2W1RA

Crystal structure of the c-terminal domain of b. subtilis spovt
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
117
structure length
117
Chain Sequence
DFAKEYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLERTMDQRSSVLESDAKSVQLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHKAVETAAGFLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAGE V SPORULATION PROTEIN T
publication title Crystal Structure of Spovt, the Final Modulator of Gene Expression During Spore Development in Bacillus Subtilis
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 41
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w1rA00
4R6LA 4IUHA 4BWIA 3IBJA 4Q0IA 2IA2A 3IBRA 4G3KA 2O99A 2W1TB 2W3HA 3KO6A 2HGVA 4E04A 4DMZA 4ZRRA 1TD5A 4O01A 2O0YA 2QYBA 4LRXC 4MCWA 4IUKA 2XSSA 3LFVA 3NOUC 2G7UA 3KSFA 1ZTUA 5TJJA 4YNRA 1YSPA 3RFBA 3KSIA 2O9CA 5C5KA 3TRCA 3MQ0A 2W3GA 4ETXA 4PAUA 4ME4A 5LBRA 3MF0A 3S7QA 4R70A 4MMNA 5L8MA 2KLIA 2B18A 2VZWA 4ETZA 3OBFA 2M7UA 2VEAA 2K2NA 5HPIA 4QPRA 4GW9A 3DBAA 2O9AA 3CITA 3E0YA 2W3EA 4FOFA 5DFYA 4O0PA 2ZMFA 3E98A 4LRZE 5I5LA 5DFXA 2M7VA 4Y5FA 5HSQA 3S7NA 4Q0JA 3OOVA 2W3FA 3MMHA 3EEAA 4MDZA 3C2WA 4G3WA 3S7OA 3BJNA 2LB9A 3G6OA 4Z1WA 4G3VA 3VV4A 3ZQ5A 2GX5A 1STZA 3D3OA 3CI6A 2W3DA 4GLQA 1YSQA 3NHQA 2LB5A 1YKDA 3NOTC 3NOPC 1F5MA 5HL6A 4MN7A 4Q0HA 1MKMA 4O8GA 2VJWA 3HCYA 3KSGA 2KOIA 2XRNA 2Y8HA 3S7PA 2VKSA 4LRYC 3R4KA 2OOLA 2W1TA 5HPFA 5AJGA 3K2NA 4EU0A 2XROA 3KSHA 1MC0A 4RQ9A 4Y2FA 2Y79A 4CQHA 1TF1A 4EUVA 4YOFA 5K5BA 4IJGA 4DN0A 4Y3IA 1VHMA 3O5YA 2O9BA 3W2ZA 2K31A 2W1RA
chains in the Genus database with same CATH superfamily
3MXRA 2JKFA 1J9MA 1DRMA 1MBLA 1VB6A 3GDIA 4JLFA 3LYXA 2OLVA 3QHYA 2ZQAA 4P6BA 3Q7VA 4UAAA 2XFTA 4K0WA 3V3SA 3T4QA 1GHPA 4HIAA 3WS0A 4R38A 1ZKJA 1MWTA 4JXWA 1RP5A 1S6RA 2QMIA 1OJ5A 1L0DA 4N1HA 4FTXA 4ARZB 2DMWA 3MQ0A 4RA7A 3MZDA 3QNBA 5FQKA 3DW0A 2ZC6B 3IX8A 4ZAMA 1MY8A 3FV7A 3O3VA 3LR0A 5F1GA 3H82A 4MMNA 2A3UA 3HLCA 2VZWA 4C6YA 4ETZA 4L9FA 4CPKA 3OBFA 2GJ3A 1LT0A 1QMEA 1YLJA 1CI8A 3IF6C 4QPRA 5D3OA 5E2EA 3VP4A 5HWVA 3RXWA 2PU2A 3QP5A 5CGWA 3IS2A 4HH2A 3RH8B 2ZC7A 4EUZA 3GTCA 4PPRA 1VETB 1ALQA 4BD1A 2V0UA 2JCHA 2W3DA 3PAGA 3UE3A 1D06A 2ZM2A 3MQQA 4H8RA 4GJ4A 1OTBA 2G2WA 1Z6FA 2VGLM 4MNRA 4GB7A 3UE1A 1XA7A 5DJUA 3GECA 1KE0A 4B4XA 2JKTI 4R3AA 1Y28A 3C4PA 5FDSA 4PKYA 5J8XA 4RQ9A 4HJ3A 1T1BA 3BFCA 3G31A 1PW1A 3H7WA 2DRWA 5HD3A 1D7EA 2Y2PA 2Y59A 4MN6A 4DXCA 4D2OA 5FL3A 2OAP1 4XUZA 3VFHA 1H8MA 3PYPA 2C5WB 4B88A 2X02A 4JXVA 3WS5A 5M18A 1KE3A 1ES2A 1G6AA 1UGUA 5HWTA 3MZFA 1MWSA 5DJTA 1XKZA 3LIBA 4ME4A 1VEUB 4M4XA 1FSYA 1NJ4A 2B95A 2C6WB 3EQUA 3IXGA 3P98A 4O0PA 4Y0UA 5G18A 5I5LA 3IXBA 2H0YA 2PBYA 3OOVA 4I39A 4X68A 4QWOA 2ZC4B 3SW1A 2WKHA 4P87A 1L2SA 3ZQ5A 1XFQA 4PM7A 4KQDA 4RVAA 4YINA 1YKDA 4MN5A 3PBRA 4S2IA 5GLCA 2JE5A 4FH2A 4O8GA 3NULA 3KSGA 1JWPA 3Q07A 1CJFA 1FQGA 2XK1A 3QP1A 2Y2NA 4M3KA 2J3TC 4ESPA 5FQIA 3E2LA 4JKTA 2Y79A 4HI4A 3PBQA 4PM9A 4KG5A 4S2PA 3BY9A 2P7JA 1TS7A 3OC2A 2DNSA 1NZUA 4CJNA 4F3LA 1S1ZA 1EI5A 2QWSA 4UA9A 1S4SA 2J9OA 5HX9A 3C7VA 1KDSA 1JTGA 5GLAA 2Y2OA 2ZBBA 3IXDA 5EM1A 1S67L 3BQAA 2G7UA 5TBMA 3B33A 4P85A 2W0NA 1GHMA 3PR6A 3BFDA 1NRFA 1Y4OA 2JKTM 4NXEA 4Z9QA 5F6AA 3HLFA 4Q8IA 3Q7VB 1NZOA 4OPYA 4XUXA 1XJ4A 4Y17A 3VSKA 5KMWA 2VV6A 1JVJA 2ZM8A 1V9ZA 3E0YA 2EXBA 5DTKA 3UPOA 2P74A 2OLUA 5GHZA 3JPUA 4EW7A 1K0KA 1HLUP 3HBRA 1PRQA 4EQIA 1ZG6A 1YT4A 2QJ7A 2V8CA 3UPNA 4FCFA 3A3EA 4KG2A 2ZM0A 3WWXA 1K56A 2ACGA 1G28A 4U3TA 2EFUA 2HP5A 3SZTA 4U0TA 3IS2B 5A90A 3A0SA 2FH5A 4MBFA 4Y0TA 4GHIA 3CAXA 1K6SA 2ZQ8A 4GOGA 2E8JA 5HPFA 3B3XA 2HDSA 4KZ4A 3T4SA 1SCWA 4IJGA 5DKKA 2Q9NA 3PXPA 3T4LA 2H5SA 4IUHA 2EX9A 1NRJA 1JWVA 4PM8A 3FC7A 1WYBA 1FSWA 1KVMA 1XJ3A 2J7VA 4O01A 5AQAA 4OQIA 3PBSA 2PDRA 3FZCA 4IUKA 3LICA 3E4QA 3LUQA 1BLCA 4S2JA 3VOZA 5FSRA 3KSIA 2O9CA 4EQ1A 3TRCA 3V5MA 3DTEA 1PFLA 4PAUA 3T1RA 3DWZA 3LGOA 3UY6A 3V50A 1LL9A 1YM1A 3F1PA 5BOHA 3FPVA 4HQAA 3IX3A 4ZTKA 5HAIA 5L8MA 4EWFA 5FI7A 2VGKA 3HREA 4WYYA 2W3EA 2QHKA 2HP6A 5DFXA 5EOEA 2R9WA 1ACFA 1K55C 4X69A 3DWKA 3S7NA 5AVFA 4EBLA 5CEDA 3MR0A 2LB9A 4Y15A 1FR6A 1LSXA 4NEED 4DDYA 4YWZA 3OPRA 4X53A 4JXGA 1LLBA 4R3JA 3LIFA 5CEBA 1CK3A 1XJ2A 1KGFA 2OWJA 2R9XA 4EV4A 4E6WA 1X0OA 2GNXA 2W27A 2EWWA 5HZHA 1N9NA 4EU0A 1GCEA 2ZQ9A 2P04A 4Y2FA 3ZNYA 3LIEA 5F82A 4QHCA 3HLEA 5FI2A 3VE4A 1O07A 4BBUA 3DTKA 1K57C 2NUTC 3IBRA 2I72A 3NC8A 1NYYA 3FYZA 4WMCA 4PHTA 4E04A 3CWFA 1BLPA 3UDXA 3O88A 2JN7A 1YQSA 1H5XA 2WKIA 5HD5A 3LY4A 1IKGA 3GQZA 4UQIM 5TJJA 3IH9A 3ISGA 2J9PA 1PI5A 4F3LB 3R7WA 3UMEA 1HVBA 1PYYA 3GRJA 4E3LA 2M7UA 3HUOA 1SZVA 4PKYG 1BT5A 5TBMB 4HESA 4FOFA 3AGDA 3MFXA 5IHVA 4DXBA 1NYMA 1TVFA 3VOYA 5GHXA 3P09A 1OJGA 4LGWA 4EERA 3NY4A 3L9KA 4I5SA 4U0XA 4H6JA 4WUJA 1ERMA 2WUQA 3M6HA 4MBHA 4FH4A 5FEFA 2UV0E 4WZ4A 2Y8HA 3ZGAB 4IBXA 4GDBA 2OOLA 3ZFZA 3ZG8B 3VP3A 5CHMA 3UNWA 3DTIA 2Y55A 4KQRA 3W2ZA 4RX3A 1ODVA 3T4KA 1PI4A 2HDUA 4GHIB 5FDHA 4K91A 5A8BA 2XD1A 4OPRA 1E4DA 3NIAA 1HD8A 4KUOA 1SDEA 4KZAA 4WEKA 5HW3A 3Q1FA 1QMFA 1T1CA 2V20A 4D60A 5DTSA 4OQ0A 1F98A 1JWZA 5EM0A 2KX6A 1W7FA 5JYOA 3AGFA 2JKRI 4DDSA 3CITA 1E3UA 4DE3A 5DFYA 4HOIA 3E98A 4R0QA 3HL9A 3W4PA 4MLLA 4MEZA 5CX7A 3ZG7B 3LY3A 3S7OA 2YKFA 4IVKA 1IKIA 3F1PB 1IOUA 3KYZA 4C75A 2Y2JA 4L9GA 1ONGA 4N9KA 3UDFA 2X01A 1XP4A 3FWLA 3A0RA 3CZDA 3IQAA 2IWBA 3SH8A 3DAVA 4L9EA 2VK3A 3GV9A 5E2GA 1MKMA 2OWHA 4P6ZM 3EWKA 4ZJ3A 3S7PA 3V3RA 1H0MA 1WA9A 2W1TA 1PZOA 4NKPA 5FQ9A 4QB8A 5AJGA 4AFIA 2L1MA 2NUPC 1IYPA 1OTDA 4UHUA 4Y7PA 1Q2PA 5E43A 2P9VA 4DKIA 4Q0IA 3BQ8A 2IA2A 2DCFA 1DP9A 2D02A 4HP9A 5CRFA 3BFGA 3IH8A 4QY5A 3ZYTA 3CLOA 1YLYA 3FG8A 2J3WA 2WKQA 3BECA 2XFSA 4WM9A 4DRTA 3HJKA 1EROA 2VX8A 4ZBEA 2PR6A 1PWGA 4ETXA 1K55A 1N9BA 4OOLA 2VV8A 4CLCA 2EX8A 4R23A 4KZBA 3UE6A 2OSUA 3E2KA 3V67A 3TW8A 2EA9A 1PIOA 3ZG5A 1YLWA 1MKIA 5HSQA 2R78A 2Y2KA 4UQIS 3FKVA 4HP4A 4C3QA 3GMWA 2Z6CA 1J3WA 3CI6A 1NWZA 4KZ5A 4GLQA 2IWDA 5GLDA 2QZ6A 1OTAA 2VJWA 1FILA 3HCYA 4QU3A 5EVLA 1KDWA 2INWA 2H28A 3KYEA 5AQ7A 1KVLA 4OLGA 3OPHA 1H3QA 3F1NA 4NXFA 2WGIA 1Z09A 4E3JA 1W8QA 1MC0A 1Q2QA 2JKRM 4H6JB 5EE8A 4EUVA 5IT5A 4DN0A 5CHJA 2HZ5A 4IBRA 1IYQA 3SS5A 3PBNA 3MJQA 3IBJA 2MJ6A 2P08A 2PR5A 4G3KA 1I2SA 3UDIA 1SKOA 1DP6A 1K56D 3CG5A 1YLPA 5DF8A 3V39A 3VMAA 1BLHA 2PBDP 5G4YA 2ZL1A 3LFVA 4ZJ2A 5A93A 5EVIA 1ESIA 2PYPA 1G5UA 3C4OA 3DTMA 4YNRA 2WKRA 1L0GA 3BM6A 1DP8A 1O7EA 2W3GA 4GDNA 2XA7M 4KZ6A 1YMSA 1XJ6A 1SDNA 2KLIA 3FPWA 4S2NC 2B18A 3EGXC 4WF0A 4FSFA 4R1GA 4KQOA 2HDQA 5HWWA 4LLOB 3C5AA 3TG9A 5HDCA 2EXAA 3IWQA 5HAPA 1LI9A 4JGPA 3RXXA 2ZMVA 3CMZA 2HJ9C 4JGRA 4B4ZA 4ZDXA 1IYSA 5FQJA 2EFXA 5F68A 5FI6A 2LB5A 3CHWP 4OKPA 3TOIA 2Y4AA 4X56A 5IU1A 1L0FA 5HDDA 2XQZA 5EOOA 3HLDA 4E3OA 2QPNA 2BASA 4GZBA 3H82B 4I38A 1GA0A 3K2NA 4JBFA 2XD5A 2VLGA 1K4FA 4R6LA 1W79A 3VFFA 3N8SA 5A91A 1OT6A 1T19A 2W1TB 4OQHA 2HGVA 4I3JA 2Z2LB 1CEGA 4DMZA 1BULA 4P6ZS 5CECA 3LO7A 2A2LA 4EEUA 4BJPA 5HDSA 2X71A 3QP6A 1ES3A 3QP2A 1YSPA 3RFBA 2PYRA 5C5KA 5G4ZA 3Q81A 3HLGA 1XXMA 3E4OA 2D01A 1K4EA 3UB8A 5F69A 3H7WB 2K2NA 3EEHA 3HUNA 3BLSA 3G30A 2Q9MA 3P01A 4LRZE 4Y5FA 3IF6A 4WMCD 3NCKA 2A24A 3G35A 4CLCB 3N6IA 4R4RA 4E3NA 3BFEA 1HTZA 3OCLA 2XR0A 3O87A 4Y13A 3NOTC 1RGZA 3HJIA 1NXYA 1XA1A 3TSGA 1K38A 4EEPA 4Q0HA 4YFMA 1PW8A 4DE0A 1UWNX 4EBPA 3OLOA 1CQAA 5FAPA 4LRYC 3N8RA 3T4TA 2H10A 3W4OA 1DJAA 1ZG4A 2EWVA 4WBGA 1DY6A 3KSHA 3BRMA 2QJ5A 2V8FA 4Y3IA 1VHMA 2W1RA 5I94A 1FR1A 4II7A 1JTDA 4EXOA 3GSGA 5TR7A 2V9AA 1S66L 3F1NB 2ZC3B 3PBTA 4ZRRA 2WGWA 1FCMA 1VETA 4QY6A 4N1XA 3MBZA 3LR3A 5HARA 1BUEA 3NOUC 2B02A 3G2YA 1XPBA 3KSFA 4OLDA 3IWOA 3G32A 3T50A 2BLSA 3T1QB 4HBTA 1DJBA 1MZUA 3M2JA 1DJCA 1PWDA 1P9RA 3IF5A 5KSCA 2E8IA 4E3KA 5A92A 2PHYA 2HP9A 5FAOA 4I3IA 3JVUA 2ZL1B 2OV5A 1XX2A 4JF5A 2XEPA 2V2FF 3IT9A 3ZG9B 5EVIB 3B47A 3LCEA 5HFOA 1FCOA 3HUMA 2VV7A 1CEFA 4Q0JA 3LIAA 4GS9A 3G6OA 2QKPA 2HJEA 3A3DA 1KOUA 2XA7S 3OPPA 3VP1A 1I5QA 3ZG0A 4JF6A 4OP8A 2ZQDA 2V1AA 2XRNA 4K0XA 4HJ6A 5DF7A 4LPZA 3R4KA 1OTEA 2WZXA 1OPXA 3LR4A 4L0LA 4UA6A 2XROA 4P0MA 1E3UD 4FUWA 3C30A 1YLZA 2O9BA 4LFUA 5DVAA 4GN2A 1U60A 1IELA 3C38A 4OOMA 3WRTA 3MFDA 2WAFA 1ERQA 5L10A 3MS6A 2W3HA 4KZ7A 4N92A 1ZC2A 2UWXA 4IEDA 1N4OA 4NK3A 4KZ9A 3LR5A 3LIDA 2J8YA 4LRXC 4OH0A 1M40A 4S2NA 2Y2LA 1XFNA 5U47A 5CTMA 4N9LA 5CERA 4XT2A 3QP4A 4WZ5C 3QP8A 1K54C 3ULFA 5LBRA 4OPZA 4RYEA 4LV2A 3L7HA 4S2MA 4X25A 3SS3A 4HY8A 5GL9A 1IFQA 3LEQA 5AQBA 3UB7A 2ZMFA 2YKHA 5AVEA 2W3FA 3MMHA 3CPTA 1GSVA 3UB5P 1BTLA 1GSXA 3IF6B 5HL6A 1ES5A 2A24B 3MKFA 3WRZA 4KENB 1NLYA 4JGQA 2WZZA 3ITAA 3BWLA 4E3IA 4CLCD 5M19A 4GNUA 2PD7A 2WYXA 4YOFA 2FZ0A 3KX0X 5FQQA 3S4XA 5EFWA 2JKGA 4BWIA 2WK0A 1F9IA 1JNUA 1ES4A 3GVBA 2FFFB 3K3CA 5KIZA 3S22A 2O0YA 2ZOHA 3CUEC 3A3FA 1CF0A 2HDRA 3VP2A 5KZHA 4ID4A 3MXQA 3ZNTA 4BMWA 1Y54A 2L4RA 4A5RA 3IXHA 4R4SA 1H8ZA 5IS1A 3N7WA 3NDEA 1MXOA 3ICYA 3NECA 4Y0OA 2WGWB 1GHIA 2K7SA 4PMAA 2ZMAA 2J80A 3OCNA 4X55A 1RCJA 2O9AA 2XH9A 3MSHA 1EWZA 3VSLA 1OT9A 2V1ZA 4G3WA 4O7DA 2WKEA 1WE4A 1M6KA 5EVID 4HHDA 1F5MA 3OPLA 1FCNA 3HLWA 4GS9B 3LEZA 1TEMA 1ESUA 1F2KA 3W4QA 3WS2A 1LL8A 3R7WB 2OAQ1 1TS6A 4I3AA 2WADA 2Y91A 3F1OA 4HBUA 1T18A 2GZAA 3MZEA 4KZ8A 4F94A 3JYIA 3U2AA 3BEBA 3T12B 1V9YA 4DE2A 4DF6A 1LSVA 1S4RA 2O99A 2M1CA 3I7JA 2Y2HA 1P0ZA 5JYPA 1K57A 1TS8A 2HV1A 3BFFA 4BENA 4R3BA 4MCWA 1FOFA 5CGXA 3AGEA 3RTYA 1XGIA 3WS4A 4HJ4A 3D9YA 5DF9A 4XXRA 1K6RA 1LL5A 2ZJ9A 1LSWA 4JGOA 4OONA 2Y2GA 1MWUA 1GSWA 3ZVWA 5J3WA 3A0VA 1KGGA 3ZVTA 4GW9A 3DBAA 1N9LA 4XT2B 3NI9A 5GLBA 3IX4A 4GD8A 2GDNA 2G2UA 5CTNA 1EW0A 2RCXA 3EEAA 4X1LA 2H0TA 5FQMA 3Q82A 3S1YA 3BJNA 3VV4A 3LI8A 4OPQA 4LV3A 2GX5A 1STZA 3T4JA 3SH7A 4DJ2A 1G68A 3A3IA 5HL1A 3NHQA 3IHAA 1NY0A 3NOPC 4HH3A 1RGYA 1VQQA 5GHYA 3W8KA 1I2WA 4X1MA 4LV0A 4OQGA 5EECA 3CPTB 3P7NA 1YAXA 1KGEA 4GD6A 4NXGA 4NXBA 4JPMA 1MPLA 3UB6A 1W63M 4OP5A 4CQHA 5K5BA 1TDGA 2Y2MA 2K31A 1OMEA 3IWIA 5CHUA 3KYQA 5M1AA 3ZDJA 2V0WA 3VE3A 1P9WA 2PAVP 4EBNA 4WZ5A 2QYBA 1K54A 2FFYA 3UE0A 4KUKA 1ONHA 1L0EA 1SHVA 1MWRA 5EPHA 4PM5A 2CMNA 1A0KA 5EV0A 2Z6DA 1C3BA 4OVDA 4S2OA 5L09A 2Y2QA 4EETB 4PM6A 1AXBA 1E25A 5AQ9A 2BG1A 3SOIA 3ZCZA 2P9VB 4HNBA 3Q7ZA 2M7VA 1OTIA 5E2HA 1UWPX 3K3DA 3D4FA 5TGFA 3C2WA 4UEYA 4Z1WA 1LI0A 1ZHHB 3ITBA 2XDMA 3PHYA 1G6OA 1YMXA 1YSQA 1BLSA 1BYWA 2VA0A 4BL2A 4MN7A 4B93A 4JF4A 1BZAA 5FAQA 4LCMA 3OZHA 2VKSA 3UN7A 1NLZA 4E6XA 4WLAA 2VGLS 2I9VA 3B42A 2WAEA 1IYOA 1TF1A 4QD4A 3C7UA 3RJUA 3M6BA 3CUEA 4IVIA 3EGDC 2CC1A 3ZHHA 4BD0A 4QJGA 4KZ3A 4IHQA 2PD8A 5FASA 2L0WA 4KG6A 3TE8A 3F1OB 4ARZA 5DTTA 5EUAA 4OOYA 3BLMA 4B9OA 1TD5A 3FKWA 3T1SA 5F83A 4RX2A 3UMDA 2WGVA 2B5RA 2PRFA 3N8LA 3MKEA 3PBOA 2ZLYA 4CLCC 1W63Q 2IWCA 3VP0A 3HLBA 3UB9A 1CI9A 1FIKA 3JVVA 5DKLA 3MF0A 3S7QA 1H8YA 2PT7A 2KDKA 1XGJA 2ZD8A 2J3TD 4EESA 4ZJ1A 2VEAA 2JBFA 2Z2MB 1TS0A 4X6TA 5FATA 5CGSA 4MDZA 3GR2A 4BL3A 4GCZA 1SKOB 1L3LA 4G3VA 5FA7A 1YPRA 5MC7A 2AVXA 3D3OA 3MQOA 1S0WA 4GKUA 4WL9A 1P97A 2A49A 1LHYA 3M2KA 3HVFA 2EX6A 2PU4A 1VM1A 2KOIA 2JC7A 4UA7A 4LCLA 4WELA 3NJAA 3PAEA 3IHBA 2EX2A 1GA9A 3U4LP 5F1FA 4JXSA 1KE4A 3MXSA 5EVEA 4E3MA 1YLTA 3UO9A 5J7EA 3C8CA 3QNCA 2JHEA 4S2LA 3G4PA 3UPPA 4K08A 3LI9A 3VOLA 1BSGA 3A3JA 1PZPA 1PNEA 3N4IA 3BW6A 1D1JA 3KO6A 4DE1A 2XF3A 4BBTA 5J4EA 3EQVA 5KSHA 1S1YA 4BLMA 3E4PA 4BQMA 4S2KA 1VEUA 5EVIC 2BTFP 4CLCE 5TFQA 4LV1A 2XSSA 4NETA 3G34A 4WN5A 1ZTUA 2ZOIA 1T1AA 3NBLA 1IEMA 5E2FA 3T1XA 5CXWA 2RL3A 3G2ZA 3O86A 2XLNA 5FEGA 4R70A 5L2FA 2V1BA 5HPIA 3EOIA 3SS4A 4KQQA 4MBKA 1HZOA 3CJMA 2ZQ7A 5F5YA 3PTEA 3BYDA 1WYCA 4WEJA 2HF6A 3H9WA 3NDGA 1W5DA 1W8YA 3WS1A 4HEFA 1SKFA 4FD8A 3T4OA 4NG2A 3BY8A 1PWCA 1K25A 1AWIA 2XGNA 4BBVA 3D72A 2ZQCA 5L07A 2Q0OA 2HPBA 2VGJA 2WKPA 2Y2IA 4LENA 2ZC5B 1TDLA 3TJZC 4DJ3A 3O5YA 1N9OA 3SH9A 5HAQA
chains in the Genus database with same CATH topology
4R6LA 1DRMA 4BBUA 1V9YA 1OT6A 1VB6A 2NUTC 3GDIA 3IBRA 1LSVA 1S4RA 1T19A 2O99A 2W1TB 2M1CA 3LYXA 4PHTA 2HGVA 4I3JA 1P0ZA 4E04A 4DMZA 3CWFA 2JN7A 4P6ZS 1TS8A 2HV1A 2A2LA 4MCWA 4EEUA 4BJPA 5HDSA 5HD5A 3T4QA 4HIAA 3RTYA 4R38A 4UQIM 4HJ4A 5TJJA 5DF9A 1OJ5A 1YSPA 3RFBA 2PYRA 5C5KA 5G4ZA 4ARZB 2DMWA 3E4OA 3MQ0A 1LSWA 4JGOA 2D01A 4F3LB 1GSWA 3R7WA 3UMEA 5J3WA 3LR0A 3A0VA 3H82A 4MMNA 3UB8A 5F69A 2VZWA 4ETZA 4L9FA 3OBFA 2M7UA 3H7WB 2GJ3A 1LT0A 2K2NA 4QPRA 4PKYG 4GW9A 3DBAA 3EEHA 5TBMB 1N9LA 4FOFA 5HWVA 3MFXA 3P01A 4LRZE 4XT2B 4Y5FA 3IS2A 1EW0A 2A24A 3EEAA 4HH2A 3RH8B 4CLCB 3BJNA 3VV4A 3LI8A 1OJGA 3OCLA 2GX5A 1STZA 4EERA 3T4JA 2V0UA 4DJ2A 4I5SA 2W3DA 3UE3A 1D06A 3NHQA 3NOTC 3HJIA 4H6JA 4WUJA 3NOPC 3MQQA 4EEPA 4HH3A 4GJ4A 1OTBA 4Q0HA 2VGLM 2Y8HA 1UWNX 3OLOA 5DJUA 3GECA 4LRYC 2OOLA 3P7NA 3T4TA 1YAXA 2JKTI 4R3AA 4NXGA 4NXBA 1Y28A 2EWVA 4PKYA 3UB6A 1W63M 3KSHA 4RQ9A 4HJ3A 4CQHA 1T1BA 2QJ5A 5K5BA 3H7WA 4Y3IA 1VHMA 3W2ZA 2K31A 2W1RA 1ODVA 4II7A 3T4KA 5HD3A 4EXOA 3KYQA 1D7EA 2V9AA 4GHIB 2V0WA 3VE3A 1P9WA 1S66L 3F1NB 4MN6A 5A8BA 3PBTA 4ZRRA 5FL3A 2OAP1 2QYBA 1H8MA 3PYPA 4KUKA 4KUOA 3LR3A 4WEKA 3NOUC 1T1CA 2B02A 3KSFA 3T50A 1UGUA 2CMNA 5HWTA 1MZUA 2Z6DA 1F98A 1P9RA 5DJTA 2KX6A 3LIBA 4ME4A 4EETB 4M4XA 2PHYA 4I3IA 3JVUA 2JKRI 3EQUA 3B47A 3CITA 5DFYA 4HOIA 4O0PA 4HNBA 3E98A 5I5LA 2M7VA 1OTIA 2VV7A 1UWPX 4Q0JA 3OOVA 3K3DA 5CX7A 3LIAA 4I39A 4GS9A 3C2WA 3S7OA 4UEYA 2YKFA 4Z1WA 3G6OA 3F1PB 2QKPA 3SW1A 3ZQ5A 1IOUA 3KYZA 1ZHHB 2HJEA 1XFQA 3PHYA 1G6OA 1KOUA 4L9GA 4KQDA 3A0RA 1YSQA 2XA7S 1YKDA 1BYWA 4L9EA 2VA0A 4MN7A 4B93A 4MN5A 3PBRA 1MKMA 4O8GA 2OWHA 4P6ZM 3KSGA 3EWKA 2V1AA 2XRNA 3S7PA 4HJ6A 2VKSA 4LPZA 1NLZA 3R4KA 1OTEA 1WA9A 2W1TA 4WLAA 2VGLS 1OPXA 2I9VA 3LR4A 4NKPA 2J3TC 4L0LA 3B42A 5AJGA 4AFIA 2XROA 2L1MA 2Y79A 2NUPC 1TF1A 4HI4A 3C30A 1OTDA 3CUEA 3PBQA 2O9BA 3EGDC 3C38A 4OOMA 3BY9A 2P7JA 4Q0IA 3BQ8A 2IA2A 4IHQA 1TS7A 1DP9A 2D02A 2W3HA 2PD8A 4HP9A 2L0WA 3TE8A 3OC2A 3F1OB 4ARZA 3ZYTA 3CLOA 4B9OA 1TD5A 4F3LA 3LR5A 1S1ZA 3FG8A 3LIDA 2QWSA 4LRXC 1S4SA 3UMDA 2J3WA 2WKQA 2ZBBA 1S67L 3BQAA 2G7UA 3HJKA 5TBMA 1XFNA 3B33A 3PBOA 2W0NA 3PR6A 2VX8A 4CLCC 4XT2A 1W63Q 3UB9A 2PR6A 2JKTM 4NXEA 4ETXA 5F6AA 3ULFA 3JVVA 4OOLA 5LBRA 5DKLA 2VV8A 3MF0A 4CLCA 3S7QA 1XJ4A 4HY8A 2PT7A 2KDKA 1IFQA 2VV6A 3UE6A 2J3TD 4EESA 2VEAA 3V67A 1TS0A 1V9ZA 3TW8A 3E0YA 3UB7A 2EA9A 2ZMFA 5HSQA 2YKHA 5AVEA 2R78A 2W3FA 3MMHA 4MDZA 4EW7A 4GCZA 4UQIS 4G3VA 4HP4A 5MC7A 2QJ7A 2Z6CA 1GSVA 3D3OA 3MQOA 3CI6A 4WL9A 1NWZA 4GLQA 1GSXA 1P97A 1G28A 5HL6A 3IS2B 2A24B 1OTAA 3HCYA 2VJWA 3A0SA 2KOIA 2FH5A 1NLYA 4JGQA 3BWLA 2INWA 4CLCD 4WELA 3NJAA 2H28A 4GHIA 3CAXA 1H3QA 3F1NA 4NXFA 5HPFA 2PD7A 1MC0A 2JKRM 5J7EA 4H6JB 3C8CA 3T4SA 2JHEA 4YOFA 4EUVA 2FZ0A 5IT5A 4IJGA 5DKKA 4DN0A 3KX0X 4K08A 3PXPA 3LI9A 3VOLA 3T4LA 5EFWA 4IUHA 3PBNA 3MJQA 4BWIA 3IBJA 1NRJA 2MJ6A 2P08A 2PR5A 1F9IA 1JNUA 4G3KA 3BW6A 3FC7A 3KO6A 1XJ3A 4BBTA 3K3CA 5J4EA 3EQVA 4O01A 5KIZA 1S1YA 1DP6A 5KSHA 2O0YA 2ZOHA 3PBSA 3CUEC 3E4PA 2PDRA 3MXQA 4BMWA 4CLCE 4IUKA 2L4RA 2XSSA 3LICA 3LFVA 5G4YA 3E4QA 3LUQA 4WN5A 2PYPA 5IS1A 1ZTUA 2ZOIA 1T1AA 4YNRA 2WKRA 3KSIA 2O9CA 4EQ1A 1DP8A 3ICYA 3TRCA 2W3GA 4PAUA 2XA7M 2K7SA 1XJ6A 3F1PA 4R70A 3FPVA 2J80A 4HQAA 5L8MA 2KLIA 3FPWA 2B18A 3EGXC 3OCNA 4WF0A 2V1BA 4FSFA 5HPIA 3EOIA 4KQOA 2O9AA 2W3EA 2QHKA 4LLOB 5HWWA 5DFXA 3S7NA 5AVFA 5HDCA 3MR0A 1OT9A 4G3WA 2LB9A 4JGPA 5F5YA 2ZMVA 1LSXA 2HJ9C 4JGRA 4NEED 4YWZA 4WEJA 2HF6A 5F68A 3H9WA 2LB5A 4HHDA 5IU1A 3LIFA 5HDDA 1F5MA 1XJ2A 2OWJA 4GS9B 3T4OA 1X0OA 2GNXA 1LL8A 2W27A 3R7WB 3BY8A 2BASA 2OAQ1 1TS6A 3H82B 4I3AA 4BBVA 2EWWA 3D72A 5HZHA 4I38A 3F1OA 1T18A 1N9NA 2GZAA 2WKPA 3K2NA 4EU0A 2P04A 4Y2FA 3LIEA 3TJZC 4DJ3A 3O5YA 1N9OA 3U2AA 2VLGA 3VE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6L A;  4IUH A;  4BWI A;  3IBJ A;  4Q0I A;  2IA2 A;  3IBR A;  4G3K A;  2O99 A;  2W1T B;  2W3H A;  3KO6 A;  2HGV A;  4E04 A;  4DMZ A;  4ZRR A;  1TD5 A;  4O01 A;  2O0Y A;  2QYB A;  4LRX C;  4MCW A;  4IUK A;  2XSS A;  3LFV A;  3NOU C;  2G7U A;  3KSF A;  1ZTU A;  5TJJ A;  4YNR A;  1YSP A;  3RFB A;  3KSI A;  2O9C A;  5C5K A;  3TRC A;  3MQ0 A;  2W3G A;  4ETX A;  4PAU A;  4ME4 A;  5LBR A;  3MF0 A;  3S7Q A;  4R70 A;  4MMN A;  5L8M A;  2KLI A;  2B18 A;  2VZW A;  4ETZ A;  3OBF A;  2M7U A;  2VEA A;  2K2N A;  5HPI A;  4QPR A;  4GW9 A;  3DBA A;  2O9A A;  3CIT A;  3E0Y A;  2W3E A;  4FOF A;  5DFY A;  4O0P A;  2ZMF A;  3E98 A;  4LRZ E;  5I5L A;  5DFX A;  2M7V A;  4Y5F A;  5HSQ A;  3S7N A;  4Q0J A;  3OOV A;  2W3F A;  3MMH A;  3EEA A;  4MDZ A;  3C2W A;  4G3W A;  3S7O A;  3BJN A;  2LB9 A;  3G6O A;  4Z1W A;  4G3V A;  3VV4 A;  3ZQ5 A;  2GX5 A;  1STZ A;  3D3O A;  3CI6 A;  2W3D A;  4GLQ A;  1YSQ A;  3NHQ A;  2LB5 A;  1YKD A;  3NOT C;  3NOP C;  1F5M A;  5HL6 A;  4MN7 A;  4Q0H A;  1MKM A;  4O8G A;  2VJW A;  3HCY A;  3KSG A;  2KOI A;  2XRN A;  2Y8H A;  3S7P A;  2VKS A;  4LRY C;  3R4K A;  2OOL A;  2W1T A;  5HPF A;  5AJG A;  3K2N A;  4EU0 A;  2XRO A;  3KSH A;  1MC0 A;  4RQ9 A;  4Y2F A;  2Y79 A;  4CQH A;  1TF1 A;  4EUV A;  4YOF A;  5K5B A;  4IJG A;  4DN0 A;  4Y3I A;  1VHM A;  3O5Y A;  2O9B A;  3W2Z A;  2K31 A;  2W1R A; 
#chains in the Genus database with same CATH topology
 3MXR A;  2JKF A;  1J9M A;  1DRM A;  1MBL A;  1VB6 A;  3GDI A;  4JLF A;  3LYX A;  2OLV A;  3QHY A;  2ZQA A;  4P6B A;  3Q7V A;  4UAA A;  2XFT A;  4K0W A;  3V3S A;  3T4Q A;  1GHP A;  4HIA A;  3WS0 A;  4R38 A;  1ZKJ A;  1MWT A;  4JXW A;  1RP5 A;  1S6R A;  2QMI A;  1OJ5 A;  1L0D A;  4N1H A;  4FTX A;  4ARZ B;  2DMW A;  3MQ0 A;  4RA7 A;  3MZD A;  3QNB A;  5FQK A;  3DW0 A;  2ZC6 B;  3IX8 A;  4ZAM A;  1MY8 A;  3FV7 A;  3O3V A;  3LR0 A;  5F1G A;  3H82 A;  4MMN A;  2A3U A;  3HLC A;  2VZW A;  4C6Y A;  4ETZ A;  4L9F A;  4CPK A;  3OBF A;  2GJ3 A;  1LT0 A;  1QME A;  1YLJ A;  1CI8 A;  3IF6 C;  4QPR A;  5D3O A;  5E2E A;  3VP4 A;  5HWV A;  3RXW A;  2PU2 A;  3QP5 A;  5CGW A;  3IS2 A;  4HH2 A;  3RH8 B;  2ZC7 A;  4EUZ A;  3GTC A;  4PPR A;  1VET B;  1ALQ A;  4BD1 A;  2V0U A;  2JCH A;  2W3D A;  3PAG A;  3UE3 A;  1D06 A;  2ZM2 A;  3MQQ A;  4H8R A;  4GJ4 A;  1OTB A;  2G2W A;  1Z6F A;  2VGL M;  4MNR A;  4GB7 A;  3UE1 A;  1XA7 A;  5DJU A;  3GEC A;  1KE0 A;  4B4X A;  2JKT I;  4R3A A;  1Y28 A;  3C4P A;  5FDS A;  4PKY A;  5J8X A;  4RQ9 A;  4HJ3 A;  1T1B A;  3BFC A;  3G31 A;  1PW1 A;  3H7W A;  2DRW A;  5HD3 A;  1D7E A;  2Y2P A;  2Y59 A;  4MN6 A;  4DXC A;  4D2O A;  5FL3 A;  2OAP 1;  4XUZ A;  3VFH A;  1H8M A;  3PYP A;  2C5W B;  4B88 A;  2X02 A;  4JXV A;  3WS5 A;  5M18 A;  1KE3 A;  1ES2 A;  1G6A A;  1UGU A;  5HWT A;  3MZF A;  1MWS A;  5DJT A;  1XKZ A;  3LIB A;  4ME4 A;  1VEU B;  4M4X A;  1FSY A;  1NJ4 A;  2B95 A;  2C6W B;  3EQU A;  3IXG A;  3P98 A;  4O0P A;  4Y0U A;  5G18 A;  5I5L A;  3IXB A;  2H0Y A;  2PBY A;  3OOV A;  4I39 A;  4X68 A;  4QWO A;  2ZC4 B;  3SW1 A;  2WKH A;  4P87 A;  1L2S A;  3ZQ5 A;  1XFQ A;  4PM7 A;  4KQD A;  4RVA A;  4YIN A;  1YKD A;  4MN5 A;  3PBR A;  4S2I A;  5GLC A;  2JE5 A;  4FH2 A;  4O8G A;  3NUL A;  3KSG A;  1JWP A;  3Q07 A;  1CJF A;  1FQG A;  2XK1 A;  3QP1 A;  2Y2N A;  4M3K A;  2J3T C;  4ESP A;  5FQI A;  3E2L A;  4JKT A;  2Y79 A;  4HI4 A;  3PBQ A;  4PM9 A;  4KG5 A;  4S2P A;  3BY9 A;  2P7J A;  1TS7 A;  3OC2 A;  2DNS A;  1NZU A;  4CJN A;  4F3L A;  1S1Z A;  1EI5 A;  2QWS A;  4UA9 A;  1S4S A;  2J9O A;  5HX9 A;  3C7V A;  1KDS A;  1JTG A;  5GLA A;  2Y2O A;  2ZBB A;  3IXD A;  5EM1 A;  1S67 L;  3BQA A;  2G7U A;  5TBM A;  3B33 A;  4P85 A;  2W0N A;  1GHM A;  3PR6 A;  3BFD A;  1NRF A;  1Y4O A;  2JKT M;  4NXE A;  4Z9Q A;  5F6A A;  3HLF A;  4Q8I A;  3Q7V B;  1NZO A;  4OPY A;  4XUX A;  1XJ4 A;  4Y17 A;  3VSK A;  5KMW A;  2VV6 A;  1JVJ A;  2ZM8 A;  1V9Z A;  3E0Y A;  2EXB A;  5DTK A;  3UPO A;  2P74 A;  2OLU A;  5GHZ A;  3JPU A;  4EW7 A;  1K0K A;  1HLU P;  3HBR A;  1PRQ A;  4EQI A;  1ZG6 A;  1YT4 A;  2QJ7 A;  2V8C A;  3UPN A;  4FCF A;  3A3E A;  4KG2 A;  2ZM0 A;  3WWX A;  1K56 A;  2ACG A;  1G28 A;  4U3T A;  2EFU A;  2HP5 A;  3SZT A;  4U0T A;  3IS2 B;  5A90 A;  3A0S A;  2FH5 A;  4MBF A;  4Y0T A;  4GHI A;  3CAX A;  1K6S A;  2ZQ8 A;  4GOG A;  2E8J A;  5HPF A;  3B3X A;  2HDS A;  4KZ4 A;  3T4S A;  1SCW A;  4IJG A;  5DKK A;  2Q9N A;  3PXP A;  3T4L A;  2H5S A;  4IUH A;  2EX9 A;  1NRJ A;  1JWV A;  4PM8 A;  3FC7 A;  1WYB A;  1FSW A;  1KVM A;  1XJ3 A;  2J7V A;  4O01 A;  5AQA A;  4OQI A;  3PBS A;  2PDR A;  3FZC A;  4IUK A;  3LIC A;  3E4Q A;  3LUQ A;  1BLC A;  4S2J A;  3VOZ A;  5FSR A;  3KSI A;  2O9C A;  4EQ1 A;  3TRC A;  3V5M A;  3DTE A;  1PFL A;  4PAU A;  3T1R A;  3DWZ A;  3LGO A;  3UY6 A;  3V50 A;  1LL9 A;  1YM1 A;  3F1P A;  5BOH A;  3FPV A;  4HQA A;  3IX3 A;  4ZTK A;  5HAI A;  5L8M A;  4EWF A;  5FI7 A;  2VGK A;  3HRE A;  4WYY A;  2W3E A;  2QHK A;  2HP6 A;  5DFX A;  5EOE A;  2R9W A;  1ACF A;  1K55 C;  4X69 A;  3DWK A;  3S7N A;  5AVF A;  4EBL A;  5CED A;  3MR0 A;  2LB9 A;  4Y15 A;  1FR6 A;  1LSX A;  4NEE D;  4DDY A;  4YWZ A;  3OPR A;  4X53 A;  4JXG A;  1LLB A;  4R3J A;  3LIF A;  5CEB A;  1CK3 A;  1XJ2 A;  1KGF A;  2OWJ A;  2R9X A;  4EV4 A;  4E6W A;  1X0O A;  2GNX A;  2W27 A;  2EWW A;  5HZH A;  1N9N A;  4EU0 A;  1GCE A;  2ZQ9 A;  2P04 A;  4Y2F A;  3ZNY A;  3LIE A;  5F82 A;  4QHC A;  3HLE A;  5FI2 A;  3VE4 A;  1O07 A;  4BBU A;  3DTK A;  1K57 C;  2NUT C;  3IBR A;  2I72 A;  3NC8 A;  1NYY A;  3FYZ A;  4WMC A;  4PHT A;  4E04 A;  3CWF A;  1BLP A;  3UDX A;  3O88 A;  2JN7 A;  1YQS A;  1H5X A;  2WKI A;  5HD5 A;  3LY4 A;  1IKG A;  3GQZ A;  4UQI M;  5TJJ A;  3IH9 A;  3ISG A;  2J9P A;  1PI5 A;  4F3L B;  3R7W A;  3UME A;  1HVB A;  1PYY A;  3GRJ A;  4E3L A;  2M7U A;  3HUO A;  1SZV A;  4PKY G;  1BT5 A;  5TBM B;  4HES A;  4FOF A;  3AGD A;  3MFX A;  5IHV A;  4DXB A;  1NYM A;  1TVF A;  3VOY A;  5GHX A;  3P09 A;  1OJG A;  4LGW A;  4EER A;  3NY4 A;  3L9K A;  4I5S A;  4U0X A;  4H6J A;  4WUJ A;  1ERM A;  2WUQ A;  3M6H A;  4MBH A;  4FH4 A;  5FEF A;  2UV0 E;  4WZ4 A;  2Y8H A;  3ZGA B;  4IBX A;  4GDB A;  2OOL A;  3ZFZ A;  3ZG8 B;  3VP3 A;  5CHM A;  3UNW A;  3DTI A;  2Y55 A;  4KQR A;  3W2Z A;  4RX3 A;  1ODV A;  3T4K A;  1PI4 A;  2HDU A;  4GHI B;  5FDH A;  4K91 A;  5A8B A;  2XD1 A;  4OPR A;  1E4D A;  3NIA A;  1HD8 A;  4KUO A;  1SDE A;  4KZA A;  4WEK A;  5HW3 A;  3Q1F A;  1QMF A;  1T1C A;  2V20 A;  4D60 A;  5DTS A;  4OQ0 A;  1F98 A;  1JWZ A;  5EM0 A;  2KX6 A;  1W7F A;  5JYO A;  3AGF A;  2JKR I;  4DDS A;  3CIT A;  1E3U A;  4DE3 A;  5DFY A;  4HOI A;  3E98 A;  4R0Q A;  3HL9 A;  3W4P A;  4MLL A;  4MEZ A;  5CX7 A;  3ZG7 B;  3LY3 A;  3S7O A;  2YKF A;  4IVK A;  1IKI A;  3F1P B;  1IOU A;  3KYZ A;  4C75 A;  2Y2J A;  4L9G A;  1ONG A;  4N9K A;  3UDF A;  2X01 A;  1XP4 A;  3FWL A;  3A0R A;  3CZD A;  3IQA A;  2IWB A;  3SH8 A;  3DAV A;  4L9E A;  2VK3 A;  3GV9 A;  5E2G A;  1MKM A;  2OWH A;  4P6Z M;  3EWK A;  4ZJ3 A;  3S7P A;  3V3R A;  1H0M A;  1WA9 A;  2W1T A;  1PZO A;  4NKP A;  5FQ9 A;  4QB8 A;  5AJG A;  4AFI A;  2L1M A;  2NUP C;  1IYP A;  1OTD A;  4UHU A;  4Y7P A;  1Q2P A;  5E43 A;  2P9V A;  4DKI A;  4Q0I A;  3BQ8 A;  2IA2 A;  2DCF A;  1DP9 A;  2D02 A;  4HP9 A;  5CRF A;  3BFG A;  3IH8 A;  4QY5 A;  3ZYT A;  3CLO A;  1YLY A;  3FG8 A;  2J3W A;  2WKQ A;  3BEC A;  2XFS A;  4WM9 A;  4DRT A;  3HJK A;  1ERO A;  2VX8 A;  4ZBE A;  2PR6 A;  1PWG A;  4ETX A;  1K55 A;  1N9B A;  4OOL A;  2VV8 A;  4CLC A;  2EX8 A;  4R23 A;  4KZB A;  3UE6 A;  2OSU A;  3E2K A;  3V67 A;  3TW8 A;  2EA9 A;  1PIO A;  3ZG5 A;  1YLW A;  1MKI A;  5HSQ A;  2R78 A;  2Y2K A;  4UQI S;  3FKV A;  4HP4 A;  4C3Q A;  3GMW A;  2Z6C A;  1J3W A;  3CI6 A;  1NWZ A;  4KZ5 A;  4GLQ A;  2IWD A;  5GLD A;  2QZ6 A;  1OTA A;  2VJW A;  1FIL A;  3HCY A;  4QU3 A;  5EVL A;  1KDW A;  2INW A;  2H28 A;  3KYE A;  5AQ7 A;  1KVL A;  4OLG A;  3OPH A;  1H3Q A;  3F1N A;  4NXF A;  2WGI A;  1Z09 A;  4E3J A;  1W8Q A;  1MC0 A;  1Q2Q A;  2JKR M;  4H6J B;  5EE8 A;  4EUV A;  5IT5 A;  4DN0 A;  5CHJ A;  2HZ5 A;  4IBR A;  1IYQ A;  3SS5 A;  3PBN A;  3MJQ A;  3IBJ A;  2MJ6 A;  2P08 A;  2PR5 A;  4G3K A;  1I2S A;  3UDI A;  1SKO A;  1DP6 A;  1K56 D;  3CG5 A;  1YLP A;  5DF8 A;  3V39 A;  3VMA A;  1BLH A;  2PBD P;  5G4Y A;  2ZL1 A;  3LFV A;  4ZJ2 A;  5A93 A;  5EVI A;  1ESI A;  2PYP A;  1G5U A;  3C4O A;  3DTM A;  4YNR A;  2WKR A;  1L0G A;  3BM6 A;  1DP8 A;  1O7E A;  2W3G A;  4GDN A;  2XA7 M;  4KZ6 A;  1YMS A;  1XJ6 A;  1SDN A;  2KLI A;  3FPW A;  4S2N C;  2B18 A;  3EGX C;  4WF0 A;  4FSF A;  4R1G A;  4KQO A;  2HDQ A;  5HWW A;  4LLO B;  3C5A A;  3TG9 A;  5HDC A;  2EXA A;  3IWQ A;  5HAP A;  1LI9 A;  4JGP A;  3RXX A;  2ZMV A;  3CMZ A;  2HJ9 C;  4JGR A;  4B4Z A;  4ZDX A;  1IYS A;  5FQJ A;  2EFX A;  5F68 A;  5FI6 A;  2LB5 A;  3CHW P;  4OKP A;  3TOI A;  2Y4A A;  4X56 A;  5IU1 A;  1L0F A;  5HDD A;  2XQZ A;  5EOO A;  3HLD A;  4E3O A;  2QPN A;  2BAS A;  4GZB A;  3H82 B;  4I38 A;  1GA0 A;  3K2N A;  4JBF A;  2XD5 A;  2VLG A;  1K4F A;  4R6L A;  1W79 A;  3VFF A;  3N8S A;  5A91 A;  1OT6 A;  1T19 A;  2W1T B;  4OQH A;  2HGV A;  4I3J A;  2Z2L B;  1CEG A;  4DMZ A;  1BUL A;  4P6Z S;  5CEC A;  3LO7 A;  2A2L A;  4EEU A;  4BJP A;  5HDS A;  2X71 A;  3QP6 A;  1ES3 A;  3QP2 A;  1YSP A;  3RFB A;  2PYR A;  5C5K A;  5G4Z A;  3Q81 A;  3HLG A;  1XXM A;  3E4O A;  2D01 A;  1K4E A;  3UB8 A;  5F69 A;  3H7W B;  2K2N A;  3EEH A;  3HUN A;  3BLS A;  3G30 A;  2Q9M A;  3P01 A;  4LRZ E;  4Y5F A;  3IF6 A;  4WMC D;  3NCK A;  2A24 A;  3G35 A;  4CLC B;  3N6I A;  4R4R A;  4E3N A;  3BFE A;  1HTZ A;  3OCL A;  2XR0 A;  3O87 A;  4Y13 A;  3NOT C;  1RGZ A;  3HJI A;  1NXY A;  1XA1 A;  3TSG A;  1K38 A;  4EEP A;  4Q0H A;  4YFM A;  1PW8 A;  4DE0 A;  1UWN X;  4EBP A;  3OLO A;  1CQA A;  5FAP A;  4LRY C;  3N8R A;  3T4T A;  2H10 A;  3W4O A;  1DJA A;  1ZG4 A;  2EWV A;  4WBG A;  1DY6 A;  3KSH A;  3BRM A;  2QJ5 A;  2V8F A;  4Y3I A;  1VHM A;  2W1R A;  5I94 A;  1FR1 A;  4II7 A;  1JTD A;  4EXO A;  3GSG A;  5TR7 A;  2V9A A;  1S66 L;  3F1N B;  2ZC3 B;  3PBT A;  4ZRR A;  2WGW A;  1FCM A;  1VET A;  4QY6 A;  4N1X A;  3MBZ A;  3LR3 A;  5HAR A;  1BUE A;  3NOU C;  2B02 A;  3G2Y A;  1XPB A;  3KSF A;  4OLD A;  3IWO A;  3G32 A;  3T50 A;  2BLS A;  3T1Q B;  4HBT A;  1DJB A;  1MZU A;  3M2J A;  1DJC A;  1PWD A;  1P9R A;  3IF5 A;  5KSC A;  2E8I A;  4E3K A;  5A92 A;  2PHY A;  2HP9 A;  5FAO A;  4I3I A;  3JVU A;  2ZL1 B;  2OV5 A;  1XX2 A;  4JF5 A;  2XEP A;  2V2F F;  3IT9 A;  3ZG9 B;  5EVI B;  3B47 A;  3LCE A;  5HFO A;  1FCO A;  3HUM A;  2VV7 A;  1CEF A;  4Q0J A;  3LIA A;  4GS9 A;  3G6O A;  2QKP A;  2HJE A;  3A3D A;  1KOU A;  2XA7 S;  3OPP A;  3VP1 A;  1I5Q A;  3ZG0 A;  4JF6 A;  4OP8 A;  2ZQD A;  2V1A A;  2XRN A;  4K0X A;  4HJ6 A;  5DF7 A;  4LPZ A;  3R4K A;  1OTE A;  2WZX A;  1OPX A;  3LR4 A;  4L0L A;  4UA6 A;  2XRO A;  4P0M A;  1E3U D;  4FUW A;  3C30 A;  1YLZ A;  2O9B A;  4LFU A;  5DVA A;  4GN2 A;  1U60 A;  1IEL A;  3C38 A;  4OOM A;  3WRT A;  3MFD A;  2WAF A;  1ERQ A;  5L10 A;  3MS6 A;  2W3H A;  4KZ7 A;  4N92 A;  1ZC2 A;  2UWX A;  4IED A;  1N4O A;  4NK3 A;  4KZ9 A;  3LR5 A;  3LID A;  2J8Y A;  4LRX C;  4OH0 A;  1M40 A;  4S2N A;  2Y2L A;  1XFN A;  5U47 A;  5CTM A;  4N9L A;  5CER A;  4XT2 A;  3QP4 A;  4WZ5 C;  3QP8 A;  1K54 C;  3ULF A;  5LBR A;  4OPZ A;  4RYE A;  4LV2 A;  3L7H A;  4S2M A;  4X25 A;  3SS3 A;  4HY8 A;  5GL9 A;  1IFQ A;  3LEQ A;  5AQB A;  3UB7 A;  2ZMF A;  2YKH A;  5AVE A;  2W3F A;  3MMH A;  3CPT A;  1GSV A;  3UB5 P;  1BTL A;  1GSX A;  3IF6 B;  5HL6 A;  1ES5 A;  2A24 B;  3MKF A;  3WRZ A;  4KEN B;  1NLY A;  4JGQ A;  2WZZ A;  3ITA A;  3BWL A;  4E3I A;  4CLC D;  5M19 A;  4GNU A;  2PD7 A;  2WYX A;  4YOF A;  2FZ0 A;  3KX0 X;  5FQQ A;  3S4X A;  5EFW A;  2JKG A;  4BWI A;  2WK0 A;  1F9I A;  1JNU A;  1ES4 A;  3GVB A;  2FFF B;  3K3C A;  5KIZ A;  3S22 A;  2O0Y A;  2ZOH A;  3CUE C;  3A3F A;  1CF0 A;  2HDR A;  3VP2 A;  5KZH A;  4ID4 A;  3MXQ A;  3ZNT A;  4BMW A;  1Y54 A;  2L4R A;  4A5R A;  3IXH A;  4R4S A;  1H8Z A;  5IS1 A;  3N7W A;  3NDE A;  1MXO A;  3ICY A;  3NEC A;  4Y0O A;  2WGW B;  1GHI A;  2K7S A;  4PMA A;  2ZMA A;  2J80 A;  3OCN A;  4X55 A;  1RCJ A;  2O9A A;  2XH9 A;  3MSH A;  1EWZ A;  3VSL A;  1OT9 A;  2V1Z A;  4G3W A;  4O7D A;  2WKE A;  1WE4 A;  1M6K A;  5EVI D;  4HHD A;  1F5M A;  3OPL A;  1FCN A;  3HLW A;  4GS9 B;  3LEZ A;  1TEM A;  1ESU A;  1F2K A;  3W4Q A;  3WS2 A;  1LL8 A;  3R7W B;  2OAQ 1;  1TS6 A;  4I3A A;  2WAD A;  2Y91 A;  3F1O A;  4HBU A;  1T18 A;  2GZA A;  3MZE A;  4KZ8 A;  4F94 A;  3JYI A;  3U2A A;  3BEB A;  3T12 B;  1V9Y A;  4DE2 A;  4DF6 A;  1LSV A;  1S4R A;  2O99 A;  2M1C A;  3I7J A;  2Y2H A;  1P0Z A;  5JYP A;  1K57 A;  1TS8 A;  2HV1 A;  3BFF A;  4BEN A;  4R3B A;  4MCW A;  1FOF A;  5CGX A;  3AGE A;  3RTY A;  1XGI A;  3WS4 A;  4HJ4 A;  3D9Y A;  5DF9 A;  4XXR A;  1K6R A;  1LL5 A;  2ZJ9 A;  1LSW A;  4JGO A;  4OON A;  2Y2G A;  1MWU A;  1GSW A;  3ZVW A;  5J3W A;  3A0V A;  1KGG A;  3ZVT A;  4GW9 A;  3DBA A;  1N9L A;  4XT2 B;  3NI9 A;  5GLB A;  3IX4 A;  4GD8 A;  2GDN A;  2G2U A;  5CTN A;  1EW0 A;  2RCX A;  3EEA A;  4X1L A;  2H0T A;  5FQM A;  3Q82 A;  3S1Y A;  3BJN A;  3VV4 A;  3LI8 A;  4OPQ A;  4LV3 A;  2GX5 A;  1STZ A;  3T4J A;  3SH7 A;  4DJ2 A;  1G68 A;  3A3I A;  5HL1 A;  3NHQ A;  3IHA A;  1NY0 A;  3NOP C;  4HH3 A;  1RGY A;  1VQQ A;  5GHY A;  3W8K A;  1I2W A;  4X1M A;  4LV0 A;  4OQG A;  5EEC A;  3CPT B;  3P7N A;  1YAX A;  1KGE A;  4GD6 A;  4NXG A;  4NXB A;  4JPM A;  1MPL A;  3UB6 A;  1W63 M;  4OP5 A;  4CQH A;  5K5B A;  1TDG A;  2Y2M A;  2K31 A;  1OME A;  3IWI A;  5CHU A;  3KYQ A;  5M1A A;  3ZDJ A;  2V0W A;  3VE3 A;  1P9W A;  2PAV P;  4EBN A;  4WZ5 A;  2QYB A;  1K54 A;  2FFY A;  3UE0 A;  4KUK A;  1ONH A;  1L0E A;  1SHV A;  1MWR A;  5EPH A;  4PM5 A;  2CMN A;  1A0K A;  5EV0 A;  2Z6D A;  1C3B A;  4OVD A;  4S2O A;  5L09 A;  2Y2Q A;  4EET B;  4PM6 A;  1AXB A;  1E25 A;  5AQ9 A;  2BG1 A;  3SOI A;  3ZCZ A;  2P9V B;  4HNB A;  3Q7Z A;  2M7V A;  1OTI A;  5E2H A;  1UWP X;  3K3D A;  3D4F A;  5TGF A;  3C2W A;  4UEY A;  4Z1W A;  1LI0 A;  1ZHH B;  3ITB A;  2XDM A;  3PHY A;  1G6O A;  1YMX A;  1YSQ A;  1BLS A;  1BYW A;  2VA0 A;  4BL2 A;  4MN7 A;  4B93 A;  4JF4 A;  1BZA A;  5FAQ A;  4LCM A;  3OZH A;  2VKS A;  3UN7 A;  1NLZ A;  4E6X A;  4WLA A;  2VGL S;  2I9V A;  3B42 A;  2WAE A;  1IYO A;  1TF1 A;  4QD4 A;  3C7U A;  3RJU A;  3M6B A;  3CUE A;  4IVI A;  3EGD C;  2CC1 A;  3ZHH A;  4BD0 A;  4QJG A;  4KZ3 A;  4IHQ A;  2PD8 A;  5FAS A;  2L0W A;  4KG6 A;  3TE8 A;  3F1O B;  4ARZ A;  5DTT A;  5EUA A;  4OOY A;  3BLM A;  4B9O A;  1TD5 A;  3FKW A;  3T1S A;  5F83 A;  4RX2 A;  3UMD A;  2WGV A;  2B5R A;  2PRF A;  3N8L A;  3MKE A;  3PBO A;  2ZLY A;  4CLC C;  1W63 Q;  2IWC A;  3VP0 A;  3HLB A;  3UB9 A;  1CI9 A;  1FIK A;  3JVV A;  5DKL A;  3MF0 A;  3S7Q A;  1H8Y A;  2PT7 A;  2KDK A;  1XGJ A;  2ZD8 A;  2J3T D;  4EES A;  4ZJ1 A;  2VEA A;  2JBF A;  2Z2M B;  1TS0 A;  4X6T A;  5FAT A;  5CGS A;  4MDZ A;  3GR2 A;  4BL3 A;  4GCZ A;  1SKO B;  1L3L A;  4G3V A;  5FA7 A;  1YPR A;  5MC7 A;  2AVX A;  3D3O A;  3MQO A;  1S0W A;  4GKU A;  4WL9 A;  1P97 A;  2A49 A;  1LHY A;  3M2K A;  3HVF A;  2EX6 A;  2PU4 A;  1VM1 A;  2KOI A;  2JC7 A;  4UA7 A;  4LCL A;  4WEL A;  3NJA A;  3PAE A;  3IHB A;  2EX2 A;  1GA9 A;  3U4L P;  5F1F A;  4JXS A;  1KE4 A;  3MXS A;  5EVE A;  4E3M A;  1YLT A;  3UO9 A;  5J7E A;  3C8C A;  3QNC A;  2JHE A;  4S2L A;  3G4P A;  3UPP A;  4K08 A;  3LI9 A;  3VOL A;  1BSG A;  3A3J A;  1PZP A;  1PNE A;  3N4I A;  3BW6 A;  1D1J A;  3KO6 A;  4DE1 A;  2XF3 A;  4BBT A;  5J4E A;  3EQV A;  5KSH A;  1S1Y A;  4BLM A;  3E4P A;  4BQM A;  4S2K A;  1VEU A;  5EVI C;  2BTF P;  4CLC E;  5TFQ A;  4LV1 A;  2XSS A;  4NET A;  3G34 A;  4WN5 A;  1ZTU A;  2ZOI A;  1T1A A;  3NBL A;  1IEM A;  5E2F A;  3T1X A;  5CXW A;  2RL3 A;  3G2Z A;  3O86 A;  2XLN A;  5FEG A;  4R70 A;  5L2F A;  2V1B A;  5HPI A;  3EOI A;  3SS4 A;  4KQQ A;  4MBK A;  1HZO A;  3CJM A;  2ZQ7 A;  5F5Y A;  3PTE A;  3BYD A;  1WYC A;  4WEJ A;  2HF6 A;  3H9W A;  3NDG A;  1W5D A;  1W8Y A;  3WS1 A;  4HEF A;  1SKF A;  4FD8 A;  3T4O A;  4NG2 A;  3BY8 A;  1PWC A;  1K25 A;  1AWI A;  2XGN A;  4BBV A;  3D72 A;  2ZQC A;  5L07 A;  2Q0O A;  2HPB A;  2VGJ A;  2WKP A;  2Y2I A;  4LEN A;  2ZC5 B;  1TDL A;  3TJZ C;  4DJ3 A;  3O5Y A;  1N9O A;  3SH9 A;  5HAQ A; 
#chains in the Genus database with same CATH homology
 4R6L A;  1DRM A;  4BBU A;  1V9Y A;  1OT6 A;  1VB6 A;  2NUT C;  3GDI A;  3IBR A;  1LSV A;  1S4R A;  1T19 A;  2O99 A;  2W1T B;  2M1C A;  3LYX A;  4PHT A;  2HGV A;  4I3J A;  1P0Z A;  4E04 A;  4DMZ A;  3CWF A;  2JN7 A;  4P6Z S;  1TS8 A;  2HV1 A;  2A2L A;  4MCW A;  4EEU A;  4BJP A;  5HDS A;  5HD5 A;  3T4Q A;  4HIA A;  3RTY A;  4R38 A;  4UQI M;  4HJ4 A;  5TJJ A;  5DF9 A;  1OJ5 A;  1YSP A;  3RFB A;  2PYR A;  5C5K A;  5G4Z A;  4ARZ B;  2DMW A;  3E4O A;  3MQ0 A;  1LSW A;  4JGO A;  2D01 A;  4F3L B;  1GSW A;  3R7W A;  3UME A;  5J3W A;  3LR0 A;  3A0V A;  3H82 A;  4MMN A;  3UB8 A;  5F69 A;  2VZW A;  4ETZ A;  4L9F A;  3OBF A;  2M7U A;  3H7W B;  2GJ3 A;  1LT0 A;  2K2N A;  4QPR A;  4PKY G;  4GW9 A;  3DBA A;  3EEH A;  5TBM B;  1N9L A;  4FOF A;  5HWV A;  3MFX A;  3P01 A;  4LRZ E;  4XT2 B;  4Y5F A;  3IS2 A;  1EW0 A;  2A24 A;  3EEA A;  4HH2 A;  3RH8 B;  4CLC B;  3BJN A;  3VV4 A;  3LI8 A;  1OJG A;  3OCL A;  2GX5 A;  1STZ A;  4EER A;  3T4J A;  2V0U A;  4DJ2 A;  4I5S A;  2W3D A;  3UE3 A;  1D06 A;  3NHQ A;  3NOT C;  3HJI A;  4H6J A;  4WUJ A;  3NOP C;  3MQQ A;  4EEP A;  4HH3 A;  4GJ4 A;  1OTB A;  4Q0H A;  2VGL M;  2Y8H A;  1UWN X;  3OLO A;  5DJU A;  3GEC A;  4LRY C;  2OOL A;  3P7N A;  3T4T A;  1YAX A;  2JKT I;  4R3A A;  4NXG A;  4NXB A;  1Y28 A;  2EWV A;  4PKY A;  3UB6 A;  1W63 M;  3KSH A;  4RQ9 A;  4HJ3 A;  4CQH A;  1T1B A;  2QJ5 A;  5K5B A;  3H7W A;  4Y3I A;  1VHM A;  3W2Z A;  2K31 A;  2W1R A;  1ODV A;  4II7 A;  3T4K A;  5HD3 A;  4EXO A;  3KYQ A;  1D7E A;  2V9A A;  4GHI B;  2V0W A;  3VE3 A;  1P9W A;  1S66 L;  3F1N B;  4MN6 A;  5A8B A;  3PBT A;  4ZRR A;  5FL3 A;  2OAP 1;  2QYB A;  1H8M A;  3PYP A;  4KUK A;  4KUO A;  3LR3 A;  4WEK A;  3NOU C;  1T1C A;  2B02 A;  3KSF A;  3T50 A;  1UGU A;  2CMN A;  5HWT A;  1MZU A;  2Z6D A;  1F98 A;  1P9R A;  5DJT A;  2KX6 A;  3LIB A;  4ME4 A;  4EET B;  4M4X A;  2PHY A;  4I3I A;  3JVU A;  2JKR I;  3EQU A;  3B47 A;  3CIT A;  5DFY A;  4HOI A;  4O0P A;  4HNB A;  3E98 A;  5I5L A;  2M7V A;  1OTI A;  2VV7 A;  1UWP X;  4Q0J A;  3OOV A;  3K3D A;  5CX7 A;  3LIA A;  4I39 A;  4GS9 A;  3C2W A;  3S7O A;  4UEY A;  2YKF A;  4Z1W A;  3G6O A;  3F1P B;  2QKP A;  3SW1 A;  3ZQ5 A;  1IOU A;  3KYZ A;  1ZHH B;  2HJE A;  1XFQ A;  3PHY A;  1G6O A;  1KOU A;  4L9G A;  4KQD A;  3A0R A;  1YSQ A;  2XA7 S;  1YKD A;  1BYW A;  4L9E A;  2VA0 A;  4MN7 A;  4B93 A;  4MN5 A;  3PBR A;  1MKM A;  4O8G A;  2OWH A;  4P6Z M;  3KSG A;  3EWK A;  2V1A A;  2XRN A;  3S7P A;  4HJ6 A;  2VKS A;  4LPZ A;  1NLZ A;  3R4K A;  1OTE A;  1WA9 A;  2W1T A;  4WLA A;  2VGL S;  1OPX A;  2I9V A;  3LR4 A;  4NKP A;  2J3T C;  4L0L A;  3B42 A;  5AJG A;  4AFI A;  2XRO A;  2L1M A;  2Y79 A;  2NUP C;  1TF1 A;  4HI4 A;  3C30 A;  1OTD A;  3CUE A;  3PBQ A;  2O9B A;  3EGD C;  3C38 A;  4OOM A;  3BY9 A;  2P7J A;  4Q0I A;  3BQ8 A;  2IA2 A;  4IHQ A;  1TS7 A;  1DP9 A;  2D02 A;  2W3H A;  2PD8 A;  4HP9 A;  2L0W A;  3TE8 A;  3OC2 A;  3F1O B;  4ARZ A;  3ZYT A;  3CLO A;  4B9O A;  1TD5 A;  4F3L A;  3LR5 A;  1S1Z A;  3FG8 A;  3LID A;  2QWS A;  4LRX C;  1S4S A;  3UMD A;  2J3W A;  2WKQ A;  2ZBB A;  1S67 L;  3BQA A;  2G7U A;  3HJK A;  5TBM A;  1XFN A;  3B33 A;  3PBO A;  2W0N A;  3PR6 A;  2VX8 A;  4CLC C;  4XT2 A;  1W63 Q;  3UB9 A;  2PR6 A;  2JKT M;  4NXE A;  4ETX A;  5F6A A;  3ULF A;  3JVV A;  4OOL A;  5LBR A;  5DKL A;  2VV8 A;  3MF0 A;  4CLC A;  3S7Q A;  1XJ4 A;  4HY8 A;  2PT7 A;  2KDK A;  1IFQ A;  2VV6 A;  3UE6 A;  2J3T D;  4EES A;  2VEA A;  3V67 A;  1TS0 A;  1V9Z A;  3TW8 A;  3E0Y A;  3UB7 A;  2EA9 A;  2ZMF A;  5HSQ A;  2YKH A;  5AVE A;  2R78 A;  2W3F A;  3MMH A;  4MDZ A;  4EW7 A;  4GCZ A;  4UQI S;  4G3V A;  4HP4 A;  5MC7 A;  2QJ7 A;  2Z6C A;  1GSV A;  3D3O A;  3MQO A;  3CI6 A;  4WL9 A;  1NWZ A;  4GLQ A;  1GSX A;  1P97 A;  1G28 A;  5HL6 A;  3IS2 B;  2A24 B;  1OTA A;  3HCY A;  2VJW A;  3A0S A;  2KOI A;  2FH5 A;  1NLY A;  4JGQ A;  3BWL A;  2INW A;  4CLC D;  4WEL A;  3NJA A;  2H28 A;  4GHI A;  3CAX A;  1H3Q A;  3F1N A;  4NXF A;  5HPF A;  2PD7 A;  1MC0 A;  2JKR M;  5J7E A;  4H6J B;  3C8C A;  3T4S A;  2JHE A;  4YOF A;  4EUV A;  2FZ0 A;  5IT5 A;  4IJG A;  5DKK A;  4DN0 A;  3KX0 X;  4K08 A;  3PXP A;  3LI9 A;  3VOL A;  3T4L A;  5EFW A;  4IUH A;  3PBN A;  3MJQ A;  4BWI A;  3IBJ A;  1NRJ A;  2MJ6 A;  2P08 A;  2PR5 A;  1F9I A;  1JNU A;  4G3K A;  3BW6 A;  3FC7 A;  3KO6 A;  1XJ3 A;  4BBT A;  3K3C A;  5J4E A;  3EQV A;  4O01 A;  5KIZ A;  1S1Y A;  1DP6 A;  5KSH A;  2O0Y A;  2ZOH A;  3PBS A;  3CUE C;  3E4P A;  2PDR A;  3MXQ A;  4BMW A;  4CLC E;  4IUK A;  2L4R A;  2XSS A;  3LIC A;  3LFV A;  5G4Y A;  3E4Q A;  3LUQ A;  4WN5 A;  2PYP A;  5IS1 A;  1ZTU A;  2ZOI A;  1T1A A;  4YNR A;  2WKR A;  3KSI A;  2O9C A;  4EQ1 A;  1DP8 A;  3ICY A;  3TRC A;  2W3G A;  4PAU A;  2XA7 M;  2K7S A;  1XJ6 A;  3F1P A;  4R70 A;  3FPV A;  2J80 A;  4HQA A;  5L8M A;  2KLI A;  3FPW A;  2B18 A;  3EGX C;  3OCN A;  4WF0 A;  2V1B A;  4FSF A;  5HPI A;  3EOI A;  4KQO A;  2O9A A;  2W3E A;  2QHK A;  4LLO B;  5HWW A;  5DFX A;  3S7N A;  5AVF A;  5HDC A;  3MR0 A;  1OT9 A;  4G3W A;  2LB9 A;  4JGP A;  5F5Y A;  2ZMV A;  1LSX A;  2HJ9 C;  4JGR A;  4NEE D;  4YWZ A;  4WEJ A;  2HF6 A;  5F68 A;  3H9W A;  2LB5 A;  4HHD A;  5IU1 A;  3LIF A;  5HDD A;  1F5M A;  1XJ2 A;  2OWJ A;  4GS9 B;  3T4O A;  1X0O A;  2GNX A;  1LL8 A;  2W27 A;  3R7W B;  3BY8 A;  2BAS A;  2OAQ 1;  1TS6 A;  3H82 B;  4I3A A;  4BBV A;  2EWW A;  3D72 A;  5HZH A;  4I38 A;  3F1O A;  1T18 A;  1N9N A;  2GZA A;  2WKP A;  3K2N A;  4EU0 A;  2P04 A;  4Y2F A;  3LIE A;  3TJZ C;  4DJ3 A;  3O5Y A;  1N9O A;  3U2A A;  2VLG A;  3VE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...