2W1WA

Native structure of a family 35 carbohydrate binding module from clostridium thermocellum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
130
Chain Sequence
b'ASPVIYQAEDAIIYNAILETVNAGYTGSCYVNYHNEVGGYIEWNVNAPSSGSYALIFRYANGTTANRPMRITVNGNIVKPSMDFVSTGAWTTWNEAGIVANLNQGNNVIRATAIASDGGPNVDYLKVFSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOLYTIC ENZYME, G-D-S-L
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
total genus 27
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18099 DUF5010_C DUF5010 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w1wA00
1J83A 1GQPA 2VMFA 3JXSA 3A21A 3OBAA 4DEVA 3WNLA 2YFUA 2J7MA 3WNPA 3OGSA 4ET7A 1JU4A 2JE8A 2WN2A 1R64A 5DMYA 4DXTA 2WABA 1JZ4A 4QX2A 1SHWB 3PUHA 1DYOA 2W47A 3LPGA 2VO5A 3OG2A 2VQTA 3DECA 3IDAA 2WQ8A 2WDBA 1K3IA 3EB7A 1GUIA 3FL7A 5EIYB 4JKLA 2XONA 2Y64A 2WYSA 3T0BA 2PQSA 2XOMA 1US3A 4XURA 4P00B 4MADA 4E8CA 2W1WA 1O59A 1JZ6A 2W94A 4BK5A 3NNGA 1UMHA 4QX3A 5IFPA 1OD3A 4AG4A 3MUZ1 4QDSA 1YQ2A 2VZVA 3WQBA 3OEBA 5B4NA 2VC9A 2DDUA 1XNTA 2V5DA 2E32A 2ORXA 3ACFA 1GOGA 4A44A 4LPLA 2B9VA 1JZ8A 4KI5M 3LEIA 2J1AA 1UY4A 3MV11 1UY2A 5DQ0A 3PUIA 3I2IA 2WN3A 2C26A 4CU7A 4A3ZA 3LQCA 2WUHA 3SEPA 2YC2A 1I5PA 2BGOA 4TTGA 5JR2A 2ZEXA 3E1F1 3VD9A 4UOJA 4W4ZA 3VDCA 4QDQA 4MOAA 2W9XA 4OUEA 1F4HA 5DN2A 4QB1A 4UI9L 3HPNA 2VZUA 3WF1A 2VQUA 3CIHA 1US2A 1L7RA 2R7EB 2VL4A 1CZTA 4E8DA 2ZEYA 2VJXA 2ZEWA 2RJ2A 4W50A 3CKHA 4Z2AA 1H6XA 3SKVA 3VD3A 4JHZA 2HLEA 5JXIA 1JZ3A 2E26A 4GWIA 4M4PA 3I3BA 2VMCA 1W9WA 2QQLA 3ACGA 3WSOA 1PMJX 2VZSA 2VM9A 2X05A 4BK4A 1NKGA 4RYDA 3I2HA 3D3AA 3DYPA 2VZOA 2W91A 1UY3A 1K12A 3I2JA 5LA0A 2RVAA 2W1SA 4MGQA 2Z4FA 1CZSA 4M4RA 2QQMA 2YB7A 1UZ0A 4BXSV 3T2QA 4CU8A 3GDBA 1PX3A 3HEIA 3WNNA 1GMMA 2V72A 2YC4A 5JMOA 1LNSA 2EICA 3HJRA 3LPFA 5JUVA 4CU9A 5C70A 4FI9A 4LKSA 4A6OA 3IAPA 4RN5A 1UYXA 5JXJA 2VZ1A 4W8JA 2E33A 1OH4A 2BBAA 1UYYA 2ZEZA 2V4VA 5IFTA 4KMQA 5HXMA 2WO2A 4XZUG 2VOTA 3CZUA 2Y6LA 3OGRA 3HNBM 1GU3A 5C71A 3T0AA 4JKMA 2L9LA 4MGSA 3T0DA 4CU6A 1TG7A 3HNMA 3GM8A 1BHGA 3K4DA 2QQIA 2VZTA 2RV9A 4A42A 2Y6GA 3MUY1 5CZKA 4ARXA 1UXZA 1JYVA 1XC6A 3ECQA 1NX9A 4JX0A 1DLCA 4P02B 2EIEA 4KWUA 1OT5A 2QBXA 2CDOA 1GNYA 2J1RA 1DP0A 4DUXA 4PQQA 3FN9A 1JZ5A 3A23A 1CZVA 1F4AA 5G04L 4CUCA 3ZM8A 1UYZA 3K46A 3J7HA 4LQRA 1JYNA 1SG3A 4GZ9A 2OKXA 3WNOA 1GOHA 2CDPA 5DPNA 2ID4A 3IB3A 1O8SA 3P1IA 1GOFA 1O8PA 3CMGA 3DYOA 2Y6JA 3VDAA 2W1QA 3C7FA 3NJXA 4YPJA 2EIBA 3UESA 1JYWA 2WBKA 2VCCA 1ULOA 3CZJA 3LE0A 4UAPA 3T09A 3SKJE 2HYXA 3WF2A 5IYYA 5HPOA 1EUTA 3MO4A 3W5NA 3I3EA 3OB8A 2X10A 3THDA 1J84A 5G05L 1K45A 1W0NA 1W8OA 3ETPA 1OF3A 1JI6A 1W9SA 3UETA 4P08A 2VMEA 4QB6A 2LW8A 1XNAA 2EIDA 5CYYA 1JYXA 1L7QA 3K75B 5LA1A 4XVHA 3CDZB 5IHRA 1UWWA 1RYYA 4GWJA 3U37A 3ACHA 3VD4A 3OEAA 2C9KA 1XPWA 3FHQA 1W9TA 1WKYA 4OZOA 2W46A 2JD9A 2BGPA 3GXUA 4MO3M 3I2GA 3K4ZA 2YFZA 5FUIA 4DUWA 5LCWL 3THCA 2C4XA 2QQNA 3IIIA 3LEKA 2ORZA 2J1TA 1CIYA 2VCAA 3C7OA 1HN1A 2YG0A 3T2PA 4OYUA 1MPXA 5JXHA 3FHAA 4DEQA 3T2OA 5JXGA 3WNMA 2WAOA 1OF4A 3AC0A 3ACIA 3C7HA 3EYPA 2B4KA 4P5YA 3GGLA 4XUQA 2J1SA 1SDDB 1PMHX 4DUVA 3HOBA 3BN6A 3K4AA 3VD5A 4LHSA 2DCKA 3C7EA 4A45A 3HN3A 2QQOA 1NAEA 2J1VA 1CX1A 2BERA 2J1UA 4TXWA 5C7GA 4L0PA 2Y6KA 1TVGA 3BGAA 2VMDA 1EUUA 2Y8KA 3NRUA 5J1XA 1UY1A 4DXSA 3P6BA 2E31A 4BJ0A 5F7UA 2W92A 3WF3A 2W1UA 2X09A 2VZRA 4BDVB 4ZZ5A 4XUNA 4IUGA 3VD7A 2J1EA 3K77A 1JZ2A 5B4XA 3SEEA 2VZQA 4ZZ8A 3UNPA 4OMDA 4A4AA 4XUTA 1NUKA 1PX4A 1JU3A 1WCQA 4QPWA 5I0DA 1JZ7A 3NJVA 4D0QA 2JKXA 3DYMA 2J22A 2QQKA 2WZEA 1JHJA 3NQHA 2XQXA 3OGVA 2XHNA 4QX1A 2Y6HA 4XUOA 4ZXEA 3W5MA 3I3DA 2DCJA 2KD7A 3ABZA 1ULPA 2BZDA 2LS6A 5A1AA 1IQDC 3F2ZA 2VR4A 4CUAA 3IAQA 4D8MA 4PT6A 5EJ1B 1KEXA 1UY0A 2VZPA 4CUBA 3MBWA 3HNYM 1K42A 2WAAA 3WNKA 1W99A 2WO3A 4ZY9A 4QDRA 4A41A 2ZXQA 3WF4A 3T08A 3VDBA 1D7PM 3A7QA 4JKKA 1UXXX 3I97A 3CQOA 2W3JA 4DXRA 4QAWA 4QB2A 3I2FA 1KGYA 2VTFA 5LA2A 1T2XA 5IJRA 5EJZB 2QQJA 3A22A 1P8JA 1W8NA 3C8XA 3WF0A 2W95A 4XUPA 3WEZA 2WO1A 2VCBA 2W5FA 4AAXA 1UX7A 1UMIA 3I2KA 2W87A 4PF1A 2WZ8A 2VZ3A 3C7GA 3LEGA 4HG6B 2JDAA 4OMCA 4ARYA 4QX0A 4CVUA 1H6YA 3MV01
chains in the Genus database with same CATH superfamily
3HT1A 1CJDA 3VL8A 3AYAA 3AP6A 1CJPA 1VBA3 3EJKA 2C9AA 3A21A 3K3OA 3TRSB 3APBA 5FPBA 1ND3A 3T1MA 3ZFFC 1BQPA 2YFUA 4FOQA 5J36A 2J7MA 3WNPA 2GAUA 3M2MA 1URXA 4JQTA 2RS33 3OGJA 4JDMA 5HCFA 5C3QA 5DMYA 4P9YA 3SH3A 4CDWA 4DXTA 1AYM2 1TZOA 5BNNB 4QX2A 1HRV1 1CPMA 1FT9A 2VMHA 1YNAA 2NM1A 1K5MB 4CXYA 4MG2A 1LR5A 3GHMA 5F8PA 4A6SA 1LJ7A 1LODA 2A6VA 4MXWB 1JXNA 2VQTA 1COV1 4GB32 2ZZQA 3J9SA 4AGVA 3ILFA 4B4RA 4YSFA 3S57A 2NMOA 3ASIA 3ETQA 2RR12 4UW4A 4GXLA 1CAWA 1OD5A 1RXGA 4INDA 5IVCA 1ZNPA 4XTMA 3VHNA 1YXWA 1MEC1 2CGOA 1MZ5A 2XOMA 3CO2A 3PURA 4XIKA 4AYUA 1U0AA 4QD2A 1V6NA 5A1LA 5ACA1 2WNUB 1LOBA 4MADA 2ZGKA 2W1WA 1XE0A 2P1BA 2XXZA 1S4CA 2EA7A 3PJYA 4BQWA 4BK5A 1QNYA 3V0BA 2BQPA 3UJOA 4Q26A 1LRHA 1VBD3 5IFPA 4YZ2A 5KR7A 1QOOA 3KT7A 2YZ4A 4C1XA 4KWLA 5GLZA 1VAKA 1OVPA 4MZUA 2UYBA 3LD8A 1QJX1 2R0FA 1PGSA 3O1SA 2R071 2YGMA 4LBQD 2VC9A 1WA4A 3GCWA 3LIGA 4XF1A 1YO8A 2FZ1A 2JECA 5LBEA 2GALA 2GH8A 2V5DA 1UL9A 1UU5A 4ONUA 3T2TA 4C90A 1G9DA 5HCHA 2E32A 1VPHA 2GP5A 5J09A 4KNCA 3S6PA 1DQ6A 1QJU1 4K9SA 4XDPA 1IS4A 4KI5M 3LEIA 4YM3A 3KV9A 1H0BA 5C9AB 4OHVA 1IPKA 1C4RA 3B01A 3H3LA 4ORFA 2BYVE 3PUIA 4LKEA 2WN3A 4CU7A 4IE0A 3DXTA 2AEZA 2VY0A 1YFWA 2Z42A 3SEPA 2ET7A 2YC2A 1HV1A 3VZMA 3ZXEA 4TTGA 4K20A 2Y33A 4K8RB 5LBCA 1D2SA 2HWC1 5DDJ1 4W4ZA 3VDCA 5GZGA 4QPGA 4RR3B 2JG8B 1WCKA 3MIGA 4C1WA 3ZXFA 2ARXA 1FV2A 3HPNA 2XBO3 1RINA 5CISA 3LKJA 4D6RA 1OOPA 4K21A 3CIHA 4IV1A 1L7RA 1H8TC 4GD4A 4NWWA 4OFGA 5FZKA 2ZGPA 5F2SA 1AR62 1POV3 5ANNA 5FK7A 3RMYA 5EP9A 1Z78A 1H6XA 5LBFA 1AVBA 5FMOS 3SKVA 3VD3A 2FZ2A 2B9UA 4OCTA 2ZGTA 1SLBA 3NW4A 4QWNA 5EJ3A 1OA3A 4GWIA 4M4PA 3RI8A 1STMA 3N9MA 5FZCA 4XFIA 1PIV2 4FQ4A 5LZ6A 4XF9A 4IETA 4OI4A 2PFWA 2HEWF 2DFCA 5IVJA 3ACGA 1TMF3 3KV4A 2VQ0A 3S0MA 1MQTC 3VLBB 1TEIA 1N3PA 1K5JA 2VM9A 4BQXA 3ZFEB 2D3RA 2XJVA 1O3QA 4NN0A 4CDXA 5L9VA 5CNAA 3TN91 4RYDA 4KG8A 4ASMB 3NKGA 5EFUA 2BOJA 4CEYA 1CVNA 3S5QA 4QQHA 5E89A 5E6HA 4Q1PA 2W1SA 4L92A 5DUVA 3ZYHA 4W6XA 5F6LB 1CZSA 3K51A 4XAEA 3X29B 2QQMA 1C8M1 2YB7A 3PMSA 5FXWA 2LTNA 4ZKTB 3H50A 1I3HA 3BI3A 3T2QA 1G7YA 3PLQA 3AFKA 3GDBA 4LKFA 5L73A 3WQ7A 1FXZA 3FFZA 3KHCA 5DG1A 4Z07A 2WFF1 1ZRCA 2YC4A 1CAXA 2YUEA 5JMOA 2EICA 1DLLA 1G86A 4MYEA 3THPA 1IG0A 3SCFA 4FI9A 5FYZA 5C70A 2BNOA 1E5RA 1F31A 1MS9A 1W9FA 4XTPA 5A80A 3SXWA 4JZRA 3N35A 4KGQA 4ATEA 4L8QA 1W28A 4IEOA 4J6GA 1UYXA 3O1OA 3NV2A 2VZ1A 1D0GA 1FATA 1VBD2 4W8JA 5FWEA 3OSDA 3ZYPA 1GQHA 2QZ2A 1R1ZA 3JD73 3H3UA 1RUI3 4PHZA 4YFWA 4Y5TA 2R042 3HBKA 3B93A 5K7PA 1RUE3 1PZ7A 3BOWA 1KDKA 2ZEZA 4EZ4A 3GF6A 1K5MC 2RDSA 5L9BA 2PELA 3FFQA 4PCRA 3KVAA 1JODA 1R081 5HXMA 1CESA 2WO2A 1OPOA 2VOTA 5ABJB 2Y6LA 5IVYA 1JMUB 3M70A 5FZ8A 3FX3A 4I0WB 4BB3A 3O14A 1Z7S3 3ZDSA 1XNDA 1ASJ1 3LB9A 2IC1A 1J3PA 4NRQA 5JI9A 2L9LA 4OQ8A 3OOXA 1HRI1 3FLRA 3W58A 3RZJA 4BU2A 4CU6A 3W59A 4FPOB 2CGPA 1XNBA 2O1QA 3D6EA 3ELNA 3KQRA 4IV3B 3B69A 3DF0A 1O5LA 3ZFFA 4H7MA 4XFGA 2XPJA 4FAHA 4HZFA 1UOFA 1Q5OA 2NLRA 2VZTA 4AGRA 4QM9A 5FZHA 1W3VA 2RV9A 3IMMA 5FP3A 5DUWA 4XJ8A 2DBIA 2Y6GA 3MUY1 2WR9A 4P14A 4QHOA 5DXDA 5GZFA 2D98A 3OYWA 4M3CB 2DVFA 1RHI1 4YM2A 1LHNA 1SCRA 2PHXA 2XJPA 3J7NA 3I2OA 4NIGA 1OT5A 2DVDA 3OPWA 2XKPA 2QBXA 4XCBA 2DUPA 4LHLA 2CV6A 1R1A3 1W6PB 4NPMA 1AR91 1VRH3 3NO8A 4E27A 1V00A 2HWF2 2W39A 1GLHA 3AXDA 5IUQA 3V56A 3ZN5A 5I91A 5EYXA 1JZ5A 3A23A 4UW5A 1F4AA 4BQ1A 1FPN1 5FZGA 1SCSA 2R49A 4Y22B 4NHMA 3K48A 4LQRA 1FOD1 1AX0A 4RFT0 1LHWA 1SG3A 1VMJA 1V9U3 4GZ9A 5FPVA 2OKXA 1EV13 1ZRIA 2BRTA 5FP4A 3W9AA 3HT2A 1SPPA 2CDPA 1H4HA 5LBBA 2ID4A 4WVMA 5T5LA 1MVEA 2HEVF 4IW3A 4B4QA 3ZYGA 4RQPC 1N3OA 3AZWA 5AFEA 4D7YA 1XRUA 5AC92 3AXEA 5F5QA 4URTA 4AI9A 2OZ6A 4JDOA 1RUH2 1C5IA 5FY1A 2EIBA 2TNFA 1HN0A 1ZM1A 4GH4C 2GC1A 1JYWA 2WBKA 5LK5A 4N90A 4P9WA 1IS5A 4LEJA 2ZX3A 2ZX1A 3N4MA 4LLFA 1RL3A 2HYXA 4ITCA 2Z79A 3ZDVA 4QX5A 4XFFA 5HCBA 5IT6A 4EN7B 1AR71 2VG9A 3AP9A 1TME3 4ISRA 3VV1A 1RXFA 3PL0A 1PO21 1Z0HA 2X10A 4WM7C 3THDA 1AXZA 4Z2WA 1RUF3 3AL6A 4BZ4A 3N9QA 5IVVA 4RS5C 5FZ4A 4BOWA 5CG9A 1OF3A 5GLWA 1V70A 1W9SA 4P08A 2ZS6B 1PMIA 2VD7A 1Y7BA 3QOPA 1ND3B 4I0AA 1H8TA 4LLOA 3BTYA 4HVOA 2Q1FA 4JDNA 3MF6A 5GZCA 1AJKA 1JYXA 1PO13 2EAKA 4E4DX 1L7QA 2DV9A 2OA2A 4RSUA 5IHRA 4FP3A 1UWWA 4CDWB 4AFMA 1PM7A 1W8HA 3VDDC 3IMNA 1I6XA 1BBT2 4FP2A 5BYNA 3QACA 4Y1UA 1C3HA 1UX6A 3HIFA 3VZJA 4XJUA 4GWNA 2IXJA 4KGGA 4XQDA 3ZYBA 2C9KA 1MQTA 2QQWA 1UW8A 3FHQA 3MPBA 4QKBA 4BQ4A 4LTAA 1C28A 4Q8LA 1CAWB 3WP4A 3RZHA 2BGPA 2QQPA 1LOAA 1JYTA 3BALA 1RUG3 4AEKA 5FUIA 4DUWA 3OJBA 5FRAA 4XOGA 1ZBE3 3JBG1 1Y3TA 1GICA 2XDVA 4Q0SA 3WP5A 3GYDA 4YVSC 3KGZA 5FZLA 3RWNA 3POGA 3VBRC 2VCAA 1HN1A 4UFLA 2O8QA 3Q8CA 5ABJC 3S7IA 1KD7A 1OLRA 1MPXA 4OYUA 5JXHA 3I49A 2VVDA 1R1A2 2WAOA 4QQ2A 5ANQA 1I5ZA 1XXNA 2LALA 3R0RA 4IEQA 4Q2FA 4V1PA 3B9IA 3C7HA 4AVCA 4JTNA 2B4KA 3UGGA 1IG3A 4IV3C 4NIIA 3KWVA 3LA2A 1NCQB 2WS93 1W8ZA 5C8WA 3BN6A 1UN1A 5FZ0A 2EXIA 5A7SA 1HXS1 1EV12 4CXXA 3K4AA 4WVWA 3JU9A 2DCKA 2GH2A 3HN3A 1BK0A 1UZYA 4LORA 2QQOA 1K5MA 2J1VA 3PU8A 4GAZA 2BERA 4MXWA 4CCLA 2Y6KA 2RM21 2MEV3 1V6JA 1QQP3 1EUUA 4COYA 1GWLA 3P6BA 5GLUA 4IESA 2CAVA 4BJ0A 5F7UA 2GC3A 3N9LA 3WF3A 3ZN4A 2ZACA 1S0FA 4DRVA 4ZU4A 3ZOIA 2UURA 5J3UA 1FNZA 1LHVA 2JB4A 1TNFA 2VBPA 1JHNA 2H6BA 1OOPB 4JQRA 1GV9A 5F3EA 2VH9A 3DGTA 3M3QA 4AI0A 4ZZ8A 3ZFGC 1XOYA 3UNPA 1SBFA 1NXMA 2XUEA 3CU7A 1YLLA 3KVBA 3WP3A 4QPWA 1A6CA 1LOEA 1YJLA 2YV8A 4RGAA 1JZ7A 2VW0A 3KT4A 2JKXA 3AP5A 2XVKA 1Q8VA 3GZTB 3LCPA 1D4VB 2H0VA 2WZEA 1GNHA 3T1LA 3H7JA 3ZXGA 5EV7A 4RHV1 3NQHA 2XQXA 5HBAA 4AL9A 2JIJA 5HV4A 4XUOA 3KM5A 2RS53 2KD7A 4YG3A 1DGLA 1AXYA 1REEA 2BZDA 3ABZA 3GJBA 3NNFA 2LS6A 4DB5A 4EN8B 1RUC1 1ZRDA 4DXZA 4LJHA 1RMU1 1WD4A 1QJY1 4CP2A 4CP1A 4JGYC 4OHXA 1OPMA 2PHTA 1R092 1PO12 3QD6A 2RDQA 2C6SA 4R9AA 5F2WA 2DCYA 4FPHA 4Y26A 3POSA 3AJYA 4HK9A 1VBC1 3PNAA 4IEUA 4O7XA 5EJ1B 3UKNA 3LIHA 1W2NA 3KSCA 4CUBA 1K42A 2QTWB 2WAAA 1W99A 4GJZA 4BMEA 4CEYB 4A41A 3RJRA 2E51A 3TOJA 1NG0A 4BQYA 4A7KA 1AYN3 2ZGOA 3L2YA 4MUVA 4Q4W1 4C8DA 1A78A 1JOBA 1W6OB 2BVVA 4CPBA 3I97A 2R061 4D94A 5LWBA 4CSWA 4Q27A 1H2LA 4MSVA 4IGOA 4EN9B 1X82A 3KF3A 3RFRA 1W39A 5A32A 2OXBA 1ENXA 4HBNA 5CG8A 3RVHA 3MIDA 1JS9A 2JB8A 4GMP0 4ZPIA 3I2FA 1J59A 1LHOA 3AYEA 2AREA 1BEV3 2TEPA 1KGYA 4RQPA 5FV3A 4IE5A 3B7MA 4IGQA 4HN0A 1SEFA 5DZGA 3H0OA 2HWD1 3AZYA 2QQJA 3N9NA 5EJZB 1MZ6A 2KA3A 4R4XA 5JWPA 1P8JA 4UW3A 4AHXA 3J8F3 4GJYA 3C8XA 4D69A 4GH4A 4E2QA 3ZXJA 2VNVA 3O12A 2HWE3 3POYA 3WEZA 2XQRA 5DZEA 1GR3A 1YQCA 4I3GA 5BNPB 3O7OA 2B45X 2DCZA 2XWJB 1MACA 1ULDA 4OI1A 4AAPA 4YGBA 2KM2A 3AKSA 3I4IA 2W87A 2ET1A 2WZ8A 4FPLA 5I0SA 2EXKA 4WM7A 1YI7A 2HBUA 2VZ3A 4HG6B 4OMCA 2P6CA 4ARYA 4E4SA 2R1DA 2IXLA 1VBB3 3DEMA 3PIGA 4RS5A 1J83A 1QY4A 2P17A 3AKRA 2VMFA 3E5XA 3HN1A 4Q29A 4COZA 4KL1A 4PLNA 3OBAA 3ZFFB 1WCUA 4JC1A 4DEVA 1JH5A 1ZBA2 1YUDA 1J3QA 3U07A 2IXKA 1WCDJ 3E5UA 1EAH1 3LA7A 5T52A 1DQ1A 2NYYA 3QH7A 5KXEA 2JE8A 2WN2A 1FI2A 1U5IA 2VXRA 3EHKA 3UKVA 4HVQA 4CEWC 5F6KA 2WABA 1VLNA 1JZ4A 1ODNA 4CCCA 3VDDA 3AKQA 1W03A 4FFHA 3PDQA 3ZR5A 3RJ2X 2ZGUA 3AZZA 2QVSB 2QCSB 1NCQC 3OG2A 4XC9A 1XU2A 2NPIA 2WQ8A 3IDAA 1MS8A 1XYOA 3EB7A 1V6OA 2I07B 4PQ9A 3FL7A 4LA2A 3RPQA 3VBHB 1U5YA 5A3TA 1AL21 1HIXA 2BNMA 2WYSA 4Q4Y1 1QEXA 1UQXA 4MGTA 2RS52 1US3A 4XURA 3BODA 4P00B 4KG0A 3PVBB 5JLVA 5FOJB 1N3QA 4YVSA 3KV5A 4Y5SA 1JZ6A 1SACA 1RVF3 1XSQA 5HXVA 2UU8A 4FPCA 4RFRB 1AR82 3POJA 1UMHA 3SH5A 1W6QB 4UFIA 4A7YA 4QQPA 4XHXA 3T4HB 1OD3A 5ABJA 4HKLA 5IK7A 3AMPA 5C5UA 4QGLA 1CPNA 1LCLA 1SPPB 1GYKA 3O1VA 4WVMB 2RS12 2VZVA 3Q8EA 3OEBA 3W20A 1H1IA 2F6BA 3WQBA 4Q4X3 2D5HA 2DDUA 1KXGA 1PVC3 4EQVA 1D4M2 4KQ7A 5M0TA 2ZAHA 3DKWA 3VKLA 3ST7A 1V6IA 2D40A 2BGCA 2ORXA 1V0AA 3MEPA 1FMD1 1GOGA 2R1BA 4IV3A 1YQ6A 4XJAA 5LRRA 4A44A 2ZCWA 3I2DA 1PGW1 5FZIA 2HWB2 3I59B 2CTVA 5HCAA 5FPXA 2J1AA 2A70A 2BJSA 1UKGA 4GALA 1VIWB 4OLLA 1O6UA 1QH7A 5E1RA 2XG3A 4LBKA 2QUOA 2Z69A 3I2IA 3ZMOA 1PNGA 4CCEA 1WW6A 4QM8A 1LHUA 2UYAA 4V2VA 5FYBA 1NY71 5FMCA 5FZFA 3CJIC 3USUA 2ZEXA 3LFIA 1ZZ7A 2BWAA 5A33A 4OQ9A 4AW7A 1F8VA 3FMGA 4C0BA 4UOJA 2ARCA 3BOPA 5A7WB 4YRDA 3J8F2 5BXXA 1W6PA 3J4UH 3TBDA 1AJOA 1F4HA 4QB1A 4UI9L 5DN2A 5FLIA 3M8LA 3FBMA 3WF1A 4CCMA 4EWAA 3U0ZA 1H8TB 1US2A 2R7EB 4MXVA 3ZFGA 4UFKA 3NWKA 4M0HA 3WHTA 4OUSA 2XWBB 2ENRA 5FQ0B 2VBBA 1HQWA 2YMZA 3CKHA 4J1WA 4NMIA 4W50A 4J25A 4LITA 3SC7X 1RUD2 4Z2AA 1AYM1 3MHZA 1CX4A 1ALYA 4YGEA 2CYFA 5H9RA 5C33A 5JXIA 3KS7A 2JDZA 2A71A 4I30A 3TEWA 2ZKLA 1W9WA 4DY3A 4D7TA 4GB31 1UOBA 4FXGB 1MQTB 3N7JA 2RR11 4JGYA 1CR7A 4R9DA 2XJSA 1ULFA 3K2OA 3VBUB 1T6BX 4BQ3A 4XEZA 2ZAAA 4BK4A 1NKGA 4LULA 4QKFA 4CDUC 5F9TA 1J1LA 2BUKA 3DYPA 4XXPA 4JVAA 1QNWA 3ZIXA 3DL3A 5FYHA 3GZEA 3ITQA 1K12A 5FZ6A 3WV6A 2E53A 3UYJA 1T6GC 4B29A 5K9YA 1HRV3 2Z4FA 1UF2C 2VW1A 2JICA 5JI7A 4JCKA 4UFJA 4BXSV 1YIPA 4CU8A 4HVRA 1COV3 2P3YA 4QX7A 1HLCA 4MGYE 5GM0A 5AFBA 1GMMA 1IS3A 1OMIA 1YI9A 3WT3A 1W8UA 1LNSA 3TNQA 3LPFA 4CU9A 2ADEA 3U75A 1MEC3 1KITA 1SFNA 3ZKYA 1F35A 4NPRA 5ACA3 1VMFA 5FTTC 3B5LB 4AI3A 4W6WA 2C5DA 5J96B 5JXJA 4UBHA 5CVRA 1JUIA 4LA3A 3UGFA 2HYKA 3FZ3A 5F39A 1OH4A 3O1MA 5CKNA 5EPAA 2FMDA 2RMU3 5FY9A 3WDWA 1YFUA 2Y26A 4LNVA 3VKFC 3LOIA 4P5HA 1CONA 2V4VA 4Q0UA 4YM0A 1HQLA 2D6PA 1QJX3 4XHBA 2R073 2ZGQA 1CD3G 1W2AX 2F4PA 4M00A 4K1YA 4KMQA 1RC6A 2A6WA 2YBPA 1RJ7A 2ZMNA 1RUJ2 3PTRB 4YW3A 3VBHC 1GU3A 4UWDA 2CHHA 4Z1VA 4NHXA 1AHSA 3AMNA 2HJIA 1QJU3 1E5IA 2YU1A 4JKMA 5FYIA 4AHWA 4BXFA 5D8AC 4F8AA 2W52A 5KHGA 3M1HA 1S0IA 5A7QA 4CTEA 1DYKA 1AR61 4QHBA 4QXHA 4BIFA 3WNXA 4WBBA 4YW4A 1BHGA 2WZR2 4NIHA 3K4DA 5LB6A 3BPSA 1DIWA 1GSLA 2OPWA 1OHFA 3BPZA 4WVZA 2R32A 1PIV1 2HWC3 5DDJ3 3RGBA 1X9TA 4A42A 4I2OA 1VRBA 2XGXA 3V64A 1CGPA 2JX9A 5A3NA 2GC0A 2PLV2 3ECQA 1OSGA 5K4LA 1NCQA 2P37A 4NOTA 3H8OA 4CCDA 2BW8A 1F9KA 4AFDA 2WT2A 3UGHA 4LHNA 1WLWA 2J1RA 3WP6A 1UPSA 3PVNA 5A6ZA 1KRIA 1N1YA 2XLFA 2Y38A 3P3PA 1DU3D 3UKTA 5JCTA 4DY5A 4PQQA 3RZZA 2VNRA 1AZDA 3VKNA 1YHFA 4Z92B 1CZVA 4NVPA 1RIRA 3VB9A 4CUCA 3ZM8A 3M3OA 2WFPA 2FDFA 4IEXA 4N43C 3K46A 3QBQA 2F17A 3ZSLA 3M3IA 5AVAA 4LMFA 1VBE2 3U10A 4OI2A 4K6BA 4X8PA 5A32B 3S7EA 1GOHA 1WGPA 3AX4A 2WRAA 4W65A 4MV2A 3OTFA 3IB3A 3ILRA 4RQPB 4XFHA 2TBVA 1ACCA 2WKKA 3P1IA 4U2AA 3TN93 3VDAA 1N47A 2Y6JA 3D4KA 1VBD1 3ALQA 1UZVA 4UYBA 5GKAC 3UT0A 2ZX2A 2YPJA 4YPJA 3PVOA 1ST8A 2R041 2A6ZA 2QQVA 3BTZA 5FZAA 3ES4A 3Q8AA 4GH4B 4R8HA 4S2DA 2JJ6A 1NE4A 4DPNA 4CXWA 1C8M3 2K2SA 1WLCA 5KHJA 3TEZA 3CZJA 3T09A 4UAPA 1VBA2 1N1SA 2WIIB 3SKJE 5TSWA 4AE2A 3WF2A 1XYPA 2WFF3 3MO4A 3UJQA 4WVVA 3W21A 1XJAA 5BV6A 1CAUA 5FBJA 2D6LX 1RTVA 3CJIA 3VBUC 3AK0A 3W5NA 2RS32 4AWDA 5A3WA 1OQEA 3I3EA 4WM7B 2PQQA 2YBSA 3IT8A 1DBNA 3I54A 1ZX5A 2DCTA 5G05L 2Z5WA 1K45A 1W0NA 1OLMA 5GJ6A 3BTXA 4O9GA 2RMU2 2CNAA 3ETPA 4HPKA 4RS5B 2P4EA 5JR7B 1JI6A 1YJKA 5JAXA 2B42B 5EHDA 1TQ5A 4O9EA 5KWRA 3VBFB 2LW8A 3ZVXA 1J1TA 1W3XA 2VPVA 4N8MA 3OGGA 2EIDA 3FLPA 1W6OA 1YCIA 2VUDA 4Q0PA 5CYYA 5FYYA 1NQJA 3K75B 2VNOA 3WCRA 1WW4A 1RUOA 2G4IA 5DAQA 2PTMA 1BVP1 1R083 3WQ1A 4F7ZA 3TNPB 4HL0A 4NRPA 1XQNA 3EQEA 3VDDB 3WY6A 4GWJA 1DQ2A 1HX6A 3ZSJA 4OI0A 1XB9A 3OPTA 4Y1VA 3R4DB 1ASJ3 4D6QA 2YU2A 1HRI3 5IWFA 5JSOA 1F5FA 4CA9A 1W9TA 2W46A 2JD9A 1M4WA 1O91A 4MO3M 4WV8A 1RITA 3OD4A 2PN5A 2KXLA 1G9FA 4QPIC 2HWF1 2OQ7A 2C1FA 3I2GA 3PMEA 4CDUA 3O1RA 1E57A 2PAKA 3WG3A 2PA7A 3IIIA 4IEPA 4YVSB 2ZHLA 3OBRA 4FXKB 5BNPA 5CIRA 1SBEA 4FFIA 4COVA 4AF9A 2VMIA 4KU8A 1GWMA 1QXJA 2J1TA 4I01A 4O61A 3B3QE 3T2PA 3VBRB 5JSPA 2R16A 1RHI3 1XNKA 4QGMA 4AI8A 3FHAA 3ZXKA 4KBZA 2IXCA 1JOJA 3WNMA 3JQXA 3WINE 3IIAA 1APNA 3ACIA 5AC91 4CRQA 1JTZX 4P5YA 1W0OA 1AR93 2J1SA 4XUQA 3NL1A 4GKXA 1RUH1 1SDDB 3B02A 4PIZA 4LHKA 3WLUA 1LAJA 5I0RA 5FO8B 1FPN3 3VD5A 1MS3A 2XBO2 3H1YA 1FOD3 1HJGA 1ODMA 4A45A 1CAVB 3PHMA 4CYDA 4NPLA 1W06A 1Y9GA 3JB8A 4FTSA 1CX1A 2VBDA 3USUB 4S2FA 3IDEA 4TXWA 4XQWA 5A33B 1TVGA 2VUAA 5I8TA 5JOWA 5JZGC 5J1XA 2Y8KA 4NIDA 4DXSA 3VBHA 3GBWA 2VZRA 3NAPB 3AP7A 2GP3A 2X5IC 3AVRA 2AYHA 2UY9A 2Y34A 3AVSA 3AL5A 2J1EA 3K77A 4JAAA 4LBLA 5D8AA 5F32A 5B4XA 3POBA 3ZFGB 4B3NA 1TMF2 1W05A 5FBZA 4A4AA 4XUTA 4DS0A 1UYPA 1REFA 1JU3A 3GZAA 3EBRA 5FYVA 3SITA 4NR1A 4PIXA 1WMFA 3UK9A 2JWPA 3IDCB 1W6QA 1FX5A 4MGKE 2QQKA 1NA1C 3VZOA 2HKXA 5JOYA 4CE8A 1AR73 3WDUA 5CFDC 4XBLA 4YLZA 1BBT1 3GBFA 4ZXEA 1PO23 3W5MA 1J58A 5APAA 5FPZA 2GU9A 4B1MA 1EYBA 4IQPA 3MICA 2NMNA 1JN2P 1IQDC 2VR4A 4JGYB 4IEWA 1DF0A 4HONA 2CGNA 3QCWA 5IAXA 3IAQA 4I09A 4Y4RA 4AVTA 2ETEA 4M3CE 4D8MA 3M4FA 2ZX0A 3ZYJB 1RUNA 3RG0A 3I59A 5JPNB 5ERLA 3NMBA 2VZPA 1QXPA 4MHRA 4GA9A 4DQAA 4AQ6A 3VBSC 1GBGA 2HH9A 4KWKA 1YIFA 5B2GB 2ADDA 4QDRA 4ZY9A 4DMIA 2GN7A 4GQ7A 5DABA 2WZPP 4H7LA 1Q56A 4PI2A 3T08A 1WUVA 2ZHKA 3I3MA 3A7QA 1YYNA 4JKKA 3NNJA 1GP5A 2WWSA 4N43A 4PBOA 2JDMA 2JDUA 3Q9OA 1R1A1 2BDRA 2D6NA 3JD72 4X6RB 1RUI2 5FLHA 5FZBA 5A7WA 5JPMB 3T3YA 1Q8SA 1KJRA 3CQOA 1RUE2 2H0BA 3RZLA 4LBJA 2VGDA 3AJZA 5BY5A 5F1RA 3VBFC 4QPYA 4HMZA 2VTFA 3JBG3 1C57A 5FQ0A 1LEMA 2XHKA 4PBPA 4TYSA 2FDGA 2CL2A 1EV11 4TLFA 2CAUA 2DBNA 3I7DA 1L3JA 5FFOC 1Z7S2 1TNRA 1B09A 1QWRA 4QX8A 5CKQA 3ENRA 3WF0A 2WYFA 3SISA 3VKMA 5FYCA 2GNDA 2X8KA 4BH9A 4H55A 2A5ZA 2WLPA 4M01A 2QFEA 5A7OA 2VCBA 5C8CC 1ZYBA 1VAMA 4P9LA 1DGRA 3LEMA 2DTWA 3FLTA 3VBUA 2P5BA 1UX7A 2R6QA 5KHHA 1UO9A 3AP4A 2OW4A 3SQOA 3O1UA 2JDAA 1AUYA 3MLKA 4QX0A 5E88A 1ZRFA 3PUSA 3N7KA 5FR3A 5FP8A 1HXS3 1QOTA 2Q5TA 4DNYA 4QMAA 1HW5A 1X8EA 4FPEA 4FOWA 3HQXA 3JUUA 4DIQA 3HD8B 1DZQA 3MIBA 5IK8A 4AHYA 2VULA 4BM8A 2FDHA 4XIOA 1QJFA 2OUHA 5A7PA 4ET7A 1JU4A 4YW2A 4CEWB 1R64A 1VRH2 3UV9A 5HI0A 4FO9A 3RZGA 4BQ2A 2ZABA 5K8SA 2VW2A 1NOVA 1ZZ6A 4R9BA 1LOCA 2Y0OA 3N7MA 2ZHMA 4FT8A 2R0HA 3LPGA 1J3RA 1R091 4K3UA 4BYYA 1EPZA 1A8DA 3DECA 4TZDA 3PVEA 2WDBA 1K3IA 1GFF2 4PI0A 5FXVA 1V9U2 1GUIA 1DQ5A 1QDOA 2A3WA 3S5AA 4ZS3A 3SHRA 2JKBA 2IXIA 3DPRB 1V6KA 4JKLA 5EIYB 4QPIA 3T0BA 2PQSA 2AGSA 4BCUA 3WXPA 1B35B 1WLTA 3KMHA 4RHV3 2QKDA 1AL0G 2VVEA 4P9GA 2BTVC 4AR2A 1O59A 3D0SA 3K3NA 3GNEA 5LEKA 2ES3A 2UWBA 2B7YA 3RWKX 3WR0A 5FZ1A 4QX3A 1RMU3 1EY2A 1QJY3 4FTEA 4PIYA 2VOWA 3MDPA 3NAPC 5FZEA 4PDWB 4CP9A 4AG4A 2BU9A 1C8NA 3MUZ1 1OQ1A 1UIKA 2WNOA 3RYRA 3BU7A 5B4NA 4H3WA 1VBC3 3CBNA 2WNVC 4AEMA 3IZOA 2E6VA 1CIWA 2B5HA 2XVGA 3LGRA 4LE4A 1TME2 3Q8BA 4XDOA 4XILA 5LEJA 5H9QA 3ACFA 4FSJA 3LOBA 4P9XA 4CCOA 1JZ8A 1OVSA 1W6NB 4Q4W3 3U1XA 1RUF2 3ZSEA 4AQTA 5KHIA 4CCKA 4ES9A 3IPVA 3MV11 2R063 4FCAA 1LECA 2W08A 5DQ0A 2JEMA 3O1TA 3DN7A 1IKQA 2K0GA 5L7OB 5FPLA 2ZMLA 3AB0A 4YZ4A 3KB5A 1AX2A 1CAUB 1MS5A 2XLAA 5FZ9A 2FMYA 3CJIB 1I5PA 5CAZA 3V0AB 1VB4A 1H9PA 5JZGA 1DG6A 2BNNA 2DU0A 2OS2A 1O4ZA 4HSJA 2HWD3 4Y1XA 4QDQA 5EXOA 4JGZC 1BKZA 4I02A 5DUUA 4HPKB 1Y9MA 1IKPA 2X5IA 1JBCA 2VXJA 3RZMA 4FFFA 2CY6A 3AMHA 2VZUA 3SLIA 2VQUA 4K1ZA 2VL4A 1ZBA1 3WCSA 2ZEYA 5L7OC 2IVJA 2VJXA 2ZEWA 5JVVA 3USSA 4CPBD 3J26N 1IQAA 4JHZA 5A7NA 2HLEA 1NA1A 1RUG2 1QJEA 4AQSA 2E9QA 1D2QA 2E7QA 5CFDA 2YXSA 5A3PA 2E26A 1ZBE2 2AH2A 3NSTA 2VMCA 1BZWA 5FY7A 3J7LA 3FE5A 2WLQA 4P9JA 4CCJA 2QQLA 2I45A 3LDBA 3WSOA 1GZCA 2ZPXA 3TB0A 3KV6A 1ZREA 5IK4A 5A3MA 2X05A 2AEYA 4FQZA 1GZTA 4Y24A 4NIAA 4EJRA 2K9ZA 4CDUB 2RS51 1EAH3 1UCXA 3D3AA 3I2HA 3VBSA 4ES8A 4LT5A 2W91A 1M06G 4HT1T 2HEYF 4QU2A 3I2JA 2WS92 1AR81 5DAPA 3VBOC 5LA0A 2ZGMA 3INAA 3M7AA 3WDYA 4OHZA 4A2UA 4YVWB 1UZ0A 4MH0E 2JDKA 1XYNA 4BQ5A 3D8CA 4JV4A 3ZO0B 2RS11 3CL1A 4BMBA 2A6YA 4YW6A 1SFYA 2ZJCA 3ES1A 3OY8B 3WNNA 1W9YA 2ATFA 2V72A 5C6CA 4NWVA 4AXOA 1D4M1 2QE3A 4LO6B 1AL23 3HJRA 4Q4Y3 2VMGA 5I8YA 5CFCC 3VBFA 4FFGA 1GNZA 4DZGA 4IGPA 1UAIA 4LKSA 2MEV2 1QQP2 4RN5A 2AACA 2HWB1 3G7DA 2PHWA 1IHMA 2E33A 2GC2A 1GKBA 5FMDA 1CQ9A 2BBAA 1X7NA 4EN6B 4ATFA 1OA2A 4RD7A 4XFBA 4XJWA 1UYYA 1LGBA 1YEWA 4FOYA 2LUWA 1X33A 3POWA 1BVVA 4MVTA 1OFSA 1BCXA 4ZXKA 5KXDA 5CEHA 2JXAA 3WG1A 5C8CA 1H1AA 1EPWA 3J8F1 4PJYA 4IEVA 3AZVA 4XZUG 3WD5A 4QQLA 5CKMA 3DPRC 2DFBA 5FYSA 5C71A 5FMBA 1FMD3 1OH3A 1MR5A 2OYZA 2OT7A 1W2UA 5KC5A 1B35C 3WG4A 5D8AB 5LY2A 4KWJA 2A73B 4NAOA 2PHRA 5A3OA 3E6DA 3T0DA 2OQ6A 1QMJA 1YRZA 1BMV2 4QXKA 3VBRA 1VJ2A 1UMZA 1RB8G 1AXKA 1RUD1 1NT0A 4LE3A 3KZ4C 2QQIA 1OBNA 4PLMA 2A7AA 5FUNA 4PDWC 2WSUA 5F37A 3WX5A 2CWSA 5KC6A 5T3NA 4Q4V3 5CZKA 1PGL2 1ND2C 3N3HA 2FCVA 5T54A 2JE7A 4ARXA 3VHPA 1AYN2 1XC6A 3NJZA 1NX9A 4JX0A 4HLTA 4LIVA 4P02B 4KWUA 4ZS2A 1G9AA 3R4UA 2OPKA 4YARA 1DFQA 2JDNA 5GLTA 4AVAA 2CDOA 1DGWA 1LOGA 1PNFA 1WWYA 1GNYA 1S0DA 1H9WA 5J48A 4Y1YA 4V2WA 1VE0A 3ACLA 1A3KA 1QGLA 3HQRA 1CAVA 3RMXA 5T5OA 1AYM3 1H2NA 2P2KA 1BEV2 4IEYA 5FK8A 3RRDA 1NZIA 4DFSA 4DUXA 1PVXA 2D3PA 5C5TA 3AYDA 2ZGLA 5A6XA 5JMCA 3TEXA 4GKYA 4Q0QA 2A75A 1FNYA 3R4SA 2F4LA 1UYZA 4N43B 2PYTA 4QXCA 4XF4A 2H6CA 2BOIA 4GB33 4Z8BA 3FUQA 2RR13 3NAPA 3WNOA 2HWE2 3MI8A 3OCPA 1JYCA 5DPNA 1IPJA 3H42B 2A1XA 4XXAA 1O8SA 3O0XA 4PF5A 1Q8OA 1O8PA 2WNVA 3HWJA 1DGWX 5FYTA 3FBYA 4D7SA 2W1QA 5FXXA 2Q8OA 5I93A 3H9AA 1GP6A 2FCUA 1VR3A 3MFAA 4YW1A 2FDJA 5FZ7A 3TYJA 2Q8EA 2XR4A 4EV0A 1VBB2 4CDXC 4K8FA 2GSYA 3AMMA 2VUJA 3WQ0A 1RGSA 1YQ5A 3LAGA 4ZONA 1HB4A 3KCCA 3BIEA 5HPOA 3GALA 1EUTA 4YW5A 1S55A 4CP0A 2ZGRA 4TLGA 4TWTA 1RUJ1 4XDQA 2VECA 1H1MA 4K40A 4QGNA 1OXCA 2BEOA 5FY4A 3GCXA 2B46X 2WWJA 4Q8KA 1J84A 4JGZA 4B7KA 1W8OA 3RZKA 2OVUA 1LEDA 4I3PA 2W68A 2IUWA 4AEDC 1UD1A 4LO5B 2VMEA 3AMQA 3MFCA 2WZR1 1NLQA 1XNAA 2D3SA 3P5BA 4OZXA 4WZFA 5FY8A 3RI9A 4F83A 4YFZA 5L7OA 2VTXA 1U12A 3A4UA 4YVWC 1PK6C 2XH6A 4HK8A 4XVHA 2MNGA 5LA1A 3CDZB 4LK6A 3ILNA 5DZFA 2ZOEB 3LSEA 5I0UA 3WDTA 1UU6A 2OX0A 4XZPA 3CNAA 4Y5Z0 3LA3A 4HOOA 2PLV1 2YY1A 1OA4A 5C3PA 4GMP1 4B7EA 3VD4A 1RVF2 4LR4A 2QJVA 3E97A 1XPWA 2FCTA 2O14A 1AR63 2YROA 1KFXL 1SLTA 4OZOA 4NHLA 3AKPA 3GXUA 1JW6A 4DRRA 4LBOA 4QPIB 3ZPOA 3K4ZA 2YFZA 3KT1A 4Q4V2 4Q4X2 5LCWL 3NJYA 3ZSMA 4BISA 1X50A 1PVC2 2OUJA 3THCA 2C4XA 2LRPA 1PIV3 4OHWA 2ZA9A 4L99A 4AFBA 3WZ1A 3IM0A 5GALA 4DOUA 5C4WB 1SZBA 1GZWB 1DDLA 3VBOA 1CIYA 3C7OA 1JOPA 2IZWA 1VBE1 5GLVA 5GZDA 4I0BA 4IE7A 4BLIA 2UY8A 4N9HA 4CP9B 4N53C 5JXGA 1E5HA 5K0UB 4BPZA 2XL9A 4AZZA 1O3TA 3RNSA 2AC1A 5LASA 2ZHNA 4P9IA 3MF9A 3NNLA 3ZX7A 3GGLA 5CFCA 4FPKA 3RYPA 3MW2A 2A3YA 2FHRA 4DUVA 4MGZE 3P3NA 5FUPA 3GHNA 5H9PA 3HOBA 1LULA 5A1FA 1X36A 4DO0A 4CEWA 3QLQA 2EXHA 1WZXA 3IPVB 1VBA1 2J42A 3MLLA 4LHSA 1DZRA 1ZA7A 3URFA 3U4SA 3BTAA 3JZVA 1HB3A 2NN8A 1H8VA 4NHYA 4Y20B 4AI2A 2BPA2 2G19A 4K7JA 1WD3A 2Y0IA 4LOTA 4YZ3A 5IVEA 2RS31 2FQPA 1XBFA 1LU2A 5JZGB 5BUVA 3ZXDA 2JDPA 1UY1A 1X8MA 1ULGA 2RMU1 2W92A 2W1UA 3DPRA 3MYXA 3ZN6A 4BDVB 2G9FA 2X5IB 4EWDA 2IXHA 4ZZ5A 5FZMA 4IUGA 1B35A 2R043 3VD7A 3ZR6A 1OLQA 5D1IA 4NJ4A 3DXUA 3IWZA 4LBQA 4UFMA 4XMAA 3SEEA 1JZ2A 5FIXA 5DAVA 2RDNA 4OMDA 2PMWB 1S0CA 2XMLA 1WCQA 1OUSA 2P3KA 4D0QA 3WG2A 5F3CA 3DYMA 1XU1A 4IDZA 3RS6A 1NA1B 2V73A 1OFNA 4PDWA 2DTYA 5CFDB 5C3OA 3OGVA 3WDVA 1CWPA 2XHNA 4QX1A 2EALA 3IN9A 4BIOA 3I3DA 2DCJA 1G9CA 1A34A 1Y43B 2BBVA 5DUXA 1ND2A 1ULPA 1IZ3A 1GQGA 1UIJA 1HRV2 2YHJA 5A1AA 5EWSA 3LSDA 2D97A 1GWKA 4AK3A 2WC2A 1Y9QA 3GZUC 1SLLA 1W6NA 1COV2 3N36A 4QT6A 4PT6A 1QOSA 3L2HA 3NV3A 1WMXA 3O5SA 2CWMA 4UBGA 1MVQA 4ZU5A 3VBSB 3MBWA 4C91A 5LK7B 3WNKA 2WO3A 4COUA 5BNOB 1MEC2 4HSLA 4LO4B 4HKWA 5ACA2 2XJQA 1D7PM 2YYOA 3V0AA 1DCSA 1UXXX 2D7FA 1ULCA 1ZZ9A 2ARBA 2JD4A 3O0WA 4IE6A 1FAYA 3ZYRA 3B94A 4XFAA 1ULEA 1WBLA 1OKOA 2W3JA 3DCQA 4DXRA 4SLIA 3DV8A 3H8RA 1Y4WA 4LXLA 4QAWA 5FO7B 3J7MA 4QB2A 2XLGA 1QJX2 2HWF3 1L7LA 2FBEA 2R072 3ME2A 2V4AA 4Z82A 5LY1A 5LA2A 1HB1A 2LROA 1T2XA 2WL1A 1NCRB 3OBTA 4EN0A 4KH9A 5E16A 4AVSA 2ARAA 1W8NA 2XBO1 3RSJA 4QHZA 1QJU2 4UT5A 1DGRN 4LUKA 3BCWA 2FDIA 4R52A 5A6YA 2W95A 3NNMA 2WA4A 3C2UA 4PLOA 5DG2A 1POV1 3BYWA 1IS6A 3JB4C 1HB2A 5C8CB 1BLZA 2ZKNA 2W5FA 5GZEA 3KGLA 5AC93 4AAXA 1S0GA 2RJLA 1UMIA 3I2KA 1JYIA 5CU1A 4PF1A 5KBFA 1RUH3 3THTA 3LEGA 2HWC2 3C7GA 5DDJ2 3WW1A 4FPFA 3MV01 3VKOA 2GNBA 1H30A 1TMF1 2VOVA 3VGIA 5FZ3A 1GQPA 3D82A 1G9BA 2NQYA 3RQ0A 1LOFC 3JXSA 5C4WC 4AEDA 4IL7A 4B8EA 3VZKA 2DYCA 1N1VA 3WNLA 1XE8A 3SCGA 4YYOA 5KHKA 3HR9A 3TEYA 4YVWA 2RJKA 2EAAA 3DUIA 1PK6A 4XABA 5A70A 2XB6C 5FLJA 1IPSA 3OGSA 2TUNA 1XE7A 2X29A 5K0UC 5KXBA 3OF1A 5FYUA 2BFUL 3OY8A 3IKWA 2I74A 4H2AA 2O0OA 5BNNC 3SMHA 1SHWB 3PUHA 1DYOA 2W47A 3MGUA 2VO5A 3JCIA 2WSVA 3PIJA 2W2IA 4YG0A 1W0PA 5IATA 3H8UA 1NLSA 3EMRA 5FJHA 3VZNA 2P3JA 4TSVA 2ZX4A 5CADA 1W8TA 4YW7A 1LGCA 2XONA 2Y64A 1SBDA 1E5SA 1ONAA 3POIA 4NAMA 2LM3A 4Y1ZA 4WM8B 1XSRA 3TN92 1UKRA 2D6MA 5E8AA 1KDMA 5J37A 3L9JT 2WNUC 3KF5A 4E8CA 1VMHA 2JENA 1BBT3 5JSRA 3CF6E 1OQDA 2P6HA 2X53S 3JD71 2PHLA 1RUI1 2W94A 4D6SA 2PHDA 3NNGA 4X8NA 4MHUA 1AX1A 1RUE1 5T50A 3WUDA 1C8M2 4AFAA 3CEWA 4N53A 1ZRRA 1KQRA 1NE6A 1I1EA 3BU0A 4QDSA 4JHTA 1YQ2A 2DURA 3N7LA 4XBNA 2WFF2 2WNVB 2NZ9A 1XNTA 5JOZA 2VUCA 2ZTNA 4XF0A 5C3RA 5FDBA 3H7YA 1SFPA 1DHKB 5JUVA 5FZOA 2SLIA 4LPLA 5I0TA 1Z7S1 5JIUA 2B9VA 2IWGB 5L19A 1JUHA 1G6NA 2ZBJA 3WUCA 1U5ZA 2ZZJA 3NKTA 4S2GA 1UY4A 1W6MB 5C9AC 4FTBA 2GN3A 4FVVA 1UY2A 2CSGA 2K46A 2XJRA 5FPUA 2Q8CA 2C26A 5D2AA 4A3ZA 4E2GA 5EZWA 4XJZA 3LQCA 4FOVA 2WUHA 2G9ZA 5BPXA 1PM4A 5T5JA 2BGOA 2B39A 5JR2A 1S2KA 3E1F1 3VD9A 4UF0A 3JQWA 2YBKA 2AZ5A 4YNIA 3IDBB 3ZLIA 1R082 4EWEA 3A0KA 4RR3C 3CHXA 4JGZB 4MOAA 3ZIWA 1SDWA 2JG8C 2W9XA 3WW3A 4AQ2A 3NV1A 2Q1ZB 4OUEA 4AVBA 2MPFA 3WW2A 3ZMNA 1W2OA 2RE9A 2UWCA 5BNOC 1QF3A 4QKDA 4XW3A 2RDRA 1ASJ2 5FO9B 2EF6A 1CZTA 4E8DA 1HRI2 3POFA 5JOXA 2BWCA 3OUIA 1CN1A 2RJ2A 4NUBA 4YZ5A 1WW7A 5BNQA 3HMYA 1LENA 3FUOA 1VRH1 4E4ZA 2IFRA 4TN7A 5LW9A 4Q0VA 4R4ZA 4CDQB 1JZ3A 3U14A 4AVVA 3I3BA 2A6XA 1POQA 4CCNA 4XBQA 3ZXLA 3WW4A 1SLAA 1XNCA 1UPIA 1MS4A 1NCRC 3S30A 1PMJX 1V9U1 1RHI2 3EO6A 5SV8A 1QJZA 2VZSA 2JG9B 4N7IA 4EYUA 2ZGSA 3KHBA 4L11A 3ZFEC 1GP4A 1O5UA 1UOJA 3OPZA 2JDYA 3H8XA 4GULA 2VQAA 5IAVA 3SCHA 4BA6A 4E2SA 2VZOA 1UY3A 1AR92 1MS1A 1NLRA 1H4GA 2D93A 3WHUA 1QH6A 1UOGA 1HJFA 2D44A 3VBOB 1QHDA 2RVAA 2XVLA 4MGQA 5T5PA 2GMMA 3BB6A 4M4RA 5JIAA 1W8FA 1X9PA 2WT0A 3VHOA 2Y60A 1FPN2 3WOGA 4SBVA 1R093 1O7FA 1OUXA 2Z2SB 1PX3A 1U5XA 1FOD2 1W8WA 3HEIA 4RGKA 5EQUA 5FKCA 2VCMA 1GZ9A 3HVDA 2RHPA 2FDKA 1DQ4A 3BIWE 4ASLA 1PHMA 1TME1 3ZPYA 5CFCB 2VU9A 2ILMA 4QU1A 3VN4A 4XE9A 1O4YA 4A6OA 3GBGA 3D0JA 3IAPA 3TAYA 1DQ0A 1QDCA 1RUF1 3ATGA 2Q0AA 3VUOA 1IOAA 4XCAA 5FP9A 4G4FA 1GANA 1C5HA 1FYUA 3EXUA 2RM23 2DWRA 2YDEA 4XAAA 1S0EA 2UWAA 4WZCA 1PZ9A 3KLSA 5FXZA 3C3VA 2DVAA 1YC61 1YQ8A 3LZZA 4ISQA 4G3YC 5C3SA 1PZ8A 1PO11 1SLCA 1YFYA 2WQZC 1ZZCA 1OI6A 3BUCA 3AKTA 5IFTA 3N9OA 4YM1A 4IE4A 3V0BB 3PU3A 5LATA 4XMIA 3CZUA 1AR72 2GNMA 3OGRA 3ZN6B 3HNBM 3KQ4B 4CZSA 1PO22 3T0AA 3U11A 4WM8C 4DINB 5FWJA 4CUGA 4LBQB 3CLPA 4Q5OA 2GMEA 4YG6A 5J98B 1VP6A 4MGSA 1RJ8A 2DU1A 3M3CA 1HQNA 3N9PA 4YGDA 2BV4A 3WDXA 1LOFA 1TG7A 2XL7A 5C4WA 1GZWA 4AEJA 2WINB 3HNMA 4B4PA 1QXRA 3MPPG 1RUC3 3GM8A 4JRAA 5F5CA 1RUG1 1TE1B 5FZDA 2GMPA 1S0JA 3HQUA 1LU1A 1ZBE1 5I8SA 4AGGA 5K0UA 2RG4A 4BWOA 3BVCA 4FPGA 1O3RA 1BXHA 2WO7A 2QZ3A 3ZSKA 1O3SA 3V65A 4AI1A 2DVBA 1ND2B 2E63A 5BNNA 1UXZA 4HETA 2GNTA 2IFWA 1JYVA 2VAUA 4YGCA 2WQ4A 3UL2A 1KS5A 1DYPA 3B9CA 1DLCA 4L97A 2EIEA 1W04A 2VOKA 1G8WA 4MGIE 2AR6A 4UFHA 1BK1A 4BE3A 5FOBB 1ZBA3 4A3XA 5H9SA 4QPGB 2Q4SA 1DP0A 2Y6FA 2I2SA 5FKBA 1Q8QA 2JIGA 3F95A 3RDIA 4Y20A 1H2KA 2O8OA 2WS91 4KU7A 4BLJA 5CBLA 3FN9A 2WNUA 4IV1B 3VL9A 1MS0A 3JBG2 2P34A 3PJQA 3AYCA 3LDKA 5G04L 4E4HA 4XQ4A 3J7HA 1JYNA 2JDHA 5L36A 1ENSA 3GJAA 3I3QA 2PAEA 2VTXJ 1UZWA 3HBZA 3E6CC 3ROUA 2WA3A 3AM2A 1ZZBA 5J7MA 3FJSA 2QQUA 2SBAA 2BFUS 1WLDA 1S1AA 2A3XA 1QQP1 1GOFA 1LGNA 2MEV1 3CMGA 3QH6A 3DYOA 2Q8DA 1LESA 2AENA 2E7TA 1OURA 3H1WA 3C7FA 1LTEA 2QDNA 3NJXA 5IW0A 3WVJA 5L9RA 1VALA 4ASKA 5ISLA 2D6KA 1AR83 3UESA 2P3IA 3AFGA 4CDQC 4OHYA 3LDRA 4CDXB 4A7ZA 5C9AA 1HXS2 3SNMA 1WBFA 1ZZ8A 2VCCA 4OVEA 1ULOA 3LE0A 4HN1A 4LK7A 1UNBA 2RS13 2QNKA 5IYYA 3B00A 4MX3A 1D4M3 3O1PA 5IK5A 2JG9C 2W0XA 3R05A 4L9BA 3OB8A 4COWA 1KJLA 2RM22 3T30A 4RR3A 1LB2A 2HWB3 3E5QA 1Q3EA 2JG8A 4XJ9A 5A6QA 3M3EA 1A8MA 1ZA4A 4Y4YA 1CAXB 4XETA 2B8MA 3TWIA 3UETA 4AHZA 5BNOA 1BMV1 4AEDB 5JDBA 1OLME 1ND3C 4QB6A 2EVXA 2D43A 3H3ZA 3T4VA 3LF7A 1KS4A 4IXLA 2XJTA 2D5FA 1PK6B 2OZJA 2EIGA 3ZYIB 3OBZA 1HKDA 4YWAA 3MLJA 2QDRA 2V09A 2XKOA 1PGL1 4CDWC 1RYYA 1S2EA 2GZWA 2WWUA 4RGGA 4ZU7A 2C0ZA 1AYN1 3POEA 4RHV2 5FP7A 2PHUA 1ENQA 1N1TA 4XACA 5FCCA 1YFXA 3U37A 3ACHA 1SLIA 1I9RA 3G6JB 3OUJA 3OEAA 5CB7A 1NCRA 3IBMA 1RUC2 3HAGA 5FJKA 1RMU2 1QJY2 1WKYA 1ENRA 1V6MA 2VNGA 2XUMA 4UW6A 5FY5A 4U36A 3E6BA 1D0HA 5LA9A 2MHFA 4IEZA 3ZFEA 2DVGA 5KXCA 1RUD3 4J1XA 3OD0A 1S2BA 1BEV1 4LKDA 1BJQA 3DKQA 1VBC2 4FPYA 1O4TA 5AVPA 2QQNA 1HDKA 3LEKA 2ORZA 4FBFA 4F3JA 2WT1A 3VHRA 1BYHA 1NXD1 2YG0A 1F5JA 4OULA 4Q4W2 5CA6A 5DAXA 1QU0A 4KBBA 4AFCA 2HWE1 4N53B 3T2OA 4DEQA 1V6LA 2R062 3ON7A 3PUAA 4NHKA 2DUQA 1WW5A 3O0VA 1VAVA 1OF4A 3AC0A 2ZGNA 1NYWA 3NV4A 5FYMA 3OYWB 5FPAA 1NQDA 3EYPA 3ZKUA 3FHIB 4AOCA 4OUMA 5FMOL 5HV0A 2VOXA 3ZYFA 5FZOB 1PMHX 4LOSA 1KFUL 5A3UA 2HWD2 4G9SB 1VBB1 3A0NA 5F3GA 3MIFA 2XJUA 1SMVA 2OIIA 3C7EA 1REDA 3PUQA 4H14A 1NAEA 5LRSA 2J1UA 3U4XA 3MW4A 5C7GA 4L0PA 5SV5A 1LKNA 3BGAA 1WMDA 1OKQA 2VMDA 4M0NA 1QKQA 3NRUA 4UF0B 1YWKA 3U78A 3VZLA 2E31A 4QPGC 4LIUA 2X09A 3LWCA 4QQOA 4XUNA 3MIEA 4LBNA 4WM8A 2FD8A 1OOPC 4IV1C 2ERFA 4NE9A 2VZQA 1W90A 4LBMA 4R9CA 4RL7A 1NUKA 1PX4A 4FPJA 3ORJA 5I0DA 3NJVA 5IVBA 4GWMA 2J22A 1F2NA 4D3WA 5EYYA 2VVFA 1JHJA 1RUJ3 1EAH2 1S0BA 1Q43A 4L2NA 2AUYA 2Y6HA 2NP0A 1AF9A 4EZHA 2Q1MA 2WNEA 1RVF1 2KR2A 4C0HA 2G1MA 4M3CA 2EXJA 2R30A 1QIQA 4NO4A 4ZHNA 2BVBA 3F2ZA 1H2MA 3KCXA 4JTOA 4X6QB 4XF3A 4IERA 4CUAA 1C1FA 4M3CF 2WZR3 2BP6A 2E7AA 4Q4X1 2V5YA 4Q4V1 1WCSA 1W6MA 1KEXA 1PVC1 1UY0A 3MIHA 4HANA 3MZHA 1WA6X 3HNYM 1AL22 4Q4Y2 4CEYC 4HFSA 4URAA 2PXJA 2VE1A 2WJSA 2YPDA 5D21A 1EP0A 3OUHA 4B1LA 3KD4A 1HV0A 2JE9A 2ZXQA 3CJXA 4NROA 3WF4A 2C24A 5A3LA 1Q8PA 4YZ1A 3VDBA 1MZFA 2PLV3 4O65A 2DUOA 4Y22A 4GMP3 5F5AA 4LO8A 3D5OA 4E9KA 5T55A 2YC0A 1NZCA 1SQ4A 1VB2A 3LFMA 4Q1RA 4NRMA 4Y3OA 3FC0A 1POV0 1IGOA 2G9GA 2D6OX 1F15A 1ZVFA 2CU5A 1MZEA 3ZXAC 1UZZA 2PHFA 2ZMKA 4HXCA 4BHPA 5IVFA 3PTYA 5FY0A 3SH4A 4EE2A 5IJRA 3FWEA 5F3IA 4QXBA 2HBTA 3A22A 4META 1UU4A 4XPVA 1FMD2 3H1MA 5FREA 3KCYA 1PGW2 4CDQA 1VBE3 3NVCA 4W6YA 1FV3A 2DF7A 2PAMA 4N7UA 3R6SA 4RA0A 4EROA 1OC1A 4LO7A 2IVIB 4S2HA 3AZXA 5FAXA 4XUPA 3RYKA 4GIQA 2WO1A 1DZTA 4JRLA 4XFCA 1C1LA 3Q8FA 5F5IA 5BNPC 4Y33A 4MLOA 2JG9A 2Q30A 1NY72 4UXAA 2YGLA 4HKOA 5DAWA 2GDFA 4LUMA 2N7GA 1WMEA 1W2TA 3BKZA 3I8TA 4XYXA 4QKNA 4CVUA 1H6YA 4N9IA 3MW3A 4FAGA
chains in the Genus database with same CATH topology
1J83A 1GQPA 2VMFA 3JXSA 3A21A 3OBAA 4DEVA 3WNLA 2YFUA 2J7MA 3WNPA 3OGSA 4ET7A 1JU4A 2JE8A 2WN2A 1R64A 5DMYA 4DXTA 2WABA 1JZ4A 4QX2A 1SHWB 3PUHA 1DYOA 2W47A 3LPGA 2VO5A 3OG2A 2VQTA 3DECA 3IDAA 2WQ8A 2WDBA 1K3IA 3EB7A 1GUIA 3FL7A 5EIYB 4JKLA 2XONA 2Y64A 2WYSA 3T0BA 2PQSA 2XOMA 1US3A 4XURA 4P00B 4MADA 4E8CA 2W1WA 1O59A 1JZ6A 2W94A 4BK5A 3NNGA 1UMHA 4QX3A 5IFPA 1OD3A 4AG4A 3MUZ1 4QDSA 1YQ2A 2VZVA 3WQBA 3OEBA 5B4NA 2VC9A 2DDUA 1XNTA 2V5DA 2E32A 2ORXA 3ACFA 1GOGA 4A44A 4LPLA 2B9VA 1JZ8A 4KI5M 3LEIA 2J1AA 1UY4A 3MV11 1UY2A 5DQ0A 3PUIA 3I2IA 2WN3A 2C26A 4CU7A 4A3ZA 3LQCA 2WUHA 3SEPA 2YC2A 1I5PA 2BGOA 4TTGA 5JR2A 2ZEXA 3E1F1 3VD9A 4UOJA 4W4ZA 3VDCA 4QDQA 4MOAA 2W9XA 4OUEA 1F4HA 5DN2A 4QB1A 4UI9L 3HPNA 2VZUA 3WF1A 2VQUA 3CIHA 1US2A 1L7RA 2R7EB 2VL4A 1CZTA 4E8DA 2ZEYA 2VJXA 2ZEWA 2RJ2A 4W50A 3CKHA 4Z2AA 1H6XA 3SKVA 3VD3A 4JHZA 2HLEA 5JXIA 1JZ3A 2E26A 4GWIA 4M4PA 3I3BA 2VMCA 1W9WA 2QQLA 3ACGA 3WSOA 1PMJX 2VZSA 2VM9A 2X05A 4BK4A 1NKGA 4RYDA 3I2HA 3D3AA 3DYPA 2VZOA 2W91A 1UY3A 1K12A 3I2JA 5LA0A 2RVAA 2W1SA 4MGQA 2Z4FA 1CZSA 4M4RA 2QQMA 2YB7A 1UZ0A 4BXSV 3T2QA 4CU8A 3GDBA 1PX3A 3HEIA 3WNNA 1GMMA 2V72A 2YC4A 5JMOA 1LNSA 2EICA 3HJRA 3LPFA 5JUVA 4CU9A 5C70A 4FI9A 4LKSA 4A6OA 3IAPA 4RN5A 1UYXA 5JXJA 2VZ1A 4W8JA 2E33A 1OH4A 2BBAA 1UYYA 2ZEZA 2V4VA 5IFTA 4KMQA 5HXMA 2WO2A 4XZUG 2VOTA 3CZUA 2Y6LA 3OGRA 3HNBM 1GU3A 5C71A 3T0AA 4JKMA 2L9LA 4MGSA 3T0DA 4CU6A 1TG7A 3HNMA 3GM8A 1BHGA 3K4DA 2QQIA 2VZTA 2RV9A 4A42A 2Y6GA 3MUY1 5CZKA 4ARXA 1UXZA 1JYVA 1XC6A 3ECQA 1NX9A 4JX0A 1DLCA 4P02B 2EIEA 4KWUA 1OT5A 2QBXA 2CDOA 1GNYA 2J1RA 1DP0A 4DUXA 4PQQA 3FN9A 1JZ5A 3A23A 1CZVA 1F4AA 5G04L 4CUCA 3ZM8A 1UYZA 3K46A 3J7HA 4LQRA 1JYNA 1SG3A 4GZ9A 2OKXA 3WNOA 1GOHA 2CDPA 5DPNA 2ID4A 3IB3A 1O8SA 3P1IA 1GOFA 1O8PA 3CMGA 3DYOA 2Y6JA 3VDAA 2W1QA 3C7FA 3NJXA 4YPJA 2EIBA 3UESA 1JYWA 2WBKA 2VCCA 1ULOA 3CZJA 3LE0A 4UAPA 3T09A 3SKJE 2HYXA 3WF2A 5IYYA 5HPOA 1EUTA 3MO4A 3W5NA 3I3EA 3OB8A 2X10A 3THDA 1J84A 5G05L 1K45A 1W0NA 1W8OA 3ETPA 1OF3A 1JI6A 1W9SA 3UETA 4P08A 2VMEA 4QB6A 2LW8A 1XNAA 2EIDA 5CYYA 1JYXA 1L7QA 3K75B 5LA1A 4XVHA 3CDZB 5IHRA 1UWWA 1RYYA 4GWJA 3U37A 3ACHA 3VD4A 3OEAA 2C9KA 1XPWA 3FHQA 1W9TA 1WKYA 4OZOA 2W46A 2JD9A 2BGPA 3GXUA 4MO3M 3I2GA 3K4ZA 2YFZA 5FUIA 4DUWA 5LCWL 3THCA 2C4XA 2QQNA 3IIIA 3LEKA 2ORZA 2J1TA 1CIYA 2VCAA 3C7OA 1HN1A 2YG0A 3T2PA 4OYUA 1MPXA 5JXHA 3FHAA 4DEQA 3T2OA 5JXGA 3WNMA 2WAOA 1OF4A 3AC0A 3ACIA 3C7HA 3EYPA 2B4KA 4P5YA 3GGLA 4XUQA 2J1SA 1SDDB 1PMHX 4DUVA 3HOBA 3BN6A 3K4AA 3VD5A 4LHSA 2DCKA 3C7EA 4A45A 3HN3A 2QQOA 1NAEA 2J1VA 1CX1A 2BERA 2J1UA 4TXWA 5C7GA 4L0PA 2Y6KA 1TVGA 3BGAA 2VMDA 1EUUA 2Y8KA 3NRUA 5J1XA 1UY1A 4DXSA 3P6BA 2E31A 4BJ0A 5F7UA 2W92A 3WF3A 2W1UA 2X09A 2VZRA 4BDVB 4ZZ5A 4XUNA 4IUGA 3VD7A 2J1EA 3K77A 1JZ2A 5B4XA 3SEEA 2VZQA 4ZZ8A 3UNPA 4OMDA 4A4AA 4XUTA 1NUKA 1PX4A 1JU3A 1WCQA 4QPWA 5I0DA 1JZ7A 3NJVA 4D0QA 2JKXA 3DYMA 2J22A 2QQKA 2WZEA 1JHJA 3NQHA 2XQXA 3OGVA 2XHNA 4QX1A 2Y6HA 4XUOA 4ZXEA 3W5MA 3I3DA 2DCJA 2KD7A 3ABZA 1ULPA 2BZDA 2LS6A 5A1AA 1IQDC 3F2ZA 2VR4A 4CUAA 3IAQA 4D8MA 4PT6A 5EJ1B 1KEXA 1UY0A 2VZPA 4CUBA 3MBWA 3HNYM 1K42A 2WAAA 3WNKA 1W99A 2WO3A 4ZY9A 4QDRA 4A41A 2ZXQA 3WF4A 3T08A 3VDBA 1D7PM 3A7QA 4JKKA 1UXXX 3I97A 3CQOA 2W3JA 4DXRA 4QAWA 4QB2A 3I2FA 1KGYA 2VTFA 5LA2A 1T2XA 5IJRA 5EJZB 2QQJA 3A22A 1P8JA 1W8NA 3C8XA 3WF0A 2W95A 4XUPA 3WEZA 2WO1A 2VCBA 2W5FA 4AAXA 1UX7A 1UMIA 3I2KA 2W87A 4PF1A 2WZ8A 2VZ3A 3C7GA 3LEGA 4HG6B 2JDAA 4OMCA 4ARYA 4QX0A 4CVUA 1H6YA 3MV01
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J83 A;  1GQP A;  2VMF A;  3JXS A;  3A21 A;  3OBA A;  4DEV A;  3WNL A;  2YFU A;  2J7M A;  3WNP A;  3OGS A;  4ET7 A;  1JU4 A;  2JE8 A;  2WN2 A;  1R64 A;  5DMY A;  4DXT A;  2WAB A;  1JZ4 A;  4QX2 A;  1SHW B;  3PUH A;  1DYO A;  2W47 A;  3LPG A;  2VO5 A;  3OG2 A;  2VQT A;  3DEC A;  3IDA A;  2WQ8 A;  2WDB A;  1K3I A;  3EB7 A;  1GUI A;  3FL7 A;  5EIY B;  4JKL A;  2XON A;  2Y64 A;  2WYS A;  3T0B A;  2PQS A;  2XOM A;  1US3 A;  4XUR A;  4P00 B;  4MAD A;  4E8C A;  2W1W A;  1O59 A;  1JZ6 A;  2W94 A;  4BK5 A;  3NNG A;  1UMH A;  4QX3 A;  5IFP A;  1OD3 A;  4AG4 A;  3MUZ 1;  4QDS A;  1YQ2 A;  2VZV A;  3WQB A;  3OEB A;  5B4N A;  2VC9 A;  2DDU A;  1XNT A;  2V5D A;  2E32 A;  2ORX A;  3ACF A;  1GOG A;  4A44 A;  4LPL A;  2B9V A;  1JZ8 A;  4KI5 M;  3LEI A;  2J1A A;  1UY4 A;  3MV1 1;  1UY2 A;  5DQ0 A;  3PUI A;  3I2I A;  2WN3 A;  2C26 A;  4CU7 A;  4A3Z A;  3LQC A;  2WUH A;  3SEP A;  2YC2 A;  1I5P A;  2BGO A;  4TTG A;  5JR2 A;  2ZEX A;  3E1F 1;  3VD9 A;  4UOJ A;  4W4Z A;  3VDC A;  4QDQ A;  4MOA A;  2W9X A;  4OUE A;  1F4H A;  5DN2 A;  4QB1 A;  4UI9 L;  3HPN A;  2VZU A;  3WF1 A;  2VQU A;  3CIH A;  1US2 A;  1L7R A;  2R7E B;  2VL4 A;  1CZT A;  4E8D A;  2ZEY A;  2VJX A;  2ZEW A;  2RJ2 A;  4W50 A;  3CKH A;  4Z2A A;  1H6X A;  3SKV A;  3VD3 A;  4JHZ A;  2HLE A;  5JXI A;  1JZ3 A;  2E26 A;  4GWI A;  4M4P A;  3I3B A;  2VMC A;  1W9W A;  2QQL A;  3ACG A;  3WSO A;  1PMJ X;  2VZS A;  2VM9 A;  2X05 A;  4BK4 A;  1NKG A;  4RYD A;  3I2H A;  3D3A A;  3DYP A;  2VZO A;  2W91 A;  1UY3 A;  1K12 A;  3I2J A;  5LA0 A;  2RVA A;  2W1S A;  4MGQ A;  2Z4F A;  1CZS A;  4M4R A;  2QQM A;  2YB7 A;  1UZ0 A;  4BXS V;  3T2Q A;  4CU8 A;  3GDB A;  1PX3 A;  3HEI A;  3WNN A;  1GMM A;  2V72 A;  2YC4 A;  5JMO A;  1LNS A;  2EIC A;  3HJR A;  3LPF A;  5JUV A;  4CU9 A;  5C70 A;  4FI9 A;  4LKS A;  4A6O A;  3IAP A;  4RN5 A;  1UYX A;  5JXJ A;  2VZ1 A;  4W8J A;  2E33 A;  1OH4 A;  2BBA A;  1UYY A;  2ZEZ A;  2V4V A;  5IFT A;  4KMQ A;  5HXM A;  2WO2 A;  4XZU G;  2VOT A;  3CZU A;  2Y6L A;  3OGR A;  3HNB M;  1GU3 A;  5C71 A;  3T0A A;  4JKM A;  2L9L A;  4MGS A;  3T0D A;  4CU6 A;  1TG7 A;  3HNM A;  3GM8 A;  1BHG A;  3K4D A;  2QQI A;  2VZT A;  2RV9 A;  4A42 A;  2Y6G A;  3MUY 1;  5CZK A;  4ARX A;  1UXZ A;  1JYV A;  1XC6 A;  3ECQ A;  1NX9 A;  4JX0 A;  1DLC A;  4P02 B;  2EIE A;  4KWU A;  1OT5 A;  2QBX A;  2CDO A;  1GNY A;  2J1R A;  1DP0 A;  4DUX A;  4PQQ A;  3FN9 A;  1JZ5 A;  3A23 A;  1CZV A;  1F4A A;  5G04 L;  4CUC A;  3ZM8 A;  1UYZ A;  3K46 A;  3J7H A;  4LQR A;  1JYN A;  1SG3 A;  4GZ9 A;  2OKX A;  3WNO A;  1GOH A;  2CDP A;  5DPN A;  2ID4 A;  3IB3 A;  1O8S A;  3P1I A;  1GOF A;  1O8P A;  3CMG A;  3DYO A;  2Y6J A;  3VDA A;  2W1Q A;  3C7F A;  3NJX A;  4YPJ A;  2EIB A;  3UES A;  1JYW A;  2WBK A;  2VCC A;  1ULO A;  3CZJ A;  3LE0 A;  4UAP A;  3T09 A;  3SKJ E;  2HYX A;  3WF2 A;  5IYY A;  5HPO A;  1EUT A;  3MO4 A;  3W5N A;  3I3E A;  3OB8 A;  2X10 A;  3THD A;  1J84 A;  5G05 L;  1K45 A;  1W0N A;  1W8O A;  3ETP A;  1OF3 A;  1JI6 A;  1W9S A;  3UET A;  4P08 A;  2VME A;  4QB6 A;  2LW8 A;  1XNA A;  2EID A;  5CYY A;  1JYX A;  1L7Q A;  3K75 B;  5LA1 A;  4XVH A;  3CDZ B;  5IHR A;  1UWW A;  1RYY A;  4GWJ A;  3U37 A;  3ACH A;  3VD4 A;  3OEA A;  2C9K A;  1XPW A;  3FHQ A;  1W9T A;  1WKY A;  4OZO A;  2W46 A;  2JD9 A;  2BGP A;  3GXU A;  4MO3 M;  3I2G A;  3K4Z A;  2YFZ A;  5FUI A;  4DUW A;  5LCW L;  3THC A;  2C4X A;  2QQN A;  3III A;  3LEK A;  2ORZ A;  2J1T A;  1CIY A;  2VCA A;  3C7O A;  1HN1 A;  2YG0 A;  3T2P A;  4OYU A;  1MPX A;  5JXH A;  3FHA A;  4DEQ A;  3T2O A;  5JXG A;  3WNM A;  2WAO A;  1OF4 A;  3AC0 A;  3ACI A;  3C7H A;  3EYP A;  2B4K A;  4P5Y A;  3GGL A;  4XUQ A;  2J1S A;  1SDD B;  1PMH X;  4DUV A;  3HOB A;  3BN6 A;  3K4A A;  3VD5 A;  4LHS A;  2DCK A;  3C7E A;  4A45 A;  3HN3 A;  2QQO A;  1NAE A;  2J1V A;  1CX1 A;  2BER A;  2J1U A;  4TXW A;  5C7G A;  4L0P A;  2Y6K A;  1TVG A;  3BGA A;  2VMD A;  1EUU A;  2Y8K A;  3NRU A;  5J1X A;  1UY1 A;  4DXS A;  3P6B A;  2E31 A;  4BJ0 A;  5F7U A;  2W92 A;  3WF3 A;  2W1U A;  2X09 A;  2VZR A;  4BDV B;  4ZZ5 A;  4XUN A;  4IUG A;  3VD7 A;  2J1E A;  3K77 A;  1JZ2 A;  5B4X A;  3SEE A;  2VZQ A;  4ZZ8 A;  3UNP A;  4OMD A;  4A4A A;  4XUT A;  1NUK A;  1PX4 A;  1JU3 A;  1WCQ A;  4QPW A;  5I0D A;  1JZ7 A;  3NJV A;  4D0Q A;  2JKX A;  3DYM A;  2J22 A;  2QQK A;  2WZE A;  1JHJ A;  3NQH A;  2XQX A;  3OGV A;  2XHN A;  4QX1 A;  2Y6H A;  4XUO A;  4ZXE A;  3W5M A;  3I3D A;  2DCJ A;  2KD7 A;  3ABZ A;  1ULP A;  2BZD A;  2LS6 A;  5A1A A;  1IQD C;  3F2Z A;  2VR4 A;  4CUA A;  3IAQ A;  4D8M A;  4PT6 A;  5EJ1 B;  1KEX A;  1UY0 A;  2VZP A;  4CUB A;  3MBW A;  3HNY M;  1K42 A;  2WAA A;  3WNK A;  1W99 A;  2WO3 A;  4ZY9 A;  4QDR A;  4A41 A;  2ZXQ A;  3WF4 A;  3T08 A;  3VDB A;  1D7P M;  3A7Q A;  4JKK A;  1UXX X;  3I97 A;  3CQO A;  2W3J A;  4DXR A;  4QAW A;  4QB2 A;  3I2F A;  1KGY A;  2VTF A;  5LA2 A;  1T2X A;  5IJR A;  5EJZ B;  2QQJ A;  3A22 A;  1P8J A;  1W8N A;  3C8X A;  3WF0 A;  2W95 A;  4XUP A;  3WEZ A;  2WO1 A;  2VCB A;  2W5F A;  4AAX A;  1UX7 A;  1UMI A;  3I2K A;  2W87 A;  4PF1 A;  2WZ8 A;  2VZ3 A;  3C7G A;  3LEG A;  4HG6 B;  2JDA A;  4OMC A;  4ARY A;  4QX0 A;  4CVU A;  1H6Y A;  3MV0 1; 
#chains in the Genus database with same CATH topology
 3HT1 A;  1CJD A;  3VL8 A;  3AYA A;  3AP6 A;  1CJP A;  1VBA 3;  3EJK A;  2C9A A;  3A21 A;  3K3O A;  3TRS B;  3APB A;  5FPB A;  1ND3 A;  3T1M A;  3ZFF C;  1BQP A;  2YFU A;  4FOQ A;  5J36 A;  2J7M A;  3WNP A;  2GAU A;  3M2M A;  1URX A;  4JQT A;  2RS3 3;  3OGJ A;  4JDM A;  5HCF A;  5C3Q A;  5DMY A;  4P9Y A;  3SH3 A;  4CDW A;  4DXT A;  1AYM 2;  1TZO A;  5BNN B;  4QX2 A;  1HRV 1;  1CPM A;  1FT9 A;  2VMH A;  1YNA A;  2NM1 A;  1K5M B;  4CXY A;  4MG2 A;  1LR5 A;  3GHM A;  5F8P A;  4A6S A;  1LJ7 A;  1LOD A;  2A6V A;  4MXW B;  1JXN A;  2VQT A;  1COV 1;  4GB3 2;  2ZZQ A;  3J9S A;  4AGV A;  3ILF A;  4B4R A;  4YSF A;  3S57 A;  2NMO A;  3ASI A;  3ETQ A;  2RR1 2;  4UW4 A;  4GXL A;  1CAW A;  1OD5 A;  1RXG A;  4IND A;  5IVC A;  1ZNP A;  4XTM A;  3VHN A;  1YXW A;  1MEC 1;  2CGO A;  1MZ5 A;  2XOM A;  3CO2 A;  3PUR A;  4XIK A;  4AYU A;  1U0A A;  4QD2 A;  1V6N A;  5A1L A;  5ACA 1;  2WNU B;  1LOB A;  4MAD A;  2ZGK A;  2W1W A;  1XE0 A;  2P1B A;  2XXZ A;  1S4C A;  2EA7 A;  3PJY A;  4BQW A;  4BK5 A;  1QNY A;  3V0B A;  2BQP A;  3UJO A;  4Q26 A;  1LRH A;  1VBD 3;  5IFP A;  4YZ2 A;  5KR7 A;  1QOO A;  3KT7 A;  2YZ4 A;  4C1X A;  4KWL A;  5GLZ A;  1VAK A;  1OVP A;  4MZU A;  2UYB A;  3LD8 A;  1QJX 1;  2R0F A;  1PGS A;  3O1S A;  2R07 1;  2YGM A;  4LBQ D;  2VC9 A;  1WA4 A;  3GCW A;  3LIG A;  4XF1 A;  1YO8 A;  2FZ1 A;  2JEC A;  5LBE A;  2GAL A;  2GH8 A;  2V5D A;  1UL9 A;  1UU5 A;  4ONU A;  3T2T A;  4C90 A;  1G9D A;  5HCH A;  2E32 A;  1VPH A;  2GP5 A;  5J09 A;  4KNC A;  3S6P A;  1DQ6 A;  1QJU 1;  4K9S A;  4XDP A;  1IS4 A;  4KI5 M;  3LEI A;  4YM3 A;  3KV9 A;  1H0B A;  5C9A B;  4OHV A;  1IPK A;  1C4R A;  3B01 A;  3H3L A;  4ORF A;  2BYV E;  3PUI A;  4LKE A;  2WN3 A;  4CU7 A;  4IE0 A;  3DXT A;  2AEZ A;  2VY0 A;  1YFW A;  2Z42 A;  3SEP A;  2ET7 A;  2YC2 A;  1HV1 A;  3VZM A;  3ZXE A;  4TTG A;  4K20 A;  2Y33 A;  4K8R B;  5LBC A;  1D2S A;  2HWC 1;  5DDJ 1;  4W4Z A;  3VDC A;  5GZG A;  4QPG A;  4RR3 B;  2JG8 B;  1WCK A;  3MIG A;  4C1W A;  3ZXF A;  2ARX A;  1FV2 A;  3HPN A;  2XBO 3;  1RIN A;  5CIS A;  3LKJ A;  4D6R A;  1OOP A;  4K21 A;  3CIH A;  4IV1 A;  1L7R A;  1H8T C;  4GD4 A;  4NWW A;  4OFG A;  5FZK A;  2ZGP A;  5F2S A;  1AR6 2;  1POV 3;  5ANN A;  5FK7 A;  3RMY A;  5EP9 A;  1Z78 A;  1H6X A;  5LBF A;  1AVB A;  5FMO S;  3SKV A;  3VD3 A;  2FZ2 A;  2B9U A;  4OCT A;  2ZGT A;  1SLB A;  3NW4 A;  4QWN A;  5EJ3 A;  1OA3 A;  4GWI A;  4M4P A;  3RI8 A;  1STM A;  3N9M A;  5FZC A;  4XFI A;  1PIV 2;  4FQ4 A;  5LZ6 A;  4XF9 A;  4IET A;  4OI4 A;  2PFW A;  2HEW F;  2DFC A;  5IVJ A;  3ACG A;  1TMF 3;  3KV4 A;  2VQ0 A;  3S0M A;  1MQT C;  3VLB B;  1TEI A;  1N3P A;  1K5J A;  2VM9 A;  4BQX A;  3ZFE B;  2D3R A;  2XJV A;  1O3Q A;  4NN0 A;  4CDX A;  5L9V A;  5CNA A;  3TN9 1;  4RYD A;  4KG8 A;  4ASM B;  3NKG A;  5EFU A;  2BOJ A;  4CEY A;  1CVN A;  3S5Q A;  4QQH A;  5E89 A;  5E6H A;  4Q1P A;  2W1S A;  4L92 A;  5DUV A;  3ZYH A;  4W6X A;  5F6L B;  1CZS A;  3K51 A;  4XAE A;  3X29 B;  2QQM A;  1C8M 1;  2YB7 A;  3PMS A;  5FXW A;  2LTN A;  4ZKT B;  3H50 A;  1I3H A;  3BI3 A;  3T2Q A;  1G7Y A;  3PLQ A;  3AFK A;  3GDB A;  4LKF A;  5L73 A;  3WQ7 A;  1FXZ A;  3FFZ A;  3KHC A;  5DG1 A;  4Z07 A;  2WFF 1;  1ZRC A;  2YC4 A;  1CAX A;  2YUE A;  5JMO A;  2EIC A;  1DLL A;  1G86 A;  4MYE A;  3THP A;  1IG0 A;  3SCF A;  4FI9 A;  5FYZ A;  5C70 A;  2BNO A;  1E5R A;  1F31 A;  1MS9 A;  1W9F A;  4XTP A;  5A80 A;  3SXW A;  4JZR A;  3N35 A;  4KGQ A;  4ATE A;  4L8Q A;  1W28 A;  4IEO A;  4J6G A;  1UYX A;  3O1O A;  3NV2 A;  2VZ1 A;  1D0G A;  1FAT A;  1VBD 2;  4W8J A;  5FWE A;  3OSD A;  3ZYP A;  1GQH A;  2QZ2 A;  1R1Z A;  3JD7 3;  3H3U A;  1RUI 3;  4PHZ A;  4YFW A;  4Y5T A;  2R04 2;  3HBK A;  3B93 A;  5K7P A;  1RUE 3;  1PZ7 A;  3BOW A;  1KDK A;  2ZEZ A;  4EZ4 A;  3GF6 A;  1K5M C;  2RDS A;  5L9B A;  2PEL A;  3FFQ A;  4PCR A;  3KVA A;  1JOD A;  1R08 1;  5HXM A;  1CES A;  2WO2 A;  1OPO A;  2VOT A;  5ABJ B;  2Y6L A;  5IVY A;  1JMU B;  3M70 A;  5FZ8 A;  3FX3 A;  4I0W B;  4BB3 A;  3O14 A;  1Z7S 3;  3ZDS A;  1XND A;  1ASJ 1;  3LB9 A;  2IC1 A;  1J3P A;  4NRQ A;  5JI9 A;  2L9L A;  4OQ8 A;  3OOX A;  1HRI 1;  3FLR A;  3W58 A;  3RZJ A;  4BU2 A;  4CU6 A;  3W59 A;  4FPO B;  2CGP A;  1XNB A;  2O1Q A;  3D6E A;  3ELN A;  3KQR A;  4IV3 B;  3B69 A;  3DF0 A;  1O5L A;  3ZFF A;  4H7M A;  4XFG A;  2XPJ A;  4FAH A;  4HZF A;  1UOF A;  1Q5O A;  2NLR A;  2VZT A;  4AGR A;  4QM9 A;  5FZH A;  1W3V A;  2RV9 A;  3IMM A;  5FP3 A;  5DUW A;  4XJ8 A;  2DBI A;  2Y6G A;  3MUY 1;  2WR9 A;  4P14 A;  4QHO A;  5DXD A;  5GZF A;  2D98 A;  3OYW A;  4M3C B;  2DVF A;  1RHI 1;  4YM2 A;  1LHN A;  1SCR A;  2PHX A;  2XJP A;  3J7N A;  3I2O A;  4NIG A;  1OT5 A;  2DVD A;  3OPW A;  2XKP A;  2QBX A;  4XCB A;  2DUP A;  4LHL A;  2CV6 A;  1R1A 3;  1W6P B;  4NPM A;  1AR9 1;  1VRH 3;  3NO8 A;  4E27 A;  1V00 A;  2HWF 2;  2W39 A;  1GLH A;  3AXD A;  5IUQ A;  3V56 A;  3ZN5 A;  5I91 A;  5EYX A;  1JZ5 A;  3A23 A;  4UW5 A;  1F4A A;  4BQ1 A;  1FPN 1;  5FZG A;  1SCS A;  2R49 A;  4Y22 B;  4NHM A;  3K48 A;  4LQR A;  1FOD 1;  1AX0 A;  4RFT 0;  1LHW A;  1SG3 A;  1VMJ A;  1V9U 3;  4GZ9 A;  5FPV A;  2OKX A;  1EV1 3;  1ZRI A;  2BRT A;  5FP4 A;  3W9A A;  3HT2 A;  1SPP A;  2CDP A;  1H4H A;  5LBB A;  2ID4 A;  4WVM A;  5T5L A;  1MVE A;  2HEV F;  4IW3 A;  4B4Q A;  3ZYG A;  4RQP C;  1N3O A;  3AZW A;  5AFE A;  4D7Y A;  1XRU A;  5AC9 2;  3AXE A;  5F5Q A;  4URT A;  4AI9 A;  2OZ6 A;  4JDO A;  1RUH 2;  1C5I A;  5FY1 A;  2EIB A;  2TNF A;  1HN0 A;  1ZM1 A;  4GH4 C;  2GC1 A;  1JYW A;  2WBK A;  5LK5 A;  4N90 A;  4P9W A;  1IS5 A;  4LEJ A;  2ZX3 A;  2ZX1 A;  3N4M A;  4LLF A;  1RL3 A;  2HYX A;  4ITC A;  2Z79 A;  3ZDV A;  4QX5 A;  4XFF A;  5HCB A;  5IT6 A;  4EN7 B;  1AR7 1;  2VG9 A;  3AP9 A;  1TME 3;  4ISR A;  3VV1 A;  1RXF A;  3PL0 A;  1PO2 1;  1Z0H A;  2X10 A;  4WM7 C;  3THD A;  1AXZ A;  4Z2W A;  1RUF 3;  3AL6 A;  4BZ4 A;  3N9Q A;  5IVV A;  4RS5 C;  5FZ4 A;  4BOW A;  5CG9 A;  1OF3 A;  5GLW A;  1V70 A;  1W9S A;  4P08 A;  2ZS6 B;  1PMI A;  2VD7 A;  1Y7B A;  3QOP A;  1ND3 B;  4I0A A;  1H8T A;  4LLO A;  3BTY A;  4HVO A;  2Q1F A;  4JDN A;  3MF6 A;  5GZC A;  1AJK A;  1JYX A;  1PO1 3;  2EAK A;  4E4D X;  1L7Q A;  2DV9 A;  2OA2 A;  4RSU A;  5IHR A;  4FP3 A;  1UWW A;  4CDW B;  4AFM A;  1PM7 A;  1W8H A;  3VDD C;  3IMN A;  1I6X A;  1BBT 2;  4FP2 A;  5BYN A;  3QAC A;  4Y1U A;  1C3H A;  1UX6 A;  3HIF A;  3VZJ A;  4XJU A;  4GWN A;  2IXJ A;  4KGG A;  4XQD A;  3ZYB A;  2C9K A;  1MQT A;  2QQW A;  1UW8 A;  3FHQ A;  3MPB A;  4QKB A;  4BQ4 A;  4LTA A;  1C28 A;  4Q8L A;  1CAW B;  3WP4 A;  3RZH A;  2BGP A;  2QQP A;  1LOA A;  1JYT A;  3BAL A;  1RUG 3;  4AEK A;  5FUI A;  4DUW A;  3OJB A;  5FRA A;  4XOG A;  1ZBE 3;  3JBG 1;  1Y3T A;  1GIC A;  2XDV A;  4Q0S A;  3WP5 A;  3GYD A;  4YVS C;  3KGZ A;  5FZL A;  3RWN A;  3POG A;  3VBR C;  2VCA A;  1HN1 A;  4UFL A;  2O8Q A;  3Q8C A;  5ABJ C;  3S7I A;  1KD7 A;  1OLR A;  1MPX A;  4OYU A;  5JXH A;  3I49 A;  2VVD A;  1R1A 2;  2WAO A;  4QQ2 A;  5ANQ A;  1I5Z A;  1XXN A;  2LAL A;  3R0R A;  4IEQ A;  4Q2F A;  4V1P A;  3B9I A;  3C7H A;  4AVC A;  4JTN A;  2B4K A;  3UGG A;  1IG3 A;  4IV3 C;  4NII A;  3KWV A;  3LA2 A;  1NCQ B;  2WS9 3;  1W8Z A;  5C8W A;  3BN6 A;  1UN1 A;  5FZ0 A;  2EXI A;  5A7S A;  1HXS 1;  1EV1 2;  4CXX A;  3K4A A;  4WVW A;  3JU9 A;  2DCK A;  2GH2 A;  3HN3 A;  1BK0 A;  1UZY A;  4LOR A;  2QQO A;  1K5M A;  2J1V A;  3PU8 A;  4GAZ A;  2BER A;  4MXW A;  4CCL A;  2Y6K A;  2RM2 1;  2MEV 3;  1V6J A;  1QQP 3;  1EUU A;  4COY A;  1GWL A;  3P6B A;  5GLU A;  4IES A;  2CAV A;  4BJ0 A;  5F7U A;  2GC3 A;  3N9L A;  3WF3 A;  3ZN4 A;  2ZAC A;  1S0F A;  4DRV A;  4ZU4 A;  3ZOI A;  2UUR A;  5J3U A;  1FNZ A;  1LHV A;  2JB4 A;  1TNF A;  2VBP A;  1JHN A;  2H6B A;  1OOP B;  4JQR A;  1GV9 A;  5F3E A;  2VH9 A;  3DGT A;  3M3Q A;  4AI0 A;  4ZZ8 A;  3ZFG C;  1XOY A;  3UNP A;  1SBF A;  1NXM A;  2XUE A;  3CU7 A;  1YLL A;  3KVB A;  3WP3 A;  4QPW A;  1A6C A;  1LOE A;  1YJL A;  2YV8 A;  4RGA A;  1JZ7 A;  2VW0 A;  3KT4 A;  2JKX A;  3AP5 A;  2XVK A;  1Q8V A;  3GZT B;  3LCP A;  1D4V B;  2H0V A;  2WZE A;  1GNH A;  3T1L A;  3H7J A;  3ZXG A;  5EV7 A;  4RHV 1;  3NQH A;  2XQX A;  5HBA A;  4AL9 A;  2JIJ A;  5HV4 A;  4XUO A;  3KM5 A;  2RS5 3;  2KD7 A;  4YG3 A;  1DGL A;  1AXY A;  1REE A;  2BZD A;  3ABZ A;  3GJB A;  3NNF A;  2LS6 A;  4DB5 A;  4EN8 B;  1RUC 1;  1ZRD A;  4DXZ A;  4LJH A;  1RMU 1;  1WD4 A;  1QJY 1;  4CP2 A;  4CP1 A;  4JGY C;  4OHX A;  1OPM A;  2PHT A;  1R09 2;  1PO1 2;  3QD6 A;  2RDQ A;  2C6S A;  4R9A A;  5F2W A;  2DCY A;  4FPH A;  4Y26 A;  3POS A;  3AJY A;  4HK9 A;  1VBC 1;  3PNA A;  4IEU A;  4O7X A;  5EJ1 B;  3UKN A;  3LIH A;  1W2N A;  3KSC A;  4CUB A;  1K42 A;  2QTW B;  2WAA A;  1W99 A;  4GJZ A;  4BME A;  4CEY B;  4A41 A;  3RJR A;  2E51 A;  3TOJ A;  1NG0 A;  4BQY A;  4A7K A;  1AYN 3;  2ZGO A;  3L2Y A;  4MUV A;  4Q4W 1;  4C8D A;  1A78 A;  1JOB A;  1W6O B;  2BVV A;  4CPB A;  3I97 A;  2R06 1;  4D94 A;  5LWB A;  4CSW A;  4Q27 A;  1H2L A;  4MSV A;  4IGO A;  4EN9 B;  1X82 A;  3KF3 A;  3RFR A;  1W39 A;  5A32 A;  2OXB A;  1ENX A;  4HBN A;  5CG8 A;  3RVH A;  3MID A;  1JS9 A;  2JB8 A;  4GMP 0;  4ZPI A;  3I2F A;  1J59 A;  1LHO A;  3AYE A;  2ARE A;  1BEV 3;  2TEP A;  1KGY A;  4RQP A;  5FV3 A;  4IE5 A;  3B7M A;  4IGQ A;  4HN0 A;  1SEF A;  5DZG A;  3H0O A;  2HWD 1;  3AZY A;  2QQJ A;  3N9N A;  5EJZ B;  1MZ6 A;  2KA3 A;  4R4X A;  5JWP A;  1P8J A;  4UW3 A;  4AHX A;  3J8F 3;  4GJY A;  3C8X A;  4D69 A;  4GH4 A;  4E2Q A;  3ZXJ A;  2VNV A;  3O12 A;  2HWE 3;  3POY A;  3WEZ A;  2XQR A;  5DZE A;  1GR3 A;  1YQC A;  4I3G A;  5BNP B;  3O7O A;  2B45 X;  2DCZ A;  2XWJ B;  1MAC A;  1ULD A;  4OI1 A;  4AAP A;  4YGB A;  2KM2 A;  3AKS A;  3I4I A;  2W87 A;  2ET1 A;  2WZ8 A;  4FPL A;  5I0S A;  2EXK A;  4WM7 A;  1YI7 A;  2HBU A;  2VZ3 A;  4HG6 B;  4OMC A;  2P6C A;  4ARY A;  4E4S A;  2R1D A;  2IXL A;  1VBB 3;  3DEM A;  3PIG A;  4RS5 A;  1J83 A;  1QY4 A;  2P17 A;  3AKR A;  2VMF A;  3E5X A;  3HN1 A;  4Q29 A;  4COZ A;  4KL1 A;  4PLN A;  3OBA A;  3ZFF B;  1WCU A;  4JC1 A;  4DEV A;  1JH5 A;  1ZBA 2;  1YUD A;  1J3Q A;  3U07 A;  2IXK A;  1WCD J;  3E5U A;  1EAH 1;  3LA7 A;  5T52 A;  1DQ1 A;  2NYY A;  3QH7 A;  5KXE A;  2JE8 A;  2WN2 A;  1FI2 A;  1U5I A;  2VXR A;  3EHK A;  3UKV A;  4HVQ A;  4CEW C;  5F6K A;  2WAB A;  1VLN A;  1JZ4 A;  1ODN A;  4CCC A;  3VDD A;  3AKQ A;  1W03 A;  4FFH A;  3PDQ A;  3ZR5 A;  3RJ2 X;  2ZGU A;  3AZZ A;  2QVS B;  2QCS B;  1NCQ C;  3OG2 A;  4XC9 A;  1XU2 A;  2NPI A;  2WQ8 A;  3IDA A;  1MS8 A;  1XYO A;  3EB7 A;  1V6O A;  2I07 B;  4PQ9 A;  3FL7 A;  4LA2 A;  3RPQ A;  3VBH B;  1U5Y A;  5A3T A;  1AL2 1;  1HIX A;  2BNM A;  2WYS A;  4Q4Y 1;  1QEX A;  1UQX A;  4MGT A;  2RS5 2;  1US3 A;  4XUR A;  3BOD A;  4P00 B;  4KG0 A;  3PVB B;  5JLV A;  5FOJ B;  1N3Q A;  4YVS A;  3KV5 A;  4Y5S A;  1JZ6 A;  1SAC A;  1RVF 3;  1XSQ A;  5HXV A;  2UU8 A;  4FPC A;  4RFR B;  1AR8 2;  3POJ A;  1UMH A;  3SH5 A;  1W6Q B;  4UFI A;  4A7Y A;  4QQP A;  4XHX A;  3T4H B;  1OD3 A;  5ABJ A;  4HKL A;  5IK7 A;  3AMP A;  5C5U A;  4QGL A;  1CPN A;  1LCL A;  1SPP B;  1GYK A;  3O1V A;  4WVM B;  2RS1 2;  2VZV A;  3Q8E A;  3OEB A;  3W20 A;  1H1I A;  2F6B A;  3WQB A;  4Q4X 3;  2D5H A;  2DDU A;  1KXG A;  1PVC 3;  4EQV A;  1D4M 2;  4KQ7 A;  5M0T A;  2ZAH A;  3DKW A;  3VKL A;  3ST7 A;  1V6I A;  2D40 A;  2BGC A;  2ORX A;  1V0A A;  3MEP A;  1FMD 1;  1GOG A;  2R1B A;  4IV3 A;  1YQ6 A;  4XJA A;  5LRR A;  4A44 A;  2ZCW A;  3I2D A;  1PGW 1;  5FZI A;  2HWB 2;  3I59 B;  2CTV A;  5HCA A;  5FPX A;  2J1A A;  2A70 A;  2BJS A;  1UKG A;  4GAL A;  1VIW B;  4OLL A;  1O6U A;  1QH7 A;  5E1R A;  2XG3 A;  4LBK A;  2QUO A;  2Z69 A;  3I2I A;  3ZMO A;  1PNG A;  4CCE A;  1WW6 A;  4QM8 A;  1LHU A;  2UYA A;  4V2V A;  5FYB A;  1NY7 1;  5FMC A;  5FZF A;  3CJI C;  3USU A;  2ZEX A;  3LFI A;  1ZZ7 A;  2BWA A;  5A33 A;  4OQ9 A;  4AW7 A;  1F8V A;  3FMG A;  4C0B A;  4UOJ A;  2ARC A;  3BOP A;  5A7W B;  4YRD A;  3J8F 2;  5BXX A;  1W6P A;  3J4U H;  3TBD A;  1AJO A;  1F4H A;  4QB1 A;  4UI9 L;  5DN2 A;  5FLI A;  3M8L A;  3FBM A;  3WF1 A;  4CCM A;  4EWA A;  3U0Z A;  1H8T B;  1US2 A;  2R7E B;  4MXV A;  3ZFG A;  4UFK A;  3NWK A;  4M0H A;  3WHT A;  4OUS A;  2XWB B;  2ENR A;  5FQ0 B;  2VBB A;  1HQW A;  2YMZ A;  3CKH A;  4J1W A;  4NMI A;  4W50 A;  4J25 A;  4LIT A;  3SC7 X;  1RUD 2;  4Z2A A;  1AYM 1;  3MHZ A;  1CX4 A;  1ALY A;  4YGE A;  2CYF A;  5H9R A;  5C33 A;  5JXI A;  3KS7 A;  2JDZ A;  2A71 A;  4I30 A;  3TEW A;  2ZKL A;  1W9W A;  4DY3 A;  4D7T A;  4GB3 1;  1UOB A;  4FXG B;  1MQT B;  3N7J A;  2RR1 1;  4JGY A;  1CR7 A;  4R9D A;  2XJS A;  1ULF A;  3K2O A;  3VBU B;  1T6B X;  4BQ3 A;  4XEZ A;  2ZAA A;  4BK4 A;  1NKG A;  4LUL A;  4QKF A;  4CDU C;  5F9T A;  1J1L A;  2BUK A;  3DYP A;  4XXP A;  4JVA A;  1QNW A;  3ZIX A;  3DL3 A;  5FYH A;  3GZE A;  3ITQ A;  1K12 A;  5FZ6 A;  3WV6 A;  2E53 A;  3UYJ A;  1T6G C;  4B29 A;  5K9Y A;  1HRV 3;  2Z4F A;  1UF2 C;  2VW1 A;  2JIC A;  5JI7 A;  4JCK A;  4UFJ A;  4BXS V;  1YIP A;  4CU8 A;  4HVR A;  1COV 3;  2P3Y A;  4QX7 A;  1HLC A;  4MGY E;  5GM0 A;  5AFB A;  1GMM A;  1IS3 A;  1OMI A;  1YI9 A;  3WT3 A;  1W8U A;  1LNS A;  3TNQ A;  3LPF A;  4CU9 A;  2ADE A;  3U75 A;  1MEC 3;  1KIT A;  1SFN A;  3ZKY A;  1F35 A;  4NPR A;  5ACA 3;  1VMF A;  5FTT C;  3B5L B;  4AI3 A;  4W6W A;  2C5D A;  5J96 B;  5JXJ A;  4UBH A;  5CVR A;  1JUI A;  4LA3 A;  3UGF A;  2HYK A;  3FZ3 A;  5F39 A;  1OH4 A;  3O1M A;  5CKN A;  5EPA A;  2FMD A;  2RMU 3;  5FY9 A;  3WDW A;  1YFU A;  2Y26 A;  4LNV A;  3VKF C;  3LOI A;  4P5H A;  1CON A;  2V4V A;  4Q0U A;  4YM0 A;  1HQL A;  2D6P A;  1QJX 3;  4XHB A;  2R07 3;  2ZGQ A;  1CD3 G;  1W2A X;  2F4P A;  4M00 A;  4K1Y A;  4KMQ A;  1RC6 A;  2A6W A;  2YBP A;  1RJ7 A;  2ZMN A;  1RUJ 2;  3PTR B;  4YW3 A;  3VBH C;  1GU3 A;  4UWD A;  2CHH A;  4Z1V A;  4NHX A;  1AHS A;  3AMN A;  2HJI A;  1QJU 3;  1E5I A;  2YU1 A;  4JKM A;  5FYI A;  4AHW A;  4BXF A;  5D8A C;  4F8A A;  2W52 A;  5KHG A;  3M1H A;  1S0I A;  5A7Q A;  4CTE A;  1DYK A;  1AR6 1;  4QHB A;  4QXH A;  4BIF A;  3WNX A;  4WBB A;  4YW4 A;  1BHG A;  2WZR 2;  4NIH A;  3K4D A;  5LB6 A;  3BPS A;  1DIW A;  1GSL A;  2OPW A;  1OHF A;  3BPZ A;  4WVZ A;  2R32 A;  1PIV 1;  2HWC 3;  5DDJ 3;  3RGB A;  1X9T A;  4A42 A;  4I2O A;  1VRB A;  2XGX A;  3V64 A;  1CGP A;  2JX9 A;  5A3N A;  2GC0 A;  2PLV 2;  3ECQ A;  1OSG A;  5K4L A;  1NCQ A;  2P37 A;  4NOT A;  3H8O A;  4CCD A;  2BW8 A;  1F9K A;  4AFD A;  2WT2 A;  3UGH A;  4LHN A;  1WLW A;  2J1R A;  3WP6 A;  1UPS A;  3PVN A;  5A6Z A;  1KRI A;  1N1Y A;  2XLF A;  2Y38 A;  3P3P A;  1DU3 D;  3UKT A;  5JCT A;  4DY5 A;  4PQQ A;  3RZZ A;  2VNR A;  1AZD A;  3VKN A;  1YHF A;  4Z92 B;  1CZV A;  4NVP A;  1RIR A;  3VB9 A;  4CUC A;  3ZM8 A;  3M3O A;  2WFP A;  2FDF A;  4IEX A;  4N43 C;  3K46 A;  3QBQ A;  2F17 A;  3ZSL A;  3M3I A;  5AVA A;  4LMF A;  1VBE 2;  3U10 A;  4OI2 A;  4K6B A;  4X8P A;  5A32 B;  3S7E A;  1GOH A;  1WGP A;  3AX4 A;  2WRA A;  4W65 A;  4MV2 A;  3OTF A;  3IB3 A;  3ILR A;  4RQP B;  4XFH A;  2TBV A;  1ACC A;  2WKK A;  3P1I A;  4U2A A;  3TN9 3;  3VDA A;  1N47 A;  2Y6J A;  3D4K A;  1VBD 1;  3ALQ A;  1UZV A;  4UYB A;  5GKA C;  3UT0 A;  2ZX2 A;  2YPJ A;  4YPJ A;  3PVO A;  1ST8 A;  2R04 1;  2A6Z A;  2QQV A;  3BTZ A;  5FZA A;  3ES4 A;  3Q8A A;  4GH4 B;  4R8H A;  4S2D A;  2JJ6 A;  1NE4 A;  4DPN A;  4CXW A;  1C8M 3;  2K2S A;  1WLC A;  5KHJ A;  3TEZ A;  3CZJ A;  3T09 A;  4UAP A;  1VBA 2;  1N1S A;  2WII B;  3SKJ E;  5TSW A;  4AE2 A;  3WF2 A;  1XYP A;  2WFF 3;  3MO4 A;  3UJQ A;  4WVV A;  3W21 A;  1XJA A;  5BV6 A;  1CAU A;  5FBJ A;  2D6L X;  1RTV A;  3CJI A;  3VBU C;  3AK0 A;  3W5N A;  2RS3 2;  4AWD A;  5A3W A;  1OQE A;  3I3E A;  4WM7 B;  2PQQ A;  2YBS A;  3IT8 A;  1DBN A;  3I54 A;  1ZX5 A;  2DCT A;  5G05 L;  2Z5W A;  1K45 A;  1W0N A;  1OLM A;  5GJ6 A;  3BTX A;  4O9G A;  2RMU 2;  2CNA A;  3ETP A;  4HPK A;  4RS5 B;  2P4E A;  5JR7 B;  1JI6 A;  1YJK A;  5JAX A;  2B42 B;  5EHD A;  1TQ5 A;  4O9E A;  5KWR A;  3VBF B;  2LW8 A;  3ZVX A;  1J1T A;  1W3X A;  2VPV A;  4N8M A;  3OGG A;  2EID A;  3FLP A;  1W6O A;  1YCI A;  2VUD A;  4Q0P A;  5CYY A;  5FYY A;  1NQJ A;  3K75 B;  2VNO A;  3WCR A;  1WW4 A;  1RUO A;  2G4I A;  5DAQ A;  2PTM A;  1BVP 1;  1R08 3;  3WQ1 A;  4F7Z A;  3TNP B;  4HL0 A;  4NRP A;  1XQN A;  3EQE A;  3VDD B;  3WY6 A;  4GWJ A;  1DQ2 A;  1HX6 A;  3ZSJ A;  4OI0 A;  1XB9 A;  3OPT A;  4Y1V A;  3R4D B;  1ASJ 3;  4D6Q A;  2YU2 A;  1HRI 3;  5IWF A;  5JSO A;  1F5F A;  4CA9 A;  1W9T A;  2W46 A;  2JD9 A;  1M4W A;  1O91 A;  4MO3 M;  4WV8 A;  1RIT A;  3OD4 A;  2PN5 A;  2KXL A;  1G9F A;  4QPI C;  2HWF 1;  2OQ7 A;  2C1F A;  3I2G A;  3PME A;  4CDU A;  3O1R A;  1E57 A;  2PAK A;  3WG3 A;  2PA7 A;  3III A;  4IEP A;  4YVS B;  2ZHL A;  3OBR A;  4FXK B;  5BNP A;  5CIR A;  1SBE A;  4FFI A;  4COV A;  4AF9 A;  2VMI A;  4KU8 A;  1GWM A;  1QXJ A;  2J1T A;  4I01 A;  4O61 A;  3B3Q E;  3T2P A;  3VBR B;  5JSP A;  2R16 A;  1RHI 3;  1XNK A;  4QGM A;  4AI8 A;  3FHA A;  3ZXK A;  4KBZ A;  2IXC A;  1JOJ A;  3WNM A;  3JQX A;  3WIN E;  3IIA A;  1APN A;  3ACI A;  5AC9 1;  4CRQ A;  1JTZ X;  4P5Y A;  1W0O A;  1AR9 3;  2J1S A;  4XUQ A;  3NL1 A;  4GKX A;  1RUH 1;  1SDD B;  3B02 A;  4PIZ A;  4LHK A;  3WLU A;  1LAJ A;  5I0R A;  5FO8 B;  1FPN 3;  3VD5 A;  1MS3 A;  2XBO 2;  3H1Y A;  1FOD 3;  1HJG A;  1ODM A;  4A45 A;  1CAV B;  3PHM A;  4CYD A;  4NPL A;  1W06 A;  1Y9G A;  3JB8 A;  4FTS A;  1CX1 A;  2VBD A;  3USU B;  4S2F A;  3IDE A;  4TXW A;  4XQW A;  5A33 B;  1TVG A;  2VUA A;  5I8T A;  5JOW A;  5JZG C;  5J1X A;  2Y8K A;  4NID A;  4DXS A;  3VBH A;  3GBW A;  2VZR A;  3NAP B;  3AP7 A;  2GP3 A;  2X5I C;  3AVR A;  2AYH A;  2UY9 A;  2Y34 A;  3AVS A;  3AL5 A;  2J1E A;  3K77 A;  4JAA A;  4LBL A;  5D8A A;  5F32 A;  5B4X A;  3POB A;  3ZFG B;  4B3N A;  1TMF 2;  1W05 A;  5FBZ A;  4A4A A;  4XUT A;  4DS0 A;  1UYP A;  1REF A;  1JU3 A;  3GZA A;  3EBR A;  5FYV A;  3SIT A;  4NR1 A;  4PIX A;  1WMF A;  3UK9 A;  2JWP A;  3IDC B;  1W6Q A;  1FX5 A;  4MGK E;  2QQK A;  1NA1 C;  3VZO A;  2HKX A;  5JOY A;  4CE8 A;  1AR7 3;  3WDU A;  5CFD C;  4XBL A;  4YLZ A;  1BBT 1;  3GBF A;  4ZXE A;  1PO2 3;  3W5M A;  1J58 A;  5APA A;  5FPZ A;  2GU9 A;  4B1M A;  1EYB A;  4IQP A;  3MIC A;  2NMN A;  1JN2 P;  1IQD C;  2VR4 A;  4JGY B;  4IEW A;  1DF0 A;  4HON A;  2CGN A;  3QCW A;  5IAX A;  3IAQ A;  4I09 A;  4Y4R A;  4AVT A;  2ETE A;  4M3C E;  4D8M A;  3M4F A;  2ZX0 A;  3ZYJ B;  1RUN A;  3RG0 A;  3I59 A;  5JPN B;  5ERL A;  3NMB A;  2VZP A;  1QXP A;  4MHR A;  4GA9 A;  4DQA A;  4AQ6 A;  3VBS C;  1GBG A;  2HH9 A;  4KWK A;  1YIF A;  5B2G B;  2ADD A;  4QDR A;  4ZY9 A;  4DMI A;  2GN7 A;  4GQ7 A;  5DAB A;  2WZP P;  4H7L A;  1Q56 A;  4PI2 A;  3T08 A;  1WUV A;  2ZHK A;  3I3M A;  3A7Q A;  1YYN A;  4JKK A;  3NNJ A;  1GP5 A;  2WWS A;  4N43 A;  4PBO A;  2JDM A;  2JDU A;  3Q9O A;  1R1A 1;  2BDR A;  2D6N A;  3JD7 2;  4X6R B;  1RUI 2;  5FLH A;  5FZB A;  5A7W A;  5JPM B;  3T3Y A;  1Q8S A;  1KJR A;  3CQO A;  1RUE 2;  2H0B A;  3RZL A;  4LBJ A;  2VGD A;  3AJZ A;  5BY5 A;  5F1R A;  3VBF C;  4QPY A;  4HMZ A;  2VTF A;  3JBG 3;  1C57 A;  5FQ0 A;  1LEM A;  2XHK A;  4PBP A;  4TYS A;  2FDG A;  2CL2 A;  1EV1 1;  4TLF A;  2CAU A;  2DBN A;  3I7D A;  1L3J A;  5FFO C;  1Z7S 2;  1TNR A;  1B09 A;  1QWR A;  4QX8 A;  5CKQ A;  3ENR A;  3WF0 A;  2WYF A;  3SIS A;  3VKM A;  5FYC A;  2GND A;  2X8K A;  4BH9 A;  4H55 A;  2A5Z A;  2WLP A;  4M01 A;  2QFE A;  5A7O A;  2VCB A;  5C8C C;  1ZYB A;  1VAM A;  4P9L A;  1DGR A;  3LEM A;  2DTW A;  3FLT A;  3VBU A;  2P5B A;  1UX7 A;  2R6Q A;  5KHH A;  1UO9 A;  3AP4 A;  2OW4 A;  3SQO A;  3O1U A;  2JDA A;  1AUY A;  3MLK A;  4QX0 A;  5E88 A;  1ZRF A;  3PUS A;  3N7K A;  5FR3 A;  5FP8 A;  1HXS 3;  1QOT A;  2Q5T A;  4DNY A;  4QMA A;  1HW5 A;  1X8E A;  4FPE A;  4FOW A;  3HQX A;  3JUU A;  4DIQ A;  3HD8 B;  1DZQ A;  3MIB A;  5IK8 A;  4AHY A;  2VUL A;  4BM8 A;  2FDH A;  4XIO A;  1QJF A;  2OUH A;  5A7P A;  4ET7 A;  1JU4 A;  4YW2 A;  4CEW B;  1R64 A;  1VRH 2;  3UV9 A;  5HI0 A;  4FO9 A;  3RZG A;  4BQ2 A;  2ZAB A;  5K8S A;  2VW2 A;  1NOV A;  1ZZ6 A;  4R9B A;  1LOC A;  2Y0O A;  3N7M A;  2ZHM A;  4FT8 A;  2R0H A;  3LPG A;  1J3R A;  1R09 1;  4K3U A;  4BYY A;  1EPZ A;  1A8D A;  3DEC A;  4TZD A;  3PVE A;  2WDB A;  1K3I A;  1GFF 2;  4PI0 A;  5FXV A;  1V9U 2;  1GUI A;  1DQ5 A;  1QDO A;  2A3W A;  3S5A A;  4ZS3 A;  3SHR A;  2JKB A;  2IXI A;  3DPR B;  1V6K A;  4JKL A;  5EIY B;  4QPI A;  3T0B A;  2PQS A;  2AGS A;  4BCU A;  3WXP A;  1B35 B;  1WLT A;  3KMH A;  4RHV 3;  2QKD A;  1AL0 G;  2VVE A;  4P9G A;  2BTV C;  4AR2 A;  1O59 A;  3D0S A;  3K3N A;  3GNE A;  5LEK A;  2ES3 A;  2UWB A;  2B7Y A;  3RWK X;  3WR0 A;  5FZ1 A;  4QX3 A;  1RMU 3;  1EY2 A;  1QJY 3;  4FTE A;  4PIY A;  2VOW A;  3MDP A;  3NAP C;  5FZE A;  4PDW B;  4CP9 A;  4AG4 A;  2BU9 A;  1C8N A;  3MUZ 1;  1OQ1 A;  1UIK A;  2WNO A;  3RYR A;  3BU7 A;  5B4N A;  4H3W A;  1VBC 3;  3CBN A;  2WNV C;  4AEM A;  3IZO A;  2E6V A;  1CIW A;  2B5H A;  2XVG A;  3LGR A;  4LE4 A;  1TME 2;  3Q8B A;  4XDO A;  4XIL A;  5LEJ A;  5H9Q A;  3ACF A;  4FSJ A;  3LOB A;  4P9X A;  4CCO A;  1JZ8 A;  1OVS A;  1W6N B;  4Q4W 3;  3U1X A;  1RUF 2;  3ZSE A;  4AQT A;  5KHI A;  4CCK A;  4ES9 A;  3IPV A;  3MV1 1;  2R06 3;  4FCA A;  1LEC A;  2W08 A;  5DQ0 A;  2JEM A;  3O1T A;  3DN7 A;  1IKQ A;  2K0G A;  5L7O B;  5FPL A;  2ZML A;  3AB0 A;  4YZ4 A;  3KB5 A;  1AX2 A;  1CAU B;  1MS5 A;  2XLA A;  5FZ9 A;  2FMY A;  3CJI B;  1I5P A;  5CAZ A;  3V0A B;  1VB4 A;  1H9P A;  5JZG A;  1DG6 A;  2BNN A;  2DU0 A;  2OS2 A;  1O4Z A;  4HSJ A;  2HWD 3;  4Y1X A;  4QDQ A;  5EXO A;  4JGZ C;  1BKZ A;  4I02 A;  5DUU A;  4HPK B;  1Y9M A;  1IKP A;  2X5I A;  1JBC A;  2VXJ A;  3RZM A;  4FFF A;  2CY6 A;  3AMH A;  2VZU A;  3SLI A;  2VQU A;  4K1Z A;  2VL4 A;  1ZBA 1;  3WCS A;  2ZEY A;  5L7O C;  2IVJ A;  2VJX A;  2ZEW A;  5JVV A;  3USS A;  4CPB D;  3J26 N;  1IQA A;  4JHZ A;  5A7N A;  2HLE A;  1NA1 A;  1RUG 2;  1QJE A;  4AQS A;  2E9Q A;  1D2Q A;  2E7Q A;  5CFD A;  2YXS A;  5A3P A;  2E26 A;  1ZBE 2;  2AH2 A;  3NST A;  2VMC A;  1BZW A;  5FY7 A;  3J7L A;  3FE5 A;  2WLQ A;  4P9J A;  4CCJ A;  2QQL A;  2I45 A;  3LDB A;  3WSO A;  1GZC A;  2ZPX A;  3TB0 A;  3KV6 A;  1ZRE A;  5IK4 A;  5A3M A;  2X05 A;  2AEY A;  4FQZ A;  1GZT A;  4Y24 A;  4NIA A;  4EJR A;  2K9Z A;  4CDU B;  2RS5 1;  1EAH 3;  1UCX A;  3D3A A;  3I2H A;  3VBS A;  4ES8 A;  4LT5 A;  2W91 A;  1M06 G;  4HT1 T;  2HEY F;  4QU2 A;  3I2J A;  2WS9 2;  1AR8 1;  5DAP A;  3VBO C;  5LA0 A;  2ZGM A;  3INA A;  3M7A A;  3WDY A;  4OHZ A;  4A2U A;  4YVW B;  1UZ0 A;  4MH0 E;  2JDK A;  1XYN A;  4BQ5 A;  3D8C A;  4JV4 A;  3ZO0 B;  2RS1 1;  3CL1 A;  4BMB A;  2A6Y A;  4YW6 A;  1SFY A;  2ZJC A;  3ES1 A;  3OY8 B;  3WNN A;  1W9Y A;  2ATF A;  2V72 A;  5C6C A;  4NWV A;  4AXO A;  1D4M 1;  2QE3 A;  4LO6 B;  1AL2 3;  3HJR A;  4Q4Y 3;  2VMG A;  5I8Y A;  5CFC C;  3VBF A;  4FFG A;  1GNZ A;  4DZG A;  4IGP A;  1UAI A;  4LKS A;  2MEV 2;  1QQP 2;  4RN5 A;  2AAC A;  2HWB 1;  3G7D A;  2PHW A;  1IHM A;  2E33 A;  2GC2 A;  1GKB A;  5FMD A;  1CQ9 A;  2BBA A;  1X7N A;  4EN6 B;  4ATF A;  1OA2 A;  4RD7 A;  4XFB A;  4XJW A;  1UYY A;  1LGB A;  1YEW A;  4FOY A;  2LUW A;  1X33 A;  3POW A;  1BVV A;  4MVT A;  1OFS A;  1BCX A;  4ZXK A;  5KXD A;  5CEH A;  2JXA A;  3WG1 A;  5C8C A;  1H1A A;  1EPW A;  3J8F 1;  4PJY A;  4IEV A;  3AZV A;  4XZU G;  3WD5 A;  4QQL A;  5CKM A;  3DPR C;  2DFB A;  5FYS A;  5C71 A;  5FMB A;  1FMD 3;  1OH3 A;  1MR5 A;  2OYZ A;  2OT7 A;  1W2U A;  5KC5 A;  1B35 C;  3WG4 A;  5D8A B;  5LY2 A;  4KWJ A;  2A73 B;  4NAO A;  2PHR A;  5A3O A;  3E6D A;  3T0D A;  2OQ6 A;  1QMJ A;  1YRZ A;  1BMV 2;  4QXK A;  3VBR A;  1VJ2 A;  1UMZ A;  1RB8 G;  1AXK A;  1RUD 1;  1NT0 A;  4LE3 A;  3KZ4 C;  2QQI A;  1OBN A;  4PLM A;  2A7A A;  5FUN A;  4PDW C;  2WSU A;  5F37 A;  3WX5 A;  2CWS A;  5KC6 A;  5T3N A;  4Q4V 3;  5CZK A;  1PGL 2;  1ND2 C;  3N3H A;  2FCV A;  5T54 A;  2JE7 A;  4ARX A;  3VHP A;  1AYN 2;  1XC6 A;  3NJZ A;  1NX9 A;  4JX0 A;  4HLT A;  4LIV A;  4P02 B;  4KWU A;  4ZS2 A;  1G9A A;  3R4U A;  2OPK A;  4YAR A;  1DFQ A;  2JDN A;  5GLT A;  4AVA A;  2CDO A;  1DGW A;  1LOG A;  1PNF A;  1WWY A;  1GNY A;  1S0D A;  1H9W A;  5J48 A;  4Y1Y A;  4V2W A;  1VE0 A;  3ACL A;  1A3K A;  1QGL A;  3HQR A;  1CAV A;  3RMX A;  5T5O A;  1AYM 3;  1H2N A;  2P2K A;  1BEV 2;  4IEY A;  5FK8 A;  3RRD A;  1NZI A;  4DFS A;  4DUX A;  1PVX A;  2D3P A;  5C5T A;  3AYD A;  2ZGL A;  5A6X A;  5JMC A;  3TEX A;  4GKY A;  4Q0Q A;  2A75 A;  1FNY A;  3R4S A;  2F4L A;  1UYZ A;  4N43 B;  2PYT A;  4QXC A;  4XF4 A;  2H6C A;  2BOI A;  4GB3 3;  4Z8B A;  3FUQ A;  2RR1 3;  3NAP A;  3WNO A;  2HWE 2;  3MI8 A;  3OCP A;  1JYC A;  5DPN A;  1IPJ A;  3H42 B;  2A1X A;  4XXA A;  1O8S A;  3O0X A;  4PF5 A;  1Q8O A;  1O8P A;  2WNV A;  3HWJ A;  1DGW X;  5FYT A;  3FBY A;  4D7S A;  2W1Q A;  5FXX A;  2Q8O A;  5I93 A;  3H9A A;  1GP6 A;  2FCU A;  1VR3 A;  3MFA A;  4YW1 A;  2FDJ A;  5FZ7 A;  3TYJ A;  2Q8E A;  2XR4 A;  4EV0 A;  1VBB 2;  4CDX C;  4K8F A;  2GSY A;  3AMM A;  2VUJ A;  3WQ0 A;  1RGS A;  1YQ5 A;  3LAG A;  4ZON A;  1HB4 A;  3KCC A;  3BIE A;  5HPO A;  3GAL A;  1EUT A;  4YW5 A;  1S55 A;  4CP0 A;  2ZGR A;  4TLG A;  4TWT A;  1RUJ 1;  4XDQ A;  2VEC A;  1H1M A;  4K40 A;  4QGN A;  1OXC A;  2BEO A;  5FY4 A;  3GCX A;  2B46 X;  2WWJ A;  4Q8K A;  1J84 A;  4JGZ A;  4B7K A;  1W8O A;  3RZK A;  2OVU A;  1LED A;  4I3P A;  2W68 A;  2IUW A;  4AED C;  1UD1 A;  4LO5 B;  2VME A;  3AMQ A;  3MFC A;  2WZR 1;  1NLQ A;  1XNA A;  2D3S A;  3P5B A;  4OZX A;  4WZF A;  5FY8 A;  3RI9 A;  4F83 A;  4YFZ A;  5L7O A;  2VTX A;  1U12 A;  3A4U A;  4YVW C;  1PK6 C;  2XH6 A;  4HK8 A;  4XVH A;  2MNG A;  5LA1 A;  3CDZ B;  4LK6 A;  3ILN A;  5DZF A;  2ZOE B;  3LSE A;  5I0U A;  3WDT A;  1UU6 A;  2OX0 A;  4XZP A;  3CNA A;  4Y5Z 0;  3LA3 A;  4HOO A;  2PLV 1;  2YY1 A;  1OA4 A;  5C3P A;  4GMP 1;  4B7E A;  3VD4 A;  1RVF 2;  4LR4 A;  2QJV A;  3E97 A;  1XPW A;  2FCT A;  2O14 A;  1AR6 3;  2YRO A;  1KFX L;  1SLT A;  4OZO A;  4NHL A;  3AKP A;  3GXU A;  1JW6 A;  4DRR A;  4LBO A;  4QPI B;  3ZPO A;  3K4Z A;  2YFZ A;  3KT1 A;  4Q4V 2;  4Q4X 2;  5LCW L;  3NJY A;  3ZSM A;  4BIS A;  1X50 A;  1PVC 2;  2OUJ A;  3THC A;  2C4X A;  2LRP A;  1PIV 3;  4OHW A;  2ZA9 A;  4L99 A;  4AFB A;  3WZ1 A;  3IM0 A;  5GAL A;  4DOU A;  5C4W B;  1SZB A;  1GZW B;  1DDL A;  3VBO A;  1CIY A;  3C7O A;  1JOP A;  2IZW A;  1VBE 1;  5GLV A;  5GZD A;  4I0B A;  4IE7 A;  4BLI A;  2UY8 A;  4N9H A;  4CP9 B;  4N53 C;  5JXG A;  1E5H A;  5K0U B;  4BPZ A;  2XL9 A;  4AZZ A;  1O3T A;  3RNS A;  2AC1 A;  5LAS A;  2ZHN A;  4P9I A;  3MF9 A;  3NNL A;  3ZX7 A;  3GGL A;  5CFC A;  4FPK A;  3RYP A;  3MW2 A;  2A3Y A;  2FHR A;  4DUV A;  4MGZ E;  3P3N A;  5FUP A;  3GHN A;  5H9P A;  3HOB A;  1LUL A;  5A1F A;  1X36 A;  4DO0 A;  4CEW A;  3QLQ A;  2EXH A;  1WZX A;  3IPV B;  1VBA 1;  2J42 A;  3MLL A;  4LHS A;  1DZR A;  1ZA7 A;  3URF A;  3U4S A;  3BTA A;  3JZV A;  1HB3 A;  2NN8 A;  1H8V A;  4NHY A;  4Y20 B;  4AI2 A;  2BPA 2;  2G19 A;  4K7J A;  1WD3 A;  2Y0I A;  4LOT A;  4YZ3 A;  5IVE A;  2RS3 1;  2FQP A;  1XBF A;  1LU2 A;  5JZG B;  5BUV A;  3ZXD A;  2JDP A;  1UY1 A;  1X8M A;  1ULG A;  2RMU 1;  2W92 A;  2W1U A;  3DPR A;  3MYX A;  3ZN6 A;  4BDV B;  2G9F A;  2X5I B;  4EWD A;  2IXH A;  4ZZ5 A;  5FZM A;  4IUG A;  1B35 A;  2R04 3;  3VD7 A;  3ZR6 A;  1OLQ A;  5D1I A;  4NJ4 A;  3DXU A;  3IWZ A;  4LBQ A;  4UFM A;  4XMA A;  3SEE A;  1JZ2 A;  5FIX A;  5DAV A;  2RDN A;  4OMD A;  2PMW B;  1S0C A;  2XML A;  1WCQ A;  1OUS A;  2P3K A;  4D0Q A;  3WG2 A;  5F3C A;  3DYM A;  1XU1 A;  4IDZ A;  3RS6 A;  1NA1 B;  2V73 A;  1OFN A;  4PDW A;  2DTY A;  5CFD B;  5C3O A;  3OGV A;  3WDV A;  1CWP A;  2XHN A;  4QX1 A;  2EAL A;  3IN9 A;  4BIO A;  3I3D A;  2DCJ A;  1G9C A;  1A34 A;  1Y43 B;  2BBV A;  5DUX A;  1ND2 A;  1ULP A;  1IZ3 A;  1GQG A;  1UIJ A;  1HRV 2;  2YHJ A;  5A1A A;  5EWS A;  3LSD A;  2D97 A;  1GWK A;  4AK3 A;  2WC2 A;  1Y9Q A;  3GZU C;  1SLL A;  1W6N A;  1COV 2;  3N36 A;  4QT6 A;  4PT6 A;  1QOS A;  3L2H A;  3NV3 A;  1WMX A;  3O5S A;  2CWM A;  4UBG A;  1MVQ A;  4ZU5 A;  3VBS B;  3MBW A;  4C91 A;  5LK7 B;  3WNK A;  2WO3 A;  4COU A;  5BNO B;  1MEC 2;  4HSL A;  4LO4 B;  4HKW A;  5ACA 2;  2XJQ A;  1D7P M;  2YYO A;  3V0A A;  1DCS A;  1UXX X;  2D7F A;  1ULC A;  1ZZ9 A;  2ARB A;  2JD4 A;  3O0W A;  4IE6 A;  1FAY A;  3ZYR A;  3B94 A;  4XFA A;  1ULE A;  1WBL A;  1OKO A;  2W3J A;  3DCQ A;  4DXR A;  4SLI A;  3DV8 A;  3H8R A;  1Y4W A;  4LXL A;  4QAW A;  5FO7 B;  3J7M A;  4QB2 A;  2XLG A;  1QJX 2;  2HWF 3;  1L7L A;  2FBE A;  2R07 2;  3ME2 A;  2V4A A;  4Z82 A;  5LY1 A;  5LA2 A;  1HB1 A;  2LRO A;  1T2X A;  2WL1 A;  1NCR B;  3OBT A;  4EN0 A;  4KH9 A;  5E16 A;  4AVS A;  2ARA A;  1W8N A;  2XBO 1;  3RSJ A;  4QHZ A;  1QJU 2;  4UT5 A;  1DGR N;  4LUK A;  3BCW A;  2FDI A;  4R52 A;  5A6Y A;  2W95 A;  3NNM A;  2WA4 A;  3C2U A;  4PLO A;  5DG2 A;  1POV 1;  3BYW A;  1IS6 A;  3JB4 C;  1HB2 A;  5C8C B;  1BLZ A;  2ZKN A;  2W5F A;  5GZE A;  3KGL A;  5AC9 3;  4AAX A;  1S0G A;  2RJL A;  1UMI A;  3I2K A;  1JYI A;  5CU1 A;  4PF1 A;  5KBF A;  1RUH 3;  3THT A;  3LEG A;  2HWC 2;  3C7G A;  5DDJ 2;  3WW1 A;  4FPF A;  3MV0 1;  3VKO A;  2GNB A;  1H30 A;  1TMF 1;  2VOV A;  3VGI A;  5FZ3 A;  1GQP A;  3D82 A;  1G9B A;  2NQY A;  3RQ0 A;  1LOF C;  3JXS A;  5C4W C;  4AED A;  4IL7 A;  4B8E A;  3VZK A;  2DYC A;  1N1V A;  3WNL A;  1XE8 A;  3SCG A;  4YYO A;  5KHK A;  3HR9 A;  3TEY A;  4YVW A;  2RJK A;  2EAA A;  3DUI A;  1PK6 A;  4XAB A;  5A70 A;  2XB6 C;  5FLJ A;  1IPS A;  3OGS A;  2TUN A;  1XE7 A;  2X29 A;  5K0U C;  5KXB A;  3OF1 A;  5FYU A;  2BFU L;  3OY8 A;  3IKW A;  2I74 A;  4H2A A;  2O0O A;  5BNN C;  3SMH A;  1SHW B;  3PUH A;  1DYO A;  2W47 A;  3MGU A;  2VO5 A;  3JCI A;  2WSV A;  3PIJ A;  2W2I A;  4YG0 A;  1W0P A;  5IAT A;  3H8U A;  1NLS A;  3EMR A;  5FJH A;  3VZN A;  2P3J A;  4TSV A;  2ZX4 A;  5CAD A;  1W8T A;  4YW7 A;  1LGC A;  2XON A;  2Y64 A;  1SBD A;  1E5S A;  1ONA A;  3POI A;  4NAM A;  2LM3 A;  4Y1Z A;  4WM8 B;  1XSR A;  3TN9 2;  1UKR A;  2D6M A;  5E8A A;  1KDM A;  5J37 A;  3L9J T;  2WNU C;  3KF5 A;  4E8C A;  1VMH A;  2JEN A;  1BBT 3;  5JSR A;  3CF6 E;  1OQD A;  2P6H A;  2X53 S;  3JD7 1;  2PHL A;  1RUI 1;  2W94 A;  4D6S A;  2PHD A;  3NNG A;  4X8N A;  4MHU A;  1AX1 A;  1RUE 1;  5T50 A;  3WUD A;  1C8M 2;  4AFA A;  3CEW A;  4N53 A;  1ZRR A;  1KQR A;  1NE6 A;  1I1E A;  3BU0 A;  4QDS A;  4JHT A;  1YQ2 A;  2DUR A;  3N7L A;  4XBN A;  2WFF 2;  2WNV B;  2NZ9 A;  1XNT A;  5JOZ A;  2VUC A;  2ZTN A;  4XF0 A;  5C3R A;  5FDB A;  3H7Y A;  1SFP A;  1DHK B;  5JUV A;  5FZO A;  2SLI A;  4LPL A;  5I0T A;  1Z7S 1;  5JIU A;  2B9V A;  2IWG B;  5L19 A;  1JUH A;  1G6N A;  2ZBJ A;  3WUC A;  1U5Z A;  2ZZJ A;  3NKT A;  4S2G A;  1UY4 A;  1W6M B;  5C9A C;  4FTB A;  2GN3 A;  4FVV A;  1UY2 A;  2CSG A;  2K46 A;  2XJR A;  5FPU A;  2Q8C A;  2C26 A;  5D2A A;  4A3Z A;  4E2G A;  5EZW A;  4XJZ A;  3LQC A;  4FOV A;  2WUH A;  2G9Z A;  5BPX A;  1PM4 A;  5T5J A;  2BGO A;  2B39 A;  5JR2 A;  1S2K A;  3E1F 1;  3VD9 A;  4UF0 A;  3JQW A;  2YBK A;  2AZ5 A;  4YNI A;  3IDB B;  3ZLI A;  1R08 2;  4EWE A;  3A0K A;  4RR3 C;  3CHX A;  4JGZ B;  4MOA A;  3ZIW A;  1SDW A;  2JG8 C;  2W9X A;  3WW3 A;  4AQ2 A;  3NV1 A;  2Q1Z B;  4OUE A;  4AVB A;  2MPF A;  3WW2 A;  3ZMN A;  1W2O A;  2RE9 A;  2UWC A;  5BNO C;  1QF3 A;  4QKD A;  4XW3 A;  2RDR A;  1ASJ 2;  5FO9 B;  2EF6 A;  1CZT A;  4E8D A;  1HRI 2;  3POF A;  5JOX A;  2BWC A;  3OUI A;  1CN1 A;  2RJ2 A;  4NUB A;  4YZ5 A;  1WW7 A;  5BNQ A;  3HMY A;  1LEN A;  3FUO A;  1VRH 1;  4E4Z A;  2IFR A;  4TN7 A;  5LW9 A;  4Q0V A;  4R4Z A;  4CDQ B;  1JZ3 A;  3U14 A;  4AVV A;  3I3B A;  2A6X A;  1POQ A;  4CCN A;  4XBQ A;  3ZXL A;  3WW4 A;  1SLA A;  1XNC A;  1UPI A;  1MS4 A;  1NCR C;  3S30 A;  1PMJ X;  1V9U 1;  1RHI 2;  3EO6 A;  5SV8 A;  1QJZ A;  2VZS A;  2JG9 B;  4N7I A;  4EYU A;  2ZGS A;  3KHB A;  4L11 A;  3ZFE C;  1GP4 A;  1O5U A;  1UOJ A;  3OPZ A;  2JDY A;  3H8X A;  4GUL A;  2VQA A;  5IAV A;  3SCH A;  4BA6 A;  4E2S A;  2VZO A;  1UY3 A;  1AR9 2;  1MS1 A;  1NLR A;  1H4G A;  2D93 A;  3WHU A;  1QH6 A;  1UOG A;  1HJF A;  2D44 A;  3VBO B;  1QHD A;  2RVA A;  2XVL A;  4MGQ A;  5T5P A;  2GMM A;  3BB6 A;  4M4R A;  5JIA A;  1W8F A;  1X9P A;  2WT0 A;  3VHO A;  2Y60 A;  1FPN 2;  3WOG A;  4SBV A;  1R09 3;  1O7F A;  1OUX A;  2Z2S B;  1PX3 A;  1U5X A;  1FOD 2;  1W8W A;  3HEI A;  4RGK A;  5EQU A;  5FKC A;  2VCM A;  1GZ9 A;  3HVD A;  2RHP A;  2FDK A;  1DQ4 A;  3BIW E;  4ASL A;  1PHM A;  1TME 1;  3ZPY A;  5CFC B;  2VU9 A;  2ILM A;  4QU1 A;  3VN4 A;  4XE9 A;  1O4Y A;  4A6O A;  3GBG A;  3D0J A;  3IAP A;  3TAY A;  1DQ0 A;  1QDC A;  1RUF 1;  3ATG A;  2Q0A A;  3VUO A;  1IOA A;  4XCA A;  5FP9 A;  4G4F A;  1GAN A;  1C5H A;  1FYU A;  3EXU A;  2RM2 3;  2DWR A;  2YDE A;  4XAA A;  1S0E A;  2UWA A;  4WZC A;  1PZ9 A;  3KLS A;  5FXZ A;  3C3V A;  2DVA A;  1YC6 1;  1YQ8 A;  3LZZ A;  4ISQ A;  4G3Y C;  5C3S A;  1PZ8 A;  1PO1 1;  1SLC A;  1YFY A;  2WQZ C;  1ZZC A;  1OI6 A;  3BUC A;  3AKT A;  5IFT A;  3N9O A;  4YM1 A;  4IE4 A;  3V0B B;  3PU3 A;  5LAT A;  4XMI A;  3CZU A;  1AR7 2;  2GNM A;  3OGR A;  3ZN6 B;  3HNB M;  3KQ4 B;  4CZS A;  1PO2 2;  3T0A A;  3U11 A;  4WM8 C;  4DIN B;  5FWJ A;  4CUG A;  4LBQ B;  3CLP A;  4Q5O A;  2GME A;  4YG6 A;  5J98 B;  1VP6 A;  4MGS A;  1RJ8 A;  2DU1 A;  3M3C A;  1HQN A;  3N9P A;  4YGD A;  2BV4 A;  3WDX A;  1LOF A;  1TG7 A;  2XL7 A;  5C4W A;  1GZW A;  4AEJ A;  2WIN B;  3HNM A;  4B4P A;  1QXR A;  3MPP G;  1RUC 3;  3GM8 A;  4JRA A;  5F5C A;  1RUG 1;  1TE1 B;  5FZD A;  2GMP A;  1S0J A;  3HQU A;  1LU1 A;  1ZBE 1;  5I8S A;  4AGG A;  5K0U A;  2RG4 A;  4BWO A;  3BVC A;  4FPG A;  1O3R A;  1BXH A;  2WO7 A;  2QZ3 A;  3ZSK A;  1O3S A;  3V65 A;  4AI1 A;  2DVB A;  1ND2 B;  2E63 A;  5BNN A;  1UXZ A;  4HET A;  2GNT A;  2IFW A;  1JYV A;  2VAU A;  4YGC A;  2WQ4 A;  3UL2 A;  1KS5 A;  1DYP A;  3B9C A;  1DLC A;  4L97 A;  2EIE A;  1W04 A;  2VOK A;  1G8W A;  4MGI E;  2AR6 A;  4UFH A;  1BK1 A;  4BE3 A;  5FOB B;  1ZBA 3;  4A3X A;  5H9S A;  4QPG B;  2Q4S A;  1DP0 A;  2Y6F A;  2I2S A;  5FKB A;  1Q8Q A;  2JIG A;  3F95 A;  3RDI A;  4Y20 A;  1H2K A;  2O8O A;  2WS9 1;  4KU7 A;  4BLJ A;  5CBL A;  3FN9 A;  2WNU A;  4IV1 B;  3VL9 A;  1MS0 A;  3JBG 2;  2P34 A;  3PJQ A;  3AYC A;  3LDK A;  5G04 L;  4E4H A;  4XQ4 A;  3J7H A;  1JYN A;  2JDH A;  5L36 A;  1ENS A;  3GJA A;  3I3Q A;  2PAE A;  2VTX J;  1UZW A;  3HBZ A;  3E6C C;  3ROU A;  2WA3 A;  3AM2 A;  1ZZB A;  5J7M A;  3FJS A;  2QQU A;  2SBA A;  2BFU S;  1WLD A;  1S1A A;  2A3X A;  1QQP 1;  1GOF A;  1LGN A;  2MEV 1;  3CMG A;  3QH6 A;  3DYO A;  2Q8D A;  1LES A;  2AEN A;  2E7T A;  1OUR A;  3H1W A;  3C7F A;  1LTE A;  2QDN A;  3NJX A;  5IW0 A;  3WVJ A;  5L9R A;  1VAL A;  4ASK A;  5ISL A;  2D6K A;  1AR8 3;  3UES A;  2P3I A;  3AFG A;  4CDQ C;  4OHY A;  3LDR A;  4CDX B;  4A7Z A;  5C9A A;  1HXS 2;  3SNM A;  1WBF A;  1ZZ8 A;  2VCC A;  4OVE A;  1ULO A;  3LE0 A;  4HN1 A;  4LK7 A;  1UNB A;  2RS1 3;  2QNK A;  5IYY A;  3B00 A;  4MX3 A;  1D4M 3;  3O1P A;  5IK5 A;  2JG9 C;  2W0X A;  3R05 A;  4L9B A;  3OB8 A;  4COW A;  1KJL A;  2RM2 2;  3T30 A;  4RR3 A;  1LB2 A;  2HWB 3;  3E5Q A;  1Q3E A;  2JG8 A;  4XJ9 A;  5A6Q A;  3M3E A;  1A8M A;  1ZA4 A;  4Y4Y A;  1CAX B;  4XET A;  2B8M A;  3TWI A;  3UET A;  4AHZ A;  5BNO A;  1BMV 1;  4AED B;  5JDB A;  1OLM E;  1ND3 C;  4QB6 A;  2EVX A;  2D43 A;  3H3Z A;  3T4V A;  3LF7 A;  1KS4 A;  4IXL A;  2XJT A;  2D5F A;  1PK6 B;  2OZJ A;  2EIG A;  3ZYI B;  3OBZ A;  1HKD A;  4YWA A;  3MLJ A;  2QDR A;  2V09 A;  2XKO A;  1PGL 1;  4CDW C;  1RYY A;  1S2E A;  2GZW A;  2WWU A;  4RGG A;  4ZU7 A;  2C0Z A;  1AYN 1;  3POE A;  4RHV 2;  5FP7 A;  2PHU A;  1ENQ A;  1N1T A;  4XAC A;  5FCC A;  1YFX A;  3U37 A;  3ACH A;  1SLI A;  1I9R A;  3G6J B;  3OUJ A;  3OEA A;  5CB7 A;  1NCR A;  3IBM A;  1RUC 2;  3HAG A;  5FJK A;  1RMU 2;  1QJY 2;  1WKY A;  1ENR A;  1V6M A;  2VNG A;  2XUM A;  4UW6 A;  5FY5 A;  4U36 A;  3E6B A;  1D0H A;  5LA9 A;  2MHF A;  4IEZ A;  3ZFE A;  2DVG A;  5KXC A;  1RUD 3;  4J1X A;  3OD0 A;  1S2B A;  1BEV 1;  4LKD A;  1BJQ A;  3DKQ A;  1VBC 2;  4FPY A;  1O4T A;  5AVP A;  2QQN A;  1HDK A;  3LEK A;  2ORZ A;  4FBF A;  4F3J A;  2WT1 A;  3VHR A;  1BYH A;  1NXD 1;  2YG0 A;  1F5J A;  4OUL A;  4Q4W 2;  5CA6 A;  5DAX A;  1QU0 A;  4KBB A;  4AFC A;  2HWE 1;  4N53 B;  3T2O A;  4DEQ A;  1V6L A;  2R06 2;  3ON7 A;  3PUA A;  4NHK A;  2DUQ A;  1WW5 A;  3O0V A;  1VAV A;  1OF4 A;  3AC0 A;  2ZGN A;  1NYW A;  3NV4 A;  5FYM A;  3OYW B;  5FPA A;  1NQD A;  3EYP A;  3ZKU A;  3FHI B;  4AOC A;  4OUM A;  5FMO L;  5HV0 A;  2VOX A;  3ZYF A;  5FZO B;  1PMH X;  4LOS A;  1KFU L;  5A3U A;  2HWD 2;  4G9S B;  1VBB 1;  3A0N A;  5F3G A;  3MIF A;  2XJU A;  1SMV A;  2OII A;  3C7E A;  1RED A;  3PUQ A;  4H14 A;  1NAE A;  5LRS A;  2J1U A;  3U4X A;  3MW4 A;  5C7G A;  4L0P A;  5SV5 A;  1LKN A;  3BGA A;  1WMD A;  1OKQ A;  2VMD A;  4M0N A;  1QKQ A;  3NRU A;  4UF0 B;  1YWK A;  3U78 A;  3VZL A;  2E31 A;  4QPG C;  4LIU A;  2X09 A;  3LWC A;  4QQO A;  4XUN A;  3MIE A;  4LBN A;  4WM8 A;  2FD8 A;  1OOP C;  4IV1 C;  2ERF A;  4NE9 A;  2VZQ A;  1W90 A;  4LBM A;  4R9C A;  4RL7 A;  1NUK A;  1PX4 A;  4FPJ A;  3ORJ A;  5I0D A;  3NJV A;  5IVB A;  4GWM A;  2J22 A;  1F2N A;  4D3W A;  5EYY A;  2VVF A;  1JHJ A;  1RUJ 3;  1EAH 2;  1S0B A;  1Q43 A;  4L2N A;  2AUY A;  2Y6H A;  2NP0 A;  1AF9 A;  4EZH A;  2Q1M A;  2WNE A;  1RVF 1;  2KR2 A;  4C0H A;  2G1M A;  4M3C A;  2EXJ A;  2R30 A;  1QIQ A;  4NO4 A;  4ZHN A;  2BVB A;  3F2Z A;  1H2M A;  3KCX A;  4JTO A;  4X6Q B;  4XF3 A;  4IER A;  4CUA A;  1C1F A;  4M3C F;  2WZR 3;  2BP6 A;  2E7A A;  4Q4X 1;  2V5Y A;  4Q4V 1;  1WCS A;  1W6M A;  1KEX A;  1PVC 1;  1UY0 A;  3MIH A;  4HAN A;  3MZH A;  1WA6 X;  3HNY M;  1AL2 2;  4Q4Y 2;  4CEY C;  4HFS A;  4URA A;  2PXJ A;  2VE1 A;  2WJS A;  2YPD A;  5D21 A;  1EP0 A;  3OUH A;  4B1L A;  3KD4 A;  1HV0 A;  2JE9 A;  2ZXQ A;  3CJX A;  4NRO A;  3WF4 A;  2C24 A;  5A3L A;  1Q8P A;  4YZ1 A;  3VDB A;  1MZF A;  2PLV 3;  4O65 A;  2DUO A;  4Y22 A;  4GMP 3;  5F5A A;  4LO8 A;  3D5O A;  4E9K A;  5T55 A;  2YC0 A;  1NZC A;  1SQ4 A;  1VB2 A;  3LFM A;  4Q1R A;  4NRM A;  4Y3O A;  3FC0 A;  1POV 0;  1IGO A;  2G9G A;  2D6O X;  1F15 A;  1ZVF A;  2CU5 A;  1MZE A;  3ZXA C;  1UZZ A;  2PHF A;  2ZMK A;  4HXC A;  4BHP A;  5IVF A;  3PTY A;  5FY0 A;  3SH4 A;  4EE2 A;  5IJR A;  3FWE A;  5F3I A;  4QXB A;  2HBT A;  3A22 A;  4MET A;  1UU4 A;  4XPV A;  1FMD 2;  3H1M A;  5FRE A;  3KCY A;  1PGW 2;  4CDQ A;  1VBE 3;  3NVC A;  4W6Y A;  1FV3 A;  2DF7 A;  2PAM A;  4N7U A;  3R6S A;  4RA0 A;  4ERO A;  1OC1 A;  4LO7 A;  2IVI B;  4S2H A;  3AZX A;  5FAX A;  4XUP A;  3RYK A;  4GIQ A;  2WO1 A;  1DZT A;  4JRL A;  4XFC A;  1C1L A;  3Q8F A;  5F5I A;  5BNP C;  4Y33 A;  4MLO A;  2JG9 A;  2Q30 A;  1NY7 2;  4UXA A;  2YGL A;  4HKO A;  5DAW A;  2GDF A;  4LUM A;  2N7G A;  1WME A;  1W2T A;  3BKZ A;  3I8T A;  4XYX A;  4QKN A;  4CVU A;  1H6Y A;  4N9I A;  3MW3 A;  4FAG A; 
#chains in the Genus database with same CATH homology
 1J83 A;  1GQP A;  2VMF A;  3JXS A;  3A21 A;  3OBA A;  4DEV A;  3WNL A;  2YFU A;  2J7M A;  3WNP A;  3OGS A;  4ET7 A;  1JU4 A;  2JE8 A;  2WN2 A;  1R64 A;  5DMY A;  4DXT A;  2WAB A;  1JZ4 A;  4QX2 A;  1SHW B;  3PUH A;  1DYO A;  2W47 A;  3LPG A;  2VO5 A;  3OG2 A;  2VQT A;  3DEC A;  3IDA A;  2WQ8 A;  2WDB A;  1K3I A;  3EB7 A;  1GUI A;  3FL7 A;  5EIY B;  4JKL A;  2XON A;  2Y64 A;  2WYS A;  3T0B A;  2PQS A;  2XOM A;  1US3 A;  4XUR A;  4P00 B;  4MAD A;  4E8C A;  2W1W A;  1O59 A;  1JZ6 A;  2W94 A;  4BK5 A;  3NNG A;  1UMH A;  4QX3 A;  5IFP A;  1OD3 A;  4AG4 A;  3MUZ 1;  4QDS A;  1YQ2 A;  2VZV A;  3WQB A;  3OEB A;  5B4N A;  2VC9 A;  2DDU A;  1XNT A;  2V5D A;  2E32 A;  2ORX A;  3ACF A;  1GOG A;  4A44 A;  4LPL A;  2B9V A;  1JZ8 A;  4KI5 M;  3LEI A;  2J1A A;  1UY4 A;  3MV1 1;  1UY2 A;  5DQ0 A;  3PUI A;  3I2I A;  2WN3 A;  2C26 A;  4CU7 A;  4A3Z A;  3LQC A;  2WUH A;  3SEP A;  2YC2 A;  1I5P A;  2BGO A;  4TTG A;  5JR2 A;  2ZEX A;  3E1F 1;  3VD9 A;  4UOJ A;  4W4Z A;  3VDC A;  4QDQ A;  4MOA A;  2W9X A;  4OUE A;  1F4H A;  5DN2 A;  4QB1 A;  4UI9 L;  3HPN A;  2VZU A;  3WF1 A;  2VQU A;  3CIH A;  1US2 A;  1L7R A;  2R7E B;  2VL4 A;  1CZT A;  4E8D A;  2ZEY A;  2VJX A;  2ZEW A;  2RJ2 A;  4W50 A;  3CKH A;  4Z2A A;  1H6X A;  3SKV A;  3VD3 A;  4JHZ A;  2HLE A;  5JXI A;  1JZ3 A;  2E26 A;  4GWI A;  4M4P A;  3I3B A;  2VMC A;  1W9W A;  2QQL A;  3ACG A;  3WSO A;  1PMJ X;  2VZS A;  2VM9 A;  2X05 A;  4BK4 A;  1NKG A;  4RYD A;  3I2H A;  3D3A A;  3DYP A;  2VZO A;  2W91 A;  1UY3 A;  1K12 A;  3I2J A;  5LA0 A;  2RVA A;  2W1S A;  4MGQ A;  2Z4F A;  1CZS A;  4M4R A;  2QQM A;  2YB7 A;  1UZ0 A;  4BXS V;  3T2Q A;  4CU8 A;  3GDB A;  1PX3 A;  3HEI A;  3WNN A;  1GMM A;  2V72 A;  2YC4 A;  5JMO A;  1LNS A;  2EIC A;  3HJR A;  3LPF A;  5JUV A;  4CU9 A;  5C70 A;  4FI9 A;  4LKS A;  4A6O A;  3IAP A;  4RN5 A;  1UYX A;  5JXJ A;  2VZ1 A;  4W8J A;  2E33 A;  1OH4 A;  2BBA A;  1UYY A;  2ZEZ A;  2V4V A;  5IFT A;  4KMQ A;  5HXM A;  2WO2 A;  4XZU G;  2VOT A;  3CZU A;  2Y6L A;  3OGR A;  3HNB M;  1GU3 A;  5C71 A;  3T0A A;  4JKM A;  2L9L A;  4MGS A;  3T0D A;  4CU6 A;  1TG7 A;  3HNM A;  3GM8 A;  1BHG A;  3K4D A;  2QQI A;  2VZT A;  2RV9 A;  4A42 A;  2Y6G A;  3MUY 1;  5CZK A;  4ARX A;  1UXZ A;  1JYV A;  1XC6 A;  3ECQ A;  1NX9 A;  4JX0 A;  1DLC A;  4P02 B;  2EIE A;  4KWU A;  1OT5 A;  2QBX A;  2CDO A;  1GNY A;  2J1R A;  1DP0 A;  4DUX A;  4PQQ A;  3FN9 A;  1JZ5 A;  3A23 A;  1CZV A;  1F4A A;  5G04 L;  4CUC A;  3ZM8 A;  1UYZ A;  3K46 A;  3J7H A;  4LQR A;  1JYN A;  1SG3 A;  4GZ9 A;  2OKX A;  3WNO A;  1GOH A;  2CDP A;  5DPN A;  2ID4 A;  3IB3 A;  1O8S A;  3P1I A;  1GOF A;  1O8P A;  3CMG A;  3DYO A;  2Y6J A;  3VDA A;  2W1Q A;  3C7F A;  3NJX A;  4YPJ A;  2EIB A;  3UES A;  1JYW A;  2WBK A;  2VCC A;  1ULO A;  3CZJ A;  3LE0 A;  4UAP A;  3T09 A;  3SKJ E;  2HYX A;  3WF2 A;  5IYY A;  5HPO A;  1EUT A;  3MO4 A;  3W5N A;  3I3E A;  3OB8 A;  2X10 A;  3THD A;  1J84 A;  5G05 L;  1K45 A;  1W0N A;  1W8O A;  3ETP A;  1OF3 A;  1JI6 A;  1W9S A;  3UET A;  4P08 A;  2VME A;  4QB6 A;  2LW8 A;  1XNA A;  2EID A;  5CYY A;  1JYX A;  1L7Q A;  3K75 B;  5LA1 A;  4XVH A;  3CDZ B;  5IHR A;  1UWW A;  1RYY A;  4GWJ A;  3U37 A;  3ACH A;  3VD4 A;  3OEA A;  2C9K A;  1XPW A;  3FHQ A;  1W9T A;  1WKY A;  4OZO A;  2W46 A;  2JD9 A;  2BGP A;  3GXU A;  4MO3 M;  3I2G A;  3K4Z A;  2YFZ A;  5FUI A;  4DUW A;  5LCW L;  3THC A;  2C4X A;  2QQN A;  3III A;  3LEK A;  2ORZ A;  2J1T A;  1CIY A;  2VCA A;  3C7O A;  1HN1 A;  2YG0 A;  3T2P A;  4OYU A;  1MPX A;  5JXH A;  3FHA A;  4DEQ A;  3T2O A;  5JXG A;  3WNM A;  2WAO A;  1OF4 A;  3AC0 A;  3ACI A;  3C7H A;  3EYP A;  2B4K A;  4P5Y A;  3GGL A;  4XUQ A;  2J1S A;  1SDD B;  1PMH X;  4DUV A;  3HOB A;  3BN6 A;  3K4A A;  3VD5 A;  4LHS A;  2DCK A;  3C7E A;  4A45 A;  3HN3 A;  2QQO A;  1NAE A;  2J1V A;  1CX1 A;  2BER A;  2J1U A;  4TXW A;  5C7G A;  4L0P A;  2Y6K A;  1TVG A;  3BGA A;  2VMD A;  1EUU A;  2Y8K A;  3NRU A;  5J1X A;  1UY1 A;  4DXS A;  3P6B A;  2E31 A;  4BJ0 A;  5F7U A;  2W92 A;  3WF3 A;  2W1U A;  2X09 A;  2VZR A;  4BDV B;  4ZZ5 A;  4XUN A;  4IUG A;  3VD7 A;  2J1E A;  3K77 A;  1JZ2 A;  5B4X A;  3SEE A;  2VZQ A;  4ZZ8 A;  3UNP A;  4OMD A;  4A4A A;  4XUT A;  1NUK A;  1PX4 A;  1JU3 A;  1WCQ A;  4QPW A;  5I0D A;  1JZ7 A;  3NJV A;  4D0Q A;  2JKX A;  3DYM A;  2J22 A;  2QQK A;  2WZE A;  1JHJ A;  3NQH A;  2XQX A;  3OGV A;  2XHN A;  4QX1 A;  2Y6H A;  4XUO A;  4ZXE A;  3W5M A;  3I3D A;  2DCJ A;  2KD7 A;  3ABZ A;  1ULP A;  2BZD A;  2LS6 A;  5A1A A;  1IQD C;  3F2Z A;  2VR4 A;  4CUA A;  3IAQ A;  4D8M A;  4PT6 A;  5EJ1 B;  1KEX A;  1UY0 A;  2VZP A;  4CUB A;  3MBW A;  3HNY M;  1K42 A;  2WAA A;  3WNK A;  1W99 A;  2WO3 A;  4ZY9 A;  4QDR A;  4A41 A;  2ZXQ A;  3WF4 A;  3T08 A;  3VDB A;  1D7P M;  3A7Q A;  4JKK A;  1UXX X;  3I97 A;  3CQO A;  2W3J A;  4DXR A;  4QAW A;  4QB2 A;  3I2F A;  1KGY A;  2VTF A;  5LA2 A;  1T2X A;  5IJR A;  5EJZ B;  2QQJ A;  3A22 A;  1P8J A;  1W8N A;  3C8X A;  3WF0 A;  2W95 A;  4XUP A;  3WEZ A;  2WO1 A;  2VCB A;  2W5F A;  4AAX A;  1UX7 A;  1UMI A;  3I2K A;  2W87 A;  4PF1 A;  2WZ8 A;  2VZ3 A;  3C7G A;  3LEG A;  4HG6 B;  2JDA A;  4OMC A;  4ARY A;  4QX0 A;  4CVU A;  1H6Y A;  3MV0 1; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...