A 3MVDK 2YNOA 3PXTD 4L9OA 3KRWB 1JMXB 4IMMA 3C99A 4J82A 4PC0A 3W15A 3ZE2A 2H9MA 3BWSA 4NC4A 3I7LA 3EI2B 3IJ0A 4GGDA 4U7AA 5IT9g 4KFMB 3SHFA 4O3UB 3I89A 1OLZA 2MTAH 5I5JA 2IWKA 5JWZA 3NVNA 3OL2B 2PM7B 3DDUA 4JHNA 2B5LA 3O4HA 1JV2A 4JSNC 4GM3A 3NIFA 4Z8LA 5EM2A 4X61B 3UVNA 1O6FA 3NVXA 2PM9B 5FKRA 3V4VA 3JB9L 1JTDB 4JHPC 1U8CA 4JSPC 2BCJB 3UVLA 5IGQA 3FCSA 2H3XA 2HKRA 2VDOA 4CZXA 4ESGA 4I79A 2HU5A 4HDJA 2H47A 3BG1A 3CIKB 4CI2A 5GMKn 3P4FA 3EI1A 4N14A 2OVRB 3AL8B 2XZGA 5TEEA 2GC4A 2I0SA 3EI2A 4UI9R 3MMYA 4MMYA 2Z2PA 2EBSA 2EIEA 2JKXA 3VI4A 4NSXA 3HFQA 3GC3B 3JZHA 5CXBA 3RRMC 3VGZA 1N6EA 4LG8A 5E6RA 2H6QA 3ZE0A 5TDHB 3IURA 3IUQA 3U4YA 4X63B 5C9ZB 4J77A 3SJLD 3PSCB 3GD1I 3JRPA 4WK0A 3AFCA 1L5GA 4FA1D 2XYIA 4Z7QA 1P22A 3OKWA 5B4WA 5EM2B 2AGYA 4CY5A 1TYQC 1XIPA 5EMMB 3T3PA 3ORVD 3MUNA 2HXCA 3OTTA 5K1CC 4O3TB 4TZ4A 1GOTB 5FA5B 5CXCA 3BG0A 3ULEC 5IGOA 2IUPA 4Y5RD 5M5TA 2VDRA 3EI1B 3SBRA 5M5RA 4GQ2P 4BUJC 4R7AB 1TYEA 4A2LA 2P9UC 3CFVA 1QFMA 4DNUA 2AH0A 3K72A 4A2MA 1UOPA 4FWWA 1QFSA 4O9DA 4EWRA 5CXBB 3PXSD 4UM9A 1VE7A 2H14A 3N0EA 5AFU3 3C5MA 4NBMA 4Z7OA 3OKTA 2EIDA 4J8BA 3J80g 2P9KC 2AH1A 4H5JA 4YVDA 3T3MA 2P9LC 4OWRA 3VA6A 4E54A 1VYHC 2P9SC 4AN0A 1N6FA 4A7JA 2G9AA 5HQGA 3UKUC 5A2Qg 4QT8A 4CY2A 2XE4A 4DNWA 3I2NA 3JZNA 4O45A 2UZYB 3I7OA 3IJCA 3V9FA 4A09A 5CXCB 5HYNB 3EQ8A 4QL1A 1RI6A 2VZ1A 1E8MA 2IAAA 4BH6A 2HJBA 3IUMA 2IUQA 4ES0A 1O6GA 3EWEA 3PVUB 3I8EA 3VI3A 2IURA 5FFOA 4QRJA 5M5SA 2OVQB 4J0XA 5FQDA 3PSLA 5AMSA 5FFGA 4XEIC 4O1QD 5HE2B 4X60B 4FB1D 1YR2A 4CZYA 4CI8A 2I3TA 3ODTA 4AMZA 4XYHA 4GGCA 5E6SA 4J86A 4WK2A 2B4EA 2AGWA 3RN1D 4D9SA 1VZ3A 2OVPB 4U1EI 4PBZA 4E54B 3L4OD 4BCBA 2VZ3A 3EI3A 2OK4A 4A0BA 2TRCB 2H6KA 1MG2A 4J78A 1UOOA 4Y7RA 4K3JB 3V5WB 3AL9A 3J81g 4JXMA 1U4CA 4A09B 4BP8A 5FKQA 4BP9A 5KDOB 4XYIA 2VDPA 3MKQA 3DXKC 2PBIB 2I0TA 3I7HA 3DWLC 3PE7A 3I7NA 5EAMA 2I3SA 4WJKA 2HJ4A 4D0KA 3EI4A 2YBAA 4ZN4A 3K6SA 4J0WA 5M61A 1NEXB 2VDKA 2YNNA 5FXYA 5THAA 3KRXB 4PSXB 2CO0C 2IWFA 1K8KC 3PVWB 4J87A 3EG6A 4MMZA 5EAPA 3E0CA 2AGZA 3V7DB 4G1EA 3IJ1A 5M5UA 2VDLA 3IUJA 3JZGA 1FWXA 3SFZA 4RE6A 2W18A 1C9LA 3NIGA 1R5MA 1PBYB 5H17A 4GQ1A 5K19A 3JROA 1K3IA 5EMLB 4PNKB 3EI3B 4A0BB 4BCCA 5H14A 4J84A 2CE9A 2VDMA 1S4UX 2YNPA 2IUVA 4G55A 3RLMD 4AOWA 2GNQA 4JSVC 4L1MA 2J56H 4CZVA 3RFGA 4K3ID 4ERZA 2HKMA 3V4PA 4JD2C 3FGBA 3SXTD 4CC9A 4BCDA 4IA9A 1K32A 4MMXA 3K71A 3NVQA 4GM9A 3RN0D 3FRXA 3B7FA 2XU7A 5TF2A 2HESX 5FLXg 2YMUA 3JPXA 5AJAA 1E5TA 2H6NA 3I7PA 3O4JA 1GP2B 1NR0A 3UR4A 1TBGA 1OMWB 2BKLA 4X3EA 2AGXA 4AX4A 1MG3A 5CYKA 5M5VA 2H13A 2CE8A 1B9YA 5IC7A 3I7KA 4O02A 4J81A 4Z7NA 5TEFA 1L0QA 1GG2B 4A11A 5HDBA 4ZOZA 2J57G 4O2WA 1VE6A 4CY3A 2XL2A 1A0RB 3PXWD 4MK0B 4BL0A 2WQ8A 3RSEC 5HE1B 4L1QD 3IUNA 3N0DA 2UZXB 5I5IA 4H5IA 4GMBA 2AQ5A 4IRZA 1H2YA 2QXVA 3EMHA 3IIWA 3UKRC 3OW8A 3L4MD 1E8NA 2QR5A 1JMZB 2HU8A 3UVOA 4FA4D 1PI6A 5C2VB 1MDAH 3SCYA 2H9PA 3MXXA 4PXWA 3F3GA 3SWSD 3O4IA 1UOQA 4NENA 3OKYA 4FAND 5EMJB 3CFSB 4AN1A 4FA9D 5C2WB 1ERJA 1H2ZA 3GFCA 5GSAA 4A08A 3RMZD 3ZDZA 3OF7A 2Z2NA 2H9NA 3IVMA 1A12A 3F3PA 1B9XA 3IJEA 2VDNA 4AEZA 3UVKA 5EMKB 1JJUB 5CYKB 4D6VA 2P9IC 1BPOA 3JAMg 4E5ZA 3F3FA 4PSWB 2OK6A 5H1MA 2J55H 2XL3A 4GGAA 3QHYB 4A11B 5EALA 4GZ8A 2Z2OA 1T2XA 2CNXA 1H2WA 3SMRA 4GQBB 1GXRA 1GOFA 4ZOVA 3IULA 2CN3A 3C9CA 3ZWLB 3MZLA 4UM8A 1N6DA 2BBKH 2EICA 5SXMA 5C92A 1VZ2A 2P9PC 5I5MA 1SHYB 4AMYA 4NAAA 1XKSA 3QI0A 1PGUA 1GOGA 4RE5A 1QNIA 3OKYB 2B5NA 4L3HD 4A08B 4PBYA 4OZUA 3SLED 2YB8B 3I8CA 1UTCA 3MKSB 4ZOYA 2QZPA 2OJYA 3UVMA 3RFHA 4WK4A 2QC5A 3KCIA 3K27A 3DXMC 1XHMA 3A0FA 4JSXC 4A0AA 3SBPA 4E5ZB 5IJ8E 3SN6B 4GM8A 2CN2A 1Q47A 1PEVA 4CY1A 1SQJA 2H9LA 5HE0B 3EI4B 4ERQA 3DSMA 3ZDXA 1C9IA 3EQ7A 2GC7A 2PM6B
chains in the Genus database with same CATH topology
4CI1A 3K26A 4G56B 4LGNA 3IKOA 1U2VC 3GREA 5GXIA 3MZKA 5EARA 3SBQA 2OIZA 3OL2A 4J79A 4FAVD 3SVWD 2HYEA 2PM9A 3FM0A 4J8GA 5GXHA 4JT5C 5FKTA 4FA5D 2B5MA 3DM0A 5HE3B 4ERYA 1SQ9A 2H68A 2CO0A 1YFQA 4FHLA 4LG9A 4QQEA 2AGLA 3C75H 3AH8B 2G99A 5FKSA 4L3GD 4ZOXA 2I0RA 4CI3A 3AL8A 4A0AB 3IIYA 2P9NC 1JOFA 5IJ7E 3VH0A 4JT6C 4J73A 2O9KA 2Q7QA 3EU7A 2YNOA 3PXTD 4L9OA 3KRWB 1JMXB 4IMMA 3C99A 4J82A 4PC0A 3W15A 2H9MA 3BWSA 3I7LA 3EI2B 3IJ0A 4GGDA 4U7AA 5IT9g 4KFMB 3SHFA 4O3UB 3I89A 1OLZA 2MTAH 5I5JA 2IWKA 5JWZA 3NVNA 3OL2B 2PM7B 2B5LA 4JSNC 4GM3A 4Z8LA 5EM2A 4X61B 3UVNA 3NVXA 5FKRA 2PM9B 3JB9L 4JSPC 2BCJB 3UVLA 5IGQA 2H3XA 2HKRA 4CZXA 4ESGA 4I79A 4HDJA 2H47A 3BG1A 3CIKB 4CI2A 5GMKn 3P4FA 3EI1A 4N14A 2OVRB 3AL8B 5TEEA 2GC4A 2I0SA 3EI2A 4UI9R 3MMYA 2Z2PA 2EBSA 4NSXA 3HFQA 3JZHA 5CXBA 3RRMC 3VGZA 1N6EA 4LG8A 2H6QA 5TDHB 3U4YA 4X63B 5C9ZB 4J77A 3SJLD 3PSCB 3JRPA 3AFCA 4FA1D 2XYIA 1P22A 3OKWA 5B4WA 5EM2B 2AGYA 4CY5A 1TYQC 1XIPA 5EMMB 3ORVD 2HXCA 3OTTA 5K1CC 4O3TB 4TZ4A 1GOTB 5FA5B 5CXCA 3BG0A 3ULEC 5IGOA 2IUPA 4Y5RD 3EI1B 3SBRA 4GQ2P 4BUJC 4R7AB 4A2LA 2P9UC 3CFVA 2AH0A 4A2MA 4FWWA 4O9DA 4EWRA 5CXBB 3PXSD 3N0EA 2H14A 5AFU3 3C5MA 3OKTA 4J8BA 3J80g 2P9KC 2AH1A 4H5JA 4YVDA 2P9LC 4OWRA 3VA6A 4E54A 1VYHC 2P9SC 1N6FA 4A7JA 2G9AA 5HQGA 3UKUC 5A2Qg 4QT8A 4CY2A 3I2NA 3JZNA 4O45A 2UZYB 3I7OA 3IJCA 3V9FA 4A09A 5CXCB 5HYNB 4QL1A 1RI6A 2IAAA 4BH6A 2HJBA 2IUQA 4ES0A 3EWEA 3PVUB 3I8EA 2IURA 4QRJA 2OVQB 4J0XA 5FQDA 3PSLA 5AMSA 4XEIC 4O1QD 5HE2B 4X60B 4FB1D 4CZYA 4CI8A 2I3TA 3ODTA 4XYHA 4GGCA 4J86A 2B4EA 2AGWA 3RN1D 2OVPB 4U1EI 4PBZA 4E54B 3L4OD 3EI3A 2OK4A 4A0BA 2TRCB 2H6KA 1MG2A 4J78A 4Y7RA 4K3JB 3V5WB 3AL9A 3J81g 4JXMA 1U4CA 4A09B 5FKQA 5KDOB 4XYIA 3MKQA 3DXKC 2PBIB 2I0TA 3I7HA 3DWLC 3PE7A 3I7NA 5EAMA 2I3SA 2HJ4A 4D0KA 3EI4A 2YBAA 4ZN4A 4J0WA 1NEXB 2YNNA 5FXYA 5THAA 3KRXB 4PSXB 2CO0C 2IWFA 1K8KC 3PVWB 4J87A 3EG6A 5EAPA 3E0CA 2AGZA 3V7DB 3IJ1A 3JZGA 1FWXA 3SFZA 2W18A 1R5MA 1PBYB 5H17A 4GQ1A 5K19A 3JROA 5EMLB 4PNKB 3EI3B 4A0BB 5H14A 4J84A 2CE9A 1S4UX 2YNPA 2IUVA 3RLMD 4AOWA 2GNQA 4JSVC 4CZVA 2J56H 3RFGA 4K3ID 4ERZA 2HKMA 4JD2C 3FGBA 3SXTD 4CC9A 4IA9A 1K32A 3NVQA 4GM9A 3RN0D 3FRXA 3B7FA 2XU7A 5TF2A 2HESX 5FLXg 2YMUA 3JPXA 5AJAA 2H6NA 3I7PA 1GP2B 1NR0A 3UR4A 1TBGA 1OMWB 4X3EA 2AGXA 1MG3A 5CYKA 2H13A 2CE8A 1B9YA 5IC7A 3I7KA 4J81A 5TEFA 1L0QA 1GG2B 4A11A 4ZOZA 2J57G 4CY3A 1A0RB 2XL2A 3PXWD 4MK0B 4BL0A 3RSEC 5HE1B 4L1QD 3N0DA 2UZXB 5I5IA 4H5IA 4GMBA 2AQ5A 2QXVA 3EMHA 3IIWA 3UKRC 3OW8A 3L4MD 1JMZB 3UVOA 4FA4D 1PI6A 5C2VB 1MDAH 3SCYA 2H9PA 3MXXA 4PXWA 3F3GA 3SWSD 3OKYA 4FAND 5EMJB 3CFSB 4FA9D 5C2WB 1ERJA 3GFCA 4A08A 5GSAA 3RMZD 2Z2NA 2H9NA 3F3PA 1B9XA 4AEZA 3UVKA 5EMKB 1JJUB 5CYKB 4D6VA 2P9IC 3JAMg 4E5ZA 3F3FA 4PSWB 2OK6A 5H1MA 2J55H 2XL3A 4GGAA 4A11B 5EALA 4GZ8A 2Z2OA 2CNXA 3SMRA 4GQBB 1GXRA 4ZOVA 2CN3A 3C9CA 3ZWLB 3MZLA 1N6DA 2BBKH 5SXMA 2P9PC 5I5MA 1SHYB 1XKSA 1PGUA 1QNIA 3OKYB 2B5NA 4L3HD 4A08B 4PBYA 4OZUA 3SLED 2YB8B 3I8CA 4ZOYA 3MKSB 2OJYA 3UVMA 3RFHA 2QC5A 3K27A 3DXMC 1XHMA 3A0FA 4JSXC 4A0AA 3SBPA 4E5ZB 5IJ8E 3SN6B 4GM8A 2CN2A 1Q47A 1PEVA 4CY1A 1SQJA 2H9LA 5HE0B 3EI4B 4ERQA 3DSMA 2GC7A 2PM6B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CI1 A;  3K26 A;  4G56 B;  4LGN A;  3IKO A;  1U2V C;  3GRE A;  5GXI A;  3MZK A;  5EAR A;  3SBQ A;  2OIZ A;  3OL2 A;  4J79 A;  4FAV D;  3SVW D;  2HYE A;  2PM9 A;  3FM0 A;  4J8G A;  5GXH A;  4JT5 C;  5FKT A;  4FA5 D;  2B5M A;  3DM0 A;  5HE3 B;  4ERY A;  1SQ9 A;  2H68 A;  2CO0 A;  1YFQ A;  4FHL A;  4LG9 A;  4QQE A;  2AGL A;  3C75 H;  3AH8 B;  2G99 A;  5FKS A;  4L3G D;  4ZOX A;  2I0R A;  4CI3 A;  3AL8 A;  4A0A B;  3IIY A;  2P9N C;  1JOF A;  5IJ7 E;  3VH0 A;  4JT6 C;  4J73 A;  2O9K A;  2Q7Q A;  3EU7 A;  2YNO A;  3PXT D;  4L9O A;  3KRW B;  1JMX B;  4IMM A;  3C99 A;  4J82 A;  4PC0 A;  3W15 A;  2H9M A;  3BWS A;  3I7L A;  3EI2 B;  3IJ0 A;  4GGD A;  4U7A A;  5IT9 g;  4KFM B;  3SHF A;  4O3U B;  3I89 A;  1OLZ A;  2MTA H;  5I5J A;  2IWK A;  5JWZ A;  3NVN A;  3OL2 B;  2PM7 B;  2B5L A;  4JSN C;  4GM3 A;  4Z8L A;  5EM2 A;  4X61 B;  3UVN A;  3NVX A;  5FKR A;  2PM9 B;  3JB9 L;  4JSP C;  2BCJ B;  3UVL A;  5IGQ A;  2H3X A;  2HKR A;  4CZX A;  4ESG A;  4I79 A;  4HDJ A;  2H47 A;  3BG1 A;  3CIK B;  4CI2 A;  5GMK n;  3P4F A;  3EI1 A;  4N14 A;  2OVR B;  3AL8 B;  5TEE A;  2GC4 A;  2I0S A;  3EI2 A;  4UI9 R;  3MMY A;  2Z2P A;  2EBS A;  4NSX A;  3HFQ A;  3JZH A;  5CXB A;  3RRM C;  3VGZ A;  1N6E A;  4LG8 A;  2H6Q A;  5TDH B;  3U4Y A;  4X63 B;  5C9Z B;  4J77 A;  3SJL D;  3PSC B;  3JRP A;  3AFC A;  4FA1 D;  2XYI A;  1P22 A;  3OKW A;  5B4W A;  5EM2 B;  2AGY A;  4CY5 A;  1TYQ C;  1XIP A;  5EMM B;  3ORV D;  2HXC A;  3OTT A;  5K1C C;  4O3T B;  4TZ4 A;  1GOT B;  5FA5 B;  5CXC A;  3BG0 A;  3ULE C;  5IGO A;  2IUP A;  4Y5R D;  3EI1 B;  3SBR A;  4GQ2 P;  4BUJ C;  4R7A B;  4A2L A;  2P9U C;  3CFV A;  2AH0 A;  4A2M A;  4FWW A;  4O9D A;  4EWR A;  5CXB B;  3PXS D;  3N0E A;  2H14 A;  5AFU 3;  3C5M A;  3OKT A;  4J8B A;  3J80 g;  2P9K C;  2AH1 A;  4H5J A;  4YVD A;  2P9L C;  4OWR A;  3VA6 A;  4E54 A;  1VYH C;  2P9S C;  1N6F A;  4A7J A;  2G9A A;  5HQG A;  3UKU C;  5A2Q g;  4QT8 A;  4CY2 A;  3I2N A;  3JZN A;  4O45 A;  2UZY B;  3I7O A;  3IJC A;  3V9F A;  4A09 A;  5CXC B;  5HYN B;  4QL1 A;  1RI6 A;  2IAA A;  4BH6 A;  2HJB A;  2IUQ A;  4ES0 A;  3EWE A;  3PVU B;  3I8E A;  2IUR A;  4QRJ A;  2OVQ B;  4J0X A;  5FQD A;  3PSL A;  5AMS A;  4XEI C;  4O1Q D;  5HE2 B;  4X60 B;  4FB1 D;  4CZY A;  4CI8 A;  2I3T A;  3ODT A;  4XYH A;  4GGC A;  4J86 A;  2B4E A;  2AGW A;  3RN1 D;  2OVP B;  4U1E I;  4PBZ A;  4E54 B;  3L4O D;  3EI3 A;  2OK4 A;  4A0B A;  2TRC B;  2H6K A;  1MG2 A;  4J78 A;  4Y7R A;  4K3J B;  3V5W B;  3AL9 A;  3J81 g;  4JXM A;  1U4C A;  4A09 B;  5FKQ A;  5KDO B;  4XYI A;  3MKQ A;  3DXK C;  2PBI B;  2I0T A;  3I7H A;  3DWL C;  3PE7 A;  3I7N A;  5EAM A;  2I3S A;  2HJ4 A;  4D0K A;  3EI4 A;  2YBA A;  4ZN4 A;  4J0W A;  1NEX B;  2YNN A;  5FXY A;  5THA A;  3KRX B;  4PSX B;  2CO0 C;  2IWF A;  1K8K C;  3PVW B;  4J87 A;  3EG6 A;  5EAP A;  3E0C A;  2AGZ A;  3V7D B;  3IJ1 A;  3JZG A;  1FWX A;  3SFZ A;  2W18 A;  1R5M A;  1PBY B;  5H17 A;  4GQ1 A;  5K19 A;  3JRO A;  5EML B;  4PNK B;  3EI3 B;  4A0B B;  5H14 A;  4J84 A;  2CE9 A;  1S4U X;  2YNP A;  2IUV A;  3RLM D;  4AOW A;  2GNQ A;  4JSV C;  4CZV A;  2J56 H;  3RFG A;  4K3I D;  4ERZ A;  2HKM A;  4JD2 C;  3FGB A;  3SXT D;  4CC9 A;  4IA9 A;  1K32 A;  3NVQ A;  4GM9 A;  3RN0 D;  3FRX A;  3B7F A;  2XU7 A;  5TF2 A;  2HES X;  5FLX g;  2YMU A;  3JPX A;  5AJA A;  2H6N A;  3I7P A;  1GP2 B;  1NR0 A;  3UR4 A;  1TBG A;  1OMW B;  4X3E A;  2AGX A;  1MG3 A;  5CYK A;  2H13 A;  2CE8 A;  1B9Y A;  5IC7 A;  3I7K A;  4J81 A;  5TEF A;  1L0Q A;  1GG2 B;  4A11 A;  4ZOZ A;  2J57 G;  4CY3 A;  1A0R B;  2XL2 A;  3PXW D;  4MK0 B;  4BL0 A;  3RSE C;  5HE1 B;  4L1Q D;  3N0D A;  2UZX B;  5I5I A;  4H5I A;  4GMB A;  2AQ5 A;  2QXV A;  3EMH A;  3IIW A;  3UKR C;  3OW8 A;  3L4M D;  1JMZ B;  3UVO A;  4FA4 D;  1PI6 A;  5C2V B;  1MDA H;  3SCY A;  2H9P A;  3MXX A;  4PXW A;  3F3G A;  3SWS D;  3OKY A;  4FAN D;  5EMJ B;  3CFS B;  4FA9 D;  5C2W B;  1ERJ A;  3GFC A;  4A08 A;  5GSA A;  3RMZ D;  2Z2N A;  2H9N A;  3F3P A;  1B9X A;  4AEZ A;  3UVK A;  5EMK B;  1JJU B;  5CYK B;  4D6V A;  2P9I C;  3JAM g;  4E5Z A;  3F3F A;  4PSW B;  2OK6 A;  5H1M A;  2J55 H;  2XL3 A;  4GGA A;  4A11 B;  5EAL A;  4GZ8 A;  2Z2O A;  2CNX A;  3SMR A;  4GQB B;  1GXR A;  4ZOV A;  2CN3 A;  3C9C A;  3ZWL B;  3MZL A;  1N6D A;  2BBK H;  5SXM A;  2P9P C;  5I5M A;  1SHY B;  1XKS A;  1PGU A;  1QNI A;  3OKY B;  2B5N A;  4L3H D;  4A08 B;  4PBY A;  4OZU A;  3SLE D;  2YB8 B;  3I8C A;  4ZOY A;  3MKS B;  2OJY A;  3UVM A;  3RFH A;  2QC5 A;  3K27 A;  3DXM C;  1XHM A;  3A0F A;  4JSX C;  4A0A A;  3SBP A;  4E5Z B;  5IJ8 E;  3SN6 B;  4GM8 A;  2CN2 A;  1Q47 A;  1PEV A;  4CY1 A;  1SQJ A;  2H9L A;  5HE0 B;  3EI4 B;  4ERQ A;  3DSM A;  2GC7 A;  2PM6 B; 
#chains in the Genus database with same CATH topology
 4CI1 A;  3K26 A;  4G56 B;  3NID A;  1H2X A;  5E6U A;  4LGN A;  3IKO A;  1U2V C;  3O4G A;  3GRE A;  5GXI A;  1I2M B;  3MZK A;  5EAR A;  3SBQ A;  2OIZ A;  3OL2 A;  3ZDY A;  4J79 A;  4FAV D;  2EIB A;  3EQ9 A;  3SVW D;  2HYE A;  1M1X A;  2PM9 A;  3FM0 A;  4J8G A;  5GXH A;  4JT5 C;  5FKT A;  4FA5 D;  2B5M A;  4G1M A;  3DM0 A;  5HE3 B;  4ERY A;  1SQ9 A;  2H68 A;  2CO0 A;  1YFQ A;  4FHL A;  3ZE1 A;  1GOH A;  4LG9 A;  4QQE A;  5C86 A;  2AGL A;  3C75 H;  2VDQ A;  3AH8 B;  2XDW A;  2G99 A;  5FKS A;  2HU7 A;  4L3G D;  4ZOX A;  4DNV A;  2VC2 A;  3FCU A;  3MUO A;  2I0R A;  4CI3 A;  3AL8 A;  4A0A B;  3IIY A;  2P9N C;  1JOF A;  5IJ7 E;  3VH0 A;  4JT6 C;  4J73 A;  4QAM A;  2O9K A;  2Q7Q A;  3EU7 A;  3MVD K;  2YNO A;  3PXT D;  4L9O A;  3KRW B;  1JMX B;  4IMM A;  3C99 A;  4J82 A;  4PC0 A;  3W15 A;  3ZE2 A;  2H9M A;  3BWS A;  4NC4 A;  3I7L A;  3EI2 B;  3IJ0 A;  4GGD A;  4U7A A;  5IT9 g;  4KFM B;  3SHF A;  4O3U B;  3I89 A;  1OLZ A;  2MTA H;  5I5J A;  2IWK A;  5JWZ A;  3NVN A;  3OL2 B;  2PM7 B;  3DDU A;  4JHN A;  2B5L A;  3O4H A;  1JV2 A;  4JSN C;  4GM3 A;  3NIF A;  4Z8L A;  5EM2 A;  4X61 B;  3UVN A;  1O6F A;  3NVX A;  2PM9 B;  5FKR A;  3V4V A;  3JB9 L;  1JTD B;  4JHP C;  1U8C A;  4JSP C;  2BCJ B;  3UVL A;  5IGQ A;  3FCS A;  2H3X A;  2HKR A;  2VDO A;  4CZX A;  4ESG A;  4I79 A;  2HU5 A;  4HDJ A;  2H47 A;  3BG1 A;  3CIK B;  4CI2 A;  5GMK n;  3P4F A;  3EI1 A;  4N14 A;  2OVR B;  3AL8 B;  2XZG A;  5TEE A;  2GC4 A;  2I0S A;  3EI2 A;  4UI9 R;  3MMY A;  4MMY A;  2Z2P A;  2EBS A;  2EIE A;  2JKX A;  3VI4 A;  4NSX A;  3HFQ A;  3GC3 B;  3JZH A;  5CXB A;  3RRM C;  3VGZ A;  1N6E A;  4LG8 A;  5E6R A;  2H6Q A;  3ZE0 A;  5TDH B;  3IUR A;  3IUQ A;  3U4Y A;  4X63 B;  5C9Z B;  4J77 A;  3SJL D;  3PSC B;  3GD1 I;  3JRP A;  4WK0 A;  3AFC A;  1L5G A;  4FA1 D;  2XYI A;  4Z7Q A;  1P22 A;  3OKW A;  5B4W A;  5EM2 B;  2AGY A;  4CY5 A;  1TYQ C;  1XIP A;  5EMM B;  3T3P A;  3ORV D;  3MUN A;  2HXC A;  3OTT A;  5K1C C;  4O3T B;  4TZ4 A;  1GOT B;  5FA5 B;  5CXC A;  3BG0 A;  3ULE C;  5IGO A;  2IUP A;  4Y5R D;  5M5T A;  2VDR A;  3EI1 B;  3SBR A;  5M5R A;  4GQ2 P;  4BUJ C;  4R7A B;  1TYE A;  4A2L A;  2P9U C;  3CFV A;  1QFM A;  4DNU A;  2AH0 A;  3K72 A;  4A2M A;  1UOP A;  4FWW A;  1QFS A;  4O9D A;  4EWR A;  5CXB B;  3PXS D;  4UM9 A;  1VE7 A;  2H14 A;  3N0E A;  5AFU 3;  3C5M A;  4NBM A;  4Z7O A;  3OKT A;  2EID A;  4J8B A;  3J80 g;  2P9K C;  2AH1 A;  4H5J A;  4YVD A;  3T3M A;  2P9L C;  4OWR A;  3VA6 A;  4E54 A;  1VYH C;  2P9S C;  4AN0 A;  1N6F A;  4A7J A;  2G9A A;  5HQG A;  3UKU C;  5A2Q g;  4QT8 A;  4CY2 A;  2XE4 A;  4DNW A;  3I2N A;  3JZN A;  4O45 A;  2UZY B;  3I7O A;  3IJC A;  3V9F A;  4A09 A;  5CXC B;  5HYN B;  3EQ8 A;  4QL1 A;  1RI6 A;  2VZ1 A;  1E8M A;  2IAA A;  4BH6 A;  2HJB A;  3IUM A;  2IUQ A;  4ES0 A;  1O6G A;  3EWE A;  3PVU B;  3I8E A;  3VI3 A;  2IUR A;  5FFO A;  4QRJ A;  5M5S A;  2OVQ B;  4J0X A;  5FQD A;  3PSL A;  5AMS A;  5FFG A;  4XEI C;  4O1Q D;  5HE2 B;  4X60 B;  4FB1 D;  1YR2 A;  4CZY A;  4CI8 A;  2I3T A;  3ODT A;  4AMZ A;  4XYH A;  4GGC A;  5E6S A;  4J86 A;  4WK2 A;  2B4E A;  2AGW A;  3RN1 D;  4D9S A;  1VZ3 A;  2OVP B;  4U1E I;  4PBZ A;  4E54 B;  3L4O D;  4BCB A;  2VZ3 A;  3EI3 A;  2OK4 A;  4A0B A;  2TRC B;  2H6K A;  1MG2 A;  4J78 A;  1UOO A;  4Y7R A;  4K3J B;  3V5W B;  3AL9 A;  3J81 g;  4JXM A;  1U4C A;  4A09 B;  4BP8 A;  5FKQ A;  4BP9 A;  5KDO B;  4XYI A;  2VDP A;  3MKQ A;  3DXK C;  2PBI B;  2I0T A;  3I7H A;  3DWL C;  3PE7 A;  3I7N A;  5EAM A;  2I3S A;  4WJK A;  2HJ4 A;  4D0K A;  3EI4 A;  2YBA A;  4ZN4 A;  3K6S A;  4J0W A;  5M61 A;  1NEX B;  2VDK A;  2YNN A;  5FXY A;  5THA A;  3KRX B;  4PSX B;  2CO0 C;  2IWF A;  1K8K C;  3PVW B;  4J87 A;  3EG6 A;  4MMZ A;  5EAP A;  3E0C A;  2AGZ A;  3V7D B;  4G1E A;  3IJ1 A;  5M5U A;  2VDL A;  3IUJ A;  3JZG A;  1FWX A;  3SFZ A;  4RE6 A;  2W18 A;  1C9L A;  3NIG A;  1R5M A;  1PBY B;  5H17 A;  4GQ1 A;  5K19 A;  3JRO A;  1K3I A;  5EML B;  4PNK B;  3EI3 B;  4A0B B;  4BCC A;  5H14 A;  4J84 A;  2CE9 A;  2VDM A;  1S4U X;  2YNP A;  2IUV A;  4G55 A;  3RLM D;  4AOW A;  2GNQ A;  4JSV C;  4L1M A;  2J56 H;  4CZV A;  3RFG A;  4K3I D;  4ERZ A;  2HKM A;  3V4P A;  4JD2 C;  3FGB A;  3SXT D;  4CC9 A;  4BCD A;  4IA9 A;  1K32 A;  4MMX A;  3K71 A;  3NVQ A;  4GM9 A;  3RN0 D;  3FRX A;  3B7F A;  2XU7 A;  5TF2 A;  2HES X;  5FLX g;  2YMU A;  3JPX A;  5AJA A;  1E5T A;  2H6N A;  3I7P A;  3O4J A;  1GP2 B;  1NR0 A;  3UR4 A;  1TBG A;  1OMW B;  2BKL A;  4X3E A;  2AGX A;  4AX4 A;  1MG3 A;  5CYK A;  5M5V A;  2H13 A;  2CE8 A;  1B9Y A;  5IC7 A;  3I7K A;  4O02 A;  4J81 A;  4Z7N A;  5TEF A;  1L0Q A;  1GG2 B;  4A11 A;  5HDB A;  4ZOZ A;  2J57 G;  4O2W A;  1VE6 A;  4CY3 A;  2XL2 A;  1A0R B;  3PXW D;  4MK0 B;  4BL0 A;  2WQ8 A;  3RSE C;  5HE1 B;  4L1Q D;  3IUN A;  3N0D A;  2UZX B;  5I5I A;  4H5I A;  4GMB A;  2AQ5 A;  4IRZ A;  1H2Y A;  2QXV A;  3EMH A;  3IIW A;  3UKR C;  3OW8 A;  3L4M D;  1E8N A;  2QR5 A;  1JMZ B;  2HU8 A;  3UVO A;  4FA4 D;  1PI6 A;  5C2V B;  1MDA H;  3SCY A;  2H9P A;  3MXX A;  4PXW A;  3F3G A;  3SWS D;  3O4I A;  1UOQ A;  4NEN A;  3OKY A;  4FAN D;  5EMJ B;  3CFS B;  4AN1 A;  4FA9 D;  5C2W B;  1ERJ A;  1H2Z A;  3GFC A;  5GSA A;  4A08 A;  3RMZ D;  3ZDZ A;  3OF7 A;  2Z2N A;  2H9N A;  3IVM A;  1A12 A;  3F3P A;  1B9X A;  3IJE A;  2VDN A;  4AEZ A;  3UVK A;  5EMK B;  1JJU B;  5CYK B;  4D6V A;  2P9I C;  1BPO A;  3JAM g;  4E5Z A;  3F3F A;  4PSW B;  2OK6 A;  5H1M A;  2J55 H;  2XL3 A;  4GGA A;  3QHY B;  4A11 B;  5EAL A;  4GZ8 A;  2Z2O A;  1T2X A;  2CNX A;  1H2W A;  3SMR A;  4GQB B;  1GXR A;  1GOF A;  4ZOV A;  3IUL A;  2CN3 A;  3C9C A;  3ZWL B;  3MZL A;  4UM8 A;  1N6D A;  2BBK H;  2EIC A;  5SXM A;  5C92 A;  1VZ2 A;  2P9P C;  5I5M A;  1SHY B;  4AMY A;  4NAA A;  1XKS A;  3QI0 A;  1PGU A;  1GOG A;  4RE5 A;  1QNI A;  3OKY B;  2B5N A;  4L3H D;  4A08 B;  4PBY A;  4OZU A;  3SLE D;  2YB8 B;  3I8C A;  1UTC A;  3MKS B;  4ZOY A;  2QZP A;  2OJY A;  3UVM A;  3RFH A;  4WK4 A;  2QC5 A;  3KCI A;  3K27 A;  3DXM C;  1XHM A;  3A0F A;  4JSX C;  4A0A A;  3SBP A;  4E5Z B;  5IJ8 E;  3SN6 B;  4GM8 A;  2CN2 A;  1Q47 A;  1PEV A;  4CY1 A;  1SQJ A;  2H9L A;  5HE0 B;  3EI4 B;  4ERQ A;  3DSM A;  3ZDX A;  1C9I A;  3EQ7 A;  2GC7 A;  2PM6 B; 
#chains in the Genus database with same CATH homology
 4CI1 A;  3K26 A;  4G56 B;  4LGN A;  3IKO A;  1U2V C;  3GRE A;  5GXI A;  3MZK A;  5EAR A;  3SBQ A;  2OIZ A;  3OL2 A;  4J79 A;  4FAV D;  3SVW D;  2HYE A;  2PM9 A;  3FM0 A;  4J8G A;  5GXH A;  4JT5 C;  5FKT A;  4FA5 D;  2B5M A;  3DM0 A;  5HE3 B;  4ERY A;  1SQ9 A;  2H68 A;  2CO0 A;  1YFQ A;  4FHL A;  4LG9 A;  4QQE A;  2AGL A;  3C75 H;  3AH8 B;  2G99 A;  5FKS A;  4L3G D;  4ZOX A;  2I0R A;  4CI3 A;  3AL8 A;  4A0A B;  3IIY A;  2P9N C;  1JOF A;  5IJ7 E;  3VH0 A;  4JT6 C;  4J73 A;  2O9K A;  2Q7Q A;  3EU7 A;  2YNO A;  3PXT D;  4L9O A;  3KRW B;  1JMX B;  4IMM A;  3C99 A;  4J82 A;  4PC0 A;  3W15 A;  2H9M A;  3BWS A;  3I7L A;  3EI2 B;  3IJ0 A;  4GGD A;  4U7A A;  5IT9 g;  4KFM B;  3SHF A;  4O3U B;  3I89 A;  1OLZ A;  2MTA H;  5I5J A;  2IWK A;  5JWZ A;  3NVN A;  3OL2 B;  2PM7 B;  2B5L A;  4JSN C;  4GM3 A;  4Z8L A;  5EM2 A;  4X61 B;  3UVN A;  3NVX A;  5FKR A;  2PM9 B;  3JB9 L;  4JSP C;  2BCJ B;  3UVL A;  5IGQ A;  2H3X A;  2HKR A;  4CZX A;  4ESG A;  4I79 A;  4HDJ A;  2H47 A;  3BG1 A;  3CIK B;  4CI2 A;  5GMK n;  3P4F A;  3EI1 A;  4N14 A;  2OVR B;  3AL8 B;  5TEE A;  2GC4 A;  2I0S A;  3EI2 A;  4UI9 R;  3MMY A;  2Z2P A;  2EBS A;  4NSX A;  3HFQ A;  3JZH A;  5CXB A;  3RRM C;  3VGZ A;  1N6E A;  4LG8 A;  2H6Q A;  5TDH B;  3U4Y A;  4X63 B;  5C9Z B;  4J77 A;  3SJL D;  3PSC B;  3JRP A;  3AFC A;  4FA1 D;  2XYI A;  1P22 A;  3OKW A;  5B4W A;  5EM2 B;  2AGY A;  4CY5 A;  1TYQ C;  1XIP A;  5EMM B;  3ORV D;  2HXC A;  3OTT A;  5K1C C;  4O3T B;  4TZ4 A;  1GOT B;  5FA5 B;  5CXC A;  3BG0 A;  3ULE C;  5IGO A;  2IUP A;  4Y5R D;  3EI1 B;  3SBR A;  4GQ2 P;  4BUJ C;  4R7A B;  4A2L A;  2P9U C;  3CFV A;  2AH0 A;  4A2M A;  4FWW A;  4O9D A;  4EWR A;  5CXB B;  3PXS D;  3N0E A;  2H14 A;  5AFU 3;  3C5M A;  3OKT A;  4J8B A;  3J80 g;  2P9K C;  2AH1 A;  4H5J A;  4YVD A;  2P9L C;  4OWR A;  3VA6 A;  4E54 A;  1VYH C;  2P9S C;  1N6F A;  4A7J A;  2G9A A;  5HQG A;  3UKU C;  5A2Q g;  4QT8 A;  4CY2 A;  3I2N A;  3JZN A;  4O45 A;  2UZY B;  3I7O A;  3IJC A;  3V9F A;  4A09 A;  5CXC B;  5HYN B;  4QL1 A;  1RI6 A;  2IAA A;  4BH6 A;  2HJB A;  2IUQ A;  4ES0 A;  3EWE A;  3PVU B;  3I8E A;  2IUR A;  4QRJ A;  2OVQ B;  4J0X A;  5FQD A;  3PSL A;  5AMS A;  4XEI C;  4O1Q D;  5HE2 B;  4X60 B;  4FB1 D;  4CZY A;  4CI8 A;  2I3T A;  3ODT A;  4XYH A;  4GGC A;  4J86 A;  2B4E A;  2AGW A;  3RN1 D;  2OVP B;  4U1E I;  4PBZ A;  4E54 B;  3L4O D;  3EI3 A;  2OK4 A;  4A0B A;  2TRC B;  2H6K A;  1MG2 A;  4J78 A;  4Y7R A;  4K3J B;  3V5W B;  3AL9 A;  3J81 g;  4JXM A;  1U4C A;  4A09 B;  5FKQ A;  5KDO B;  4XYI A;  3MKQ A;  3DXK C;  2PBI B;  2I0T A;  3I7H A;  3DWL C;  3PE7 A;  3I7N A;  5EAM A;  2I3S A;  2HJ4 A;  4D0K A;  3EI4 A;  2YBA A;  4ZN4 A;  4J0W A;  1NEX B;  2YNN A;  5FXY A;  5THA A;  3KRX B;  4PSX B;  2CO0 C;  2IWF A;  1K8K C;  3PVW B;  4J87 A;  3EG6 A;  5EAP A;  3E0C A;  2AGZ A;  3V7D B;  3IJ1 A;  3JZG A;  1FWX A;  3SFZ A;  2W18 A;  1R5M A;  1PBY B;  5H17 A;  4GQ1 A;  5K19 A;  3JRO A;  5EML B;  4PNK B;  3EI3 B;  4A0B B;  5H14 A;  4J84 A;  2CE9 A;  1S4U X;  2YNP A;  2IUV A;  3RLM D;  4AOW A;  2GNQ A;  4JSV C;  4CZV A;  2J56 H;  3RFG A;  4K3I D;  4ERZ A;  2HKM A;  4JD2 C;  3FGB A;  3SXT D;  4CC9 A;  4IA9 A;  1K32 A;  3NVQ A;  4GM9 A;  3RN0 D;  3FRX A;  3B7F A;  2XU7 A;  5TF2 A;  2HES X;  5FLX g;  2YMU A;  3JPX A;  5AJA A;  2H6N A;  3I7P A;  1GP2 B;  1NR0 A;  3UR4 A;  1TBG A;  1OMW B;  4X3E A;  2AGX A;  1MG3 A;  5CYK A;  2H13 A;  2CE8 A;  1B9Y A;  5IC7 A;  3I7K A;  4J81 A;  5TEF A;  1L0Q A;  1GG2 B;  4A11 A;  4ZOZ A;  2J57 G;  4CY3 A;  1A0R B;  2XL2 A;  3PXW D;  4MK0 B;  4BL0 A;  3RSE C;  5HE1 B;  4L1Q D;  3N0D A;  2UZX B;  5I5I A;  4H5I A;  4GMB A;  2AQ5 A;  2QXV A;  3EMH A;  3IIW A;  3UKR C;  3OW8 A;  3L4M D;  1JMZ B;  3UVO A;  4FA4 D;  1PI6 A;  5C2V B;  1MDA H;  3SCY A;  2H9P A;  3MXX A;  4PXW A;  3F3G A;  3SWS D;  3OKY A;  4FAN D;  5EMJ B;  3CFS B;  4FA9 D;  5C2W B;  1ERJ A;  3GFC A;  4A08 A;  5GSA A;  3RMZ D;  2Z2N A;  2H9N A;  3F3P A;  1B9X A;  4AEZ A;  3UVK A;  5EMK B;  1JJU B;  5CYK B;  4D6V A;  2P9I C;  3JAM g;  4E5Z A;  3F3F A;  4PSW B;  2OK6 A;  5H1M A;  2J55 H;  2XL3 A;  4GGA A;  4A11 B;  5EAL A;  4GZ8 A;  2Z2O A;  2CNX A;  3SMR A;  4GQB B;  1GXR A;  4ZOV A;  2CN3 A;  3C9C A;  3ZWL B;  3MZL A;  1N6D A;  2BBK H;  5SXM A;  2P9P C;  5I5M A;  1SHY B;  1XKS A;  1PGU A;  1QNI A;  3OKY B;  2B5N A;  4L3H D;  4A08 B;  4PBY A;  4OZU A;  3SLE D;  2YB8 B;  3I8C A;  4ZOY A;  3MKS B;  2OJY A;  3UVM A;  3RFH A;  2QC5 A;  3K27 A;  3DXM C;  1XHM A;  3A0F A;  4JSX C;  4A0A A;  3SBP A;  4E5Z B;  5IJ8 E;  3SN6 B;  4GM8 A;  2CN2 A;  1Q47 A;  1PEV A;  4CY1 A;  1SQJ A;  2H9L A;  5HE0 B;  3EI4 B;  4ERQ A;  3DSM A;  2GC7 A;  2PM6 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...