2W18A

Crystal structure of the c-terminal wd40 domain of human palb2
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
333
structure length
306
Chain Sequence
b'NLQLVSELKNPSGSCSVDVSAMFWEKEPCIITACEDVVSLWKALDAWQWEKLYTWHFAEVPVLQIVPVPDVYNLVCVALGNLEIREIRALFCEKQVLLKSGNIKAVLGLTKRRLVSSSGTLSDQQVEVMTFAEDGGGKENQFLMPPEETILTFAEVQGMQEALLGTTIMNNIVIWNLKTGQLLKKMHIDDASVCHKAYSEMGLLFIVLSPVFQLIVINPKTTLSVGVMLYCLPPGQAGRFLEGDVKDHCAAAILTSGTIAIWDLLLGQCTALLPPVQHWSFVKWSGTDSHLLAGQKDGNIFVYHYS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Recruitment of Brca2 by Palb2
pubmed doi rcsb
molecule keywords PARTNER AND LOCALIZER OF BRCA2
source organism Homo sapiens
molecule tags Nuclear protein
total genus 69
structure length 306
sequence length 333
ec nomenclature
pdb deposition date 2008-10-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16756 PALB2_WD40 Partner and localizer of BRCA2 WD40 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.130.10.10 Mainly Beta 7 Propeller Methylamine Dehydrogenase; Chain H YVTN repeat-like/Quinoprotein amine dehydrogenase 2w18A00
4CI8A 4FA4D 3N0EA 2CNXA 5EM2A 2CE8A 5HE0B 4CY2A 5FKTA 2P9NC 3UVMA 3OTTA 5H1MA 3GREA 2OVPB 5TF2A 2IWFA 4GM3A 2UZXB 1JMZB 1R5MA 2GC4A 3MMYA 5C9ZB 3OKYB 3RN1D 3OL2A 3F3FA 2PM6B 3I7HA 5TDHB 4E54B 3EI2A 1OMWB 3UKRC 3E0CA 5EM2B 1JMXB 4N14A 2HXCA 1JOFA 2H9PA 5IJ8E 2AGXA 3K27A 3I8EA 3I2NA 4G56B 4A0BA 4J77A 5C2VB 4X3EA 5EAPA 3OKWA 1XIPA 2Z2NA 3FRXA 4PC0A 5GXHA 4K3JB 3W15A 3OL2B 2H3XA 5EMKB 2YNPA 3EI2B 4ZOVA 3EG6A 2IURA 3JAMg 4L3HD 4IMMA 2CN3A 5FKSA 1XHMA 3JZHA 2CO0C 3SLED 3BG1A 4A0BB 2H13A 2O9KA 3C75H 5C2WB 2CN2A 3PXTD 2QC5A 4GMBA 4H5JA 3EI3A 4FA9D 4FA5D 3I7NA 4L3GD 3AH8B 2GC7A 2HYEA 5GXIA 3DM0A 2H9LA 2P9UC 2HJ4A 3PVWB 1TYQC 4UI9R 3PVUB 3UVKA 3BWSA 2H6QA 5EARA 3RN0D 4FB1D 1GG2B 3EI3B 3N0DA 1XKSA 4ZN4A 3SVWD 3NVNA 2G99A 3PSLA 2XU7A 1K8KC 4FWWA 3MXXA 1L0QA 4ESGA 4GM8A 2EBSA 4D6VA 4ES0A 2TRCB 4J8BA 4BL0A 3A0FA 1A0RB 4JXMA 2UZYB 4J78A 5EALA 2AH1A 4HDJA 4CY3A 3SN6B 2AGZA 4O45A 4NSXA 2HKRA 4J79A 3UR4A 5JWZA 4AEZA 2J57G 4CI2A 3IJCA 2PM9A 1PGUA 5EMJB 2QXVA 4X60B 3DWLC 1SQ9A 4CZYA 4PNKB 3J81g 1GOTB 4J84A 3ULEC 4J0XA 5FQDA 3KRWB 4U7AA 2HJBA 2IUVA 3EWEA 3EI4A 3IJ1A 1Q47A 3CIKB 2B4EA 1NR0A 2Z2OA 1N6FA 2I0RA 3RRMC 2PM9B 1N6DA 2G9AA 2IWKA 3SBQA 2IUPA 4FAND 4D0KA 5AFU3 4Z8LA 2H6KA 5FKQA 2CE9A 3SWSD 4I79A 4O3TB 4ZOXA 3AL8A 3EI4B 2YB8B 4A2MA 2H47A 3VGZA 2XL3A 3SCYA 2XL2A 2IAAA 2AQ5A 2OIZA 3UVOA 5KDOB 4A08A 5FXYA 4U1EI 3EMHA 3PSCB 4PBZA 4XEIC 4L1QD 2P9LC 1VYHC 5CXBA 1PI6A 2W18A 4ERQA 4QRJA 5I5IA 3OKTA 4XYIA 2P9SC 2AH0A 3IIYA 2I0TA 1FWXA 4CI3A 1B9YA 3AL8B 2OJYA 1YFQA 5IGQA 4CY1A 3EI1A 4Y5RD 1MG2A 3PXWD 3VH0A 2BBKH 4A08B 4TZ4A 4ERZA 3I7PA 3SJLD 3F3GA 4LGNA 4GQ1A 3NVXA 4R7AB 3J80g 4JSPC 5HE3B 5CXBB 5HE1B 3IKOA 4X63B 4A11A 4E5ZA 2HKMA 3FM0A 5CYKA 1SHYB 3I7KA 2Q7QA 3RMZD 2YNNA 3RFGA 3EI1B 5HYNB 3PE7A 5EMMB 4J81A 4ERYA 1P22A 4CZVA 1U4CA 3C5MA 3MZLA 3BG0A 3OW8A 4J73A 3AL9A 5IGOA 5IC7A 2P9IC 4K3ID 4A11B 4E5ZB 2I3SA 3CFVA 2H68A 3AFCA 3JROA 1GP2B 5CYKB 4A2LA 4A09A 2AGLA 4X61B 4J8GA 4J87A 4PBYA 2I3TA 4Y7RA 2MTAH 4GGAA 4BUJC 4JT6C 4KFMB 1MG3A 3SBPA 3SXTD 4XYHA 3FGBA 5AMSA 4JT5C 5A2Qg 4E54A 1SQJA 4JSNC 5SXMA 3ODTA 2B5LA 3JRPA 4GGDA 4FHLA 3RSEC 2P9PC 5B4WA 4A09B 3K26A 1ERJA 3JZGA 3PXSD 4FA1D 5GSAA 4QL1A 3I89A 4OWRA 5HQGA 1B9XA 4IA9A 3NVQA 4GQBB 4JSVC 4LG8A 4A0AA 4O3UB 1U2VC 2Z2PA 4O1QD 2YBAA 5H17A 3DXMC 4QQEA 5GMKn 2H6NA 3MKSB 3UVLA 4EWRA 2I0SA 3MKQA 1OLZA 2YMUA 2CO0A 2OVRB 2BCJB 2H9NA 3P4FA 2HESX 5I5JA 1NEXB 5FKRA 3JB9L 1RI6A 5IJ7E 3IJ0A 4O9DA 3RFHA 3RLMD 3GFCA 4ZOZA 4A0AB 2PM7B 2B5MA 2PBIB 3VA6A 4PSWB 3SFZA 3JPXA 4QT8A 5EMLB 3ORVD 5FA5B 2AGWA 3I7OA 3IIWA 1TBGA 3L4OD 3MZKA 5I5MA 3KRXB 4CI1A 3EU7A 2AGYA 5THAA 4FAVD 4PSXB 4L9OA 4BH6A 2P9KC 5IT9g 4J0WA 1MDAH 2J56H 3I8CA 1K32A 5K19A 2GNQA 1GXRA 3SBRA 3HFQA 3C9CA 3L4MD 3UKUC 4GM9A 3SMRA 4GZ8A 1PBYB 4LG9A 4CY5A 2XYIA 2OK6A 3V7DB 1S4UX 3UVNA 5CXCA 3V9FA 1N6EA 2J55H 2IUQA 3C99A 3ZWLB 3B7FA 4AOWA 5H14A 4JD2C 5AJAA 2YNOA 1JJUB 4PXWA 4MK0B 2H9MA 3CFSB 4CC9A 4J86A 3F3PA 3V5WB 4ZOYA 4YVDA 4GQ2P 4JSXC 3SHFA 3DSMA 1QNIA 5CXCB 5EAMA 3JZNA 1PEVA 4CZXA 3U4YA 3DXKC 4H5IA 5TEFA 2B5NA 4A7JA 3OKYA 5K1CC 5HE2B 4GGCA 5TEEA 4OZUA 2H14A 3I7LA 5FLXg 4J82A 2OK4A 2OVQB
chains in the Genus database with same CATH superfamily
4CI8A 4FA4D 3N0EA 2CNXA 5EM2A 3NIFA 2CE8A 5HE0B 1JV2A 5FKTA 4CY2A 2P9NC 1H2XA 3UVMA 3MUNA 1GOGA 3OTTA 5H1MA 2HU7A 3GREA 2OVPB 2HU5A 5TF2A 2IWFA 4GM3A 2UZXB 1JMZB 1R5MA 2GC4A 3MMYA 5C9ZB 3OKYB 3RN1D 3OL2A 2VDQA 3F3FA 2PM6B 3I7HA 5TDHB 4E54B 1E5TA 3EI2A 1OMWB 3UKRC 4Z7QA 3E0CA 5EM2B 1JMXB 4N14A 2HXCA 1JOFA 2H9PA 5IJ8E 2AGXA 1YR2A 4BCDA 3IUMA 3K27A 3V4PA 3I8EA 3I2NA 4MMYA 4G56B 2VDPA 4J77A 4A0BA 5HDBA 4WK0A 1VZ2A 5C2VB 4X3EA 5EAPA 3OKWA 1XIPA 3IUJA 2Z2NA 3FRXA 4PC0A 5GXHA 4K3JB 3W15A 3OL2B 2H3XA 5EMKB 2YNPA 3EI2B 4ZOVA 1O6FA 3EG6A 2IURA 3JAMg 4AN0A 4L3HD 4IMMA 2CN3A 5FKSA 1XHMA 4G55A 1TYEA 1T2XA 3JZHA 2CO0C 3SLED 3BG1A 4A0BB 4AMZA 2H13A 2O9KA 3C75H 3QI0A 5C2WB 1VZ3A 2CN2A 3PXTD 1GOHA 2QC5A 4GMBA 4H5JA 3EI3A 4FA9D 4FA5D 3I7NA 4L3GD 4MMXA 3AH8B 2GC7A 2VC2A 2HYEA 5GXIA 3DM0A 2H9LA 2P9UC 2HJ4A 3PVWB 4BCCA 1TYQC 2VZ1A 4UI9R 5M5RA 3PVUB 1VE7A 3BWSA 3UVKA 2H6QA 5EARA 5C92A 3IUQA 3RN0D 4FB1D 3NIGA 3O4IA 2BKLA 1GG2B 1UOQA 3EI3B 3N0DA 1XKSA 4ZN4A 3SVWD 5FFGA 2XDWA 3MUOA 3NVNA 2G99A 3PSLA 2XU7A 1K8KC 3GC3B 3EQ7A 1C9IA 4FWWA 2VDMA 1L0QA 3MXXA 3T3MA 4ESGA 4Z7OA 4GM8A 2EBSA 4D6VA 4ES0A 2QR5A 2TRCB 4J8BA 4BL0A 4NC4A 3A0FA 1A0RB 4JXMA 2UZYB 4J78A 5EALA 2AH1A 4HDJA 4CY3A 3SN6B 2AGZA 4O45A 4NSXA 2HKRA 4O2WA 5M5VA 1QFSA 4J79A 3OF7A 5M61A 3UR4A 5JWZA 4AEZA 2J57G 4CI2A 3IJCA 3EQ8A 5M5SA 2PM9A 1PGUA 2XZGA 5EMJB 1JTDB 2QXVA 5M5TA 4X60B 3DWLC 1SQ9A 4CZYA 4PNKB 3J81g 1GOTB 4QAMA 4J84A 3ULEC 4J0XA 5FQDA 4D9SA 3KRWB 4BP8A 4U7AA 2HJBA 2IUVA 3EWEA 5E6SA 3EI4A 3IJ1A 1Q47A 3CIKB 2B4EA 1NR0A 2Z2OA 3IULA 1N6FA 4DNVA 2I0RA 3RRMC 2PM9B 3EQ9A 1N6DA 2G9AA 2XE4A 2EIBA 2IWKA 3SBQA 2IUPA 4DNWA 4FAND 4D0KA 5AFU3 3V4VA 4Z8LA 2H6KA 5FKQA 2VDKA 2CE9A 3SWSD 4I79A 3K72A 4O3TB 4ZOXA 3AL8A 3EI4B 2YB8B 4A2MA 2H47A 3VGZA 2XL3A 2EIEA 3SCYA 2XL2A 2IAAA 2AQ5A 3GD1I 2OIZA 1I2MB 3UVOA 5KDOB 4A08A 5FXYA 4RE6A 4U1EI 3EMHA 3PSCB 4NBMA 4PBZA 4XEIC 4L1QD 2P9LC 4NENA 1VYHC 5CXBA 1PI6A 2W18A 4ERQA 4QRJA 5I5IA 3K71A 3OKTA 4XYIA 2P9SC 3VI3A 2AH0A 3IIYA 4BP9A 2I0TA 1FWXA 4CI3A 1B9YA 3AL8B 3K6SA 3NIDA 2OJYA 1YFQA 5IGQA 4CY1A 4WJKA 3EI1A 4Y5RD 1MG2A 3PXWD 3VH0A 2BBKH 4A08B 4TZ4A 2HU8A 4ERZA 3I7PA 3SJLD 3F3GA 4LGNA 4GQ1A 3IUNA 3NVXA 4R7AB 3FCUA 3J80g 4JSPC 4O02A 5HE3B 5CXBB 4JHNA 5HE1B 3IKOA 4X63B 4A11A 4E5ZA 2HKMA 1H2YA 3FM0A 2VDLA 5CYKA 1SHYB 3I7KA 2Q7QA 3RMZD 2YNNA 3RFGA 3DDUA 3EI1B 3FCSA 3PE7A 5HYNB 3IJEA 5EMMB 1K3IA 4J81A 4WK2A 3O4GA 1P22A 4CZVA 4ERYA 3ZDYA 1U4CA 5E6UA 3ZE2A 3C5MA 3MZLA 3BG0A 3OW8A 4J73A 3AL9A 5IGOA 5IC7A 1E8MA 2P9IC 4K3ID 4A11B 4E5ZB 2I3SA 3CFVA 2H68A 3AFCA 1M1XA 3JROA 1C9LA 3KCIA 2EIDA 1GP2B 5CYKB 4A2LA 4A09A 2AGLA 4X61B 5M5UA 1O6GA 4J8GA 4J87A 4PBYA 2I3TA 4Y7RA 2MTAH 4GGAA 4BUJC 4JT6C 4KFMB 1MG3A 3SBPA 3SXTD 4AX4A 4XYHA 3FGBA 5AMSA 4JT5C 5A2Qg 4E54A 1SQJA 4JSNC 5SXMA 3ODTA 2VDRA 2B5LA 3JRPA 4GGDA 4FHLA 4AN1A 3RSEC 2P9PC 5B4WA 4A09B 3K26A 1ERJA 3JZGA 3PXSD 4FA1D 5GSAA 4QL1A 3I89A 4OWRA 5HQGA 1B9XA 4IA9A 3NVQA 4GQBB 2EICA 4JSVC 4LG8A 4A0AA 1U2VC 2Z2PA 4O3UB 4O1QD 2YBAA 5H17A 3DXMC 4QQEA 5GMKn 2H6NA 3MKSB 4MMZA 3UVLA 4L1MA 2VDOA 3ZDXA 4EWRA 2I0SA 3MKQA 3ZE0A 1OLZA 4RE5A 2YMUA 5E6RA 2CO0A 2OVRB 2BCJB 2H9NA 3P4FA 2HESX 3IVMA 5I5JA 1NEXB 1U8CA 4DNUA 2JKXA 1E8NA 5FKRA 3JB9L 1H2WA 1A12A 1RI6A 4Z7NA 5IJ7E 3ZE1A 4IRZA 3IJ0A 4O9DA 3RFHA 3RLMD 1QFMA 4JHPC 3GFCA 4ZOZA 4A0AB 2PM7B 4UM9A 2B5MA 2PBIB 3VA6A 4PSWB 3SFZA 5FFOA 3O4JA 3JPXA 4QT8A 5EMLB 2QZPA 3ORVD 5FA5B 2AGWA 3I7OA 3IIWA 1TBGA 3L4OD 3MZKA 5I5MA 3KRXB 4CI1A 3EU7A 2AGYA 1VE6A 5THAA 4FAVD 4PSXB 4L9OA 1GOFA 4BH6A 2P9KC 5IT9g 4J0WA 1MDAH 2J56H 3I8CA 1K32A 1UTCA 4WK4A 5K19A 2GNQA 1GXRA 3SBRA 3HFQA 3MVDK 3C9CA 3L4MD 3ZDZA 3UKUC 3VI4A 4GM9A 3SMRA 3QHYB 5C86A 4GZ8A 1PBYB 4LG9A 4CY5A 2XYIA 2OK6A 3V7DB 1S4UX 3UVNA 5CXCA 3V9FA 4G1MA 1N6EA 2J55H 2IUQA 1UOPA 4UM8A 3O4HA 1H2ZA 3C99A 3ZWLB 3B7FA 4AOWA 5H14A 4JD2C 5AJAA 2YNOA 1JJUB 4PXWA 4MK0B 4BCBA 2H9MA 3CFSB 4G1EA 4J86A 3F3PA 4CC9A 3T3PA 3V5WB 4YVDA 4ZOYA 4GQ2P 4JSXC 2WQ8A 3SHFA 3DSMA 1QNIA 1L5GA 5CXCB 5EAMA 3JZNA 1PEVA 4CZXA 3U4YA 2VZ3A 4AMYA 3DXKC 4H5IA 2VDNA 5TEFA 2B5NA 3IURA 3OKYA 4A7JA 1BPOA 5K1CC 5HE2B 4GGCA 1UOOA 5TEEA 4OZUA 2H14A 3I7LA 5FLXg 4NAAA 4J82A 2OK4A 2OVQB
chains in the Genus database with same CATH topology
4CI8A 4FA4D 3N0EA 2CNXA 5EM2A 2CE8A 5HE0B 4CY2A 5FKTA 2P9NC 3UVMA 3OTTA 5H1MA 3GREA 2OVPB 5TF2A 2IWFA 4GM3A 2UZXB 1JMZB 1R5MA 2GC4A 3MMYA 5C9ZB 3OKYB 3RN1D 3OL2A 3F3FA 2PM6B 3I7HA 5TDHB 4E54B 3EI2A 1OMWB 3UKRC 3E0CA 5EM2B 1JMXB 4N14A 2HXCA 1JOFA 2H9PA 5IJ8E 2AGXA 3K27A 3I8EA 3I2NA 4G56B 4A0BA 4J77A 5C2VB 4X3EA 5EAPA 3OKWA 1XIPA 2Z2NA 3FRXA 4PC0A 5GXHA 4K3JB 3W15A 3OL2B 2H3XA 5EMKB 2YNPA 3EI2B 4ZOVA 3EG6A 2IURA 3JAMg 4L3HD 4IMMA 2CN3A 5FKSA 1XHMA 3JZHA 2CO0C 3SLED 3BG1A 4A0BB 2H13A 2O9KA 3C75H 5C2WB 2CN2A 3PXTD 2QC5A 4GMBA 4H5JA 3EI3A 4FA9D 4FA5D 3I7NA 4L3GD 3AH8B 2GC7A 2HYEA 5GXIA 3DM0A 2H9LA 2P9UC 2HJ4A 3PVWB 1TYQC 4UI9R 3PVUB 3UVKA 3BWSA 2H6QA 5EARA 3RN0D 4FB1D 1GG2B 3EI3B 3N0DA 1XKSA 4ZN4A 3SVWD 3NVNA 2G99A 3PSLA 2XU7A 1K8KC 4FWWA 3MXXA 1L0QA 4ESGA 4GM8A 2EBSA 4D6VA 4ES0A 2TRCB 4J8BA 4BL0A 3A0FA 1A0RB 4JXMA 2UZYB 4J78A 5EALA 2AH1A 4HDJA 4CY3A 3SN6B 2AGZA 4O45A 4NSXA 2HKRA 4J79A 3UR4A 5JWZA 4AEZA 2J57G 4CI2A 3IJCA 2PM9A 1PGUA 5EMJB 2QXVA 4X60B 3DWLC 1SQ9A 4CZYA 4PNKB 3J81g 1GOTB 4J84A 3ULEC 4J0XA 5FQDA 3KRWB 4U7AA 2HJBA 2IUVA 3EWEA 3EI4A 3IJ1A 1Q47A 3CIKB 2B4EA 1NR0A 2Z2OA 1N6FA 2I0RA 3RRMC 2PM9B 1N6DA 2G9AA 2IWKA 3SBQA 2IUPA 4FAND 4D0KA 5AFU3 4Z8LA 2H6KA 5FKQA 2CE9A 3SWSD 4I79A 4O3TB 4ZOXA 3AL8A 3EI4B 2YB8B 4A2MA 2H47A 3VGZA 2XL3A 3SCYA 2XL2A 2IAAA 2AQ5A 2OIZA 3UVOA 5KDOB 4A08A 5FXYA 4U1EI 3EMHA 3PSCB 4PBZA 4XEIC 4L1QD 2P9LC 1VYHC 5CXBA 1PI6A 2W18A 4ERQA 4QRJA 5I5IA 3OKTA 4XYIA 2P9SC 2AH0A 3IIYA 2I0TA 1FWXA 4CI3A 1B9YA 3AL8B 2OJYA 1YFQA 5IGQA 4CY1A 3EI1A 4Y5RD 1MG2A 3PXWD 3VH0A 2BBKH 4A08B 4TZ4A 4ERZA 3I7PA 3SJLD 3F3GA 4LGNA 4GQ1A 3NVXA 4R7AB 3J80g 4JSPC 5HE3B 5CXBB 5HE1B 3IKOA 4X63B 4A11A 4E5ZA 2HKMA 3FM0A 5CYKA 1SHYB 3I7KA 2Q7QA 3RMZD 2YNNA 3RFGA 3EI1B 5HYNB 3PE7A 5EMMB 4J81A 4ERYA 1P22A 4CZVA 1U4CA 3C5MA 3MZLA 3BG0A 3OW8A 4J73A 3AL9A 5IGOA 5IC7A 2P9IC 4K3ID 4A11B 4E5ZB 2I3SA 3CFVA 2H68A 3AFCA 3JROA 1GP2B 5CYKB 4A2LA 4A09A 2AGLA 4X61B 4J8GA 4J87A 4PBYA 2I3TA 4Y7RA 2MTAH 4GGAA 4BUJC 4JT6C 4KFMB 1MG3A 3SBPA 3SXTD 4XYHA 3FGBA 5AMSA 4JT5C 5A2Qg 4E54A 1SQJA 4JSNC 5SXMA 3ODTA 2B5LA 3JRPA 4GGDA 4FHLA 3RSEC 2P9PC 5B4WA 4A09B 3K26A 1ERJA 3JZGA 3PXSD 4FA1D 5GSAA 4QL1A 3I89A 4OWRA 5HQGA 1B9XA 4IA9A 3NVQA 4GQBB 4JSVC 4LG8A 4A0AA 4O3UB 1U2VC 2Z2PA 4O1QD 2YBAA 5H17A 3DXMC 4QQEA 5GMKn 2H6NA 3MKSB 3UVLA 4EWRA 2I0SA 3MKQA 1OLZA 2YMUA 2CO0A 2OVRB 2BCJB 2H9NA 3P4FA 2HESX 5I5JA 1NEXB 5FKRA 3JB9L 1RI6A 5IJ7E 3IJ0A 4O9DA 3RFHA 3RLMD 3GFCA 4ZOZA 4A0AB 2PM7B 2B5MA 2PBIB 3VA6A 4PSWB 3SFZA 3JPXA 4QT8A 5EMLB 3ORVD 5FA5B 2AGWA 3I7OA 3IIWA 1TBGA 3L4OD 3MZKA 5I5MA 3KRXB 4CI1A 3EU7A 2AGYA 5THAA 4FAVD 4PSXB 4L9OA 4BH6A 2P9KC 5IT9g 4J0WA 1MDAH 2J56H 3I8CA 1K32A 5K19A 2GNQA 1GXRA 3SBRA 3HFQA 3C9CA 3L4MD 3UKUC 4GM9A 3SMRA 4GZ8A 1PBYB 4LG9A 4CY5A 2XYIA 2OK6A 3V7DB 1S4UX 3UVNA 5CXCA 3V9FA 1N6EA 2J55H 2IUQA 3C99A 3ZWLB 3B7FA 4AOWA 5H14A 4JD2C 5AJAA 2YNOA 1JJUB 4PXWA 4MK0B 2H9MA 3CFSB 4CC9A 4J86A 3F3PA 3V5WB 4ZOYA 4YVDA 4GQ2P 4JSXC 3SHFA 3DSMA 1QNIA 5CXCB 5EAMA 3JZNA 1PEVA 4CZXA 3U4YA 3DXKC 4H5IA 5TEFA 2B5NA 4A7JA 3OKYA 5K1CC 5HE2B 4GGCA 5TEEA 4OZUA 2H14A 3I7LA 5FLXg 4J82A 2OK4A 2OVQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4CI8 A;  4FA4 D;  3N0E A;  2CNX A;  5EM2 A;  2CE8 A;  5HE0 B;  4CY2 A;  5FKT A;  2P9N C;  3UVM A;  3OTT A;  5H1M A;  3GRE A;  2OVP B;  5TF2 A;  2IWF A;  4GM3 A;  2UZX B;  1JMZ B;  1R5M A;  2GC4 A;  3MMY A;  5C9Z B;  3OKY B;  3RN1 D;  3OL2 A;  3F3F A;  2PM6 B;  3I7H A;  5TDH B;  4E54 B;  3EI2 A;  1OMW B;  3UKR C;  3E0C A;  5EM2 B;  1JMX B;  4N14 A;  2HXC A;  1JOF A;  2H9P A;  5IJ8 E;  2AGX A;  3K27 A;  3I8E A;  3I2N A;  4G56 B;  4A0B A;  4J77 A;  5C2V B;  4X3E A;  5EAP A;  3OKW A;  1XIP A;  2Z2N A;  3FRX A;  4PC0 A;  5GXH A;  4K3J B;  3W15 A;  3OL2 B;  2H3X A;  5EMK B;  2YNP A;  3EI2 B;  4ZOV A;  3EG6 A;  2IUR A;  3JAM g;  4L3H D;  4IMM A;  2CN3 A;  5FKS A;  1XHM A;  3JZH A;  2CO0 C;  3SLE D;  3BG1 A;  4A0B B;  2H13 A;  2O9K A;  3C75 H;  5C2W B;  2CN2 A;  3PXT D;  2QC5 A;  4GMB A;  4H5J A;  3EI3 A;  4FA9 D;  4FA5 D;  3I7N A;  4L3G D;  3AH8 B;  2GC7 A;  2HYE A;  5GXI A;  3DM0 A;  2H9L A;  2P9U C;  2HJ4 A;  3PVW B;  1TYQ C;  4UI9 R;  3PVU B;  3UVK A;  3BWS A;  2H6Q A;  5EAR A;  3RN0 D;  4FB1 D;  1GG2 B;  3EI3 B;  3N0D A;  1XKS A;  4ZN4 A;  3SVW D;  3NVN A;  2G99 A;  3PSL A;  2XU7 A;  1K8K C;  4FWW A;  3MXX A;  1L0Q A;  4ESG A;  4GM8 A;  2EBS A;  4D6V A;  4ES0 A;  2TRC B;  4J8B A;  4BL0 A;  3A0F A;  1A0R B;  4JXM A;  2UZY B;  4J78 A;  5EAL A;  2AH1 A;  4HDJ A;  4CY3 A;  3SN6 B;  2AGZ A;  4O45 A;  4NSX A;  2HKR A;  4J79 A;  3UR4 A;  5JWZ A;  4AEZ A;  2J57 G;  4CI2 A;  3IJC A;  2PM9 A;  1PGU A;  5EMJ B;  2QXV A;  4X60 B;  3DWL C;  1SQ9 A;  4CZY A;  4PNK B;  3J81 g;  1GOT B;  4J84 A;  3ULE C;  4J0X A;  5FQD A;  3KRW B;  4U7A A;  2HJB A;  2IUV A;  3EWE A;  3EI4 A;  3IJ1 A;  1Q47 A;  3CIK B;  2B4E A;  1NR0 A;  2Z2O A;  1N6F A;  2I0R A;  3RRM C;  2PM9 B;  1N6D A;  2G9A A;  2IWK A;  3SBQ A;  2IUP A;  4FAN D;  4D0K A;  5AFU 3;  4Z8L A;  2H6K A;  5FKQ A;  2CE9 A;  3SWS D;  4I79 A;  4O3T B;  4ZOX A;  3AL8 A;  3EI4 B;  2YB8 B;  4A2M A;  2H47 A;  3VGZ A;  2XL3 A;  3SCY A;  2XL2 A;  2IAA A;  2AQ5 A;  2OIZ A;  3UVO A;  5KDO B;  4A08 A;  5FXY A;  4U1E I;  3EMH A;  3PSC B;  4PBZ A;  4XEI C;  4L1Q D;  2P9L C;  1VYH C;  5CXB A;  1PI6 A;  2W18 A;  4ERQ A;  4QRJ A;  5I5I A;  3OKT A;  4XYI A;  2P9S C;  2AH0 A;  3IIY A;  2I0T A;  1FWX A;  4CI3 A;  1B9Y A;  3AL8 B;  2OJY A;  1YFQ A;  5IGQ A;  4CY1 A;  3EI1 A;  4Y5R D;  1MG2 A;  3PXW D;  3VH0 A;  2BBK H;  4A08 B;  4TZ4 A;  4ERZ A;  3I7P A;  3SJL D;  3F3G A;  4LGN A;  4GQ1 A;  3NVX A;  4R7A B;  3J80 g;  4JSP C;  5HE3 B;  5CXB B;  5HE1 B;  3IKO A;  4X63 B;  4A11 A;  4E5Z A;  2HKM A;  3FM0 A;  5CYK A;  1SHY B;  3I7K A;  2Q7Q A;  3RMZ D;  2YNN A;  3RFG A;  3EI1 B;  5HYN B;  3PE7 A;  5EMM B;  4J81 A;  4ERY A;  1P22 A;  4CZV A;  1U4C A;  3C5M A;  3MZL A;  3BG0 A;  3OW8 A;  4J73 A;  3AL9 A;  5IGO A;  5IC7 A;  2P9I C;  4K3I D;  4A11 B;  4E5Z B;  2I3S A;  3CFV A;  2H68 A;  3AFC A;  3JRO A;  1GP2 B;  5CYK B;  4A2L A;  4A09 A;  2AGL A;  4X61 B;  4J8G A;  4J87 A;  4PBY A;  2I3T A;  4Y7R A;  2MTA H;  4GGA A;  4BUJ C;  4JT6 C;  4KFM B;  1MG3 A;  3SBP A;  3SXT D;  4XYH A;  3FGB A;  5AMS A;  4JT5 C;  5A2Q g;  4E54 A;  1SQJ A;  4JSN C;  5SXM A;  3ODT A;  2B5L A;  3JRP A;  4GGD A;  4FHL A;  3RSE C;  2P9P C;  5B4W A;  4A09 B;  3K26 A;  1ERJ A;  3JZG A;  3PXS D;  4FA1 D;  5GSA A;  4QL1 A;  3I89 A;  4OWR A;  5HQG A;  1B9X A;  4IA9 A;  3NVQ A;  4GQB B;  4JSV C;  4LG8 A;  4A0A A;  4O3U B;  1U2V C;  2Z2P A;  4O1Q D;  2YBA A;  5H17 A;  3DXM C;  4QQE A;  5GMK n;  2H6N A;  3MKS B;  3UVL A;  4EWR A;  2I0S A;  3MKQ A;  1OLZ A;  2YMU A;  2CO0 A;  2OVR B;  2BCJ B;  2H9N A;  3P4F A;  2HES X;  5I5J A;  1NEX B;  5FKR A;  3JB9 L;  1RI6 A;  5IJ7 E;  3IJ0 A;  4O9D A;  3RFH A;  3RLM D;  3GFC A;  4ZOZ A;  4A0A B;  2PM7 B;  2B5M A;  2PBI B;  3VA6 A;  4PSW B;  3SFZ A;  3JPX A;  4QT8 A;  5EML B;  3ORV D;  5FA5 B;  2AGW A;  3I7O A;  3IIW A;  1TBG A;  3L4O D;  3MZK A;  5I5M A;  3KRX B;  4CI1 A;  3EU7 A;  2AGY A;  5THA A;  4FAV D;  4PSX B;  4L9O A;  4BH6 A;  2P9K C;  5IT9 g;  4J0W A;  1MDA H;  2J56 H;  3I8C A;  1K32 A;  5K19 A;  2GNQ A;  1GXR A;  3SBR A;  3HFQ A;  3C9C A;  3L4M D;  3UKU C;  4GM9 A;  3SMR A;  4GZ8 A;  1PBY B;  4LG9 A;  4CY5 A;  2XYI A;  2OK6 A;  3V7D B;  1S4U X;  3UVN A;  5CXC A;  3V9F A;  1N6E A;  2J55 H;  2IUQ A;  3C99 A;  3ZWL B;  3B7F A;  4AOW A;  5H14 A;  4JD2 C;  5AJA A;  2YNO A;  1JJU B;  4PXW A;  4MK0 B;  2H9M A;  3CFS B;  4CC9 A;  4J86 A;  3F3P A;  3V5W B;  4ZOY A;  4YVD A;  4GQ2 P;  4JSX C;  3SHF A;  3DSM A;  1QNI A;  5CXC B;  5EAM A;  3JZN A;  1PEV A;  4CZX A;  3U4Y A;  3DXK C;  4H5I A;  5TEF A;  2B5N A;  4A7J A;  3OKY A;  5K1C C;  5HE2 B;  4GGC A;  5TEE A;  4OZU A;  2H14 A;  3I7L A;  5FLX g;  4J82 A;  2OK4 A;  2OVQ B; 
#chains in the Genus database with same CATH topology
 4CI8 A;  4FA4 D;  3N0E A;  2CNX A;  5EM2 A;  3NIF A;  2CE8 A;  5HE0 B;  1JV2 A;  5FKT A;  4CY2 A;  2P9N C;  1H2X A;  3UVM A;  3MUN A;  1GOG A;  3OTT A;  5H1M A;  2HU7 A;  3GRE A;  2OVP B;  2HU5 A;  5TF2 A;  2IWF A;  4GM3 A;  2UZX B;  1JMZ B;  1R5M A;  2GC4 A;  3MMY A;  5C9Z B;  3OKY B;  3RN1 D;  3OL2 A;  2VDQ A;  3F3F A;  2PM6 B;  3I7H A;  5TDH B;  4E54 B;  1E5T A;  3EI2 A;  1OMW B;  3UKR C;  4Z7Q A;  3E0C A;  5EM2 B;  1JMX B;  4N14 A;  2HXC A;  1JOF A;  2H9P A;  5IJ8 E;  2AGX A;  1YR2 A;  4BCD A;  3IUM A;  3K27 A;  3V4P A;  3I8E A;  3I2N A;  4MMY A;  4G56 B;  2VDP A;  4J77 A;  4A0B A;  5HDB A;  4WK0 A;  1VZ2 A;  5C2V B;  4X3E A;  5EAP A;  3OKW A;  1XIP A;  3IUJ A;  2Z2N A;  3FRX A;  4PC0 A;  5GXH A;  4K3J B;  3W15 A;  3OL2 B;  2H3X A;  5EMK B;  2YNP A;  3EI2 B;  4ZOV A;  1O6F A;  3EG6 A;  2IUR A;  3JAM g;  4AN0 A;  4L3H D;  4IMM A;  2CN3 A;  5FKS A;  1XHM A;  4G55 A;  1TYE A;  1T2X A;  3JZH A;  2CO0 C;  3SLE D;  3BG1 A;  4A0B B;  4AMZ A;  2H13 A;  2O9K A;  3C75 H;  3QI0 A;  5C2W B;  1VZ3 A;  2CN2 A;  3PXT D;  1GOH A;  2QC5 A;  4GMB A;  4H5J A;  3EI3 A;  4FA9 D;  4FA5 D;  3I7N A;  4L3G D;  4MMX A;  3AH8 B;  2GC7 A;  2VC2 A;  2HYE A;  5GXI A;  3DM0 A;  2H9L A;  2P9U C;  2HJ4 A;  3PVW B;  4BCC A;  1TYQ C;  2VZ1 A;  4UI9 R;  5M5R A;  3PVU B;  1VE7 A;  3BWS A;  3UVK A;  2H6Q A;  5EAR A;  5C92 A;  3IUQ A;  3RN0 D;  4FB1 D;  3NIG A;  3O4I A;  2BKL A;  1GG2 B;  1UOQ A;  3EI3 B;  3N0D A;  1XKS A;  4ZN4 A;  3SVW D;  5FFG A;  2XDW A;  3MUO A;  3NVN A;  2G99 A;  3PSL A;  2XU7 A;  1K8K C;  3GC3 B;  3EQ7 A;  1C9I A;  4FWW A;  2VDM A;  1L0Q A;  3MXX A;  3T3M A;  4ESG A;  4Z7O A;  4GM8 A;  2EBS A;  4D6V A;  4ES0 A;  2QR5 A;  2TRC B;  4J8B A;  4BL0 A;  4NC4 A;  3A0F A;  1A0R B;  4JXM A;  2UZY B;  4J78 A;  5EAL A;  2AH1 A;  4HDJ A;  4CY3 A;  3SN6 B;  2AGZ A;  4O45 A;  4NSX A;  2HKR A;  4O2W A;  5M5V A;  1QFS A;  4J79 A;  3OF7 A;  5M61 A;  3UR4 A;  5JWZ A;  4AEZ A;  2J57 G;  4CI2 A;  3IJC A;  3EQ8 A;  5M5S A;  2PM9 A;  1PGU A;  2XZG A;  5EMJ B;  1JTD B;  2QXV A;  5M5T A;  4X60 B;  3DWL C;  1SQ9 A;  4CZY A;  4PNK B;  3J81 g;  1GOT B;  4QAM A;  4J84 A;  3ULE C;  4J0X A;  5FQD A;  4D9S A;  3KRW B;  4BP8 A;  4U7A A;  2HJB A;  2IUV A;  3EWE A;  5E6S A;  3EI4 A;  3IJ1 A;  1Q47 A;  3CIK B;  2B4E A;  1NR0 A;  2Z2O A;  3IUL A;  1N6F A;  4DNV A;  2I0R A;  3RRM C;  2PM9 B;  3EQ9 A;  1N6D A;  2G9A A;  2XE4 A;  2EIB A;  2IWK A;  3SBQ A;  2IUP A;  4DNW A;  4FAN D;  4D0K A;  5AFU 3;  3V4V A;  4Z8L A;  2H6K A;  5FKQ A;  2VDK A;  2CE9 A;  3SWS D;  4I79 A;  3K72 A;  4O3T B;  4ZOX A;  3AL8 A;  3EI4 B;  2YB8 B;  4A2M A;  2H47 A;  3VGZ A;  2XL3 A;  2EIE A;  3SCY A;  2XL2 A;  2IAA A;  2AQ5 A;  3GD1 I;  2OIZ A;  1I2M B;  3UVO A;  5KDO B;  4A08 A;  5FXY A;  4RE6 A;  4U1E I;  3EMH A;  3PSC B;  4NBM A;  4PBZ A;  4XEI C;  4L1Q D;  2P9L C;  4NEN A;  1VYH C;  5CXB A;  1PI6 A;  2W18 A;  4ERQ A;  4QRJ A;  5I5I A;  3K71 A;  3OKT A;  4XYI A;  2P9S C;  3VI3 A;  2AH0 A;  3IIY A;  4BP9 A;  2I0T A;  1FWX A;  4CI3 A;  1B9Y A;  3AL8 B;  3K6S A;  3NID A;  2OJY A;  1YFQ A;  5IGQ A;  4CY1 A;  4WJK A;  3EI1 A;  4Y5R D;  1MG2 A;  3PXW D;  3VH0 A;  2BBK H;  4A08 B;  4TZ4 A;  2HU8 A;  4ERZ A;  3I7P A;  3SJL D;  3F3G A;  4LGN A;  4GQ1 A;  3IUN A;  3NVX A;  4R7A B;  3FCU A;  3J80 g;  4JSP C;  4O02 A;  5HE3 B;  5CXB B;  4JHN A;  5HE1 B;  3IKO A;  4X63 B;  4A11 A;  4E5Z A;  2HKM A;  1H2Y A;  3FM0 A;  2VDL A;  5CYK A;  1SHY B;  3I7K A;  2Q7Q A;  3RMZ D;  2YNN A;  3RFG A;  3DDU A;  3EI1 B;  3FCS A;  3PE7 A;  5HYN B;  3IJE A;  5EMM B;  1K3I A;  4J81 A;  4WK2 A;  3O4G A;  1P22 A;  4CZV A;  4ERY A;  3ZDY A;  1U4C A;  5E6U A;  3ZE2 A;  3C5M A;  3MZL A;  3BG0 A;  3OW8 A;  4J73 A;  3AL9 A;  5IGO A;  5IC7 A;  1E8M A;  2P9I C;  4K3I D;  4A11 B;  4E5Z B;  2I3S A;  3CFV A;  2H68 A;  3AFC A;  1M1X A;  3JRO A;  1C9L A;  3KCI A;  2EID A;  1GP2 B;  5CYK B;  4A2L A;  4A09 A;  2AGL A;  4X61 B;  5M5U A;  1O6G A;  4J8G A;  4J87 A;  4PBY A;  2I3T A;  4Y7R A;  2MTA H;  4GGA A;  4BUJ C;  4JT6 C;  4KFM B;  1MG3 A;  3SBP A;  3SXT D;  4AX4 A;  4XYH A;  3FGB A;  5AMS A;  4JT5 C;  5A2Q g;  4E54 A;  1SQJ A;  4JSN C;  5SXM A;  3ODT A;  2VDR A;  2B5L A;  3JRP A;  4GGD A;  4FHL A;  4AN1 A;  3RSE C;  2P9P C;  5B4W A;  4A09 B;  3K26 A;  1ERJ A;  3JZG A;  3PXS D;  4FA1 D;  5GSA A;  4QL1 A;  3I89 A;  4OWR A;  5HQG A;  1B9X A;  4IA9 A;  3NVQ A;  4GQB B;  2EIC A;  4JSV C;  4LG8 A;  4A0A A;  1U2V C;  2Z2P A;  4O3U B;  4O1Q D;  2YBA A;  5H17 A;  3DXM C;  4QQE A;  5GMK n;  2H6N A;  3MKS B;  4MMZ A;  3UVL A;  4L1M A;  2VDO A;  3ZDX A;  4EWR A;  2I0S A;  3MKQ A;  3ZE0 A;  1OLZ A;  4RE5 A;  2YMU A;  5E6R A;  2CO0 A;  2OVR B;  2BCJ B;  2H9N A;  3P4F A;  2HES X;  3IVM A;  5I5J A;  1NEX B;  1U8C A;  4DNU A;  2JKX A;  1E8N A;  5FKR A;  3JB9 L;  1H2W A;  1A12 A;  1RI6 A;  4Z7N A;  5IJ7 E;  3ZE1 A;  4IRZ A;  3IJ0 A;  4O9D A;  3RFH A;  3RLM D;  1QFM A;  4JHP C;  3GFC A;  4ZOZ A;  4A0A B;  2PM7 B;  4UM9 A;  2B5M A;  2PBI B;  3VA6 A;  4PSW B;  3SFZ A;  5FFO A;  3O4J A;  3JPX A;  4QT8 A;  5EML B;  2QZP A;  3ORV D;  5FA5 B;  2AGW A;  3I7O A;  3IIW A;  1TBG A;  3L4O D;  3MZK A;  5I5M A;  3KRX B;  4CI1 A;  3EU7 A;  2AGY A;  1VE6 A;  5THA A;  4FAV D;  4PSX B;  4L9O A;  1GOF A;  4BH6 A;  2P9K C;  5IT9 g;  4J0W A;  1MDA H;  2J56 H;  3I8C A;  1K32 A;  1UTC A;  4WK4 A;  5K19 A;  2GNQ A;  1GXR A;  3SBR A;  3HFQ A;  3MVD K;  3C9C A;  3L4M D;  3ZDZ A;  3UKU C;  3VI4 A;  4GM9 A;  3SMR A;  3QHY B;  5C86 A;  4GZ8 A;  1PBY B;  4LG9 A;  4CY5 A;  2XYI A;  2OK6 A;  3V7D B;  1S4U X;  3UVN A;  5CXC A;  3V9F A;  4G1M A;  1N6E A;  2J55 H;  2IUQ A;  1UOP A;  4UM8 A;  3O4H A;  1H2Z A;  3C99 A;  3ZWL B;  3B7F A;  4AOW A;  5H14 A;  4JD2 C;  5AJA A;  2YNO A;  1JJU B;  4PXW A;  4MK0 B;  4BCB A;  2H9M A;  3CFS B;  4G1E A;  4J86 A;  3F3P A;  4CC9 A;  3T3P A;  3V5W B;  4YVD A;  4ZOY A;  4GQ2 P;  4JSX C;  2WQ8 A;  3SHF A;  3DSM A;  1QNI A;  1L5G A;  5CXC B;  5EAM A;  3JZN A;  1PEV A;  4CZX A;  3U4Y A;  2VZ3 A;  4AMY A;  3DXK C;  4H5I A;  2VDN A;  5TEF A;  2B5N A;  3IUR A;  3OKY A;  4A7J A;  1BPO A;  5K1C C;  5HE2 B;  4GGC A;  1UOO A;  5TEE A;  4OZU A;  2H14 A;  3I7L A;  5FLX g;  4NAA A;  4J82 A;  2OK4 A;  2OVQ B; 
#chains in the Genus database with same CATH homology
 4CI8 A;  4FA4 D;  3N0E A;  2CNX A;  5EM2 A;  2CE8 A;  5HE0 B;  4CY2 A;  5FKT A;  2P9N C;  3UVM A;  3OTT A;  5H1M A;  3GRE A;  2OVP B;  5TF2 A;  2IWF A;  4GM3 A;  2UZX B;  1JMZ B;  1R5M A;  2GC4 A;  3MMY A;  5C9Z B;  3OKY B;  3RN1 D;  3OL2 A;  3F3F A;  2PM6 B;  3I7H A;  5TDH B;  4E54 B;  3EI2 A;  1OMW B;  3UKR C;  3E0C A;  5EM2 B;  1JMX B;  4N14 A;  2HXC A;  1JOF A;  2H9P A;  5IJ8 E;  2AGX A;  3K27 A;  3I8E A;  3I2N A;  4G56 B;  4A0B A;  4J77 A;  5C2V B;  4X3E A;  5EAP A;  3OKW A;  1XIP A;  2Z2N A;  3FRX A;  4PC0 A;  5GXH A;  4K3J B;  3W15 A;  3OL2 B;  2H3X A;  5EMK B;  2YNP A;  3EI2 B;  4ZOV A;  3EG6 A;  2IUR A;  3JAM g;  4L3H D;  4IMM A;  2CN3 A;  5FKS A;  1XHM A;  3JZH A;  2CO0 C;  3SLE D;  3BG1 A;  4A0B B;  2H13 A;  2O9K A;  3C75 H;  5C2W B;  2CN2 A;  3PXT D;  2QC5 A;  4GMB A;  4H5J A;  3EI3 A;  4FA9 D;  4FA5 D;  3I7N A;  4L3G D;  3AH8 B;  2GC7 A;  2HYE A;  5GXI A;  3DM0 A;  2H9L A;  2P9U C;  2HJ4 A;  3PVW B;  1TYQ C;  4UI9 R;  3PVU B;  3UVK A;  3BWS A;  2H6Q A;  5EAR A;  3RN0 D;  4FB1 D;  1GG2 B;  3EI3 B;  3N0D A;  1XKS A;  4ZN4 A;  3SVW D;  3NVN A;  2G99 A;  3PSL A;  2XU7 A;  1K8K C;  4FWW A;  3MXX A;  1L0Q A;  4ESG A;  4GM8 A;  2EBS A;  4D6V A;  4ES0 A;  2TRC B;  4J8B A;  4BL0 A;  3A0F A;  1A0R B;  4JXM A;  2UZY B;  4J78 A;  5EAL A;  2AH1 A;  4HDJ A;  4CY3 A;  3SN6 B;  2AGZ A;  4O45 A;  4NSX A;  2HKR A;  4J79 A;  3UR4 A;  5JWZ A;  4AEZ A;  2J57 G;  4CI2 A;  3IJC A;  2PM9 A;  1PGU A;  5EMJ B;  2QXV A;  4X60 B;  3DWL C;  1SQ9 A;  4CZY A;  4PNK B;  3J81 g;  1GOT B;  4J84 A;  3ULE C;  4J0X A;  5FQD A;  3KRW B;  4U7A A;  2HJB A;  2IUV A;  3EWE A;  3EI4 A;  3IJ1 A;  1Q47 A;  3CIK B;  2B4E A;  1NR0 A;  2Z2O A;  1N6F A;  2I0R A;  3RRM C;  2PM9 B;  1N6D A;  2G9A A;  2IWK A;  3SBQ A;  2IUP A;  4FAN D;  4D0K A;  5AFU 3;  4Z8L A;  2H6K A;  5FKQ A;  2CE9 A;  3SWS D;  4I79 A;  4O3T B;  4ZOX A;  3AL8 A;  3EI4 B;  2YB8 B;  4A2M A;  2H47 A;  3VGZ A;  2XL3 A;  3SCY A;  2XL2 A;  2IAA A;  2AQ5 A;  2OIZ A;  3UVO A;  5KDO B;  4A08 A;  5FXY A;  4U1E I;  3EMH A;  3PSC B;  4PBZ A;  4XEI C;  4L1Q D;  2P9L C;  1VYH C;  5CXB A;  1PI6 A;  2W18 A;  4ERQ A;  4QRJ A;  5I5I A;  3OKT A;  4XYI A;  2P9S C;  2AH0 A;  3IIY A;  2I0T A;  1FWX A;  4CI3 A;  1B9Y A;  3AL8 B;  2OJY A;  1YFQ A;  5IGQ A;  4CY1 A;  3EI1 A;  4Y5R D;  1MG2 A;  3PXW D;  3VH0 A;  2BBK H;  4A08 B;  4TZ4 A;  4ERZ A;  3I7P A;  3SJL D;  3F3G A;  4LGN A;  4GQ1 A;  3NVX A;  4R7A B;  3J80 g;  4JSP C;  5HE3 B;  5CXB B;  5HE1 B;  3IKO A;  4X63 B;  4A11 A;  4E5Z A;  2HKM A;  3FM0 A;  5CYK A;  1SHY B;  3I7K A;  2Q7Q A;  3RMZ D;  2YNN A;  3RFG A;  3EI1 B;  5HYN B;  3PE7 A;  5EMM B;  4J81 A;  4ERY A;  1P22 A;  4CZV A;  1U4C A;  3C5M A;  3MZL A;  3BG0 A;  3OW8 A;  4J73 A;  3AL9 A;  5IGO A;  5IC7 A;  2P9I C;  4K3I D;  4A11 B;  4E5Z B;  2I3S A;  3CFV A;  2H68 A;  3AFC A;  3JRO A;  1GP2 B;  5CYK B;  4A2L A;  4A09 A;  2AGL A;  4X61 B;  4J8G A;  4J87 A;  4PBY A;  2I3T A;  4Y7R A;  2MTA H;  4GGA A;  4BUJ C;  4JT6 C;  4KFM B;  1MG3 A;  3SBP A;  3SXT D;  4XYH A;  3FGB A;  5AMS A;  4JT5 C;  5A2Q g;  4E54 A;  1SQJ A;  4JSN C;  5SXM A;  3ODT A;  2B5L A;  3JRP A;  4GGD A;  4FHL A;  3RSE C;  2P9P C;  5B4W A;  4A09 B;  3K26 A;  1ERJ A;  3JZG A;  3PXS D;  4FA1 D;  5GSA A;  4QL1 A;  3I89 A;  4OWR A;  5HQG A;  1B9X A;  4IA9 A;  3NVQ A;  4GQB B;  4JSV C;  4LG8 A;  4A0A A;  4O3U B;  1U2V C;  2Z2P A;  4O1Q D;  2YBA A;  5H17 A;  3DXM C;  4QQE A;  5GMK n;  2H6N A;  3MKS B;  3UVL A;  4EWR A;  2I0S A;  3MKQ A;  1OLZ A;  2YMU A;  2CO0 A;  2OVR B;  2BCJ B;  2H9N A;  3P4F A;  2HES X;  5I5J A;  1NEX B;  5FKR A;  3JB9 L;  1RI6 A;  5IJ7 E;  3IJ0 A;  4O9D A;  3RFH A;  3RLM D;  3GFC A;  4ZOZ A;  4A0A B;  2PM7 B;  2B5M A;  2PBI B;  3VA6 A;  4PSW B;  3SFZ A;  3JPX A;  4QT8 A;  5EML B;  3ORV D;  5FA5 B;  2AGW A;  3I7O A;  3IIW A;  1TBG A;  3L4O D;  3MZK A;  5I5M A;  3KRX B;  4CI1 A;  3EU7 A;  2AGY A;  5THA A;  4FAV D;  4PSX B;  4L9O A;  4BH6 A;  2P9K C;  5IT9 g;  4J0W A;  1MDA H;  2J56 H;  3I8C A;  1K32 A;  5K19 A;  2GNQ A;  1GXR A;  3SBR A;  3HFQ A;  3C9C A;  3L4M D;  3UKU C;  4GM9 A;  3SMR A;  4GZ8 A;  1PBY B;  4LG9 A;  4CY5 A;  2XYI A;  2OK6 A;  3V7D B;  1S4U X;  3UVN A;  5CXC A;  3V9F A;  1N6E A;  2J55 H;  2IUQ A;  3C99 A;  3ZWL B;  3B7F A;  4AOW A;  5H14 A;  4JD2 C;  5AJA A;  2YNO A;  1JJU B;  4PXW A;  4MK0 B;  2H9M A;  3CFS B;  4CC9 A;  4J86 A;  3F3P A;  3V5W B;  4ZOY A;  4YVD A;  4GQ2 P;  4JSX C;  3SHF A;  3DSM A;  1QNI A;  5CXC B;  5EAM A;  3JZN A;  1PEV A;  4CZX A;  3U4Y A;  3DXK C;  4H5I A;  5TEF A;  2B5N A;  4A7J A;  3OKY A;  5K1C C;  5HE2 B;  4GGC A;  5TEE A;  4OZU A;  2H14 A;  3I7L A;  5FLX g;  4J82 A;  2OK4 A;  2OVQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...