2W1RA

Crystal structure of the c-terminal domain of b. subtilis spovt
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
117
structure length
117
Chain Sequence
b'DFAKEYADALYDSLGHSVLICDRDVYIAVSGSSKKDYLNKSISEMLERTMDQRSSVLESDAKSVQLVNGIDEDMNSYTVGPIVANGDPIGAVVIFSKDQTMGEVEHKAVETAAGFLA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAGE V SPORULATION PROTEIN T
molecule tags Transcription
source organism Bacillus subtilis
publication title Crystal Structure of Spovt, the Final Modulator of Gene Expression During Spore Development in Bacillus Subtilis
pubmed doi rcsb
total genus 41
structure length 117
sequence length 117
ec nomenclature
pdb deposition date 2008-10-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 2w1rA00
4PAUA 4BWIA 2W1RA 2W3GA 4EUVA 3HCYA 2Y79A 2XSSA 2VZWA 3KSGA 1YSPA 2W3FA 4G3VA 4O8GA 5HSQA 2B18A 1STZA 4Z1WA 2VKSA 4ME4A 2OOLA 3MQ0A 3NOUC 3S7QA 4R6LA 1MKMA 4O01A 2VJWA 3CI6A 3KSHA 3E0YA 5DFYA 3VV4A 4Y2FA 1YSQA 5HL6A 3O5YA 4FOFA 3OOVA 4YNRA 4E04A 4LRXC 4IJGA 2O0YA 2QYBA 4Q0IA 3MF0A 2KLIA 3OBFA 2M7VA 4Y3IA 1TD5A 5HPIA 3NOTC 4ZRRA 1TF1A 3R4KA 4RQ9A 5C5KA 3IBRA 3K2NA 2W1TB 3KO6A 4O0PA 3RFBA 4G3WA 4Y5FA 4MMNA 1F5MA 2IA2A 2W3DA 2M7UA 4DMZA 4Q0HA 3S7NA 3W2ZA 4CQHA 3NOPC 5I5LA 5HPFA 4IUKA 2HGVA 2LB5A 2LB9A 3KSFA 2O9CA 3KSIA 2VEAA 3D3OA 2K2NA 5K5BA 3TRCA 4YOFA 4DN0A 4GW9A 5AJGA 4R70A 3LFVA 3G6OA 2GX5A 4LRYC 4IUHA 4G3KA 3S7PA 2O99A 2W3HA 3MMHA 5TJJA 2O9AA 4LRZE 3BJNA 2XRNA 1YKDA 4ETXA 3C2WA 3ZQ5A 2W1TA 2KOIA 2G7UA 2ZMFA 3DBAA 1MC0A 1ZTUA 2K31A 2XROA 4GLQA 4MCWA 3S7OA 2W3EA 2O9BA 2Y8HA 5LBRA 4MN7A 4QPRA 4EU0A 4ETZA 4Q0JA 3IBJA 3NHQA 5L8MA 3CITA 3E98A 1VHMA 4MDZA 5DFXA 3EEAA
chains in the Genus database with same CATH superfamily
3C38A 4KQRA 3UB5P 3IF6C 1P97A 1ZG6A 3OPRA 1K56A 4BD0A 2B18A 1LT0A 2PAVP 4WF0A 3ZG9B 3C7UA 3QP5A 1OJGA 2QWSA 4HH3A 3IQAA 1XP4A 4FOFA 2E8IA 4E3MA 4HNBA 3QHYA 1S1YA 4GDBA 2PD7A 3R4KA 3VE4A 5J7EA 1BLHA 2EXAA 2R78A 1IYQA 3FG8A 4IBXA 1BLPA 2HDRA 1O07A 3IX8A 4MLLA 4HOIA 3EQVA 1EROA 1J3WA 4DJ3A 2K2NA 4U0XA 4N9LA 1XXMA 3MQOA 1SHVA 3CPTA 3EGDC 3LI8A 2DRWA 1RCJA 1HLUP 4WZ5A 5HFOA 3A3DA 1OJ5A 4CLCE 2EA9A 3C5AA 2G7UA 3B3XA 4WM9A 4OQIA 4K08A 3QP1A 4MCWA 3LR3A 4KZ5A 4S2IA 4YFMA 3UDIA 1ZKJA 5FEFA 5DFXA 3E98A 1BT5A 3PBSA 3S1YA 4OQGA 1N4OA 4EEUA 2Y79A 1W63M 4JF6A 1K54C 4MBHA 3F1OB 1G5UA 3GR2A 3IX3A 4P6ZS 4MBFA 3BRMA 3N8SA 3MQ0A 4LENA 1NZOA 1VETA 5E2GA 1MWUA 1MY8A 4LFUA 3WWXA 2WKIA 3HREA 3GRJA 5GLAA 4YNRA 2D01A 4ZJ3A 1Z09A 1RGZA 2AVXA 4A5RA 2PR6A 1NWZA 1YQSA 3K2NA 3ZYTA 1TDLA 3RFBA 4KZ8A 2HP5A 2GJ3A 4DE1A 3AGEA 2WKQA 1PWGA 3E2LA 3TJZC 4EQIA 3P98A 3TRCA 1PRQA 2XR0A 1XJ6A 4XT2B 4NXBA 1IYPA 3E4OA 2WAEA 3PAEA 5DTKA 3HL9A 1LHYA 5JYOA 2QKPA 3IXBA 3W4OA 3NDEA 3ZQ5A 4D60A 1NRJA 5FAQA 3ITAA 4HJ4A 4QD4A 2VV6A 3MQQA 1TS7A 1SKOA 2OWHA 4Y7PA 2Y2JA 3O86A 3I7JA 2QJ7A 2WUQA 2HDUA 4CLCD 3PHYA 3HUNA 4KG6A 4PM7A 5KIZA 1CJFA 4WLAA 5DF8A 1FCMA 1DP8A 1LSVA 2GZAA 3FKVA 1TS0A 5EM1A 3NDGA 3ZNTA 3VP2A 4HP9A 3UPOA 2I72A 2VJWA 3IF5A 2A3UA 2L0WA 5FDHA 4HI4A 4LCMA 4DJ2A 4CJNA 3GV9A 5A93A 4RX2A 1Z6FA 2Z6CA 3F1NA 4EQ1A 5FA7A 2O0YA 3ZGAB 1MXOA 1FR1A 1E25A 1L0FA 2Y2OA 2H0TA 1N9BA 3RH8B 3WRTA 2HJ9C 3KO6A 1QMEA 5M18A 4Y5FA 4OOYA 1BYWA 4QJGA 3FKWA 1P9RA 4CQHA 3ZG7B 5HPFA 4LLOB 4ARZA 3KSIA 5J8XA 1GA0A 4LPZA 1YMSA 3DTIA 1OTAA 5IU1A 4LRYC 2JKGA 3VOYA 1KGFA 1ZG4A 3LIEA 3S7PA 1F9IA 3DW0A 2EX9A 3BM6A 2EX2A 1YKDA 3SZTA 1FCNA 3DBAA 1ZTUA 4DRTA 4JXWA 3R7WA 1GCEA 2Q9NA 1K54A 4BQMA 1K38A 3BQ8A 4R1GA 3T1SA 3CPTB 1GHPA 5HDCA 3EEAA 2V1BA 2V8FA 4QHCA 4I39A 4X1MA 1XPBA 1KDWA 3WS4A 5KMWA 2Y4AA 5EM0A 1PNEA 5CGXA 4IHQA 5FQQA 2RL3A 4KQQA 4F94A 5HAQA 3S7QA 4LV3A 4F3LB 3PYPA 2VGJA 1XKZA 3C7VA 5E43A 2R9XA 5HW3A 1I5QA 3BEBA 4Q0IA 1C3BA 3OBFA 1L0GA 2M7VA 3GSGA 1FSYA 3EEHA 5AQ7A 1SDEA 3OPPA 3LEZA 4UAAA 3H9WA 5C5KA 3FV7A 5CECA 3OC2A 5A92A 5L2FA 1OTBA 3LIFA 2W3DA 5L10A 2GNXA 5F68A 2FZ0A 3ZFZA 1LSXA 3M2KA 2XFSA 4IUKA 5GHZA 3K3DA 5L09A 1XX2A 3GECA 4OPZA 2P9VA 3TSGA 3K3CA 4GW9A 4R70A 3G6OA 4ID4A 3JVUA 4GHIA 4K0XA 5TGFA 4GS9B 2W3HA 2BTFP 4I3AA 5D3OA 4DE2A 3WS2A 3LI9A 2V2FF 4ZDXA 2J7VA 1VEUB 2A24B 3C4PA 1H5XA 1K6SA 2W3EA 5HDDA 4MN7A 2ZOIA 4C3QA 1Y28A 1E4DA 4JKTA 3NHQA 1VHMA 2G2WA 5EE8A 1K57A 3MZEA 3N8RA 4EUVA 1ESIA 4JBFA 4PM8A 5J3WA 1CEFA 4P87A 1PI5A 2WKPA 2XA7S 5DVAA 2Q9MA 4EV4A 4L9FA 4WMCA 3FC7A 3NULA 2Y2QA 1GHMA 5EECA 5M1AA 2P9VB 3SW1A 5EV0A 5DF9A 3P09A 1BTLA 3O5YA 1DY6A 5HARA 3DAVA 3H7WB 4O7DA 4E3JA 3LIBA 4EETB 4HP4A 3T4LA 1EI5A 3KX0X 4HJ3A 2XDMA 3MKEA 4OOMA 4WL9A 3UMEA 2WKHA 2EWWA 3LO7A 4RQ9A 4ZJ2A 3B33A 4WMCD 2HV1A 2M7UA 1PZOA 2EX6A 1KE0A 5EVIB 5GHYA 2Z2LB 1UWNX 2J80A 1N9LA 3D3OA 1G6AA 2V1ZA 4BMWA 5G18A 1ES5A 1N9OA 5FDSA 4XUZA 2ZJ9A 4KZ6A 3UMDA 4S2OA 4EERA 1PI4A 3ZG8B 3G4PA 5E2EA 2Y91A 3F1PB 5FASA 2YKFA 2ZLYA 1O7EA 3HLFA 3ZG0A 3HLBA 2X01A 4Q0JA 3L7HA 4HJ6A 1IFQA 4FSFA 4PM9A 2A2LA 3KYEA 5E2FA 4UA9A 3QNBA 2C6WB 3KYZA 3G31A 4Q8IA 2WGVA 5F6AA 3HBRA 1MKMA 3V50A 4I3JA 3V5MA 1F2KA 3KSHA 3B42A 2VGKA 4NK3A 5AVEA 1H8ZA 1YM1A 1MWRA 4B9OA 1AXBA 4LGWA 1PWDA 2ZC3B 4JGPA 4KZ9A 2P04A 3V67A 1KGGA 2EWVA 5J4EA 2KLIA 2L1MA 3NCKA 2PBDP 4BBUA 2QJ5A 5HPIA 3IF6B 2JBFA 3ZNYA 2VLGA 2XFTA 3BLSA 2Y55A 2ZD8A 1ES4A 1YMXA 2CMNA 1XJ2A 3MBZA 2XGNA 1TVFA 5FI2A 1L2SA 4PM6A 3IXGA 2A24A 5CEBA 1T1CA 4ARZB 1BUEA 3LR4A 2H28A 5HX9A 3CMZA 5KSCA 1Q2PA 2I9VA 5GLCA 1ESUA 2DCFA 5FI6A 3MFDA 1YLPA 4LRZE 4I5SA 4IVKA 4BL2A 1OTEA 2OAQ1 2P74A 2E8JA 2ZMFA 2ZOHA 4MEZA 3M6BA 3S7OA 3VSLA 1M40A 3H82A 5TFQA 3NY4A 3RJUA 1LI9A 1TDGA 1E3UD 4N1HA 3BFCA 4CLCA 4O8GA 1YLTA 3QNCA 3FZCA 3ZHHA 3P7NA 2UWXA 3W4QA 3F1OA 4ZBEA 3EGXC 3UPNA 1HZOA 4X25A 3V39A 3VV4A 2XF3A 4Y2FA 4H6JA 1X0OA 4HEFA 4E04A 4KG5A 3UY6A 2PR5A 1PZPA 3ICYA 2OSUA 3LY4A 5A90A 1YLYA 5FQJA 1BZAA 3T4TA 4ZTKA 4Q0HA 1IEMA 1J9MA 3E4PA 3BW6A 3R7WB 1CEGA 2JN7A 3T12B 3VE3A 4JGRA 2CC1A 3LIAA 4S2KA 5IT5A 3M2JA 1DRMA 1BSGA 3LICA 2Y2GA 5FATA 3QP2A 1OTDA 3GTCA 2WK0A 3ISGA 4HY8A 2W0NA 3Q1FA 2X71A 4IBRA 3HLGA 3OZHA 4HESA 3UB7A 1KE3A 4NEED 4EU0A 1IYSA 3UE0A 3MXQA 3HLCA 4ETZA 3G32A 4NKPA 1S6RA 1VQQA 2XD5A 1RGYA 2QZ6A 1W79A 4GB7A 2ZQ8A 5FEGA 3G30A 1JTDA 3KSGA 4GJ4A 4GOGA 3UO9A 5HD3A 4BJPA 3A0VA 4UA7A 4S2NC 4Z9QA 3NOUC 2INWA 3PBTA 3M6HA 3NECA 4QB8A 1ERMA 3CI6A 3TG9A 3E0YA 1G6OA 4C75A 2ZM8A 4BLMA 1XJ4A 4KENB 1I2SA 2WZXA 4Y13A 5F83A 1IKIA 3VFFA 2L4RA 4H8RA 5IS1A 4BD1A 4QU3A 3D4FA 5A8BA 3B47A 4OKPA 2W1TB 1HVBA 3VP1A 3V3SA 2Y59A 3BFEA 2JE5A 2ZQAA 3UDXA 5I5LA 4D2OA 3WRZA 4OLGA 1CK3A 3BY9A 3HJKA 2OWJA 2VEAA 3N8LA 1FSWA 1XFQA 1XFNA 3LR5A 4KUKA 2J9PA 4IEDA 4R38A 2O99A 2WYXA 1MKIA 4OH0A 4H6JB 5G4ZA 3WS0A 4OP8A 4PHTA 4N1XA 1JWPA 2XEPA 3CUEC 1MWTA 1WYBA 4CLCC 2HJEA 1IELA 1FILA 5HAIA 5FAOA 1GHIA 1T19A 1F98A 1VM1A 2PHYA 3HJIA 1YLWA 3O3VA 4R3BA 3CAXA 4CPKA 3DWZA 1JWVA 3MFXA 2ZQCA 5FQ9A 1W63Q 4X56A 3WS1A 1HD8A 4Z1WA 4WBGA 1KVMA 1S1ZA 3GDIA 4X53A 2PU4A 2QPNA 4OVDA 3MJQA 3F1PA 3PXPA 3PAGA 3ZVWA 5GLBA 4KUOA 5TBMA 4DXBA 4MNRA 2KDKA 2ZQ9A 3NJAA 5DKKA 2ZMAA 3ITBA 1KGEA 4R3AA 2NUPC 1LL5A 5EPHA 2HP9A 2WKRA 1XJ3A 1LL9A 3OCNA 1YT4A 4G3WA 1ES3A 5GHXA 4PKYA 2EFUA 1GSXA 1Q2QA 3VFHA 2PD8A 3S4XA 1L0EA 1SCWA 4S2JA 3PBRA 4OPQA 3A3JA 4DE3A 2ZBBA 4OQHA 1WA9A 4XXRA 1MPLA 1KVLA 1D7EA 1UGUA 2XRNA 3C2WA 3UN7A 3FPVA 3D9YA 5CXWA 2EX8A 4HHDA 3UNWA 3VMAA 3UDFA 3PBOA 3ULFA 2V9AA 1MWSA 2O9BA 4KG2A 2IWDA 4L0LA 5L8MA 4PMAA 3CITA 2HDSA 4X55A 2ZL1B 1IYOA 3PBNA 5CTNA 2KX6A 2IWBA 3CUEA 4X68A 4MBKA 2VZWA 3LEQA 4EEPA 3GQZA 3IWIA 4E3IA 3Q7ZA 1ALQA 5CGSA 2J8YA 4PKYG 2V8CA 4O01A 1P9WA 1YLJA 3CLOA 4GD8A 4JPMA 1S4RA 4HBTA 3JYIA 1K4EA 4AFIA 4GD6A 1S0WA 4RX3A 1OTIA 3T4QA 2C5WB 2YKHA 1SZVA 2Y2PA 5CX7A 5KSHA 1PW1A 2J3TC 1YAXA 4WUJA 5DJTA 1W8YA 4MMNA 2VX8A 1W8QA 5F1FA 1K56D 2PBYA 4UQIS 1CI9A 2HDQA 4HH2A 2PYRA 1AWIA 3H82B 3A3IA 2JC7A 2MJ6A 4YINA 1RP5A 4I38A 1JVJA 5TBMB 3PBQA 1DP9A 2WGWA 3LIDA 5MC7A 2A49A 3EWKA 2VGLS 3MZFA 3W8KA 4R3JA 4MN5A 4B93A 5F1GA 2ZMVA 4RYEA 1FQGA 3DTKA 1FCOA 1CI8A 3E4QA 4JF5A 2WAFA 1LL8A 1T1BA 2XQZA 3HCYA 2XH9A 4QWOA 2FFFB 3ZDJA 2XLNA 1STZA 3DTMA 2OLUA 1G68A 1D1JA 2OOLA 1KDSA 4LCLA 3IF6A 3MKFA 1DJAA 3HLWA 4F3LA 1YSQA 3OLOA 4BL3A 1DJCA 3Q81A 4GN2A 4OP5A 3OOVA 5AVFA 4GS9A 2B02A 4LRXC 2QYBA 1BULA 2OV5A 2ZC7A 2B95A 4PPRA 3TE8A 4Y3IA 4ZRRA 4L9GA 3MXRA 2V1AA 3LCEA 1FR6A 3VOLA 2VA0A 2J9OA 1W7FA 4O0PA 5EFWA 2XK1A 1XA7A 1D06A 1Y54A 3SH9A 1G28A 2Y2KA 2PRFA 4Y17A 1JNUA 1S66L 2Z2MB 3U4LP 3T4KA 3FYZA 3G34A 5G4YA 2XD1A 4S2PA 3E2KA 1EW0A 2O9CA 5L07A 4RVAA 2JKRM 2VK3A 1K25A 1MBLA 1K55A 2B5RA 2HPBA 5EVIC 5A91A 4KZ3A 3HUOA 5TJJA 3BJNA 3BFFA 4M3KA 2NUTC 3C4OA 2Y2IA 2HF6A 2Y8HA 4XUXA 1NYYA 3S22A 5HWVA 4MDZA 4WEKA 3MSHA 3OPLA 4II7A 4BWIA 2JKRI 3N6IA 4U3TA 1H3QA 2XSSA 5HZHA 1FOFA 3CJMA 4DE0A 3T4JA 4FH2A 3BFGA 4NETA 3UE1A 4MN6A 4QY6A 3Q07A 1L3LA 3IH9A 3Q82A 3A0SA 3T1QB 5CHJA 4RA7A 1PIOA 4WEJA 4R23A 4JXGA 1PFLA 3ZVTA 3CWFA 3CZDA 5BOHA 3WS5A 3SH7A 4X69A 3GMWA 5U47A 4E3KA 1DJBA 1TF1A 5DF7A 4EESA 3IBRA 5CTMA 4E6WA 2V20A 3SH8A 2JKTM 4L9EA 3MZDA 3EQUA 2J3WA 2PYPA 2R9WA 1ONHA 1CF0A 4E6XA 4I3IA 3KSFA 1ONGA 5K5BA 3LGOA 4EBPA 3IXHA 4ESPA 5CEDA 4WYYA 4NG2A 4Y0TA 3EOIA 3P01A 4XT2A 3GVBA 1KE4A 4C6YA 1PW8A 4GKUA 5FQMA 2EFXA 5AQAA 4R4RA 2K31A 4P6BA 1VETB 3Q7VB 1K55C 2WGWB 2ZQ7A 5LBRA 4DXCA 4QPRA 4GHIB 5HL1A 4DDSA 3BWLA 3N7WA 4B88A 2WGIA 3OCLA 2P08A 3BYDA 5F69A 3RXXA 2J3TD 3T50A 5IHVA 2QMIA 5F5YA 4G3VA 4GZBA 4BBTA 1H8MA 3A3FA 3UB6A 2Y2NA 3QP8A 2VKSA 4S2MA 5FQIA 2JHEA 1U60A 1ERQA 5FSRA 1BLCA 5DFYA 3AGFA 4JLFA 5FI7A 3IXDA 3IX4A 5HL6A 1YLZA 5DJUA 2PT7A 1VB6A 3SS3A 4IJGA 3A3EA 1H0MA 3Q7VA 3L9KA 1XGIA 4KZAA 2VV8A 4FD8A 1GA9A 1TD5A 3LR0A 3IS2A 2VV7A 4DDYA 2DMWA 2UV0E 2QHKA 5GLDA 2ACGA 1F5MA 3W2ZA 4LV2A 2BLSA 4K0WA 4FUWA 2LB9A 5CGWA 4B4XA 3HVFA 4HQAA 2GX5A 2OLVA 1I2WA 4S2LA 5FL3A 2ZC6B 2ZM0A 2W1TA 2KOIA 4Y0UA 2EXBA 2Q0OA 1SDNA 3PR6A 3C8CA 3NC8A 4DF6A 5HD5A 2H5SA 5TR7A 1TEMA 1TS6A 4OONA 5HWWA 3T4OA 4N92A 4JXSA 3IBJA 4GNUA 4S2NA 4EBNA 3MS6A 3BQAA 4E3LA 2V0UA 3IS2B 5M19A 3VOZA 2HZ5A 3PTEA 2OAP1 3O87A 4R4SA 3HLDA 1YSPA 3LYXA 2BG1A 3KYQA 4ME4A 2ZM2A 3RXWA 3DTEA 3JPUA 4R6LA 3OPHA 3C30A 2IWCA 3QP6A 1NXYA 4OLDA 4KZBA 4WZ4A 3MXSA 2H0YA 3SOIA 3G2ZA 5HWTA 3TW8A 3F1NB 2G2UA 4ZAMA 4DKIA 4HBUA 3UE6A 2JKFA 4KQDA 4GCZA 4OPRA 2ZC4B 4UEYA 3UB8A 1ODVA 5I94A 1NRFA 5EVIA 3CG5A 2W27A 1IKGA 4NXEA 5CERA 3BY8A 3S7NA 2Y2HA 1CQAA 4B4ZA 4CLCB 2XA7M 4KZ4A 4K91A 2WZZA 4E3OA 3FWLA 4IVIA 1V9YA 3ZG5A 5CHMA 1E3UA 1QMFA 4FH4A 3IWOA 2K7SA 2PU2A 4X6TA 4KZ7A 4BENA 4UHUA 2O9AA 5CRFA 1XGJA 2JCHA 1ZC2A 3IWQA 1KOUA 4JF4A 4ZJ1A 2PDRA 2D02A 1GSVA 1H8YA 3VP4A 1L0DA 3G35A 4FCFA 1BLSA 2ZQDA 4PAUA 1ZHHB 2W3GA 1Y4OA 1FIKA 4NXFA 2Z6DA 1NYMA 1WE4A 4NXGA 5FAPA 5HSQA 1JWZA 5AQ9A 3VP0A 4X1LA 3NIAA 1K57C 5EVLA 4PM5A 2FFYA 3BFDA 3T4SA 1OMEA 1VEUA 2V0WA 1OT6A 4U0TA 1PYYA 3TOIA 3MF0A 3V3RA 2BASA 2H10A 1LSWA 4EW7A 3HUMA 3NBLA 3AGDA 5EUAA 2GDNA 5DKLA 1UWPX 4M4XA 4BBVA 3ZCZA 3NOPC 3CHWP 2HGVA 2FH5A 3RTYA 2ZC5B 4EXOA 2LB5A 1A0KA 5DTTA 1OT9A 3NI9A 1YPRA 1ACFA 4YOFA 5GL9A 4DN0A 1MZUA 5AJGA 3LFVA 3A0RA 1K0KA 1K4FA 4E3NA 4IUHA 5KZHA 4G3KA 4WN5A 3LY3A 4JGQA 1K6RA 3D72A 4N9KA 3BLMA 4ETXA 4EWFA 4HIAA 1EWZA 5CHUA 2XROA 4P0MA 4GLQA 5EVEA 4UA6A 3UE3A 3O88A 5EOOA 3H7WA 4Y15A 1NLYA 4EBLA 2W1RA 5EOEA 4FTXA 3DWKA 4LV1A 3IHBA 4YWZA 1PWCA 4P6ZM 4OOLA 2W3FA 1NZUA 4KQOA 1S67L 3U2AA 5EVID 3IT9A 3UB9A 5JYPA 3G2YA 1SKFA 3IHAA 4WELA 1V9ZA 3VSKA 2ZL1A 4GDNA 2WADA 1IOUA 4EUZA 2VGLM 4JXVA 1P0ZA 2JKTI 1S4SA 1N9NA 3BECA 1ES2A 3T1RA 3IH8A 1GSWA 2M1CA 2DNSA 3FPWA 4R0QA 4OPYA 3NOTC 3VP3A 5E2HA 5AQBA 3LUQA 2Y2LA 3SS4A 2WKEA 1NY0A 1T1AA 1WYCA 4UQIM 4DMZA 2IA2A 4JGOA 4WZ5C 4QY5A 1NJ4A 3T1XA 3N4IA 1DP6A 2RCXA 4LV0A 5DTSA 3HLEA 4P85A 1XA1A 2Y2MA 2X02A 5HDSA 1LLBA 2P7JA 3W4PA 1T18A 1NLZA 3QP4A 3JVVA 3MMHA 5HAPA 1SKOB 5F82A 1MC0A 2HP6A 3UPPA 3SS5A 4Y0OA 1M6KA 1JTGA 1LI0A 1OPXA 4OQ0A 3MR0A 1W5DA 1HTZA 1TS8A 5FQKA
chains in the Genus database with same CATH topology
3C38A 3OCLA 3CAXA 2P08A 1P97A 5F69A 4EUVA 2J3TD 3MFXA 3T50A 5J3WA 1W63Q 5F5YA 4G3VA 4BBTA 1H8MA 2WKPA 2B18A 4Z1WA 3UB6A 2XA7S 2VKSA 1LT0A 4WF0A 4L9FA 3FC7A 1S1ZA 2JHEA 3GDIA 1OJGA 3SW1A 2QWSA 5DFYA 3MJQA 4HH3A 3F1PA 5DF9A 3PXPA 5HL6A 3O5YA 4KUOA 5TBMA 5DJUA 4FOFA 3H7WB 2KDKA 2PT7A 1VB6A 3LIBA 4EETB 4HP4A 3T4LA 4IJGA 3KX0X 4HJ3A 4HNBA 4OOMA 1S1YA 3NJAA 5DKKA 4WL9A 4R3AA 2NUPC 3UMEA 2VV8A 2PD7A 1TD5A 2EWWA 3LR0A 3R4KA 4RQ9A 3VE4A 5J7EA 3IS2A 3B33A 2WKRA 2VV7A 2DMWA 1XJ3A 2QHKA 2R78A 3FG8A 3OCNA 4G3WA 2HV1A 1F5MA 2M7UA 4PKYA 3W2ZA 1GSXA 2PD8A 4HOIA 1UWNX 2J80A 2LB9A 3EQVA 3PBRA 4DJ3A 1N9LA 3D3OA 2K2NA 4BMWA 4HQAA 3MQOA 2ZBBA 1WA9A 1N9OA 2GX5A 3EGDC 3LI8A 1D7EA 1UGUA 1OJ5A 5FL3A 2XRNA 4CLCE 3UMDA 2EA9A 4EERA 3C2WA 2W1TA 2KOIA 3FPVA 2G7UA 3F1PB 4HHDA 3PBOA 3PR6A 4K08A 3C8CA 3ULFA 2YKFA 4MCWA 3LR3A 2V9AA 2O9BA 5HD5A 1TS6A 5HWWA 3T4OA 4Q0JA 3IBJA 4L0LA 5L8MA 3CITA 3E98A 5DFXA 3PBSA 3BQAA 3PBNA 4HJ6A 1IFQA 2V0UA 3IS2B 4FSFA 2A2LA 2KX6A 4EEUA 3CUEA 2Y79A 2OAP1 1W63M 2VZWA 3LYXA 1YSPA 4EEPA 3F1OB 3KYZA 3KYQA 4P6ZS 4ME4A 5F6AA 4PKYG 3MQ0A 4R6LA 1MKMA 4O01A 1P9WA 3CLOA 3C30A 4I3JA 3KSHA 3B42A 1S4RA 5AVEA 4AFIA 4B9OA 4YNRA 4JGPA 1OTIA 2P04A 5HWTA 2D01A 3TW8A 3V67A 3F1NB 2EWVA 5J4EA 2KLIA 2L1MA 3T4QA 2YKHA 4BBUA 2QJ5A 5HPIA 3UE6A 5CX7A 4KQDA 5KSHA 2PR6A 4GCZA 2J3TC 4UEYA 1NWZA 3UB8A 1ODVA 3K2NA 1YAXA 4WUJA 3ZYTA 5DJTA 3RFBA 2VLGA 4MMNA 2GJ3A 2VX8A 2W27A 4NXEA 3S7NA 3BY8A 2CMNA 1XJ2A 2WKQA 4CLCB 2XA7M 4UQIS 4HH2A 2PYRA 1V9YA 2A24A 1T1CA 4ARZB 3LR4A 3TJZC 3TRCA 2H28A 1XJ6A 4XT2B 4NXBA 2K7SA 3E4OA 3H82B 2I9VA 2MJ6A 4I38A 2QKPA 2O9AA 4LRZE 4I5SA 5TBMB 1OTEA 2OAQ1 3ZQ5A 3PBQA 1DP9A 3LIDA 5MC7A 3EWKA 1NRJA 2ZMFA 2VGLS 2ZOHA 4HJ4A 2VV6A 1KOUA 3MQQA 1TS7A 3S7OA 2OWHA 4MN5A 4B93A 2ZMVA 2PDRA 2D02A 1GSVA 3H82A 2QJ7A 4CLCD 3PHYA 4PAUA 1ZHHB 3E4QA 5KIZA 4WLAA 2W3GA 1LL8A 1T1BA 1DP8A 1LSVA 2GZAA 3HCYA 2Z6DA 4NXFA 4CLCA 1TS0A 4NXGA 4O8GA 5HSQA 1STZA 3P7NA 3F1OA 2OOLA 4HP9A 3EGXC 2VJWA 2L0WA 3T4SA 3VV4A 4HI4A 4F3LA 4DJ2A 4Y2FA 1YSQA 3OLOA 2V0WA 1OT6A 2Z6CA 1X0OA 3F1NA 4H6JA 4EQ1A 3OOVA 5AVFA 4E04A 4GS9A 2B02A 4LRXC 2O0YA 2QYBA 2PR5A 3MF0A 2BASA 1LSWA 3TE8A 4Y3IA 4ZRRA 4L9GA 4EW7A 3ICYA 2V1AA 3RH8B 2HJ9C 3VOLA 3KO6A 2VA0A 4O0PA 5EFWA 4Y5FA 1D06A 3T4TA 1BYWA 5DKLA 1P9RA 1G28A 4Q0HA 1UWPX 4M4XA 4BBVA 4CQHA 3NOPC 3E4PA 1JNUA 1S66L 3BW6A 3R7WB 5HPFA 3T4KA 5G4YA 2HGVA 2FH5A 2JN7A 3RTYA 4EXOA 2LB5A 4LLOB 4ARZA 1OT9A 1EW0A 2O9CA 3KSIA 3VE3A 4JGRA 2JKRM 3LIAA 4LPZA 4YOFA 4DN0A 1MZUA 1OTAA 5AJGA 3LFVA 5IU1A 3A0RA 5IT5A 4LRYC 1DRMA 4IUHA 3LICA 4G3KA 3LIEA 3S7PA 1F9IA 4WN5A 5TJJA 4JGQA 3BJNA 1OTDA 3D72A 1YKDA 4ETXA 4HY8A 2W0NA 2NUTC 4HIAA 3DBAA 1ZTUA 2XROA 4GLQA 3UB7A 3R7WA 2HF6A 2Y8HA 4NEED 4EU0A 3MXQA 5HWVA 3BQ8A 3UE3A 4ETZA 4MDZA 4WEKA 5HDCA 3H7WA 1NLYA 3EEAA 2V1BA 4NKPA 4II7A 4BWIA 2W1RA 2JKRI 4I39A 4YWZA 1H3QA 4P6ZM 2XSSA 4OOLA 3KSGA 5HZHA 2W3FA 4GJ4A 4KQOA 5HD3A 1S67L 4BJPA 4IHQA 3U2AA 3T4JA 3A0VA 3UB9A 3NOUC 3S7QA 2INWA 4MN6A 3PBTA 4F3LB 3CI6A 4WELA 3PYPA 3E0YA 1G6OA 1V9ZA 3A0SA 1IOUA 1XJ4A 4WEJA 2VGLM 1P0ZA 2JKTI 1S4SA 1N9NA 3CWFA 4Q0IA 3OBFA 2M7VA 1GSWA 2M1CA 3FPWA 3EEHA 2L4RA 3NOTC 5IS1A 1TF1A 3H9WA 4EESA 5C5KA 3IBRA 3B47A 3LUQA 5A8BA 2W1TB 3OC2A 1OTBA 1T1AA 3LIFA 4UQIM 2IA2A 2W3DA 4DMZA 2JKTM 4L9EA 2GNXA 5F68A 4JGOA 5I5LA 2FZ0A 1LSXA 1DP6A 4IUKA 3EQUA 2J3WA 2PYPA 3K3DA 3BY9A 4I3IA 3HJKA 3KSFA 2OWJA 2VEAA 3GECA 5K5BA 1XFQA 1XFNA 3LR5A 3K3CA 4KUKA 4GW9A 4R70A 3G6OA 5HDSA 2P7JA 4R38A 3JVUA 1T18A 4GHIA 1NLZA 4GS9B 3EOIA 3P01A 2O99A 2W3HA 3JVVA 3MMHA 4XT2A 4I3AA 3LI9A 4H6JB 5G4ZA 4PHTA 1MC0A 2A24B 2K31A 3CUEC 4CLCC 2HJEA 2W3EA 5LBRA 5HDDA 4MN7A 2ZOIA 4QPRA 1OPXA 4GHIB 1Y28A 3BWLA 3MR0A 3NHQA 1T19A 1VHMA 1F98A 1TS8A 2PHYA 3HJIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAU A;  4BWI A;  2W1R A;  2W3G A;  4EUV A;  3HCY A;  2Y79 A;  2XSS A;  2VZW A;  3KSG A;  1YSP A;  2W3F A;  4G3V A;  4O8G A;  5HSQ A;  2B18 A;  1STZ A;  4Z1W A;  2VKS A;  4ME4 A;  2OOL A;  3MQ0 A;  3NOU C;  3S7Q A;  4R6L A;  1MKM A;  4O01 A;  2VJW A;  3CI6 A;  3KSH A;  3E0Y A;  5DFY A;  3VV4 A;  4Y2F A;  1YSQ A;  5HL6 A;  3O5Y A;  4FOF A;  3OOV A;  4YNR A;  4E04 A;  4LRX C;  4IJG A;  2O0Y A;  2QYB A;  4Q0I A;  3MF0 A;  2KLI A;  3OBF A;  2M7V A;  4Y3I A;  1TD5 A;  5HPI A;  3NOT C;  4ZRR A;  1TF1 A;  3R4K A;  4RQ9 A;  5C5K A;  3IBR A;  3K2N A;  2W1T B;  3KO6 A;  4O0P A;  3RFB A;  4G3W A;  4Y5F A;  4MMN A;  1F5M A;  2IA2 A;  2W3D A;  2M7U A;  4DMZ A;  4Q0H A;  3S7N A;  3W2Z A;  4CQH A;  3NOP C;  5I5L A;  5HPF A;  4IUK A;  2HGV A;  2LB5 A;  2LB9 A;  3KSF A;  2O9C A;  3KSI A;  2VEA A;  3D3O A;  2K2N A;  5K5B A;  3TRC A;  4YOF A;  4DN0 A;  4GW9 A;  5AJG A;  4R70 A;  3LFV A;  3G6O A;  2GX5 A;  4LRY C;  4IUH A;  4G3K A;  3S7P A;  2O99 A;  2W3H A;  3MMH A;  5TJJ A;  2O9A A;  4LRZ E;  3BJN A;  2XRN A;  1YKD A;  4ETX A;  3C2W A;  3ZQ5 A;  2W1T A;  2KOI A;  2G7U A;  2ZMF A;  3DBA A;  1MC0 A;  1ZTU A;  2K31 A;  2XRO A;  4GLQ A;  4MCW A;  3S7O A;  2W3E A;  2O9B A;  2Y8H A;  5LBR A;  4MN7 A;  4QPR A;  4EU0 A;  4ETZ A;  4Q0J A;  3IBJ A;  3NHQ A;  5L8M A;  3CIT A;  3E98 A;  1VHM A;  4MDZ A;  5DFX A;  3EEA A; 
#chains in the Genus database with same CATH topology
 3C38 A;  4KQR A;  3UB5 P;  3IF6 C;  1P97 A;  1ZG6 A;  3OPR A;  1K56 A;  4BD0 A;  2B18 A;  1LT0 A;  2PAV P;  4WF0 A;  3ZG9 B;  3C7U A;  3QP5 A;  1OJG A;  2QWS A;  4HH3 A;  3IQA A;  1XP4 A;  4FOF A;  2E8I A;  4E3M A;  4HNB A;  3QHY A;  1S1Y A;  4GDB A;  2PD7 A;  3R4K A;  3VE4 A;  5J7E A;  1BLH A;  2EXA A;  2R78 A;  1IYQ A;  3FG8 A;  4IBX A;  1BLP A;  2HDR A;  1O07 A;  3IX8 A;  4MLL A;  4HOI A;  3EQV A;  1ERO A;  1J3W A;  4DJ3 A;  2K2N A;  4U0X A;  4N9L A;  1XXM A;  3MQO A;  1SHV A;  3CPT A;  3EGD C;  3LI8 A;  2DRW A;  1RCJ A;  1HLU P;  4WZ5 A;  5HFO A;  3A3D A;  1OJ5 A;  4CLC E;  2EA9 A;  3C5A A;  2G7U A;  3B3X A;  4WM9 A;  4OQI A;  4K08 A;  3QP1 A;  4MCW A;  3LR3 A;  4KZ5 A;  4S2I A;  4YFM A;  3UDI A;  1ZKJ A;  5FEF A;  5DFX A;  3E98 A;  1BT5 A;  3PBS A;  3S1Y A;  4OQG A;  1N4O A;  4EEU A;  2Y79 A;  1W63 M;  4JF6 A;  1K54 C;  4MBH A;  3F1O B;  1G5U A;  3GR2 A;  3IX3 A;  4P6Z S;  4MBF A;  3BRM A;  3N8S A;  3MQ0 A;  4LEN A;  1NZO A;  1VET A;  5E2G A;  1MWU A;  1MY8 A;  4LFU A;  3WWX A;  2WKI A;  3HRE A;  3GRJ A;  5GLA A;  4YNR A;  2D01 A;  4ZJ3 A;  1Z09 A;  1RGZ A;  2AVX A;  4A5R A;  2PR6 A;  1NWZ A;  1YQS A;  3K2N A;  3ZYT A;  1TDL A;  3RFB A;  4KZ8 A;  2HP5 A;  2GJ3 A;  4DE1 A;  3AGE A;  2WKQ A;  1PWG A;  3E2L A;  3TJZ C;  4EQI A;  3P98 A;  3TRC A;  1PRQ A;  2XR0 A;  1XJ6 A;  4XT2 B;  4NXB A;  1IYP A;  3E4O A;  2WAE A;  3PAE A;  5DTK A;  3HL9 A;  1LHY A;  5JYO A;  2QKP A;  3IXB A;  3W4O A;  3NDE A;  3ZQ5 A;  4D60 A;  1NRJ A;  5FAQ A;  3ITA A;  4HJ4 A;  4QD4 A;  2VV6 A;  3MQQ A;  1TS7 A;  1SKO A;  2OWH A;  4Y7P A;  2Y2J A;  3O86 A;  3I7J A;  2QJ7 A;  2WUQ A;  2HDU A;  4CLC D;  3PHY A;  3HUN A;  4KG6 A;  4PM7 A;  5KIZ A;  1CJF A;  4WLA A;  5DF8 A;  1FCM A;  1DP8 A;  1LSV A;  2GZA A;  3FKV A;  1TS0 A;  5EM1 A;  3NDG A;  3ZNT A;  3VP2 A;  4HP9 A;  3UPO A;  2I72 A;  2VJW A;  3IF5 A;  2A3U A;  2L0W A;  5FDH A;  4HI4 A;  4LCM A;  4DJ2 A;  4CJN A;  3GV9 A;  5A93 A;  4RX2 A;  1Z6F A;  2Z6C A;  3F1N A;  4EQ1 A;  5FA7 A;  2O0Y A;  3ZGA B;  1MXO A;  1FR1 A;  1E25 A;  1L0F A;  2Y2O A;  2H0T A;  1N9B A;  3RH8 B;  3WRT A;  2HJ9 C;  3KO6 A;  1QME A;  5M18 A;  4Y5F A;  4OOY A;  1BYW A;  4QJG A;  3FKW A;  1P9R A;  4CQH A;  3ZG7 B;  5HPF A;  4LLO B;  4ARZ A;  3KSI A;  5J8X A;  1GA0 A;  4LPZ A;  1YMS A;  3DTI A;  1OTA A;  5IU1 A;  4LRY C;  2JKG A;  3VOY A;  1KGF A;  1ZG4 A;  3LIE A;  3S7P A;  1F9I A;  3DW0 A;  2EX9 A;  3BM6 A;  2EX2 A;  1YKD A;  3SZT A;  1FCN A;  3DBA A;  1ZTU A;  4DRT A;  4JXW A;  3R7W A;  1GCE A;  2Q9N A;  1K54 A;  4BQM A;  1K38 A;  3BQ8 A;  4R1G A;  3T1S A;  3CPT B;  1GHP A;  5HDC A;  3EEA A;  2V1B A;  2V8F A;  4QHC A;  4I39 A;  4X1M A;  1XPB A;  1KDW A;  3WS4 A;  5KMW A;  2Y4A A;  5EM0 A;  1PNE A;  5CGX A;  4IHQ A;  5FQQ A;  2RL3 A;  4KQQ A;  4F94 A;  5HAQ A;  3S7Q A;  4LV3 A;  4F3L B;  3PYP A;  2VGJ A;  1XKZ A;  3C7V A;  5E43 A;  2R9X A;  5HW3 A;  1I5Q A;  3BEB A;  4Q0I A;  1C3B A;  3OBF A;  1L0G A;  2M7V A;  3GSG A;  1FSY A;  3EEH A;  5AQ7 A;  1SDE A;  3OPP A;  3LEZ A;  4UAA A;  3H9W A;  5C5K A;  3FV7 A;  5CEC A;  3OC2 A;  5A92 A;  5L2F A;  1OTB A;  3LIF A;  2W3D A;  5L10 A;  2GNX A;  5F68 A;  2FZ0 A;  3ZFZ A;  1LSX A;  3M2K A;  2XFS A;  4IUK A;  5GHZ A;  3K3D A;  5L09 A;  1XX2 A;  3GEC A;  4OPZ A;  2P9V A;  3TSG A;  3K3C A;  4GW9 A;  4R70 A;  3G6O A;  4ID4 A;  3JVU A;  4GHI A;  4K0X A;  5TGF A;  4GS9 B;  2W3H A;  2BTF P;  4I3A A;  5D3O A;  4DE2 A;  3WS2 A;  3LI9 A;  2V2F F;  4ZDX A;  2J7V A;  1VEU B;  2A24 B;  3C4P A;  1H5X A;  1K6S A;  2W3E A;  5HDD A;  4MN7 A;  2ZOI A;  4C3Q A;  1Y28 A;  1E4D A;  4JKT A;  3NHQ A;  1VHM A;  2G2W A;  5EE8 A;  1K57 A;  3MZE A;  3N8R A;  4EUV A;  1ESI A;  4JBF A;  4PM8 A;  5J3W A;  1CEF A;  4P87 A;  1PI5 A;  2WKP A;  2XA7 S;  5DVA A;  2Q9M A;  4EV4 A;  4L9F A;  4WMC A;  3FC7 A;  3NUL A;  2Y2Q A;  1GHM A;  5EEC A;  5M1A A;  2P9V B;  3SW1 A;  5EV0 A;  5DF9 A;  3P09 A;  1BTL A;  3O5Y A;  1DY6 A;  5HAR A;  3DAV A;  3H7W B;  4O7D A;  4E3J A;  3LIB A;  4EET B;  4HP4 A;  3T4L A;  1EI5 A;  3KX0 X;  4HJ3 A;  2XDM A;  3MKE A;  4OOM A;  4WL9 A;  3UME A;  2WKH A;  2EWW A;  3LO7 A;  4RQ9 A;  4ZJ2 A;  3B33 A;  4WMC D;  2HV1 A;  2M7U A;  1PZO A;  2EX6 A;  1KE0 A;  5EVI B;  5GHY A;  2Z2L B;  1UWN X;  2J80 A;  1N9L A;  3D3O A;  1G6A A;  2V1Z A;  4BMW A;  5G18 A;  1ES5 A;  1N9O A;  5FDS A;  4XUZ A;  2ZJ9 A;  4KZ6 A;  3UMD A;  4S2O A;  4EER A;  1PI4 A;  3ZG8 B;  3G4P A;  5E2E A;  2Y91 A;  3F1P B;  5FAS A;  2YKF A;  2ZLY A;  1O7E A;  3HLF A;  3ZG0 A;  3HLB A;  2X01 A;  4Q0J A;  3L7H A;  4HJ6 A;  1IFQ A;  4FSF A;  4PM9 A;  2A2L A;  3KYE A;  5E2F A;  4UA9 A;  3QNB A;  2C6W B;  3KYZ A;  3G31 A;  4Q8I A;  2WGV A;  5F6A A;  3HBR A;  1MKM A;  3V50 A;  4I3J A;  3V5M A;  1F2K A;  3KSH A;  3B42 A;  2VGK A;  4NK3 A;  5AVE A;  1H8Z A;  1YM1 A;  1MWR A;  4B9O A;  1AXB A;  4LGW A;  1PWD A;  2ZC3 B;  4JGP A;  4KZ9 A;  2P04 A;  3V67 A;  1KGG A;  2EWV A;  5J4E A;  2KLI A;  2L1M A;  3NCK A;  2PBD P;  4BBU A;  2QJ5 A;  5HPI A;  3IF6 B;  2JBF A;  3ZNY A;  2VLG A;  2XFT A;  3BLS A;  2Y55 A;  2ZD8 A;  1ES4 A;  1YMX A;  2CMN A;  1XJ2 A;  3MBZ A;  2XGN A;  1TVF A;  5FI2 A;  1L2S A;  4PM6 A;  3IXG A;  2A24 A;  5CEB A;  1T1C A;  4ARZ B;  1BUE A;  3LR4 A;  2H28 A;  5HX9 A;  3CMZ A;  5KSC A;  1Q2P A;  2I9V A;  5GLC A;  1ESU A;  2DCF A;  5FI6 A;  3MFD A;  1YLP A;  4LRZ E;  4I5S A;  4IVK A;  4BL2 A;  1OTE A;  2OAQ 1;  2P74 A;  2E8J A;  2ZMF A;  2ZOH A;  4MEZ A;  3M6B A;  3S7O A;  3VSL A;  1M40 A;  3H82 A;  5TFQ A;  3NY4 A;  3RJU A;  1LI9 A;  1TDG A;  1E3U D;  4N1H A;  3BFC A;  4CLC A;  4O8G A;  1YLT A;  3QNC A;  3FZC A;  3ZHH A;  3P7N A;  2UWX A;  3W4Q A;  3F1O A;  4ZBE A;  3EGX C;  3UPN A;  1HZO A;  4X25 A;  3V39 A;  3VV4 A;  2XF3 A;  4Y2F A;  4H6J A;  1X0O A;  4HEF A;  4E04 A;  4KG5 A;  3UY6 A;  2PR5 A;  1PZP A;  3ICY A;  2OSU A;  3LY4 A;  5A90 A;  1YLY A;  5FQJ A;  1BZA A;  3T4T A;  4ZTK A;  4Q0H A;  1IEM A;  1J9M A;  3E4P A;  3BW6 A;  3R7W B;  1CEG A;  2JN7 A;  3T12 B;  3VE3 A;  4JGR A;  2CC1 A;  3LIA A;  4S2K A;  5IT5 A;  3M2J A;  1DRM A;  1BSG A;  3LIC A;  2Y2G A;  5FAT A;  3QP2 A;  1OTD A;  3GTC A;  2WK0 A;  3ISG A;  4HY8 A;  2W0N A;  3Q1F A;  2X71 A;  4IBR A;  3HLG A;  3OZH A;  4HES A;  3UB7 A;  1KE3 A;  4NEE D;  4EU0 A;  1IYS A;  3UE0 A;  3MXQ A;  3HLC A;  4ETZ A;  3G32 A;  4NKP A;  1S6R A;  1VQQ A;  2XD5 A;  1RGY A;  2QZ6 A;  1W79 A;  4GB7 A;  2ZQ8 A;  5FEG A;  3G30 A;  1JTD A;  3KSG A;  4GJ4 A;  4GOG A;  3UO9 A;  5HD3 A;  4BJP A;  3A0V A;  4UA7 A;  4S2N C;  4Z9Q A;  3NOU C;  2INW A;  3PBT A;  3M6H A;  3NEC A;  4QB8 A;  1ERM A;  3CI6 A;  3TG9 A;  3E0Y A;  1G6O A;  4C75 A;  2ZM8 A;  4BLM A;  1XJ4 A;  4KEN B;  1I2S A;  2WZX A;  4Y13 A;  5F83 A;  1IKI A;  3VFF A;  2L4R A;  4H8R A;  5IS1 A;  4BD1 A;  4QU3 A;  3D4F A;  5A8B A;  3B47 A;  4OKP A;  2W1T B;  1HVB A;  3VP1 A;  3V3S A;  2Y59 A;  3BFE A;  2JE5 A;  2ZQA A;  3UDX A;  5I5L A;  4D2O A;  3WRZ A;  4OLG A;  1CK3 A;  3BY9 A;  3HJK A;  2OWJ A;  2VEA A;  3N8L A;  1FSW A;  1XFQ A;  1XFN A;  3LR5 A;  4KUK A;  2J9P A;  4IED A;  4R38 A;  2O99 A;  2WYX A;  1MKI A;  4OH0 A;  4H6J B;  5G4Z A;  3WS0 A;  4OP8 A;  4PHT A;  4N1X A;  1JWP A;  2XEP A;  3CUE C;  1MWT A;  1WYB A;  4CLC C;  2HJE A;  1IEL A;  1FIL A;  5HAI A;  5FAO A;  1GHI A;  1T19 A;  1F98 A;  1VM1 A;  2PHY A;  3HJI A;  1YLW A;  3O3V A;  4R3B A;  3CAX A;  4CPK A;  3DWZ A;  1JWV A;  3MFX A;  2ZQC A;  5FQ9 A;  1W63 Q;  4X56 A;  3WS1 A;  1HD8 A;  4Z1W A;  4WBG A;  1KVM A;  1S1Z A;  3GDI A;  4X53 A;  2PU4 A;  2QPN A;  4OVD A;  3MJQ A;  3F1P A;  3PXP A;  3PAG A;  3ZVW A;  5GLB A;  4KUO A;  5TBM A;  4DXB A;  4MNR A;  2KDK A;  2ZQ9 A;  3NJA A;  5DKK A;  2ZMA A;  3ITB A;  1KGE A;  4R3A A;  2NUP C;  1LL5 A;  5EPH A;  2HP9 A;  2WKR A;  1XJ3 A;  1LL9 A;  3OCN A;  1YT4 A;  4G3W A;  1ES3 A;  5GHX A;  4PKY A;  2EFU A;  1GSX A;  1Q2Q A;  3VFH A;  2PD8 A;  3S4X A;  1L0E A;  1SCW A;  4S2J A;  3PBR A;  4OPQ A;  3A3J A;  4DE3 A;  2ZBB A;  4OQH A;  1WA9 A;  4XXR A;  1MPL A;  1KVL A;  1D7E A;  1UGU A;  2XRN A;  3C2W A;  3UN7 A;  3FPV A;  3D9Y A;  5CXW A;  2EX8 A;  4HHD A;  3UNW A;  3VMA A;  3UDF A;  3PBO A;  3ULF A;  2V9A A;  1MWS A;  2O9B A;  4KG2 A;  2IWD A;  4L0L A;  5L8M A;  4PMA A;  3CIT A;  2HDS A;  4X55 A;  2ZL1 B;  1IYO A;  3PBN A;  5CTN A;  2KX6 A;  2IWB A;  3CUE A;  4X68 A;  4MBK A;  2VZW A;  3LEQ A;  4EEP A;  3GQZ A;  3IWI A;  4E3I A;  3Q7Z A;  1ALQ A;  5CGS A;  2J8Y A;  4PKY G;  2V8C A;  4O01 A;  1P9W A;  1YLJ A;  3CLO A;  4GD8 A;  4JPM A;  1S4R A;  4HBT A;  3JYI A;  1K4E A;  4AFI A;  4GD6 A;  1S0W A;  4RX3 A;  1OTI A;  3T4Q A;  2C5W B;  2YKH A;  1SZV A;  2Y2P A;  5CX7 A;  5KSH A;  1PW1 A;  2J3T C;  1YAX A;  4WUJ A;  5DJT A;  1W8Y A;  4MMN A;  2VX8 A;  1W8Q A;  5F1F A;  1K56 D;  2PBY A;  4UQI S;  1CI9 A;  2HDQ A;  4HH2 A;  2PYR A;  1AWI A;  3H82 B;  3A3I A;  2JC7 A;  2MJ6 A;  4YIN A;  1RP5 A;  4I38 A;  1JVJ A;  5TBM B;  3PBQ A;  1DP9 A;  2WGW A;  3LID A;  5MC7 A;  2A49 A;  3EWK A;  2VGL S;  3MZF A;  3W8K A;  4R3J A;  4MN5 A;  4B93 A;  5F1G A;  2ZMV A;  4RYE A;  1FQG A;  3DTK A;  1FCO A;  1CI8 A;  3E4Q A;  4JF5 A;  2WAF A;  1LL8 A;  1T1B A;  2XQZ A;  3HCY A;  2XH9 A;  4QWO A;  2FFF B;  3ZDJ A;  2XLN A;  1STZ A;  3DTM A;  2OLU A;  1G68 A;  1D1J A;  2OOL A;  1KDS A;  4LCL A;  3IF6 A;  3MKF A;  1DJA A;  3HLW A;  4F3L A;  1YSQ A;  3OLO A;  4BL3 A;  1DJC A;  3Q81 A;  4GN2 A;  4OP5 A;  3OOV A;  5AVF A;  4GS9 A;  2B02 A;  4LRX C;  2QYB A;  1BUL A;  2OV5 A;  2ZC7 A;  2B95 A;  4PPR A;  3TE8 A;  4Y3I A;  4ZRR A;  4L9G A;  3MXR A;  2V1A A;  3LCE A;  1FR6 A;  3VOL A;  2VA0 A;  2J9O A;  1W7F A;  4O0P A;  5EFW A;  2XK1 A;  1XA7 A;  1D06 A;  1Y54 A;  3SH9 A;  1G28 A;  2Y2K A;  2PRF A;  4Y17 A;  1JNU A;  1S66 L;  2Z2M B;  3U4L P;  3T4K A;  3FYZ A;  3G34 A;  5G4Y A;  2XD1 A;  4S2P A;  3E2K A;  1EW0 A;  2O9C A;  5L07 A;  4RVA A;  2JKR M;  2VK3 A;  1K25 A;  1MBL A;  1K55 A;  2B5R A;  2HPB A;  5EVI C;  5A91 A;  4KZ3 A;  3HUO A;  5TJJ A;  3BJN A;  3BFF A;  4M3K A;  2NUT C;  3C4O A;  2Y2I A;  2HF6 A;  2Y8H A;  4XUX A;  1NYY A;  3S22 A;  5HWV A;  4MDZ A;  4WEK A;  3MSH A;  3OPL A;  4II7 A;  4BWI A;  2JKR I;  3N6I A;  4U3T A;  1H3Q A;  2XSS A;  5HZH A;  1FOF A;  3CJM A;  4DE0 A;  3T4J A;  4FH2 A;  3BFG A;  4NET A;  3UE1 A;  4MN6 A;  4QY6 A;  3Q07 A;  1L3L A;  3IH9 A;  3Q82 A;  3A0S A;  3T1Q B;  5CHJ A;  4RA7 A;  1PIO A;  4WEJ A;  4R23 A;  4JXG A;  1PFL A;  3ZVT A;  3CWF A;  3CZD A;  5BOH A;  3WS5 A;  3SH7 A;  4X69 A;  3GMW A;  5U47 A;  4E3K A;  1DJB A;  1TF1 A;  5DF7 A;  4EES A;  3IBR A;  5CTM A;  4E6W A;  2V20 A;  3SH8 A;  2JKT M;  4L9E A;  3MZD A;  3EQU A;  2J3W A;  2PYP A;  2R9W A;  1ONH A;  1CF0 A;  4E6X A;  4I3I A;  3KSF A;  1ONG A;  5K5B A;  3LGO A;  4EBP A;  3IXH A;  4ESP A;  5CED A;  4WYY A;  4NG2 A;  4Y0T A;  3EOI A;  3P01 A;  4XT2 A;  3GVB A;  1KE4 A;  4C6Y A;  1PW8 A;  4GKU A;  5FQM A;  2EFX A;  5AQA A;  4R4R A;  2K31 A;  4P6B A;  1VET B;  3Q7V B;  1K55 C;  2WGW B;  2ZQ7 A;  5LBR A;  4DXC A;  4QPR A;  4GHI B;  5HL1 A;  4DDS A;  3BWL A;  3N7W A;  4B88 A;  2WGI A;  3OCL A;  2P08 A;  3BYD A;  5F69 A;  3RXX A;  2J3T D;  3T50 A;  5IHV A;  2QMI A;  5F5Y A;  4G3V A;  4GZB A;  4BBT A;  1H8M A;  3A3F A;  3UB6 A;  2Y2N A;  3QP8 A;  2VKS A;  4S2M A;  5FQI A;  2JHE A;  1U60 A;  1ERQ A;  5FSR A;  1BLC A;  5DFY A;  3AGF A;  4JLF A;  5FI7 A;  3IXD A;  3IX4 A;  5HL6 A;  1YLZ A;  5DJU A;  2PT7 A;  1VB6 A;  3SS3 A;  4IJG A;  3A3E A;  1H0M A;  3Q7V A;  3L9K A;  1XGI A;  4KZA A;  2VV8 A;  4FD8 A;  1GA9 A;  1TD5 A;  3LR0 A;  3IS2 A;  2VV7 A;  4DDY A;  2DMW A;  2UV0 E;  2QHK A;  5GLD A;  2ACG A;  1F5M A;  3W2Z A;  4LV2 A;  2BLS A;  4K0W A;  4FUW A;  2LB9 A;  5CGW A;  4B4X A;  3HVF A;  4HQA A;  2GX5 A;  2OLV A;  1I2W A;  4S2L A;  5FL3 A;  2ZC6 B;  2ZM0 A;  2W1T A;  2KOI A;  4Y0U A;  2EXB A;  2Q0O A;  1SDN A;  3PR6 A;  3C8C A;  3NC8 A;  4DF6 A;  5HD5 A;  2H5S A;  5TR7 A;  1TEM A;  1TS6 A;  4OON A;  5HWW A;  3T4O A;  4N92 A;  4JXS A;  3IBJ A;  4GNU A;  4S2N A;  4EBN A;  3MS6 A;  3BQA A;  4E3L A;  2V0U A;  3IS2 B;  5M19 A;  3VOZ A;  2HZ5 A;  3PTE A;  2OAP 1;  3O87 A;  4R4S A;  3HLD A;  1YSP A;  3LYX A;  2BG1 A;  3KYQ A;  4ME4 A;  2ZM2 A;  3RXW A;  3DTE A;  3JPU A;  4R6L A;  3OPH A;  3C30 A;  2IWC A;  3QP6 A;  1NXY A;  4OLD A;  4KZB A;  4WZ4 A;  3MXS A;  2H0Y A;  3SOI A;  3G2Z A;  5HWT A;  3TW8 A;  3F1N B;  2G2U A;  4ZAM A;  4DKI A;  4HBU A;  3UE6 A;  2JKF A;  4KQD A;  4GCZ A;  4OPR A;  2ZC4 B;  4UEY A;  3UB8 A;  1ODV A;  5I94 A;  1NRF A;  5EVI A;  3CG5 A;  2W27 A;  1IKG A;  4NXE A;  5CER A;  3BY8 A;  3S7N A;  2Y2H A;  1CQA A;  4B4Z A;  4CLC B;  2XA7 M;  4KZ4 A;  4K91 A;  2WZZ A;  4E3O A;  3FWL A;  4IVI A;  1V9Y A;  3ZG5 A;  5CHM A;  1E3U A;  1QMF A;  4FH4 A;  3IWO A;  2K7S A;  2PU2 A;  4X6T A;  4KZ7 A;  4BEN A;  4UHU A;  2O9A A;  5CRF A;  1XGJ A;  2JCH A;  1ZC2 A;  3IWQ A;  1KOU A;  4JF4 A;  4ZJ1 A;  2PDR A;  2D02 A;  1GSV A;  1H8Y A;  3VP4 A;  1L0D A;  3G35 A;  4FCF A;  1BLS A;  2ZQD A;  4PAU A;  1ZHH B;  2W3G A;  1Y4O A;  1FIK A;  4NXF A;  2Z6D A;  1NYM A;  1WE4 A;  4NXG A;  5FAP A;  5HSQ A;  1JWZ A;  5AQ9 A;  3VP0 A;  4X1L A;  3NIA A;  1K57 C;  5EVL A;  4PM5 A;  2FFY A;  3BFD A;  3T4S A;  1OME A;  1VEU A;  2V0W A;  1OT6 A;  4U0T A;  1PYY A;  3TOI A;  3MF0 A;  3V3R A;  2BAS A;  2H10 A;  1LSW A;  4EW7 A;  3HUM A;  3NBL A;  3AGD A;  5EUA A;  2GDN A;  5DKL A;  1UWP X;  4M4X A;  4BBV A;  3ZCZ A;  3NOP C;  3CHW P;  2HGV A;  2FH5 A;  3RTY A;  2ZC5 B;  4EXO A;  2LB5 A;  1A0K A;  5DTT A;  1OT9 A;  3NI9 A;  1YPR A;  1ACF A;  4YOF A;  5GL9 A;  4DN0 A;  1MZU A;  5AJG A;  3LFV A;  3A0R A;  1K0K A;  1K4F A;  4E3N A;  4IUH A;  5KZH A;  4G3K A;  4WN5 A;  3LY3 A;  4JGQ A;  1K6R A;  3D72 A;  4N9K A;  3BLM A;  4ETX A;  4EWF A;  4HIA A;  1EWZ A;  5CHU A;  2XRO A;  4P0M A;  4GLQ A;  5EVE A;  4UA6 A;  3UE3 A;  3O88 A;  5EOO A;  3H7W A;  4Y15 A;  1NLY A;  4EBL A;  2W1R A;  5EOE A;  4FTX A;  3DWK A;  4LV1 A;  3IHB A;  4YWZ A;  1PWC A;  4P6Z M;  4OOL A;  2W3F A;  1NZU A;  4KQO A;  1S67 L;  3U2A A;  5EVI D;  3IT9 A;  3UB9 A;  5JYP A;  3G2Y A;  1SKF A;  3IHA A;  4WEL A;  1V9Z A;  3VSK A;  2ZL1 A;  4GDN A;  2WAD A;  1IOU A;  4EUZ A;  2VGL M;  4JXV A;  1P0Z A;  2JKT I;  1S4S A;  1N9N A;  3BEC A;  1ES2 A;  3T1R A;  3IH8 A;  1GSW A;  2M1C A;  2DNS A;  3FPW A;  4R0Q A;  4OPY A;  3NOT C;  3VP3 A;  5E2H A;  5AQB A;  3LUQ A;  2Y2L A;  3SS4 A;  2WKE A;  1NY0 A;  1T1A A;  1WYC A;  4UQI M;  4DMZ A;  2IA2 A;  4JGO A;  4WZ5 C;  4QY5 A;  1NJ4 A;  3T1X A;  3N4I A;  1DP6 A;  2RCX A;  4LV0 A;  5DTS A;  3HLE A;  4P85 A;  1XA1 A;  2Y2M A;  2X02 A;  5HDS A;  1LLB A;  2P7J A;  3W4P A;  1T18 A;  1NLZ A;  3QP4 A;  3JVV A;  3MMH A;  5HAP A;  1SKO B;  5F82 A;  1MC0 A;  2HP6 A;  3UPP A;  3SS5 A;  4Y0O A;  1M6K A;  1JTG A;  1LI0 A;  1OPX A;  4OQ0 A;  3MR0 A;  1W5D A;  1HTZ A;  1TS8 A;  5FQK A; 
#chains in the Genus database with same CATH homology
 3C38 A;  3OCL A;  3CAX A;  2P08 A;  1P97 A;  5F69 A;  4EUV A;  2J3T D;  3MFX A;  3T50 A;  5J3W A;  1W63 Q;  5F5Y A;  4G3V A;  4BBT A;  1H8M A;  2WKP A;  2B18 A;  4Z1W A;  3UB6 A;  2XA7 S;  2VKS A;  1LT0 A;  4WF0 A;  4L9F A;  3FC7 A;  1S1Z A;  2JHE A;  3GDI A;  1OJG A;  3SW1 A;  2QWS A;  5DFY A;  3MJQ A;  4HH3 A;  3F1P A;  5DF9 A;  3PXP A;  5HL6 A;  3O5Y A;  4KUO A;  5TBM A;  5DJU A;  4FOF A;  3H7W B;  2KDK A;  2PT7 A;  1VB6 A;  3LIB A;  4EET B;  4HP4 A;  3T4L A;  4IJG A;  3KX0 X;  4HJ3 A;  4HNB A;  4OOM A;  1S1Y A;  3NJA A;  5DKK A;  4WL9 A;  4R3A A;  2NUP C;  3UME A;  2VV8 A;  2PD7 A;  1TD5 A;  2EWW A;  3LR0 A;  3R4K A;  4RQ9 A;  3VE4 A;  5J7E A;  3IS2 A;  3B33 A;  2WKR A;  2VV7 A;  2DMW A;  1XJ3 A;  2QHK A;  2R78 A;  3FG8 A;  3OCN A;  4G3W A;  2HV1 A;  1F5M A;  2M7U A;  4PKY A;  3W2Z A;  1GSX A;  2PD8 A;  4HOI A;  1UWN X;  2J80 A;  2LB9 A;  3EQV A;  3PBR A;  4DJ3 A;  1N9L A;  3D3O A;  2K2N A;  4BMW A;  4HQA A;  3MQO A;  2ZBB A;  1WA9 A;  1N9O A;  2GX5 A;  3EGD C;  3LI8 A;  1D7E A;  1UGU A;  1OJ5 A;  5FL3 A;  2XRN A;  4CLC E;  3UMD A;  2EA9 A;  4EER A;  3C2W A;  2W1T A;  2KOI A;  3FPV A;  2G7U A;  3F1P B;  4HHD A;  3PBO A;  3PR6 A;  4K08 A;  3C8C A;  3ULF A;  2YKF A;  4MCW A;  3LR3 A;  2V9A A;  2O9B A;  5HD5 A;  1TS6 A;  5HWW A;  3T4O A;  4Q0J A;  3IBJ A;  4L0L A;  5L8M A;  3CIT A;  3E98 A;  5DFX A;  3PBS A;  3BQA A;  3PBN A;  4HJ6 A;  1IFQ A;  2V0U A;  3IS2 B;  4FSF A;  2A2L A;  2KX6 A;  4EEU A;  3CUE A;  2Y79 A;  2OAP 1;  1W63 M;  2VZW A;  3LYX A;  1YSP A;  4EEP A;  3F1O B;  3KYZ A;  3KYQ A;  4P6Z S;  4ME4 A;  5F6A A;  4PKY G;  3MQ0 A;  4R6L A;  1MKM A;  4O01 A;  1P9W A;  3CLO A;  3C30 A;  4I3J A;  3KSH A;  3B42 A;  1S4R A;  5AVE A;  4AFI A;  4B9O A;  4YNR A;  4JGP A;  1OTI A;  2P04 A;  5HWT A;  2D01 A;  3TW8 A;  3V67 A;  3F1N B;  2EWV A;  5J4E A;  2KLI A;  2L1M A;  3T4Q A;  2YKH A;  4BBU A;  2QJ5 A;  5HPI A;  3UE6 A;  5CX7 A;  4KQD A;  5KSH A;  2PR6 A;  4GCZ A;  2J3T C;  4UEY A;  1NWZ A;  3UB8 A;  1ODV A;  3K2N A;  1YAX A;  4WUJ A;  3ZYT A;  5DJT A;  3RFB A;  2VLG A;  4MMN A;  2GJ3 A;  2VX8 A;  2W27 A;  4NXE A;  3S7N A;  3BY8 A;  2CMN A;  1XJ2 A;  2WKQ A;  4CLC B;  2XA7 M;  4UQI S;  4HH2 A;  2PYR A;  1V9Y A;  2A24 A;  1T1C A;  4ARZ B;  3LR4 A;  3TJZ C;  3TRC A;  2H28 A;  1XJ6 A;  4XT2 B;  4NXB A;  2K7S A;  3E4O A;  3H82 B;  2I9V A;  2MJ6 A;  4I38 A;  2QKP A;  2O9A A;  4LRZ E;  4I5S A;  5TBM B;  1OTE A;  2OAQ 1;  3ZQ5 A;  3PBQ A;  1DP9 A;  3LID A;  5MC7 A;  3EWK A;  1NRJ A;  2ZMF A;  2VGL S;  2ZOH A;  4HJ4 A;  2VV6 A;  1KOU A;  3MQQ A;  1TS7 A;  3S7O A;  2OWH A;  4MN5 A;  4B93 A;  2ZMV A;  2PDR A;  2D02 A;  1GSV A;  3H82 A;  2QJ7 A;  4CLC D;  3PHY A;  4PAU A;  1ZHH B;  3E4Q A;  5KIZ A;  4WLA A;  2W3G A;  1LL8 A;  1T1B A;  1DP8 A;  1LSV A;  2GZA A;  3HCY A;  2Z6D A;  4NXF A;  4CLC A;  1TS0 A;  4NXG A;  4O8G A;  5HSQ A;  1STZ A;  3P7N A;  3F1O A;  2OOL A;  4HP9 A;  3EGX C;  2VJW A;  2L0W A;  3T4S A;  3VV4 A;  4HI4 A;  4F3L A;  4DJ2 A;  4Y2F A;  1YSQ A;  3OLO A;  2V0W A;  1OT6 A;  2Z6C A;  1X0O A;  3F1N A;  4H6J A;  4EQ1 A;  3OOV A;  5AVF A;  4E04 A;  4GS9 A;  2B02 A;  4LRX C;  2O0Y A;  2QYB A;  2PR5 A;  3MF0 A;  2BAS A;  1LSW A;  3TE8 A;  4Y3I A;  4ZRR A;  4L9G A;  4EW7 A;  3ICY A;  2V1A A;  3RH8 B;  2HJ9 C;  3VOL A;  3KO6 A;  2VA0 A;  4O0P A;  5EFW A;  4Y5F A;  1D06 A;  3T4T A;  1BYW A;  5DKL A;  1P9R A;  1G28 A;  4Q0H A;  1UWP X;  4M4X A;  4BBV A;  4CQH A;  3NOP C;  3E4P A;  1JNU A;  1S66 L;  3BW6 A;  3R7W B;  5HPF A;  3T4K A;  5G4Y A;  2HGV A;  2FH5 A;  2JN7 A;  3RTY A;  4EXO A;  2LB5 A;  4LLO B;  4ARZ A;  1OT9 A;  1EW0 A;  2O9C A;  3KSI A;  3VE3 A;  4JGR A;  2JKR M;  3LIA A;  4LPZ A;  4YOF A;  4DN0 A;  1MZU A;  1OTA A;  5AJG A;  3LFV A;  5IU1 A;  3A0R A;  5IT5 A;  4LRY C;  1DRM A;  4IUH A;  3LIC A;  4G3K A;  3LIE A;  3S7P A;  1F9I A;  4WN5 A;  5TJJ A;  4JGQ A;  3BJN A;  1OTD A;  3D72 A;  1YKD A;  4ETX A;  4HY8 A;  2W0N A;  2NUT C;  4HIA A;  3DBA A;  1ZTU A;  2XRO A;  4GLQ A;  3UB7 A;  3R7W A;  2HF6 A;  2Y8H A;  4NEE D;  4EU0 A;  3MXQ A;  5HWV A;  3BQ8 A;  3UE3 A;  4ETZ A;  4MDZ A;  4WEK A;  5HDC A;  3H7W A;  1NLY A;  3EEA A;  2V1B A;  4NKP A;  4II7 A;  4BWI A;  2W1R A;  2JKR I;  4I39 A;  4YWZ A;  1H3Q A;  4P6Z M;  2XSS A;  4OOL A;  3KSG A;  5HZH A;  2W3F A;  4GJ4 A;  4KQO A;  5HD3 A;  1S67 L;  4BJP A;  4IHQ A;  3U2A A;  3T4J A;  3A0V A;  3UB9 A;  3NOU C;  3S7Q A;  2INW A;  4MN6 A;  3PBT A;  4F3L B;  3CI6 A;  4WEL A;  3PYP A;  3E0Y A;  1G6O A;  1V9Z A;  3A0S A;  1IOU A;  1XJ4 A;  4WEJ A;  2VGL M;  1P0Z A;  2JKT I;  1S4S A;  1N9N A;  3CWF A;  4Q0I A;  3OBF A;  2M7V A;  1GSW A;  2M1C A;  3FPW A;  3EEH A;  2L4R A;  3NOT C;  5IS1 A;  1TF1 A;  3H9W A;  4EES A;  5C5K A;  3IBR A;  3B47 A;  3LUQ A;  5A8B A;  2W1T B;  3OC2 A;  1OTB A;  1T1A A;  3LIF A;  4UQI M;  2IA2 A;  2W3D A;  4DMZ A;  2JKT M;  4L9E A;  2GNX A;  5F68 A;  4JGO A;  5I5L A;  2FZ0 A;  1LSX A;  1DP6 A;  4IUK A;  3EQU A;  2J3W A;  2PYP A;  3K3D A;  3BY9 A;  4I3I A;  3HJK A;  3KSF A;  2OWJ A;  2VEA A;  3GEC A;  5K5B A;  1XFQ A;  1XFN A;  3LR5 A;  3K3C A;  4KUK A;  4GW9 A;  4R70 A;  3G6O A;  5HDS A;  2P7J A;  4R38 A;  3JVU A;  1T18 A;  4GHI A;  1NLZ A;  4GS9 B;  3EOI A;  3P01 A;  2O99 A;  2W3H A;  3JVV A;  3MMH A;  4XT2 A;  4I3A A;  3LI9 A;  4H6J B;  5G4Z A;  4PHT A;  1MC0 A;  2A24 B;  2K31 A;  3CUE C;  4CLC C;  2HJE A;  2W3E A;  5LBR A;  5HDD A;  4MN7 A;  2ZOI A;  4QPR A;  1OPX A;  4GHI B;  1Y28 A;  3BWL A;  3MR0 A;  3NHQ A;  1T19 A;  1VHM A;  1F98 A;  1TS8 A;  2PHY A;  3HJI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...