2W18A

Crystal structure of the c-terminal wd40 domain of human palb2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
333
structure length
306
Chain Sequence
NLQLVSELKNPSGSCSVDVSAMFWEKEPCIITACEDVVSLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGGKENQFLMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDASVCHKAYSEMGLLFIVLSPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHCAAAILTSGTIAIWDLLLGQCTALLPPVQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Recruitment of Brca2 by Palb2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nuclear protein
molecule keywords PARTNER AND LOCALIZER OF BRCA2
total genus 69
structure length 306
sequence length 333
ec nomenclature
pdb deposition date 2008-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16756 PALB2_WD40 Partner and localizer of BRCA2 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2w18A00
2QC5A 2I0RA 3P4FA 4UI9R 3IJ0A 4FWWA 1B9YA 1S4UX 3C75H 3MKQA 2CN3A 4K3JB 5EMLB 2EBSA 4XYIA 2UZYB 4X61B 1JMXB 2B4EA 1U2VC 1OMWB 5FXYA 3GFCA 3AFCA 4ZOZA 2CE8A 3I7NA 4CY1A 3L4OD 2Z2OA 2H6NA 1GXRA 1NR0A 3EI2A 4JSXC 2IUQA 4CZYA 3JAMg 2CNXA 3J81g 4J78A 4GQ1A 3IJCA 2XL3A 5CXCB 3SWSD 2AGZA 2AGXA 4BUJC 2CO0A 3V5WB 5HE1B 2H14A 3EI3B 3PSLA 2AH1A 5GMKn 5AFU3 1L0QA 3MMYA 5HE0B 3L4MD 4PBYA 2HKRA 3AL8B 3JZHA 3OKYB 5I5MA 2HJBA 4A08B 1SHYB 4GGCA 3PVUB 4IA9A 3KRWB 1YFQA 2IURA 4D6VA 4ZOVA 4JXMA 3BG0A 4JT6C 4KFMB 2MTAH 1ERJA 4R7AB 4PC0A 5K1CC 3ZWLB 2Q7QA 2GC4A 3K27A 3RRMC 1JJUB 4NSXA 3EI3A 4GM3A 4J8GA 4LGNA 3EI1A 2P9PC 2PM9A 4A2MA 3FRXA 3V9FA 1P22A 2YB8B 4A11B 4BL0A 3SVWD 1A0RB 2H13A 4O9DA 3N0EA 5EM2B 3IJ1A 3JRPA 3OKWA 2IWKA 2H6KA 3I2NA 4PXWA 2AGLA 3JZGA 3OL2A 4CY5A 2IUPA 4L3HD 2HYEA 4FAND 2J55H 1XHMA 3UVLA 1XKSA 5JWZA 3UVKA 5CXBB 3RN1D 4E54A 2P9IC 2OVQB 4GZ8A 2H9MA 2B5LA 4A09A 4CI8A 3V7DB 4CY3A 4FA5D 2XL2A 3AH8B 5C2WB 2H47A 3CFVA 2OVRB 5CYKA 4FA4D 3I7KA 4O3UB 3BWSA 3CFSB 3EWEA 3F3FA 3MKSB 3C99A 2H9NA 5EMKB 5IGOA 3A0FA 3DSMA 3RFHA 2IUVA 4X60B 1K32A 5C2VB 1N6DA 3PXSD 2CE9A 5CXCA 4A0BA 1GOTB 2CO0C 4A7JA 4A11A 4FA1D 4FAVD 5FKSA 2H9LA 5EAMA 4AEZA 3F3GA 1VYHC 1QNIA 1SQJA 2H68A 5B4WA 5FKTA 3CIKB 2P9KC 4J8BA 2AGWA 4OWRA 4A0AB 4ES0A 1B9XA 1TBGA 5I5JA 3KRXB 4A08A 3SHFA 3PXWD 4JSNC 3OTTA 4YVDA 5CXBA 4E54B 4BH6A 4FB1D 3AL8A 4FA9D 4Y5RD 5IJ7E 2OK4A 1R5MA 5EMMB 3UVNA 4PBZA 4ESGA 3C9CA 3EU7A 5H14A 4JD2C 2GNQA 3ULEC 5GXIA 2UZXB 2OVPB 4MK0B 2OK6A 5HQGA 4D0KA 2J56H 4FHLA 3DM0A 4J86A 5FQDA 4CZVA 1PBYB 4QL1A 5AMSA 2H6QA 3I7OA 3I7HA 5HYNB 4A0BB 1SQ9A 3SFZA 3JPXA 4H5IA 2AGYA 5KDOB 3EI1B 1NEXB 1XIPA 3IIYA 3JZNA 3MXXA 1RI6A 2YNPA 5GSAA 3IIWA 4QQEA 4CZXA 4LG8A 4Z8LA 2GC7A 4TZ4A 4G56B 1Q47A 2PM6B 5HE2B 3SLED 2H3XA 1K8KC 3SXTD 3RLMD 1MDAH 2PM9B 1MG2A 2BBKH 1PGUA 5IJ8E 3C5MA 2TRCB 4ERZA 4JT5C 4ZOYA 5C9ZB 2IAAA 2P9UC 3PE7A 1N6EA 5AJAA 3OL2B 4PSXB 3UVOA 1JMZB 2BCJB 5H17A 3SBQA 4J79A 4GMBA 4GM9A 2I0SA 3RN0D 3JB9L 4Y7RA 5THAA 4X63B 3SCYA 2YNNA 2G99A 3OKTA 5HE3B 3DXMC 2OIZA 2B5NA 4U7AA 3I7LA 3MZLA 5TEEA 2AH0A 5EARA 5TEFA 5FLXg 5TF2A 4N14A 2G9AA 3EI4B 4CI2A 3U4YA 3OW8A 4U1EI 3FGBA 4ZOXA 3UVMA 2CN2A 3HFQA 3K26A 3FM0A 4PNKB 2YNOA 5FA5B 4J0WA 2Z2PA 4GQ2P 5A2Qg 5IT9g 4QT8A 4EWRA 3VGZA 2XYIA 4A09B 4L9OA 1MG3A 3SN6B 5EMJB 1TYQC 2AQ5A 4CY2A 1PEVA 3OKYA 3EMHA 4O45A 4CI1A 5EALA 5IGQA 3JROA 2P9SC 4J73A 2I3TA 2O9KA 3ODTA 3I8CA 5CYKB 5H1MA 1JOFA 3E0CA 4HDJA 4JSPC 3UR4A 4J87A 4ERYA 4CI3A 3W15A 2W18A 3PSCB 3VA6A 3SMRA 2HESX 3MZKA 3AL9A 4J0XA 1GG2B 4H5JA 4QRJA 4J81A 3PVWB 4L1QD 3IKOA 5FKRA 3SBRA 4JSVC 3GREA 2H9PA 4E5ZB 5I5IA 5SXMA 3BG1A 4X3EA 5K19A 3B7FA 3I7PA 5EM2A 4I79A 4A2LA 3I89A 3NVXA 2I0TA 3PXTD 2I3SA 3EG6A 1N6FA 4ZN4A 4GQBB 4K3ID 4XEIC 4J84A 1OLZA 4J77A 5EAPA 3SBPA 4GM8A 5TDHB 2J57G 3RMZD 3J80g 3EI2B 4PSWB 4OZUA 2P9NC 2YBAA 2QXVA 4AOWA 1GP2B 2HXCA 2HJ4A 2B5MA 2P9LC 2PBIB 4O3TB 2Z2NA 4O1QD 4GGAA 3RFGA 5FKQA 3I8EA 5GXHA 4L3GD 3DWLC 3NVNA 2IWFA 3UKRC 3ORVD 2YMUA 4E5ZA 3DXKC 4GGDA 5IC7A 4ERQA 3SJLD 4XYHA 1FWXA 3NVQA 3EI4A 3RSEC 1U4CA 4LG9A 2OJYA 3VH0A 3F3PA 4A0AA 4IMMA 3UKUC 4J82A 4CC9A 3N0DA 2HKMA 1PI6A 2PM7B 2XU7A
chains in the Genus database with same CATH superfamily
2QC5A 2I0RA 3P4FA 4UI9R 3T3MA 5M5VA 3IJ0A 4MMYA 1H2ZA 4FWWA 1B9YA 4AMYA 1S4UX 3C75H 3MKQA 2CN3A 4K3JB 5EMLB 2EBSA 4XYIA 2UZYB 4X61B 1JMXB 2B4EA 1U2VC 1OMWB 4G1MA 5FXYA 3GFCA 3AFCA 4ZOZA 2CE8A 3I7NA 4DNWA 4CY1A 3L4OD 2Z2OA 2H6NA 4DNVA 4Z7QA 1GXRA 1NR0A 3EI2A 4JSXC 2IUQA 4CZYA 3JAMg 2CNXA 3J81g 3V4VA 4J78A 4GQ1A 3IJCA 2XL3A 5CXCB 3IUMA 1L5GA 1H2WA 3SWSD 2AGZA 2AGXA 4BUJC 2CO0A 3V5WB 5HE1B 3VI3A 3O4JA 3O4IA 2H14A 3EI3B 3EQ9A 3PSLA 2AH1A 5GMKn 1QFMA 5AFU3 1L0QA 3MMYA 5HE0B 3L4MD 4PBYA 3MUNA 2HKRA 3AL8B 3IUQA 3JZHA 3OKYB 5FFOA 5I5MA 5C86A 2HJBA 4A08B 1SHYB 4GGCA 3PVUB 3VI4A 4IA9A 3KRWB 1YFQA 2IURA 4D6VA 4ZOVA 4JXMA 2VZ1A 3BG0A 4JT6C 4KFMB 2MTAH 3IULA 1ERJA 4R7AB 3K72A 4PC0A 5K1CC 3ZWLB 4Z7NA 1VZ3A 2Q7QA 2GC4A 3K27A 3RRMC 1JJUB 4NSXA 3EI3A 4D9SA 4GM3A 4J8GA 4LGNA 3IVMA 2VZ3A 3EI1A 2P9PC 2PM9A 4A2MA 3FRXA 5C92A 3V9FA 1P22A 2YB8B 4Z7OA 4A11B 4BL0A 3SVWD 1A0RB 2H13A 1VE6A 4O9DA 3QI0A 3N0EA 5EM2B 3IJ1A 3JRPA 3OKWA 4BP9A 2IWKA 2H6KA 3I2NA 4PXWA 2AGLA 3JZGA 3OL2A 4CY5A 1O6FA 2IUPA 4L3HD 2HYEA 4FAND 1E8NA 2J55H 1XHMA 3UVLA 1XKSA 4NENA 5JWZA 1GOHA 3UVKA 5CXBB 3RN1D 4E54A 2P9IC 2OVQB 5E6UA 4GZ8A 2H9MA 1VE7A 5M5RA 2B5LA 4A09A 4CI8A 3V7DB 4CY3A 4FA5D 2XL2A 3AH8B 5C2WB 2H47A 3CFVA 5M5UA 5M61A 2OVRB 1GOFA 5CYKA 4FA4D 3I7KA 4O3UB 3BWSA 3CFSB 3EWEA 3EQ8A 3F3FA 3C99A 2H9NA 3MKSB 5EMKB 3A0FA 3DSMA 5IGOA 3RFHA 4NC4A 3GC3B 2IUVA 4X60B 1K32A 5C2VB 3ZDZA 2QZPA 1N6DA 1E8MA 1GOGA 3PXSD 2CE9A 2EIDA 5CXCA 4A0BA 1GOTB 2CO0C 4A7JA 4A11A 1U8CA 4FA1D 4FAVD 5FKSA 2H9LA 2VDKA 5EAMA 4BCDA 4AEZA 3F3GA 1VYHC 3FCSA 1QNIA 1SQJA 2VDPA 2H68A 4MMXA 5B4WA 5FKTA 4WK0A 3CIKB 4JHPC 2P9KC 1K3IA 2AGWA 3O4HA 4J8BA 4OWRA 4ES0A 4A0AB 1B9XA 1TBGA 5I5JA 3KRXB 4A08A 4UM8A 3SHFA 3PXWD 4JSNC 3OTTA 4YVDA 5CXBA 4E54B 4BH6A 4FB1D 3AL8A 4FA9D 4Y5RD 5IJ7E 2OK4A 4AX4A 4G55A 1R5MA 1QFSA 4AMZA 5EMMB 3UVNA 3NIDA 1JTDB 4WK2A 4O02A 4PBZA 4ESGA 3C9CA 3EU7A 5H14A 1T2XA 4JD2C 2GNQA 3ULEC 5GXIA 2UZXB 1H2XA 2OVPB 4MK0B 2OK6A 3ZE1A 5HQGA 4D0KA 5M5TA 4DNUA 2J56H 3FCUA 4FHLA 3DM0A 4J86A 3O4GA 5FQDA 4CZVA 1PBYB 4NAAA 4QL1A 2H6QA 3I7OA 3I7HA 5AMSA 5HYNB 4A0BB 1SQ9A 3SFZA 3JPXA 4H5IA 2AGYA 1O6GA 1H2YA 1JV2A 1TYEA 5KDOB 3K71A 3EI1B 1NEXB 1XIPA 3IIYA 3JZNA 3MXXA 5E6RA 2HU7A 1RI6A 2YNPA 5E6SA 5GSAA 3IIWA 3EQ7A 3DDUA 2EICA 4QQEA 5FFGA 4CZXA 3IUNA 4LG8A 4Z8LA 2GC7A 4TZ4A 4G56B 1Q47A 2PM6B 5HE2B 3SLED 3NIGA 2H3XA 1K8KC 3SXTD 3RLMD 1MDAH 2PM9B 1MG2A 2BBKH 1PGUA 5IJ8E 3C5MA 2TRCB 3ZE0A 4ERZA 4JT5C 4ZOYA 5C9ZB 2IAAA 2P9UC 3PE7A 1N6EA 5AJAA 3OL2B 4PSXB 3UVOA 1JMZB 2BCJB 4IRZA 5H17A 4GMBA 4J79A 3SBQA 4GM9A 4RE6A 2I0SA 1I2MB 4BCCA 2XZGA 3RN0D 3T3PA 3JB9L 2EIBA 4Y7RA 5THAA 4X63B 3SCYA 2YNNA 2G99A 3OKTA 5HE3B 3DXMC 4BP8A 2OIZA 2B5NA 4U7AA 3I7LA 3MZLA 5TEEA 3IJEA 2AH0A 5EARA 5TEFA 5FLXg 1M1XA 5TF2A 4N14A 2G9AA 3KCIA 3EI4B 4UM9A 4CI2A 4NBMA 3U4YA 3OW8A 4U1EI 2HU8A 3FGBA 4ZOXA 2CN2A 3UVMA 3HFQA 3K26A 3FM0A 4PNKB 2VC2A 3ZDYA 2YNOA 5FA5B 4J0WA 2VDRA 2Z2PA 4GQ2P 5A2Qg 5IT9g 4JHNA 4QT8A 4EWRA 3VGZA 2XYIA 4L1MA 2JKXA 4A09B 4L9OA 2EIEA 1MG3A 1E5TA 3SN6B 2VDNA 5EMJB 1TYQC 2AQ5A 1A12A 4CY2A 4RE5A 1PEVA 3OKYA 3EMHA 4O45A 3ZDXA 3OF7A 4WK4A 4CI1A 5EALA 5IGQA 3JROA 5HDBA 2P9SC 4J73A 4O2WA 2I3TA 2O9KA 3ODTA 4BCBA 2VDMA 3IUJA 3I8CA 5CYKB 5H1MA 1JOFA 3E0CA 4HDJA 4JSPC 3UR4A 4J87A 3MVDK 3GD1I 4ERYA 4CI3A 3W15A 2W18A 3PSCB 3VA6A 3SMRA 2HESX 3MZKA 3AL9A 4J0XA 1GG2B 4H5JA 4QRJA 4J81A 3PVWB 1C9LA 4L1QD 3K6SA 3IKOA 5FKRA 3SBRA 4JSVC 3GREA 2H9PA 4E5ZB 5I5IA 3V4PA 5SXMA 3BG1A 1UOPA 4X3EA 1VZ2A 2QR5A 4MMZA 1YR2A 5K19A 3B7FA 3I7PA 5EM2A 4I79A 3ZE2A 4A2LA 3I89A 4G1EA 1C9IA 3NVXA 2I0TA 3PXTD 2I3SA 3EG6A 1N6FA 4ZN4A 4GQBB 4K3ID 4XEIC 4J84A 1OLZA 4J77A 5EAPA 3SBPA 4GM8A 5TDHB 4AN1A 2J57G 3RMZD 3J80g 3EI2B 4PSWB 2HU5A 4OZUA 2VDLA 2P9NC 2YBAA 2QXVA 4AOWA 1GP2B 2HXCA 2HJ4A 2B5MA 2P9LC 2PBIB 4QAMA 4O3TB 4WJKA 1BPOA 2Z2NA 4O1QD 2WQ8A 4GGAA 3RFGA 5FKQA 3I8EA 5GXHA 1UOOA 2VDOA 4L3GD 1UOQA 3DWLC 3MUOA 3NVNA 2IWFA 3UKRC 3ORVD 2YMUA 4E5ZA 3DXKC 4GGDA 2XDWA 5IC7A 4ERQA 3SJLD 3IURA 4XYHA 4AN0A 1FWXA 3NVQA 2BKLA 2VDQA 2XE4A 3EI4A 3RSEC 1U4CA 4LG9A 2OJYA 3VH0A 3NIFA 3F3PA 3QHYB 4A0AA 4IMMA 3UKUC 4J82A 4CC9A 5M5SA 3N0DA 2HKMA 1PI6A 2PM7B 1UTCA 2XU7A
chains in the Genus database with same CATH topology
2QC5A 2I0RA 3P4FA 4UI9R 3IJ0A 4FWWA 1B9YA 1S4UX 3C75H 3MKQA 2CN3A 4K3JB 5EMLB 2EBSA 4XYIA 2UZYB 4X61B 1JMXB 2B4EA 1U2VC 1OMWB 5FXYA 3GFCA 3AFCA 4ZOZA 2CE8A 3I7NA 4CY1A 3L4OD 2Z2OA 2H6NA 1GXRA 1NR0A 3EI2A 4JSXC 2IUQA 4CZYA 3JAMg 2CNXA 3J81g 4J78A 4GQ1A 3IJCA 2XL3A 5CXCB 3SWSD 2AGZA 2AGXA 4BUJC 2CO0A 3V5WB 5HE1B 2H14A 3EI3B 3PSLA 2AH1A 5GMKn 5AFU3 1L0QA 3MMYA 5HE0B 3L4MD 4PBYA 2HKRA 3AL8B 3JZHA 3OKYB 5I5MA 2HJBA 4A08B 1SHYB 4GGCA 3PVUB 4IA9A 3KRWB 1YFQA 2IURA 4D6VA 4ZOVA 4JXMA 3BG0A 4JT6C 4KFMB 2MTAH 1ERJA 4R7AB 4PC0A 5K1CC 3ZWLB 2Q7QA 2GC4A 3K27A 3RRMC 1JJUB 4NSXA 3EI3A 4GM3A 4J8GA 4LGNA 3EI1A 2P9PC 2PM9A 4A2MA 3FRXA 3V9FA 1P22A 2YB8B 4A11B 4BL0A 3SVWD 1A0RB 2H13A 4O9DA 3N0EA 5EM2B 3IJ1A 3JRPA 3OKWA 2IWKA 2H6KA 3I2NA 4PXWA 2AGLA 3JZGA 3OL2A 4CY5A 2IUPA 4L3HD 2HYEA 4FAND 2J55H 1XHMA 3UVLA 1XKSA 5JWZA 3UVKA 5CXBB 3RN1D 4E54A 2P9IC 2OVQB 4GZ8A 2H9MA 2B5LA 4A09A 4CI8A 3V7DB 4CY3A 4FA5D 2XL2A 3AH8B 5C2WB 2H47A 3CFVA 2OVRB 5CYKA 4FA4D 3I7KA 4O3UB 3BWSA 3CFSB 3EWEA 3F3FA 3MKSB 3C99A 2H9NA 5EMKB 5IGOA 3A0FA 3DSMA 3RFHA 2IUVA 4X60B 1K32A 5C2VB 1N6DA 3PXSD 2CE9A 5CXCA 4A0BA 1GOTB 2CO0C 4A7JA 4A11A 4FA1D 4FAVD 5FKSA 2H9LA 5EAMA 4AEZA 3F3GA 1VYHC 1QNIA 1SQJA 2H68A 5B4WA 5FKTA 3CIKB 2P9KC 4J8BA 2AGWA 4OWRA 4A0AB 4ES0A 1B9XA 1TBGA 5I5JA 3KRXB 4A08A 3SHFA 3PXWD 4JSNC 3OTTA 4YVDA 5CXBA 4E54B 4BH6A 4FB1D 3AL8A 4FA9D 4Y5RD 5IJ7E 2OK4A 1R5MA 5EMMB 3UVNA 4PBZA 4ESGA 3C9CA 3EU7A 5H14A 4JD2C 2GNQA 3ULEC 5GXIA 2UZXB 2OVPB 4MK0B 2OK6A 5HQGA 4D0KA 2J56H 4FHLA 3DM0A 4J86A 5FQDA 4CZVA 1PBYB 4QL1A 5AMSA 2H6QA 3I7OA 3I7HA 5HYNB 4A0BB 1SQ9A 3SFZA 3JPXA 4H5IA 2AGYA 5KDOB 3EI1B 1NEXB 1XIPA 3IIYA 3JZNA 3MXXA 1RI6A 2YNPA 5GSAA 3IIWA 4QQEA 4CZXA 4LG8A 4Z8LA 2GC7A 4TZ4A 4G56B 1Q47A 2PM6B 5HE2B 3SLED 2H3XA 1K8KC 3SXTD 3RLMD 1MDAH 2PM9B 1MG2A 2BBKH 1PGUA 5IJ8E 3C5MA 2TRCB 4ERZA 4JT5C 4ZOYA 5C9ZB 2IAAA 2P9UC 3PE7A 1N6EA 5AJAA 3OL2B 4PSXB 3UVOA 1JMZB 2BCJB 5H17A 3SBQA 4J79A 4GMBA 4GM9A 2I0SA 3RN0D 3JB9L 4Y7RA 5THAA 4X63B 3SCYA 2YNNA 2G99A 3OKTA 5HE3B 3DXMC 2OIZA 2B5NA 4U7AA 3I7LA 3MZLA 5TEEA 2AH0A 5EARA 5TEFA 5FLXg 5TF2A 4N14A 2G9AA 3EI4B 4CI2A 3U4YA 3OW8A 4U1EI 3FGBA 4ZOXA 3UVMA 2CN2A 3HFQA 3K26A 3FM0A 4PNKB 2YNOA 5FA5B 4J0WA 2Z2PA 4GQ2P 5A2Qg 5IT9g 4QT8A 4EWRA 3VGZA 2XYIA 4A09B 4L9OA 1MG3A 3SN6B 5EMJB 1TYQC 2AQ5A 4CY2A 1PEVA 3OKYA 3EMHA 4O45A 4CI1A 5EALA 5IGQA 3JROA 2P9SC 4J73A 2I3TA 2O9KA 3ODTA 3I8CA 5CYKB 5H1MA 1JOFA 3E0CA 4HDJA 4JSPC 3UR4A 4J87A 4ERYA 4CI3A 3W15A 2W18A 3PSCB 3VA6A 3SMRA 2HESX 3MZKA 3AL9A 4J0XA 1GG2B 4H5JA 4QRJA 4J81A 3PVWB 4L1QD 3IKOA 5FKRA 3SBRA 4JSVC 3GREA 2H9PA 4E5ZB 5I5IA 5SXMA 3BG1A 4X3EA 5K19A 3B7FA 3I7PA 5EM2A 4I79A 4A2LA 3I89A 3NVXA 2I0TA 3PXTD 2I3SA 3EG6A 1N6FA 4ZN4A 4GQBB 4K3ID 4XEIC 4J84A 1OLZA 4J77A 5EAPA 3SBPA 4GM8A 5TDHB 2J57G 3RMZD 3J80g 3EI2B 4PSWB 4OZUA 2P9NC 2YBAA 2QXVA 4AOWA 1GP2B 2HXCA 2HJ4A 2B5MA 2P9LC 2PBIB 4O3TB 2Z2NA 4O1QD 4GGAA 3RFGA 5FKQA 3I8EA 5GXHA 4L3GD 3DWLC 3NVNA 2IWFA 3UKRC 3ORVD 2YMUA 4E5ZA 3DXKC 4GGDA 5IC7A 4ERQA 3SJLD 4XYHA 1FWXA 3NVQA 3EI4A 3RSEC 1U4CA 4LG9A 2OJYA 3VH0A 3F3PA 4A0AA 4IMMA 3UKUC 4J82A 4CC9A 3N0DA 2HKMA 1PI6A 2PM7B 2XU7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QC5 A;  2I0R A;  3P4F A;  4UI9 R;  3IJ0 A;  4FWW A;  1B9Y A;  1S4U X;  3C75 H;  3MKQ A;  2CN3 A;  4K3J B;  5EML B;  2EBS A;  4XYI A;  2UZY B;  4X61 B;  1JMX B;  2B4E A;  1U2V C;  1OMW B;  5FXY A;  3GFC A;  3AFC A;  4ZOZ A;  2CE8 A;  3I7N A;  4CY1 A;  3L4O D;  2Z2O A;  2H6N A;  1GXR A;  1NR0 A;  3EI2 A;  4JSX C;  2IUQ A;  4CZY A;  3JAM g;  2CNX A;  3J81 g;  4J78 A;  4GQ1 A;  3IJC A;  2XL3 A;  5CXC B;  3SWS D;  2AGZ A;  2AGX A;  4BUJ C;  2CO0 A;  3V5W B;  5HE1 B;  2H14 A;  3EI3 B;  3PSL A;  2AH1 A;  5GMK n;  5AFU 3;  1L0Q A;  3MMY A;  5HE0 B;  3L4M D;  4PBY A;  2HKR A;  3AL8 B;  3JZH A;  3OKY B;  5I5M A;  2HJB A;  4A08 B;  1SHY B;  4GGC A;  3PVU B;  4IA9 A;  3KRW B;  1YFQ A;  2IUR A;  4D6V A;  4ZOV A;  4JXM A;  3BG0 A;  4JT6 C;  4KFM B;  2MTA H;  1ERJ A;  4R7A B;  4PC0 A;  5K1C C;  3ZWL B;  2Q7Q A;  2GC4 A;  3K27 A;  3RRM C;  1JJU B;  4NSX A;  3EI3 A;  4GM3 A;  4J8G A;  4LGN A;  3EI1 A;  2P9P C;  2PM9 A;  4A2M A;  3FRX A;  3V9F A;  1P22 A;  2YB8 B;  4A11 B;  4BL0 A;  3SVW D;  1A0R B;  2H13 A;  4O9D A;  3N0E A;  5EM2 B;  3IJ1 A;  3JRP A;  3OKW A;  2IWK A;  2H6K A;  3I2N A;  4PXW A;  2AGL A;  3JZG A;  3OL2 A;  4CY5 A;  2IUP A;  4L3H D;  2HYE A;  4FAN D;  2J55 H;  1XHM A;  3UVL A;  1XKS A;  5JWZ A;  3UVK A;  5CXB B;  3RN1 D;  4E54 A;  2P9I C;  2OVQ B;  4GZ8 A;  2H9M A;  2B5L A;  4A09 A;  4CI8 A;  3V7D B;  4CY3 A;  4FA5 D;  2XL2 A;  3AH8 B;  5C2W B;  2H47 A;  3CFV A;  2OVR B;  5CYK A;  4FA4 D;  3I7K A;  4O3U B;  3BWS A;  3CFS B;  3EWE A;  3F3F A;  3MKS B;  3C99 A;  2H9N A;  5EMK B;  5IGO A;  3A0F A;  3DSM A;  3RFH A;  2IUV A;  4X60 B;  1K32 A;  5C2V B;  1N6D A;  3PXS D;  2CE9 A;  5CXC A;  4A0B A;  1GOT B;  2CO0 C;  4A7J A;  4A11 A;  4FA1 D;  4FAV D;  5FKS A;  2H9L A;  5EAM A;  4AEZ A;  3F3G A;  1VYH C;  1QNI A;  1SQJ A;  2H68 A;  5B4W A;  5FKT A;  3CIK B;  2P9K C;  4J8B A;  2AGW A;  4OWR A;  4A0A B;  4ES0 A;  1B9X A;  1TBG A;  5I5J A;  3KRX B;  4A08 A;  3SHF A;  3PXW D;  4JSN C;  3OTT A;  4YVD A;  5CXB A;  4E54 B;  4BH6 A;  4FB1 D;  3AL8 A;  4FA9 D;  4Y5R D;  5IJ7 E;  2OK4 A;  1R5M A;  5EMM B;  3UVN A;  4PBZ A;  4ESG A;  3C9C A;  3EU7 A;  5H14 A;  4JD2 C;  2GNQ A;  3ULE C;  5GXI A;  2UZX B;  2OVP B;  4MK0 B;  2OK6 A;  5HQG A;  4D0K A;  2J56 H;  4FHL A;  3DM0 A;  4J86 A;  5FQD A;  4CZV A;  1PBY B;  4QL1 A;  5AMS A;  2H6Q A;  3I7O A;  3I7H A;  5HYN B;  4A0B B;  1SQ9 A;  3SFZ A;  3JPX A;  4H5I A;  2AGY A;  5KDO B;  3EI1 B;  1NEX B;  1XIP A;  3IIY A;  3JZN A;  3MXX A;  1RI6 A;  2YNP A;  5GSA A;  3IIW A;  4QQE A;  4CZX A;  4LG8 A;  4Z8L A;  2GC7 A;  4TZ4 A;  4G56 B;  1Q47 A;  2PM6 B;  5HE2 B;  3SLE D;  2H3X A;  1K8K C;  3SXT D;  3RLM D;  1MDA H;  2PM9 B;  1MG2 A;  2BBK H;  1PGU A;  5IJ8 E;  3C5M A;  2TRC B;  4ERZ A;  4JT5 C;  4ZOY A;  5C9Z B;  2IAA A;  2P9U C;  3PE7 A;  1N6E A;  5AJA A;  3OL2 B;  4PSX B;  3UVO A;  1JMZ B;  2BCJ B;  5H17 A;  3SBQ A;  4J79 A;  4GMB A;  4GM9 A;  2I0S A;  3RN0 D;  3JB9 L;  4Y7R A;  5THA A;  4X63 B;  3SCY A;  2YNN A;  2G99 A;  3OKT A;  5HE3 B;  3DXM C;  2OIZ A;  2B5N A;  4U7A A;  3I7L A;  3MZL A;  5TEE A;  2AH0 A;  5EAR A;  5TEF A;  5FLX g;  5TF2 A;  4N14 A;  2G9A A;  3EI4 B;  4CI2 A;  3U4Y A;  3OW8 A;  4U1E I;  3FGB A;  4ZOX A;  3UVM A;  2CN2 A;  3HFQ A;  3K26 A;  3FM0 A;  4PNK B;  2YNO A;  5FA5 B;  4J0W A;  2Z2P A;  4GQ2 P;  5A2Q g;  5IT9 g;  4QT8 A;  4EWR A;  3VGZ A;  2XYI A;  4A09 B;  4L9O A;  1MG3 A;  3SN6 B;  5EMJ B;  1TYQ C;  2AQ5 A;  4CY2 A;  1PEV A;  3OKY A;  3EMH A;  4O45 A;  4CI1 A;  5EAL A;  5IGQ A;  3JRO A;  2P9S C;  4J73 A;  2I3T A;  2O9K A;  3ODT A;  3I8C A;  5CYK B;  5H1M A;  1JOF A;  3E0C A;  4HDJ A;  4JSP C;  3UR4 A;  4J87 A;  4ERY A;  4CI3 A;  3W15 A;  2W18 A;  3PSC B;  3VA6 A;  3SMR A;  2HES X;  3MZK A;  3AL9 A;  4J0X A;  1GG2 B;  4H5J A;  4QRJ A;  4J81 A;  3PVW B;  4L1Q D;  3IKO A;  5FKR A;  3SBR A;  4JSV C;  3GRE A;  2H9P A;  4E5Z B;  5I5I A;  5SXM A;  3BG1 A;  4X3E A;  5K19 A;  3B7F A;  3I7P A;  5EM2 A;  4I79 A;  4A2L A;  3I89 A;  3NVX A;  2I0T A;  3PXT D;  2I3S A;  3EG6 A;  1N6F A;  4ZN4 A;  4GQB B;  4K3I D;  4XEI C;  4J84 A;  1OLZ A;  4J77 A;  5EAP A;  3SBP A;  4GM8 A;  5TDH B;  2J57 G;  3RMZ D;  3J80 g;  3EI2 B;  4PSW B;  4OZU A;  2P9N C;  2YBA A;  2QXV A;  4AOW A;  1GP2 B;  2HXC A;  2HJ4 A;  2B5M A;  2P9L C;  2PBI B;  4O3T B;  2Z2N A;  4O1Q D;  4GGA A;  3RFG A;  5FKQ A;  3I8E A;  5GXH A;  4L3G D;  3DWL C;  3NVN A;  2IWF A;  3UKR C;  3ORV D;  2YMU A;  4E5Z A;  3DXK C;  4GGD A;  5IC7 A;  4ERQ A;  3SJL D;  4XYH A;  1FWX A;  3NVQ A;  3EI4 A;  3RSE C;  1U4C A;  4LG9 A;  2OJY A;  3VH0 A;  3F3P A;  4A0A A;  4IMM A;  3UKU C;  4J82 A;  4CC9 A;  3N0D A;  2HKM A;  1PI6 A;  2PM7 B;  2XU7 A; 
#chains in the Genus database with same CATH topology
 2QC5 A;  2I0R A;  3P4F A;  4UI9 R;  3T3M A;  5M5V A;  3IJ0 A;  4MMY A;  1H2Z A;  4FWW A;  1B9Y A;  4AMY A;  1S4U X;  3C75 H;  3MKQ A;  2CN3 A;  4K3J B;  5EML B;  2EBS A;  4XYI A;  2UZY B;  4X61 B;  1JMX B;  2B4E A;  1U2V C;  1OMW B;  4G1M A;  5FXY A;  3GFC A;  3AFC A;  4ZOZ A;  2CE8 A;  3I7N A;  4DNW A;  4CY1 A;  3L4O D;  2Z2O A;  2H6N A;  4DNV A;  4Z7Q A;  1GXR A;  1NR0 A;  3EI2 A;  4JSX C;  2IUQ A;  4CZY A;  3JAM g;  2CNX A;  3J81 g;  3V4V A;  4J78 A;  4GQ1 A;  3IJC A;  2XL3 A;  5CXC B;  3IUM A;  1L5G A;  1H2W A;  3SWS D;  2AGZ A;  2AGX A;  4BUJ C;  2CO0 A;  3V5W B;  5HE1 B;  3VI3 A;  3O4J A;  3O4I A;  2H14 A;  3EI3 B;  3EQ9 A;  3PSL A;  2AH1 A;  5GMK n;  1QFM A;  5AFU 3;  1L0Q A;  3MMY A;  5HE0 B;  3L4M D;  4PBY A;  3MUN A;  2HKR A;  3AL8 B;  3IUQ A;  3JZH A;  3OKY B;  5FFO A;  5I5M A;  5C86 A;  2HJB A;  4A08 B;  1SHY B;  4GGC A;  3PVU B;  3VI4 A;  4IA9 A;  3KRW B;  1YFQ A;  2IUR A;  4D6V A;  4ZOV A;  4JXM A;  2VZ1 A;  3BG0 A;  4JT6 C;  4KFM B;  2MTA H;  3IUL A;  1ERJ A;  4R7A B;  3K72 A;  4PC0 A;  5K1C C;  3ZWL B;  4Z7N A;  1VZ3 A;  2Q7Q A;  2GC4 A;  3K27 A;  3RRM C;  1JJU B;  4NSX A;  3EI3 A;  4D9S A;  4GM3 A;  4J8G A;  4LGN A;  3IVM A;  2VZ3 A;  3EI1 A;  2P9P C;  2PM9 A;  4A2M A;  3FRX A;  5C92 A;  3V9F A;  1P22 A;  2YB8 B;  4Z7O A;  4A11 B;  4BL0 A;  3SVW D;  1A0R B;  2H13 A;  1VE6 A;  4O9D A;  3QI0 A;  3N0E A;  5EM2 B;  3IJ1 A;  3JRP A;  3OKW A;  4BP9 A;  2IWK A;  2H6K A;  3I2N A;  4PXW A;  2AGL A;  3JZG A;  3OL2 A;  4CY5 A;  1O6F A;  2IUP A;  4L3H D;  2HYE A;  4FAN D;  1E8N A;  2J55 H;  1XHM A;  3UVL A;  1XKS A;  4NEN A;  5JWZ A;  1GOH A;  3UVK A;  5CXB B;  3RN1 D;  4E54 A;  2P9I C;  2OVQ B;  5E6U A;  4GZ8 A;  2H9M A;  1VE7 A;  5M5R A;  2B5L A;  4A09 A;  4CI8 A;  3V7D B;  4CY3 A;  4FA5 D;  2XL2 A;  3AH8 B;  5C2W B;  2H47 A;  3CFV A;  5M5U A;  5M61 A;  2OVR B;  1GOF A;  5CYK A;  4FA4 D;  3I7K A;  4O3U B;  3BWS A;  3CFS B;  3EWE A;  3EQ8 A;  3F3F A;  3C99 A;  2H9N A;  3MKS B;  5EMK B;  3A0F A;  3DSM A;  5IGO A;  3RFH A;  4NC4 A;  3GC3 B;  2IUV A;  4X60 B;  1K32 A;  5C2V B;  3ZDZ A;  2QZP A;  1N6D A;  1E8M A;  1GOG A;  3PXS D;  2CE9 A;  2EID A;  5CXC A;  4A0B A;  1GOT B;  2CO0 C;  4A7J A;  4A11 A;  1U8C A;  4FA1 D;  4FAV D;  5FKS A;  2H9L A;  2VDK A;  5EAM A;  4BCD A;  4AEZ A;  3F3G A;  1VYH C;  3FCS A;  1QNI A;  1SQJ A;  2VDP A;  2H68 A;  4MMX A;  5B4W A;  5FKT A;  4WK0 A;  3CIK B;  4JHP C;  2P9K C;  1K3I A;  2AGW A;  3O4H A;  4J8B A;  4OWR A;  4ES0 A;  4A0A B;  1B9X A;  1TBG A;  5I5J A;  3KRX B;  4A08 A;  4UM8 A;  3SHF A;  3PXW D;  4JSN C;  3OTT A;  4YVD A;  5CXB A;  4E54 B;  4BH6 A;  4FB1 D;  3AL8 A;  4FA9 D;  4Y5R D;  5IJ7 E;  2OK4 A;  4AX4 A;  4G55 A;  1R5M A;  1QFS A;  4AMZ A;  5EMM B;  3UVN A;  3NID A;  1JTD B;  4WK2 A;  4O02 A;  4PBZ A;  4ESG A;  3C9C A;  3EU7 A;  5H14 A;  1T2X A;  4JD2 C;  2GNQ A;  3ULE C;  5GXI A;  2UZX B;  1H2X A;  2OVP B;  4MK0 B;  2OK6 A;  3ZE1 A;  5HQG A;  4D0K A;  5M5T A;  4DNU A;  2J56 H;  3FCU A;  4FHL A;  3DM0 A;  4J86 A;  3O4G A;  5FQD A;  4CZV A;  1PBY B;  4NAA A;  4QL1 A;  2H6Q A;  3I7O A;  3I7H A;  5AMS A;  5HYN B;  4A0B B;  1SQ9 A;  3SFZ A;  3JPX A;  4H5I A;  2AGY A;  1O6G A;  1H2Y A;  1JV2 A;  1TYE A;  5KDO B;  3K71 A;  3EI1 B;  1NEX B;  1XIP A;  3IIY A;  3JZN A;  3MXX A;  5E6R A;  2HU7 A;  1RI6 A;  2YNP A;  5E6S A;  5GSA A;  3IIW A;  3EQ7 A;  3DDU A;  2EIC A;  4QQE A;  5FFG A;  4CZX A;  3IUN A;  4LG8 A;  4Z8L A;  2GC7 A;  4TZ4 A;  4G56 B;  1Q47 A;  2PM6 B;  5HE2 B;  3SLE D;  3NIG A;  2H3X A;  1K8K C;  3SXT D;  3RLM D;  1MDA H;  2PM9 B;  1MG2 A;  2BBK H;  1PGU A;  5IJ8 E;  3C5M A;  2TRC B;  3ZE0 A;  4ERZ A;  4JT5 C;  4ZOY A;  5C9Z B;  2IAA A;  2P9U C;  3PE7 A;  1N6E A;  5AJA A;  3OL2 B;  4PSX B;  3UVO A;  1JMZ B;  2BCJ B;  4IRZ A;  5H17 A;  4GMB A;  4J79 A;  3SBQ A;  4GM9 A;  4RE6 A;  2I0S A;  1I2M B;  4BCC A;  2XZG A;  3RN0 D;  3T3P A;  3JB9 L;  2EIB A;  4Y7R A;  5THA A;  4X63 B;  3SCY A;  2YNN A;  2G99 A;  3OKT A;  5HE3 B;  3DXM C;  4BP8 A;  2OIZ A;  2B5N A;  4U7A A;  3I7L A;  3MZL A;  5TEE A;  3IJE A;  2AH0 A;  5EAR A;  5TEF A;  5FLX g;  1M1X A;  5TF2 A;  4N14 A;  2G9A A;  3KCI A;  3EI4 B;  4UM9 A;  4CI2 A;  4NBM A;  3U4Y A;  3OW8 A;  4U1E I;  2HU8 A;  3FGB A;  4ZOX A;  2CN2 A;  3UVM A;  3HFQ A;  3K26 A;  3FM0 A;  4PNK B;  2VC2 A;  3ZDY A;  2YNO A;  5FA5 B;  4J0W A;  2VDR A;  2Z2P A;  4GQ2 P;  5A2Q g;  5IT9 g;  4JHN A;  4QT8 A;  4EWR A;  3VGZ A;  2XYI A;  4L1M A;  2JKX A;  4A09 B;  4L9O A;  2EIE A;  1MG3 A;  1E5T A;  3SN6 B;  2VDN A;  5EMJ B;  1TYQ C;  2AQ5 A;  1A12 A;  4CY2 A;  4RE5 A;  1PEV A;  3OKY A;  3EMH A;  4O45 A;  3ZDX A;  3OF7 A;  4WK4 A;  4CI1 A;  5EAL A;  5IGQ A;  3JRO A;  5HDB A;  2P9S C;  4J73 A;  4O2W A;  2I3T A;  2O9K A;  3ODT A;  4BCB A;  2VDM A;  3IUJ A;  3I8C A;  5CYK B;  5H1M A;  1JOF A;  3E0C A;  4HDJ A;  4JSP C;  3UR4 A;  4J87 A;  3MVD K;  3GD1 I;  4ERY A;  4CI3 A;  3W15 A;  2W18 A;  3PSC B;  3VA6 A;  3SMR A;  2HES X;  3MZK A;  3AL9 A;  4J0X A;  1GG2 B;  4H5J A;  4QRJ A;  4J81 A;  3PVW B;  1C9L A;  4L1Q D;  3K6S A;  3IKO A;  5FKR A;  3SBR A;  4JSV C;  3GRE A;  2H9P A;  4E5Z B;  5I5I A;  3V4P A;  5SXM A;  3BG1 A;  1UOP A;  4X3E A;  1VZ2 A;  2QR5 A;  4MMZ A;  1YR2 A;  5K19 A;  3B7F A;  3I7P A;  5EM2 A;  4I79 A;  3ZE2 A;  4A2L A;  3I89 A;  4G1E A;  1C9I A;  3NVX A;  2I0T A;  3PXT D;  2I3S A;  3EG6 A;  1N6F A;  4ZN4 A;  4GQB B;  4K3I D;  4XEI C;  4J84 A;  1OLZ A;  4J77 A;  5EAP A;  3SBP A;  4GM8 A;  5TDH B;  4AN1 A;  2J57 G;  3RMZ D;  3J80 g;  3EI2 B;  4PSW B;  2HU5 A;  4OZU A;  2VDL A;  2P9N C;  2YBA A;  2QXV A;  4AOW A;  1GP2 B;  2HXC A;  2HJ4 A;  2B5M A;  2P9L C;  2PBI B;  4QAM A;  4O3T B;  4WJK A;  1BPO A;  2Z2N A;  4O1Q D;  2WQ8 A;  4GGA A;  3RFG A;  5FKQ A;  3I8E A;  5GXH A;  1UOO A;  2VDO A;  4L3G D;  1UOQ A;  3DWL C;  3MUO A;  3NVN A;  2IWF A;  3UKR C;  3ORV D;  2YMU A;  4E5Z A;  3DXK C;  4GGD A;  2XDW A;  5IC7 A;  4ERQ A;  3SJL D;  3IUR A;  4XYH A;  4AN0 A;  1FWX A;  3NVQ A;  2BKL A;  2VDQ A;  2XE4 A;  3EI4 A;  3RSE C;  1U4C A;  4LG9 A;  2OJY A;  3VH0 A;  3NIF A;  3F3P A;  3QHY B;  4A0A A;  4IMM A;  3UKU C;  4J82 A;  4CC9 A;  5M5S A;  3N0D A;  2HKM A;  1PI6 A;  2PM7 B;  1UTC A;  2XU7 A; 
#chains in the Genus database with same CATH homology
 2QC5 A;  2I0R A;  3P4F A;  4UI9 R;  3IJ0 A;  4FWW A;  1B9Y A;  1S4U X;  3C75 H;  3MKQ A;  2CN3 A;  4K3J B;  5EML B;  2EBS A;  4XYI A;  2UZY B;  4X61 B;  1JMX B;  2B4E A;  1U2V C;  1OMW B;  5FXY A;  3GFC A;  3AFC A;  4ZOZ A;  2CE8 A;  3I7N A;  4CY1 A;  3L4O D;  2Z2O A;  2H6N A;  1GXR A;  1NR0 A;  3EI2 A;  4JSX C;  2IUQ A;  4CZY A;  3JAM g;  2CNX A;  3J81 g;  4J78 A;  4GQ1 A;  3IJC A;  2XL3 A;  5CXC B;  3SWS D;  2AGZ A;  2AGX A;  4BUJ C;  2CO0 A;  3V5W B;  5HE1 B;  2H14 A;  3EI3 B;  3PSL A;  2AH1 A;  5GMK n;  5AFU 3;  1L0Q A;  3MMY A;  5HE0 B;  3L4M D;  4PBY A;  2HKR A;  3AL8 B;  3JZH A;  3OKY B;  5I5M A;  2HJB A;  4A08 B;  1SHY B;  4GGC A;  3PVU B;  4IA9 A;  3KRW B;  1YFQ A;  2IUR A;  4D6V A;  4ZOV A;  4JXM A;  3BG0 A;  4JT6 C;  4KFM B;  2MTA H;  1ERJ A;  4R7A B;  4PC0 A;  5K1C C;  3ZWL B;  2Q7Q A;  2GC4 A;  3K27 A;  3RRM C;  1JJU B;  4NSX A;  3EI3 A;  4GM3 A;  4J8G A;  4LGN A;  3EI1 A;  2P9P C;  2PM9 A;  4A2M A;  3FRX A;  3V9F A;  1P22 A;  2YB8 B;  4A11 B;  4BL0 A;  3SVW D;  1A0R B;  2H13 A;  4O9D A;  3N0E A;  5EM2 B;  3IJ1 A;  3JRP A;  3OKW A;  2IWK A;  2H6K A;  3I2N A;  4PXW A;  2AGL A;  3JZG A;  3OL2 A;  4CY5 A;  2IUP A;  4L3H D;  2HYE A;  4FAN D;  2J55 H;  1XHM A;  3UVL A;  1XKS A;  5JWZ A;  3UVK A;  5CXB B;  3RN1 D;  4E54 A;  2P9I C;  2OVQ B;  4GZ8 A;  2H9M A;  2B5L A;  4A09 A;  4CI8 A;  3V7D B;  4CY3 A;  4FA5 D;  2XL2 A;  3AH8 B;  5C2W B;  2H47 A;  3CFV A;  2OVR B;  5CYK A;  4FA4 D;  3I7K A;  4O3U B;  3BWS A;  3CFS B;  3EWE A;  3F3F A;  3MKS B;  3C99 A;  2H9N A;  5EMK B;  5IGO A;  3A0F A;  3DSM A;  3RFH A;  2IUV A;  4X60 B;  1K32 A;  5C2V B;  1N6D A;  3PXS D;  2CE9 A;  5CXC A;  4A0B A;  1GOT B;  2CO0 C;  4A7J A;  4A11 A;  4FA1 D;  4FAV D;  5FKS A;  2H9L A;  5EAM A;  4AEZ A;  3F3G A;  1VYH C;  1QNI A;  1SQJ A;  2H68 A;  5B4W A;  5FKT A;  3CIK B;  2P9K C;  4J8B A;  2AGW A;  4OWR A;  4A0A B;  4ES0 A;  1B9X A;  1TBG A;  5I5J A;  3KRX B;  4A08 A;  3SHF A;  3PXW D;  4JSN C;  3OTT A;  4YVD A;  5CXB A;  4E54 B;  4BH6 A;  4FB1 D;  3AL8 A;  4FA9 D;  4Y5R D;  5IJ7 E;  2OK4 A;  1R5M A;  5EMM B;  3UVN A;  4PBZ A;  4ESG A;  3C9C A;  3EU7 A;  5H14 A;  4JD2 C;  2GNQ A;  3ULE C;  5GXI A;  2UZX B;  2OVP B;  4MK0 B;  2OK6 A;  5HQG A;  4D0K A;  2J56 H;  4FHL A;  3DM0 A;  4J86 A;  5FQD A;  4CZV A;  1PBY B;  4QL1 A;  5AMS A;  2H6Q A;  3I7O A;  3I7H A;  5HYN B;  4A0B B;  1SQ9 A;  3SFZ A;  3JPX A;  4H5I A;  2AGY A;  5KDO B;  3EI1 B;  1NEX B;  1XIP A;  3IIY A;  3JZN A;  3MXX A;  1RI6 A;  2YNP A;  5GSA A;  3IIW A;  4QQE A;  4CZX A;  4LG8 A;  4Z8L A;  2GC7 A;  4TZ4 A;  4G56 B;  1Q47 A;  2PM6 B;  5HE2 B;  3SLE D;  2H3X A;  1K8K C;  3SXT D;  3RLM D;  1MDA H;  2PM9 B;  1MG2 A;  2BBK H;  1PGU A;  5IJ8 E;  3C5M A;  2TRC B;  4ERZ A;  4JT5 C;  4ZOY A;  5C9Z B;  2IAA A;  2P9U C;  3PE7 A;  1N6E A;  5AJA A;  3OL2 B;  4PSX B;  3UVO A;  1JMZ B;  2BCJ B;  5H17 A;  3SBQ A;  4J79 A;  4GMB A;  4GM9 A;  2I0S A;  3RN0 D;  3JB9 L;  4Y7R A;  5THA A;  4X63 B;  3SCY A;  2YNN A;  2G99 A;  3OKT A;  5HE3 B;  3DXM C;  2OIZ A;  2B5N A;  4U7A A;  3I7L A;  3MZL A;  5TEE A;  2AH0 A;  5EAR A;  5TEF A;  5FLX g;  5TF2 A;  4N14 A;  2G9A A;  3EI4 B;  4CI2 A;  3U4Y A;  3OW8 A;  4U1E I;  3FGB A;  4ZOX A;  3UVM A;  2CN2 A;  3HFQ A;  3K26 A;  3FM0 A;  4PNK B;  2YNO A;  5FA5 B;  4J0W A;  2Z2P A;  4GQ2 P;  5A2Q g;  5IT9 g;  4QT8 A;  4EWR A;  3VGZ A;  2XYI A;  4A09 B;  4L9O A;  1MG3 A;  3SN6 B;  5EMJ B;  1TYQ C;  2AQ5 A;  4CY2 A;  1PEV A;  3OKY A;  3EMH A;  4O45 A;  4CI1 A;  5EAL A;  5IGQ A;  3JRO A;  2P9S C;  4J73 A;  2I3T A;  2O9K A;  3ODT A;  3I8C A;  5CYK B;  5H1M A;  1JOF A;  3E0C A;  4HDJ A;  4JSP C;  3UR4 A;  4J87 A;  4ERY A;  4CI3 A;  3W15 A;  2W18 A;  3PSC B;  3VA6 A;  3SMR A;  2HES X;  3MZK A;  3AL9 A;  4J0X A;  1GG2 B;  4H5J A;  4QRJ A;  4J81 A;  3PVW B;  4L1Q D;  3IKO A;  5FKR A;  3SBR A;  4JSV C;  3GRE A;  2H9P A;  4E5Z B;  5I5I A;  5SXM A;  3BG1 A;  4X3E A;  5K19 A;  3B7F A;  3I7P A;  5EM2 A;  4I79 A;  4A2L A;  3I89 A;  3NVX A;  2I0T A;  3PXT D;  2I3S A;  3EG6 A;  1N6F A;  4ZN4 A;  4GQB B;  4K3I D;  4XEI C;  4J84 A;  1OLZ A;  4J77 A;  5EAP A;  3SBP A;  4GM8 A;  5TDH B;  2J57 G;  3RMZ D;  3J80 g;  3EI2 B;  4PSW B;  4OZU A;  2P9N C;  2YBA A;  2QXV A;  4AOW A;  1GP2 B;  2HXC A;  2HJ4 A;  2B5M A;  2P9L C;  2PBI B;  4O3T B;  2Z2N A;  4O1Q D;  4GGA A;  3RFG A;  5FKQ A;  3I8E A;  5GXH A;  4L3G D;  3DWL C;  3NVN A;  2IWF A;  3UKR C;  3ORV D;  2YMU A;  4E5Z A;  3DXK C;  4GGD A;  5IC7 A;  4ERQ A;  3SJL D;  4XYH A;  1FWX A;  3NVQ A;  3EI4 A;  3RSE C;  1U4C A;  4LG9 A;  2OJY A;  3VH0 A;  3F3P A;  4A0A A;  4IMM A;  3UKU C;  4J82 A;  4CC9 A;  3N0D A;  2HKM A;  1PI6 A;  2PM7 B;  2XU7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...