2W1QA

Unique ligand binding specificity for a family 32 carbohydrate- binding module from the mu toxin produced by clostridium perfringens
Total Genus 37
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
37
sequence length
140
structure length
140
Chain Sequence
NPSLIRSESWQVYEGNEANLLDGDDNTGVWYKTLNGDTSLAGEFIGLDLGKEIKLDGIRFVIGKNGGGSSDKWNKFKLEYSLDNESWTTIKEYDKTGAPAGKDVIEESFETPISAKYIRLTNMENINKWLTFSEFAIVSD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title N-Acetylglucosamine Recognition by a Family 32 Carbohydrate-Binding Module from Clostridium Perfringens Nagh.
pubmed doi rcsb
source organism Clostridium perfringens
molecule tags Hydrolase
molecule keywords HYALURONOGLUCOSAMINIDASE
total genus 37
structure length 140
sequence length 140
chains with identical sequence B
ec nomenclature ec 3.2.1.35: Hyaluronoglucosaminidase.
pdb deposition date 2008-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00754 F5_F8_type_C F5/8 type C domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w1qA00
2YC4A 1SDDB 3HNYM 3VDCA 4UOJA 2VMEA 2VTFA 2QQKA 3VD7A 1L7QA 1UY3A 3LEGA 1ULOA 4ZXEA 3VD5A 1J83A 2XQXA 4D8MA 4XVHA 1UX7A 4XURA 2JKXA 5FUIA 2WZEA 3HPNA 1GU3A 1F4AA 5JR2A 2VQUA 3GGLA 3WNKA 5I0DA 5JMOA 3C8XA 3WF1A 2JDAA 1PMHX 2WUHA 1DYOA 2Y6GA 3GDBA 4W50A 4DXTA 1PX4A 3UESA 4HG6B 1DLCA 2VM9A 1JZ2A 3DYMA 1UY1A 1UY2A 2VCCA 1GQPA 2ID4A 2Y6JA 1L7RA 1LNSA 2YFUA 1JI6A 1XPWA 2YB7A 4DEQA 1XNTA 5EIYB 3PUHA 3WF0A 4A41A 2E26A 3T2OA 3MUZ1 2VZRA 3WNOA 4JKKA 4Z2AA 1J84A 3FHQA 1UWWA 2RVAA 3IAQA 3HNBM 5B4XA 4CU9A 2VZPA 4TTGA 3FHAA 3I2FA 3HEIA 3OB8A 1K45A 4JHZA 3F2ZA 3ACGA 5C7GA 2ORXA 4QX0A 3T0BA 1RYYA 1W9WA 3VDBA 3W5NA 4PQQA 4BK5A 3MUY1 3LEKA 4LKSA 4QB1A 1F4HA 2ZEWA 1H6YA 1TVGA 3THCA 1YQ2A 4DXSA 2HLEA 2WQ8A 1IQDC 4ARYA 2WAOA 3LQCA 3VDAA 2QQLA 3T2QA 2WN2A 2Y64A 3U37A 4ARXA 1JZ4A 1JZ8A 2QQMA 3BN6A 2E31A 3ACFA 5DPNA 3WNNA 3I2JA 3LPGA 1OF4A 2EIBA 5B4NA 2CDPA 3VD9A 4BXSV 2KD7A 2WBKA 2WAAA 1NAEA 2C9KA 3T09A 2WABA 3MV01 2VZTA 1O8SA 1PX3A 2J1AA 1UY4A 2W1UA 4M4PA 3CQOA 4P08A 1XNAA 4QX1A 3GXUA 4XUNA 5LCWL 5IFPA 1W0NA 2VOTA 4A45A 3JXSA 4FI9A 1UMIA 4GZ9A 2WO1A 4CU6A 4XZUG 3P1IA 2DCKA 2WO3A 5JUVA 2YG0A 2VZSA 2VL4A 3C7HA 3NNGA 5LA2A 3NQHA 3OBAA 1GOFA 1BHGA 4MOAA 2E33A 1JZ7A 4QDSA 3WSOA 2Y8KA 5G05L 3OEBA 3CKHA 3WF3A 5IFTA 1JU4A 1NKGA 1GOGA 2X10A 2V72A 2VC9A 1XC6A 3K4DA 2W95A 3OGSA 3NRUA 1OH4A 5IJRA 2VCBA 4AAXA 1UYXA 1US3A 2LW8A 4CU8A 4QPWA 4P00B 3NJVA 3E1F1 4PF1A 3A21A 2J1RA 3LE0A 3WNPA 2XOMA 1R64A 2BZDA 2DCJA 1P8JA 2W92A 2QQJA 3WEZA 1UYZA 2RJ2A 4P02B 5C71A 3VD3A 2ZEZA 3FL7A 3OGRA 3T0AA 4A42A 4XUTA 1CZTA 3C7GA 2B9VA 3OGVA 2E32A 5A1AA 1JYWA 3C7OA 3FN9A 2X05A 2V5DA 2WO2A 3CZJA 3IAPA 1JZ6A 4QDRA 1W9TA 2X09A 4LPLA 2J1TA 3CMGA 4W4ZA 4ZZ5A 3C7FA 3ABZA 4YPJA 3DYPA 2ZXQA 4OUEA 4XUQA 3J7HA 1WKYA 2Y6KA 3D3AA 4ZZ8A 3HOBA 1US2A 2VZOA 2WN3A 3I2IA 3HN3A 2W47A 2DDUA 4E8DA 3I2HA 3A23A 3K75B 2VMFA 1I5PA 4AG4A 2BGPA 1UYYA 4L0PA 2PQSA 3VD4A 2WZ8A 5JXJA 2BGOA 2VZUA 4D0QA 1JHJA 5IYYA 2J1UA 3GM8A 2VZ3A 2QQIA 1EUTA 2EIEA 1CZVA 2EICA 4KI5M 3P6BA 3T0DA 2J7MA 2VZ1A 2VJXA 3EYPA 3MO4A 4XUPA 2B4KA 1GMMA 3K46A 1UXXX 2W46A 1W9SA 3I3DA 2J1VA 2QBXA 3A7QA 2W9XA 1UZ0A 5HXMA 1W99A 3CZUA 3THDA 5LA1A 2W94A 4CU7A 2VZQA 2YFZA 3ECQA 4LHSA 2VCAA 2VZVA 5LA0A 3ACIA 1OT5A 1UXZA 1NX9A 2YC2A 2Y6LA 1JYVA 2J1SA 2ZEXA 3I3BA 3K77A 4KMQA 4OMDA 3T08A 2BBAA 5EJZB 2XONA 4BDVB 5JXIA 3WF2A 2WDBA 4CUBA 5F7UA 3SEPA 2W3JA 4MGQA 2LS6A 2J1EA 5HPOA 2VO5A 3I2GA 4QB2A 1PMJX 1CZSA 1W8OA 1WCQA 4DUWA 1JZ5A 1KGYA 4BJ0A 5G04L 2WYSA 4QB6A 4MO3M 4GWJA 5DMYA 1TG7A 2JD9A 4OZOA 3SKJE 1MPXA 3MBWA 3CDZB 1D7PM 1OD3A 4A3ZA 4BK4A 3WF4A 3SEEA 1K12A 2Z4FA 4TXWA 4XUOA 2C26A 2W87A 2VQTA 4P5YA 4JKLA 2W1WA 3K4ZA 4JX0A 4MGSA 4OYUA 2HYXA 3C7EA 1OF3A 4A4AA 4OMCA 3UNPA 1O8PA 3DYOA 2L9LA 4LQRA 3I2KA 4DUVA 3DECA 2Y6HA 3CIHA 4QDQA 3BGAA 4ET7A 3WNMA 1JU3A 3LEIA 1CIYA 3WNLA 1NUKA 4A44A 4MADA 4RYDA 5EJ1B 1O59A 4QAWA 3OG2A 1K42A 3PUIA 5JXHA 3IB3A 2R7EB 5CZKA 1EUUA 2W1QA 4E8CA 2VR4A 5IHRA 3HNMA 4ZY9A 3I97A 5CYYA 2OKXA 1GUIA 1JZ3A 5JXGA 3ZM8A 2QQOA 2CDOA 4M4RA 4A6OA 4CUCA 1JYNA 3LPFA 2JE8A 3K4AA 1KEXA 1SHWB 4DEVA 4DXRA 4KWUA 5DQ0A 3ETPA 4CUAA 2BERA 1W8NA 4PT6A 4QX2A 3W5MA 1CX1A 4IUGA 3T2PA 3WQBA 3OEAA 4QX3A 2V4VA 1SG3A 1T2XA 1UMHA 1H6XA 3IIIA 4UAPA 2VMDA 5J1XA 3NJXA 2C4XA 2VMCA 3ACHA 2RV9A 2ZEYA 1GOHA 2W91A 1HN1A 4RN5A 4UI9L 4JKMA 3EB7A 1ULPA 1UY0A 3IDAA 3AC0A 3HJRA 4CVUA 2W1SA 2W5FA 4GWIA 5DN2A 1JYXA 4DUXA 1K3IA 3A22A 3SKVA 3MV11 2QQNA 3UETA 2J22A 4W8JA 3I3EA 5C70A 2ORZA 1DP0A 2XHNA 1GNYA 2EIDA
chains in the Genus database with same CATH superfamily
4BQ3A 4D6RA 4AOCA 3VDCA 4UF0A 4UOJA 1XE0A 4U2AA 1N1SA 4UBGA 3W9AA 4Q0UA 4Q8KA 1LTEA 1XE7A 4AVBA 1LKNA 2MEV3 4JAAA 1CAUA 1HXS2 1QXJA 4XXPA 3QD6A 4ZXEA 1V6NA 1PGL2 4CPBA 4Q4X2 5BNQA 5K7PA 1WLCA 2WKKA 4EN6B 1J1TA 1APNA 3D8CA 4J1WA 3VBUB 3HT1A 4RS5C 1J83A 2XQXA 2Y33A 4WM7A 3WG1A 3MHZA 4QD2A 5F3CA 2VAUA 3NV1A 5BV6A 4MX3A 4XJ9A 1UX7A 4Y4YA 1V9U1 1Z7S1 2JKXA 4RS5A 4NN0A 5JR7B 2Q0AA 1LOGA 1N3OA 4A7KA 2GU9A 3RWNA 5JR2A 2SBAA 3PHMA 2E51A 3FC0A 1BLZA 3SC7X 2VQUA 1EAH2 1UZWA 2DURA 2K2SA 5F39A 5JZGA 1S4CA 3VZJA 2GNBA 2JECA 3PVBB 5I0DA 2ZGMA 1WCKA 1ZRIA 1JOJA 1RHI2 4XDOA 2IUWA 2JDAA 4DOUA 1W6OA 2VPVA 1NXMA 1QEXA 5CG9A 1BBT2 4I01A 4W50A 1KS4A 1LHWA 5EWSA 3UESA 2JDKA 3H8OA 3S57A 2VM9A 3AMPA 3DYMA 2OS2A 3AXDA 3H3LA 3WW3A 4J6GA 1DFQA 4FCAA 3H50A 1GQPA 3SNMA 1D2SA 5F2WA 1L7RA 5FPBA 1XPWA 1HDKA 1N1TA 1XNTA 1DCSA 1W90A 3DUIA 3VKMA 4F3JA 3FJSA 3CBNA 3KCCA 2A6ZA 1LHVA 4DY5A 1V6OA 5APAA 1S0DA 2CU5A 3MUZ1 5I8SA 4Z2AA 1H0BA 4RS5B 1N3QA 2RVAA 2ZZJA 4FO9A 4RR3A 2WNOA 4YVWC 1AZDA 3EJKA 4Q1RA 5IK4A 4DPNA 2JG8C 1Q8QA 3OB8A 3LSEA 1K45A 2ZAHA 4N43C 4PDWB 4Q0QA 1AR91 1SCRA 1HIXA 2LROA 3AP6A 4H3WA 4JTOA 2ZGOA 2JG8A 4E9KA 3VDBA 1EP0A 5BNNC 4BK5A 3O1OA 3J8F1 1G9FA 3LEKA 3MUY1 4R9DA 1LR5A 1ASJ3 1H6YA 5FYYA 4IV3A 2BJSA 3J9SA 2VVDA 1VBD3 3MW4A 5A3WA 5TSWA 1IPSA 2ZCWA 3VBSC 1GP6A 4GQ7A 1YEWA 3LCPA 1T6GC 4L8QA 5A3LA 2RJKA 4CSWA 2HWD1 1LENA 5K0UB 1ODMA 4WVWA 3D4KA 1LGBA 4L99A 2DU1A 1VBE1 1DIWA 1OF4A 2A73B 2EIBA 5B4NA 3KLSA 2LTNA 1QWRA 2LUWA 2QTWB 1X7NA 1LEMA 1YQCA 3OSDA 5DDJ2 4Z92B 3Q8EA 4BXSV 5IK8A 1XQNA 1NA1C 4FOYA 1DQ2A 3HN1A 4YW4A 3RZZA 4EN9B 3ZYIB 1OUSA 3T4VA 2JG8B 2O14A 2PTMA 3MV01 2VZTA 4ZXKA 5IATA 1QJFA 1O8SA 3OY8A 2RMU1 2WT1A 4RFRB 3TN92 5A3NA 4NHXA 1UY4A 2AACA 1KJLA 3UKTA 1UOBA 2R071 4P08A 3WDWA 3POWA 4P9IA 4NWWA 1PVC1 3WDYA 4GD4A 4AVTA 4FFGA 1MS3A 2YC0A 2VOXA 4AI8A 4PQ9A 5EPAA 1ND3A 1X9PA 4LOTA 4YYOA 2D5HA 3B9IA 1OLQA 1CAXB 3ZO0B 2BV4A 2BOIA 1O4YA 1YHFA 2XKOA 3BOWA 4AFBA 5HV0A 2GZWA 1MEC3 4UXAA 1GZWA 4R9AA 4XACA 2YG0A 2VNOA 2VZSA 4BHPA 3USUA 3WW1A 3LGRA 3VZOA 5C4WB 4TLFA 2VL4A 5F32A 2GH8A 3NNGA 1UPIA 3UV9A 2QFEA 2WWSA 1LHOA 1PO21 1UD1A 3E5UA 4FPEA 1RJ7A 1QH6A 3O1RA 1S2EA 4XBQA 1VBC1 4FPFA 3QOPA 4Y5Z0 1IS4A 2E33A 3ASIA 1NA1B 1UMZA 2Q4SA 1VBD2 3JZVA 5JDBA 2JDZA 2EALA 3BPSA 2WINB 3WF3A 3UJQA 3ZXDA 5IFTA 1OI6A 1SMVA 4QWNA 2V72A 4LO5B 3U78A 4XMIA 4NO4A 1WLWA 3O1MA 4LBNA 3H8XA 2D98A 2RG4A 3BPZA 2DBIA 4MG2A 5IJRA 2QQWA 4YGCA 1ND2C 4X6QB 3D82A 1PM7A 1OLRA 1RUG1 1NE4A 1Q43A 2E7QA 2LW8A 1GWKA 3NNMA 4YG6A 3WDXA 1OD5A 3KM5A 2DUPA 2OXBA 3WLUA 3B7MA 4QKFA 4ES8A 4EWAA 3SH4A 5BNNA 5I91A 1MQTC 1MZ6A 2E7TA 5FZEA 2DCJA 3ZYBA 3AP9A 4AAPA 1QDOA 3S7IA 2XKPA 1QY4A 4MH0E 4QM8A 2RS33 2D6PA 4QXKA 2Q8DA 1PM4A 3POFA 1UU4A 3VKNA 4JGZA 1UIJA 1FNZA 1NYWA 4JHTA 4YZ3A 1HX6A 3ZFEB 1SCSA 4XMAA 2E63A 4WZCA 4HKLA 2YV8A 3KV9A 4BOWA 4EZHA 5A3OA 3OPZA 3SCHA 3ALQA 5D8AA 1VIWB 4OI0A 1F8VA 2X05A 4Q4Y2 1RIRA 5CFCC 1E57A 1NA1A 5J7MA 1W8UA 4RGKA 2VECA 3IAPA 2GNDA 3WQ7A 2RDRA 2XJSA 5EJ3A 5FMOL 1EAH3 4CPBD 1JZ6A 2VNGA 4BH9A 2DVDA 1TMF3 1NQJA 2X09A 5LBBA 4ZONA 2J1TA 2VMIA 2V5YA 2ZKLA 5F1RA 4W4ZA 2EF6A 3C7FA 1SPPB 1UPSA 3HAGA 4YPJA 3DYPA 2Z42A 5T50A 1IHMA 1IG3A 4EN7B 1GZWB 3P3PA 4DRRA 3VBFC 4BMEA 3OGJA 2VXRA 1MS8A 2KR2A 5KHIA 1D4M1 4LBKA 3D3AA 4R8HA 4ZZ8A 2MEV2 1US2A 5FYCA 4QPIC 2VZOA 4ATFA 4NROA 2WN3A 4Q4V1 2W47A 4IV3C 4Q2FA 2CGNA 2OZJA 2PYTA 4C91A 1E5HA 1X50A 3EBRA 3FLTA 4AHXA 4IE0A 5FK7A 1H2NA 3OUJA 4GIQA 3ITQA 5H9QA 4XF9A 2VCMA 2VMFA 3G6JB 5KXCA 2NM1A 5E6HA 4QMAA 3ZXLA 3WY6A 2GAUA 3NW4A 1O3RA 1NCQC 2WFPA 2VZUA 1OLMA 4R9BA 3VBHB 4ZKTB 4H7MA 2AYHA 1WW6A 2VZ3A 2I2SA 3LDBA 2VXJA 4YWAA 3THPA 1LGCA 2EICA 1QJX1 4DXSA 2GNTA 3RDIA 3DGTA 1FPN3 1PO13 3P6BA 1I9RA 1AYN1 1XYPA 4DB5A 2VOVA 1SEFA 3VBOC 2VBPA 5FXXA 1GMMA 1QIQA 3K46A 3WUCA 2WQZC 3JQWA 1M06G 5CU1A 3ZN6A 1QJU2 2ZAAA 4SBVA 3TBDA 1PZ7A 3NJZA 1W9SA 4UFKA 1WW7A 1GQHA 1OH3A 3A7QA 3I3DA 5F5CA 4LHLA 1IS3A 4KBZA 2JG9B 4IERA 5FK8A 4YFWA 4QPIB 4UFHA 4EN8B 3UKNA 2R0HA 2OPKA 5ANNA 3CZUA 4LBOA 1BYHA 3LFMA 1G9CA 4IV3B 5SV8A 1WW4A 3THDA 1QOSA 3VZLA 4QHOA 4DMIA 4CU7A 2FDHA 3PVNA 5T55A 4LHSA 3DXUA 1VBA1 2VBBA 3ACLA 2HWB3 2P5BA 2DTWA 3D0JA 3UGFA 3GZAA 4XQDA 1OT5A 3AKSA 2JX9A 2YC2A 2BVBA 1RUD3 5L36A 2J1SA 1AR82 2RHPA 3HR9A 3KT1A 5D1IA 5T5OA 1PGSA 3K77A 1N1VA 4COZA 1BJQA 5A33B 5CEHA 2BBAA 2Q30A 2BTVC 4AGVA 4FPHA 3VUOA 4FOWA 2N7GA 4EZ4A 1J59A 1NCRA 4CUBA 2TNFA 2WQ4A 1B35B 1C3HA 3IMMA 3LFIA 2VUDA 4Q4W2 3W58A 2AGSA 4COWA 4MGQA 1RUF1 5BNOA 1UU5A 2QQPA 1NCRC 3FWEA 4IEYA 4L97A 4XZPA 4YW5A 5FYHA 1HRI2 2O8OA 1ENRA 3HIFA 3SHRA 4CEYA 5HPOA 2VO5A 2XWJB 1C1FA 2ZACA 2JG9C 5FBZA 3KCXA 4LO8A 2HBUA 2YPJA 5FR3A 3E5XA 3NJYA 3TB0A 2XL7A 5KC6A 2ETEA 3BTYA 3JD71 2ES3A 4KWJA 1DLLA 4QHBA 4P9XA 4MGTA 1JZ5A 3ENRA 4AI9A 2C9AA 5JCTA 2GP5A 2GC3A 2H0BA 4FPYA 4JGYC 4E2QA 5C3QA 1S55A 2EAAA 5F5AA 1Q8VA 4MO3M 3T30A 2DWRA 2PHUA 5FZ7A 5IT6A 1TG7A 1W2AX 2NQYA 4NRMA 1IQAA 4QU1A 4P9GA 4OZOA 3VB9A 4DZGA 3MBWA 4HZFA 1OD3A 2GSYA 1UZYA 4OLLA 4A3ZA 1LAJA 4BK4A 1K12A 2Z4FA 5F6LB 5LK5A 4FPOB 1DBNA 2DVGA 2C24A 3ES1A 4LULA 2C26A 4AQTA 4TWTA 4B4RA 2VQTA 4P5YA 3VBUA 4LBMA 3ZN4A 1Y3TA 2ARBA 4FPCA 3H42B 4HPKB 4XFAA 5FZKA 4E4ZA 4OYUA 2HYXA 1RHI3 1GQGA 1UKGA 3C7EA 3PLQA 4CDUC 1QXPA 3D5OA 4A4AA 1C57A 3UNPA 1G9DA 5GZDA 1AYM1 3ON7A 3WCSA 3DYOA 3E97A 2G1MA 2VBDA 3OF1A 2FDIA 2YZ4A 5BXXA 5A6XA 3OTFA 3H8UA 2GC2A 3CIHA 4O61A 4QDQA 5LEKA 5JZGC 3JBG2 3FFQA 1WA6X 1RUG3 4HPKA 5K9YA 2AREA 2RS51 1JU3A 3WNLA 1CIYA 4AI1A 4H55A 4OFGA 2CGPA 1HRV3 1B09A 1LODA 1YIPA 4RYDA 4B7KA 1AX1A 1MVQA 5FZAA 3M3IA 4DXZA 5CISA 4QAWA 1HXS3 3T3YA 5T52A 2WJSA 3DPRC 1IZ3A 3VHNA 3KQ4B 3O0WA 2R7EB 2HKXA 2JJ6A 1Y9MA 2IXHA 3NKGA 5CZKA 1EUUA 4MVTA 3IKWA 3J7NA 3WG2A 4XTPA 2UY9A 5I8TA 1A3KA 1PK6A 3SXWA 3WXPA 4X6RB 5IHRA 1OQDA 2ZHKA 2CTVA 3GCWA 5E16A 3AMNA 4Q0PA 2OKXA 2FDKA 2HWD2 1A78A 4JV4A 2OW4A 1KXGA 3TWIA 3AVSA 1J3RA 4N53C 4CUCA 4KGGA 3WVJA 4Y5SA 3ME2A 2IXCA 4IEXA 5L7OC 5HCAA 1H8VA 1NY71 5LA9A 5CB7A 4V2VA 3USUB 1SHWB 1RMU3 4UT5A 2QZ3A 1OA2A 1AR63 4R9CA 1AL22 1MS4A 2HWD3 1K5MC 2VULA 1VLNA 3J8F2 1LB2A 2X5IC 4QX2A 3NAPA 2K46A 4AE2A 1CAXA 2Y6FA 3BU0A 1YCIA 5T3NA 3T2PA 1ND3B 3WQBA 3OEAA 2KM2A 1T2XA 1UMHA 1H6XA 2PLV1 3LDRA 2Y60A 3IIIA 4I3PA 5FYBA 3GHNA 5FTTC 4Q4X1 4COUA 1FOD3 2WT0A 1GICA 3AKTA 4YW1A 4DIQA 5HV4A 2ZGLA 5J98B 5J1XA 2CSGA 4IGQA 3ACHA 3VDDC 1SBFA 1RUE2 3ZFGC 5C9AC 1GOHA 2R32A 3ZFFC 4UI9L 3O1VA 4JKMA 1RUG2 4HK8A 2PXJA 3AVRA 3IDAA 3Q8AA 5FP4A 4V2WA 4OHWA 3QACA 2W5FA 2D6OX 3ZFGB 5C9AB 1ZVFA 2HWE2 1JHNA 2BQPA 2WL1A 1GP4A 4XBLA 2PHXA 5GM0A 3MV11 1XU1A 2QQNA 1GANA 4G4FA 3LA2A 5T5PA 4AEDB 5BNPC 1X9TA 3DEMA 3MI8A 2XHNA 5HXVA 3HD8B 3RFRA 1LESA 3GF6A 3UYJA 2UWAA 1VB2A 5C6CA 2HWC1 1W9YA 5JWPA 1DHKB 5CA6A 1SDDB 2WNUA 3T4HB 4NIGA 1S0GA 1VBC3 3G7DA 5BY5A 3VD7A 4CXWA 2WT2A 3LEGA 4LBJA 3HWJA 4A7YA 3VD5A 4IEQA 5FP7A 1Q56A 4IEZA 3VBFA 2D6NA 2ZX3A 2WZPP 4YLZA 4BQ2A 3V0AA 5EQUA 5FP8A 3UKVA 2QUOA 5J36A 1VAVA 3SQOA 3ZFFB 2PAEA 1FNYA 4K7JA 5FUIA 4IQPA 2WZEA 3AYDA 4RR3B 5F6KA 3ILNA 3MYXA 4K6BA 2WNVC 4PBOA 1RUF3 3OPWA 2W39A 5F5IA 1HRI3 1WCDJ 2V09A 3GGLA 1BVVA 2CY6A 3NO8A 1LHUA 2ZABA 4BB3A 3WF1A 5IVFA 3HQXA 4XBNA 5JOZA 4IE7A 2FD8A 1PX4A 4LEJA 4XAEA 5FOJB 2Y6JA 1BXHA 4LOSA 4WBBA 2BBVA 4ORFA 3AZYA 1HB4A 2XVLA 5FZDA 1AR83 1ODNA 1V6JA 1DZRA 3VBRB 5F3EA 1XNDA 1GWMA 4TYSA 3UK9A 1RTVA 1UNBA 4LLOA 5FXVA 4ONUA 3A4UA 4YVSC 5F37A 1HJFA 4A41A 4CDQC 2ET7A 4X8NA 5IUQA 4EQVA 3VHRA 2BP6A 1UAIA 5IW0A 1WW5A 4A2UA 2VZRA 3WNOA 1QHDA 2DV9A 2FZ2A 1NQDA 1V0AA 4YVSB 3N9LA 5I8YA 1ZZCA 2VG9A 3IAQA 3ZFEA 1LOCA 5FXWA 2O1QA 5JSRA 5FZBA 1CD3G 2Q5TA 3GZEA 1Z7S3 4RR3C 5JOYA 1SLIA 1KQRA 2RS31 4MXVA 2RMU2 3I2FA 4B4QA 4BWOA 1Q8SA 4GH4A 1WD3A 5JVVA 4JHZA 4NHKA 3F2ZA 4IXLA 3ZN5A 2ORXA 2YROA 4QX0A 2XH6A 3OD0A 3CEWA 1ASJ1 1V70A 3AP7A 4JDOA 4PQQA 4LKSA 4UW3A 2ADEA 2P1BA 3B01A 1GFF2 1F4HA 2ZEWA 3POJA 4GMP1 4XYXA 5DDJ1 1TVGA 1BK1A 1RUNA 2AR6A 3THCA 1LCLA 3ZKYA 2OA2A 1VBB2 4Y1VA 1OBNA 1PO12 2HLEA 4LLFA 3VKFC 3WDVA 2WAOA 1ZRCA 3AYEA 3VDAA 5BYNA 5FQ0A 3MIHA 1URXA 1RXGA 2BNMA 3BIWE 2PHLA 4PI2A 3N7LA 3U37A 4ARXA 2OQ6A 3RZGA 4LKDA 3O14A 5HI0A 2K9ZA 4CDQB 2YDEA 5DPNA 5FZIA 3WG3A 3M3EA 1BMV2 2JXAA 3LPGA 1D2QA 1U0AA 3MIBA 4YARA 2FMYA 1W04A 3PUSA 1RUI3 2ZBJA 1RMU1 1COV1 1LOFA 1YI7A 2KD7A 5FZ4A 2DFBA 2C9KA 5LASA 1G86A 5C4WA 3K2OA 4XJ8A 3M2MA 4NOTA 4WV8A 1PX3A 3LIHA 3AK0A 3HQRA 2J1AA 1M4WA 3MLJA 3POSA 1KD7A 4LIUA 3ZYFA 3LZZA 3M8LA 1W05A 4M4PA 5FY4A 2GN3A 5KBFA 4QX1A 5FV3A 3GXUA 4XUNA 4NMIA 3U4XA 2R16A 1C5IA 2DF7A 3AXEA 5LCWL 1DDLA 1W0NA 3W20A 1W6QB 2DBNA 1TMF2 1W6MB 5IAXA 5ISLA 1KFXL 4CZSA 2QJVA 4I0AA 5EXOA 2VOTA 2PMWB 1VBD1 5GZGA 4FI9A 1X33A 3P5BA 2WO1A 2B45X 1ZA7A 4UWDA 1F9KA 4MLOA 1ST8A 2DCKA 2WO3A 4AVVA 3TEZA 1REDA 5A32B 2A6YA 5JUVA 1JYTA 1YFXA 3RZLA 3AL6A 4MXWA 2Z2SB 1V9U2 2AEYA 4LO4B 4NIIA 3KGLA 3C7HA 1YQ8A 3VBSB 3OJBA 1N3PA 5LA2A 4E2SA 4PHZA 5GJ6A 3AYAA 5C33A 1G9AA 4A3XA 4IE4A 3WHTA 1GOFA 4MOAA 4Y22A 4CDUB 1U12A 3OUHA 1K5JA 1VALA 1VPHA 5FYIA 3ZXFA 1PVXA 1G7YA 3CKHA 4RD7A 1JU4A 5DAWA 4E2GA 4FTSA 1VBE3 4LE4A 1FT9A 2X10A 2Q8OA 5EYYA 2VC9A 1JW6A 5I0RA 5FZOA 3MF6A 1ULCA 3OGSA 4I3GA 4KL1A 3SITA 3NRUA 4HVRA 1PIV3 3AL5A 2VCBA 1GZ9A 2WSVA 2XR4A 1CIWA 5A7PA 2D40A 5HCBA 3U75A 3O1TA 5FQ0B 4CTEA 4P00B 1YQ6A 2D43A 3NJVA 4FPJA 4Q0SA 5L9RA 5C8WA 5L73A 4PF1A 3A21A 3WOGA 4AGGA 4QKNA 2XOMA 3KT7A 3PMSA 1ZRFA 3V64A 4LK6A 2BZDA 1JN2P 4Q4Y1 4Y4RA 3AJZA 1UYZA 5BNPA 2RJ2A 4AK3A 3GZTB 4WVVA 1OVSA 1RVF3 2ZEZA 2XGXA 4WZFA 5BNNB 3SH5A 4Y20A 1ND2B 1KFUL 1BEV2 1ZM1A 5DZGA 4EWDA 1JXNA 2GN7A 3I59A 2B9VA 5JPMB 2E32A 1JYWA 2ARAA 4MUVA 3AM2A 4HSLA 2VNRA 3IT8A 4YVSA 3BKZA 1MEC2 1SFPA 3HT2A 5FDBA 3C7OA 1PVC3 3FN9A 1QJX2 2VH9A 2A3XA 2YYOA 2VE1A 2X5IB 5JSPA 1O3QA 1UZZA 1FXZA 2F6BA 1W9TA 1PGW2 3GBGA 2QCSB 4CE8A 3U07A 1RVF1 3ABZA 5FPAA 2FCUA 2HWB1 3NAPC 4JCKA 1EPZA 1Y4WA 2ZXQA 4GB31 4RHV1 4CCDA 1RUI1 3OYWA 3TN93 5A7OA 2PLV2 1CAVA 2WNUC 3PUAA 1FV3A 2P4EA 3HOBA 2KXLA 4Y24A 2IFWA 3RJRA 4LKEA 4HONA 2ZGNA 2BFUL 1W6MA 2NMOA 1XSQA 1YWKA 2BW8A 3I2IA 1GLHA 3HN3A 4FPLA 4LR4A 4YNIA 3WP5A 3I59B 2ZHMA 1GNZA 1AR73 2W68A 5SV5A 2XLGA 3S7EA 4E8DA 1H2MA 4LORA 3GZUC 3K75B 2FCTA 1GNHA 2I07B 3URFA 1UYYA 1W6NB 2JE7A 3GJBA 4CRQA 3LF7A 3L9JT 5DUXA 5JXJA 2YXSA 2RR13 1W39A 2YU1A 4K8RB 1JHJA 4LIVA 3FBYA 4BIFA 3SCGA 1DGRN 5KHHA 3ZXGA 3VBFB 1AYN3 2QQIA 2EIEA 3INAA 1FPN1 5I0SA 4FFIA 3WT3A 3ZFEC 3QH7A 1SLTA 2BEOA 5C4WC 3AMQA 3WV6A 4YSFA 2VJXA 2DVAA 2XB6C 4XUPA 3TEXA 2PQQA 1U5ZA 3SH3A 1JOPA 4CP9A 2W46A 1I6XA 1IG0A 1G6NA 2XMLA 3O7OA 5EHDA 3NV2A 2VNVA 1H8TB 1UZ0A 4LO6B 4UFJA 1ENQA 1ALYA 4QPGA 1W99A 1Z78A 4NPMA 4Z1VA 4AYUA 5LA1A 3RI9A 3WQ1A 1IS5A 4YM0A 3GJAA 1LGNA 3ECQA 3IIAA 5GLUA 2JDUA 3TEWA 2VZVA 2B39A 4XF4A 1DQ5A 1POV0 3ACIA 2O0OA 4MGZE 1MVEA 1MQTB 4XFFA 2A6VA 5BPXA 2OIIA 4E27A 5B2GB 4YZ1A 2ZHLA 1JYVA 2G9FA 3B5LB 2I45A 2ZEXA 5FLHA 2ZGSA 1E5SA 4OMDA 4ZS2A 2XONA 1RUE1 3IPVB 1QOTA 3FX3A 4CXXA 2IXIA 1ZYBA 3PJYA 3FE5A 5F5QA 3VBHC 3N9NA 1RUJ3 4MZUA 2NPIA 5FWJA 5L7OA 4QX5A 2LS6A 2ZGUA 4IESA 1PHMA 1RUC1 4K40A 2BVVA 3GHMA 1W0PA 2NYYA 4G3YC 4I30A 1DQ0A 3I2GA 2PN5A 4Z07A 3IMNA 1WGPA 2CGOA 4CEYC 1PMJX 4S2HA 5DUWA 2CAVA 2ILMA 3ORJA 3KV6A 4Y3OA 1CZSA 2NN8A 1C8NA 1WCQA 3N9PA 3CNAA 2WYSA 4Q4X3 4QB6A 2WA3A 2JENA 4XC9A 4GWJA 2UYAA 2FHRA 2D5FA 4HKWA 2JB4A 4W6XA 1ZA4A 4K21A 4PI0A 3WF4A 4CUGA 4CCJA 2C5DA 1DF0A 2EXKA 2OUHA 3N35A 3ZFFA 2R042 1ENSA 1YI9A 3KF5A 1ACCA 4XFGA 4JKLA 4AGRA 4QGLA 4ZHNA 4JX0A 4W6YA 4ZU4A 4C1XA 1UN1A 4WM7B 5FOBB 1D4M2 3THTA 1N1YA 5FAXA 5FZ1A 1BK0A 3FUQA 2VQ0A 3C3VA 5C5TA 2R1DA 5DXDA 2VUAA 4MGIE 5FZ8A 4XHBA 4ZPIA 1GBGA 4Q4V2 4Y33A 3POYA 4IDZA 1AX0A 1OVPA 4D3WA 5FZ0A 2DTYA 4ET7A 2IXKA 3D6EA 3C2UA 4YFZA 4INDA 3E6CC 3CHXA 1NUKA 4A44A 4BU2A 1X8MA 1CPMA 3MIDA 5FMOS 3VBOB 1T6BX 2PHDA 3OG2A 1YJKA 4Q0VA 1PO22 1RUD1 5JXHA 1FMD1 2ATFA 2G19A 3L2YA 4Q4V3 4AHWA 4GB32 2VR4A 5FYSA 4I0WB 3JB8A 5FZ9A 4OVEA 2R072 5DUUA 3VZKA 3HNMA 4GH4C 1NG0A 5IK7A 1VRH1 1V00A 1S0EA 2ZOEB 3QBQA 5CYYA 3TYJA 4DS0A 4Y22B 3WNXA 1A8MA 1GUIA 2GC0A 4D6QA 5CAZA 4LXLA 5BUVA 5JPNB 5JXGA 1BCXA 3TRSB 4A6OA 5LW9A 1E5RA 3O0XA 3LPFA 5FFOC 3LOIA 1TME3 1GV9A 3LSDA 1STMA 1XU2A 2XDVA 3WHUA 4AQ6A 2JIJA 3M3OA 2ZMLA 4OUMA 1BVP1 1MACA 1V6LA 2V73A 4JZRA 4DXRA 5FCCA 5FMDA 5DQ0A 2FCVA 2B5HA 2BUKA 3ETPA 3KT4A 3ZPYA 3H3UA 2XJRA 5BNOB 2WSUA 4PT6A 3PIGA 1VJ2A 1ZX5A 1EY2A 1B35A 3IPVA 4EYUA 4IUGA 5A70A 1PIV1 1A8DA 1W6QA 5ERLA 3VZMA 4MHUA 4XCAA 2V4VA 5GZFA 4BQXA 3I2OA 1AR81 3M4FA 4ASKA 3H7JA 3CU7A 1CX4A 3AKQA 3NJXA 3V56A 3V0BA 4XJUA 3PU3A 3OD4A 2ZMNA 3HQUA 4QQPA 4QPGC 1UF2C 3NVCA 1LU2A 1RUJ2 1O91A 1RUC3 2W91A 2W0XA 1W3XA 2VTXA 4NAOA 4F7ZA 1YYNA 1ZBE3 1MEC1 2P34A 1ULPA 2ZS6B 4QX7A 4XXAA 3POGA 4ITCA 1H2LA 2BFUS 3AC0A 4FQ4A 5H9SA 3B94A 1HRI1 4ES9A 1AYM3 2YMZA 4EV0A 3U0ZA 3BODA 4BMBA 5IAVA 4JDNA 2HYKA 4ISQA 4Y1YA 3RNSA 1FOD1 2DCYA 2JDNA 5D8AB 4YGEA 1RHI1 2H6BA 1FX5A 4ISRA 4QHZA 5FYTA 5F9TA 5JOWA 3SKVA 2JG9A 4CDXA 1LU1A 3CO2A 1MZ5A 3SLIA 2RS13 1LJ7A 5IVCA 3NL1A 1RUH1 4I0BA 1GNYA 3CJIA 1H2KA 4Y1ZA 1QQP2 4N9IA 5CIRA 3T1LA 2JD4A 2IZWA 3NV3A 2YPDA 2YC4A 4NHMA 3HNYM 4BE3A 5AVPA 5CBLA 3AB0A 3WP6A 1HN0A 1Y9QA 4QM9A 2VY0A 2VTFA 2XLAA 2YGLA 5KC5A 1L7QA 1UY3A 4IEVA 4JQRA 3FLPA 4IEWA 3OBZA 4CEWB 3ZMOA 3ETQA 1COV3 1UIKA 3ZYPA 2IVJA 5F3GA 3EQEA 2EXJA 2BPA2 1ND3C 4XVHA 4XURA 1MS0A 1V6KA 3POEA 4J25A 4PF5A 4R4ZA 4AEDC 1F4AA 3AZWA 4OCTA 1TQ5A 5EP9A 5FP3A 3K3OA 1JS9A 3U11A 1S0IA 1OOPB 2WR9A 1N47A 4HL0A 4P9LA 1WBFA 4Y26A 5GALA 4Z2WA 1CAVB 3WNKA 2P3IA 1DGRA 3C8XA 2FDJA 5JMOA 1G9BA 1AXKA 5FZLA 1REFA 2BU9A 1AVBA 3OYWB 4MSVA 3BYWA 3GYDA 1W9FA 3M3CA 1PMHX 3JU9A 1AHSA 1DYOA 3AMHA 4MV2A 4U36A 3NKTA 2RR12 4BIOA 4DXTA 1OHFA 4FQZA 1DZQA 4HG6B 1RINA 2YUEA 5LWBA 1UY2A 1NCQA 3DKQA 1KDKA 4I09A 4HLTA 1LNSA 2ZGTA 1A6CA 1AR72 1S0BA 2YFUA 4O9EA 1W6OB 4H7LA 3WG4A 3ES4A 4HN0A 4XFBA 3SMHA 4GKXA 5EIYB 2HWC3 4LTAA 4GMP0 3PUHA 3WF0A 4HMZA 1NE6A 1ZZBA 4N53B 3N4MA 1MS1A 2E26A 3RQ0A 3ZR5A 5L7OB 3T2OA 2UY8A 1R092 5LK7B 3DKWA 4JKKA 1S0JA 1VBA2 2CHHA 2VW1A 1SDWA 3NSTA 3FHQA 4QT6A 4E4HA 1AF9A 2CWSA 1UWWA 3IN9A 3LD8A 4FP3A 5B4XA 3HNBM 1K5MB 4RHV2 5GLTA 2BRTA 1DGLA 5FO9B 4TTGA 3FHAA 5IVVA 4XF0A 5EYXA 4CDXC 1JUIA 1UQXA 4N8MA 1MZFA 5FZMA 1OOPC 3VV1A 1YRZA 3DPRA 4RFT0 4BLJA 4HBNA 1J1LA 1OXCA 3PURA 3PU8A 2BYVE 1REEA 1RYYA 3T0BA 3KV4A 2Y0OA 2Z5WA 4BM8A 3W5NA 4IE5A 5ANQA 5GLZA 4RL7A 4CCLA 2RM22 1CN1A 1FMD2 4CCNA 5CFDC 1YQ2A 4JVAA 2ENRA 3DF0A 2RDNA 1YO8A 3GNEA 1O6UA 3LQCA 2DVFA 5CFCB 2PHRA 3MPBA 3QCWA 1PGW1 2YBPA 3T2QA 4CP1A 2AC1A 5IVJA 2D93A 2WN2A 2WZR2 4LHKA 2Y64A 4GXLA 4QQLA 1JZ4A 1JZ8A 2QQMA 1NLRA 4ATEA 2E31A 4B29A 1TZOA 2OT7A 2EAKA 4META 3FBMA 4K20A 4QKBA 2WIIB 1RUJ1 3WNNA 5EZWA 4FTEA 1W8WA 2D97A 2CL2A 2WNEA 5LEJA 3ZFGA 5C9AA 1S1AA 2ZPXA 5E88A 4P5HA 2CDPA 3VD9A 3AMMA 3PDQA 5A6ZA 2P6HA 3UJOA 3VBUC 4AXOA 4NRPA 3T09A 4C90A 1C8M2 3GBFA 3FZ3A 2BOJA 4MXWB 2NZ9A 1PIV2 4UW6A 1Z0HA 3WUDA 3USSA 4CEYB 5FY7A 1HB2A 1SLLA 3CQOA 1ZBA2 1GZCA 2F4PA 3BTXA 1VBE2 5L19A 1RUH2 1WLTA 3OCPA 4YGDA 2WC2A 5FPZA 5IFPA 1IOAA 2PELA 4BQ1A 4JGYA 4AZZA 1OKOA 4AF9A 2Y38A 3M7AA 4YW2A 3S5QA 4Y1UA 1UMIA 4J1XA 4GZ9A 1WLDA 2WNVA 4XZUG 3P1IA 2GH2A 1OQ1A 1TME1 3K51A 1V9U3 1DQ1A 2TEPA 1RJ8A 1W8HA 4KU7A 1Q8PA 4QQOA 4MGKE 2D6MA 4AI2A 4NPRA 3NNLA 5LB6A 1SPPA 3MIFA 4X8PA 2HEVF 2R061 5T5LA 3LAGA 3ZIXA 4CP2A 5CKNA 3M1HA 2CV6A 3P3NA 4AL9A 1NCQB 1G8WA 1OFNA 1HQNA 1JTZX 2WZR3 3NQHA 3OBAA 2C1FA 1BHGA 2BGCA 2E53A 3WSOA 4XJZA 2JDMA 3JQXA 4OI1A 5A1FA 3OEBA 1VRH3 1QH7A 4ASLA 1FMD3 2YGMA 5DZFA 1NKGA 4FFFA 4PIZA 5HBAA 5KHKA 2FDFA 4OHYA 4XE9A 2WWUA 1PK6B 1XC6A 1SFYA 2B46X 2W95A 1ZNPA 3U1XA 4LA2A 4NIDA 2WFF2 5FIXA 2LRPA 2R30A 4LBQA 1OH4A 3KMHA 3RJ2X 1F5FA 1AR61 5AC92 4N43B 4PDWC 2JWPA 3Q8BA 1UYXA 3KCYA 1AR71 4CU8A 3WINE 5HCFA 4QPWA 3SCFA 1TE1B 2VVEA 1JUHA 4Y20B 5ACA3 2ZHNA 4FFHA 1QNWA 3AFGA 3E1F1 5C3PA 2J1RA 3WNPA 4K1ZA 3WD5A 4AVCA 1CAUB 1VBA3 3AZXA 1CVNA 1W3VA 4Y1XA 1P8JA 1R083 3BVCA 3M3QA 2QQJA 3KHBA 5LZ6A 2XWBB 4D69A 3DN7A 4P02B 4OI2A 5C71A 3MICA 3VBHA 1CGPA 1H9WA 4RGAA 3RVHA 4AEMA 2YHJA 3HVDA 1S2BA 4KGQA 3S30A 1OA3A 1O7FA 5K0UC 1W2TA 2VW2A 1GYKA 3T0AA 4AQ2A 1WZXA 3PTYA 3TEYA 2PFWA 1X82A 1ULDA 5LY2A 1DQ4A 5A1AA 2W52A 5JIUA 2XUEA 3E5QA 1QJZA 4XPVA 1R082 2MNGA 1HXS1 3ILFA 2XJPA 1C28A 4M01A 2MEV1 2RJLA 1GSLA 5HCHA 2WS91 2EXHA 1OC1A 1XYOA 2RMU3 2A1XA 1XYNA 2IWGB 3BTAA 2V4AA 3QLQA 4QDRA 4GMP3 4CDWB 1NLSA 3KS7A 1IS6A 4DRVA 2OZ6A 1R091 2ZX4A 3CMGA 4O65A 4ZZ5A 5EFUA 2D44A 1L3JA 2WFF3 1CQ9A 4FAHA 5KR7A 4Z8BA 3VHOA 3RYPA 3ZXEA 4CDWC 1J3PA 5C5UA 4XUQA 3EMRA 3J7HA 1WKYA 3ZIWA 4BPZA 2FQPA 4Q29A 3BOPA 1VRH2 2YU2A 4LBQD 4AQSA 1L7LA 3MLLA 1WMEA 5JIAA 2A3WA 1CR7A 1SLCA 4IE6A 4JGYB 3U14A 5JMCA 3BI3A 5FBJA 3WR0A 1OA4A 1KITA 3RSJA 2DDUA 3MLKA 1YQ5A 5CKMA 4IEUA 5GLWA 4UYBA 3R0RA 1Q5OA 1I5PA 1QJU1 1QQP3 2WWJA 3N9QA 4L0PA 4TSVA 2PQSA 4XILA 5D8AC 1TEIA 5DABA 3VD4A 2WZ8A 3B93A 4FAGA 3N7MA 4ASMB 4D0QA 4K9SA 5IYYA 1HW5A 2D7FA 2DYCA 2J1UA 3GM8A 3MGUA 5DAVA 1XE8A 2BNNA 5JAXA 3PMEA 5K8SA 4Q8LA 1UOFA 1RUF2 2B9UA 4GA9A 4KBBA 2J7MA 2VZ1A 4Y5TA 3DL3A 1U5YA 1W8ZA 3MF9A 3MO4A 1UXXX 3UL2A 2GMPA 4PBPA 3W21A 3L2HA 4RQPA 4OZXA 1ZBA3 1BBT1 4UBHA 1RUC2 2XHKA 3CJIB 1EV12 1GR3A 4IGPA 5JSOA 2QBXA 4KG8A 3R4SA 4NRQA 4LBQB 1WWYA 4CEWC 2ADDA 4AFAA 4CP9B 2JIGA 5HXMA 2PHTA 4AI0A 2RDSA 3O12A 3VKLA 4XAAA 5I0UA 4HSJA 5GKAC 2W94A 3DCQA 1NZIA 1S0CA 2VZQA 2WRAA 2YFZA 3LDKA 4NVPA 2D6KA 3ZXJA 1H1MA 1PNGA 5IVBA 1XB9A 4PDWA 5AFEA 1IPKA 1NT0A 4JTNA 3I3MA 1C1LA 2LALA 1UXZA 5IWFA 1ULGA 2VW0A 2WS93 4CP0A 1FI2A 4AFDA 2Y6LA 2HWF3 4I02A 1QQP1 1TME2 4GAZA 1K5MA 2HWE3 1H8TC 1ENXA 3WX5A 4MHRA 4IV1C 5A3PA 4KMQA 2C6SA 2HEYF 2XVKA 3A0KA 4QXCA 3WZ1A 4D6SA 4BDVB 5FYUA 3WF2A 4LT5A 4UW5A 2IXLA 4N53A 4XOGA 1CJPA 1XRUA 2O8QA 5FLIA 2P17A 2A3YA 2GMMA 4NHYA 2VMHA 5A6QA 3B02A 4GB33 3RMYA 4BCUA 4QB2A 1FOD2 2OYZA 1R1A2 2GNMA 2UWBA 1O5UA 5DUVA 5A6YA 3LEMA 2DU0A 1PO23 3B3QE 4FT8A 4XCBA 1LOBA 1WCUA 3LWCA 4S2DA 3ZYHA 4YW3A 4DUWA 4YG0A 5F3IA 4D94A 1OUXA 3ZR6A 1KGYA 3AZZA 1R093 4LO7A 5G04L 2H6CA 1BKZA 1SLBA 5KXDA 5H9RA 3RMXA 3VDDB 3ZSLA 4JRLA 2WLPA 3TOJA 2HWC2 1MPXA 1SBDA 1RMU2 3KB5A 1D7PM 4EWEA 1R1ZA 1ONAA 1D0HA 3J26N 3AP5A 3SEEA 2GALA 3ZSMA 5FZGA 4OQ9A 4IEPA 4OHVA 2BWCA 3M70A 4XUOA 4BZ4A 1D4M3 3FFZA 4FBFA 1QJY1 2G9GA 3K4ZA 3Q9OA 4AEJA 4CEWA 1DZTA 4MGSA 3VL9A 1QMJA 5DZEA 3PUQA 5FYZA 2R043 1OF3A 4YGBA 5LATA 3KGZA 5BNPB 2X8KA 1OSGA 3S0MA 5F8PA 1O8PA 1S2KA 2Z79A 4YG3A 2R49A 1W8FA 3PVOA 5C8CB 4LUKA 2L9LA 1ZZ7A 2MPFA 1F2NA 1O5LA 2NP0A 2IVIB 4LQRA 4N90A 4A6SA 1AJOA 1R081 4UFLA 3DECA 2Y6HA 5LBCA 1UO9A 2GP3A 4DUVA 5ABJB 2D3SA 3BGAA 1I3HA 3WNMA 2NMNA 4M3CB 4F8AA 3LEIA 5AVAA 3BB6A 3JD72 3I2DA 1COV2 4NPLA 2P3JA 2HJIA 2GC1A 4YZ2A 1VMFA 3JBG3 1O59A 1VMJA 4IETA 2XL9A 5L9VA 1H8TA 2JDHA 3RZHA 4QU2A 4WM7C 1ZRDA 1H4GA 3PUIA 3ZYRA 5FY5A 4O9GA 2W1QA 3N36A 4LK7A 4E8CA 1CWPA 2XBO2 2PAKA 1F35A 5GLVA 2XJVA 4EN0A 3HBZA 1SFNA 1ZREA 1ZZ9A 1ZZ8A 3I97A 2OX0A 2I74A 5I0TA 3S6PA 2VUJA 4COVA 3VBSA 4M3CE 3AKPA 2ZGPA 2JDPA 2R063 4XFIA 2WFF1 3WW4A 3H1WA 2XUMA 3OGGA 2CDOA 4JGZC 4NAMA 3ZM8A 4ZU7A 1OLME 2XVGA 1JYNA 1OURA 2CYFA 2JE8A 3K4AA 3J4UH 1XNCA 1KEXA 3K3NA 1YIFA 4DEVA 1AYM2 1VR3A 4Z82A 2OUJA 1WD4A 2R062 4GULA 3VBRC 1OOPA 1NCRB 2BERA 4LBLA 2RM21 5C3SA 1UOJA 1CX1A 3PL0A 4XTMA 5FY0A 1VRBA 2P3YA 4LJHA 4G9SB 1O4ZA 4C1WA 2IXJA 2ZZQA 4PJYA 4OHZA 3X29B 2XBO3 4QX3A 3I7DA 5E89A 3I4IA 2VD7A 2GMEA 1NY72 1XOYA 1BEV1 4SLIA 3OUIA 4M3CF 3NV4A 1EV11 3NNJA 4GWNA 5KWRA 2VMCA 2EXIA 3I8TA 4Q4W3 3J7MA 3JD73 4UF0B 2RV9A 1F5JA 4YZ4A 3EHKA 1HN1A 3ZMNA 2C0ZA 1I5ZA 2ZGQA 3EB7A 1WA4A 5CNAA 1UY0A 3KZ4C 1HV1A 4XHXA 3HJRA 3KSCA 1B35C 1W03A 3RS6A 5JI7A 2OVUA 4QXBA 4URTA 5A80A 3WP4A 2JEMA 2VTXJ 5DN2A 2A6XA 5DG1A 1JYXA 2QDRA 3F95A 1VAMA 1YNAA 3NWKA 1UU6A 3WQ0A 3A22A 2PHWA 1W06A 3WW2A 2XJUA 2VU9A 4AHYA 3IDCB 3UETA 3MDPA 2HWB2 4N9HA 4H14A 4W8JA 1DGWX 3ZOIA 1DP0A 4NIHA 2BWAA 2Y34A 3R4DB 2EIDA 2R073 1UCXA 2D6LX 3RPQA 2QQUA 5FO8B 2W08A 4JQTA 1J3QA 3BUCA 4HANA 4QQ2A 2H0VA 1HKDA 2ET1A 4CCCA 1DYPA 2VMEA 1HV0A 4YVWB 1FATA 2QQKA 2QZ2A 4R4XA 5C8CA 4OULA 2ZX1A 1ULOA 3EXUA 4FXKB 1AXYA 1CAWB 2UURA 4FPGA 5H9PA 3DPRB 4OUSA 4C0BA 2A5ZA 5FY1A 4D8MA 1QJU3 2R1BA 4AR2A 2UU8A 3EO6A 3HPNA 1GU3A 2IC1A 2VQAA 1FPN2 1ZRRA 1R1A3 1OKQA 1O3TA 3MIGA 3JUUA 4BXFA 1W2UA 5FJKA 1XSRA 2XQRA 1DYKA 2Y0IA 3AX4A 1QJX3 4LITA 1QJEA 4S2GA 2WUHA 3GDBA 2Y6GA 4DY3A 1O4TA 2IFRA 4K1YA 2A70A 3FUOA 2VVFA 1DLCA 1W6PA 1JZ2A 1XNBA 1UY1A 1YUDA 3I3QA 4JDMA 3ZSJA 2VCCA 5ACA1 2ID4A 3LKJA 3KF3A 1JI6A 1NOVA 2JE9A 2YB7A 3PVEA 4DEQA 1VAKA 5CFDA 5GZEA 2HWF2 1KS5A 5IK5A 5FUPA 2WS92 3BCWA 1CONA 4QPYA 5F2SA 4AVAA 5DMYA 2RS11 4XJAA 1CPNA 1MS9A 5FZ3A 5JLVA 3KV5A 5A3MA 1W2OA 4OI4A 4RA0A 4FOQA 1RUOA 3A0NA 4XF1A 1C8M1 3OOXA 1J84A 2DCZA 2ZGKA 1QGLA 2PHFA 3PJQA 4LNVA 4WVMA 1U5IA 3H8RA 3UGHA 3TAYA 4RSUA 1ZBA1 4CU9A 2VZPA 2P3KA 5A33A 5BNOC 5KXEA 1CAWA 1MZEA 2B7YA 1ZBE1 1MQTA 1ND2A 5J09A 3HEIA 2FMDA 1AL21 3ACGA 4Q26A 5A7NA 3ZSEA 5C7GA 4Q5OA 1AUYA 1JODA 2QE3A 2TBVA 4Q4Y3 1LOAA 1EV13 1W9WA 5FREA 2HBTA 5A1LA 2E6VA 4N7IA 4QB1A 3V65A 2ZX0A 4Q4W1 3O1SA 1TMF1 1X8EA 1YLLA 3PIJA 4DO0A 4S2FA 5GZCA 1F15A 4QPGB 1VB4A 2WQ8A 1IQDC 4ARYA 3GALA 3S5AA 1HB3A 2QQLA 4N43A 3VL8A 1H1AA 3FHIB 2UWCA 4GJYA 5K4LA 4AI3A 4AEKA 2ZA9A 2DVBA 2RS32 4NUBA 2A6WA 4BQWA 4NWVA 4CDXB 1GWLA 3RI8A 3KVAA 1QF3A 1YFUA 3BN6A 3I54A 3ACFA 3MW2A 2ARCA 3N3HA 2ZGRA 3I2JA 1JYCA 5FZOB 4L9BA 3CLPA 4EROA 1U5XA 4LUMA 4W65A 4XEZA 4KG0A 3ATGA 5FJHA 1CESA 2UYBA 4FVVA 1D0GA 4IV1A 1YC61 1LOEA 4LKFA 2WBKA 2WAAA 1NAEA 4HKOA 4HXCA 2WABA 3GCXA 3J7LA 1GKBA 1SZBA 3ST7A 2NLRA 3AP4A 1OPMA 1QKQA 3H1MA 2Z69A 2W1UA 4UFMA 5LBFA 1FV2A 1DGWA 2EIGA 2FDGA 2WNVB 1XNAA 4D7TA 2XXZA 2WA4A 3OPTA 2PAMA 1BZWA 3RWKX 3NAPB 3T2TA 5FY9A 5KHJA 3MPPG 4EJRA 2YY1A 4HETA 4A45A 1OPOA 3FMGA 1RL3A 3JXSA 5A7WA 1AYN2 4CU6A 1IKQA 1WBLA 2MHFA 1A34A 3WCRA 4UW4A 1MR5A 1LRHA 1XBFA 3H7YA 1UYPA 3TN91 5EV7A 1POV3 2QKDA 3FLRA 1IKPA 1TNFA 4PCRA 5CFDB 4COYA 2YBKA 3LB9A 3K48A 3RZKA 3NMBA 1LHNA 4TN7A 1ULFA 1F31A 3RGBA 4BQYA 1JZ7A 4QDSA 1EAH1 1WCSA 1C5HA 2Y8KA 4LMFA 4N7UA 1KJRA 1DG6A 5G05L 1KRIA 3KHCA 5LY1A 4B4PA 2PLV3 5C8CC 1GOGA 2VMGA 4L11A 1FYUA 2ZMKA 2YBSA 3K4DA 1AL0G 3CL1A 3ZYGA 3RYKA 3UT0A 4O7XA 5ABJC 5DAQA 1HRV1 3R6SA 3ZSKA 5JOXA 1OMIA 5ACA2 2Y26A 4AAXA 4BYYA 3H0OA 1US3A 5FXZA 1I1EA 3AZVA 1EYBA 4M3CA 5AC93 1QNYA 3CF6E 2Q1MA 2QQVA 5DDJ3 3LE0A 3AFKA 1W8TA 1E5IA 3B00A 5AFBA 1PVC2 1W28A 2RDQA 5D21A 1R64A 2W92A 4WVZA 2DUOA 3WEZA 1QXRA 4B1LA 3VD3A 4JRAA 1O3SA 2Q1FA 3IBMA 4P9WA 4DNYA 4K3UA 3FL7A 2JKBA 3I49A 1BEV3 1C4RA 4MYEA 2R0FA 3OGRA 4A42A 3AYCA 4XUTA 4XETA 1RVF2 1CZTA 4PLMA 3AJYA 3C7GA 3PNAA 4KNCA 3OGVA 3B69A 4XFCA 2AUYA 2P2KA 1ASJ2 3B9CA 5CFCA 3DXTA 4QGNA 5A7SA 4FP2A 4C8DA 4XIOA 5FLJA 4FOVA 4BA6A 1VE0A 1LECA 3D0SA 2V5DA 4YW7A 3VDDA 4D7SA 5E1RA 4B8EA 1Y9GA 4CCOA 2K0GA 1MS5A 2WO2A 1PO11 3CZJA 4CYDA 4OQ8A 5IVYA 3KVBA 2JB8A 2AZ5A 1NZCA 4GKYA 4I2OA 3ROUA 2SLIA 4LPLA 3VBRA 2QDNA 3VKOA 3H3ZA 2CWMA 4KQ7A 1RUH3 4D7YA 5A32A 3POBA 2A71A 3U10A 2Q8CA 1BMV1 1POQA 4NR1A 1JYIA 2B8MA 4XABA 2G9ZA 1IPJA 4M00A 4OUEA 5LRSA 2Y6KA 2E7AA 2D3PA 1C8M3 3N7JA 4AFCA 4YRDA 5LBEA 4TZDA 3BIEA 3H1YA 4GALA 4KWKA 4XDPA 2G4IA 3Q8FA 1YFYA 3RZJA 3I2HA 2WLQA 3A23A 2VOKA 4HN1A 4YW6A 3QH6A 3IM0A 4IW3A 5CVRA 2BGPA 4AG4A 5KHGA 3ZXAC 1W2NA 3OBRA 5DAXA 2BGOA 5A7QA 1BBT3 2F17A 1YXWA 3ZYJB 2XLFA 4AVSA 5C3OA 4GWMA 1VMHA 1QOOA 1EPWA 3IWZA 1Y43B 1HLCA 3IZOA 1FAYA 1EUTA 3UGGA 1CZVA 4KU8A 2X53S 3VZNA 2WYFA 1RB8G 3R05A 4KI5M 4BLIA 3T0DA 1Q8OA 1UOGA 3EYPA 5FKCA 2B4KA 4XF3A 1R1A1 2Q1ZB 4ZU5A 1WMXA 2J42A 2RM23 3MW3A 4CDQA 4RGGA 1VP6A 4AHZA 5CADA 2J1VA 4XDQA 4XQ4A 3ZDVA 4DQAA 1CJDA 5FWEA 5K0UA 2W9XA 4QX8A 5IVEA 3Q8CA 1PK6C 1D4VB 1IGOA 3LA3A 3MFAA 5FZCA 2Q8EA 3ZN6B 4ZS3A 2HWF1 3RZMA 4DFSA 3H9AA 4URAA 3U4SA 2DUQA 2QNKA 1VBB1 4RHV3 4C0HA 1RUI2 3SISA 3OBTA 1H4HA 5J48A 4M0HA 5ABJA 5FPXA 2VCAA 1Q3EA 3J8F3 5FZ6A 3ZXKA 5LA0A 3MZHA 3BTZA 4GH4B 4L2NA 4YZ5A 4BISA 5AC91 1NX9A 1AR62 3WDTA 1JH5A 3R4UA 4DINB 3ZDSA 2AENA 3KWVA 3ZKUA 3LOBA 4KH9A 1PMIA 4Q1PA 2XPJA 3I3BA 1QJY2 1AX2A 3N9MA 4WVMB 2RR11 1VBB3 3IDBB 5A7WB 3RRDA 3T08A 1W6NA 5EJZB 5M0TA 2P37A 5JXIA 1W0OA 1LULA 5L9BA 4CXYA 2WDBA 4QKDA 2HEWF 2CNAA 1UZVA 4PIXA 5I93A 3SEPA 1ULEA 2W3JA 2XG3A 3O0VA 3ZX7A 1PGL1 2VUCA 3W59A 4NJ4A 4HFSA 1RC6A 4FXGB 2E9QA 4P9YA 2J1EA 4B7EA 4F83A 1XJAA 3N9OA 2EA7A 2HWE1 3MEPA 1Z7S2 2JDYA 2ERFA 2DCTA 1Y7BA 1WMFA 2B42B 2AH2A 1OQEA 1WUVA 3ELNA 3IDEA 5KXBA 1H1IA 4CDWA 3DV8A 1HRV2 3CJIC 1W8OA 4Q27A 3T1MA 3TNPB 4IV1B 1X36A 4XIKA 4KWLA 2TUNA 1DU3D 4BJ0A 4JC1A 5JI9A 4MGYE 3APBA 4P9JA 2X5IA 5FUNA 2JD9A 1UX6A 1HJGA 1AR93 1OFSA 1ZZ6A 2F4LA 2XBO1 3SKJE 3VLBB 2W2IA 3CDZB 3LIGA 1GZTA 4L92A 4FPKA 2VGDA 5FPUA 5JZGB 2DFCA 4OHXA 1SLAA 1YFWA 4TXWA 2W87A 3POIA 2W1WA 2BNOA 4GJZA 2RS53 1PZ8A 4YM2A 2RS12 3HBKA 5FP9A 4W6WA 1H9PA 3MFCA 1SACA 5FYVA 4IGOA 3VGIA 5A3TA 1SQ4A 1V6IA 1J58A 4OMCA 2WNUB 2ZKNA 1TNRA 5T5JA 5D2AA 5J96B 4LHNA 3I2KA 5LRRA 3JB4C 3RG0A 2ARXA 2OQ7A 4HK9A 1ZBE2 1POV1 2R6QA 1JOBA 4AEDA 4H2AA 3JCIA 4QXHA 2EVXA 4YM3A 3CJXA 4MADA 4QPIA 5FZFA 5EJ1B 4PLOA 4BQ4A 2FBEA 3O5SA 4CCMA 2A75A 4XQWA 1RGSA 1NXD1 1LEDA 2BDRA 4WM8C 1K42A 1S0FA 1GP5A 3IB3A 1VBC2 2LM3A 2FZ1A 3TNQA 1QU0A 3LA7A 2JICA 5CG8A 4RQPB 3GBWA 4HOOA 3WP3A 4PLNA 1WMDA 2XJQA 3ILRA 1HQWA 4ZY9A 2ZX2A 4P14A 4R52A 4CA9A 2VOWA 2RS52 3MIEA 4CDUA 1JBCA 5FMCA 1NLQA 2GDFA 1JZ3A 3HMYA 2OPWA 2QQOA 4RQPC 5FPVA 4V1PA 1W6PB 4M4RA 4QGMA 5FZHA 5F7UA 4HT1T 4HVOA 3VN4A 2WO7A 3V0BB 1XXNA 2X29A 2R041 1RUD2 3BALA 5A3UA 1SBEA 1H30A 4NE9A 3ZLIA 5FKBA 3PTRB 4B3NA 4WM8A 5E8AA 4KWUA 1AR92 1XNKA 1YJLA 5FMBA 4BQ5A 2A7AA 3E6BA 2QVSB 4NIAA 5CKQA 4CUAA 1W8NA 4E4DX 1AXZA 4A7ZA 4XJWA 4CCKA 3W5MA 4XW3A 4XFHA 1RUE3 3NNFA 2RE9A 1UW8A 1V6MA 2XJTA 5DG2A 1JMUB 5FY8A 1HQLA 3V0AB 1SG3A 2KA3A 4AW7A 4WM8B 2AEZA 4UFIA 5FPLA 3JBG1 3ZPOA 3OY8B 5J37A 3O1PA 2ZJCA 4UAPA 3VHPA 2WZR1 2VMDA 3AKRA 1UL9A 4YVWA 2C4XA 4TLGA 4M0NA 4AWDA 2ZTNA 1PZ9A 1KDMA 2ZEYA 4IEOA 1QDCA 4FTBA 4FSJA 4RN5A 3E6DA 4QQHA 5FYMA 4AFMA 5FO7B 3O1UA 4LE3A 1UKRA 2P6CA 4CCEA 4E4SA 1AL23 4K8FA 4CVUA 2CAUA 2W1SA 1QJY3 3KQRA 1HB1A 3WDUA 1DQ6A 4GWIA 2HH9A 2PA7A 4IL7A 4DUXA 3ZVXA 1K3IA 5FRAA 4HVQA 1PNFA 4NHLA 5DAPA 3N7KA 4YM1A 4PIYA 3KD4A 1RXFA 3RYRA 4EE2A 4LA3A 3VBOA 2J22A 1RITA 5T54A 3BU7A 3I3EA 4B1MA 5C70A 2ORZA 4JGZB 5C3RA 5J3UA 1LOFC 1BQPA 2D3RA 1AJKA
chains in the Genus database with same CATH topology
2YC4A 1SDDB 3HNYM 3VDCA 4UOJA 2VMEA 2VTFA 2QQKA 3VD7A 1L7QA 1UY3A 3LEGA 1ULOA 4ZXEA 3VD5A 1J83A 2XQXA 4D8MA 4XVHA 1UX7A 4XURA 2JKXA 5FUIA 2WZEA 3HPNA 1GU3A 1F4AA 5JR2A 2VQUA 3GGLA 3WNKA 5I0DA 5JMOA 3C8XA 3WF1A 2JDAA 1PMHX 2WUHA 1DYOA 2Y6GA 3GDBA 4W50A 4DXTA 1PX4A 3UESA 4HG6B 1DLCA 2VM9A 1JZ2A 3DYMA 1UY1A 1UY2A 2VCCA 1GQPA 2ID4A 2Y6JA 1L7RA 1LNSA 2YFUA 1JI6A 1XPWA 2YB7A 4DEQA 1XNTA 5EIYB 3PUHA 3WF0A 4A41A 2E26A 3T2OA 3MUZ1 2VZRA 3WNOA 4JKKA 4Z2AA 1J84A 3FHQA 1UWWA 2RVAA 3IAQA 3HNBM 5B4XA 4CU9A 2VZPA 4TTGA 3FHAA 3I2FA 3HEIA 3OB8A 1K45A 4JHZA 3F2ZA 3ACGA 5C7GA 2ORXA 4QX0A 3T0BA 1RYYA 1W9WA 3VDBA 3W5NA 4PQQA 4BK5A 3MUY1 3LEKA 4LKSA 4QB1A 1F4HA 2ZEWA 1H6YA 1TVGA 3THCA 1YQ2A 4DXSA 2HLEA 2WQ8A 1IQDC 4ARYA 2WAOA 3LQCA 3VDAA 2QQLA 3T2QA 2WN2A 2Y64A 3U37A 4ARXA 1JZ4A 1JZ8A 2QQMA 3BN6A 2E31A 3ACFA 5DPNA 3WNNA 3I2JA 3LPGA 1OF4A 2EIBA 5B4NA 2CDPA 3VD9A 4BXSV 2KD7A 2WBKA 2WAAA 1NAEA 2C9KA 3T09A 2WABA 3MV01 2VZTA 1O8SA 1PX3A 2J1AA 1UY4A 2W1UA 4M4PA 3CQOA 4P08A 1XNAA 4QX1A 3GXUA 4XUNA 5LCWL 5IFPA 1W0NA 2VOTA 4A45A 3JXSA 4FI9A 1UMIA 4GZ9A 2WO1A 4CU6A 4XZUG 3P1IA 2DCKA 2WO3A 5JUVA 2YG0A 2VZSA 2VL4A 3C7HA 3NNGA 5LA2A 3NQHA 3OBAA 1GOFA 1BHGA 4MOAA 2E33A 1JZ7A 4QDSA 3WSOA 2Y8KA 5G05L 3OEBA 3CKHA 3WF3A 5IFTA 1JU4A 1NKGA 1GOGA 2X10A 2V72A 2VC9A 1XC6A 3K4DA 2W95A 3OGSA 3NRUA 1OH4A 5IJRA 2VCBA 4AAXA 1UYXA 1US3A 2LW8A 4CU8A 4QPWA 4P00B 3NJVA 3E1F1 4PF1A 3A21A 2J1RA 3LE0A 3WNPA 2XOMA 1R64A 2BZDA 2DCJA 1P8JA 2W92A 2QQJA 3WEZA 1UYZA 2RJ2A 4P02B 5C71A 3VD3A 2ZEZA 3FL7A 3OGRA 3T0AA 4A42A 4XUTA 1CZTA 3C7GA 2B9VA 3OGVA 2E32A 5A1AA 1JYWA 3C7OA 3FN9A 2X05A 2V5DA 2WO2A 3CZJA 3IAPA 1JZ6A 4QDRA 1W9TA 2X09A 4LPLA 2J1TA 3CMGA 4W4ZA 4ZZ5A 3C7FA 3ABZA 4YPJA 3DYPA 2ZXQA 4OUEA 4XUQA 3J7HA 1WKYA 2Y6KA 3D3AA 4ZZ8A 3HOBA 1US2A 2VZOA 2WN3A 3I2IA 3HN3A 2W47A 2DDUA 4E8DA 3I2HA 3A23A 3K75B 2VMFA 1I5PA 4AG4A 2BGPA 1UYYA 4L0PA 2PQSA 3VD4A 2WZ8A 5JXJA 2BGOA 2VZUA 4D0QA 1JHJA 5IYYA 2J1UA 3GM8A 2VZ3A 2QQIA 1EUTA 2EIEA 1CZVA 2EICA 4KI5M 3P6BA 3T0DA 2J7MA 2VZ1A 2VJXA 3EYPA 3MO4A 4XUPA 2B4KA 1GMMA 3K46A 1UXXX 2W46A 1W9SA 3I3DA 2J1VA 2QBXA 3A7QA 2W9XA 1UZ0A 5HXMA 1W99A 3CZUA 3THDA 5LA1A 2W94A 4CU7A 2VZQA 2YFZA 3ECQA 4LHSA 2VCAA 2VZVA 5LA0A 3ACIA 1OT5A 1UXZA 1NX9A 2YC2A 2Y6LA 1JYVA 2J1SA 2ZEXA 3I3BA 3K77A 4KMQA 4OMDA 3T08A 2BBAA 5EJZB 2XONA 4BDVB 5JXIA 3WF2A 2WDBA 4CUBA 5F7UA 3SEPA 2W3JA 4MGQA 2LS6A 2J1EA 5HPOA 2VO5A 3I2GA 4QB2A 1PMJX 1CZSA 1W8OA 1WCQA 4DUWA 1JZ5A 1KGYA 4BJ0A 5G04L 2WYSA 4QB6A 4MO3M 4GWJA 5DMYA 1TG7A 2JD9A 4OZOA 3SKJE 1MPXA 3MBWA 3CDZB 1D7PM 1OD3A 4A3ZA 4BK4A 3WF4A 3SEEA 1K12A 2Z4FA 4TXWA 4XUOA 2C26A 2W87A 2VQTA 4P5YA 4JKLA 2W1WA 3K4ZA 4JX0A 4MGSA 4OYUA 2HYXA 3C7EA 1OF3A 4A4AA 4OMCA 3UNPA 1O8PA 3DYOA 2L9LA 4LQRA 3I2KA 4DUVA 3DECA 2Y6HA 3CIHA 4QDQA 3BGAA 4ET7A 3WNMA 1JU3A 3LEIA 1CIYA 3WNLA 1NUKA 4A44A 4MADA 4RYDA 5EJ1B 1O59A 4QAWA 3OG2A 1K42A 3PUIA 5JXHA 3IB3A 2R7EB 5CZKA 1EUUA 2W1QA 4E8CA 2VR4A 5IHRA 3HNMA 4ZY9A 3I97A 5CYYA 2OKXA 1GUIA 1JZ3A 5JXGA 3ZM8A 2QQOA 2CDOA 4M4RA 4A6OA 4CUCA 1JYNA 3LPFA 2JE8A 3K4AA 1KEXA 1SHWB 4DEVA 4DXRA 4KWUA 5DQ0A 3ETPA 4CUAA 2BERA 1W8NA 4PT6A 4QX2A 3W5MA 1CX1A 4IUGA 3T2PA 3WQBA 3OEAA 4QX3A 2V4VA 1SG3A 1T2XA 1UMHA 1H6XA 3IIIA 4UAPA 2VMDA 5J1XA 3NJXA 2C4XA 2VMCA 3ACHA 2RV9A 2ZEYA 1GOHA 2W91A 1HN1A 4RN5A 4UI9L 4JKMA 3EB7A 1ULPA 1UY0A 3IDAA 3AC0A 3HJRA 4CVUA 2W1SA 2W5FA 4GWIA 5DN2A 1JYXA 4DUXA 1K3IA 3A22A 3SKVA 3MV11 2QQNA 3UETA 2J22A 4W8JA 3I3EA 5C70A 2ORZA 1DP0A 2XHNA 1GNYA 2EIDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YC4 A;  1SDD B;  3HNY M;  3VDC A;  4UOJ A;  2VME A;  2VTF A;  2QQK A;  3VD7 A;  1L7Q A;  1UY3 A;  3LEG A;  1ULO A;  4ZXE A;  3VD5 A;  1J83 A;  2XQX A;  4D8M A;  4XVH A;  1UX7 A;  4XUR A;  2JKX A;  5FUI A;  2WZE A;  3HPN A;  1GU3 A;  1F4A A;  5JR2 A;  2VQU A;  3GGL A;  3WNK A;  5I0D A;  5JMO A;  3C8X A;  3WF1 A;  2JDA A;  1PMH X;  2WUH A;  1DYO A;  2Y6G A;  3GDB A;  4W50 A;  4DXT A;  1PX4 A;  3UES A;  4HG6 B;  1DLC A;  2VM9 A;  1JZ2 A;  3DYM A;  1UY1 A;  1UY2 A;  2VCC A;  1GQP A;  2ID4 A;  2Y6J A;  1L7R A;  1LNS A;  2YFU A;  1JI6 A;  1XPW A;  2YB7 A;  4DEQ A;  1XNT A;  5EIY B;  3PUH A;  3WF0 A;  4A41 A;  2E26 A;  3T2O A;  3MUZ 1;  2VZR A;  3WNO A;  4JKK A;  4Z2A A;  1J84 A;  3FHQ A;  1UWW A;  2RVA A;  3IAQ A;  3HNB M;  5B4X A;  4CU9 A;  2VZP A;  4TTG A;  3FHA A;  3I2F A;  3HEI A;  3OB8 A;  1K45 A;  4JHZ A;  3F2Z A;  3ACG A;  5C7G A;  2ORX A;  4QX0 A;  3T0B A;  1RYY A;  1W9W A;  3VDB A;  3W5N A;  4PQQ A;  4BK5 A;  3MUY 1;  3LEK A;  4LKS A;  4QB1 A;  1F4H A;  2ZEW A;  1H6Y A;  1TVG A;  3THC A;  1YQ2 A;  4DXS A;  2HLE A;  2WQ8 A;  1IQD C;  4ARY A;  2WAO A;  3LQC A;  3VDA A;  2QQL A;  3T2Q A;  2WN2 A;  2Y64 A;  3U37 A;  4ARX A;  1JZ4 A;  1JZ8 A;  2QQM A;  3BN6 A;  2E31 A;  3ACF A;  5DPN A;  3WNN A;  3I2J A;  3LPG A;  1OF4 A;  2EIB A;  5B4N A;  2CDP A;  3VD9 A;  4BXS V;  2KD7 A;  2WBK A;  2WAA A;  1NAE A;  2C9K A;  3T09 A;  2WAB A;  3MV0 1;  2VZT A;  1O8S A;  1PX3 A;  2J1A A;  1UY4 A;  2W1U A;  4M4P A;  3CQO A;  4P08 A;  1XNA A;  4QX1 A;  3GXU A;  4XUN A;  5LCW L;  5IFP A;  1W0N A;  2VOT A;  4A45 A;  3JXS A;  4FI9 A;  1UMI A;  4GZ9 A;  2WO1 A;  4CU6 A;  4XZU G;  3P1I A;  2DCK A;  2WO3 A;  5JUV A;  2YG0 A;  2VZS A;  2VL4 A;  3C7H A;  3NNG A;  5LA2 A;  3NQH A;  3OBA A;  1GOF A;  1BHG A;  4MOA A;  2E33 A;  1JZ7 A;  4QDS A;  3WSO A;  2Y8K A;  5G05 L;  3OEB A;  3CKH A;  3WF3 A;  5IFT A;  1JU4 A;  1NKG A;  1GOG A;  2X10 A;  2V72 A;  2VC9 A;  1XC6 A;  3K4D A;  2W95 A;  3OGS A;  3NRU A;  1OH4 A;  5IJR A;  2VCB A;  4AAX A;  1UYX A;  1US3 A;  2LW8 A;  4CU8 A;  4QPW A;  4P00 B;  3NJV A;  3E1F 1;  4PF1 A;  3A21 A;  2J1R A;  3LE0 A;  3WNP A;  2XOM A;  1R64 A;  2BZD A;  2DCJ A;  1P8J A;  2W92 A;  2QQJ A;  3WEZ A;  1UYZ A;  2RJ2 A;  4P02 B;  5C71 A;  3VD3 A;  2ZEZ A;  3FL7 A;  3OGR A;  3T0A A;  4A42 A;  4XUT A;  1CZT A;  3C7G A;  2B9V A;  3OGV A;  2E32 A;  5A1A A;  1JYW A;  3C7O A;  3FN9 A;  2X05 A;  2V5D A;  2WO2 A;  3CZJ A;  3IAP A;  1JZ6 A;  4QDR A;  1W9T A;  2X09 A;  4LPL A;  2J1T A;  3CMG A;  4W4Z A;  4ZZ5 A;  3C7F A;  3ABZ A;  4YPJ A;  3DYP A;  2ZXQ A;  4OUE A;  4XUQ A;  3J7H A;  1WKY A;  2Y6K A;  3D3A A;  4ZZ8 A;  3HOB A;  1US2 A;  2VZO A;  2WN3 A;  3I2I A;  3HN3 A;  2W47 A;  2DDU A;  4E8D A;  3I2H A;  3A23 A;  3K75 B;  2VMF A;  1I5P A;  4AG4 A;  2BGP A;  1UYY A;  4L0P A;  2PQS A;  3VD4 A;  2WZ8 A;  5JXJ A;  2BGO A;  2VZU A;  4D0Q A;  1JHJ A;  5IYY A;  2J1U A;  3GM8 A;  2VZ3 A;  2QQI A;  1EUT A;  2EIE A;  1CZV A;  2EIC A;  4KI5 M;  3P6B A;  3T0D A;  2J7M A;  2VZ1 A;  2VJX A;  3EYP A;  3MO4 A;  4XUP A;  2B4K A;  1GMM A;  3K46 A;  1UXX X;  2W46 A;  1W9S A;  3I3D A;  2J1V A;  2QBX A;  3A7Q A;  2W9X A;  1UZ0 A;  5HXM A;  1W99 A;  3CZU A;  3THD A;  5LA1 A;  2W94 A;  4CU7 A;  2VZQ A;  2YFZ A;  3ECQ A;  4LHS A;  2VCA A;  2VZV A;  5LA0 A;  3ACI A;  1OT5 A;  1UXZ A;  1NX9 A;  2YC2 A;  2Y6L A;  1JYV A;  2J1S A;  2ZEX A;  3I3B A;  3K77 A;  4KMQ A;  4OMD A;  3T08 A;  2BBA A;  5EJZ B;  2XON A;  4BDV B;  5JXI A;  3WF2 A;  2WDB A;  4CUB A;  5F7U A;  3SEP A;  2W3J A;  4MGQ A;  2LS6 A;  2J1E A;  5HPO A;  2VO5 A;  3I2G A;  4QB2 A;  1PMJ X;  1CZS A;  1W8O A;  1WCQ A;  4DUW A;  1JZ5 A;  1KGY A;  4BJ0 A;  5G04 L;  2WYS A;  4QB6 A;  4MO3 M;  4GWJ A;  5DMY A;  1TG7 A;  2JD9 A;  4OZO A;  3SKJ E;  1MPX A;  3MBW A;  3CDZ B;  1D7P M;  1OD3 A;  4A3Z A;  4BK4 A;  3WF4 A;  3SEE A;  1K12 A;  2Z4F A;  4TXW A;  4XUO A;  2C26 A;  2W87 A;  2VQT A;  4P5Y A;  4JKL A;  2W1W A;  3K4Z A;  4JX0 A;  4MGS A;  4OYU A;  2HYX A;  3C7E A;  1OF3 A;  4A4A A;  4OMC A;  3UNP A;  1O8P A;  3DYO A;  2L9L A;  4LQR A;  3I2K A;  4DUV A;  3DEC A;  2Y6H A;  3CIH A;  4QDQ A;  3BGA A;  4ET7 A;  3WNM A;  1JU3 A;  3LEI A;  1CIY A;  3WNL A;  1NUK A;  4A44 A;  4MAD A;  4RYD A;  5EJ1 B;  1O59 A;  4QAW A;  3OG2 A;  1K42 A;  3PUI A;  5JXH A;  3IB3 A;  2R7E B;  5CZK A;  1EUU A;  2W1Q A;  4E8C A;  2VR4 A;  5IHR A;  3HNM A;  4ZY9 A;  3I97 A;  5CYY A;  2OKX A;  1GUI A;  1JZ3 A;  5JXG A;  3ZM8 A;  2QQO A;  2CDO A;  4M4R A;  4A6O A;  4CUC A;  1JYN A;  3LPF A;  2JE8 A;  3K4A A;  1KEX A;  1SHW B;  4DEV A;  4DXR A;  4KWU A;  5DQ0 A;  3ETP A;  4CUA A;  2BER A;  1W8N A;  4PT6 A;  4QX2 A;  3W5M A;  1CX1 A;  4IUG A;  3T2P A;  3WQB A;  3OEA A;  4QX3 A;  2V4V A;  1SG3 A;  1T2X A;  1UMH A;  1H6X A;  3III A;  4UAP A;  2VMD A;  5J1X A;  3NJX A;  2C4X A;  2VMC A;  3ACH A;  2RV9 A;  2ZEY A;  1GOH A;  2W91 A;  1HN1 A;  4RN5 A;  4UI9 L;  4JKM A;  3EB7 A;  1ULP A;  1UY0 A;  3IDA A;  3AC0 A;  3HJR A;  4CVU A;  2W1S A;  2W5F A;  4GWI A;  5DN2 A;  1JYX A;  4DUX A;  1K3I A;  3A22 A;  3SKV A;  3MV1 1;  2QQN A;  3UET A;  2J22 A;  4W8J A;  3I3E A;  5C70 A;  2ORZ A;  1DP0 A;  2XHN A;  1GNY A;  2EID A; 
#chains in the Genus database with same CATH topology
 4BQ3 A;  4D6R A;  4AOC A;  3VDC A;  4UF0 A;  4UOJ A;  1XE0 A;  4U2A A;  1N1S A;  4UBG A;  3W9A A;  4Q0U A;  4Q8K A;  1LTE A;  1XE7 A;  4AVB A;  1LKN A;  2MEV 3;  4JAA A;  1CAU A;  1HXS 2;  1QXJ A;  4XXP A;  3QD6 A;  4ZXE A;  1V6N A;  1PGL 2;  4CPB A;  4Q4X 2;  5BNQ A;  5K7P A;  1WLC A;  2WKK A;  4EN6 B;  1J1T A;  1APN A;  3D8C A;  4J1W A;  3VBU B;  3HT1 A;  4RS5 C;  1J83 A;  2XQX A;  2Y33 A;  4WM7 A;  3WG1 A;  3MHZ A;  4QD2 A;  5F3C A;  2VAU A;  3NV1 A;  5BV6 A;  4MX3 A;  4XJ9 A;  1UX7 A;  4Y4Y A;  1V9U 1;  1Z7S 1;  2JKX A;  4RS5 A;  4NN0 A;  5JR7 B;  2Q0A A;  1LOG A;  1N3O A;  4A7K A;  2GU9 A;  3RWN A;  5JR2 A;  2SBA A;  3PHM A;  2E51 A;  3FC0 A;  1BLZ A;  3SC7 X;  2VQU A;  1EAH 2;  1UZW A;  2DUR A;  2K2S A;  5F39 A;  5JZG A;  1S4C A;  3VZJ A;  2GNB A;  2JEC A;  3PVB B;  5I0D A;  2ZGM A;  1WCK A;  1ZRI A;  1JOJ A;  1RHI 2;  4XDO A;  2IUW A;  2JDA A;  4DOU A;  1W6O A;  2VPV A;  1NXM A;  1QEX A;  5CG9 A;  1BBT 2;  4I01 A;  4W50 A;  1KS4 A;  1LHW A;  5EWS A;  3UES A;  2JDK A;  3H8O A;  3S57 A;  2VM9 A;  3AMP A;  3DYM A;  2OS2 A;  3AXD A;  3H3L A;  3WW3 A;  4J6G A;  1DFQ A;  4FCA A;  3H50 A;  1GQP A;  3SNM A;  1D2S A;  5F2W A;  1L7R A;  5FPB A;  1XPW A;  1HDK A;  1N1T A;  1XNT A;  1DCS A;  1W90 A;  3DUI A;  3VKM A;  4F3J A;  3FJS A;  3CBN A;  3KCC A;  2A6Z A;  1LHV A;  4DY5 A;  1V6O A;  5APA A;  1S0D A;  2CU5 A;  3MUZ 1;  5I8S A;  4Z2A A;  1H0B A;  4RS5 B;  1N3Q A;  2RVA A;  2ZZJ A;  4FO9 A;  4RR3 A;  2WNO A;  4YVW C;  1AZD A;  3EJK A;  4Q1R A;  5IK4 A;  4DPN A;  2JG8 C;  1Q8Q A;  3OB8 A;  3LSE A;  1K45 A;  2ZAH A;  4N43 C;  4PDW B;  4Q0Q A;  1AR9 1;  1SCR A;  1HIX A;  2LRO A;  3AP6 A;  4H3W A;  4JTO A;  2ZGO A;  2JG8 A;  4E9K A;  3VDB A;  1EP0 A;  5BNN C;  4BK5 A;  3O1O A;  3J8F 1;  1G9F A;  3LEK A;  3MUY 1;  4R9D A;  1LR5 A;  1ASJ 3;  1H6Y A;  5FYY A;  4IV3 A;  2BJS A;  3J9S A;  2VVD A;  1VBD 3;  3MW4 A;  5A3W A;  5TSW A;  1IPS A;  2ZCW A;  3VBS C;  1GP6 A;  4GQ7 A;  1YEW A;  3LCP A;  1T6G C;  4L8Q A;  5A3L A;  2RJK A;  4CSW A;  2HWD 1;  1LEN A;  5K0U B;  1ODM A;  4WVW A;  3D4K A;  1LGB A;  4L99 A;  2DU1 A;  1VBE 1;  1DIW A;  1OF4 A;  2A73 B;  2EIB A;  5B4N A;  3KLS A;  2LTN A;  1QWR A;  2LUW A;  2QTW B;  1X7N A;  1LEM A;  1YQC A;  3OSD A;  5DDJ 2;  4Z92 B;  3Q8E A;  4BXS V;  5IK8 A;  1XQN A;  1NA1 C;  4FOY A;  1DQ2 A;  3HN1 A;  4YW4 A;  3RZZ A;  4EN9 B;  3ZYI B;  1OUS A;  3T4V A;  2JG8 B;  2O14 A;  2PTM A;  3MV0 1;  2VZT A;  4ZXK A;  5IAT A;  1QJF A;  1O8S A;  3OY8 A;  2RMU 1;  2WT1 A;  4RFR B;  3TN9 2;  5A3N A;  4NHX A;  1UY4 A;  2AAC A;  1KJL A;  3UKT A;  1UOB A;  2R07 1;  4P08 A;  3WDW A;  3POW A;  4P9I A;  4NWW A;  1PVC 1;  3WDY A;  4GD4 A;  4AVT A;  4FFG A;  1MS3 A;  2YC0 A;  2VOX A;  4AI8 A;  4PQ9 A;  5EPA A;  1ND3 A;  1X9P A;  4LOT A;  4YYO A;  2D5H A;  3B9I A;  1OLQ A;  1CAX B;  3ZO0 B;  2BV4 A;  2BOI A;  1O4Y A;  1YHF A;  2XKO A;  3BOW A;  4AFB A;  5HV0 A;  2GZW A;  1MEC 3;  4UXA A;  1GZW A;  4R9A A;  4XAC A;  2YG0 A;  2VNO A;  2VZS A;  4BHP A;  3USU A;  3WW1 A;  3LGR A;  3VZO A;  5C4W B;  4TLF A;  2VL4 A;  5F32 A;  2GH8 A;  3NNG A;  1UPI A;  3UV9 A;  2QFE A;  2WWS A;  1LHO A;  1PO2 1;  1UD1 A;  3E5U A;  4FPE A;  1RJ7 A;  1QH6 A;  3O1R A;  1S2E A;  4XBQ A;  1VBC 1;  4FPF A;  3QOP A;  4Y5Z 0;  1IS4 A;  2E33 A;  3ASI A;  1NA1 B;  1UMZ A;  2Q4S A;  1VBD 2;  3JZV A;  5JDB A;  2JDZ A;  2EAL A;  3BPS A;  2WIN B;  3WF3 A;  3UJQ A;  3ZXD A;  5IFT A;  1OI6 A;  1SMV A;  4QWN A;  2V72 A;  4LO5 B;  3U78 A;  4XMI A;  4NO4 A;  1WLW A;  3O1M A;  4LBN A;  3H8X A;  2D98 A;  2RG4 A;  3BPZ A;  2DBI A;  4MG2 A;  5IJR A;  2QQW A;  4YGC A;  1ND2 C;  4X6Q B;  3D82 A;  1PM7 A;  1OLR A;  1RUG 1;  1NE4 A;  1Q43 A;  2E7Q A;  2LW8 A;  1GWK A;  3NNM A;  4YG6 A;  3WDX A;  1OD5 A;  3KM5 A;  2DUP A;  2OXB A;  3WLU A;  3B7M A;  4QKF A;  4ES8 A;  4EWA A;  3SH4 A;  5BNN A;  5I91 A;  1MQT C;  1MZ6 A;  2E7T A;  5FZE A;  2DCJ A;  3ZYB A;  3AP9 A;  4AAP A;  1QDO A;  3S7I A;  2XKP A;  1QY4 A;  4MH0 E;  4QM8 A;  2RS3 3;  2D6P A;  4QXK A;  2Q8D A;  1PM4 A;  3POF A;  1UU4 A;  3VKN A;  4JGZ A;  1UIJ A;  1FNZ A;  1NYW A;  4JHT A;  4YZ3 A;  1HX6 A;  3ZFE B;  1SCS A;  4XMA A;  2E63 A;  4WZC A;  4HKL A;  2YV8 A;  3KV9 A;  4BOW A;  4EZH A;  5A3O A;  3OPZ A;  3SCH A;  3ALQ A;  5D8A A;  1VIW B;  4OI0 A;  1F8V A;  2X05 A;  4Q4Y 2;  1RIR A;  5CFC C;  1E57 A;  1NA1 A;  5J7M A;  1W8U A;  4RGK A;  2VEC A;  3IAP A;  2GND A;  3WQ7 A;  2RDR A;  2XJS A;  5EJ3 A;  5FMO L;  1EAH 3;  4CPB D;  1JZ6 A;  2VNG A;  4BH9 A;  2DVD A;  1TMF 3;  1NQJ A;  2X09 A;  5LBB A;  4ZON A;  2J1T A;  2VMI A;  2V5Y A;  2ZKL A;  5F1R A;  4W4Z A;  2EF6 A;  3C7F A;  1SPP B;  1UPS A;  3HAG A;  4YPJ A;  3DYP A;  2Z42 A;  5T50 A;  1IHM A;  1IG3 A;  4EN7 B;  1GZW B;  3P3P A;  4DRR A;  3VBF C;  4BME A;  3OGJ A;  2VXR A;  1MS8 A;  2KR2 A;  5KHI A;  1D4M 1;  4LBK A;  3D3A A;  4R8H A;  4ZZ8 A;  2MEV 2;  1US2 A;  5FYC A;  4QPI C;  2VZO A;  4ATF A;  4NRO A;  2WN3 A;  4Q4V 1;  2W47 A;  4IV3 C;  4Q2F A;  2CGN A;  2OZJ A;  2PYT A;  4C91 A;  1E5H A;  1X50 A;  3EBR A;  3FLT A;  4AHX A;  4IE0 A;  5FK7 A;  1H2N A;  3OUJ A;  4GIQ A;  3ITQ A;  5H9Q A;  4XF9 A;  2VCM A;  2VMF A;  3G6J B;  5KXC A;  2NM1 A;  5E6H A;  4QMA A;  3ZXL A;  3WY6 A;  2GAU A;  3NW4 A;  1O3R A;  1NCQ C;  2WFP A;  2VZU A;  1OLM A;  4R9B A;  3VBH B;  4ZKT B;  4H7M A;  2AYH A;  1WW6 A;  2VZ3 A;  2I2S A;  3LDB A;  2VXJ A;  4YWA A;  3THP A;  1LGC A;  2EIC A;  1QJX 1;  4DXS A;  2GNT A;  3RDI A;  3DGT A;  1FPN 3;  1PO1 3;  3P6B A;  1I9R A;  1AYN 1;  1XYP A;  4DB5 A;  2VOV A;  1SEF A;  3VBO C;  2VBP A;  5FXX A;  1GMM A;  1QIQ A;  3K46 A;  3WUC A;  2WQZ C;  3JQW A;  1M06 G;  5CU1 A;  3ZN6 A;  1QJU 2;  2ZAA A;  4SBV A;  3TBD A;  1PZ7 A;  3NJZ A;  1W9S A;  4UFK A;  1WW7 A;  1GQH A;  1OH3 A;  3A7Q A;  3I3D A;  5F5C A;  4LHL A;  1IS3 A;  4KBZ A;  2JG9 B;  4IER A;  5FK8 A;  4YFW A;  4QPI B;  4UFH A;  4EN8 B;  3UKN A;  2R0H A;  2OPK A;  5ANN A;  3CZU A;  4LBO A;  1BYH A;  3LFM A;  1G9C A;  4IV3 B;  5SV8 A;  1WW4 A;  3THD A;  1QOS A;  3VZL A;  4QHO A;  4DMI A;  4CU7 A;  2FDH A;  3PVN A;  5T55 A;  4LHS A;  3DXU A;  1VBA 1;  2VBB A;  3ACL A;  2HWB 3;  2P5B A;  2DTW A;  3D0J A;  3UGF A;  3GZA A;  4XQD A;  1OT5 A;  3AKS A;  2JX9 A;  2YC2 A;  2BVB A;  1RUD 3;  5L36 A;  2J1S A;  1AR8 2;  2RHP A;  3HR9 A;  3KT1 A;  5D1I A;  5T5O A;  1PGS A;  3K77 A;  1N1V A;  4COZ A;  1BJQ A;  5A33 B;  5CEH A;  2BBA A;  2Q30 A;  2BTV C;  4AGV A;  4FPH A;  3VUO A;  4FOW A;  2N7G A;  4EZ4 A;  1J59 A;  1NCR A;  4CUB A;  2TNF A;  2WQ4 A;  1B35 B;  1C3H A;  3IMM A;  3LFI A;  2VUD A;  4Q4W 2;  3W58 A;  2AGS A;  4COW A;  4MGQ A;  1RUF 1;  5BNO A;  1UU5 A;  2QQP A;  1NCR C;  3FWE A;  4IEY A;  4L97 A;  4XZP A;  4YW5 A;  5FYH A;  1HRI 2;  2O8O A;  1ENR A;  3HIF A;  3SHR A;  4CEY A;  5HPO A;  2VO5 A;  2XWJ B;  1C1F A;  2ZAC A;  2JG9 C;  5FBZ A;  3KCX A;  4LO8 A;  2HBU A;  2YPJ A;  5FR3 A;  3E5X A;  3NJY A;  3TB0 A;  2XL7 A;  5KC6 A;  2ETE A;  3BTY A;  3JD7 1;  2ES3 A;  4KWJ A;  1DLL A;  4QHB A;  4P9X A;  4MGT A;  1JZ5 A;  3ENR A;  4AI9 A;  2C9A A;  5JCT A;  2GP5 A;  2GC3 A;  2H0B A;  4FPY A;  4JGY C;  4E2Q A;  5C3Q A;  1S55 A;  2EAA A;  5F5A A;  1Q8V A;  4MO3 M;  3T30 A;  2DWR A;  2PHU A;  5FZ7 A;  5IT6 A;  1TG7 A;  1W2A X;  2NQY A;  4NRM A;  1IQA A;  4QU1 A;  4P9G A;  4OZO A;  3VB9 A;  4DZG A;  3MBW A;  4HZF A;  1OD3 A;  2GSY A;  1UZY A;  4OLL A;  4A3Z A;  1LAJ A;  4BK4 A;  1K12 A;  2Z4F A;  5F6L B;  5LK5 A;  4FPO B;  1DBN A;  2DVG A;  2C24 A;  3ES1 A;  4LUL A;  2C26 A;  4AQT A;  4TWT A;  4B4R A;  2VQT A;  4P5Y A;  3VBU A;  4LBM A;  3ZN4 A;  1Y3T A;  2ARB A;  4FPC A;  3H42 B;  4HPK B;  4XFA A;  5FZK A;  4E4Z A;  4OYU A;  2HYX A;  1RHI 3;  1GQG A;  1UKG A;  3C7E A;  3PLQ A;  4CDU C;  1QXP A;  3D5O A;  4A4A A;  1C57 A;  3UNP A;  1G9D A;  5GZD A;  1AYM 1;  3ON7 A;  3WCS A;  3DYO A;  3E97 A;  2G1M A;  2VBD A;  3OF1 A;  2FDI A;  2YZ4 A;  5BXX A;  5A6X A;  3OTF A;  3H8U A;  2GC2 A;  3CIH A;  4O61 A;  4QDQ A;  5LEK A;  5JZG C;  3JBG 2;  3FFQ A;  1WA6 X;  1RUG 3;  4HPK A;  5K9Y A;  2ARE A;  2RS5 1;  1JU3 A;  3WNL A;  1CIY A;  4AI1 A;  4H55 A;  4OFG A;  2CGP A;  1HRV 3;  1B09 A;  1LOD A;  1YIP A;  4RYD A;  4B7K A;  1AX1 A;  1MVQ A;  5FZA A;  3M3I A;  4DXZ A;  5CIS A;  4QAW A;  1HXS 3;  3T3Y A;  5T52 A;  2WJS A;  3DPR C;  1IZ3 A;  3VHN A;  3KQ4 B;  3O0W A;  2R7E B;  2HKX A;  2JJ6 A;  1Y9M A;  2IXH A;  3NKG A;  5CZK A;  1EUU A;  4MVT A;  3IKW A;  3J7N A;  3WG2 A;  4XTP A;  2UY9 A;  5I8T A;  1A3K A;  1PK6 A;  3SXW A;  3WXP A;  4X6R B;  5IHR A;  1OQD A;  2ZHK A;  2CTV A;  3GCW A;  5E16 A;  3AMN A;  4Q0P A;  2OKX A;  2FDK A;  2HWD 2;  1A78 A;  4JV4 A;  2OW4 A;  1KXG A;  3TWI A;  3AVS A;  1J3R A;  4N53 C;  4CUC A;  4KGG A;  3WVJ A;  4Y5S A;  3ME2 A;  2IXC A;  4IEX A;  5L7O C;  5HCA A;  1H8V A;  1NY7 1;  5LA9 A;  5CB7 A;  4V2V A;  3USU B;  1SHW B;  1RMU 3;  4UT5 A;  2QZ3 A;  1OA2 A;  1AR6 3;  4R9C A;  1AL2 2;  1MS4 A;  2HWD 3;  1K5M C;  2VUL A;  1VLN A;  3J8F 2;  1LB2 A;  2X5I C;  4QX2 A;  3NAP A;  2K46 A;  4AE2 A;  1CAX A;  2Y6F A;  3BU0 A;  1YCI A;  5T3N A;  3T2P A;  1ND3 B;  3WQB A;  3OEA A;  2KM2 A;  1T2X A;  1UMH A;  1H6X A;  2PLV 1;  3LDR A;  2Y60 A;  3III A;  4I3P A;  5FYB A;  3GHN A;  5FTT C;  4Q4X 1;  4COU A;  1FOD 3;  2WT0 A;  1GIC A;  3AKT A;  4YW1 A;  4DIQ A;  5HV4 A;  2ZGL A;  5J98 B;  5J1X A;  2CSG A;  4IGQ A;  3ACH A;  3VDD C;  1SBF A;  1RUE 2;  3ZFG C;  5C9A C;  1GOH A;  2R32 A;  3ZFF C;  4UI9 L;  3O1V A;  4JKM A;  1RUG 2;  4HK8 A;  2PXJ A;  3AVR A;  3IDA A;  3Q8A A;  5FP4 A;  4V2W A;  4OHW A;  3QAC A;  2W5F A;  2D6O X;  3ZFG B;  5C9A B;  1ZVF A;  2HWE 2;  1JHN A;  2BQP A;  2WL1 A;  1GP4 A;  4XBL A;  2PHX A;  5GM0 A;  3MV1 1;  1XU1 A;  2QQN A;  1GAN A;  4G4F A;  3LA2 A;  5T5P A;  4AED B;  5BNP C;  1X9T A;  3DEM A;  3MI8 A;  2XHN A;  5HXV A;  3HD8 B;  3RFR A;  1LES A;  3GF6 A;  3UYJ A;  2UWA A;  1VB2 A;  5C6C A;  2HWC 1;  1W9Y A;  5JWP A;  1DHK B;  5CA6 A;  1SDD B;  2WNU A;  3T4H B;  4NIG A;  1S0G A;  1VBC 3;  3G7D A;  5BY5 A;  3VD7 A;  4CXW A;  2WT2 A;  3LEG A;  4LBJ A;  3HWJ A;  4A7Y A;  3VD5 A;  4IEQ A;  5FP7 A;  1Q56 A;  4IEZ A;  3VBF A;  2D6N A;  2ZX3 A;  2WZP P;  4YLZ A;  4BQ2 A;  3V0A A;  5EQU A;  5FP8 A;  3UKV A;  2QUO A;  5J36 A;  1VAV A;  3SQO A;  3ZFF B;  2PAE A;  1FNY A;  4K7J A;  5FUI A;  4IQP A;  2WZE A;  3AYD A;  4RR3 B;  5F6K A;  3ILN A;  3MYX A;  4K6B A;  2WNV C;  4PBO A;  1RUF 3;  3OPW A;  2W39 A;  5F5I A;  1HRI 3;  1WCD J;  2V09 A;  3GGL A;  1BVV A;  2CY6 A;  3NO8 A;  1LHU A;  2ZAB A;  4BB3 A;  3WF1 A;  5IVF A;  3HQX A;  4XBN A;  5JOZ A;  4IE7 A;  2FD8 A;  1PX4 A;  4LEJ A;  4XAE A;  5FOJ B;  2Y6J A;  1BXH A;  4LOS A;  4WBB A;  2BBV A;  4ORF A;  3AZY A;  1HB4 A;  2XVL A;  5FZD A;  1AR8 3;  1ODN A;  1V6J A;  1DZR A;  3VBR B;  5F3E A;  1XND A;  1GWM A;  4TYS A;  3UK9 A;  1RTV A;  1UNB A;  4LLO A;  5FXV A;  4ONU A;  3A4U A;  4YVS C;  5F37 A;  1HJF A;  4A41 A;  4CDQ C;  2ET7 A;  4X8N A;  5IUQ A;  4EQV A;  3VHR A;  2BP6 A;  1UAI A;  5IW0 A;  1WW5 A;  4A2U A;  2VZR A;  3WNO A;  1QHD A;  2DV9 A;  2FZ2 A;  1NQD A;  1V0A A;  4YVS B;  3N9L A;  5I8Y A;  1ZZC A;  2VG9 A;  3IAQ A;  3ZFE A;  1LOC A;  5FXW A;  2O1Q A;  5JSR A;  5FZB A;  1CD3 G;  2Q5T A;  3GZE A;  1Z7S 3;  4RR3 C;  5JOY A;  1SLI A;  1KQR A;  2RS3 1;  4MXV A;  2RMU 2;  3I2F A;  4B4Q A;  4BWO A;  1Q8S A;  4GH4 A;  1WD3 A;  5JVV A;  4JHZ A;  4NHK A;  3F2Z A;  4IXL A;  3ZN5 A;  2ORX A;  2YRO A;  4QX0 A;  2XH6 A;  3OD0 A;  3CEW A;  1ASJ 1;  1V70 A;  3AP7 A;  4JDO A;  4PQQ A;  4LKS A;  4UW3 A;  2ADE A;  2P1B A;  3B01 A;  1GFF 2;  1F4H A;  2ZEW A;  3POJ A;  4GMP 1;  4XYX A;  5DDJ 1;  1TVG A;  1BK1 A;  1RUN A;  2AR6 A;  3THC A;  1LCL A;  3ZKY A;  2OA2 A;  1VBB 2;  4Y1V A;  1OBN A;  1PO1 2;  2HLE A;  4LLF A;  3VKF C;  3WDV A;  2WAO A;  1ZRC A;  3AYE A;  3VDA A;  5BYN A;  5FQ0 A;  3MIH A;  1URX A;  1RXG A;  2BNM A;  3BIW E;  2PHL A;  4PI2 A;  3N7L A;  3U37 A;  4ARX A;  2OQ6 A;  3RZG A;  4LKD A;  3O14 A;  5HI0 A;  2K9Z A;  4CDQ B;  2YDE A;  5DPN A;  5FZI A;  3WG3 A;  3M3E A;  1BMV 2;  2JXA A;  3LPG A;  1D2Q A;  1U0A A;  3MIB A;  4YAR A;  2FMY A;  1W04 A;  3PUS A;  1RUI 3;  2ZBJ A;  1RMU 1;  1COV 1;  1LOF A;  1YI7 A;  2KD7 A;  5FZ4 A;  2DFB A;  2C9K A;  5LAS A;  1G86 A;  5C4W A;  3K2O A;  4XJ8 A;  3M2M A;  4NOT A;  4WV8 A;  1PX3 A;  3LIH A;  3AK0 A;  3HQR A;  2J1A A;  1M4W A;  3MLJ A;  3POS A;  1KD7 A;  4LIU A;  3ZYF A;  3LZZ A;  3M8L A;  1W05 A;  4M4P A;  5FY4 A;  2GN3 A;  5KBF A;  4QX1 A;  5FV3 A;  3GXU A;  4XUN A;  4NMI A;  3U4X A;  2R16 A;  1C5I A;  2DF7 A;  3AXE A;  5LCW L;  1DDL A;  1W0N A;  3W20 A;  1W6Q B;  2DBN A;  1TMF 2;  1W6M B;  5IAX A;  5ISL A;  1KFX L;  4CZS A;  2QJV A;  4I0A A;  5EXO A;  2VOT A;  2PMW B;  1VBD 1;  5GZG A;  4FI9 A;  1X33 A;  3P5B A;  2WO1 A;  2B45 X;  1ZA7 A;  4UWD A;  1F9K A;  4MLO A;  1ST8 A;  2DCK A;  2WO3 A;  4AVV A;  3TEZ A;  1RED A;  5A32 B;  2A6Y A;  5JUV A;  1JYT A;  1YFX A;  3RZL A;  3AL6 A;  4MXW A;  2Z2S B;  1V9U 2;  2AEY A;  4LO4 B;  4NII A;  3KGL A;  3C7H A;  1YQ8 A;  3VBS B;  3OJB A;  1N3P A;  5LA2 A;  4E2S A;  4PHZ A;  5GJ6 A;  3AYA A;  5C33 A;  1G9A A;  4A3X A;  4IE4 A;  3WHT A;  1GOF A;  4MOA A;  4Y22 A;  4CDU B;  1U12 A;  3OUH A;  1K5J A;  1VAL A;  1VPH A;  5FYI A;  3ZXF A;  1PVX A;  1G7Y A;  3CKH A;  4RD7 A;  1JU4 A;  5DAW A;  4E2G A;  4FTS A;  1VBE 3;  4LE4 A;  1FT9 A;  2X10 A;  2Q8O A;  5EYY A;  2VC9 A;  1JW6 A;  5I0R A;  5FZO A;  3MF6 A;  1ULC A;  3OGS A;  4I3G A;  4KL1 A;  3SIT A;  3NRU A;  4HVR A;  1PIV 3;  3AL5 A;  2VCB A;  1GZ9 A;  2WSV A;  2XR4 A;  1CIW A;  5A7P A;  2D40 A;  5HCB A;  3U75 A;  3O1T A;  5FQ0 B;  4CTE A;  4P00 B;  1YQ6 A;  2D43 A;  3NJV A;  4FPJ A;  4Q0S A;  5L9R A;  5C8W A;  5L73 A;  4PF1 A;  3A21 A;  3WOG A;  4AGG A;  4QKN A;  2XOM A;  3KT7 A;  3PMS A;  1ZRF A;  3V64 A;  4LK6 A;  2BZD A;  1JN2 P;  4Q4Y 1;  4Y4R A;  3AJZ A;  1UYZ A;  5BNP A;  2RJ2 A;  4AK3 A;  3GZT B;  4WVV A;  1OVS A;  1RVF 3;  2ZEZ A;  2XGX A;  4WZF A;  5BNN B;  3SH5 A;  4Y20 A;  1ND2 B;  1KFU L;  1BEV 2;  1ZM1 A;  5DZG A;  4EWD A;  1JXN A;  2GN7 A;  3I59 A;  2B9V A;  5JPM B;  2E32 A;  1JYW A;  2ARA A;  4MUV A;  3AM2 A;  4HSL A;  2VNR A;  3IT8 A;  4YVS A;  3BKZ A;  1MEC 2;  1SFP A;  3HT2 A;  5FDB A;  3C7O A;  1PVC 3;  3FN9 A;  1QJX 2;  2VH9 A;  2A3X A;  2YYO A;  2VE1 A;  2X5I B;  5JSP A;  1O3Q A;  1UZZ A;  1FXZ A;  2F6B A;  1W9T A;  1PGW 2;  3GBG A;  2QCS B;  4CE8 A;  3U07 A;  1RVF 1;  3ABZ A;  5FPA A;  2FCU A;  2HWB 1;  3NAP C;  4JCK A;  1EPZ A;  1Y4W A;  2ZXQ A;  4GB3 1;  4RHV 1;  4CCD A;  1RUI 1;  3OYW A;  3TN9 3;  5A7O A;  2PLV 2;  1CAV A;  2WNU C;  3PUA A;  1FV3 A;  2P4E A;  3HOB A;  2KXL A;  4Y24 A;  2IFW A;  3RJR A;  4LKE A;  4HON A;  2ZGN A;  2BFU L;  1W6M A;  2NMO A;  1XSQ A;  1YWK A;  2BW8 A;  3I2I A;  1GLH A;  3HN3 A;  4FPL A;  4LR4 A;  4YNI A;  3WP5 A;  3I59 B;  2ZHM A;  1GNZ A;  1AR7 3;  2W68 A;  5SV5 A;  2XLG A;  3S7E A;  4E8D A;  1H2M A;  4LOR A;  3GZU C;  3K75 B;  2FCT A;  1GNH A;  2I07 B;  3URF A;  1UYY A;  1W6N B;  2JE7 A;  3GJB A;  4CRQ A;  3LF7 A;  3L9J T;  5DUX A;  5JXJ A;  2YXS A;  2RR1 3;  1W39 A;  2YU1 A;  4K8R B;  1JHJ A;  4LIV A;  3FBY A;  4BIF A;  3SCG A;  1DGR N;  5KHH A;  3ZXG A;  3VBF B;  1AYN 3;  2QQI A;  2EIE A;  3INA A;  1FPN 1;  5I0S A;  4FFI A;  3WT3 A;  3ZFE C;  3QH7 A;  1SLT A;  2BEO A;  5C4W C;  3AMQ A;  3WV6 A;  4YSF A;  2VJX A;  2DVA A;  2XB6 C;  4XUP A;  3TEX A;  2PQQ A;  1U5Z A;  3SH3 A;  1JOP A;  4CP9 A;  2W46 A;  1I6X A;  1IG0 A;  1G6N A;  2XML A;  3O7O A;  5EHD A;  3NV2 A;  2VNV A;  1H8T B;  1UZ0 A;  4LO6 B;  4UFJ A;  1ENQ A;  1ALY A;  4QPG A;  1W99 A;  1Z78 A;  4NPM A;  4Z1V A;  4AYU A;  5LA1 A;  3RI9 A;  3WQ1 A;  1IS5 A;  4YM0 A;  3GJA A;  1LGN A;  3ECQ A;  3IIA A;  5GLU A;  2JDU A;  3TEW A;  2VZV A;  2B39 A;  4XF4 A;  1DQ5 A;  1POV 0;  3ACI A;  2O0O A;  4MGZ E;  1MVE A;  1MQT B;  4XFF A;  2A6V A;  5BPX A;  2OII A;  4E27 A;  5B2G B;  4YZ1 A;  2ZHL A;  1JYV A;  2G9F A;  3B5L B;  2I45 A;  2ZEX A;  5FLH A;  2ZGS A;  1E5S A;  4OMD A;  4ZS2 A;  2XON A;  1RUE 1;  3IPV B;  1QOT A;  3FX3 A;  4CXX A;  2IXI A;  1ZYB A;  3PJY A;  3FE5 A;  5F5Q A;  3VBH C;  3N9N A;  1RUJ 3;  4MZU A;  2NPI A;  5FWJ A;  5L7O A;  4QX5 A;  2LS6 A;  2ZGU A;  4IES A;  1PHM A;  1RUC 1;  4K40 A;  2BVV A;  3GHM A;  1W0P A;  2NYY A;  4G3Y C;  4I30 A;  1DQ0 A;  3I2G A;  2PN5 A;  4Z07 A;  3IMN A;  1WGP A;  2CGO A;  4CEY C;  1PMJ X;  4S2H A;  5DUW A;  2CAV A;  2ILM A;  3ORJ A;  3KV6 A;  4Y3O A;  1CZS A;  2NN8 A;  1C8N A;  1WCQ A;  3N9P A;  3CNA A;  2WYS A;  4Q4X 3;  4QB6 A;  2WA3 A;  2JEN A;  4XC9 A;  4GWJ A;  2UYA A;  2FHR A;  2D5F A;  4HKW A;  2JB4 A;  4W6X A;  1ZA4 A;  4K21 A;  4PI0 A;  3WF4 A;  4CUG A;  4CCJ A;  2C5D A;  1DF0 A;  2EXK A;  2OUH A;  3N35 A;  3ZFF A;  2R04 2;  1ENS A;  1YI9 A;  3KF5 A;  1ACC A;  4XFG A;  4JKL A;  4AGR A;  4QGL A;  4ZHN A;  4JX0 A;  4W6Y A;  4ZU4 A;  4C1X A;  1UN1 A;  4WM7 B;  5FOB B;  1D4M 2;  3THT A;  1N1Y A;  5FAX A;  5FZ1 A;  1BK0 A;  3FUQ A;  2VQ0 A;  3C3V A;  5C5T A;  2R1D A;  5DXD A;  2VUA A;  4MGI E;  5FZ8 A;  4XHB A;  4ZPI A;  1GBG A;  4Q4V 2;  4Y33 A;  3POY A;  4IDZ A;  1AX0 A;  1OVP A;  4D3W A;  5FZ0 A;  2DTY A;  4ET7 A;  2IXK A;  3D6E A;  3C2U A;  4YFZ A;  4IND A;  3E6C C;  3CHX A;  1NUK A;  4A44 A;  4BU2 A;  1X8M A;  1CPM A;  3MID A;  5FMO S;  3VBO B;  1T6B X;  2PHD A;  3OG2 A;  1YJK A;  4Q0V A;  1PO2 2;  1RUD 1;  5JXH A;  1FMD 1;  2ATF A;  2G19 A;  3L2Y A;  4Q4V 3;  4AHW A;  4GB3 2;  2VR4 A;  5FYS A;  4I0W B;  3JB8 A;  5FZ9 A;  4OVE A;  2R07 2;  5DUU A;  3VZK A;  3HNM A;  4GH4 C;  1NG0 A;  5IK7 A;  1VRH 1;  1V00 A;  1S0E A;  2ZOE B;  3QBQ A;  5CYY A;  3TYJ A;  4DS0 A;  4Y22 B;  3WNX A;  1A8M A;  1GUI A;  2GC0 A;  4D6Q A;  5CAZ A;  4LXL A;  5BUV A;  5JPN B;  5JXG A;  1BCX A;  3TRS B;  4A6O A;  5LW9 A;  1E5R A;  3O0X A;  3LPF A;  5FFO C;  3LOI A;  1TME 3;  1GV9 A;  3LSD A;  1STM A;  1XU2 A;  2XDV A;  3WHU A;  4AQ6 A;  2JIJ A;  3M3O A;  2ZML A;  4OUM A;  1BVP 1;  1MAC A;  1V6L A;  2V73 A;  4JZR A;  4DXR A;  5FCC A;  5FMD A;  5DQ0 A;  2FCV A;  2B5H A;  2BUK A;  3ETP A;  3KT4 A;  3ZPY A;  3H3U A;  2XJR A;  5BNO B;  2WSU A;  4PT6 A;  3PIG A;  1VJ2 A;  1ZX5 A;  1EY2 A;  1B35 A;  3IPV A;  4EYU A;  4IUG A;  5A70 A;  1PIV 1;  1A8D A;  1W6Q A;  5ERL A;  3VZM A;  4MHU A;  4XCA A;  2V4V A;  5GZF A;  4BQX A;  3I2O A;  1AR8 1;  3M4F A;  4ASK A;  3H7J A;  3CU7 A;  1CX4 A;  3AKQ A;  3NJX A;  3V56 A;  3V0B A;  4XJU A;  3PU3 A;  3OD4 A;  2ZMN A;  3HQU A;  4QQP A;  4QPG C;  1UF2 C;  3NVC A;  1LU2 A;  1RUJ 2;  1O91 A;  1RUC 3;  2W91 A;  2W0X A;  1W3X A;  2VTX A;  4NAO A;  4F7Z A;  1YYN A;  1ZBE 3;  1MEC 1;  2P34 A;  1ULP A;  2ZS6 B;  4QX7 A;  4XXA A;  3POG A;  4ITC A;  1H2L A;  2BFU S;  3AC0 A;  4FQ4 A;  5H9S A;  3B94 A;  1HRI 1;  4ES9 A;  1AYM 3;  2YMZ A;  4EV0 A;  3U0Z A;  3BOD A;  4BMB A;  5IAV A;  4JDN A;  2HYK A;  4ISQ A;  4Y1Y A;  3RNS A;  1FOD 1;  2DCY A;  2JDN A;  5D8A B;  4YGE A;  1RHI 1;  2H6B A;  1FX5 A;  4ISR A;  4QHZ A;  5FYT A;  5F9T A;  5JOW A;  3SKV A;  2JG9 A;  4CDX A;  1LU1 A;  3CO2 A;  1MZ5 A;  3SLI A;  2RS1 3;  1LJ7 A;  5IVC A;  3NL1 A;  1RUH 1;  4I0B A;  1GNY A;  3CJI A;  1H2K A;  4Y1Z A;  1QQP 2;  4N9I A;  5CIR A;  3T1L A;  2JD4 A;  2IZW A;  3NV3 A;  2YPD A;  2YC4 A;  4NHM A;  3HNY M;  4BE3 A;  5AVP A;  5CBL A;  3AB0 A;  3WP6 A;  1HN0 A;  1Y9Q A;  4QM9 A;  2VY0 A;  2VTF A;  2XLA A;  2YGL A;  5KC5 A;  1L7Q A;  1UY3 A;  4IEV A;  4JQR A;  3FLP A;  4IEW A;  3OBZ A;  4CEW B;  3ZMO A;  3ETQ A;  1COV 3;  1UIK A;  3ZYP A;  2IVJ A;  5F3G A;  3EQE A;  2EXJ A;  2BPA 2;  1ND3 C;  4XVH A;  4XUR A;  1MS0 A;  1V6K A;  3POE A;  4J25 A;  4PF5 A;  4R4Z A;  4AED C;  1F4A A;  3AZW A;  4OCT A;  1TQ5 A;  5EP9 A;  5FP3 A;  3K3O A;  1JS9 A;  3U11 A;  1S0I A;  1OOP B;  2WR9 A;  1N47 A;  4HL0 A;  4P9L A;  1WBF A;  4Y26 A;  5GAL A;  4Z2W A;  1CAV B;  3WNK A;  2P3I A;  1DGR A;  3C8X A;  2FDJ A;  5JMO A;  1G9B A;  1AXK A;  5FZL A;  1REF A;  2BU9 A;  1AVB A;  3OYW B;  4MSV A;  3BYW A;  3GYD A;  1W9F A;  3M3C A;  1PMH X;  3JU9 A;  1AHS A;  1DYO A;  3AMH A;  4MV2 A;  4U36 A;  3NKT A;  2RR1 2;  4BIO A;  4DXT A;  1OHF A;  4FQZ A;  1DZQ A;  4HG6 B;  1RIN A;  2YUE A;  5LWB A;  1UY2 A;  1NCQ A;  3DKQ A;  1KDK A;  4I09 A;  4HLT A;  1LNS A;  2ZGT A;  1A6C A;  1AR7 2;  1S0B A;  2YFU A;  4O9E A;  1W6O B;  4H7L A;  3WG4 A;  3ES4 A;  4HN0 A;  4XFB A;  3SMH A;  4GKX A;  5EIY B;  2HWC 3;  4LTA A;  4GMP 0;  3PUH A;  3WF0 A;  4HMZ A;  1NE6 A;  1ZZB A;  4N53 B;  3N4M A;  1MS1 A;  2E26 A;  3RQ0 A;  3ZR5 A;  5L7O B;  3T2O A;  2UY8 A;  1R09 2;  5LK7 B;  3DKW A;  4JKK A;  1S0J A;  1VBA 2;  2CHH A;  2VW1 A;  1SDW A;  3NST A;  3FHQ A;  4QT6 A;  4E4H A;  1AF9 A;  2CWS A;  1UWW A;  3IN9 A;  3LD8 A;  4FP3 A;  5B4X A;  3HNB M;  1K5M B;  4RHV 2;  5GLT A;  2BRT A;  1DGL A;  5FO9 B;  4TTG A;  3FHA A;  5IVV A;  4XF0 A;  5EYX A;  4CDX C;  1JUI A;  1UQX A;  4N8M A;  1MZF A;  5FZM A;  1OOP C;  3VV1 A;  1YRZ A;  3DPR A;  4RFT 0;  4BLJ A;  4HBN A;  1J1L A;  1OXC A;  3PUR A;  3PU8 A;  2BYV E;  1REE A;  1RYY A;  3T0B A;  3KV4 A;  2Y0O A;  2Z5W A;  4BM8 A;  3W5N A;  4IE5 A;  5ANQ A;  5GLZ A;  4RL7 A;  4CCL A;  2RM2 2;  1CN1 A;  1FMD 2;  4CCN A;  5CFD C;  1YQ2 A;  4JVA A;  2ENR A;  3DF0 A;  2RDN A;  1YO8 A;  3GNE A;  1O6U A;  3LQC A;  2DVF A;  5CFC B;  2PHR A;  3MPB A;  3QCW A;  1PGW 1;  2YBP A;  3T2Q A;  4CP1 A;  2AC1 A;  5IVJ A;  2D93 A;  2WN2 A;  2WZR 2;  4LHK A;  2Y64 A;  4GXL A;  4QQL A;  1JZ4 A;  1JZ8 A;  2QQM A;  1NLR A;  4ATE A;  2E31 A;  4B29 A;  1TZO A;  2OT7 A;  2EAK A;  4MET A;  3FBM A;  4K20 A;  4QKB A;  2WII B;  1RUJ 1;  3WNN A;  5EZW A;  4FTE A;  1W8W A;  2D97 A;  2CL2 A;  2WNE A;  5LEJ A;  3ZFG A;  5C9A A;  1S1A A;  2ZPX A;  5E88 A;  4P5H A;  2CDP A;  3VD9 A;  3AMM A;  3PDQ A;  5A6Z A;  2P6H A;  3UJO A;  3VBU C;  4AXO A;  4NRP A;  3T09 A;  4C90 A;  1C8M 2;  3GBF A;  3FZ3 A;  2BOJ A;  4MXW B;  2NZ9 A;  1PIV 2;  4UW6 A;  1Z0H A;  3WUD A;  3USS A;  4CEY B;  5FY7 A;  1HB2 A;  1SLL A;  3CQO A;  1ZBA 2;  1GZC A;  2F4P A;  3BTX A;  1VBE 2;  5L19 A;  1RUH 2;  1WLT A;  3OCP A;  4YGD A;  2WC2 A;  5FPZ A;  5IFP A;  1IOA A;  2PEL A;  4BQ1 A;  4JGY A;  4AZZ A;  1OKO A;  4AF9 A;  2Y38 A;  3M7A A;  4YW2 A;  3S5Q A;  4Y1U A;  1UMI A;  4J1X A;  4GZ9 A;  1WLD A;  2WNV A;  4XZU G;  3P1I A;  2GH2 A;  1OQ1 A;  1TME 1;  3K51 A;  1V9U 3;  1DQ1 A;  2TEP A;  1RJ8 A;  1W8H A;  4KU7 A;  1Q8P A;  4QQO A;  4MGK E;  2D6M A;  4AI2 A;  4NPR A;  3NNL A;  5LB6 A;  1SPP A;  3MIF A;  4X8P A;  2HEV F;  2R06 1;  5T5L A;  3LAG A;  3ZIX A;  4CP2 A;  5CKN A;  3M1H A;  2CV6 A;  3P3N A;  4AL9 A;  1NCQ B;  1G8W A;  1OFN A;  1HQN A;  1JTZ X;  2WZR 3;  3NQH A;  3OBA A;  2C1F A;  1BHG A;  2BGC A;  2E53 A;  3WSO A;  4XJZ A;  2JDM A;  3JQX A;  4OI1 A;  5A1F A;  3OEB A;  1VRH 3;  1QH7 A;  4ASL A;  1FMD 3;  2YGM A;  5DZF A;  1NKG A;  4FFF A;  4PIZ A;  5HBA A;  5KHK A;  2FDF A;  4OHY A;  4XE9 A;  2WWU A;  1PK6 B;  1XC6 A;  1SFY A;  2B46 X;  2W95 A;  1ZNP A;  3U1X A;  4LA2 A;  4NID A;  2WFF 2;  5FIX A;  2LRP A;  2R30 A;  4LBQ A;  1OH4 A;  3KMH A;  3RJ2 X;  1F5F A;  1AR6 1;  5AC9 2;  4N43 B;  4PDW C;  2JWP A;  3Q8B A;  1UYX A;  3KCY A;  1AR7 1;  4CU8 A;  3WIN E;  5HCF A;  4QPW A;  3SCF A;  1TE1 B;  2VVE A;  1JUH A;  4Y20 B;  5ACA 3;  2ZHN A;  4FFH A;  1QNW A;  3AFG A;  3E1F 1;  5C3P A;  2J1R A;  3WNP A;  4K1Z A;  3WD5 A;  4AVC A;  1CAU B;  1VBA 3;  3AZX A;  1CVN A;  1W3V A;  4Y1X A;  1P8J A;  1R08 3;  3BVC A;  3M3Q A;  2QQJ A;  3KHB A;  5LZ6 A;  2XWB B;  4D69 A;  3DN7 A;  4P02 B;  4OI2 A;  5C71 A;  3MIC A;  3VBH A;  1CGP A;  1H9W A;  4RGA A;  3RVH A;  4AEM A;  2YHJ A;  3HVD A;  1S2B A;  4KGQ A;  3S30 A;  1OA3 A;  1O7F A;  5K0U C;  1W2T A;  2VW2 A;  1GYK A;  3T0A A;  4AQ2 A;  1WZX A;  3PTY A;  3TEY A;  2PFW A;  1X82 A;  1ULD A;  5LY2 A;  1DQ4 A;  5A1A A;  2W52 A;  5JIU A;  2XUE A;  3E5Q A;  1QJZ A;  4XPV A;  1R08 2;  2MNG A;  1HXS 1;  3ILF A;  2XJP A;  1C28 A;  4M01 A;  2MEV 1;  2RJL A;  1GSL A;  5HCH A;  2WS9 1;  2EXH A;  1OC1 A;  1XYO A;  2RMU 3;  2A1X A;  1XYN A;  2IWG B;  3BTA A;  2V4A A;  3QLQ A;  4QDR A;  4GMP 3;  4CDW B;  1NLS A;  3KS7 A;  1IS6 A;  4DRV A;  2OZ6 A;  1R09 1;  2ZX4 A;  3CMG A;  4O65 A;  4ZZ5 A;  5EFU A;  2D44 A;  1L3J A;  2WFF 3;  1CQ9 A;  4FAH A;  5KR7 A;  4Z8B A;  3VHO A;  3RYP A;  3ZXE A;  4CDW C;  1J3P A;  5C5U A;  4XUQ A;  3EMR A;  3J7H A;  1WKY A;  3ZIW A;  4BPZ A;  2FQP A;  4Q29 A;  3BOP A;  1VRH 2;  2YU2 A;  4LBQ D;  4AQS A;  1L7L A;  3MLL A;  1WME A;  5JIA A;  2A3W A;  1CR7 A;  1SLC A;  4IE6 A;  4JGY B;  3U14 A;  5JMC A;  3BI3 A;  5FBJ A;  3WR0 A;  1OA4 A;  1KIT A;  3RSJ A;  2DDU A;  3MLK A;  1YQ5 A;  5CKM A;  4IEU A;  5GLW A;  4UYB A;  3R0R A;  1Q5O A;  1I5P A;  1QJU 1;  1QQP 3;  2WWJ A;  3N9Q A;  4L0P A;  4TSV A;  2PQS A;  4XIL A;  5D8A C;  1TEI A;  5DAB A;  3VD4 A;  2WZ8 A;  3B93 A;  4FAG A;  3N7M A;  4ASM B;  4D0Q A;  4K9S A;  5IYY A;  1HW5 A;  2D7F A;  2DYC A;  2J1U A;  3GM8 A;  3MGU A;  5DAV A;  1XE8 A;  2BNN A;  5JAX A;  3PME A;  5K8S A;  4Q8L A;  1UOF A;  1RUF 2;  2B9U A;  4GA9 A;  4KBB A;  2J7M A;  2VZ1 A;  4Y5T A;  3DL3 A;  1U5Y A;  1W8Z A;  3MF9 A;  3MO4 A;  1UXX X;  3UL2 A;  2GMP A;  4PBP A;  3W21 A;  3L2H A;  4RQP A;  4OZX A;  1ZBA 3;  1BBT 1;  4UBH A;  1RUC 2;  2XHK A;  3CJI B;  1EV1 2;  1GR3 A;  4IGP A;  5JSO A;  2QBX A;  4KG8 A;  3R4S A;  4NRQ A;  4LBQ B;  1WWY A;  4CEW C;  2ADD A;  4AFA A;  4CP9 B;  2JIG A;  5HXM A;  2PHT A;  4AI0 A;  2RDS A;  3O12 A;  3VKL A;  4XAA A;  5I0U A;  4HSJ A;  5GKA C;  2W94 A;  3DCQ A;  1NZI A;  1S0C A;  2VZQ A;  2WRA A;  2YFZ A;  3LDK A;  4NVP A;  2D6K A;  3ZXJ A;  1H1M A;  1PNG A;  5IVB A;  1XB9 A;  4PDW A;  5AFE A;  1IPK A;  1NT0 A;  4JTN A;  3I3M A;  1C1L A;  2LAL A;  1UXZ A;  5IWF A;  1ULG A;  2VW0 A;  2WS9 3;  4CP0 A;  1FI2 A;  4AFD A;  2Y6L A;  2HWF 3;  4I02 A;  1QQP 1;  1TME 2;  4GAZ A;  1K5M A;  2HWE 3;  1H8T C;  1ENX A;  3WX5 A;  4MHR A;  4IV1 C;  5A3P A;  4KMQ A;  2C6S A;  2HEY F;  2XVK A;  3A0K A;  4QXC A;  3WZ1 A;  4D6S A;  4BDV B;  5FYU A;  3WF2 A;  4LT5 A;  4UW5 A;  2IXL A;  4N53 A;  4XOG A;  1CJP A;  1XRU A;  2O8Q A;  5FLI A;  2P17 A;  2A3Y A;  2GMM A;  4NHY A;  2VMH A;  5A6Q A;  3B02 A;  4GB3 3;  3RMY A;  4BCU A;  4QB2 A;  1FOD 2;  2OYZ A;  1R1A 2;  2GNM A;  2UWB A;  1O5U A;  5DUV A;  5A6Y A;  3LEM A;  2DU0 A;  1PO2 3;  3B3Q E;  4FT8 A;  4XCB A;  1LOB A;  1WCU A;  3LWC A;  4S2D A;  3ZYH A;  4YW3 A;  4DUW A;  4YG0 A;  5F3I A;  4D94 A;  1OUX A;  3ZR6 A;  1KGY A;  3AZZ A;  1R09 3;  4LO7 A;  5G04 L;  2H6C A;  1BKZ A;  1SLB A;  5KXD A;  5H9R A;  3RMX A;  3VDD B;  3ZSL A;  4JRL A;  2WLP A;  3TOJ A;  2HWC 2;  1MPX A;  1SBD A;  1RMU 2;  3KB5 A;  1D7P M;  4EWE A;  1R1Z A;  1ONA A;  1D0H A;  3J26 N;  3AP5 A;  3SEE A;  2GAL A;  3ZSM A;  5FZG A;  4OQ9 A;  4IEP A;  4OHV A;  2BWC A;  3M70 A;  4XUO A;  4BZ4 A;  1D4M 3;  3FFZ A;  4FBF A;  1QJY 1;  2G9G A;  3K4Z A;  3Q9O A;  4AEJ A;  4CEW A;  1DZT A;  4MGS A;  3VL9 A;  1QMJ A;  5DZE A;  3PUQ A;  5FYZ A;  2R04 3;  1OF3 A;  4YGB A;  5LAT A;  3KGZ A;  5BNP B;  2X8K A;  1OSG A;  3S0M A;  5F8P A;  1O8P A;  1S2K A;  2Z79 A;  4YG3 A;  2R49 A;  1W8F A;  3PVO A;  5C8C B;  4LUK A;  2L9L A;  1ZZ7 A;  2MPF A;  1F2N A;  1O5L A;  2NP0 A;  2IVI B;  4LQR A;  4N90 A;  4A6S A;  1AJO A;  1R08 1;  4UFL A;  3DEC A;  2Y6H A;  5LBC A;  1UO9 A;  2GP3 A;  4DUV A;  5ABJ B;  2D3S A;  3BGA A;  1I3H A;  3WNM A;  2NMN A;  4M3C B;  4F8A A;  3LEI A;  5AVA A;  3BB6 A;  3JD7 2;  3I2D A;  1COV 2;  4NPL A;  2P3J A;  2HJI A;  2GC1 A;  4YZ2 A;  1VMF A;  3JBG 3;  1O59 A;  1VMJ A;  4IET A;  2XL9 A;  5L9V A;  1H8T A;  2JDH A;  3RZH A;  4QU2 A;  4WM7 C;  1ZRD A;  1H4G A;  3PUI A;  3ZYR A;  5FY5 A;  4O9G A;  2W1Q A;  3N36 A;  4LK7 A;  4E8C A;  1CWP A;  2XBO 2;  2PAK A;  1F35 A;  5GLV A;  2XJV A;  4EN0 A;  3HBZ A;  1SFN A;  1ZRE A;  1ZZ9 A;  1ZZ8 A;  3I97 A;  2OX0 A;  2I74 A;  5I0T A;  3S6P A;  2VUJ A;  4COV A;  3VBS A;  4M3C E;  3AKP A;  2ZGP A;  2JDP A;  2R06 3;  4XFI A;  2WFF 1;  3WW4 A;  3H1W A;  2XUM A;  3OGG A;  2CDO A;  4JGZ C;  4NAM A;  3ZM8 A;  4ZU7 A;  1OLM E;  2XVG A;  1JYN A;  1OUR A;  2CYF A;  2JE8 A;  3K4A A;  3J4U H;  1XNC A;  1KEX A;  3K3N A;  1YIF A;  4DEV A;  1AYM 2;  1VR3 A;  4Z82 A;  2OUJ A;  1WD4 A;  2R06 2;  4GUL A;  3VBR C;  1OOP A;  1NCR B;  2BER A;  4LBL A;  2RM2 1;  5C3S A;  1UOJ A;  1CX1 A;  3PL0 A;  4XTM A;  5FY0 A;  1VRB A;  2P3Y A;  4LJH A;  4G9S B;  1O4Z A;  4C1W A;  2IXJ A;  2ZZQ A;  4PJY A;  4OHZ A;  3X29 B;  2XBO 3;  4QX3 A;  3I7D A;  5E89 A;  3I4I A;  2VD7 A;  2GME A;  1NY7 2;  1XOY A;  1BEV 1;  4SLI A;  3OUI A;  4M3C F;  3NV4 A;  1EV1 1;  3NNJ A;  4GWN A;  5KWR A;  2VMC A;  2EXI A;  3I8T A;  4Q4W 3;  3J7M A;  3JD7 3;  4UF0 B;  2RV9 A;  1F5J A;  4YZ4 A;  3EHK A;  1HN1 A;  3ZMN A;  2C0Z A;  1I5Z A;  2ZGQ A;  3EB7 A;  1WA4 A;  5CNA A;  1UY0 A;  3KZ4 C;  1HV1 A;  4XHX A;  3HJR A;  3KSC A;  1B35 C;  1W03 A;  3RS6 A;  5JI7 A;  2OVU A;  4QXB A;  4URT A;  5A80 A;  3WP4 A;  2JEM A;  2VTX J;  5DN2 A;  2A6X A;  5DG1 A;  1JYX A;  2QDR A;  3F95 A;  1VAM A;  1YNA A;  3NWK A;  1UU6 A;  3WQ0 A;  3A22 A;  2PHW A;  1W06 A;  3WW2 A;  2XJU A;  2VU9 A;  4AHY A;  3IDC B;  3UET A;  3MDP A;  2HWB 2;  4N9H A;  4H14 A;  4W8J A;  1DGW X;  3ZOI A;  1DP0 A;  4NIH A;  2BWA A;  2Y34 A;  3R4D B;  2EID A;  2R07 3;  1UCX A;  2D6L X;  3RPQ A;  2QQU A;  5FO8 B;  2W08 A;  4JQT A;  1J3Q A;  3BUC A;  4HAN A;  4QQ2 A;  2H0V A;  1HKD A;  2ET1 A;  4CCC A;  1DYP A;  2VME A;  1HV0 A;  4YVW B;  1FAT A;  2QQK A;  2QZ2 A;  4R4X A;  5C8C A;  4OUL A;  2ZX1 A;  1ULO A;  3EXU A;  4FXK B;  1AXY A;  1CAW B;  2UUR A;  4FPG A;  5H9P A;  3DPR B;  4OUS A;  4C0B A;  2A5Z A;  5FY1 A;  4D8M A;  1QJU 3;  2R1B A;  4AR2 A;  2UU8 A;  3EO6 A;  3HPN A;  1GU3 A;  2IC1 A;  2VQA A;  1FPN 2;  1ZRR A;  1R1A 3;  1OKQ A;  1O3T A;  3MIG A;  3JUU A;  4BXF A;  1W2U A;  5FJK A;  1XSR A;  2XQR A;  1DYK A;  2Y0I A;  3AX4 A;  1QJX 3;  4LIT A;  1QJE A;  4S2G A;  2WUH A;  3GDB A;  2Y6G A;  4DY3 A;  1O4T A;  2IFR A;  4K1Y A;  2A70 A;  3FUO A;  2VVF A;  1DLC A;  1W6P A;  1JZ2 A;  1XNB A;  1UY1 A;  1YUD A;  3I3Q A;  4JDM A;  3ZSJ A;  2VCC A;  5ACA 1;  2ID4 A;  3LKJ A;  3KF3 A;  1JI6 A;  1NOV A;  2JE9 A;  2YB7 A;  3PVE A;  4DEQ A;  1VAK A;  5CFD A;  5GZE A;  2HWF 2;  1KS5 A;  5IK5 A;  5FUP A;  2WS9 2;  3BCW A;  1CON A;  4QPY A;  5F2S A;  4AVA A;  5DMY A;  2RS1 1;  4XJA A;  1CPN A;  1MS9 A;  5FZ3 A;  5JLV A;  3KV5 A;  5A3M A;  1W2O A;  4OI4 A;  4RA0 A;  4FOQ A;  1RUO A;  3A0N A;  4XF1 A;  1C8M 1;  3OOX A;  1J84 A;  2DCZ A;  2ZGK A;  1QGL A;  2PHF A;  3PJQ A;  4LNV A;  4WVM A;  1U5I A;  3H8R A;  3UGH A;  3TAY A;  4RSU A;  1ZBA 1;  4CU9 A;  2VZP A;  2P3K A;  5A33 A;  5BNO C;  5KXE A;  1CAW A;  1MZE A;  2B7Y A;  1ZBE 1;  1MQT A;  1ND2 A;  5J09 A;  3HEI A;  2FMD A;  1AL2 1;  3ACG A;  4Q26 A;  5A7N A;  3ZSE A;  5C7G A;  4Q5O A;  1AUY A;  1JOD A;  2QE3 A;  2TBV A;  4Q4Y 3;  1LOA A;  1EV1 3;  1W9W A;  5FRE A;  2HBT A;  5A1L A;  2E6V A;  4N7I A;  4QB1 A;  3V65 A;  2ZX0 A;  4Q4W 1;  3O1S A;  1TMF 1;  1X8E A;  1YLL A;  3PIJ A;  4DO0 A;  4S2F A;  5GZC A;  1F15 A;  4QPG B;  1VB4 A;  2WQ8 A;  1IQD C;  4ARY A;  3GAL A;  3S5A A;  1HB3 A;  2QQL A;  4N43 A;  3VL8 A;  1H1A A;  3FHI B;  2UWC A;  4GJY A;  5K4L A;  4AI3 A;  4AEK A;  2ZA9 A;  2DVB A;  2RS3 2;  4NUB A;  2A6W A;  4BQW A;  4NWV A;  4CDX B;  1GWL A;  3RI8 A;  3KVA A;  1QF3 A;  1YFU A;  3BN6 A;  3I54 A;  3ACF A;  3MW2 A;  2ARC A;  3N3H A;  2ZGR A;  3I2J A;  1JYC A;  5FZO B;  4L9B A;  3CLP A;  4ERO A;  1U5X A;  4LUM A;  4W65 A;  4XEZ A;  4KG0 A;  3ATG A;  5FJH A;  1CES A;  2UYB A;  4FVV A;  1D0G A;  4IV1 A;  1YC6 1;  1LOE A;  4LKF A;  2WBK A;  2WAA A;  1NAE A;  4HKO A;  4HXC A;  2WAB A;  3GCX A;  3J7L A;  1GKB A;  1SZB A;  3ST7 A;  2NLR A;  3AP4 A;  1OPM A;  1QKQ A;  3H1M A;  2Z69 A;  2W1U A;  4UFM A;  5LBF A;  1FV2 A;  1DGW A;  2EIG A;  2FDG A;  2WNV B;  1XNA A;  4D7T A;  2XXZ A;  2WA4 A;  3OPT A;  2PAM A;  1BZW A;  3RWK X;  3NAP B;  3T2T A;  5FY9 A;  5KHJ A;  3MPP G;  4EJR A;  2YY1 A;  4HET A;  4A45 A;  1OPO A;  3FMG A;  1RL3 A;  3JXS A;  5A7W A;  1AYN 2;  4CU6 A;  1IKQ A;  1WBL A;  2MHF A;  1A34 A;  3WCR A;  4UW4 A;  1MR5 A;  1LRH A;  1XBF A;  3H7Y A;  1UYP A;  3TN9 1;  5EV7 A;  1POV 3;  2QKD A;  3FLR A;  1IKP A;  1TNF A;  4PCR A;  5CFD B;  4COY A;  2YBK A;  3LB9 A;  3K48 A;  3RZK A;  3NMB A;  1LHN A;  4TN7 A;  1ULF A;  1F31 A;  3RGB A;  4BQY A;  1JZ7 A;  4QDS A;  1EAH 1;  1WCS A;  1C5H A;  2Y8K A;  4LMF A;  4N7U A;  1KJR A;  1DG6 A;  5G05 L;  1KRI A;  3KHC A;  5LY1 A;  4B4P A;  2PLV 3;  5C8C C;  1GOG A;  2VMG A;  4L11 A;  1FYU A;  2ZMK A;  2YBS A;  3K4D A;  1AL0 G;  3CL1 A;  3ZYG A;  3RYK A;  3UT0 A;  4O7X A;  5ABJ C;  5DAQ A;  1HRV 1;  3R6S A;  3ZSK A;  5JOX A;  1OMI A;  5ACA 2;  2Y26 A;  4AAX A;  4BYY A;  3H0O A;  1US3 A;  5FXZ A;  1I1E A;  3AZV A;  1EYB A;  4M3C A;  5AC9 3;  1QNY A;  3CF6 E;  2Q1M A;  2QQV A;  5DDJ 3;  3LE0 A;  3AFK A;  1W8T A;  1E5I A;  3B00 A;  5AFB A;  1PVC 2;  1W28 A;  2RDQ A;  5D21 A;  1R64 A;  2W92 A;  4WVZ A;  2DUO A;  3WEZ A;  1QXR A;  4B1L A;  3VD3 A;  4JRA A;  1O3S A;  2Q1F A;  3IBM A;  4P9W A;  4DNY A;  4K3U A;  3FL7 A;  2JKB A;  3I49 A;  1BEV 3;  1C4R A;  4MYE A;  2R0F A;  3OGR A;  4A42 A;  3AYC A;  4XUT A;  4XET A;  1RVF 2;  1CZT A;  4PLM A;  3AJY A;  3C7G A;  3PNA A;  4KNC A;  3OGV A;  3B69 A;  4XFC A;  2AUY A;  2P2K A;  1ASJ 2;  3B9C A;  5CFC A;  3DXT A;  4QGN A;  5A7S A;  4FP2 A;  4C8D A;  4XIO A;  5FLJ A;  4FOV A;  4BA6 A;  1VE0 A;  1LEC A;  3D0S A;  2V5D A;  4YW7 A;  3VDD A;  4D7S A;  5E1R A;  4B8E A;  1Y9G A;  4CCO A;  2K0G A;  1MS5 A;  2WO2 A;  1PO1 1;  3CZJ A;  4CYD A;  4OQ8 A;  5IVY A;  3KVB A;  2JB8 A;  2AZ5 A;  1NZC A;  4GKY A;  4I2O A;  3ROU A;  2SLI A;  4LPL A;  3VBR A;  2QDN A;  3VKO A;  3H3Z A;  2CWM A;  4KQ7 A;  1RUH 3;  4D7Y A;  5A32 A;  3POB A;  2A71 A;  3U10 A;  2Q8C A;  1BMV 1;  1POQ A;  4NR1 A;  1JYI A;  2B8M A;  4XAB A;  2G9Z A;  1IPJ A;  4M00 A;  4OUE A;  5LRS A;  2Y6K A;  2E7A A;  2D3P A;  1C8M 3;  3N7J A;  4AFC A;  4YRD A;  5LBE A;  4TZD A;  3BIE A;  3H1Y A;  4GAL A;  4KWK A;  4XDP A;  2G4I A;  3Q8F A;  1YFY A;  3RZJ A;  3I2H A;  2WLQ A;  3A23 A;  2VOK A;  4HN1 A;  4YW6 A;  3QH6 A;  3IM0 A;  4IW3 A;  5CVR A;  2BGP A;  4AG4 A;  5KHG A;  3ZXA C;  1W2N A;  3OBR A;  5DAX A;  2BGO A;  5A7Q A;  1BBT 3;  2F17 A;  1YXW A;  3ZYJ B;  2XLF A;  4AVS A;  5C3O A;  4GWM A;  1VMH A;  1QOO A;  1EPW A;  3IWZ A;  1Y43 B;  1HLC A;  3IZO A;  1FAY A;  1EUT A;  3UGG A;  1CZV A;  4KU8 A;  2X53 S;  3VZN A;  2WYF A;  1RB8 G;  3R05 A;  4KI5 M;  4BLI A;  3T0D A;  1Q8O A;  1UOG A;  3EYP A;  5FKC A;  2B4K A;  4XF3 A;  1R1A 1;  2Q1Z B;  4ZU5 A;  1WMX A;  2J42 A;  2RM2 3;  3MW3 A;  4CDQ A;  4RGG A;  1VP6 A;  4AHZ A;  5CAD A;  2J1V A;  4XDQ A;  4XQ4 A;  3ZDV A;  4DQA A;  1CJD A;  5FWE A;  5K0U A;  2W9X A;  4QX8 A;  5IVE A;  3Q8C A;  1PK6 C;  1D4V B;  1IGO A;  3LA3 A;  3MFA A;  5FZC A;  2Q8E A;  3ZN6 B;  4ZS3 A;  2HWF 1;  3RZM A;  4DFS A;  3H9A A;  4URA A;  3U4S A;  2DUQ A;  2QNK A;  1VBB 1;  4RHV 3;  4C0H A;  1RUI 2;  3SIS A;  3OBT A;  1H4H A;  5J48 A;  4M0H A;  5ABJ A;  5FPX A;  2VCA A;  1Q3E A;  3J8F 3;  5FZ6 A;  3ZXK A;  5LA0 A;  3MZH A;  3BTZ A;  4GH4 B;  4L2N A;  4YZ5 A;  4BIS A;  5AC9 1;  1NX9 A;  1AR6 2;  3WDT A;  1JH5 A;  3R4U A;  4DIN B;  3ZDS A;  2AEN A;  3KWV A;  3ZKU A;  3LOB A;  4KH9 A;  1PMI A;  4Q1P A;  2XPJ A;  3I3B A;  1QJY 2;  1AX2 A;  3N9M A;  4WVM B;  2RR1 1;  1VBB 3;  3IDB B;  5A7W B;  3RRD A;  3T08 A;  1W6N A;  5EJZ B;  5M0T A;  2P37 A;  5JXI A;  1W0O A;  1LUL A;  5L9B A;  4CXY A;  2WDB A;  4QKD A;  2HEW F;  2CNA A;  1UZV A;  4PIX A;  5I93 A;  3SEP A;  1ULE A;  2W3J A;  2XG3 A;  3O0V A;  3ZX7 A;  1PGL 1;  2VUC A;  3W59 A;  4NJ4 A;  4HFS A;  1RC6 A;  4FXG B;  2E9Q A;  4P9Y A;  2J1E A;  4B7E A;  4F83 A;  1XJA A;  3N9O A;  2EA7 A;  2HWE 1;  3MEP A;  1Z7S 2;  2JDY A;  2ERF A;  2DCT A;  1Y7B A;  1WMF A;  2B42 B;  2AH2 A;  1OQE A;  1WUV A;  3ELN A;  3IDE A;  5KXB A;  1H1I A;  4CDW A;  3DV8 A;  1HRV 2;  3CJI C;  1W8O A;  4Q27 A;  3T1M A;  3TNP B;  4IV1 B;  1X36 A;  4XIK A;  4KWL A;  2TUN A;  1DU3 D;  4BJ0 A;  4JC1 A;  5JI9 A;  4MGY E;  3APB A;  4P9J A;  2X5I A;  5FUN A;  2JD9 A;  1UX6 A;  1HJG A;  1AR9 3;  1OFS A;  1ZZ6 A;  2F4L A;  2XBO 1;  3SKJ E;  3VLB B;  2W2I A;  3CDZ B;  3LIG A;  1GZT A;  4L92 A;  4FPK A;  2VGD A;  5FPU A;  5JZG B;  2DFC A;  4OHX A;  1SLA A;  1YFW A;  4TXW A;  2W87 A;  3POI A;  2W1W A;  2BNO A;  4GJZ A;  2RS5 3;  1PZ8 A;  4YM2 A;  2RS1 2;  3HBK A;  5FP9 A;  4W6W A;  1H9P A;  3MFC A;  1SAC A;  5FYV A;  4IGO A;  3VGI A;  5A3T A;  1SQ4 A;  1V6I A;  1J58 A;  4OMC A;  2WNU B;  2ZKN A;  1TNR A;  5T5J A;  5D2A A;  5J96 B;  4LHN A;  3I2K A;  5LRR A;  3JB4 C;  3RG0 A;  2ARX A;  2OQ7 A;  4HK9 A;  1ZBE 2;  1POV 1;  2R6Q A;  1JOB A;  4AED A;  4H2A A;  3JCI A;  4QXH A;  2EVX A;  4YM3 A;  3CJX A;  4MAD A;  4QPI A;  5FZF A;  5EJ1 B;  4PLO A;  4BQ4 A;  2FBE A;  3O5S A;  4CCM A;  2A75 A;  4XQW A;  1RGS A;  1NXD 1;  1LED A;  2BDR A;  4WM8 C;  1K42 A;  1S0F A;  1GP5 A;  3IB3 A;  1VBC 2;  2LM3 A;  2FZ1 A;  3TNQ A;  1QU0 A;  3LA7 A;  2JIC A;  5CG8 A;  4RQP B;  3GBW A;  4HOO A;  3WP3 A;  4PLN A;  1WMD A;  2XJQ A;  3ILR A;  1HQW A;  4ZY9 A;  2ZX2 A;  4P14 A;  4R52 A;  4CA9 A;  2VOW A;  2RS5 2;  3MIE A;  4CDU A;  1JBC A;  5FMC A;  1NLQ A;  2GDF A;  1JZ3 A;  3HMY A;  2OPW A;  2QQO A;  4RQP C;  5FPV A;  4V1P A;  1W6P B;  4M4R A;  4QGM A;  5FZH A;  5F7U A;  4HT1 T;  4HVO A;  3VN4 A;  2WO7 A;  3V0B B;  1XXN A;  2X29 A;  2R04 1;  1RUD 2;  3BAL A;  5A3U A;  1SBE A;  1H30 A;  4NE9 A;  3ZLI A;  5FKB A;  3PTR B;  4B3N A;  4WM8 A;  5E8A A;  4KWU A;  1AR9 2;  1XNK A;  1YJL A;  5FMB A;  4BQ5 A;  2A7A A;  3E6B A;  2QVS B;  4NIA A;  5CKQ A;  4CUA A;  1W8N A;  4E4D X;  1AXZ A;  4A7Z A;  4XJW A;  4CCK A;  3W5M A;  4XW3 A;  4XFH A;  1RUE 3;  3NNF A;  2RE9 A;  1UW8 A;  1V6M A;  2XJT A;  5DG2 A;  1JMU B;  5FY8 A;  1HQL A;  3V0A B;  1SG3 A;  2KA3 A;  4AW7 A;  4WM8 B;  2AEZ A;  4UFI A;  5FPL A;  3JBG 1;  3ZPO A;  3OY8 B;  5J37 A;  3O1P A;  2ZJC A;  4UAP A;  3VHP A;  2WZR 1;  2VMD A;  3AKR A;  1UL9 A;  4YVW A;  2C4X A;  4TLG A;  4M0N A;  4AWD A;  2ZTN A;  1PZ9 A;  1KDM A;  2ZEY A;  4IEO A;  1QDC A;  4FTB A;  4FSJ A;  4RN5 A;  3E6D A;  4QQH A;  5FYM A;  4AFM A;  5FO7 B;  3O1U A;  4LE3 A;  1UKR A;  2P6C A;  4CCE A;  4E4S A;  1AL2 3;  4K8F A;  4CVU A;  2CAU A;  2W1S A;  1QJY 3;  3KQR A;  1HB1 A;  3WDU A;  1DQ6 A;  4GWI A;  2HH9 A;  2PA7 A;  4IL7 A;  4DUX A;  3ZVX A;  1K3I A;  5FRA A;  4HVQ A;  1PNF A;  4NHL A;  5DAP A;  3N7K A;  4YM1 A;  4PIY A;  3KD4 A;  1RXF A;  3RYR A;  4EE2 A;  4LA3 A;  3VBO A;  2J22 A;  1RIT A;  5T54 A;  3BU7 A;  3I3E A;  4B1M A;  5C70 A;  2ORZ A;  4JGZ B;  5C3R A;  5J3U A;  1LOF C;  1BQP A;  2D3R A;  1AJK A; 
#chains in the Genus database with same CATH homology
 2YC4 A;  1SDD B;  3HNY M;  3VDC A;  4UOJ A;  2VME A;  2VTF A;  2QQK A;  3VD7 A;  1L7Q A;  1UY3 A;  3LEG A;  1ULO A;  4ZXE A;  3VD5 A;  1J83 A;  2XQX A;  4D8M A;  4XVH A;  1UX7 A;  4XUR A;  2JKX A;  5FUI A;  2WZE A;  3HPN A;  1GU3 A;  1F4A A;  5JR2 A;  2VQU A;  3GGL A;  3WNK A;  5I0D A;  5JMO A;  3C8X A;  3WF1 A;  2JDA A;  1PMH X;  2WUH A;  1DYO A;  2Y6G A;  3GDB A;  4W50 A;  4DXT A;  1PX4 A;  3UES A;  4HG6 B;  1DLC A;  2VM9 A;  1JZ2 A;  3DYM A;  1UY1 A;  1UY2 A;  2VCC A;  1GQP A;  2ID4 A;  2Y6J A;  1L7R A;  1LNS A;  2YFU A;  1JI6 A;  1XPW A;  2YB7 A;  4DEQ A;  1XNT A;  5EIY B;  3PUH A;  3WF0 A;  4A41 A;  2E26 A;  3T2O A;  3MUZ 1;  2VZR A;  3WNO A;  4JKK A;  4Z2A A;  1J84 A;  3FHQ A;  1UWW A;  2RVA A;  3IAQ A;  3HNB M;  5B4X A;  4CU9 A;  2VZP A;  4TTG A;  3FHA A;  3I2F A;  3HEI A;  3OB8 A;  1K45 A;  4JHZ A;  3F2Z A;  3ACG A;  5C7G A;  2ORX A;  4QX0 A;  3T0B A;  1RYY A;  1W9W A;  3VDB A;  3W5N A;  4PQQ A;  4BK5 A;  3MUY 1;  3LEK A;  4LKS A;  4QB1 A;  1F4H A;  2ZEW A;  1H6Y A;  1TVG A;  3THC A;  1YQ2 A;  4DXS A;  2HLE A;  2WQ8 A;  1IQD C;  4ARY A;  2WAO A;  3LQC A;  3VDA A;  2QQL A;  3T2Q A;  2WN2 A;  2Y64 A;  3U37 A;  4ARX A;  1JZ4 A;  1JZ8 A;  2QQM A;  3BN6 A;  2E31 A;  3ACF A;  5DPN A;  3WNN A;  3I2J A;  3LPG A;  1OF4 A;  2EIB A;  5B4N A;  2CDP A;  3VD9 A;  4BXS V;  2KD7 A;  2WBK A;  2WAA A;  1NAE A;  2C9K A;  3T09 A;  2WAB A;  3MV0 1;  2VZT A;  1O8S A;  1PX3 A;  2J1A A;  1UY4 A;  2W1U A;  4M4P A;  3CQO A;  4P08 A;  1XNA A;  4QX1 A;  3GXU A;  4XUN A;  5LCW L;  5IFP A;  1W0N A;  2VOT A;  4A45 A;  3JXS A;  4FI9 A;  1UMI A;  4GZ9 A;  2WO1 A;  4CU6 A;  4XZU G;  3P1I A;  2DCK A;  2WO3 A;  5JUV A;  2YG0 A;  2VZS A;  2VL4 A;  3C7H A;  3NNG A;  5LA2 A;  3NQH A;  3OBA A;  1GOF A;  1BHG A;  4MOA A;  2E33 A;  1JZ7 A;  4QDS A;  3WSO A;  2Y8K A;  5G05 L;  3OEB A;  3CKH A;  3WF3 A;  5IFT A;  1JU4 A;  1NKG A;  1GOG A;  2X10 A;  2V72 A;  2VC9 A;  1XC6 A;  3K4D A;  2W95 A;  3OGS A;  3NRU A;  1OH4 A;  5IJR A;  2VCB A;  4AAX A;  1UYX A;  1US3 A;  2LW8 A;  4CU8 A;  4QPW A;  4P00 B;  3NJV A;  3E1F 1;  4PF1 A;  3A21 A;  2J1R A;  3LE0 A;  3WNP A;  2XOM A;  1R64 A;  2BZD A;  2DCJ A;  1P8J A;  2W92 A;  2QQJ A;  3WEZ A;  1UYZ A;  2RJ2 A;  4P02 B;  5C71 A;  3VD3 A;  2ZEZ A;  3FL7 A;  3OGR A;  3T0A A;  4A42 A;  4XUT A;  1CZT A;  3C7G A;  2B9V A;  3OGV A;  2E32 A;  5A1A A;  1JYW A;  3C7O A;  3FN9 A;  2X05 A;  2V5D A;  2WO2 A;  3CZJ A;  3IAP A;  1JZ6 A;  4QDR A;  1W9T A;  2X09 A;  4LPL A;  2J1T A;  3CMG A;  4W4Z A;  4ZZ5 A;  3C7F A;  3ABZ A;  4YPJ A;  3DYP A;  2ZXQ A;  4OUE A;  4XUQ A;  3J7H A;  1WKY A;  2Y6K A;  3D3A A;  4ZZ8 A;  3HOB A;  1US2 A;  2VZO A;  2WN3 A;  3I2I A;  3HN3 A;  2W47 A;  2DDU A;  4E8D A;  3I2H A;  3A23 A;  3K75 B;  2VMF A;  1I5P A;  4AG4 A;  2BGP A;  1UYY A;  4L0P A;  2PQS A;  3VD4 A;  2WZ8 A;  5JXJ A;  2BGO A;  2VZU A;  4D0Q A;  1JHJ A;  5IYY A;  2J1U A;  3GM8 A;  2VZ3 A;  2QQI A;  1EUT A;  2EIE A;  1CZV A;  2EIC A;  4KI5 M;  3P6B A;  3T0D A;  2J7M A;  2VZ1 A;  2VJX A;  3EYP A;  3MO4 A;  4XUP A;  2B4K A;  1GMM A;  3K46 A;  1UXX X;  2W46 A;  1W9S A;  3I3D A;  2J1V A;  2QBX A;  3A7Q A;  2W9X A;  1UZ0 A;  5HXM A;  1W99 A;  3CZU A;  3THD A;  5LA1 A;  2W94 A;  4CU7 A;  2VZQ A;  2YFZ A;  3ECQ A;  4LHS A;  2VCA A;  2VZV A;  5LA0 A;  3ACI A;  1OT5 A;  1UXZ A;  1NX9 A;  2YC2 A;  2Y6L A;  1JYV A;  2J1S A;  2ZEX A;  3I3B A;  3K77 A;  4KMQ A;  4OMD A;  3T08 A;  2BBA A;  5EJZ B;  2XON A;  4BDV B;  5JXI A;  3WF2 A;  2WDB A;  4CUB A;  5F7U A;  3SEP A;  2W3J A;  4MGQ A;  2LS6 A;  2J1E A;  5HPO A;  2VO5 A;  3I2G A;  4QB2 A;  1PMJ X;  1CZS A;  1W8O A;  1WCQ A;  4DUW A;  1JZ5 A;  1KGY A;  4BJ0 A;  5G04 L;  2WYS A;  4QB6 A;  4MO3 M;  4GWJ A;  5DMY A;  1TG7 A;  2JD9 A;  4OZO A;  3SKJ E;  1MPX A;  3MBW A;  3CDZ B;  1D7P M;  1OD3 A;  4A3Z A;  4BK4 A;  3WF4 A;  3SEE A;  1K12 A;  2Z4F A;  4TXW A;  4XUO A;  2C26 A;  2W87 A;  2VQT A;  4P5Y A;  4JKL A;  2W1W A;  3K4Z A;  4JX0 A;  4MGS A;  4OYU A;  2HYX A;  3C7E A;  1OF3 A;  4A4A A;  4OMC A;  3UNP A;  1O8P A;  3DYO A;  2L9L A;  4LQR A;  3I2K A;  4DUV A;  3DEC A;  2Y6H A;  3CIH A;  4QDQ A;  3BGA A;  4ET7 A;  3WNM A;  1JU3 A;  3LEI A;  1CIY A;  3WNL A;  1NUK A;  4A44 A;  4MAD A;  4RYD A;  5EJ1 B;  1O59 A;  4QAW A;  3OG2 A;  1K42 A;  3PUI A;  5JXH A;  3IB3 A;  2R7E B;  5CZK A;  1EUU A;  2W1Q A;  4E8C A;  2VR4 A;  5IHR A;  3HNM A;  4ZY9 A;  3I97 A;  5CYY A;  2OKX A;  1GUI A;  1JZ3 A;  5JXG A;  3ZM8 A;  2QQO A;  2CDO A;  4M4R A;  4A6O A;  4CUC A;  1JYN A;  3LPF A;  2JE8 A;  3K4A A;  1KEX A;  1SHW B;  4DEV A;  4DXR A;  4KWU A;  5DQ0 A;  3ETP A;  4CUA A;  2BER A;  1W8N A;  4PT6 A;  4QX2 A;  3W5M A;  1CX1 A;  4IUG A;  3T2P A;  3WQB A;  3OEA A;  4QX3 A;  2V4V A;  1SG3 A;  1T2X A;  1UMH A;  1H6X A;  3III A;  4UAP A;  2VMD A;  5J1X A;  3NJX A;  2C4X A;  2VMC A;  3ACH A;  2RV9 A;  2ZEY A;  1GOH A;  2W91 A;  1HN1 A;  4RN5 A;  4UI9 L;  4JKM A;  3EB7 A;  1ULP A;  1UY0 A;  3IDA A;  3AC0 A;  3HJR A;  4CVU A;  2W1S A;  2W5F A;  4GWI A;  5DN2 A;  1JYX A;  4DUX A;  1K3I A;  3A22 A;  3SKV A;  3MV1 1;  2QQN A;  3UET A;  2J22 A;  4W8J A;  3I3E A;  5C70 A;  2ORZ A;  1DP0 A;  2XHN A;  1GNY A;  2EID A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...