2W1WA

Native structure of a family 35 carbohydrate binding module from clostridium thermocellum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
130
Chain Sequence
b'ASPVIYQAEDAIIYNAILETVNAGYTGSCYVNYHNEVGGYIEWNVNAPSSGSYALIFRYANGTTANRPMRITVNGNIVKPSMDFVSTGAWTTWNEAGIVANLNQGNNVIRATAIASDGGPNVDYLKVFSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LIPOLYTIC ENZYME, G-D-S-L
molecule tags Hydrolase
source organism Clostridium thermocellum
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
total genus 27
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18099 DUF5010_C DUF5010 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w1wA00
2EICA 4MGSA 1JZ6A 3WNMA 2WAAA 2J1UA 3C7GA 4GWIA 4OMDA 3D3AA 2CDPA 3I3BA 1F4HA 1T2XA 4XUOA 4PT6A 3IIIA 4UOJA 4QDRA 1YQ2A 4BJ0A 4CUBA 1XPWA 4XUTA 3GGLA 3I97A 2J22A 2R7EB 2VZ1A 2V4VA 4QX2A 3ABZA 2YG0A 2BBAA 5G05L 4M4PA 1GUIA 3K46A 4A41A 3OBAA 4OMCA 4QPWA 5LA2A 3T2OA 3LEGA 3NRUA 4DUVA 3UNPA 1JI6A 4KWUA 1JZ4A 2WZ8A 3HNBM 4MGQA 4QAWA 4UAPA 2VQTA 3THDA 1EUUA 3SEEA 5DMYA 1JZ8A 4QB6A 1R64A 5HPOA 3HJRA 3OGVA 4QB1A 1JU3A 4DUXA 3MBWA 5HXMA 1LNSA 2W3JA 5A1AA 3WNNA 1CZTA 1W8NA 5CZKA 1F4AA 5JMOA 4A42A 2W92A 3LPFA 4JX0A 3HEIA 4ZZ8A 3J7HA 1UX7A 4QDQA 2ZEYA 3HOBA 5IJRA 3WF1A 4DXRA 3NNGA 1XNTA 4CU9A 3ACFA 5I0DA 3WEZA 3I2JA 3THCA 2RJ2A 3A21A 5JR2A 2X09A 2W1QA 3NJXA 2Y6KA 1UY2A 2BGPA 2OKXA 3WF4A 3IDAA 3CZJA 2W87A 3IAPA 3K4DA 3MUY1 1PX3A 2VZOA 2YC2A 3GXUA 3VD4A 1RYYA 1UZ0A 4LKSA 4TXWA 3W5NA 1WKYA 4ARYA 2YC4A 4OUEA 1NUKA 1JYVA 2C26A 1J83A 2YFUA 4PQQA 5FUIA 3T2QA 3VDAA 1GOHA 1GU3A 1OF3A 4ARXA 3C7EA 3GDBA 2WBKA 2BZDA 2WZEA 2JDAA 2J1AA 1BHGA 1W9TA 3SKJE 4P08A 2QQJA 3OB8A 5JXGA 5IHRA 3C8XA 3DYOA 3CDZB 3NJVA 3ZM8A 5LCWL 4XUNA 2W9XA 2Z4FA 3CIHA 3FHQA 2V5DA 4DUWA 3A7QA 5DN2A 4DEVA 3WSOA 5DQ0A 4A6OA 2VR4A 4QX1A 3EB7A 2J1TA 2VZQA 1H6YA 2EIBA 2VZSA 3VD7A 1MPXA 4DEQA 4A45A 1UMIA 2VZ3A 1HN1A 1UYYA 5LA1A 2ZXQA 2WAOA 2LW8A 3LPGA 1PX4A 1UXZA 5C71A 4P02B 2VMCA 2ORXA 5JXIA 1DP0A 2VL4A 3OGSA 4DXTA 2X05A 3I2GA 4D8MA 2WO2A 4W4ZA 1JZ7A 1JYWA 1CX1A 4TTGA 3K4AA 1GOGA 2E32A 1JHJA 1SDDB 1NAEA 2VC9A 3LQCA 2Y8KA 2QQMA 2W1SA 3T0BA 1D7PM 2Y6GA 5JUVA 5F7UA 1UWWA 1SG3A 2HYXA 3HN3A 2X10A 3T08A 2WUHA 1US2A 4MOAA 2B4KA 2EIDA 2VMDA 4RN5A 2PQSA 2W47A 4CU6A 2XHNA 3HNYM 1TVGA 4QX0A 2Y6LA 4XUPA 3VDBA 2DDUA 2DCKA 3DECA 3VD3A 3ETPA 4XVHA 1W9WA 3VDCA 2W1UA 2HLEA 3T09A 3UESA 1KGYA 4E8DA 3LE0A 2J7MA 2BGOA 3GM8A 3HPNA 4PF1A 3WNKA 2J1SA 4KI5M 2W94A 3FL7A 3A22A 1UY4A 2VCCA 4KMQA 3I2FA 1WCQA 3T0DA 1CIYA 2QQKA 2BERA 2XOMA 1US3A 3MUZ1 1UMHA 3K75B 3MV01 3I3DA 1CZSA 2CDOA 5DPNA 2J1VA 4XUQA 2QQOA 3W5MA 3T2PA 2LS6A 1JZ5A 3FN9A 3WF3A 1JU4A 2V72A 3CZUA 4IUGA 4A4AA 2B9VA 1XC6A 2W1WA 1O59A 4AAXA 2WO1A 4MO3M 2W91A 3DYMA 3SKVA 2JKXA 3OEBA 4BDVB 2KD7A 2JE8A 4ZY9A 4BK4A 2VJXA 4GWJA 2W46A 3DYPA 4GZ9A 4YPJA 1DLCA 1JZ3A 1SHWB 2WN2A 2VMEA 1W9SA 4W8JA 1UY0A 1J84A 3BN6A 1DYOA 5J1XA 2DCJA 2E33A 2QBXA 3WF0A 1OD3A 4CUAA 1ULOA 4M4RA 2J1RA 3E1F1 3SEPA 5B4NA 5C70A 3PUIA 3FHAA 3VD9A 4XURA 2C9KA 2Y64A 3ACHA 1PMJX 1OH4A 1KEXA 2VZRA 3I3EA 2QQNA 3MO4A 2WABA 4A3ZA 1W99A 2VZPA 1OF4A 2QQIA 2WYSA 3P1IA 1UY3A 3EYPA 4OYUA 2ZEWA 3MV11 2W95A 1UY1A 2L9LA 4ET7A 1GMMA 4JKKA 5C7GA 1ULPA 4DXSA 2WDBA 4QX3A 1OT5A 3U37A 5EJZB 3LEIA 1L7QA 3OG2A 4P5YA 4W50A 3LEKA 5IYYA 4OZOA 1UYZA 3OGRA 3HNMA 5JXJA 5G04L 5EJ1B 3ACGA 3ACIA 1K42A 1W8OA 2VQUA 3PUHA 5IFTA 4JKMA 1CZVA 4HG6B 3IB3A 2E26A 1XNAA 4L0PA 2YFZA 3I2IA 4AG4A 4Z2AA 4QDSA 2C4XA 2QQLA 1GQPA 2VZVA 1PMHX 3F2ZA 4A44A 4CU8A 5EIYB 2WN3A 3C7FA 2WO3A 4MADA 4D0QA 1GNYA 1GOFA 2ZEXA 4QB2A 3JXSA 1UYXA 2WQ8A 3WNOA 4RYDA 2YB7A 2J1EA 2EIEA 1K3IA 2VMFA 2E31A 3NQHA 3BGAA 2ID4A 1L7RA 1P8JA 3WQBA 3CKHA 4CU7A 5LA0A 4XZUG 4ZXEA 2ZEZA 4P00B 5B4XA 1H6XA 1UXXX 4LPLA 4BXSV 1I5PA 2ORZA 2VCBA 4LHSA 4LQRA 3K77A 3A23A 3C7HA 4E8CA 3ECQA 2Y6JA 3C7OA 1K45A 1O8SA 2XQXA 3CMGA 2Y6HA 4BK5A 1JYXA 5JXHA 5CYYA 2RVAA 1O8PA 2VM9A 5IFPA 4CVUA 3CQOA 3WF2A 2W5FA 2VO5A 3WNPA 2VOTA 2VZTA 4JHZA 2XONA 4CUCA 3I2KA 2VTFA 3T0AA 1NKGA 3I2HA 4JKLA 2JD9A 3AC0A 1W0NA 1NX9A 2VCAA 3UETA 3OEAA 4FI9A 1IQDC 2RV9A 4ZZ5A 1JYNA 4UI9L 1JZ2A 1K12A 3VD5A 1TG7A 3WNLA 3K4ZA 2VZUA 3P6BA 3IAQA 1EUTA
chains in the Genus database with same CATH superfamily
4MGSA 3RWKX 2PLV1 1XBFA 1R082 1Y43B 4MVTA 3GBWA 1JZ6A 1HRV2 2AREA 1PNGA 5AC91 3FMGA 5CFCA 3TN93 3GZUC 3RSJA 1POV0 2BU9A 1LKNA 1UN1A 4J1XA 1RL3A 4GWIA 3VBRA 4OZXA 3HR9A 5J48A 1XSQA 3LGRA 1S4CA 1MS0A 3VZOA 1A8DA 5A3PA 1T2XA 2IC1A 4EN8B 4FVVA 3TN91 3Q8CA 5EFUA 1YQ2A 4LTAA 1S0GA 2D5FA 2WQ4A 1X82A 2CGNA 5JOWA 4XUTA 2R32A 5T5OA 4AOCA 1QIQA 5F3EA 1BEV1 4RQPA 5BNOB 2TNFA 2R7EB 2CSGA 1H1MA 1GZCA 1ENQA 1A6CA 1PIV2 1TME1 3QD6A 4QPGB 4I2OA 1G9BA 3VBSA 3JBG1 2ZHKA 1DQ5A 5G05L 5FZOA 3R4UA 4YGCA 4CDQB 3ILNA 2FMDA 4QPGC 3K48A 5A7WB 3LFMA 4AR2A 2RDSA 1GP5A 1SLTA 1GUIA 4C0HA 4CP9B 1K5JA 5BNPA 1ENXA 3K46A 1HX6A 2FDHA 2FHRA 3WW4A 2RS53 1VRH2 2R1BA 1RHI3 4AEDA 4OMCA 4SLIA 4WVWA 2W52A 2D43A 3GZAA 1F5JA 3VBHA 1U5XA 2ZOEB 4DUVA 3AP5A 4CYDA 1JUHA 1JI6A 3BKZA 1JZ4A 2WZ8A 3LZZA 5HXVA 1LOEA 1D4M1 2WS93 3EXUA 3J4UH 1SFYA 4LKEA 4QAWA 1BK0A 3THDA 3WP5A 1EUUA 4MXWB 2Z79A 3KT1A 4LHLA 4EWAA 4QQPA 2XJQA 4Q0UA 5DMYA 4X6RB 4OULA 1IPKA 1JZ8A 4FPJA 2WS91 3U07A 5C9AA 4NIAA 3VKLA 3VL9A 3HJRA 4YVSA 1DQ2A 2K0GA 3OGVA 3S5QA 1O3SA 1JU3A 2EF6A 1LHOA 3UGGA 5IT6A 1XOYA 2JB8A 4Q4W2 1EV13 5HV0A 1FI2A 1SMVA 4B7KA 3DKQA 2ZGNA 2FZ1A 1LJ7A 1CZTA 2V09A 1YUDA 4KG8A 1JXNA 2Q1ZB 2WRAA 4AQ2A 2W08A 4YW1A 4A3XA 1MZFA 1KXGA 3HEIA 2F6BA 3QH7A 4ZZ8A 1NOVA 2A3XA 4GA9A 4AEDB 1KD7A 3V0BA 3HOBA 3KCCA 1QJZA 4W6YA 4CCEA 4COZA 3WF1A 1DGRA 4Q0VA 2HWD1 3NNGA 3ZKUA 4L92A 1VBC2 4INDA 1QY4A 4AI8A 4BU2A 1WD4A 4GKXA 2X53S 3VBFC 1F9KA 4BZ4A 4BHPA 5AVPA 1RMU1 1JN2P 1QDOA 1LOBA 2QQVA 3E6DA 3RPQA 4DS0A 1KJLA 2QFEA 4IV3B 3N9QA 1C1FA 3RS6A 2VULA 1AZDA 4XACA 4CDUB 3WG1A 1W2OA 4OCTA 4E4HA 2ZGQA 5FZCA 3SHRA 4QWNA 4DXZA 3K4DA 1PX3A 1NE6A 1UMZA 2YC2A 4LK6A 2R043 5A3OA 4QGLA 3ZYFA 5J36A 4IE5A 1HRI1 5GLTA 4LKSA 3W5NA 2A70A 1ZRCA 3NMBA 3RZJA 1OUXA 3H1WA 5CBLA 1PNFA 2WJSA 2C26A 5FZMA 3OYWB 3O1SA 4DMIA 3BALA 3B01A 2BNOA 5A7PA 4K20A 2HWF3 2OUJA 4AI2A 1NZCA 1R1A3 1Q43A 5GZFA 1VBA2 2FCVA 4FP2A 4E4SA 3DGTA 4UWDA 1RJ7A 4S2GA 1UOJA 4RFT0 1AR73 5F9TA 1C5IA 2HWB2 1RUI3 3KM5A 4XQDA 3S7EA 3WDWA 4FSJA 2H6BA 3VZJA 4MGZE 5FZGA 1OVPA 2WZEA 5FJHA 3RWNA 1U5YA 1M4WA 4YRDA 1YWKA 2PMWB 3RMXA 3WDXA 3GF6A 4CEWA 2J1AA 1OOPC 5KXBA 1BHGA 1WW4A 4I3GA 1W9TA 5A32B 5C8CC 2VNVA 2IFWA 2AH2A 4P08A 4O65A 2QQJA 1VAMA 5K9YA 5JXGA 2PXJA 3IPVA 3MPPG 4R9DA 2BNMA 2GZWA 3DYOA 5IHRA 5FYIA 3N35A 1DDLA 3ZM8A 3AK0A 2RMU3 2W9XA 3CIHA 1H8TC 2WNVA 2XJRA 3FHQA 3H3LA 3M70A 4AEJA 3A7QA 3PMSA 5J96B 1FT9A 4BQWA 1HJGA 3ZFFA 5M0TA 4RS5A 4A6OA 3U10A 2VR4A 4QX1A 5T5LA 3VBUC 1RUC2 2J1TA 4KL1A 5FP4A 5IVEA 3PU8A 1H6YA 2EIBA 2VNGA 4MG2A 4BWOA 1UCXA 5D8AB 1UMIA 4HKOA 4FTSA 2Q0AA 1FNYA 2VZ3A 1J1TA 1IKPA 4WVMB 4UYBA 1LHWA 3ZYPA 3OD0A 2B7YA 5L7OC 1KDMA 5CG9A 2VMCA 3I8TA 2UU8A 4XHBA 4FTEA 5KHKA 1Y9GA 1UL9A 5IW0A 2VL4A 4KBZA 1JOJA 4RS5C 3BTXA 1QEXA 4P9JA 2RR13 3RQ0A 3VBOB 4CDXB 4DXTA 2Z42A 1OHFA 1EPZA 1R092 3I2GA 4D8MA 4XTMA 4Y1VA 1JYWA 2I74A 3FUQA 2WNUA 2D40A 3A4UA 1CX1A 2RR11 4UFLA 2E32A 3JD73 5C3PA 1LOCA 1JHJA 2TBVA 1SDDB 3B00A 1D2SA 1ZZCA 4HXCA 4XW3A 4D7SA 2SLIA 4WM7C 4R8HA 3PIJA 4UW5A 3OPZA 3M3CA 4B3NA 2Y6GA 1N1SA 4JQTA 1GKBA 3O0XA 5JUVA 2C5DA 1UWWA 4RHV2 3WHTA 4CPBA 5FZ3A 3HN3A 4M3CE 5A7WA 2D3PA 4LORA 5I93A 1IGOA 2WUHA 1US2A 2XHKA 4PIYA 4DY3A 1L7LA 4NHXA 1PM7A 4ASKA 1VAKA 3E97A 1M06G 3AL5A 4CU6A 5CFDB 1AR91 2O0OA 1RINA 3AKTA 1TVGA 4QX0A 5GZGA 3VDBA 2YGMA 2DCKA 4IV1A 4ZXKA 1FX5A 1W8TA 3ETPA 1W9WA 5I8YA 3O5SA 4HVOA 3WCSA 4CCKA 2IZWA 3UKVA 1FMD1 1KGYA 4MSVA 4Q29A 5FXVA 3WD5A 1O4YA 3L2HA 3GM8A 2XJTA 4COYA 2J1SA 3RYKA 4V2VA 5LRSA 5IAVA 4Y22B 4KMQA 5C3OA 4NIDA 2R49A 2RM22 4B29A 4Q4V2 1WCQA 3HBZA 2P3JA 1UOGA 4J6GA 1CIYA 5A70A 2E7AA 2Y33A 5FZBA 2BERA 4LO4B 4TLGA 4D6SA 3FHIB 2XBO1 4LOSA 2BUKA 2PAMA 4LLOA 3K75B 3MV01 4JGYB 4B1LA 5LY2A 5IAXA 4LE4A 4LHKA 3VZLA 3DL3A 1RUH3 3WXPA 4BOWA 2QQOA 1K5MB 5KXEA 5FYYA 1GP6A 3CO2A 1UQXA 2LS6A 3NW4A 3FN9A 1JZ5A 1JU4A 1NLQA 4AWDA 1RMU3 3HWJA 3OD4A 1C8M1 4A4AA 4EZHA 1XC6A 1QOOA 1W8ZA 1QJFA 3VDDA 1O59A 2DFCA 4MO3M 4P9YA 1WCUA 1HKDA 2XH6A 3GJBA 3SKVA 1LOAA 3WQ1A 5ABJA 3WDUA 2JKXA 1C8M3 4BDVB 1PO11 4BK4A 1UPIA 1KQRA 2WNUB 1RUF3 2DCZA 5FZ9A 3DYPA 2WYFA 3DPRC 2I07B 4ISRA 4YPJA 2LM3A 4M00A 2Y0IA 4AVTA 5JR7B 2GNDA 4EZ4A 3KCYA 3THPA 3MI8A 4FXGB 1XNCA 2HWF1 3AFGA 1DLLA 4JHTA 1YRZA 4A6SA 2DCJA 3SH4A 3OY8B 2B5HA 5KHHA 1W3VA 4CCLA 2PFWA 5JI7A 1ULOA 3VLBB 2CV6A 2TUNA 5FZ6A 4QQ2A 3WDTA 5LASA 3ZYJB 5FPVA 3H8RA 1D4VB 2EAKA 1HN0A 3BTAA 5B4NA 5C70A 3PUIA 1LHNA 2OIIA 3MFAA 5FIXA 3ZVXA 4XJAA 5LBBA 3D82A 2IXJA 2UWCA 1GWLA 2QZ3A 4GJYA 2VUAA 2VMHA 2VUJA 5KHIA 1HB4A 4EN9B 3ZOIA 1A34A 1XQNA 5ABJB 5FO8B 4JDMA 2R063 1NCQC 2XVGA 4RSUA 5EP9A 1KRIA 3WT3A 2P17A 2QQNA 3VDDB 5CA6A 1DCSA 1H8TB 2ARBA 1OF4A 1X8MA 4ITCA 3P1IA 2PELA 1OUSA 2KXLA 1TMF3 1UY3A 2VCMA 1BJQA 3NL1A 4QQOA 1O5UA 4XFBA 3B5LB 4FOYA 2Y60A 2DBIA 3S30A 1MS4A 2P6HA 2H0BA 1FV3A 2XB6C 2ZEWA 2VVFA 2W95A 3MLLA 3IKWA 4DINB 1BLZA 3LDKA 1CAWA 3PDQA 4HKWA 1Q56A 1AUYA 4ES9A 5JMCA 2Y0OA 3NKGA 2XLAA 1H2MA 1QQP3 1JHNA 5FY4A 5A3MA 5FY8A 5GZCA 5JPNB 5KBFA 2QCSB 1OT5A 3BODA 4Q0PA 4Y22A 3MIEA 3U37A 2AGSA 4E2SA 4EV0A 1W0OA 1S0FA 4Y5TA 1DBNA 5FY0A 4XMAA 5SV5A 2IXIA 1PO23 5DABA 3FJSA 3DN7A 5DAXA 5IYYA 1UD1A 1UYZA 1BMV1 5CFCB 4I09A 4LMFA 2CAVA 2ZJCA 4AVSA 5L7OA 1MZ6A 4QX5A 3UT0A 3QH6A 1FPN2 2ZGRA 4META 5FMOL 5FUPA 3ACGA 2GU9A 5KC6A 3USUB 3DPRA 4QXBA 1YO8A 2JWPA 3ACIA 3KWVA 4QXCA 1F2NA 4PLNA 2WWSA 5IFTA 2Y6FA 4HG6B 5EWSA 5K0UC 3H7YA 1OC1A 5C5TA 3SH3A 1OOPA 5FPZA 4Z2AA 5HI0A 1E57A 1NXD1 3ZSKA 4D94A 5GALA 2GH2A 3GCWA 1Y9MA 2R061 4AEMA 4M0NA 3IT8A 3POSA 1S0DA 4BQ5A 5A6QA 3BYWA 5FYVA 3U4XA 1H2KA 2RMU1 3KCXA 1W6MB 4MADA 3AXEA 5JZGA 1AXZA 1IKQA 5F3GA 5GZDA 5FPBA 5BNNC 1IS6A 2ZEXA 1W8WA 1PVC1 3UJOA 4CP1A 4Q1RA 4YW5A 1VB4A 4CE8A 4CCOA 3AMQA 4HKLA 4JRLA 3WNOA 2WSVA 3S0MA 2NZ9A 3WV6A 4RA0A 4NIIA 1VBD3 2EALA 5FTTC 1R1ZA 1V9U3 3J7MA 3ZN6B 4BMBA 5FPUA 4YW6A 5EQUA 1LOFC 3VKMA 3Q8BA 3WQBA 4JV4A 3J8F3 4K21A 4NO4A 3ZSJA 5LA0A 3OGGA 1YIFA 3HT2A 4ES8A 4PDWB 2VH9A 4IE4A 4BXSV 1XXNA 2ORZA 1TNFA 3ETQA 4IGOA 5CB7A 4LQRA 5CADA 3C7HA 4E8CA 3C7OA 1K45A 1KITA 3ZXAC 1A78A 5A3TA 1HRV1 3MIGA 1WA6X 5FYZA 2PLV2 4XFAA 1AJKA 4Y20B 1XE0A 1JBCA 5JZGC 3HT1A 1ZZ9A 5IFPA 3JUUA 4N90A 2W5FA 3POIA 1IPSA 2VO5A 3JBG3 5DUXA 2OPKA 3N3HA 2VZTA 3IPVB 4W6XA 4YM1A 4Q26A 1I5ZA 4FOVA 2ADEA 2XUEA 1OA2A 1AYM3 4R9AA 3ZMOA 3JQWA 3ASIA 3ZDVA 5FQ0A 3I2HA 1QJU3 4MV2A 2FQPA 4HETA 4I01A 1YNAA 3UETA 1OA4A 2LALA 2ZMLA 3POBA 1IQDC 2RV9A 4FI9A 3K3NA 3WQ7A 4AYUA 5IVVA 5HCHA 3USUA 2JG8B 3U4SA 1TG7A 1ZX5A 4YVSC 5BNPC 3AP9A 4WM8C 2VZUA 3IAQA 3W9AA 2QQUA 4MZUA 1W8FA 1MS9A 4G3YC 2WAAA 1SPPB 2LROA 5FYCA 3HQRA 4N53B 1SLIA 4OMDA 1G9CA 2WFF3 3KV6A 3KQRA 4YW4A 5AFEA 3RRDA 2A5ZA 1Q8VA 4XUOA 2JKBA 3IIIA 4UOJA 3AX4A 3MIDA 4X8PA 5JLVA 4XF3A 4IE7A 4CUBA 1C4RA 1XPWA 4I30A 4XBLA 4YVWC 4CCCA 1MS8A 5IVJA 4N9HA 2VTXA 3KMHA 4XJUA 2AEZA 1V0AA 4QGNA 2Y26A 4L9BA 1EPWA 2YZ4A 1AYN2 3J7NA 2XKPA 4BYYA 3UK9A 4BQYA 2YG0A 4GWNA 4QXHA 4PDWC 1FPN3 3KQ4B 3TOJA 1B35B 5JAXA 3FE5A 3VBFB 4AHWA 1DZQA 4JDNA 5IK8A 3NKTA 1O6UA 4L11A 1BQPA 2A75A 1MVQA 1PO22 2Q4SA 4N43C 4BIFA 3POFA 4HVQA 2BPA2 1J3QA 3LIHA 5ABJC 2HWD2 4Y20A 4QPWA 2VY0A 5FMDA 2BVBA 3SLIA 5LBFA 1TEIA 3UV9A 1XE7A 3VB9A 1QQP2 2PHXA 1WUVA 1OKQA 1UKRA 2XXZA 4OVEA 3RZZA 2JX9A 5BUVA 3KHBA 4DIQA 4BB3A 1LHVA 1NYWA 2VOKA 2VQTA 4OHWA 4Z07A 2VOXA 3DV8A 1UU5A 2UWBA 1PO21 2HYKA 3SXWA 4C90A 5A6ZA 4GH4C 4RQPC 3B69A 5JOZA 4QB6A 1R64A 2E51A 1AYN1 2XLGA 4OHXA 4DUXA 4MGTA 2CY6A 1HRI2 4D6QA 3AB0A 5HXMA 4OUMA 4OLLA 2CU5A 2JG9C 2W3JA 2X5IC 4Y1YA 1QJEA 5CNAA 2YPDA 2X5IB 3EQEA 1VB2A 5F3IA 2JDYA 4CXWA 5F3CA 1ZYBA 3BPSA 2GMEA 3T1MA 1DGWA 1WZXA 2YROA 1F4AA 3RI8A 3TEYA 2BV4A 2ENRA 3MW4A 2W92A 3NO8A 4JX0A 4MHRA 4AF9A 3KGZA 4XE9A 2ZEYA 4EYUA 3O1PA 3POEA 2VUDA 2FDFA 3H50A 1AF9A 3PJQA 2O14A 1VMJA 1AL22 1XNTA 3I7DA 5LZ6A 2ZMKA 5I0DA 4X6QB 1MACA 5F1RA 4UT5A 4CDQA 3TWIA 1PK6C 3ZSEA 1CJDA 1HV1A 3I2JA 1EAH1 4FPEA 3THCA 3VL8A 1MS1A 2PHRA 3PTYA 1CN1A 4NE9A 2FDGA 5LB6A 1KS4A 5I0SA 3MGUA 4GKYA 5C9AC 2X09A 3DPRB 3UL2A 1C8NA 2YBPA 5AVAA 1IZ3A 5T54A 3WF4A 4M0HA 2W87A 5CKQA 1IS3A 3IAPA 2XJPA 3AZWA 4IV1C 1AVBA 2VZOA 4FFHA 1FOD3 1KFXL 1BMV2 2Q1MA 3RZKA 2YC4A 4OUEA 1NUKA 2DV9A 2G1MA 2XWBB 3OYWA 4BQ2A 1UF2C 2E7QA 2WQZC 3CBNA 5JSPA 1W8UA 5L73A 3PVEA 1YFYA 1AX2A 4PQQA 5FUIA 3T2QA 1LU2A 4O7XA 1GOHA 3TRSB 4AXOA 3O1OA 1MZEA 4JGZC 2D93A 5K0UB 5FZ4A 1TQ5A 4AVVA 2VNRA 4UFIA 5LEJA 3C7EA 1CAUA 3CL1A 3J8F1 5F5IA 2WBKA 2V4AA 2PLV3 2VPVA 5C4WC 2JG8A 4OUSA 1GZTA 4OI1A 1OKOA 2OQ6A 1FYUA 5CFDA 4YLZA 1EP0A 1WA4A 4LR4A 2R6QA 2RE9A 3C2UA 3C8XA 1NQDA 3KF5A 2D3SA 3SH5A 3NAPC 4XUNA 5LCWL 3PVNA 2D7FA 4TYSA 3J8F2 4FAGA 1CAVA 5T50A 2OPWA 1ULEA 1S0CA 1BKZA 4AFCA 5FYUA 3ZYRA 4BH9A 1V9U2 2ZZJA 1E5SA 3JB4C 1EYBA 1VBD2 4L8QA 3SQOA 5EJ3A 4IESA 4P9WA 4NPLA 3RYPA 4ZU7A 1H1IA 2WNUC 1MPXA 1WBLA 4R4ZA 5FZDA 4DEQA 5H9SA 2XVKA 1W05A 4YM3A 1QDCA 1W6NA 2G9GA 1HN1A 5I8SA 2LW8A 3FFQA 5HCAA 4FP3A 2EVXA 4Q4X3 4B8EA 4G9SB 3ZIWA 3AZVA 5L9RA 2RS51 5C71A 2C6SA 3OY8A 3OPWA 1DQ0A 1O7FA 2ZHLA 3S7IA 1GR3A 1AXYA 2F4LA 3M4FA 3PIGA 4AQTA 1WBFA 3PHMA 5FLIA 5AC92 2D98A 2X05A 5D8AA 5FUNA 3M3EA 1W3XA 4CCJA 5IVCA 1C5HA 1J3RA 5FYSA 5FZKA 1JZ7A 4P14A 4QT6A 3JD72 5FMBA 3K4AA 1PGW2 4GMP0 3U75A 3L2YA 2AC1A 1RXFA 3ZFEC 2VC9A 3VUOA 3R6SA 3TBDA 1YFUA 1R093 3ZXLA 4R9BA 2RR12 5BNPB 2PHTA 2WWJA 2YU2A 1I9RA 3RYRA 1SG3A 3J7LA 3POGA 2Q30A 3WUDA 3E5QA 5C8CB 1R091 2ZMNA 1ZBA1 4UXAA 1RUD2 2RHPA 4MOAA 5J7MA 1OOPB 2B4KA 2EIDA 1RITA 2DVBA 4NAMA 3R05A 4OHYA 3I4IA 1QXJA 4PIZA 5IVYA 2PQSA 1JYIA 5FP8A 3CEWA 2XHNA 1N3PA 1RUD1 2DWRA 4YW2A 1ND3B 2A71A 2XBO2 4OI4A 4XUPA 4FFIA 1HLCA 4YNIA 4DFSA 5FZ8A 1HQNA 2WT0A 4HONA 4YG3A 1ULCA 2W1UA 4CCDA 1RUC3 5FWJA 2HLEA 2PHWA 2GSYA 4GWMA 3KZ4C 2RS12 1VBB3 2DTWA 4KI5M 1BYHA 4XDOA 3FL7A 3SCFA 5ACA2 3ILFA 1PO13 1FMD2 2AUYA 2JECA 3I2FA 3LSDA 5F5AA 4YZ5A 4CZSA 1XRUA 4HK9A 3NWKA 3PMEA 2QQKA 4ZS3A 4AFAA 3MFCA 2VG9A 1US3A 2XOMA 3MUZ1 5A33B 1QHDA 3JB8A 2UURA 4RR3C 1FMD3 1NT0A 1PO12 2Q5TA 1Q8PA 1OFSA 5ACA3 2MPFA 1RUI2 1AR72 1XU1A 1QH7A 2RDQA 3ZYGA 5L36A 3WF3A 1NXMA 1VBA3 3ZN5A 2V72A 3CZUA 4PF5A 3WQ0A 4IUGA 4QM9A 5DG1A 2HWF2 4IEQA 4KGQA 5FWEA 5LA9A 4HFSA 5L9BA 1ZRFA 2JXAA 2WO1A 4AEDC 1W90A 3GALA 1PZ9A 2W91A 2ZX3A 4Z92B 3V0BB 2A6XA 1WW7A 2KD7A 2JE8A 1UOFA 1JOPA 1ZZBA 5D8AC 3OUHA 2VJXA 2W46A 5GJ6A 4GZ9A 4IV3C 5A3LA 5IUQA 1N47A 1IOAA 1SHWB 1N3QA 1RUF2 2PTMA 1QH6A 3Q8AA 4XF1A 5EYXA 1UY0A 1J84A 1DYOA 1GWMA 4JC1A 1YHFA 4LO8A 4AQ6A 4OQ8A 1W6OA 3NV1A 4LBQA 3VZKA 2E33A 2XG3A 1MS3A 4M01A 1OD3A 3ZO0B 3HD8B 2ARAA 2ETEA 3LA3A 2RJLA 3BU7A 4A2UA 4BQ1A 1FOD1 5EXOA 1RMU2 1E5RA 3B7MA 3WVJA 3R0RA 1W9FA 3FHAA 4NRPA 4XURA 3U78A 5FBJA 5AC93 5FPAA 2JD4A 1PMJX 3RGBA 4DZGA 4K8FA 3KT7A 3C3VA 1OLRA 3SC7X 1KJRA 2VZRA 1YJKA 4FT8A 3I3EA 4QM8A 3N7JA 1NA1C 2GNTA 1RUG1 3VKOA 1S0EA 2D3RA 2QE3A 3EHKA 4OHVA 3WY6A 2ZKNA 1KDKA 4Q4V3 5A7QA 3PUQA 1CQ9A 2HKXA 4Q4X2 4ZONA 2VUCA 2BOIA 4IE0A 3ZDSA 4CDQC 5C3SA 5I0RA 2QQIA 4GD4A 2JDMA 5FZOB 1XYNA 1YJLA 2ZGUA 3VKFC 4CXXA 4RD7A 4XYXA 1B35A 3VHPA 4KWLA 1S2EA 2AYHA 4N7UA 1OFNA 2DFBA 2NPIA 1HQLA 3EBRA 1BXHA 1HV0A 2AENA 3N9PA 3PLQA 4P9GA 3N9LA 1QJX1 4J25A 5CU1A 3GYDA 1OBNA 1UY1A 1W0PA 3ES4A 2DF7A 2CTVA 4XILA 2WS92 4JKKA 4KNCA 3AYEA 1QMJA 4RQPB 3TYJA 2QKDA 1CAUB 4Z82A 1ND2A 3BTZA 1ULPA 3ZR6A 4IGQA 5A7OA 3RZHA 1X8EA 2WDBA 4LOTA 3RNSA 2R071 5E6HA 5E88A 2GALA 2GNMA 4QU2A 2WC2A 1H8VA 1VRH3 2EXJA 3LEIA 2R1DA 1UOBA 3A0NA 3AXDA 3LEKA 3T4HB 4N53A 1OI6A 4RHV3 5FZFA 4Z8BA 2P37A 4IDZA 3KT4A 3ATGA 4IEWA 2DU0A 3HNMA 4OI0A 4QX8A 2V73A 2JDHA 1SLLA 4NWWA 4A7ZA 4CDUA 1T6GC 1OQDA 5F5CA 1HB3A 1SEFA 2ARXA 1V9U1 3FBYA 1MVEA 3ZXGA 3ZIXA 3RZLA 4GB31 1CZVA 1Y4WA 3IB3A 4XCAA 1WMEA 4AW7A 3IMMA 3J9SA 1REDA 2OUHA 2NMNA 3M2MA 1IHMA 4CXYA 2QQLA 5J98B 1PMHX 4YWAA 1ZRRA 3F2ZA 4A44A 2DBNA 3PNAA 4CU8A 2BJSA 4BQXA 4YFWA 1LRHA 4UW4A 3HMYA 3HVDA 2ZGKA 2JE9A 3OSDA 1DHKB 1NY72 3ZMNA 3I3QA 2Y38A 4UF0A 2D6MA 1GNYA 3K3OA 1OQ1A 4UFJA 3AKSA 4D0QA 4FPGA 4LBQD 4IEOA 1ND3C 1HRV3 5LK5A 1UAIA 3O1MA 4QB2A 1NLRA 2PHDA 3MF9A 2IVIB 2WQ8A 1W06A 2WKKA 1BEV3 4RYDA 1ALYA 5LBEA 4RL7A 3ME2A 3VBOA 2EIEA 4CDXA 1UPSA 3NQHA 3ZXJA 3E5XA 2XPJA 5KR7A 1Z7S1 2NYYA 3FBMA 5LY1A 1ZRDA 5H9RA 4Q4Y3 2ILMA 2ZS6B 1QJU1 3PUSA 4XZUG 1URXA 4YW3A 4ZXEA 2HWB1 4AI0A 3ZN6A 2XQRA 2UY9A 1H6XA 5FMOS 1UXXX 1I5PA 1PGL1 3ZR5A 3EMRA 4N43B 1VBD1 2VW1A 3H1MA 2MNGA 4WVZA 2O8OA 5D21A 3AMHA 4K40A 4IGPA 4QU1A 3CMGA 1AJOA 2VE1A 3CJIA 2NLRA 1UZYA 5GM0A 1LTEA 1NA1A 4HSLA 1O8PA 5IVBA 2QTWB 3P3PA 1VBB2 1CAVB 2RS13 4K3UA 3I49A 4CVUA 1SFPA 3WF2A 1TZOA 1DG6A 1HIXA 5LWBA 5FYMA 4E27A 1R1A2 2PAKA 1GZWB 1OURA 4JVAA 1WWYA 2PHUA 3JU9A 2XBO3 2ZGLA 5GLVA 2JD9A 3VBUB 5FBZA 2VCAA 1UO9A 4V1PA 3MEPA 3ZKYA 4HT1T 1SBFA 2R042 1RB8G 3KB5A 3O7OA 3PVOA 5A33A 1JYNA 4UI9L 3URFA 3VD5A 1PIV1 2E6VA 3W21A 4EE2A 1IG0A 3MW3A 2KR2A 2V4VA 3P6BA 4XFGA 4XZPA 1RUD3 2D6OX 4LBKA 1VIWB 4SBVA 4GALA 3W58A 1IPJA 3AZYA 1HB2A 2BWAA 1CESA 2BRTA 2J1UA 2IUWA 3C7GA 1D0GA 5A7SA 3D3AA 2CDPA 1YC61 2YY1A 2XLFA 1AR63 1F4HA 3I3BA 2KA3A 4UBGA 5FAXA 3SITA 4PT6A 3FLTA 5IK4A 5BNNB 4QHOA 3WP4A 3VBOC 4CDXC 3LA2A 1LR5A 1AYN3 2JDZA 2ZX4A 4LKDA 3GGLA 1V6JA 3I97A 2A6WA 1C1LA 1RHI1 2VZ1A 1ND3A 2Z69A 4Q4W1 3QLQA 1QQP1 1VBE1 4FPKA 4ISQA 4QX2A 1O5LA 3D5OA 4UFHA 1I1EA 3ABZA 3S5AA 4P9XA 2ZGMA 4XIOA 4AHXA 4IEZA 4GULA 4HVRA 2HEYF 4QPIC 5FZEA 1SDWA 4UFMA 2VBDA 2BBAA 5ACA1 2P3KA 2WFF2 2DCYA 4LHNA 2A3WA 2JIGA 4M4PA 4AI3A 1EV12 4I0WB 2RS11 3RI9A 3UJQA 2R041 4MGKE 5GKAC 3ZXKA 4DNYA 5APAA 4DPNA 2OZJA 4NHLA 1N1YA 2WA4A 2P6CA 1OPMA 2WIIB 4IE6A 4Q4V1 1NA1B 3CJXA 5FZHA 3FLPA 3OBAA 1CGPA 2DUPA 2RS31 1SCSA 2YMZA 3LEGA 3NRUA 3UNPA 4PLOA 3M8LA 2QQWA 2GC2A 5T55A 4QMAA 2D6KA 4FPLA 4UAPA 1AYM2 4RGGA 4JCKA 3MIHA 1MQTB 3NNFA 5FOJB 4XF9A 3JBG2 4K9SA 1LOFA 4NHKA 2BBVA 3N9MA 1RHI2 2EXIA 1W2UA 5HPOA 1STMA 4LBQB 4LKFA 3MBWA 3LOBA 1XNDA 3ILRA 1FV2A 5AFBA 2BTVC 4WVMA 1AR93 4YZ1A 1TME2 2EXKA 2NP0A 3ZXDA 3AVRA 4HLTA 1W8NA 1ASJ3 5CZKA 4RHV1 4Y1ZA 1GSLA 1O4ZA 2UYAA 5HCBA 5JMOA 4A42A 1W9YA 3QBQA 4FQZA 3LPFA 1F8VA 2MHFA 5JZGB 4EJRA 4QDQA 4Q2FA 5IJRA 2Q8OA 1AR83 1FAYA 1DF0A 3KS7A 4MYEA 5F2SA 3THTA 3VBHC 4WM7A 3WNXA 3BOPA 1FOD2 2HH9A 3BCWA 3ACFA 4P9IA 3KHCA 3PU3A 4XDPA 1NCRB 5DDJ1 5I0TA 1L3JA 2WINB 1G9FA 4WBBA 1AR81 4M3CF 1H9PA 5DAPA 5FK8A 3N4MA 1WW6A 1RVF3 2GH8A 3O12A 3WLUA 3NNMA 5JR2A 1LODA 1PZ8A 2WR9A 4QPGA 3WG4A 4JGYA 1CPNA 2W1QA 4D7YA 4WM8B 1VJ2A 2Y6KA 3NV2A 4XF4A 5FP9A 2OQ7A 2GDFA 3IDAA 3CZJA 1V00A 4ZU4A 5L7OB 3USSA 2X8KA 1YEWA 3MUY1 3QOPA 2R30A 3AKQA 4XXAA 5DG2A 3S6PA 1U12A 1ONAA 1D0HA 4XAEA 2DVGA 1JODA 1LGCA 3OBRA 3L9JT 1AL23 4TXWA 4JGZB 2V5YA 1WKYA 4ARYA 5F37A 5FREA 4F7ZA 4XFFA 1DFQA 4B4PA 2BEOA 2Y34A 5DAVA 5T52A 4COVA 2VBBA 2YFUA 4MX3A 5FPXA 3SISA 4LEJA 2Q1FA 3NJZA 4NN0A 1TE1B 3VGIA 4OI2A 1XE8A 3WDVA 5FZLA 1WW5A 3IDEA 1NCRC 1XYPA 2BZDA 3POWA 4I3PA 1CAWB 5FLHA 1QJX2 3NAPA 3AMNA 4N8MA 4WM8A 2QVSB 3V56A 2C24A 1C57A 4XIKA 4LBNA 1JUIA 1HRI3 5FK7A 4EQVA 3O1RA 2PHLA 2WSUA 4IEVA 3ZFGC 3B94A 5F39A 1RXGA 1UYPA 2A3YA 1EY2A 3WP3A 4JTNA 2NMOA 3OB8A 3D8CA 2A6ZA 1YCIA 4YFZA 2I2SA 3CDZB 3NJVA 2B46X 5C4WA 2Z4FA 1DYPA 1SACA 2ZA9A 4DUWA 5FYTA 3RVHA 2B39A 2I45A 1J1LA 4H7LA 3WSOA 4LA2A 5DQ0A 1LHUA 4XFCA 2C9AA 3EB7A 2BYVE 3U14A 3CNAA 1ULDA 1W04A 2DUOA 3OGJA 5KWRA 2VZSA 2VW0A 2ERFA 2ZX2A 4NOTA 2XR4A 4S2DA 3QCWA 4V2WA 4MH0E 1W6PB 2HWD3 1QOSA 3VD7A 2X5IA 4GB32 4CSWA 3M1HA 1UYYA 4S2HA 5LA1A 2WAOA 3EJKA 4LITA 3MICA 3LPGA 5FDBA 4YYOA 2F17A 4P02B 3UKNA 4CDUC 2ORXA 1G6NA 3KV4A 4LBLA 4C0BA 4WZCA 3U11A 2HJIA 1UZZA 2BQPA 5ISLA 4Q4Y1 2YU1A 1MQTA 3IN9A 1H9WA 3MIFA 3OGSA 5FY9A 3RJ2X 1VE0A 3V64A 4X8NA 4XJWA 1SBEA 2VQ0A 1PVC2 5BYNA 4K7JA 1LB2A 4J1WA 3T30A 1BVVA 5CKNA 4TTGA 3IDCB 3VBHB 1GOGA 3KGLA 1ZNPA 4H2AA 3SMHA 4AL9A 1NAEA 3LQCA 3WW1A 5KHJA 1SCRA 1QNWA 2Y8KA 3DUIA 4MLOA 2W1SA 1JS9A 4Y5SA 3N7MA 5EZWA 4ASLA 1GICA 1V6IA 2Q8EA 5F7UA 2PN5A 3K2OA 5C4WB 5LEKA 2HYXA 3W20A 2JIJA 4TZDA 2W0XA 3T08A 3VBFA 3Q8FA 4AGGA 1UIKA 2VMDA 4MGYE 1YQ8A 4RN5A 1B35C 3GBGA 4FFGA 5FYHA 5A3NA 1QXPA 4IQPA 3HNYM 4PQ9A 2B9UA 1VBC1 2XDVA 2IVJA 1NG0A 2A6VA 5T5JA 1QJU2 4HSJA 4CP0A 1F35A 1Q8SA 2DDUA 2IXKA 3DECA 4MGIE 1UKGA 4D7TA 1AR71 5DAWA 3VD3A 1RUI1 4YVWB 4AE2A 1DQ1A 1QU0A 1CJPA 1D4M2 2ZZQA 3UESA 4E8DA 3N9OA 2P4EA 2XGXA 1VMFA 2WWUA 4PF1A 1HB1A 2PAEA 5FXZA 2W94A 2VOVA 4MUVA 4IETA 2ZKLA 4F3JA 1UY4A 5BY5A 3ZYBA 3NVCA 3T0DA 3TNQA 5A6XA 1LAJA 2ZHMA 3AKPA 1AX1A 3KSCA 1UZVA 3H1YA 1XU2A 3MDPA 4XC9A 5FO7B 5FJKA 5BV6A 1BK1A 4QQHA 1UMHA 5KXCA 2RM23 1IG3A 1X9TA 3HAGA 4EN7B 1CZSA 3OUIA 3VHNA 1K5MC 4CDWC 4ZPIA 3VBUA 4XUQA 4HN0A 3W5MA 3T2PA 1W6QA 4E4DX 4NRQA 3WUCA 4JGYC 4W6WA 1LEMA 1HQWA 4PJYA 5A1LA 1HXS1 1RVF1 2VQAA 4URAA 4XFHA 1H8TA 2WNVC 2B9VA 4RR3A 5CVRA 4BM8A 5KXDA 4XCBA 4AEKA 3DYMA 4PBPA 5JOYA 3H8UA 3OEBA 4NWVA 1NZIA 3N9NA 1QF3A 4QKBA 1OH3A 2JG8C 2YDEA 4GWJA 4E9KA 3I59B 1E5IA 4LNVA 2CAUA 5C3RA 3H42B 3OOXA 4YG0A 2WZPP 1POQA 4CDWA 1DLCA 1SZBA 4HPKA 5LRRA 1JZ3A 2WN2A 1ENRA 1LGNA 3CU7A 5T5PA 3CJIC 2JG9B 1SLBA 2BWCA 1YQCA 3BN6A 1F5FA 4CP2A 3WHUA 3UGHA 2QBXA 3WF0A 4AI1A 2FDIA 4CUAA 3R4SA 1NE4A 5CFDC 5IVFA 2HBTA 2IXLA 4RFRB 3GZEA 2EXHA 1OQEA 1AL21 3MLJA 2J1RA 3E1F1 1UZWA 2WNOA 4MXWA 2XKOA 3KV9A 4MXVA 1RGSA 3AZXA 2G19A 3LIGA 1J58A 5FXWA 2AACA 5GLUA 3JZVA 1W03A 2W39A 3LDBA 5HBAA 3TEWA 3ROUA 1OPOA 4GQ7A 3HN1A 1OH4A 1W39A 4Q4X1 4E2QA 4H55A 2D97A 4Q0SA 5JIAA 4UF0B 3ZFFB 3OF1A 3H9AA 1EAH2 2CYFA 4PBOA 4XPVA 4GMP3 4IEXA 1MEC3 4JQRA 2WABA 5SV8A 2PA7A 1W99A 3AMPA 1Z0HA 2WLPA 2WYSA 4HOOA 3PVBB 1AHSA 1HXS3 4GMP1 3WR0A 2NM1A 2TEPA 1ZREA 3J26N 2WO7A 2G9FA 3M7AA 4AVCA 1JH5A 1AL0G 1OLMA 5KC5A 2A6YA 2P34A 1Q8OA 5ANQA 5A80A 1CPMA 5FPLA 3OUJA 1RC6A 3FZ3A 3OCPA 1TMF2 1LGBA 3V65A 4FOWA 5C7GA 4DXSA 4ZHNA 5A7NA 1AX0A 2RMU2 4GIQA 4QX3A 5BXXA 3I2OA 3X29B 3S57A 3JD71 1S55A 2WFPA 5A3WA 2ADDA 2OVUA 3RJRA 1UX6A 2P2KA 3H0OA 5EJZB 1YFXA 2CWMA 4C1XA 2R062 3OG2A 5FFOC 5J3UA 4P5YA 4W50A 1O3QA 1RTVA 2CNAA 3B02A 1GQHA 3VBRB 4UFKA 4CTEA 2XL7A 1SPPA 2YYOA 3AP4A 3NNJA 3OGRA 4LK7A 2VGDA 4Y26A 2IXHA 1YI9A 5G04L 3AKRA 1O4TA 4TLFA 5EJ1B 5F6KA 1LCLA 3O0WA 4QHBA 4F8AA 4BA6A 1LECA 3KVBA 1JTZX 4A7YA 4Q5OA 3I3MA 2VQUA 1K42A 4JKMA 1YLLA 1OD5A 4ZS2A 2YPJA 4L0PA 5A3UA 3BI3A 2O8QA 3PL0A 3I2IA 5FQ0B 3ZFGA 3FLRA 2JDUA 4XJ9A 3AVSA 2CHHA 2VXRA 1GQPA 4FBFA 2B8MA 1BBT2 2RDNA 4XF0A 5IWFA 4XHXA 5JI9A 2D44A 2WN3A 2ZBJA 1C28A 2Q8DA 3ZLIA 2WO3A 1NCQB 2XMLA 4QXKA 3NJYA 1GOFA 4K6BA 3HBKA 2EA7A 1R1A1 1C8M2 3UGFA 3JXSA 4B4RA 1UYXA 4Y1UA 1ZBE3 4N43A 1CAXA 1OLQA 4YM2A 2ZAAA 2YB7A 3Q9OA 2J1EA 5FKBA 2ET7A 5C6CA 1VBA1 1K3IA 1E5HA 1VALA 2VMFA 3SNMA 2E31A 1VBC3 3PTRB 3BGAA 4LT5A 4R52A 2DVDA 3LAGA 3VV1A 4D6RA 1ZBE1 4YG6A 2ID4A 2VOWA 1L7RA 1FXZA 2CGPA 1RUJ3 3IWZA 1P8JA 5EPAA 1VMHA 3GHMA 3CKHA 4CU7A 4H14A 1RUH2 4E2GA 3AJYA 1AXKA 2CL2A 2GAUA 1UU4A 3ZX7A 3CF6E 2ZEZA 4P00B 3M3OA 1Y9QA 3CLPA 5B4XA 1YIPA 2ZABA 2FDJA 4LPLA 5GLWA 2VECA 1DGLA 3KF3A 1W6PA 1BCXA 2VCBA 3OBZA 3MHZA 4LHSA 5DZFA 1W8HA 2HWE2 3A23A 4ATFA 3BPZA 4Q4W3 2G9ZA 2HWE3 4P9LA 4RS5B 1NCQA 5JXHA 1SFNA 2RVAA 2Z2SB 5E8AA 3ACLA 3AP7A 2W68A 2VM9A 2ZGPA 4NHYA 4RR3B 2LTNA 3CQOA 4BISA 1A8MA 1R081 1V6MA 1GNHA 3B9CA 3I2DA 1RIRA 3ORJA 3WNPA 2VOTA 4DRVA 2XJVA 2ZCWA 1Q8QA 3O0VA 3E6BA 1Z78A 2YC0A 4JHZA 4TSVA 5ERLA 5JIUA 3I2KA 4Q8KA 3H8XA 1NKGA 1RUJ2 5C5UA 4JKLA 3AC0A 3HIFA 3TB0A 4PLMA 4DOUA 2IFRA 1NX9A 1DYKA 1WMXA 1LESA 1WCKA 3N7KA 3OEAA 4IXLA 4BQ4A 1WLCA 1REEA 4W65A 4Z2WA 1RUNA 4RGKA 4CCNA 3RG0A 1H0BA 3OPTA 4XBNA 4XJ8A 4ZZ5A 4PI0A 4YZ2A 1JZ2A 2FDKA 1G9AA 5FYBA 1SQ4A 2HEWF 3K4ZA 1ZBE2 3R4DB 4QPYA 1RUG3 2VZVA 2XVLA 1EUTA 3LDRA 2EICA 2RS52 4AGRA 5C33A 3IM0A 1WCDJ 3WNMA 1V6KA 2LRPA 3IBMA 4O9EA 3SCHA 5FOBB 3O1VA 3Q8EA 5ANNA 5CG8A 4FPYA 5BNNA 1GFF2 2WLQA 4XFIA 4BLJA 2DUQA 3OBTA 4C1WA 2R0FA 2P5BA 2QDRA 4EN6B 2QDNA 5EHDA 4QDRA 3G7DA 4N53C 1UNBA 4BJ0A 2FBEA 3KLSA 3MIBA 2Z5WA 3M3IA 5F6LB 1GV9A 1PIV3 4XAAA 2N7GA 2CWSA 2VU9A 4AFBA 1ND2B 1J59A 2PYTA 1XB9A 2QUOA 2J22A 5LW9A 5CIRA 3BU0A 3D4KA 1BBT1 3FX3A 3IIAA 1GQGA 1H1AA 4QHZA 5I91A 2C1FA 2HWC2 1ND2C 1UW8A 2JDPA 5DAQA 1WCSA 2BOJA 4QPIA 2Q8CA 2DCTA 3T2TA 4B1MA 1X33A 4KH9A 4YZ3A 1PK6B 1T6BX 2AR6A 4PHZA 4XMIA 1NCRA 1ZZ7A 1ST8A 1IS4A 1OMIA 4B7EA 3FC0A 3TN92 3JCIA 2WZR1 2P3IA 2K2SA 1YQ6A 2YGLA 1MEC1 3KV5A 3WG2A 4A41A 5FR3A 5FMCA 1V6NA 5JCTA 2ZX0A 2BFUS 5LA2A 3CJIB 3ZSMA 3ITQA 1WLDA 3E5UA 1QNYA 5F8PA 3T2OA 3E6CC 4EWEA 1COV2 3F95A 4KWUA 1GNZA 4I02A 2GNBA 3HQXA 4CEYC 4KG0A 3HNBM 4MGQA 4JAAA 2XJUA 5E1RA 1COV3 3BIEA 2W2IA 4PDWA 2FCUA 5E16A 2UYBA 4NR1A 2FMYA 2OT7A 3LA7A 5K4LA 1FATA 1GWKA 2UY8A 1KS5A 3SEEA 2GC0A 1WMDA 5CAZA 3ZPOA 4NIGA 4AGVA 3RDIA 3ZXEA 3WDYA 3BB6A 4QB1A 1HXS2 3OTFA 4YVSB 2E7TA 4HK8A 2JB4A 5I0UA 5C9AB 2B45X 2BP6A 2ZTNA 4CUGA 3DEMA 3VHRA 1LNSA 3RZMA 1U5IA 5A1AA 2ZGTA 1QGLA 1OA3A 1OVSA 2OS2A 4XETA 1MR5A 1SLCA 2RDRA 2XL9A 2VNOA 4UW6A 2OYZA 2HWB3 5B2GB 1MS5A 4CDWB 1GZ9A 4AHYA 1AYM1 1CD3G 4BLIA 4QX7A 2E63A 4XQ4A 5FP7A 2HWC3 1YFWA 1CR7A 3TEZA 2PHFA 5BNOC 1VRH1 3J7HA 1UX7A 3POYA 4FFFA 1RUF1 3ZPYA 4JDOA 4A7KA 2SBAA 4BMEA 1RJ8A 5J09A 1G7YA 4DXRA 1DGRN 2WNVB 4R9CA 5DXDA 1PM4A 4CU9A 1ZVFA 2C0ZA 4H3WA 3WEZA 2K46A 3BVCA 4IW3A 2R0HA 2D6LX 4KWKA 3INAA 4CEWC 2RJ2A 2FZ2A 3A21A 4QPIB 2ARCA 4CEWB 4IEYA 4FQ4A 1MZ5A 5BNQA 1V6LA 1FPN1 3NJXA 2HEVF 3VKNA 1UY2A 2BGPA 2DU1A 4LBOA 1QWRA 2WT1A 1RUG2 2OKXA 5CEHA 4QGMA 4NUBA 2ZACA 1RUJ1 4AHZA 5CFCC 1DU3D 1S0JA 2BW8A 3GXUA 3VD4A 1RYYA 1UZ0A 3QACA 1JYVA 3JQXA 4GAZA 3U0ZA 1CIWA 5L19A 3DXUA 3GJAA 3BOWA 1F15A 1J83A 1VAVA 2K9ZA 4NRMA 4PI2A 3VDAA 5K8SA 4DO0A 2RG4A 1GU3A 2QZ2A 2D5HA 1YQ5A 1OF3A 3ZFFC 1HW5A 4ARXA 5T3NA 4LO5B 3GDBA 1OXCA 2GN3A 1VPHA 5CKMA 1XSRA 4U36A 2QNKA 1RUH1 3NSTA 1O3TA 5JOXA 4C91A 2JDAA 4N9IA 5DZGA 5LBCA 4XTPA 4L97A 4XXPA 5FZ1A 3FUOA 4QKFA 3SKJE 2QQPA 4UBHA 1GZWA 2R16A 1GYKA 4D69A 4BIOA 1SBDA 1YYNA 3AL6A 1DQ6A 3WCRA 2V5DA 3ES1A 1DQ4A 1DZRA 3POJA 4KU8A 4MHUA 5DN2A 4DEVA 4ZU5A 5FZ0A 4HBNA 3WW2A 1Q3EA 5D1IA 1WMFA 2WT2A 5LATA 1VBB1 2G4IA 4HZFA 5GZEA 2WA3A 4DRRA 2VZQA 1D2QA 4G4FA 5FKCA 4XJZA 1G9DA 2XJSA 4L99A 4Y5Z0 4RGAA 4M3CA 2YXSA 4AVAA 4A45A 4ONUA 1POV3 3ALQA 4B4QA 3LD8A 1JMUB 2ZXQA 1HJFA 3I54A 5BPXA 4NROA 3TAYA 1OLME 1S2KA 2UWAA 1JYCA 4GH4A 2D6NA 5H9QA 3TNPB 1G86A 2VMIA 1PX4A 4NPMA 1UXZA 1W2NA 3WINE 4K1YA 2E9QA 4LIUA 3NNLA 4KWJA 1NLSA 2ZPXA 5FZ7A 3ZYIB 1W6OB 3MW2A 1CX4A 5JXIA 1DP0A 1DZTA 5JSOA 4Q1PA 5A6YA 1BBT3 1Z7S2 2JG9A 1NY71 2AZ5A 1APNA 2WO2A 1TMF1 4O9GA 2OX0A 4W4ZA 4O61A 4AFMA 4I0AA 2DURA 5JPMB 3VZMA 4D3WA 3V0AB 1H2LA 2ZGOA 5FZAA 4COUA 5TSWA 1H4GA 3H3UA 5JDBA 1AR61 5FLJA 1W6MA 2ZAHA 4LULA 1N1VA 2ZHNA 4Y4RA 1PVC3 1W2AX 5IK7A 5FY1A 3BUCA 2QQMA 4QD2A 4YZ4A 3T0BA 4FOQA 1D7PM 4NJ4A 1O91A 2BVVA 4CP9A 4P5HA 3DXTA 3IDBB 1YI7A 1ZRIA 3WG3A 2X10A 1QKQA 4IEPA 1R083 2VW2A 4F83A 1W6QB 2IWGB 4YSFA 1H4HA 3ZFGB 1K5MA 1VBE3 5DDJ3 4AK3A 2LUWA 3LFIA 4TWTA 3AM2A 1X36A 3AZZA 1H2NA 3IZOA 2W47A 2WZR3 1QJY2 4XEZA 1LENA 4GB33 4Y24A 3K51A 3NAPB 1GBGA 1UU6A 2PQQA 2Y6LA 2D6PA 3OJBA 5BNOA 4BXFA 1RUE2 4L2NA 4BCUA 3ELNA 2A1XA 3ENRA 1ZA7A 3LB9A 4YM0A 4XVHA 2O1QA 3LSEA 1LOGA 1PVXA 3VDCA 4U2AA 4YW7A 1JOBA 2A73B 3T09A 1JYXA 2J42A 1ZA4A 3LE0A 2OZ6A 5F5QA 1FNZA 1GANA 2J7MA 1COV1 5FRAA 2BGOA 3HPNA 3WNKA 4KBBA 4LE3A 1VR3A 4JGZA 4FO9A 3A22A 2RS33 1S0BA 1X50A 2VCCA 3LEMA 3O14A 4IERA 4LXLA 4XQWA 4YVWA 4K8RB 1MEC2 3WNNA 2R072 5H9PA 1V6OA 4S2FA 1EAH3 4Z1VA 1JW6A 2MEV3 3AMMA 3GCXA 4QKNA 4LO6B 3AYCA 5GLZA 3VN4A 2BDRA 4BE3A 3MYXA 3ZXFA 4XABA 5C8WA 5K7PA 3I3DA 4AVBA 2NQYA 2CDOA 4COWA 5EYYA 2VMGA 1QJX3 4LLFA 5DPNA 2J1VA 4Q0QA 5FXXA 4UW3A 3VBSC 2ATFA 4HMZA 2HWC1 5FZIA 3BIWE 1XYOA 2A7AA 2OXBA 4HANA 2CGOA 2VD7A 3KVAA 4R4XA 1ASJ1 4ASMB 4FPHA 2KM2A 3U1XA 2W1WA 1DIWA 4AAXA 1X7NA 1QOTA 4I0BA 2VTXJ 3TEXA 1VP6A 4KU7A 4LBJA 2JENA 3D0SA 4ZY9A 3ZFEB 2EAAA 2WL1A 2BGCA 1QJY3 2WZR2 3WZ1A 1ZZ8A 2GMMA 3D0JA 3NV3A 4FPCA 1IS5A 4HN1A 1S2BA 1S1AA 1PZ7A 2AEYA 4IEUA 4AZZA 5L9VA 1WD3A 3FFZA 1I6XA 4C8DA 3VZNA 2VMEA 3M3QA 1YXWA 1OSGA 1VRBA 1W9SA 4LA3A 4NHMA 4W8JA 5FY7A 1TNRA 4JTOA 5J1XA 3WP6A 1RVF2 2GC3A 5DUVA 1EV11 3MZHA 4NAOA 4Y3OA 1J3PA 4M4RA 3AP6A 3FWEA 3SEPA 1MQTC 3APBA 1ENSA 2QJVA 1U5ZA 2ES3A 4HL0A 4HPKB 1AR82 1CAXB 3MF6A 4FPFA 3WW3A 4M3CB 1ZBA3 1PHMA 1WLTA 3CHXA 4URTA 3VD9A 1LEDA 2C9KA 1S0IA 4N7IA 4AQSA 2Y64A 2ZGSA 3ACHA 4FXKB 4Q27A 4XOGA 3SCGA 3O1TA 1Z7S3 3B93A 5FP3A 3W59A 1JYTA 1KEXA 2VVDA 1G8WA 2RJKA 2VXJA 1W2TA 2GP5A 3LCPA 4YGDA 1ASJ2 3KD4A 5D2AA 4FTBA 2B42B 1TME3 5F2WA 3MO4A 1XNKA 1AR92 4A3ZA 4CCMA 2ET1A 2HWE1 2VZPA 4ORFA 3ON7A 1I3HA 3AYDA 4WVVA 2GN7A 1CVNA 3T3YA 3PUAA 2GC1A 4Q8LA 3EYPA 4Y4YA 5A32A 3H7JA 1F31A 4OYUA 1UIJA 1D4M3 3MV11 5C3QA 3ZN4A 4FPOB 1H30A 1N1TA 1SLAA 2L9LA 5EV7A 1GMMA 4NMIA 4ET7A 1WLWA 1C3HA 5E89A 4EN0A 1ACCA 4EROA 3AJZA 3BTYA 1KFUL 3AYAA 1WGPA 3O1UA 3B9IA 4NIHA 2YBKA 1XJAA 5K0UA 4AAPA 3GNEA 4KQ7A 1XNBA 3GHNA 4Y33A 2DVFA 2JICA 5FO9B 1BVP1 1ODMA 2JDKA 2XWJB 3ZYHA 1POV1 3LWCA 1L7QA 5KHGA 2NN8A 3GZTB 3P5BA 3VHOA 3EO6A 4IL7A 5DUUA 1ODNA 4XBQA 4OZOA 3NV4A 1Q5OA 1Y7BA 4H7MA 1BZWA 5LK7B 3PURA 2F4PA 1LU1A 3UKTA 1DGWX 4FAHA 4IV1B 1ZBA2 5JXJA 4OHZA 3P3NA 2JJ6A 4LUKA 3ZSLA 5FV3A 2JE7A 4IV3A 3G6JB 4DB5A 5DUWA 2JEMA 1W8OA 2H6CA 2YUEA 3PUHA 5FY5A 1RUOA 4OFGA 2E26A 1CONA 1XNAA 4JRAA 4LO7A 3AFKA 2YFZA 1ZM1A 2P3YA 4AG4A 4EWDA 4QDSA 3D6EA 2ZX1A 2C4XA 4GJZA 3DKWA 1PGW1 2BFUL 4Y1XA 3N36A 5C8CA 4QQLA 2EIGA 1PGSA 1RUC1 2YHJA 4NPRA 3RZGA 2DVAA 2WNEA 4WM7B 4ZKTB 2VBPA 5EIYB 4OQ9A 1B09A 3C7FA 4ATEA 1AR62 3T4VA 3N7LA 3GBFA 3HQUA 4LJHA 2JDNA 2XUMA 3DF0A 4YGBA 4YARA 5HV4A 3ST7A 5CISA 3V0AA 3VBRC 1O3RA 3LOIA 5FCCA 4BPZA 4DQAA 2GP3A 3A0KA 4GXLA 4TN7A 3WOGA 1NQJA 1ULFA 2H0VA 3B3QE 1U0AA 4FCAA 3PJYA 3RMYA 2BNNA 2OW4A 4CEYB 1Y3TA 2X29A 4LUMA 5F32A 3UYJA 5JWPA 4PIXA 4QKDA 5HCFA 1ULGA 1LULA 5JSRA 4CEYA 1HDKA 3T1LA 4GH4B 4LBMA 1W6NB 2YBSA 2DYCA 4KGGA 2GMPA 4BQ3A 2MEV2 1A3KA 2OA2A 1GP4A 3K77A 4DY5A 3RFRA 2R073 2FCTA 3I59A 3ECQA 2Y6JA 4JZRA 5JVVA 1REFA 4K1ZA 3VDDC 1O8SA 5I8TA 1IQAA 2XQXA 3ZFEA 1CWPA 2IXCA 2RS32 4YGEA 2Y6HA 2MEV1 4BK5A 4NVPA 5CYYA 5IATA 2VAUA 5J37A 2VVEA 3MPBA 5DZEA 2FD8A 1GLHA 3IMNA 4CPBD 1W28A 5A1FA 1RUE1 4AFDA 3DCQA 3LKJA 3H3ZA 4WV8A 4WZFA 1QJY1 2XONA 4CUCA 4AI9A 1PGL2 2VTFA 4Q4Y2 1PK6A 1RUE3 3T0AA 2WFF1 1V70A 1X9PA 4CA9A 3WX5A 3VBSB 1W0NA 1ZZ6A 2RM21 1PMIA 4XDQA 3H8OA 2P1BA 3LF7A 5IK5A 1N3OA 1VLNA 4PCRA 2E53A 2YV8A 4LIVA 1K12A 1QXRA 5DDJ2 2HBUA 1BEV2 3MLKA 1VBE2 3WNLA 4CRQA 4E4ZA 2DTYA
chains in the Genus database with same CATH topology
2EICA 4MGSA 1JZ6A 3WNMA 2WAAA 2J1UA 3C7GA 4GWIA 4OMDA 3D3AA 2CDPA 3I3BA 1F4HA 1T2XA 4XUOA 4PT6A 3IIIA 4UOJA 4QDRA 1YQ2A 4BJ0A 4CUBA 1XPWA 4XUTA 3GGLA 3I97A 2J22A 2R7EB 2VZ1A 2V4VA 4QX2A 3ABZA 2YG0A 2BBAA 5G05L 4M4PA 1GUIA 3K46A 4A41A 3OBAA 4OMCA 4QPWA 5LA2A 3T2OA 3LEGA 3NRUA 4DUVA 3UNPA 1JI6A 4KWUA 1JZ4A 2WZ8A 3HNBM 4MGQA 4QAWA 4UAPA 2VQTA 3THDA 1EUUA 3SEEA 5DMYA 1JZ8A 4QB6A 1R64A 5HPOA 3HJRA 3OGVA 4QB1A 1JU3A 4DUXA 3MBWA 5HXMA 1LNSA 2W3JA 5A1AA 3WNNA 1CZTA 1W8NA 5CZKA 1F4AA 5JMOA 4A42A 2W92A 3LPFA 4JX0A 3HEIA 4ZZ8A 3J7HA 1UX7A 4QDQA 2ZEYA 3HOBA 5IJRA 3WF1A 4DXRA 3NNGA 1XNTA 4CU9A 3ACFA 5I0DA 3WEZA 3I2JA 3THCA 2RJ2A 3A21A 5JR2A 2X09A 2W1QA 3NJXA 2Y6KA 1UY2A 2BGPA 2OKXA 3WF4A 3IDAA 3CZJA 2W87A 3IAPA 3K4DA 3MUY1 1PX3A 2VZOA 2YC2A 3GXUA 3VD4A 1RYYA 1UZ0A 4LKSA 4TXWA 3W5NA 1WKYA 4ARYA 2YC4A 4OUEA 1NUKA 1JYVA 2C26A 1J83A 2YFUA 4PQQA 5FUIA 3T2QA 3VDAA 1GOHA 1GU3A 1OF3A 4ARXA 3C7EA 3GDBA 2WBKA 2BZDA 2WZEA 2JDAA 2J1AA 1BHGA 1W9TA 3SKJE 4P08A 2QQJA 3OB8A 5JXGA 5IHRA 3C8XA 3DYOA 3CDZB 3NJVA 3ZM8A 5LCWL 4XUNA 2W9XA 2Z4FA 3CIHA 3FHQA 2V5DA 4DUWA 3A7QA 5DN2A 4DEVA 3WSOA 5DQ0A 4A6OA 2VR4A 4QX1A 3EB7A 2J1TA 2VZQA 1H6YA 2EIBA 2VZSA 3VD7A 1MPXA 4DEQA 4A45A 1UMIA 2VZ3A 1HN1A 1UYYA 5LA1A 2ZXQA 2WAOA 2LW8A 3LPGA 1PX4A 1UXZA 5C71A 4P02B 2VMCA 2ORXA 5JXIA 1DP0A 2VL4A 3OGSA 4DXTA 2X05A 3I2GA 4D8MA 2WO2A 4W4ZA 1JZ7A 1JYWA 1CX1A 4TTGA 3K4AA 1GOGA 2E32A 1JHJA 1SDDB 1NAEA 2VC9A 3LQCA 2Y8KA 2QQMA 2W1SA 3T0BA 1D7PM 2Y6GA 5JUVA 5F7UA 1UWWA 1SG3A 2HYXA 3HN3A 2X10A 3T08A 2WUHA 1US2A 4MOAA 2B4KA 2EIDA 2VMDA 4RN5A 2PQSA 2W47A 4CU6A 2XHNA 3HNYM 1TVGA 4QX0A 2Y6LA 4XUPA 3VDBA 2DDUA 2DCKA 3DECA 3VD3A 3ETPA 4XVHA 1W9WA 3VDCA 2W1UA 2HLEA 3T09A 3UESA 1KGYA 4E8DA 3LE0A 2J7MA 2BGOA 3GM8A 3HPNA 4PF1A 3WNKA 2J1SA 4KI5M 2W94A 3FL7A 3A22A 1UY4A 2VCCA 4KMQA 3I2FA 1WCQA 3T0DA 1CIYA 2QQKA 2BERA 2XOMA 1US3A 3MUZ1 1UMHA 3K75B 3MV01 3I3DA 1CZSA 2CDOA 5DPNA 2J1VA 4XUQA 2QQOA 3W5MA 3T2PA 2LS6A 1JZ5A 3FN9A 3WF3A 1JU4A 2V72A 3CZUA 4IUGA 4A4AA 2B9VA 1XC6A 2W1WA 1O59A 4AAXA 2WO1A 4MO3M 2W91A 3DYMA 3SKVA 2JKXA 3OEBA 4BDVB 2KD7A 2JE8A 4ZY9A 4BK4A 2VJXA 4GWJA 2W46A 3DYPA 4GZ9A 4YPJA 1DLCA 1JZ3A 1SHWB 2WN2A 2VMEA 1W9SA 4W8JA 1UY0A 1J84A 3BN6A 1DYOA 5J1XA 2DCJA 2E33A 2QBXA 3WF0A 1OD3A 4CUAA 1ULOA 4M4RA 2J1RA 3E1F1 3SEPA 5B4NA 5C70A 3PUIA 3FHAA 3VD9A 4XURA 2C9KA 2Y64A 3ACHA 1PMJX 1OH4A 1KEXA 2VZRA 3I3EA 2QQNA 3MO4A 2WABA 4A3ZA 1W99A 2VZPA 1OF4A 2QQIA 2WYSA 3P1IA 1UY3A 3EYPA 4OYUA 2ZEWA 3MV11 2W95A 1UY1A 2L9LA 4ET7A 1GMMA 4JKKA 5C7GA 1ULPA 4DXSA 2WDBA 4QX3A 1OT5A 3U37A 5EJZB 3LEIA 1L7QA 3OG2A 4P5YA 4W50A 3LEKA 5IYYA 4OZOA 1UYZA 3OGRA 3HNMA 5JXJA 5G04L 5EJ1B 3ACGA 3ACIA 1K42A 1W8OA 2VQUA 3PUHA 5IFTA 4JKMA 1CZVA 4HG6B 3IB3A 2E26A 1XNAA 4L0PA 2YFZA 3I2IA 4AG4A 4Z2AA 4QDSA 2C4XA 2QQLA 1GQPA 2VZVA 1PMHX 3F2ZA 4A44A 4CU8A 5EIYB 2WN3A 3C7FA 2WO3A 4MADA 4D0QA 1GNYA 1GOFA 2ZEXA 4QB2A 3JXSA 1UYXA 2WQ8A 3WNOA 4RYDA 2YB7A 2J1EA 2EIEA 1K3IA 2VMFA 2E31A 3NQHA 3BGAA 2ID4A 1L7RA 1P8JA 3WQBA 3CKHA 4CU7A 5LA0A 4XZUG 4ZXEA 2ZEZA 4P00B 5B4XA 1H6XA 1UXXX 4LPLA 4BXSV 1I5PA 2ORZA 2VCBA 4LHSA 4LQRA 3K77A 3A23A 3C7HA 4E8CA 3ECQA 2Y6JA 3C7OA 1K45A 1O8SA 2XQXA 3CMGA 2Y6HA 4BK5A 1JYXA 5JXHA 5CYYA 2RVAA 1O8PA 2VM9A 5IFPA 4CVUA 3CQOA 3WF2A 2W5FA 2VO5A 3WNPA 2VOTA 2VZTA 4JHZA 2XONA 4CUCA 3I2KA 2VTFA 3T0AA 1NKGA 3I2HA 4JKLA 2JD9A 3AC0A 1W0NA 1NX9A 2VCAA 3UETA 3OEAA 4FI9A 1IQDC 2RV9A 4ZZ5A 1JYNA 4UI9L 1JZ2A 1K12A 3VD5A 1TG7A 3WNLA 3K4ZA 2VZUA 3P6BA 3IAQA 1EUTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIC A;  4MGS A;  1JZ6 A;  3WNM A;  2WAA A;  2J1U A;  3C7G A;  4GWI A;  4OMD A;  3D3A A;  2CDP A;  3I3B A;  1F4H A;  1T2X A;  4XUO A;  4PT6 A;  3III A;  4UOJ A;  4QDR A;  1YQ2 A;  4BJ0 A;  4CUB A;  1XPW A;  4XUT A;  3GGL A;  3I97 A;  2J22 A;  2R7E B;  2VZ1 A;  2V4V A;  4QX2 A;  3ABZ A;  2YG0 A;  2BBA A;  5G05 L;  4M4P A;  1GUI A;  3K46 A;  4A41 A;  3OBA A;  4OMC A;  4QPW A;  5LA2 A;  3T2O A;  3LEG A;  3NRU A;  4DUV A;  3UNP A;  1JI6 A;  4KWU A;  1JZ4 A;  2WZ8 A;  3HNB M;  4MGQ A;  4QAW A;  4UAP A;  2VQT A;  3THD A;  1EUU A;  3SEE A;  5DMY A;  1JZ8 A;  4QB6 A;  1R64 A;  5HPO A;  3HJR A;  3OGV A;  4QB1 A;  1JU3 A;  4DUX A;  3MBW A;  5HXM A;  1LNS A;  2W3J A;  5A1A A;  3WNN A;  1CZT A;  1W8N A;  5CZK A;  1F4A A;  5JMO A;  4A42 A;  2W92 A;  3LPF A;  4JX0 A;  3HEI A;  4ZZ8 A;  3J7H A;  1UX7 A;  4QDQ A;  2ZEY A;  3HOB A;  5IJR A;  3WF1 A;  4DXR A;  3NNG A;  1XNT A;  4CU9 A;  3ACF A;  5I0D A;  3WEZ A;  3I2J A;  3THC A;  2RJ2 A;  3A21 A;  5JR2 A;  2X09 A;  2W1Q A;  3NJX A;  2Y6K A;  1UY2 A;  2BGP A;  2OKX A;  3WF4 A;  3IDA A;  3CZJ A;  2W87 A;  3IAP A;  3K4D A;  3MUY 1;  1PX3 A;  2VZO A;  2YC2 A;  3GXU A;  3VD4 A;  1RYY A;  1UZ0 A;  4LKS A;  4TXW A;  3W5N A;  1WKY A;  4ARY A;  2YC4 A;  4OUE A;  1NUK A;  1JYV A;  2C26 A;  1J83 A;  2YFU A;  4PQQ A;  5FUI A;  3T2Q A;  3VDA A;  1GOH A;  1GU3 A;  1OF3 A;  4ARX A;  3C7E A;  3GDB A;  2WBK A;  2BZD A;  2WZE A;  2JDA A;  2J1A A;  1BHG A;  1W9T A;  3SKJ E;  4P08 A;  2QQJ A;  3OB8 A;  5JXG A;  5IHR A;  3C8X A;  3DYO A;  3CDZ B;  3NJV A;  3ZM8 A;  5LCW L;  4XUN A;  2W9X A;  2Z4F A;  3CIH A;  3FHQ A;  2V5D A;  4DUW A;  3A7Q A;  5DN2 A;  4DEV A;  3WSO A;  5DQ0 A;  4A6O A;  2VR4 A;  4QX1 A;  3EB7 A;  2J1T A;  2VZQ A;  1H6Y A;  2EIB A;  2VZS A;  3VD7 A;  1MPX A;  4DEQ A;  4A45 A;  1UMI A;  2VZ3 A;  1HN1 A;  1UYY A;  5LA1 A;  2ZXQ A;  2WAO A;  2LW8 A;  3LPG A;  1PX4 A;  1UXZ A;  5C71 A;  4P02 B;  2VMC A;  2ORX A;  5JXI A;  1DP0 A;  2VL4 A;  3OGS A;  4DXT A;  2X05 A;  3I2G A;  4D8M A;  2WO2 A;  4W4Z A;  1JZ7 A;  1JYW A;  1CX1 A;  4TTG A;  3K4A A;  1GOG A;  2E32 A;  1JHJ A;  1SDD B;  1NAE A;  2VC9 A;  3LQC A;  2Y8K A;  2QQM A;  2W1S A;  3T0B A;  1D7P M;  2Y6G A;  5JUV A;  5F7U A;  1UWW A;  1SG3 A;  2HYX A;  3HN3 A;  2X10 A;  3T08 A;  2WUH A;  1US2 A;  4MOA A;  2B4K A;  2EID A;  2VMD A;  4RN5 A;  2PQS A;  2W47 A;  4CU6 A;  2XHN A;  3HNY M;  1TVG A;  4QX0 A;  2Y6L A;  4XUP A;  3VDB A;  2DDU A;  2DCK A;  3DEC A;  3VD3 A;  3ETP A;  4XVH A;  1W9W A;  3VDC A;  2W1U A;  2HLE A;  3T09 A;  3UES A;  1KGY A;  4E8D A;  3LE0 A;  2J7M A;  2BGO A;  3GM8 A;  3HPN A;  4PF1 A;  3WNK A;  2J1S A;  4KI5 M;  2W94 A;  3FL7 A;  3A22 A;  1UY4 A;  2VCC A;  4KMQ A;  3I2F A;  1WCQ A;  3T0D A;  1CIY A;  2QQK A;  2BER A;  2XOM A;  1US3 A;  3MUZ 1;  1UMH A;  3K75 B;  3MV0 1;  3I3D A;  1CZS A;  2CDO A;  5DPN A;  2J1V A;  4XUQ A;  2QQO A;  3W5M A;  3T2P A;  2LS6 A;  1JZ5 A;  3FN9 A;  3WF3 A;  1JU4 A;  2V72 A;  3CZU A;  4IUG A;  4A4A A;  2B9V A;  1XC6 A;  2W1W A;  1O59 A;  4AAX A;  2WO1 A;  4MO3 M;  2W91 A;  3DYM A;  3SKV A;  2JKX A;  3OEB A;  4BDV B;  2KD7 A;  2JE8 A;  4ZY9 A;  4BK4 A;  2VJX A;  4GWJ A;  2W46 A;  3DYP A;  4GZ9 A;  4YPJ A;  1DLC A;  1JZ3 A;  1SHW B;  2WN2 A;  2VME A;  1W9S A;  4W8J A;  1UY0 A;  1J84 A;  3BN6 A;  1DYO A;  5J1X A;  2DCJ A;  2E33 A;  2QBX A;  3WF0 A;  1OD3 A;  4CUA A;  1ULO A;  4M4R A;  2J1R A;  3E1F 1;  3SEP A;  5B4N A;  5C70 A;  3PUI A;  3FHA A;  3VD9 A;  4XUR A;  2C9K A;  2Y64 A;  3ACH A;  1PMJ X;  1OH4 A;  1KEX A;  2VZR A;  3I3E A;  2QQN A;  3MO4 A;  2WAB A;  4A3Z A;  1W99 A;  2VZP A;  1OF4 A;  2QQI A;  2WYS A;  3P1I A;  1UY3 A;  3EYP A;  4OYU A;  2ZEW A;  3MV1 1;  2W95 A;  1UY1 A;  2L9L A;  4ET7 A;  1GMM A;  4JKK A;  5C7G A;  1ULP A;  4DXS A;  2WDB A;  4QX3 A;  1OT5 A;  3U37 A;  5EJZ B;  3LEI A;  1L7Q A;  3OG2 A;  4P5Y A;  4W50 A;  3LEK A;  5IYY A;  4OZO A;  1UYZ A;  3OGR A;  3HNM A;  5JXJ A;  5G04 L;  5EJ1 B;  3ACG A;  3ACI A;  1K42 A;  1W8O A;  2VQU A;  3PUH A;  5IFT A;  4JKM A;  1CZV A;  4HG6 B;  3IB3 A;  2E26 A;  1XNA A;  4L0P A;  2YFZ A;  3I2I A;  4AG4 A;  4Z2A A;  4QDS A;  2C4X A;  2QQL A;  1GQP A;  2VZV A;  1PMH X;  3F2Z A;  4A44 A;  4CU8 A;  5EIY B;  2WN3 A;  3C7F A;  2WO3 A;  4MAD A;  4D0Q A;  1GNY A;  1GOF A;  2ZEX A;  4QB2 A;  3JXS A;  1UYX A;  2WQ8 A;  3WNO A;  4RYD A;  2YB7 A;  2J1E A;  2EIE A;  1K3I A;  2VMF A;  2E31 A;  3NQH A;  3BGA A;  2ID4 A;  1L7R A;  1P8J A;  3WQB A;  3CKH A;  4CU7 A;  5LA0 A;  4XZU G;  4ZXE A;  2ZEZ A;  4P00 B;  5B4X A;  1H6X A;  1UXX X;  4LPL A;  4BXS V;  1I5P A;  2ORZ A;  2VCB A;  4LHS A;  4LQR A;  3K77 A;  3A23 A;  3C7H A;  4E8C A;  3ECQ A;  2Y6J A;  3C7O A;  1K45 A;  1O8S A;  2XQX A;  3CMG A;  2Y6H A;  4BK5 A;  1JYX A;  5JXH A;  5CYY A;  2RVA A;  1O8P A;  2VM9 A;  5IFP A;  4CVU A;  3CQO A;  3WF2 A;  2W5F A;  2VO5 A;  3WNP A;  2VOT A;  2VZT A;  4JHZ A;  2XON A;  4CUC A;  3I2K A;  2VTF A;  3T0A A;  1NKG A;  3I2H A;  4JKL A;  2JD9 A;  3AC0 A;  1W0N A;  1NX9 A;  2VCA A;  3UET A;  3OEA A;  4FI9 A;  1IQD C;  2RV9 A;  4ZZ5 A;  1JYN A;  4UI9 L;  1JZ2 A;  1K12 A;  3VD5 A;  1TG7 A;  3WNL A;  3K4Z A;  2VZU A;  3P6B A;  3IAQ A;  1EUT A; 
#chains in the Genus database with same CATH topology
 4MGS A;  3RWK X;  2PLV 1;  1XBF A;  1R08 2;  1Y43 B;  4MVT A;  3GBW A;  1JZ6 A;  1HRV 2;  2ARE A;  1PNG A;  5AC9 1;  3FMG A;  5CFC A;  3TN9 3;  3GZU C;  3RSJ A;  1POV 0;  2BU9 A;  1LKN A;  1UN1 A;  4J1X A;  1RL3 A;  4GWI A;  3VBR A;  4OZX A;  3HR9 A;  5J48 A;  1XSQ A;  3LGR A;  1S4C A;  1MS0 A;  3VZO A;  1A8D A;  5A3P A;  1T2X A;  2IC1 A;  4EN8 B;  4FVV A;  3TN9 1;  3Q8C A;  5EFU A;  1YQ2 A;  4LTA A;  1S0G A;  2D5F A;  2WQ4 A;  1X82 A;  2CGN A;  5JOW A;  4XUT A;  2R32 A;  5T5O A;  4AOC A;  1QIQ A;  5F3E A;  1BEV 1;  4RQP A;  5BNO B;  2TNF A;  2R7E B;  2CSG A;  1H1M A;  1GZC A;  1ENQ A;  1A6C A;  1PIV 2;  1TME 1;  3QD6 A;  4QPG B;  4I2O A;  1G9B A;  3VBS A;  3JBG 1;  2ZHK A;  1DQ5 A;  5G05 L;  5FZO A;  3R4U A;  4YGC A;  4CDQ B;  3ILN A;  2FMD A;  4QPG C;  3K48 A;  5A7W B;  3LFM A;  4AR2 A;  2RDS A;  1GP5 A;  1SLT A;  1GUI A;  4C0H A;  4CP9 B;  1K5J A;  5BNP A;  1ENX A;  3K46 A;  1HX6 A;  2FDH A;  2FHR A;  3WW4 A;  2RS5 3;  1VRH 2;  2R1B A;  1RHI 3;  4AED A;  4OMC A;  4SLI A;  4WVW A;  2W52 A;  2D43 A;  3GZA A;  1F5J A;  3VBH A;  1U5X A;  2ZOE B;  4DUV A;  3AP5 A;  4CYD A;  1JUH A;  1JI6 A;  3BKZ A;  1JZ4 A;  2WZ8 A;  3LZZ A;  5HXV A;  1LOE A;  1D4M 1;  2WS9 3;  3EXU A;  3J4U H;  1SFY A;  4LKE A;  4QAW A;  1BK0 A;  3THD A;  3WP5 A;  1EUU A;  4MXW B;  2Z79 A;  3KT1 A;  4LHL A;  4EWA A;  4QQP A;  2XJQ A;  4Q0U A;  5DMY A;  4X6R B;  4OUL A;  1IPK A;  1JZ8 A;  4FPJ A;  2WS9 1;  3U07 A;  5C9A A;  4NIA A;  3VKL A;  3VL9 A;  3HJR A;  4YVS A;  1DQ2 A;  2K0G A;  3OGV A;  3S5Q A;  1O3S A;  1JU3 A;  2EF6 A;  1LHO A;  3UGG A;  5IT6 A;  1XOY A;  2JB8 A;  4Q4W 2;  1EV1 3;  5HV0 A;  1FI2 A;  1SMV A;  4B7K A;  3DKQ A;  2ZGN A;  2FZ1 A;  1LJ7 A;  1CZT A;  2V09 A;  1YUD A;  4KG8 A;  1JXN A;  2Q1Z B;  2WRA A;  4AQ2 A;  2W08 A;  4YW1 A;  4A3X A;  1MZF A;  1KXG A;  3HEI A;  2F6B A;  3QH7 A;  4ZZ8 A;  1NOV A;  2A3X A;  4GA9 A;  4AED B;  1KD7 A;  3V0B A;  3HOB A;  3KCC A;  1QJZ A;  4W6Y A;  4CCE A;  4COZ A;  3WF1 A;  1DGR A;  4Q0V A;  2HWD 1;  3NNG A;  3ZKU A;  4L92 A;  1VBC 2;  4IND A;  1QY4 A;  4AI8 A;  4BU2 A;  1WD4 A;  4GKX A;  2X53 S;  3VBF C;  1F9K A;  4BZ4 A;  4BHP A;  5AVP A;  1RMU 1;  1JN2 P;  1QDO A;  1LOB A;  2QQV A;  3E6D A;  3RPQ A;  4DS0 A;  1KJL A;  2QFE A;  4IV3 B;  3N9Q A;  1C1F A;  3RS6 A;  2VUL A;  1AZD A;  4XAC A;  4CDU B;  3WG1 A;  1W2O A;  4OCT A;  4E4H A;  2ZGQ A;  5FZC A;  3SHR A;  4QWN A;  4DXZ A;  3K4D A;  1PX3 A;  1NE6 A;  1UMZ A;  2YC2 A;  4LK6 A;  2R04 3;  5A3O A;  4QGL A;  3ZYF A;  5J36 A;  4IE5 A;  1HRI 1;  5GLT A;  4LKS A;  3W5N A;  2A70 A;  1ZRC A;  3NMB A;  3RZJ A;  1OUX A;  3H1W A;  5CBL A;  1PNF A;  2WJS A;  2C26 A;  5FZM A;  3OYW B;  3O1S A;  4DMI A;  3BAL A;  3B01 A;  2BNO A;  5A7P A;  4K20 A;  2HWF 3;  2OUJ A;  4AI2 A;  1NZC A;  1R1A 3;  1Q43 A;  5GZF A;  1VBA 2;  2FCV A;  4FP2 A;  4E4S A;  3DGT A;  4UWD A;  1RJ7 A;  4S2G A;  1UOJ A;  4RFT 0;  1AR7 3;  5F9T A;  1C5I A;  2HWB 2;  1RUI 3;  3KM5 A;  4XQD A;  3S7E A;  3WDW A;  4FSJ A;  2H6B A;  3VZJ A;  4MGZ E;  5FZG A;  1OVP A;  2WZE A;  5FJH A;  3RWN A;  1U5Y A;  1M4W A;  4YRD A;  1YWK A;  2PMW B;  3RMX A;  3WDX A;  3GF6 A;  4CEW A;  2J1A A;  1OOP C;  5KXB A;  1BHG A;  1WW4 A;  4I3G A;  1W9T A;  5A32 B;  5C8C C;  2VNV A;  2IFW A;  2AH2 A;  4P08 A;  4O65 A;  2QQJ A;  1VAM A;  5K9Y A;  5JXG A;  2PXJ A;  3IPV A;  3MPP G;  4R9D A;  2BNM A;  2GZW A;  3DYO A;  5IHR A;  5FYI A;  3N35 A;  1DDL A;  3ZM8 A;  3AK0 A;  2RMU 3;  2W9X A;  3CIH A;  1H8T C;  2WNV A;  2XJR A;  3FHQ A;  3H3L A;  3M70 A;  4AEJ A;  3A7Q A;  3PMS A;  5J96 B;  1FT9 A;  4BQW A;  1HJG A;  3ZFF A;  5M0T A;  4RS5 A;  4A6O A;  3U10 A;  2VR4 A;  4QX1 A;  5T5L A;  3VBU C;  1RUC 2;  2J1T A;  4KL1 A;  5FP4 A;  5IVE A;  3PU8 A;  1H6Y A;  2EIB A;  2VNG A;  4MG2 A;  4BWO A;  1UCX A;  5D8A B;  1UMI A;  4HKO A;  4FTS A;  2Q0A A;  1FNY A;  2VZ3 A;  1J1T A;  1IKP A;  4WVM B;  4UYB A;  1LHW A;  3ZYP A;  3OD0 A;  2B7Y A;  5L7O C;  1KDM A;  5CG9 A;  2VMC A;  3I8T A;  2UU8 A;  4XHB A;  4FTE A;  5KHK A;  1Y9G A;  1UL9 A;  5IW0 A;  2VL4 A;  4KBZ A;  1JOJ A;  4RS5 C;  3BTX A;  1QEX A;  4P9J A;  2RR1 3;  3RQ0 A;  3VBO B;  4CDX B;  4DXT A;  2Z42 A;  1OHF A;  1EPZ A;  1R09 2;  3I2G A;  4D8M A;  4XTM A;  4Y1V A;  1JYW A;  2I74 A;  3FUQ A;  2WNU A;  2D40 A;  3A4U A;  1CX1 A;  2RR1 1;  4UFL A;  2E32 A;  3JD7 3;  5C3P A;  1LOC A;  1JHJ A;  2TBV A;  1SDD B;  3B00 A;  1D2S A;  1ZZC A;  4HXC A;  4XW3 A;  4D7S A;  2SLI A;  4WM7 C;  4R8H A;  3PIJ A;  4UW5 A;  3OPZ A;  3M3C A;  4B3N A;  2Y6G A;  1N1S A;  4JQT A;  1GKB A;  3O0X A;  5JUV A;  2C5D A;  1UWW A;  4RHV 2;  3WHT A;  4CPB A;  5FZ3 A;  3HN3 A;  4M3C E;  5A7W A;  2D3P A;  4LOR A;  5I93 A;  1IGO A;  2WUH A;  1US2 A;  2XHK A;  4PIY A;  4DY3 A;  1L7L A;  4NHX A;  1PM7 A;  4ASK A;  1VAK A;  3E97 A;  1M06 G;  3AL5 A;  4CU6 A;  5CFD B;  1AR9 1;  2O0O A;  1RIN A;  3AKT A;  1TVG A;  4QX0 A;  5GZG A;  3VDB A;  2YGM A;  2DCK A;  4IV1 A;  4ZXK A;  1FX5 A;  1W8T A;  3ETP A;  1W9W A;  5I8Y A;  3O5S A;  4HVO A;  3WCS A;  4CCK A;  2IZW A;  3UKV A;  1FMD 1;  1KGY A;  4MSV A;  4Q29 A;  5FXV A;  3WD5 A;  1O4Y A;  3L2H A;  3GM8 A;  2XJT A;  4COY A;  2J1S A;  3RYK A;  4V2V A;  5LRS A;  5IAV A;  4Y22 B;  4KMQ A;  5C3O A;  4NID A;  2R49 A;  2RM2 2;  4B29 A;  4Q4V 2;  1WCQ A;  3HBZ A;  2P3J A;  1UOG A;  4J6G A;  1CIY A;  5A70 A;  2E7A A;  2Y33 A;  5FZB A;  2BER A;  4LO4 B;  4TLG A;  4D6S A;  3FHI B;  2XBO 1;  4LOS A;  2BUK A;  2PAM A;  4LLO A;  3K75 B;  3MV0 1;  4JGY B;  4B1L A;  5LY2 A;  5IAX A;  4LE4 A;  4LHK A;  3VZL A;  3DL3 A;  1RUH 3;  3WXP A;  4BOW A;  2QQO A;  1K5M B;  5KXE A;  5FYY A;  1GP6 A;  3CO2 A;  1UQX A;  2LS6 A;  3NW4 A;  3FN9 A;  1JZ5 A;  1JU4 A;  1NLQ A;  4AWD A;  1RMU 3;  3HWJ A;  3OD4 A;  1C8M 1;  4A4A A;  4EZH A;  1XC6 A;  1QOO A;  1W8Z A;  1QJF A;  3VDD A;  1O59 A;  2DFC A;  4MO3 M;  4P9Y A;  1WCU A;  1HKD A;  2XH6 A;  3GJB A;  3SKV A;  1LOA A;  3WQ1 A;  5ABJ A;  3WDU A;  2JKX A;  1C8M 3;  4BDV B;  1PO1 1;  4BK4 A;  1UPI A;  1KQR A;  2WNU B;  1RUF 3;  2DCZ A;  5FZ9 A;  3DYP A;  2WYF A;  3DPR C;  2I07 B;  4ISR A;  4YPJ A;  2LM3 A;  4M00 A;  2Y0I A;  4AVT A;  5JR7 B;  2GND A;  4EZ4 A;  3KCY A;  3THP A;  3MI8 A;  4FXG B;  1XNC A;  2HWF 1;  3AFG A;  1DLL A;  4JHT A;  1YRZ A;  4A6S A;  2DCJ A;  3SH4 A;  3OY8 B;  2B5H A;  5KHH A;  1W3V A;  4CCL A;  2PFW A;  5JI7 A;  1ULO A;  3VLB B;  2CV6 A;  2TUN A;  5FZ6 A;  4QQ2 A;  3WDT A;  5LAS A;  3ZYJ B;  5FPV A;  3H8R A;  1D4V B;  2EAK A;  1HN0 A;  3BTA A;  5B4N A;  5C70 A;  3PUI A;  1LHN A;  2OII A;  3MFA A;  5FIX A;  3ZVX A;  4XJA A;  5LBB A;  3D82 A;  2IXJ A;  2UWC A;  1GWL A;  2QZ3 A;  4GJY A;  2VUA A;  2VMH A;  2VUJ A;  5KHI A;  1HB4 A;  4EN9 B;  3ZOI A;  1A34 A;  1XQN A;  5ABJ B;  5FO8 B;  4JDM A;  2R06 3;  1NCQ C;  2XVG A;  4RSU A;  5EP9 A;  1KRI A;  3WT3 A;  2P17 A;  2QQN A;  3VDD B;  5CA6 A;  1DCS A;  1H8T B;  2ARB A;  1OF4 A;  1X8M A;  4ITC A;  3P1I A;  2PEL A;  1OUS A;  2KXL A;  1TMF 3;  1UY3 A;  2VCM A;  1BJQ A;  3NL1 A;  4QQO A;  1O5U A;  4XFB A;  3B5L B;  4FOY A;  2Y60 A;  2DBI A;  3S30 A;  1MS4 A;  2P6H A;  2H0B A;  1FV3 A;  2XB6 C;  2ZEW A;  2VVF A;  2W95 A;  3MLL A;  3IKW A;  4DIN B;  1BLZ A;  3LDK A;  1CAW A;  3PDQ A;  4HKW A;  1Q56 A;  1AUY A;  4ES9 A;  5JMC A;  2Y0O A;  3NKG A;  2XLA A;  1H2M A;  1QQP 3;  1JHN A;  5FY4 A;  5A3M A;  5FY8 A;  5GZC A;  5JPN B;  5KBF A;  2QCS B;  1OT5 A;  3BOD A;  4Q0P A;  4Y22 A;  3MIE A;  3U37 A;  2AGS A;  4E2S A;  4EV0 A;  1W0O A;  1S0F A;  4Y5T A;  1DBN A;  5FY0 A;  4XMA A;  5SV5 A;  2IXI A;  1PO2 3;  5DAB A;  3FJS A;  3DN7 A;  5DAX A;  5IYY A;  1UD1 A;  1UYZ A;  1BMV 1;  5CFC B;  4I09 A;  4LMF A;  2CAV A;  2ZJC A;  4AVS A;  5L7O A;  1MZ6 A;  4QX5 A;  3UT0 A;  3QH6 A;  1FPN 2;  2ZGR A;  4MET A;  5FMO L;  5FUP A;  3ACG A;  2GU9 A;  5KC6 A;  3USU B;  3DPR A;  4QXB A;  1YO8 A;  2JWP A;  3ACI A;  3KWV A;  4QXC A;  1F2N A;  4PLN A;  2WWS A;  5IFT A;  2Y6F A;  4HG6 B;  5EWS A;  5K0U C;  3H7Y A;  1OC1 A;  5C5T A;  3SH3 A;  1OOP A;  5FPZ A;  4Z2A A;  5HI0 A;  1E57 A;  1NXD 1;  3ZSK A;  4D94 A;  5GAL A;  2GH2 A;  3GCW A;  1Y9M A;  2R06 1;  4AEM A;  4M0N A;  3IT8 A;  3POS A;  1S0D A;  4BQ5 A;  5A6Q A;  3BYW A;  5FYV A;  3U4X A;  1H2K A;  2RMU 1;  3KCX A;  1W6M B;  4MAD A;  3AXE A;  5JZG A;  1AXZ A;  1IKQ A;  5F3G A;  5GZD A;  5FPB A;  5BNN C;  1IS6 A;  2ZEX A;  1W8W A;  1PVC 1;  3UJO A;  4CP1 A;  4Q1R A;  4YW5 A;  1VB4 A;  4CE8 A;  4CCO A;  3AMQ A;  4HKL A;  4JRL A;  3WNO A;  2WSV A;  3S0M A;  2NZ9 A;  3WV6 A;  4RA0 A;  4NII A;  1VBD 3;  2EAL A;  5FTT C;  1R1Z A;  1V9U 3;  3J7M A;  3ZN6 B;  4BMB A;  5FPU A;  4YW6 A;  5EQU A;  1LOF C;  3VKM A;  3Q8B A;  3WQB A;  4JV4 A;  3J8F 3;  4K21 A;  4NO4 A;  3ZSJ A;  5LA0 A;  3OGG A;  1YIF A;  3HT2 A;  4ES8 A;  4PDW B;  2VH9 A;  4IE4 A;  4BXS V;  1XXN A;  2ORZ A;  1TNF A;  3ETQ A;  4IGO A;  5CB7 A;  4LQR A;  5CAD A;  3C7H A;  4E8C A;  3C7O A;  1K45 A;  1KIT A;  3ZXA C;  1A78 A;  5A3T A;  1HRV 1;  3MIG A;  1WA6 X;  5FYZ A;  2PLV 2;  4XFA A;  1AJK A;  4Y20 B;  1XE0 A;  1JBC A;  5JZG C;  3HT1 A;  1ZZ9 A;  5IFP A;  3JUU A;  4N90 A;  2W5F A;  3POI A;  1IPS A;  2VO5 A;  3JBG 3;  5DUX A;  2OPK A;  3N3H A;  2VZT A;  3IPV B;  4W6X A;  4YM1 A;  4Q26 A;  1I5Z A;  4FOV A;  2ADE A;  2XUE A;  1OA2 A;  1AYM 3;  4R9A A;  3ZMO A;  3JQW A;  3ASI A;  3ZDV A;  5FQ0 A;  3I2H A;  1QJU 3;  4MV2 A;  2FQP A;  4HET A;  4I01 A;  1YNA A;  3UET A;  1OA4 A;  2LAL A;  2ZML A;  3POB A;  1IQD C;  2RV9 A;  4FI9 A;  3K3N A;  3WQ7 A;  4AYU A;  5IVV A;  5HCH A;  3USU A;  2JG8 B;  3U4S A;  1TG7 A;  1ZX5 A;  4YVS C;  5BNP C;  3AP9 A;  4WM8 C;  2VZU A;  3IAQ A;  3W9A A;  2QQU A;  4MZU A;  1W8F A;  1MS9 A;  4G3Y C;  2WAA A;  1SPP B;  2LRO A;  5FYC A;  3HQR A;  4N53 B;  1SLI A;  4OMD A;  1G9C A;  2WFF 3;  3KV6 A;  3KQR A;  4YW4 A;  5AFE A;  3RRD A;  2A5Z A;  1Q8V A;  4XUO A;  2JKB A;  3III A;  4UOJ A;  3AX4 A;  3MID A;  4X8P A;  5JLV A;  4XF3 A;  4IE7 A;  4CUB A;  1C4R A;  1XPW A;  4I30 A;  4XBL A;  4YVW C;  4CCC A;  1MS8 A;  5IVJ A;  4N9H A;  2VTX A;  3KMH A;  4XJU A;  2AEZ A;  1V0A A;  4QGN A;  2Y26 A;  4L9B A;  1EPW A;  2YZ4 A;  1AYN 2;  3J7N A;  2XKP A;  4BYY A;  3UK9 A;  4BQY A;  2YG0 A;  4GWN A;  4QXH A;  4PDW C;  1FPN 3;  3KQ4 B;  3TOJ A;  1B35 B;  5JAX A;  3FE5 A;  3VBF B;  4AHW A;  1DZQ A;  4JDN A;  5IK8 A;  3NKT A;  1O6U A;  4L11 A;  1BQP A;  2A75 A;  1MVQ A;  1PO2 2;  2Q4S A;  4N43 C;  4BIF A;  3POF A;  4HVQ A;  2BPA 2;  1J3Q A;  3LIH A;  5ABJ C;  2HWD 2;  4Y20 A;  4QPW A;  2VY0 A;  5FMD A;  2BVB A;  3SLI A;  5LBF A;  1TEI A;  3UV9 A;  1XE7 A;  3VB9 A;  1QQP 2;  2PHX A;  1WUV A;  1OKQ A;  1UKR A;  2XXZ A;  4OVE A;  3RZZ A;  2JX9 A;  5BUV A;  3KHB A;  4DIQ A;  4BB3 A;  1LHV A;  1NYW A;  2VOK A;  2VQT A;  4OHW A;  4Z07 A;  2VOX A;  3DV8 A;  1UU5 A;  2UWB A;  1PO2 1;  2HYK A;  3SXW A;  4C90 A;  5A6Z A;  4GH4 C;  4RQP C;  3B69 A;  5JOZ A;  4QB6 A;  1R64 A;  2E51 A;  1AYN 1;  2XLG A;  4OHX A;  4DUX A;  4MGT A;  2CY6 A;  1HRI 2;  4D6Q A;  3AB0 A;  5HXM A;  4OUM A;  4OLL A;  2CU5 A;  2JG9 C;  2W3J A;  2X5I C;  4Y1Y A;  1QJE A;  5CNA A;  2YPD A;  2X5I B;  3EQE A;  1VB2 A;  5F3I A;  2JDY A;  4CXW A;  5F3C A;  1ZYB A;  3BPS A;  2GME A;  3T1M A;  1DGW A;  1WZX A;  2YRO A;  1F4A A;  3RI8 A;  3TEY A;  2BV4 A;  2ENR A;  3MW4 A;  2W92 A;  3NO8 A;  4JX0 A;  4MHR A;  4AF9 A;  3KGZ A;  4XE9 A;  2ZEY A;  4EYU A;  3O1P A;  3POE A;  2VUD A;  2FDF A;  3H50 A;  1AF9 A;  3PJQ A;  2O14 A;  1VMJ A;  1AL2 2;  1XNT A;  3I7D A;  5LZ6 A;  2ZMK A;  5I0D A;  4X6Q B;  1MAC A;  5F1R A;  4UT5 A;  4CDQ A;  3TWI A;  1PK6 C;  3ZSE A;  1CJD A;  1HV1 A;  3I2J A;  1EAH 1;  4FPE A;  3THC A;  3VL8 A;  1MS1 A;  2PHR A;  3PTY A;  1CN1 A;  4NE9 A;  2FDG A;  5LB6 A;  1KS4 A;  5I0S A;  3MGU A;  4GKY A;  5C9A C;  2X09 A;  3DPR B;  3UL2 A;  1C8N A;  2YBP A;  5AVA A;  1IZ3 A;  5T54 A;  3WF4 A;  4M0H A;  2W87 A;  5CKQ A;  1IS3 A;  3IAP A;  2XJP A;  3AZW A;  4IV1 C;  1AVB A;  2VZO A;  4FFH A;  1FOD 3;  1KFX L;  1BMV 2;  2Q1M A;  3RZK A;  2YC4 A;  4OUE A;  1NUK A;  2DV9 A;  2G1M A;  2XWB B;  3OYW A;  4BQ2 A;  1UF2 C;  2E7Q A;  2WQZ C;  3CBN A;  5JSP A;  1W8U A;  5L73 A;  3PVE A;  1YFY A;  1AX2 A;  4PQQ A;  5FUI A;  3T2Q A;  1LU2 A;  4O7X A;  1GOH A;  3TRS B;  4AXO A;  3O1O A;  1MZE A;  4JGZ C;  2D93 A;  5K0U B;  5FZ4 A;  1TQ5 A;  4AVV A;  2VNR A;  4UFI A;  5LEJ A;  3C7E A;  1CAU A;  3CL1 A;  3J8F 1;  5F5I A;  2WBK A;  2V4A A;  2PLV 3;  2VPV A;  5C4W C;  2JG8 A;  4OUS A;  1GZT A;  4OI1 A;  1OKO A;  2OQ6 A;  1FYU A;  5CFD A;  4YLZ A;  1EP0 A;  1WA4 A;  4LR4 A;  2R6Q A;  2RE9 A;  3C2U A;  3C8X A;  1NQD A;  3KF5 A;  2D3S A;  3SH5 A;  3NAP C;  4XUN A;  5LCW L;  3PVN A;  2D7F A;  4TYS A;  3J8F 2;  4FAG A;  1CAV A;  5T50 A;  2OPW A;  1ULE A;  1S0C A;  1BKZ A;  4AFC A;  5FYU A;  3ZYR A;  4BH9 A;  1V9U 2;  2ZZJ A;  1E5S A;  3JB4 C;  1EYB A;  1VBD 2;  4L8Q A;  3SQO A;  5EJ3 A;  4IES A;  4P9W A;  4NPL A;  3RYP A;  4ZU7 A;  1H1I A;  2WNU C;  1MPX A;  1WBL A;  4R4Z A;  5FZD A;  4DEQ A;  5H9S A;  2XVK A;  1W05 A;  4YM3 A;  1QDC A;  1W6N A;  2G9G A;  1HN1 A;  5I8S A;  2LW8 A;  3FFQ A;  5HCA A;  4FP3 A;  2EVX A;  4Q4X 3;  4B8E A;  4G9S B;  3ZIW A;  3AZV A;  5L9R A;  2RS5 1;  5C71 A;  2C6S A;  3OY8 A;  3OPW A;  1DQ0 A;  1O7F A;  2ZHL A;  3S7I A;  1GR3 A;  1AXY A;  2F4L A;  3M4F A;  3PIG A;  4AQT A;  1WBF A;  3PHM A;  5FLI A;  5AC9 2;  2D98 A;  2X05 A;  5D8A A;  5FUN A;  3M3E A;  1W3X A;  4CCJ A;  5IVC A;  1C5H A;  1J3R A;  5FYS A;  5FZK A;  1JZ7 A;  4P14 A;  4QT6 A;  3JD7 2;  5FMB A;  3K4A A;  1PGW 2;  4GMP 0;  3U75 A;  3L2Y A;  2AC1 A;  1RXF A;  3ZFE C;  2VC9 A;  3VUO A;  3R6S A;  3TBD A;  1YFU A;  1R09 3;  3ZXL A;  4R9B A;  2RR1 2;  5BNP B;  2PHT A;  2WWJ A;  2YU2 A;  1I9R A;  3RYR A;  1SG3 A;  3J7L A;  3POG A;  2Q30 A;  3WUD A;  3E5Q A;  5C8C B;  1R09 1;  2ZMN A;  1ZBA 1;  4UXA A;  1RUD 2;  2RHP A;  4MOA A;  5J7M A;  1OOP B;  2B4K A;  2EID A;  1RIT A;  2DVB A;  4NAM A;  3R05 A;  4OHY A;  3I4I A;  1QXJ A;  4PIZ A;  5IVY A;  2PQS A;  1JYI A;  5FP8 A;  3CEW A;  2XHN A;  1N3P A;  1RUD 1;  2DWR A;  4YW2 A;  1ND3 B;  2A71 A;  2XBO 2;  4OI4 A;  4XUP A;  4FFI A;  1HLC A;  4YNI A;  4DFS A;  5FZ8 A;  1HQN A;  2WT0 A;  4HON A;  4YG3 A;  1ULC A;  2W1U A;  4CCD A;  1RUC 3;  5FWJ A;  2HLE A;  2PHW A;  2GSY A;  4GWM A;  3KZ4 C;  2RS1 2;  1VBB 3;  2DTW A;  4KI5 M;  1BYH A;  4XDO A;  3FL7 A;  3SCF A;  5ACA 2;  3ILF A;  1PO1 3;  1FMD 2;  2AUY A;  2JEC A;  3I2F A;  3LSD A;  5F5A A;  4YZ5 A;  4CZS A;  1XRU A;  4HK9 A;  3NWK A;  3PME A;  2QQK A;  4ZS3 A;  4AFA A;  3MFC A;  2VG9 A;  1US3 A;  2XOM A;  3MUZ 1;  5A33 B;  1QHD A;  3JB8 A;  2UUR A;  4RR3 C;  1FMD 3;  1NT0 A;  1PO1 2;  2Q5T A;  1Q8P A;  1OFS A;  5ACA 3;  2MPF A;  1RUI 2;  1AR7 2;  1XU1 A;  1QH7 A;  2RDQ A;  3ZYG A;  5L36 A;  3WF3 A;  1NXM A;  1VBA 3;  3ZN5 A;  2V72 A;  3CZU A;  4PF5 A;  3WQ0 A;  4IUG A;  4QM9 A;  5DG1 A;  2HWF 2;  4IEQ A;  4KGQ A;  5FWE A;  5LA9 A;  4HFS A;  5L9B A;  1ZRF A;  2JXA A;  2WO1 A;  4AED C;  1W90 A;  3GAL A;  1PZ9 A;  2W91 A;  2ZX3 A;  4Z92 B;  3V0B B;  2A6X A;  1WW7 A;  2KD7 A;  2JE8 A;  1UOF A;  1JOP A;  1ZZB A;  5D8A C;  3OUH A;  2VJX A;  2W46 A;  5GJ6 A;  4GZ9 A;  4IV3 C;  5A3L A;  5IUQ A;  1N47 A;  1IOA A;  1SHW B;  1N3Q A;  1RUF 2;  2PTM A;  1QH6 A;  3Q8A A;  4XF1 A;  5EYX A;  1UY0 A;  1J84 A;  1DYO A;  1GWM A;  4JC1 A;  1YHF A;  4LO8 A;  4AQ6 A;  4OQ8 A;  1W6O A;  3NV1 A;  4LBQ A;  3VZK A;  2E33 A;  2XG3 A;  1MS3 A;  4M01 A;  1OD3 A;  3ZO0 B;  3HD8 B;  2ARA A;  2ETE A;  3LA3 A;  2RJL A;  3BU7 A;  4A2U A;  4BQ1 A;  1FOD 1;  5EXO A;  1RMU 2;  1E5R A;  3B7M A;  3WVJ A;  3R0R A;  1W9F A;  3FHA A;  4NRP A;  4XUR A;  3U78 A;  5FBJ A;  5AC9 3;  5FPA A;  2JD4 A;  1PMJ X;  3RGB A;  4DZG A;  4K8F A;  3KT7 A;  3C3V A;  1OLR A;  3SC7 X;  1KJR A;  2VZR A;  1YJK A;  4FT8 A;  3I3E A;  4QM8 A;  3N7J A;  1NA1 C;  2GNT A;  1RUG 1;  3VKO A;  1S0E A;  2D3R A;  2QE3 A;  3EHK A;  4OHV A;  3WY6 A;  2ZKN A;  1KDK A;  4Q4V 3;  5A7Q A;  3PUQ A;  1CQ9 A;  2HKX A;  4Q4X 2;  4ZON A;  2VUC A;  2BOI A;  4IE0 A;  3ZDS A;  4CDQ C;  5C3S A;  5I0R A;  2QQI A;  4GD4 A;  2JDM A;  5FZO B;  1XYN A;  1YJL A;  2ZGU A;  3VKF C;  4CXX A;  4RD7 A;  4XYX A;  1B35 A;  3VHP A;  4KWL A;  1S2E A;  2AYH A;  4N7U A;  1OFN A;  2DFB A;  2NPI A;  1HQL A;  3EBR A;  1BXH A;  1HV0 A;  2AEN A;  3N9P A;  3PLQ A;  4P9G A;  3N9L A;  1QJX 1;  4J25 A;  5CU1 A;  3GYD A;  1OBN A;  1UY1 A;  1W0P A;  3ES4 A;  2DF7 A;  2CTV A;  4XIL A;  2WS9 2;  4JKK A;  4KNC A;  3AYE A;  1QMJ A;  4RQP B;  3TYJ A;  2QKD A;  1CAU B;  4Z82 A;  1ND2 A;  3BTZ A;  1ULP A;  3ZR6 A;  4IGQ A;  5A7O A;  3RZH A;  1X8E A;  2WDB A;  4LOT A;  3RNS A;  2R07 1;  5E6H A;  5E88 A;  2GAL A;  2GNM A;  4QU2 A;  2WC2 A;  1H8V A;  1VRH 3;  2EXJ A;  3LEI A;  2R1D A;  1UOB A;  3A0N A;  3AXD A;  3LEK A;  3T4H B;  4N53 A;  1OI6 A;  4RHV 3;  5FZF A;  4Z8B A;  2P37 A;  4IDZ A;  3KT4 A;  3ATG A;  4IEW A;  2DU0 A;  3HNM A;  4OI0 A;  4QX8 A;  2V73 A;  2JDH A;  1SLL A;  4NWW A;  4A7Z A;  4CDU A;  1T6G C;  1OQD A;  5F5C A;  1HB3 A;  1SEF A;  2ARX A;  1V9U 1;  3FBY A;  1MVE A;  3ZXG A;  3ZIX A;  3RZL A;  4GB3 1;  1CZV A;  1Y4W A;  3IB3 A;  4XCA A;  1WME A;  4AW7 A;  3IMM A;  3J9S A;  1RED A;  2OUH A;  2NMN A;  3M2M A;  1IHM A;  4CXY A;  2QQL A;  5J98 B;  1PMH X;  4YWA A;  1ZRR A;  3F2Z A;  4A44 A;  2DBN A;  3PNA A;  4CU8 A;  2BJS A;  4BQX A;  4YFW A;  1LRH A;  4UW4 A;  3HMY A;  3HVD A;  2ZGK A;  2JE9 A;  3OSD A;  1DHK B;  1NY7 2;  3ZMN A;  3I3Q A;  2Y38 A;  4UF0 A;  2D6M A;  1GNY A;  3K3O A;  1OQ1 A;  4UFJ A;  3AKS A;  4D0Q A;  4FPG A;  4LBQ D;  4IEO A;  1ND3 C;  1HRV 3;  5LK5 A;  1UAI A;  3O1M A;  4QB2 A;  1NLR A;  2PHD A;  3MF9 A;  2IVI B;  2WQ8 A;  1W06 A;  2WKK A;  1BEV 3;  4RYD A;  1ALY A;  5LBE A;  4RL7 A;  3ME2 A;  3VBO A;  2EIE A;  4CDX A;  1UPS A;  3NQH A;  3ZXJ A;  3E5X A;  2XPJ A;  5KR7 A;  1Z7S 1;  2NYY A;  3FBM A;  5LY1 A;  1ZRD A;  5H9R A;  4Q4Y 3;  2ILM A;  2ZS6 B;  1QJU 1;  3PUS A;  4XZU G;  1URX A;  4YW3 A;  4ZXE A;  2HWB 1;  4AI0 A;  3ZN6 A;  2XQR A;  2UY9 A;  1H6X A;  5FMO S;  1UXX X;  1I5P A;  1PGL 1;  3ZR5 A;  3EMR A;  4N43 B;  1VBD 1;  2VW1 A;  3H1M A;  2MNG A;  4WVZ A;  2O8O A;  5D21 A;  3AMH A;  4K40 A;  4IGP A;  4QU1 A;  3CMG A;  1AJO A;  2VE1 A;  3CJI A;  2NLR A;  1UZY A;  5GM0 A;  1LTE A;  1NA1 A;  4HSL A;  1O8P A;  5IVB A;  2QTW B;  3P3P A;  1VBB 2;  1CAV B;  2RS1 3;  4K3U A;  3I49 A;  4CVU A;  1SFP A;  3WF2 A;  1TZO A;  1DG6 A;  1HIX A;  5LWB A;  5FYM A;  4E27 A;  1R1A 2;  2PAK A;  1GZW B;  1OUR A;  4JVA A;  1WWY A;  2PHU A;  3JU9 A;  2XBO 3;  2ZGL A;  5GLV A;  2JD9 A;  3VBU B;  5FBZ A;  2VCA A;  1UO9 A;  4V1P A;  3MEP A;  3ZKY A;  4HT1 T;  1SBF A;  2R04 2;  1RB8 G;  3KB5 A;  3O7O A;  3PVO A;  5A33 A;  1JYN A;  4UI9 L;  3URF A;  3VD5 A;  1PIV 1;  2E6V A;  3W21 A;  4EE2 A;  1IG0 A;  3MW3 A;  2KR2 A;  2V4V A;  3P6B A;  4XFG A;  4XZP A;  1RUD 3;  2D6O X;  4LBK A;  1VIW B;  4SBV A;  4GAL A;  3W58 A;  1IPJ A;  3AZY A;  1HB2 A;  2BWA A;  1CES A;  2BRT A;  2J1U A;  2IUW A;  3C7G A;  1D0G A;  5A7S A;  3D3A A;  2CDP A;  1YC6 1;  2YY1 A;  2XLF A;  1AR6 3;  1F4H A;  3I3B A;  2KA3 A;  4UBG A;  5FAX A;  3SIT A;  4PT6 A;  3FLT A;  5IK4 A;  5BNN B;  4QHO A;  3WP4 A;  3VBO C;  4CDX C;  3LA2 A;  1LR5 A;  1AYN 3;  2JDZ A;  2ZX4 A;  4LKD A;  3GGL A;  1V6J A;  3I97 A;  2A6W A;  1C1L A;  1RHI 1;  2VZ1 A;  1ND3 A;  2Z69 A;  4Q4W 1;  3QLQ A;  1QQP 1;  1VBE 1;  4FPK A;  4ISQ A;  4QX2 A;  1O5L A;  3D5O A;  4UFH A;  1I1E A;  3ABZ A;  3S5A A;  4P9X A;  2ZGM A;  4XIO A;  4AHX A;  4IEZ A;  4GUL A;  4HVR A;  2HEY F;  4QPI C;  5FZE A;  1SDW A;  4UFM A;  2VBD A;  2BBA A;  5ACA 1;  2P3K A;  2WFF 2;  2DCY A;  4LHN A;  2A3W A;  2JIG A;  4M4P A;  4AI3 A;  1EV1 2;  4I0W B;  2RS1 1;  3RI9 A;  3UJQ A;  2R04 1;  4MGK E;  5GKA C;  3ZXK A;  4DNY A;  5APA A;  4DPN A;  2OZJ A;  4NHL A;  1N1Y A;  2WA4 A;  2P6C A;  1OPM A;  2WII B;  4IE6 A;  4Q4V 1;  1NA1 B;  3CJX A;  5FZH A;  3FLP A;  3OBA A;  1CGP A;  2DUP A;  2RS3 1;  1SCS A;  2YMZ A;  3LEG A;  3NRU A;  3UNP A;  4PLO A;  3M8L A;  2QQW A;  2GC2 A;  5T55 A;  4QMA A;  2D6K A;  4FPL A;  4UAP A;  1AYM 2;  4RGG A;  4JCK A;  3MIH A;  1MQT B;  3NNF A;  5FOJ B;  4XF9 A;  3JBG 2;  4K9S A;  1LOF A;  4NHK A;  2BBV A;  3N9M A;  1RHI 2;  2EXI A;  1W2U A;  5HPO A;  1STM A;  4LBQ B;  4LKF A;  3MBW A;  3LOB A;  1XND A;  3ILR A;  1FV2 A;  5AFB A;  2BTV C;  4WVM A;  1AR9 3;  4YZ1 A;  1TME 2;  2EXK A;  2NP0 A;  3ZXD A;  3AVR A;  4HLT A;  1W8N A;  1ASJ 3;  5CZK A;  4RHV 1;  4Y1Z A;  1GSL A;  1O4Z A;  2UYA A;  5HCB A;  5JMO A;  4A42 A;  1W9Y A;  3QBQ A;  4FQZ A;  3LPF A;  1F8V A;  2MHF A;  5JZG B;  4EJR A;  4QDQ A;  4Q2F A;  5IJR A;  2Q8O A;  1AR8 3;  1FAY A;  1DF0 A;  3KS7 A;  4MYE A;  5F2S A;  3THT A;  3VBH C;  4WM7 A;  3WNX A;  3BOP A;  1FOD 2;  2HH9 A;  3BCW A;  3ACF A;  4P9I A;  3KHC A;  3PU3 A;  4XDP A;  1NCR B;  5DDJ 1;  5I0T A;  1L3J A;  2WIN B;  1G9F A;  4WBB A;  1AR8 1;  4M3C F;  1H9P A;  5DAP A;  5FK8 A;  3N4M A;  1WW6 A;  1RVF 3;  2GH8 A;  3O12 A;  3WLU A;  3NNM A;  5JR2 A;  1LOD A;  1PZ8 A;  2WR9 A;  4QPG A;  3WG4 A;  4JGY A;  1CPN A;  2W1Q A;  4D7Y A;  4WM8 B;  1VJ2 A;  2Y6K A;  3NV2 A;  4XF4 A;  5FP9 A;  2OQ7 A;  2GDF A;  3IDA A;  3CZJ A;  1V00 A;  4ZU4 A;  5L7O B;  3USS A;  2X8K A;  1YEW A;  3MUY 1;  3QOP A;  2R30 A;  3AKQ A;  4XXA A;  5DG2 A;  3S6P A;  1U12 A;  1ONA A;  1D0H A;  4XAE A;  2DVG A;  1JOD A;  1LGC A;  3OBR A;  3L9J T;  1AL2 3;  4TXW A;  4JGZ B;  2V5Y A;  1WKY A;  4ARY A;  5F37 A;  5FRE A;  4F7Z A;  4XFF A;  1DFQ A;  4B4P A;  2BEO A;  2Y34 A;  5DAV A;  5T52 A;  4COV A;  2VBB A;  2YFU A;  4MX3 A;  5FPX A;  3SIS A;  4LEJ A;  2Q1F A;  3NJZ A;  4NN0 A;  1TE1 B;  3VGI A;  4OI2 A;  1XE8 A;  3WDV A;  5FZL A;  1WW5 A;  3IDE A;  1NCR C;  1XYP A;  2BZD A;  3POW A;  4I3P A;  1CAW B;  5FLH A;  1QJX 2;  3NAP A;  3AMN A;  4N8M A;  4WM8 A;  2QVS B;  3V56 A;  2C24 A;  1C57 A;  4XIK A;  4LBN A;  1JUI A;  1HRI 3;  5FK7 A;  4EQV A;  3O1R A;  2PHL A;  2WSU A;  4IEV A;  3ZFG C;  3B94 A;  5F39 A;  1RXG A;  1UYP A;  2A3Y A;  1EY2 A;  3WP3 A;  4JTN A;  2NMO A;  3OB8 A;  3D8C A;  2A6Z A;  1YCI A;  4YFZ A;  2I2S A;  3CDZ B;  3NJV A;  2B46 X;  5C4W A;  2Z4F A;  1DYP A;  1SAC A;  2ZA9 A;  4DUW A;  5FYT A;  3RVH A;  2B39 A;  2I45 A;  1J1L A;  4H7L A;  3WSO A;  4LA2 A;  5DQ0 A;  1LHU A;  4XFC A;  2C9A A;  3EB7 A;  2BYV E;  3U14 A;  3CNA A;  1ULD A;  1W04 A;  2DUO A;  3OGJ A;  5KWR A;  2VZS A;  2VW0 A;  2ERF A;  2ZX2 A;  4NOT A;  2XR4 A;  4S2D A;  3QCW A;  4V2W A;  4MH0 E;  1W6P B;  2HWD 3;  1QOS A;  3VD7 A;  2X5I A;  4GB3 2;  4CSW A;  3M1H A;  1UYY A;  4S2H A;  5LA1 A;  2WAO A;  3EJK A;  4LIT A;  3MIC A;  3LPG A;  5FDB A;  4YYO A;  2F17 A;  4P02 B;  3UKN A;  4CDU C;  2ORX A;  1G6N A;  3KV4 A;  4LBL A;  4C0B A;  4WZC A;  3U11 A;  2HJI A;  1UZZ A;  2BQP A;  5ISL A;  4Q4Y 1;  2YU1 A;  1MQT A;  3IN9 A;  1H9W A;  3MIF A;  3OGS A;  5FY9 A;  3RJ2 X;  1VE0 A;  3V64 A;  4X8N A;  4XJW A;  1SBE A;  2VQ0 A;  1PVC 2;  5BYN A;  4K7J A;  1LB2 A;  4J1W A;  3T30 A;  1BVV A;  5CKN A;  4TTG A;  3IDC B;  3VBH B;  1GOG A;  3KGL A;  1ZNP A;  4H2A A;  3SMH A;  4AL9 A;  1NAE A;  3LQC A;  3WW1 A;  5KHJ A;  1SCR A;  1QNW A;  2Y8K A;  3DUI A;  4MLO A;  2W1S A;  1JS9 A;  4Y5S A;  3N7M A;  5EZW A;  4ASL A;  1GIC A;  1V6I A;  2Q8E A;  5F7U A;  2PN5 A;  3K2O A;  5C4W B;  5LEK A;  2HYX A;  3W20 A;  2JIJ A;  4TZD A;  2W0X A;  3T08 A;  3VBF A;  3Q8F A;  4AGG A;  1UIK A;  2VMD A;  4MGY E;  1YQ8 A;  4RN5 A;  1B35 C;  3GBG A;  4FFG A;  5FYH A;  5A3N A;  1QXP A;  4IQP A;  3HNY M;  4PQ9 A;  2B9U A;  1VBC 1;  2XDV A;  2IVJ A;  1NG0 A;  2A6V A;  5T5J A;  1QJU 2;  4HSJ A;  4CP0 A;  1F35 A;  1Q8S A;  2DDU A;  2IXK A;  3DEC A;  4MGI E;  1UKG A;  4D7T A;  1AR7 1;  5DAW A;  3VD3 A;  1RUI 1;  4YVW B;  4AE2 A;  1DQ1 A;  1QU0 A;  1CJP A;  1D4M 2;  2ZZQ A;  3UES A;  4E8D A;  3N9O A;  2P4E A;  2XGX A;  1VMF A;  2WWU A;  4PF1 A;  1HB1 A;  2PAE A;  5FXZ A;  2W94 A;  2VOV A;  4MUV A;  4IET A;  2ZKL A;  4F3J A;  1UY4 A;  5BY5 A;  3ZYB A;  3NVC A;  3T0D A;  3TNQ A;  5A6X A;  1LAJ A;  2ZHM A;  3AKP A;  1AX1 A;  3KSC A;  1UZV A;  3H1Y A;  1XU2 A;  3MDP A;  4XC9 A;  5FO7 B;  5FJK A;  5BV6 A;  1BK1 A;  4QQH A;  1UMH A;  5KXC A;  2RM2 3;  1IG3 A;  1X9T A;  3HAG A;  4EN7 B;  1CZS A;  3OUI A;  3VHN A;  1K5M C;  4CDW C;  4ZPI A;  3VBU A;  4XUQ A;  4HN0 A;  3W5M A;  3T2P A;  1W6Q A;  4E4D X;  4NRQ A;  3WUC A;  4JGY C;  4W6W A;  1LEM A;  1HQW A;  4PJY A;  5A1L A;  1HXS 1;  1RVF 1;  2VQA A;  4URA A;  4XFH A;  1H8T A;  2WNV C;  2B9V A;  4RR3 A;  5CVR A;  4BM8 A;  5KXD A;  4XCB A;  4AEK A;  3DYM A;  4PBP A;  5JOY A;  3H8U A;  3OEB A;  4NWV A;  1NZI A;  3N9N A;  1QF3 A;  4QKB A;  1OH3 A;  2JG8 C;  2YDE A;  4GWJ A;  4E9K A;  3I59 B;  1E5I A;  4LNV A;  2CAU A;  5C3R A;  3H42 B;  3OOX A;  4YG0 A;  2WZP P;  1POQ A;  4CDW A;  1DLC A;  1SZB A;  4HPK A;  5LRR A;  1JZ3 A;  2WN2 A;  1ENR A;  1LGN A;  3CU7 A;  5T5P A;  3CJI C;  2JG9 B;  1SLB A;  2BWC A;  1YQC A;  3BN6 A;  1F5F A;  4CP2 A;  3WHU A;  3UGH A;  2QBX A;  3WF0 A;  4AI1 A;  2FDI A;  4CUA A;  3R4S A;  1NE4 A;  5CFD C;  5IVF A;  2HBT A;  2IXL A;  4RFR B;  3GZE A;  2EXH A;  1OQE A;  1AL2 1;  3MLJ A;  2J1R A;  3E1F 1;  1UZW A;  2WNO A;  4MXW A;  2XKO A;  3KV9 A;  4MXV A;  1RGS A;  3AZX A;  2G19 A;  3LIG A;  1J58 A;  5FXW A;  2AAC A;  5GLU A;  3JZV A;  1W03 A;  2W39 A;  3LDB A;  5HBA A;  3TEW A;  3ROU A;  1OPO A;  4GQ7 A;  3HN1 A;  1OH4 A;  1W39 A;  4Q4X 1;  4E2Q A;  4H55 A;  2D97 A;  4Q0S A;  5JIA A;  4UF0 B;  3ZFF B;  3OF1 A;  3H9A A;  1EAH 2;  2CYF A;  4PBO A;  4XPV A;  4GMP 3;  4IEX A;  1MEC 3;  4JQR A;  2WAB A;  5SV8 A;  2PA7 A;  1W99 A;  3AMP A;  1Z0H A;  2WLP A;  2WYS A;  4HOO A;  3PVB B;  1AHS A;  1HXS 3;  4GMP 1;  3WR0 A;  2NM1 A;  2TEP A;  1ZRE A;  3J26 N;  2WO7 A;  2G9F A;  3M7A A;  4AVC A;  1JH5 A;  1AL0 G;  1OLM A;  5KC5 A;  2A6Y A;  2P34 A;  1Q8O A;  5ANQ A;  5A80 A;  1CPM A;  5FPL A;  3OUJ A;  1RC6 A;  3FZ3 A;  3OCP A;  1TMF 2;  1LGB A;  3V65 A;  4FOW A;  5C7G A;  4DXS A;  4ZHN A;  5A7N A;  1AX0 A;  2RMU 2;  4GIQ A;  4QX3 A;  5BXX A;  3I2O A;  3X29 B;  3S57 A;  3JD7 1;  1S55 A;  2WFP A;  5A3W A;  2ADD A;  2OVU A;  3RJR A;  1UX6 A;  2P2K A;  3H0O A;  5EJZ B;  1YFX A;  2CWM A;  4C1X A;  2R06 2;  3OG2 A;  5FFO C;  5J3U A;  4P5Y A;  4W50 A;  1O3Q A;  1RTV A;  2CNA A;  3B02 A;  1GQH A;  3VBR B;  4UFK A;  4CTE A;  2XL7 A;  1SPP A;  2YYO A;  3AP4 A;  3NNJ A;  3OGR A;  4LK7 A;  2VGD A;  4Y26 A;  2IXH A;  1YI9 A;  5G04 L;  3AKR A;  1O4T A;  4TLF A;  5EJ1 B;  5F6K A;  1LCL A;  3O0W A;  4QHB A;  4F8A A;  4BA6 A;  1LEC A;  3KVB A;  1JTZ X;  4A7Y A;  4Q5O A;  3I3M A;  2VQU A;  1K42 A;  4JKM A;  1YLL A;  1OD5 A;  4ZS2 A;  2YPJ A;  4L0P A;  5A3U A;  3BI3 A;  2O8Q A;  3PL0 A;  3I2I A;  5FQ0 B;  3ZFG A;  3FLR A;  2JDU A;  4XJ9 A;  3AVS A;  2CHH A;  2VXR A;  1GQP A;  4FBF A;  2B8M A;  1BBT 2;  2RDN A;  4XF0 A;  5IWF A;  4XHX A;  5JI9 A;  2D44 A;  2WN3 A;  2ZBJ A;  1C28 A;  2Q8D A;  3ZLI A;  2WO3 A;  1NCQ B;  2XML A;  4QXK A;  3NJY A;  1GOF A;  4K6B A;  3HBK A;  2EA7 A;  1R1A 1;  1C8M 2;  3UGF A;  3JXS A;  4B4R A;  1UYX A;  4Y1U A;  1ZBE 3;  4N43 A;  1CAX A;  1OLQ A;  4YM2 A;  2ZAA A;  2YB7 A;  3Q9O A;  2J1E A;  5FKB A;  2ET7 A;  5C6C A;  1VBA 1;  1K3I A;  1E5H A;  1VAL A;  2VMF A;  3SNM A;  2E31 A;  1VBC 3;  3PTR B;  3BGA A;  4LT5 A;  4R52 A;  2DVD A;  3LAG A;  3VV1 A;  4D6R A;  1ZBE 1;  4YG6 A;  2ID4 A;  2VOW A;  1L7R A;  1FXZ A;  2CGP A;  1RUJ 3;  3IWZ A;  1P8J A;  5EPA A;  1VMH A;  3GHM A;  3CKH A;  4CU7 A;  4H14 A;  1RUH 2;  4E2G A;  3AJY A;  1AXK A;  2CL2 A;  2GAU A;  1UU4 A;  3ZX7 A;  3CF6 E;  2ZEZ A;  4P00 B;  3M3O A;  1Y9Q A;  3CLP A;  5B4X A;  1YIP A;  2ZAB A;  2FDJ A;  4LPL A;  5GLW A;  2VEC A;  1DGL A;  3KF3 A;  1W6P A;  1BCX A;  2VCB A;  3OBZ A;  3MHZ A;  4LHS A;  5DZF A;  1W8H A;  2HWE 2;  3A23 A;  4ATF A;  3BPZ A;  4Q4W 3;  2G9Z A;  2HWE 3;  4P9L A;  4RS5 B;  1NCQ A;  5JXH A;  1SFN A;  2RVA A;  2Z2S B;  5E8A A;  3ACL A;  3AP7 A;  2W68 A;  2VM9 A;  2ZGP A;  4NHY A;  4RR3 B;  2LTN A;  3CQO A;  4BIS A;  1A8M A;  1R08 1;  1V6M A;  1GNH A;  3B9C A;  3I2D A;  1RIR A;  3ORJ A;  3WNP A;  2VOT A;  4DRV A;  2XJV A;  2ZCW A;  1Q8Q A;  3O0V A;  3E6B A;  1Z78 A;  2YC0 A;  4JHZ A;  4TSV A;  5ERL A;  5JIU A;  3I2K A;  4Q8K A;  3H8X A;  1NKG A;  1RUJ 2;  5C5U A;  4JKL A;  3AC0 A;  3HIF A;  3TB0 A;  4PLM A;  4DOU A;  2IFR A;  1NX9 A;  1DYK A;  1WMX A;  1LES A;  1WCK A;  3N7K A;  3OEA A;  4IXL A;  4BQ4 A;  1WLC A;  1REE A;  4W65 A;  4Z2W A;  1RUN A;  4RGK A;  4CCN A;  3RG0 A;  1H0B A;  3OPT A;  4XBN A;  4XJ8 A;  4ZZ5 A;  4PI0 A;  4YZ2 A;  1JZ2 A;  2FDK A;  1G9A A;  5FYB A;  1SQ4 A;  2HEW F;  3K4Z A;  1ZBE 2;  3R4D B;  4QPY A;  1RUG 3;  2VZV A;  2XVL A;  1EUT A;  3LDR A;  2EIC A;  2RS5 2;  4AGR A;  5C33 A;  3IM0 A;  1WCD J;  3WNM A;  1V6K A;  2LRP A;  3IBM A;  4O9E A;  3SCH A;  5FOB B;  3O1V A;  3Q8E A;  5ANN A;  5CG8 A;  4FPY A;  5BNN A;  1GFF 2;  2WLQ A;  4XFI A;  4BLJ A;  2DUQ A;  3OBT A;  4C1W A;  2R0F A;  2P5B A;  2QDR A;  4EN6 B;  2QDN A;  5EHD A;  4QDR A;  3G7D A;  4N53 C;  1UNB A;  4BJ0 A;  2FBE A;  3KLS A;  3MIB A;  2Z5W A;  3M3I A;  5F6L B;  1GV9 A;  1PIV 3;  4XAA A;  2N7G A;  2CWS A;  2VU9 A;  4AFB A;  1ND2 B;  1J59 A;  2PYT A;  1XB9 A;  2QUO A;  2J22 A;  5LW9 A;  5CIR A;  3BU0 A;  3D4K A;  1BBT 1;  3FX3 A;  3IIA A;  1GQG A;  1H1A A;  4QHZ A;  5I91 A;  2C1F A;  2HWC 2;  1ND2 C;  1UW8 A;  2JDP A;  5DAQ A;  1WCS A;  2BOJ A;  4QPI A;  2Q8C A;  2DCT A;  3T2T A;  4B1M A;  1X33 A;  4KH9 A;  4YZ3 A;  1PK6 B;  1T6B X;  2AR6 A;  4PHZ A;  4XMI A;  1NCR A;  1ZZ7 A;  1ST8 A;  1IS4 A;  1OMI A;  4B7E A;  3FC0 A;  3TN9 2;  3JCI A;  2WZR 1;  2P3I A;  2K2S A;  1YQ6 A;  2YGL A;  1MEC 1;  3KV5 A;  3WG2 A;  4A41 A;  5FR3 A;  5FMC A;  1V6N A;  5JCT A;  2ZX0 A;  2BFU S;  5LA2 A;  3CJI B;  3ZSM A;  3ITQ A;  1WLD A;  3E5U A;  1QNY A;  5F8P A;  3T2O A;  3E6C C;  4EWE A;  1COV 2;  3F95 A;  4KWU A;  1GNZ A;  4I02 A;  2GNB A;  3HQX A;  4CEY C;  4KG0 A;  3HNB M;  4MGQ A;  4JAA A;  2XJU A;  5E1R A;  1COV 3;  3BIE A;  2W2I A;  4PDW A;  2FCU A;  5E16 A;  2UYB A;  4NR1 A;  2FMY A;  2OT7 A;  3LA7 A;  5K4L A;  1FAT A;  1GWK A;  2UY8 A;  1KS5 A;  3SEE A;  2GC0 A;  1WMD A;  5CAZ A;  3ZPO A;  4NIG A;  4AGV A;  3RDI A;  3ZXE A;  3WDY A;  3BB6 A;  4QB1 A;  1HXS 2;  3OTF A;  4YVS B;  2E7T A;  4HK8 A;  2JB4 A;  5I0U A;  5C9A B;  2B45 X;  2BP6 A;  2ZTN A;  4CUG A;  3DEM A;  3VHR A;  1LNS A;  3RZM A;  1U5I A;  5A1A A;  2ZGT A;  1QGL A;  1OA3 A;  1OVS A;  2OS2 A;  4XET A;  1MR5 A;  1SLC A;  2RDR A;  2XL9 A;  2VNO A;  4UW6 A;  2OYZ A;  2HWB 3;  5B2G B;  1MS5 A;  4CDW B;  1GZ9 A;  4AHY A;  1AYM 1;  1CD3 G;  4BLI A;  4QX7 A;  2E63 A;  4XQ4 A;  5FP7 A;  2HWC 3;  1YFW A;  1CR7 A;  3TEZ A;  2PHF A;  5BNO C;  1VRH 1;  3J7H A;  1UX7 A;  3POY A;  4FFF A;  1RUF 1;  3ZPY A;  4JDO A;  4A7K A;  2SBA A;  4BME A;  1RJ8 A;  5J09 A;  1G7Y A;  4DXR A;  1DGR N;  2WNV B;  4R9C A;  5DXD A;  1PM4 A;  4CU9 A;  1ZVF A;  2C0Z A;  4H3W A;  3WEZ A;  2K46 A;  3BVC A;  4IW3 A;  2R0H A;  2D6L X;  4KWK A;  3INA A;  4CEW C;  2RJ2 A;  2FZ2 A;  3A21 A;  4QPI B;  2ARC A;  4CEW B;  4IEY A;  4FQ4 A;  1MZ5 A;  5BNQ A;  1V6L A;  1FPN 1;  3NJX A;  2HEV F;  3VKN A;  1UY2 A;  2BGP A;  2DU1 A;  4LBO A;  1QWR A;  2WT1 A;  1RUG 2;  2OKX A;  5CEH A;  4QGM A;  4NUB A;  2ZAC A;  1RUJ 1;  4AHZ A;  5CFC C;  1DU3 D;  1S0J A;  2BW8 A;  3GXU A;  3VD4 A;  1RYY A;  1UZ0 A;  3QAC A;  1JYV A;  3JQX A;  4GAZ A;  3U0Z A;  1CIW A;  5L19 A;  3DXU A;  3GJA A;  3BOW A;  1F15 A;  1J83 A;  1VAV A;  2K9Z A;  4NRM A;  4PI2 A;  3VDA A;  5K8S A;  4DO0 A;  2RG4 A;  1GU3 A;  2QZ2 A;  2D5H A;  1YQ5 A;  1OF3 A;  3ZFF C;  1HW5 A;  4ARX A;  5T3N A;  4LO5 B;  3GDB A;  1OXC A;  2GN3 A;  1VPH A;  5CKM A;  1XSR A;  4U36 A;  2QNK A;  1RUH 1;  3NST A;  1O3T A;  5JOX A;  4C91 A;  2JDA A;  4N9I A;  5DZG A;  5LBC A;  4XTP A;  4L97 A;  4XXP A;  5FZ1 A;  3FUO A;  4QKF A;  3SKJ E;  2QQP A;  4UBH A;  1GZW A;  2R16 A;  1GYK A;  4D69 A;  4BIO A;  1SBD A;  1YYN A;  3AL6 A;  1DQ6 A;  3WCR A;  2V5D A;  3ES1 A;  1DQ4 A;  1DZR A;  3POJ A;  4KU8 A;  4MHU A;  5DN2 A;  4DEV A;  4ZU5 A;  5FZ0 A;  4HBN A;  3WW2 A;  1Q3E A;  5D1I A;  1WMF A;  2WT2 A;  5LAT A;  1VBB 1;  2G4I A;  4HZF A;  5GZE A;  2WA3 A;  4DRR A;  2VZQ A;  1D2Q A;  4G4F A;  5FKC A;  4XJZ A;  1G9D A;  2XJS A;  4L99 A;  4Y5Z 0;  4RGA A;  4M3C A;  2YXS A;  4AVA A;  4A45 A;  4ONU A;  1POV 3;  3ALQ A;  4B4Q A;  3LD8 A;  1JMU B;  2ZXQ A;  1HJF A;  3I54 A;  5BPX A;  4NRO A;  3TAY A;  1OLM E;  1S2K A;  2UWA A;  1JYC A;  4GH4 A;  2D6N A;  5H9Q A;  3TNP B;  1G86 A;  2VMI A;  1PX4 A;  4NPM A;  1UXZ A;  1W2N A;  3WIN E;  4K1Y A;  2E9Q A;  4LIU A;  3NNL A;  4KWJ A;  1NLS A;  2ZPX A;  5FZ7 A;  3ZYI B;  1W6O B;  3MW2 A;  1CX4 A;  5JXI A;  1DP0 A;  1DZT A;  5JSO A;  4Q1P A;  5A6Y A;  1BBT 3;  1Z7S 2;  2JG9 A;  1NY7 1;  2AZ5 A;  1APN A;  2WO2 A;  1TMF 1;  4O9G A;  2OX0 A;  4W4Z A;  4O61 A;  4AFM A;  4I0A A;  2DUR A;  5JPM B;  3VZM A;  4D3W A;  3V0A B;  1H2L A;  2ZGO A;  5FZA A;  4COU A;  5TSW A;  1H4G A;  3H3U A;  5JDB A;  1AR6 1;  5FLJ A;  1W6M A;  2ZAH A;  4LUL A;  1N1V A;  2ZHN A;  4Y4R A;  1PVC 3;  1W2A X;  5IK7 A;  5FY1 A;  3BUC A;  2QQM A;  4QD2 A;  4YZ4 A;  3T0B A;  4FOQ A;  1D7P M;  4NJ4 A;  1O91 A;  2BVV A;  4CP9 A;  4P5H A;  3DXT A;  3IDB B;  1YI7 A;  1ZRI A;  3WG3 A;  2X10 A;  1QKQ A;  4IEP A;  1R08 3;  2VW2 A;  4F83 A;  1W6Q B;  2IWG B;  4YSF A;  1H4H A;  3ZFG B;  1K5M A;  1VBE 3;  5DDJ 3;  4AK3 A;  2LUW A;  3LFI A;  4TWT A;  3AM2 A;  1X36 A;  3AZZ A;  1H2N A;  3IZO A;  2W47 A;  2WZR 3;  1QJY 2;  4XEZ A;  1LEN A;  4GB3 3;  4Y24 A;  3K51 A;  3NAP B;  1GBG A;  1UU6 A;  2PQQ A;  2Y6L A;  2D6P A;  3OJB A;  5BNO A;  4BXF A;  1RUE 2;  4L2N A;  4BCU A;  3ELN A;  2A1X A;  3ENR A;  1ZA7 A;  3LB9 A;  4YM0 A;  4XVH A;  2O1Q A;  3LSE A;  1LOG A;  1PVX A;  3VDC A;  4U2A A;  4YW7 A;  1JOB A;  2A73 B;  3T09 A;  1JYX A;  2J42 A;  1ZA4 A;  3LE0 A;  2OZ6 A;  5F5Q A;  1FNZ A;  1GAN A;  2J7M A;  1COV 1;  5FRA A;  2BGO A;  3HPN A;  3WNK A;  4KBB A;  4LE3 A;  1VR3 A;  4JGZ A;  4FO9 A;  3A22 A;  2RS3 3;  1S0B A;  1X50 A;  2VCC A;  3LEM A;  3O14 A;  4IER A;  4LXL A;  4XQW A;  4YVW A;  4K8R B;  1MEC 2;  3WNN A;  2R07 2;  5H9P A;  1V6O A;  4S2F A;  1EAH 3;  4Z1V A;  1JW6 A;  2MEV 3;  3AMM A;  3GCX A;  4QKN A;  4LO6 B;  3AYC A;  5GLZ A;  3VN4 A;  2BDR A;  4BE3 A;  3MYX A;  3ZXF A;  4XAB A;  5C8W A;  5K7P A;  3I3D A;  4AVB A;  2NQY A;  2CDO A;  4COW A;  5EYY A;  2VMG A;  1QJX 3;  4LLF A;  5DPN A;  2J1V A;  4Q0Q A;  5FXX A;  4UW3 A;  3VBS C;  2ATF A;  4HMZ A;  2HWC 1;  5FZI A;  3BIW E;  1XYO A;  2A7A A;  2OXB A;  4HAN A;  2CGO A;  2VD7 A;  3KVA A;  4R4X A;  1ASJ 1;  4ASM B;  4FPH A;  2KM2 A;  3U1X A;  2W1W A;  1DIW A;  4AAX A;  1X7N A;  1QOT A;  4I0B A;  2VTX J;  3TEX A;  1VP6 A;  4KU7 A;  4LBJ A;  2JEN A;  3D0S A;  4ZY9 A;  3ZFE B;  2EAA A;  2WL1 A;  2BGC A;  1QJY 3;  2WZR 2;  3WZ1 A;  1ZZ8 A;  2GMM A;  3D0J A;  3NV3 A;  4FPC A;  1IS5 A;  4HN1 A;  1S2B A;  1S1A A;  1PZ7 A;  2AEY A;  4IEU A;  4AZZ A;  5L9V A;  1WD3 A;  3FFZ A;  1I6X A;  4C8D A;  3VZN A;  2VME A;  3M3Q A;  1YXW A;  1OSG A;  1VRB A;  1W9S A;  4LA3 A;  4NHM A;  4W8J A;  5FY7 A;  1TNR A;  4JTO A;  5J1X A;  3WP6 A;  1RVF 2;  2GC3 A;  5DUV A;  1EV1 1;  3MZH A;  4NAO A;  4Y3O A;  1J3P A;  4M4R A;  3AP6 A;  3FWE A;  3SEP A;  1MQT C;  3APB A;  1ENS A;  2QJV A;  1U5Z A;  2ES3 A;  4HL0 A;  4HPK B;  1AR8 2;  1CAX B;  3MF6 A;  4FPF A;  3WW3 A;  4M3C B;  1ZBA 3;  1PHM A;  1WLT A;  3CHX A;  4URT A;  3VD9 A;  1LED A;  2C9K A;  1S0I A;  4N7I A;  4AQS A;  2Y64 A;  2ZGS A;  3ACH A;  4FXK B;  4Q27 A;  4XOG A;  3SCG A;  3O1T A;  1Z7S 3;  3B93 A;  5FP3 A;  3W59 A;  1JYT A;  1KEX A;  2VVD A;  1G8W A;  2RJK A;  2VXJ A;  1W2T A;  2GP5 A;  3LCP A;  4YGD A;  1ASJ 2;  3KD4 A;  5D2A A;  4FTB A;  2B42 B;  1TME 3;  5F2W A;  3MO4 A;  1XNK A;  1AR9 2;  4A3Z A;  4CCM A;  2ET1 A;  2HWE 1;  2VZP A;  4ORF A;  3ON7 A;  1I3H A;  3AYD A;  4WVV A;  2GN7 A;  1CVN A;  3T3Y A;  3PUA A;  2GC1 A;  4Q8L A;  3EYP A;  4Y4Y A;  5A32 A;  3H7J A;  1F31 A;  4OYU A;  1UIJ A;  1D4M 3;  3MV1 1;  5C3Q A;  3ZN4 A;  4FPO B;  1H30 A;  1N1T A;  1SLA A;  2L9L A;  5EV7 A;  1GMM A;  4NMI A;  4ET7 A;  1WLW A;  1C3H A;  5E89 A;  4EN0 A;  1ACC A;  4ERO A;  3AJZ A;  3BTY A;  1KFU L;  3AYA A;  1WGP A;  3O1U A;  3B9I A;  4NIH A;  2YBK A;  1XJA A;  5K0U A;  4AAP A;  3GNE A;  4KQ7 A;  1XNB A;  3GHN A;  4Y33 A;  2DVF A;  2JIC A;  5FO9 B;  1BVP 1;  1ODM A;  2JDK A;  2XWJ B;  3ZYH A;  1POV 1;  3LWC A;  1L7Q A;  5KHG A;  2NN8 A;  3GZT B;  3P5B A;  3VHO A;  3EO6 A;  4IL7 A;  5DUU A;  1ODN A;  4XBQ A;  4OZO A;  3NV4 A;  1Q5O A;  1Y7B A;  4H7M A;  1BZW A;  5LK7 B;  3PUR A;  2F4P A;  1LU1 A;  3UKT A;  1DGW X;  4FAH A;  4IV1 B;  1ZBA 2;  5JXJ A;  4OHZ A;  3P3N A;  2JJ6 A;  4LUK A;  3ZSL A;  5FV3 A;  2JE7 A;  4IV3 A;  3G6J B;  4DB5 A;  5DUW A;  2JEM A;  1W8O A;  2H6C A;  2YUE A;  3PUH A;  5FY5 A;  1RUO A;  4OFG A;  2E26 A;  1CON A;  1XNA A;  4JRA A;  4LO7 A;  3AFK A;  2YFZ A;  1ZM1 A;  2P3Y A;  4AG4 A;  4EWD A;  4QDS A;  3D6E A;  2ZX1 A;  2C4X A;  4GJZ A;  3DKW A;  1PGW 1;  2BFU L;  4Y1X A;  3N36 A;  5C8C A;  4QQL A;  2EIG A;  1PGS A;  1RUC 1;  2YHJ A;  4NPR A;  3RZG A;  2DVA A;  2WNE A;  4WM7 B;  4ZKT B;  2VBP A;  5EIY B;  4OQ9 A;  1B09 A;  3C7F A;  4ATE A;  1AR6 2;  3T4V A;  3N7L A;  3GBF A;  3HQU A;  4LJH A;  2JDN A;  2XUM A;  3DF0 A;  4YGB A;  4YAR A;  5HV4 A;  3ST7 A;  5CIS A;  3V0A A;  3VBR C;  1O3R A;  3LOI A;  5FCC A;  4BPZ A;  4DQA A;  2GP3 A;  3A0K A;  4GXL A;  4TN7 A;  3WOG A;  1NQJ A;  1ULF A;  2H0V A;  3B3Q E;  1U0A A;  4FCA A;  3PJY A;  3RMY A;  2BNN A;  2OW4 A;  4CEY B;  1Y3T A;  2X29 A;  4LUM A;  5F32 A;  3UYJ A;  5JWP A;  4PIX A;  4QKD A;  5HCF A;  1ULG A;  1LUL A;  5JSR A;  4CEY A;  1HDK A;  3T1L A;  4GH4 B;  4LBM A;  1W6N B;  2YBS A;  2DYC A;  4KGG A;  2GMP A;  4BQ3 A;  2MEV 2;  1A3K A;  2OA2 A;  1GP4 A;  3K77 A;  4DY5 A;  3RFR A;  2R07 3;  2FCT A;  3I59 A;  3ECQ A;  2Y6J A;  4JZR A;  5JVV A;  1REF A;  4K1Z A;  3VDD C;  1O8S A;  5I8T A;  1IQA A;  2XQX A;  3ZFE A;  1CWP A;  2IXC A;  2RS3 2;  4YGE A;  2Y6H A;  2MEV 1;  4BK5 A;  4NVP A;  5CYY A;  5IAT A;  2VAU A;  5J37 A;  2VVE A;  3MPB A;  5DZE A;  2FD8 A;  1GLH A;  3IMN A;  4CPB D;  1W28 A;  5A1F A;  1RUE 1;  4AFD A;  3DCQ A;  3LKJ A;  3H3Z A;  4WV8 A;  4WZF A;  1QJY 1;  2XON A;  4CUC A;  4AI9 A;  1PGL 2;  2VTF A;  4Q4Y 2;  1PK6 A;  1RUE 3;  3T0A A;  2WFF 1;  1V70 A;  1X9P A;  4CA9 A;  3WX5 A;  3VBS B;  1W0N A;  1ZZ6 A;  2RM2 1;  1PMI A;  4XDQ A;  3H8O A;  2P1B A;  3LF7 A;  5IK5 A;  1N3O A;  1VLN A;  4PCR A;  2E53 A;  2YV8 A;  4LIV A;  1K12 A;  1QXR A;  5DDJ 2;  2HBU A;  1BEV 2;  3MLK A;  1VBE 2;  3WNL A;  4CRQ A;  4E4Z A;  2DTY A; 
#chains in the Genus database with same CATH homology
 2EIC A;  4MGS A;  1JZ6 A;  3WNM A;  2WAA A;  2J1U A;  3C7G A;  4GWI A;  4OMD A;  3D3A A;  2CDP A;  3I3B A;  1F4H A;  1T2X A;  4XUO A;  4PT6 A;  3III A;  4UOJ A;  4QDR A;  1YQ2 A;  4BJ0 A;  4CUB A;  1XPW A;  4XUT A;  3GGL A;  3I97 A;  2J22 A;  2R7E B;  2VZ1 A;  2V4V A;  4QX2 A;  3ABZ A;  2YG0 A;  2BBA A;  5G05 L;  4M4P A;  1GUI A;  3K46 A;  4A41 A;  3OBA A;  4OMC A;  4QPW A;  5LA2 A;  3T2O A;  3LEG A;  3NRU A;  4DUV A;  3UNP A;  1JI6 A;  4KWU A;  1JZ4 A;  2WZ8 A;  3HNB M;  4MGQ A;  4QAW A;  4UAP A;  2VQT A;  3THD A;  1EUU A;  3SEE A;  5DMY A;  1JZ8 A;  4QB6 A;  1R64 A;  5HPO A;  3HJR A;  3OGV A;  4QB1 A;  1JU3 A;  4DUX A;  3MBW A;  5HXM A;  1LNS A;  2W3J A;  5A1A A;  3WNN A;  1CZT A;  1W8N A;  5CZK A;  1F4A A;  5JMO A;  4A42 A;  2W92 A;  3LPF A;  4JX0 A;  3HEI A;  4ZZ8 A;  3J7H A;  1UX7 A;  4QDQ A;  2ZEY A;  3HOB A;  5IJR A;  3WF1 A;  4DXR A;  3NNG A;  1XNT A;  4CU9 A;  3ACF A;  5I0D A;  3WEZ A;  3I2J A;  3THC A;  2RJ2 A;  3A21 A;  5JR2 A;  2X09 A;  2W1Q A;  3NJX A;  2Y6K A;  1UY2 A;  2BGP A;  2OKX A;  3WF4 A;  3IDA A;  3CZJ A;  2W87 A;  3IAP A;  3K4D A;  3MUY 1;  1PX3 A;  2VZO A;  2YC2 A;  3GXU A;  3VD4 A;  1RYY A;  1UZ0 A;  4LKS A;  4TXW A;  3W5N A;  1WKY A;  4ARY A;  2YC4 A;  4OUE A;  1NUK A;  1JYV A;  2C26 A;  1J83 A;  2YFU A;  4PQQ A;  5FUI A;  3T2Q A;  3VDA A;  1GOH A;  1GU3 A;  1OF3 A;  4ARX A;  3C7E A;  3GDB A;  2WBK A;  2BZD A;  2WZE A;  2JDA A;  2J1A A;  1BHG A;  1W9T A;  3SKJ E;  4P08 A;  2QQJ A;  3OB8 A;  5JXG A;  5IHR A;  3C8X A;  3DYO A;  3CDZ B;  3NJV A;  3ZM8 A;  5LCW L;  4XUN A;  2W9X A;  2Z4F A;  3CIH A;  3FHQ A;  2V5D A;  4DUW A;  3A7Q A;  5DN2 A;  4DEV A;  3WSO A;  5DQ0 A;  4A6O A;  2VR4 A;  4QX1 A;  3EB7 A;  2J1T A;  2VZQ A;  1H6Y A;  2EIB A;  2VZS A;  3VD7 A;  1MPX A;  4DEQ A;  4A45 A;  1UMI A;  2VZ3 A;  1HN1 A;  1UYY A;  5LA1 A;  2ZXQ A;  2WAO A;  2LW8 A;  3LPG A;  1PX4 A;  1UXZ A;  5C71 A;  4P02 B;  2VMC A;  2ORX A;  5JXI A;  1DP0 A;  2VL4 A;  3OGS A;  4DXT A;  2X05 A;  3I2G A;  4D8M A;  2WO2 A;  4W4Z A;  1JZ7 A;  1JYW A;  1CX1 A;  4TTG A;  3K4A A;  1GOG A;  2E32 A;  1JHJ A;  1SDD B;  1NAE A;  2VC9 A;  3LQC A;  2Y8K A;  2QQM A;  2W1S A;  3T0B A;  1D7P M;  2Y6G A;  5JUV A;  5F7U A;  1UWW A;  1SG3 A;  2HYX A;  3HN3 A;  2X10 A;  3T08 A;  2WUH A;  1US2 A;  4MOA A;  2B4K A;  2EID A;  2VMD A;  4RN5 A;  2PQS A;  2W47 A;  4CU6 A;  2XHN A;  3HNY M;  1TVG A;  4QX0 A;  2Y6L A;  4XUP A;  3VDB A;  2DDU A;  2DCK A;  3DEC A;  3VD3 A;  3ETP A;  4XVH A;  1W9W A;  3VDC A;  2W1U A;  2HLE A;  3T09 A;  3UES A;  1KGY A;  4E8D A;  3LE0 A;  2J7M A;  2BGO A;  3GM8 A;  3HPN A;  4PF1 A;  3WNK A;  2J1S A;  4KI5 M;  2W94 A;  3FL7 A;  3A22 A;  1UY4 A;  2VCC A;  4KMQ A;  3I2F A;  1WCQ A;  3T0D A;  1CIY A;  2QQK A;  2BER A;  2XOM A;  1US3 A;  3MUZ 1;  1UMH A;  3K75 B;  3MV0 1;  3I3D A;  1CZS A;  2CDO A;  5DPN A;  2J1V A;  4XUQ A;  2QQO A;  3W5M A;  3T2P A;  2LS6 A;  1JZ5 A;  3FN9 A;  3WF3 A;  1JU4 A;  2V72 A;  3CZU A;  4IUG A;  4A4A A;  2B9V A;  1XC6 A;  2W1W A;  1O59 A;  4AAX A;  2WO1 A;  4MO3 M;  2W91 A;  3DYM A;  3SKV A;  2JKX A;  3OEB A;  4BDV B;  2KD7 A;  2JE8 A;  4ZY9 A;  4BK4 A;  2VJX A;  4GWJ A;  2W46 A;  3DYP A;  4GZ9 A;  4YPJ A;  1DLC A;  1JZ3 A;  1SHW B;  2WN2 A;  2VME A;  1W9S A;  4W8J A;  1UY0 A;  1J84 A;  3BN6 A;  1DYO A;  5J1X A;  2DCJ A;  2E33 A;  2QBX A;  3WF0 A;  1OD3 A;  4CUA A;  1ULO A;  4M4R A;  2J1R A;  3E1F 1;  3SEP A;  5B4N A;  5C70 A;  3PUI A;  3FHA A;  3VD9 A;  4XUR A;  2C9K A;  2Y64 A;  3ACH A;  1PMJ X;  1OH4 A;  1KEX A;  2VZR A;  3I3E A;  2QQN A;  3MO4 A;  2WAB A;  4A3Z A;  1W99 A;  2VZP A;  1OF4 A;  2QQI A;  2WYS A;  3P1I A;  1UY3 A;  3EYP A;  4OYU A;  2ZEW A;  3MV1 1;  2W95 A;  1UY1 A;  2L9L A;  4ET7 A;  1GMM A;  4JKK A;  5C7G A;  1ULP A;  4DXS A;  2WDB A;  4QX3 A;  1OT5 A;  3U37 A;  5EJZ B;  3LEI A;  1L7Q A;  3OG2 A;  4P5Y A;  4W50 A;  3LEK A;  5IYY A;  4OZO A;  1UYZ A;  3OGR A;  3HNM A;  5JXJ A;  5G04 L;  5EJ1 B;  3ACG A;  3ACI A;  1K42 A;  1W8O A;  2VQU A;  3PUH A;  5IFT A;  4JKM A;  1CZV A;  4HG6 B;  3IB3 A;  2E26 A;  1XNA A;  4L0P A;  2YFZ A;  3I2I A;  4AG4 A;  4Z2A A;  4QDS A;  2C4X A;  2QQL A;  1GQP A;  2VZV A;  1PMH X;  3F2Z A;  4A44 A;  4CU8 A;  5EIY B;  2WN3 A;  3C7F A;  2WO3 A;  4MAD A;  4D0Q A;  1GNY A;  1GOF A;  2ZEX A;  4QB2 A;  3JXS A;  1UYX A;  2WQ8 A;  3WNO A;  4RYD A;  2YB7 A;  2J1E A;  2EIE A;  1K3I A;  2VMF A;  2E31 A;  3NQH A;  3BGA A;  2ID4 A;  1L7R A;  1P8J A;  3WQB A;  3CKH A;  4CU7 A;  5LA0 A;  4XZU G;  4ZXE A;  2ZEZ A;  4P00 B;  5B4X A;  1H6X A;  1UXX X;  4LPL A;  4BXS V;  1I5P A;  2ORZ A;  2VCB A;  4LHS A;  4LQR A;  3K77 A;  3A23 A;  3C7H A;  4E8C A;  3ECQ A;  2Y6J A;  3C7O A;  1K45 A;  1O8S A;  2XQX A;  3CMG A;  2Y6H A;  4BK5 A;  1JYX A;  5JXH A;  5CYY A;  2RVA A;  1O8P A;  2VM9 A;  5IFP A;  4CVU A;  3CQO A;  3WF2 A;  2W5F A;  2VO5 A;  3WNP A;  2VOT A;  2VZT A;  4JHZ A;  2XON A;  4CUC A;  3I2K A;  2VTF A;  3T0A A;  1NKG A;  3I2H A;  4JKL A;  2JD9 A;  3AC0 A;  1W0N A;  1NX9 A;  2VCA A;  3UET A;  3OEA A;  4FI9 A;  1IQD C;  2RV9 A;  4ZZ5 A;  1JYN A;  4UI9 L;  1JZ2 A;  1K12 A;  3VD5 A;  1TG7 A;  3WNL A;  3K4Z A;  2VZU A;  3P6B A;  3IAQ A;  1EUT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...