2W1WA

Native structure of a family 35 carbohydrate binding module from clostridium thermocellum
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
130
structure length
130
Chain Sequence
ASPVIYQAEDAIIYNAILETVNAGYTGSCYVNYHNEVGGYIEWNVNAPSSGSYALIFRYANGTTANRPMRITVNGNIVKPSMDFVSTGAWTTWNEAGIVANLNQGNNVIRATAIASDGGPNVDYLKVFSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Evidence that Family 35 Carbohydrate Binding Modules Display Conserved Specificity But Divergent Function.
pubmed doi rcsb
source organism Clostridium thermocellum
molecule tags Hydrolase
molecule keywords LIPOLYTIC ENZYME, G-D-S-L
total genus 27
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-10-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18099 DUF5010_C DUF5010 C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.260 Mainly Beta Sandwich Jelly Rolls Galactose-binding domain-like 2w1wA00
2WO1A 1W99A 1WCQA 3A21A 3K46A 4M4RA 2ZXQA 1I5PA 2WABA 5EJZB 2EICA 3UETA 5EIYB 3LEIA 5I0DA 1D7PM 5DMYA 4ARXA 4ZZ5A 2V72A 3IAQA 2JKXA 3I2JA 4KI5M 5EJ1B 2EIBA 1JZ8A 2DCJA 2J1EA 2VZQA 2VZTA 2Z4FA 3T2PA 1PMJX 4A41A 3ETPA 4YPJA 5A1AA 2QQOA 1O8SA 4ZY9A 1SHWB 3ACFA 3LEKA 1SDDB 2BZDA 4UAPA 3I3EA 1DP0A 3HOBA 1HN1A 3I2GA 5LA2A 3HEIA 4PF1A 2BERA 4DUVA 4ZXEA 3K4AA 3WF0A 4LHSA 2W94A 2EIEA 3GGLA 1JYXA 1W0NA 3WF1A 1H6XA 2W1WA 1XNAA 2JDAA 2Y6GA 1UX7A 1UXZA 1K45A 3NNGA 4A6OA 2B9VA 3GM8A 1JYWA 4QPWA 1GU3A 2B4KA 2XHNA 3A22A 3IAPA 2VZRA 5CZKA 5JUVA 1MPXA 3OBAA 5G04L 1UY3A 1GNYA 2VZVA 2YG0A 1GOHA 2E31A 2V5DA 2QQMA 2VZPA 4A42A 1W8NA 1BHGA 2X05A 4TTGA 1W8OA 2J1AA 2WN3A 3WF4A 2Y6JA 3C7GA 4DUXA 1P8JA 3T2OA 4A45A 3OB8A 2Y6HA 1EUTA 4MOAA 1JZ7A 3WNPA 4ET7A 3VD3A 3VDAA 1PX4A 4QX0A 4DUWA 3LQCA 2J22A 1K12A 4A44A 3D3AA 1L7RA 2ORXA 5G05L 5IHRA 4BXSV 3WNKA 1JYNA 2YB7A 4XUQA 2QQNA 4RYDA 4LKSA 5J1XA 1OF4A 2VZUA 1OD3A 3J7HA 4P5YA 3F2ZA 3A7QA 2VTFA 2W1UA 3CZJA 1ULOA 2J1RA 3DYMA 4W50A 2VL4A 3HPNA 3CIHA 3W5NA 1XNTA 4E8DA 3MO4A 2BGOA 5LCWL 3I2KA 1XPWA 1CIYA 1UYYA 1O8PA 4BK4A 3BN6A 3ACGA 4QB1A 1NUKA 4QB2A 2RVAA 2QBXA 1JHJA 3VD5A 4A4AA 4GZ9A 2W92A 2CDOA 3WEZA 3CDZB 3I2IA 5C70A 2ZEXA 2RV9A 5HXMA 2WO3A 4FI9A 3GXUA 4W8JA 4MADA 4DEVA 3I3DA 2W46A 1JI6A 2W91A 2VZ3A 3SKJE 2ZEWA 5B4XA 1OF3A 2VC9A 2VZSA 5IFTA 4UI9L 2YFUA 1UY0A 2WAOA 1ULPA 2C4XA 4P02B 1UMHA 1F4HA 4PQQA 3UNPA 3W5MA 3EB7A 4QAWA 3VD7A 2Y6KA 1UYZA 2LS6A 3DYPA 4KWUA 1UXXX 2OKXA 3T2QA 3THCA 1US3A 3UESA 1UZ0A 3SEPA 1GOFA 3CZUA 2WUHA 2W1SA 1JU4A 2X10A 4LPLA 2Y8KA 3WNOA 3OGVA 3C7FA 2VOTA 2Y64A 1YQ2A 3NRUA 3GDBA 4JX0A 4L0PA 1TVGA 3OGRA 5DPNA 2X09A 2WZ8A 2YC4A 4DXRA 3WF3A 4E8CA 1JYVA 2VCBA 4OZOA 4JKMA 1CZVA 2YC2A 1OH4A 4LQRA 3VD9A 2VQTA 2VCAA 4XUTA 1LNSA 2QQKA 3CKHA 1L7QA 3ABZA 2WBKA 1CZTA 5IYYA 1SG3A 1US2A 2WYSA 1R64A 1UMIA 3FHAA 5JXJA 4CU7A 1JZ4A 1RYYA 4PT6A 1NKGA 3P6BA 3PUHA 4Z2AA 3PUIA 2VMEA 2BBAA 1JZ3A 3K4DA 1PMHX 4MGQA 5LA1A 3NJXA 1JZ5A 3HJRA 3FHQA 4BK5A 4D0QA 2XONA 1CZSA 5FUIA 1UWWA 4XUPA 2ORZA 5JMOA 3OG2A 4OUEA 4AG4A 1W9TA 2W5FA 2YFZA 3LPGA 4KMQA 4ZZ8A 5HPOA 3WNNA 2E33A 3WNLA 4CU8A 4M4PA 3WSOA 2VQUA 2E26A 5C7GA 4QDSA 4QB6A 4OYUA 3ACHA 1IQDC 4QDRA 2J1SA 5JXHA 1XC6A 3T08A 3MBWA 4QX1A 5CYYA 2R7EB 3VD4A 2VMDA 3T0AA 2C26A 1T2XA 2WQ8A 5JXGA 2WO2A 4D8MA 2VZOA 1JU3A 4MO3M 3CQOA 3WF2A 3K75B 1GMMA 2KD7A 3JXSA 2C9KA 4CUBA 3OEAA 2CDPA 1K3IA 4XUOA 5JXIA 4CU9A 3LE0A 3WQBA 3K4ZA 5DQ0A 1KEXA 2ZEZA 2ID4A 3A23A 3SEEA 1UYXA 4XVHA 4P08A 2VMFA 4W4ZA 3I2HA 2VMCA 3MUY1 3MV11 3OGSA 3HNMA 4OMDA 2VM9A 3HNBM 1CX1A 4CUCA 3T09A 4TXWA 5C71A 5JR2A 4A3ZA 2V4VA 2W9XA 3MUZ1 5DN2A 4XURA 4UOJA 4AAXA 2WN2A 1DYOA 3C7OA 3E1F1 4MGSA 4OMCA 4XUNA 1O59A 2DCKA 1GOGA 2XOMA 3AC0A 1UY4A 3LEGA 2XQXA 3VDBA 1GUIA 4HG6B 2W47A 2PQSA 1UY1A 2QQJA 2RJ2A 5B4NA 4BDVB 3IIIA 3THDA 3VDCA 4XZUG 5F7UA 3HN3A 3NQHA 2J7MA 3I2FA 3SKVA 3C7EA 2QQLA 3C7HA 1KGYA 2VCCA 2VO5A 3C8XA 1NX9A 4GWIA 1WKYA 2J1VA 3I97A 2L9LA 2LW8A 3FL7A 3K77A 5IFPA 4BJ0A 2JE8A 1TG7A 4ARYA 1DLCA 4DXTA 1NAEA 1OT5A 3EYPA 2HYXA 3OEBA 1J84A 3I3BA 4CVUA 3DECA 4P00B 3ZM8A 2WDBA 1GQPA 4JKKA 1JZ2A 5IJRA 2WAAA 2VZ1A 2QQIA 2Y6LA 4DEQA 2J1UA 2JD9A 1J83A 4QDQA 2W1QA 3WNMA 1PX3A 1W9WA 2DDUA 3BGAA 3HNYM 2J1TA 1H6YA 3NJVA 3IB3A 3T0BA 3IDAA 4IUGA 2W87A 4RN5A 2E32A 3DYOA 4CU6A 1F4AA 2HLEA 1K42A 3ECQA 4CUAA 3U37A 2VR4A 1UY2A 4GWJA 1JZ6A 3ACIA 4DXSA 2EIDA 4JKLA 4QX3A 3T0DA 3FN9A 5LA0A 2VJXA 3CMGA 4QX2A 1EUUA 2W95A 3MV01 1W9SA 2BGPA 2ZEYA 4JHZA 3P1IA 2W3JA 2WZEA 3LPFA
chains in the Genus database with same CATH superfamily
1QJEA 1WCQA 3A21A 4M4RA 1H4HA 1SFPA 1FV3A 4W6YA 2ARXA 3HIFA 1Y7BA 4LKEA 3RQ0A 1YJKA 4Q0QA 4UFLA 1V9U3 3CJXA 4YGBA 5DAVA 4YZ3A 3OPTA 3MLJA 3NV4A 4CDWC 3O1RA 1DQ4A 2IWGB 2OZ6A 3GZEA 1SBEA 5L9VA 5K8SA 5LK5A 1WCKA 1FNYA 2Z2SB 3CLPA 4XZPA 1S0GA 4J25A 3WCSA 1MZEA 4WM7A 4UW3A 1J3PA 2ZKLA 1LGCA 1JZ8A 4Z8BA 4GB31 1GBGA 1ZRRA 4XFGA 2VZQA 2Z4FA 3KMHA 4KQ7A 3VUOA 1PMJX 4KU7A 5ABJB 1MZ6A 3J8F3 1V6OA 3JD71 4Q4W1 3ZSKA 1PK6B 3JU9A 5ANQA 3M7AA 1QJU2 2VMGA 2VBDA 1SLLA 3OUHA 3KF3A 1SHWB 1XYNA 2XKPA 1UF2C 3D5OA 3KF5A 2Y38A 4CDQC 2BZDA 5JDBA 3O1UA 1LRHA 2AYHA 5KHGA 1DP0A 4IE5A 3UKNA 2W2IA 5K9YA 3AVSA 2HWD2 3I2GA 5L19A 1RUG2 1OSGA 3JCIA 4U36A 3ZXFA 3E6BA 4DUVA 1I6XA 1SPPA 2VGDA 4ZXEA 2VNGA 3DEMA 3RWKX 1OKQA 1UAIA 3GZTB 4BISA 1FAYA 3KB5A 4JHTA 3WF1A 4KU8A 4FPGA 4TYSA 2VY0A 4O9GA 4OVEA 1QGLA 2Y6GA 3OF1A 1H8TB 1R092 1UXZA 3WVJA 4FSJA 1K45A 1R1A1 3RG0A 2VW0A 3CNAA 3O5SA 3UT0A 2ZGNA 4LK6A 4RHV3 2WS91 3BKZA 4FAHA 1VR3A 3AFKA 3JB4C 1NYWA 4E27A 2JE9A 4LLOA 1OUSA 5CZKA 3RI8A 2P34A 3IN9A 4BQXA 4PHZA 3ZN6A 5C33A 1DHKB 1W8UA 5F5AA 1SZBA 4AEMA 2HWB2 1VRBA 4Y20A 4Q4X1 2VZPA 3UGFA 2BOJA 1C28A 2ADDA 5DDJ1 2P5BA 1OVSA 1VRH3 2X05A 4YG3A 1DQ1A 1W0OA 2RS51 2WN3A 4QXKA 3LOBA 5T5OA 1MZ5A 4PLOA 2B7YA 4B8EA 3ZIXA 1I9RA 1SBDA 4C0HA 4CTEA 2RDRA 4IESA 4A45A 5BY5A 1DU3D 4FTSA 2Y6HA 2Y26A 3RI9A 3F95A 5A32A 2W39A 5FZIA 4OUMA 2VNVA 2O8OA 1TNFA 4QKDA 4ZONA 4G9SB 1PK6C 4ZKTB 1I1EA 4XDQA 3LSDA 4COZA 3OGGA 1VBC3 4LBMA 1QDCA 4AEKA 1UKGA 5G05L 3CEWA 2RMU1 4FOWA 4V2VA 3WNKA 5CFDC 1ZA7A 1LOGA 1JYNA 4Q0SA 1LJ7A 4CDXA 2DURA 1RVF1 4WM7B 4YGCA 4EZHA 2QQNA 3UGHA 4ZU7A 4LKSA 4QKFA 4XABA 2VZUA 1XSRA 1AX2A 4P9GA 5FXVA 4FT8A 1FMD2 4I30A 4P5YA 5AFEA 1AR62 3VKFC 4N43C 1DLLA 3A7QA 2VTFA 4NN0A 3ZKYA 3CZJA 5JOZA 1LGNA 1OA2A 1PMIA 4MUVA 5F32A 5FYMA 3H1WA 1J3RA 1YHFA 2AR6A 1HQWA 4HXCA 4NJ4A 4W50A 1O3TA 4Q0UA 3ZDVA 1MVEA 3CIHA 4IV1C 4Z07A 2P3KA 2ZMLA 3C2UA 4IQPA 5FYSA 3ILRA 3OY8B 1ND2A 3MIEA 1LOEA 4HT1T 3PIJA 4NROA 4ZU4A 2BGOA 3DKWA 5K7PA 1F5JA 1Z0HA 4UBHA 4UFHA 1D4M2 2P37A 5GM0A 1UYYA 3T30A 3MIGA 3Q8AA 1PM4A 4NAMA 5A7PA 2PELA 3MEPA 1C3HA 3MIHA 1HRV2 4QB2A 1RMU1 1ZX5A 5BNPC 1AXKA 1RUI3 3MF6A 4Y5TA 1BMV1 2ZMKA 1FPN3 1JUHA 5I0UA 1ZBA1 4ZU5A 3K3NA 3RDIA 3VBFC 3VD5A 1HIXA 2W92A 1V6LA 3KT4A 4UT5A 3I2IA 5HXMA 4LO7A 1YO8A 3GXUA 4CCDA 4FVVA 2R072 4MADA 1QJFA 3I3DA 2YU1A 5FZ4A 4BB3A 4BMBA 1XNDA 2W91A 2YMZA 2DU1A 2WQZC 3AMNA 1W3VA 1W8TA 5IVBA 3H8XA 1OOPC 2BU9A 3N9PA 2D7FA 4QWNA 4HK9A 5B4XA 4YZ4A 5A32B 1XQNA 3SCFA 4OQ8A 2YYOA 2VC9A 4AK3A 1B35B 3AJYA 4NWWA 2YFUA 4QPYA 3VZNA 4EZ4A 3RRDA 5FP7A 4CXYA 3DPRC 1ULPA 4PI2A 3DV8A 1A34A 4M0HA 4ZPIA 2XMLA 3AZXA 3CF6E 5J37A 1GLHA 3ZFEC 4BA6A 1RUOA 2PXJA 2BWAA 4RQPA 2B5HA 4ITCA 1AR93 4BWOA 1F15A 3FC0A 2P17A 5FFOC 5FKCA 4Y4YA 3WDWA 3EB7A 2R30A 3PTYA 4XJAA 3VD7A 5JSPA 3BIEA 1ND2C 1K5JA 1UYZA 3DYPA 4KWUA 3ZFGA 1NY72 1ZM1A 1DGWA 1W3XA 1AJKA 3ZYJB 3HD8B 1UZ0A 5DDJ2 2VH9A 3VBRC 2DVAA 2JJ6A 1DFQA 4OZXA 5DZEA 3VDDB 4K9SA 2WC2A 5T5LA 3CZUA 2WUHA 5IAVA 2F4LA 2FZ2A 2W1SA 4KWJA 4E4SA 3N3HA 1J1TA 1JU4A 2X10A 4AEJA 4LPLA 5DAXA 1MQTB 3M3CA 3GZAA 1BQPA 1KDKA 3MLKA 1GANA 5JOYA 3B7MA 5L9RA 1H1IA 2JDKA 3NRUA 3AP5A 1STMA 1HXS3 4EWAA 2RS53 2PFWA 2JG9C 3D82A 4AGGA 4FTBA 5FLJA 2QQVA 2XUEA 3OGRA 2X09A 4LMFA 1CN1A 5FP4A 1GQHA 2DVDA 3WF3A 2PQQA 5ISLA 1JYVA 3J4UH 5FYZA 3ZOIA 2TUNA 4TWTA 4OLLA 3SQOA 1NCRB 4FPEA 2VQTA 4XUTA 3MIFA 1RHI2 2W52A 3BIWE 3ABZA 3VBSA 2I2SA 1AYM1 4DO0A 5IYYA 4NHXA 5FLIA 4R8HA 1SG3A 3ZN4A 1V6JA 4PJYA 2ARCA 1QJY3 4P9YA 1NCQB 1IS5A 3WG1A 2XJPA 3R05A 1N47A 1L3JA 1CAWA 4CDQA 3NNMA 1QOOA 2VVEA 1XE0A 2GC3A 4ZS3A 4OHYA 2GP3A 1ENSA 2OVUA 3IWZA 4Z2AA 5KWRA 4AI1A 5AVPA 2VMEA 4IE4A 5CNAA 2GMEA 1RUH2 5A3WA 2EXKA 2GH2A 1YEWA 4UYBA 5D2AA 2UWBA 2DFCA 5K0UA 5LA1A 4FPLA 4XAEA 2RDSA 1JZ5A 3NV2A 5FMOS 1LU2A 4BK5A 2HWC1 5FY4A 4PI0A 2NMOA 5CFCC 1OD5A 4YVSC 1E5RA 5FUIA 2GP5A 1JMUB 5JMCA 1PGSA 3WUCA 2EA7A 2D40A 1QKQA 1POQA 5LZ6A 1W03A 1OA3A 4IXLA 3HT2A 3OG2A 2A6XA 2K9ZA 2LUWA 3N36A 5E6HA 3SMHA 1Q8OA 1S0IA 1QJX3 2RS52 2W5FA 1LOAA 1VMFA 5EPAA 4F3JA 3ZXGA 1GP6A 3POBA 5HPOA 3NVCA 5F8PA 4Z82A 1APNA 1PO23 2PAKA 3N35A 2VUDA 1IHMA 3RZZA 4NIHA 1V6MA 2JG9A 4XOGA 3AK0A 4FFFA 4QB6A 2GC0A 1H8TA 4Z2WA 2BVBA 3ZYFA 4XFFA 4OYUA 4K1YA 4Y1ZA 3ACHA 4LIVA 2J1SA 4QPGA 3WZ1A 1T6BX 5FO9B 1ZZCA 1ASJ3 1ASJ1 4WM8A 4QX1A 5A7WA 4I0AA 1RL3A 5CYYA 2WL1A 3VD4A 5JCTA 1YRZA 4M3CB 5LY2A 4QX5A 2VMDA 5FWJA 1E57A 1LHOA 1URXA 3RZGA 3MLLA 4LK7A 1OOPA 1JN2P 1RTVA 5JXGA 4A7YA 1RJ7A 1H9WA 4YM3A 4MXWB 1X33A 1PO21 3JQWA 1DCSA 3CQOA 1LOBA 1S0JA 3K75B 1QJZA 3POFA 1GNZA 1E5IA 2VOVA 4OI2A 4CEWA 5FTTC 4C8DA 1WLTA 4IEVA 2VUCA 3POSA 4Y5Z0 4A3XA 1BVP1 2ARBA 5FMOL 1D4M1 5C9AB 5CFDB 1JYIA 3WP4A 5F5QA 4CU9A 5EJ3A 1D4VB 1NA1A 3VBOB 3O1VA 4JGZC 4ASKA 1G6NA 2ZEZA 1QH6A 1VBC2 2VBPA 3MYXA 4HPKB 5F3CA 1RVF2 1YIFA 3SEEA 3B9CA 5FPZA 4FAGA 1EP0A 2X53S 2GNMA 2H0BA 2Q8DA 1ZREA 4YVSA 1LHWA 1D0GA 1LKNA 1SQ4A 3HNMA 3ROUA 4LBLA 2QUOA 2P4EA 3H42B 4QHBA 4X6RB 4AEDA 1IOAA 4CUCA 3I2DA 2G1MA 4YW3A 4F7ZA 2JD4A 4WVMB 1TMF1 2F4PA 1RUD2 1C1LA 1MS9A 3EJKA 2VOXA 4GAZA 5D8AB 2ZGUA 5FJHA 2YPJA 3H0OA 4AEDC 1XU1A 4Q8KA 2QJVA 5JR2A 3IDBB 4IEYA 4A3ZA 2V4VA 3J7MA 1QMJA 3MUZ1 1OLMA 4CE8A 5DN2A 2HWC2 3O1SA 4WZFA 4RQPC 2WNOA 4Y1XA 2AEYA 3ELNA 3SISA 2OA2A 3AYEA 5FZOA 1UMZA 1V6IA 3H3ZA 2DCKA 5FZ1A 1EAH2 5FZFA 1KXGA 3VBSC 2VULA 1GUIA 1GZWA 4HG6B 2W47A 1Q5OA 3DN7A 1BXHA 1WW7A 4NOTA 4QPIA 1LHVA 1Y4WA 1ZBE1 1QIQA 3S57A 4YVWA 1BEV2 4IE0A 5GLWA 4YM1A 3AKRA 2WS92 4XZUG 4TLFA 5GZDA 4CEWC 3NQHA 1VBA3 4BQYA 3B02A 1IS4A 3H3LA 3C7EA 4QGMA 1NY71 3GF6A 1IGOA 3GJAA 5DG1A 3C7HA 3U78A 1H2LA 3WW3A 1LB2A 4GIQA 2JEMA 1RUNA 1MEC3 4PF5A 2HWF1 3ZO0B 2I45A 2XBO2 1NX9A 2QCSB 4JGYC 2L9LA 3T4HB 2FMYA 4XBNA 2K46A 4RS5A 2VNRA 1G9BA 2JE8A 1TG7A 4JGZB 3LWCA 4RHV1 5BUVA 1HV0A 4JQRA 1V0AA 1FT9A 2X5IB 4IEUA 1NAEA 3PNAA 3TAYA 4BXFA 4CP1A 5DAQA 3KV9A 5FUNA 1UZZA 1YC61 4KL1A 5A3PA 4NWVA 5LWBA 2GMMA 4AVAA 4UF0A 1GQPA 1JZ2A 1ASJ2 2HBTA 3PUAA 5LB6A 2Q1MA 5FBZA 3ZYHA 1DIWA 4MGZE 2VZ1A 3Q8EA 4G3YC 3AYAA 2Y6LA 1JOJA 5LBFA 3BTZA 3V0AB 1R1ZA 4GD4A 1AYM2 2J1UA 2OUHA 1J83A 2D98A 1HRV1 2O1QA 2VD7A 4Y1YA 4DY5A 3IMMA 2BBVA 1W9WA 4AVSA 2BV4A 2DF7A 3M4FA 5FZGA 4CCNA 4YFWA 3HNYM 1DGRA 1O6UA 3V56A 1H6YA 3HR9A 2WNVB 4XJ9A 4JDNA 3T0BA 1WMXA 2BJSA 1RUE3 1QJU3 4Y26A 1KD7A 3SH4A 2ZZQA 4E2GA 4R4ZA 2JE7A 5FV3A 3DYOA 4CU6A 1F4AA 2HLEA 3BOPA 5FPBA 3RSJA 4CUAA 1W6NA 4DPNA 5F6LB 4FXKB 4GWJA 5CVRA 2ZPXA 2TEPA 3WP3A 3TBDA 4S2HA 4DXSA 1Y9MA 3WG3A 3S5QA 4DMIA 2FDHA 4K6BA 3AYCA 2J42A 2YDEA 4MGTA 2VPVA 1BBT2 5LA0A 1CAWB 3CMGA 4CDQB 3ZPYA 3MV01 1FV2A 3GBGA 3LEMA 1HB1A 2CTVA 3BPZA 4K1ZA 3O12A 2BGPA 2ZEYA 4XHBA 2W3JA 4KBBA 1KFUL 4K3UA 1VBD3 2YY1A 3VBOC 1CIWA 3FFQA 3K46A 2GU9A 2ZXQA 3ZSEA 2WABA 2HEWF 2Q1FA 5DAWA 1V9U2 1QJY2 1N1TA 5DUXA 2ZGRA 5A6YA 4YVWB 5EIYB 2D93A 3FBYA 4OHZA 5A6QA 5DZGA 3SLIA 1ZBA3 2WZPP 1TNRA 4FP2A 2O8QA 5I0DA 4UXAA 1V70A 4IW3A 4ARXA 4ZZ5A 1QQP1 4IGPA 3JQXA 3VHRA 1JHNA 1LU1A 1W6QA 1NCQC 2B46X 1RJ8A 1YFXA 5EJ1B 2EIBA 5FPAA 2J1EA 2OQ6A 3EQEA 4MGKE 4XTPA 2VNOA 1YQCA 4RGKA 1LECA 2VZTA 4QHOA 3VZJA 1VP6A 4DRVA 4C91A 1DDLA 1ENRA 1S55A 2BYVE 3OTFA 4MV2A 3U4XA 2D6PA 1O4ZA 3WV6A 5A1AA 3MGUA 5CA6A 5TSWA 2Z69A 4DOUA 1DQ0A 5H9SA 1EAH1 4UWDA 3KQ4B 1W6QB 4IEWA 1Q56A 4YFZA 2JDHA 3AKTA 4N9HA 4R9BA 5LATA 1ZYBA 3VBHC 1PO13 4QHZA 3Q9OA 2D6NA 1LCLA 3PDQA 3AKSA 1ZBE2 4XF0A 3WINE 2HKXA 4BM8A 1NZIA 4HKWA 3WY6A 2BERA 1PGW2 1HB3A 4XJUA 2WT1A 3WF0A 4YG6A 3BI3A 4LHSA 5JIAA 5J7MA 3W9AA 1W8FA 4JRAA 3TNQA 1MACA 1PO11 2RJLA 2WA4A 4P5HA 5FY9A 3ZIWA 1FNZA 4GALA 2W1WA 4META 3BU0A 1DGLA 5FP3A 1R093 1HLCA 3OGJA 4N7UA 3KWVA 5FY5A 3O1MA 5C8WA 2R073 3GHNA 3BTYA 3PIGA 2B9VA 4JRLA 4P9LA 4AF9A 3MIDA 4QPWA 3E6DA 4LUKA 4OCTA 1CPMA 1PM7A 5LRRA 2XHNA 1Q43A 5DZFA 1SCRA 1W39A 4N53C 3HQRA 1H8VA 1WMFA 5GJ6A 4K21A 4K7JA 5G04L 3G7DA 1VRH1 3JD72 4Q4W2 2Q8CA 4RGGA 1N1VA 1GNYA 4AVBA 2VZVA 4Y22B 2WT0A 1ZRCA 2YG0A 1AR71 2RE9A 2WFF1 3LDRA 5F5CA 3VZLA 1UYPA 2V5DA 2QQMA 5AC93 1X8MA 1KRIA 4A42A 1WCDJ 1XE7A 3TEXA 1W8OA 3IDEA 4KH9A 3AM2A 3GBFA 3VKMA 1OURA 4HOOA 3WF4A 4DUXA 1JH5A 1AX1A 1ZRIA 2XVLA 1SEFA 2WS93 1EUTA 1XU2A 3V0BB 4Z92B 4HBNA 4ET7A 1C1FA 3SITA 2ZMNA 3VD3A 5I8TA 4XFAA 5LY1A 3TB0A 2E51A 2OPWA 4QX0A 2RR12 1COV2 1WCSA 2R043 4MHUA 5IVVA 2FD8A 1K12A 4LBNA 1RMU3 3MFAA 2D43A 5IHRA 2D97A 5JOXA 3N4MA 4RFRB 3THTA 3BVCA 1GFF2 2YB7A 5FPVA 3ZDSA 5KHKA 2GALA 4DIQA 3JZVA 4GWMA 4Y22A 3D4KA 4D94A 1OF4A 4AGVA 5J1XA 3M3OA 5JZGB 5FBJA 2RS33 4CEYC 3QH7A 1ZVFA 4L92A 2NN8A 4JDMA 2ZGLA 3N9LA 3QBQA 5A1FA 3QCWA 2GZWA 5F2WA 1FOD3 2AENA 5GZCA 1BBT1 3LKJA 4PLMA 4QXBA 5KR7A 1QJX1 1H9PA 1SLAA 4Y33A 5IWFA 3DYMA 2ZABA 4LHLA 1F8VA 2XVGA 1JYTA 1QXJA 2GMPA 1VBB2 4PDWC 4NHMA 5CKQA 4NIDA 5T5JA 4E8DA 1PZ8A 3GBWA 3MO4A 1HRV3 1WW4A 2BWCA 5LCWL 2JICA 4G4FA 1XPWA 1CIYA 2D6MA 1Q8PA 5IK5A 4GXLA 5CU1A 2A6ZA 3K2OA 3ZFEB 1W8ZA 2WNUC 1S2KA 4W6XA 4AFCA 3L2YA 4BK4A 1ZRDA 4MX3A 5F6KA 3ACGA 5IVFA 3ILFA 3KV6A 2BPA2 4KG0A 1NG0A 1RIRA 1NUKA 4AI0A 3VHPA 2RVAA 1HDKA 4BQ4A 5A70A 4HSLA 1C8NA 3V64A 1JHJA 3LDBA 4IL7A 1GYKA 1IPJA 4A4AA 3A0KA 2WZR3 2YGLA 1XNCA 4AI8A 4NRMA 1Q3EA 4BYYA 4AE2A 1YWKA 4F8AA 2EAKA 1W6OB 3S7IA 4LKFA 4YM0A 1MS8A 5FMCA 4DEVA 1W04A 2JG8C 3UL2A 3AYDA 1CAXB 4RR3A 4CDXC 4BCUA 3SKJE 3KD4A 3PLQA 1H4GA 2JG8A 1TME1 1VBE2 3H1YA 4KWKA 1MS4A 1XBFA 2WR9A 3PVBB 5B2GB 5IFTA 2ZACA 5IVYA 2Q5TA 3ZXJA 2MPFA 2D5HA 4XAAA 2AZ5A 3AZVA 4XE9A 2ZHLA 4LUMA 4XMAA 3CU7A 4COVA 5CKMA 1T6GC 4XFBA 3WDXA 4FPYA 3OCPA 2DVFA 4P02B 3S6PA 5KXEA 2ADEA 5I93A 2Q4SA 1QXPA 4IEZA 3BODA 4JGYA 4BZ4A 2RM23 1EY2A 1HQNA 3UNPA 2R0FA 5LW9A 5BNOB 1RINA 4K8RB 1BZWA 2HWE1 4NAOA 4A7ZA 3FUQA 3GCWA 1US3A 1LHNA 3QD6A 4U2AA 3INAA 5AC92 1HKDA 1DF0A 5EYYA 3NO8A 3SEPA 2A6YA 3VBUC 2RJKA 3PJQA 4XTMA 1WA6X 1YFUA 3USSA 2JDNA 3OYWB 2Y8KA 3WNOA 1V00A 3Q8CA 5T52A 3PU3A 2Y64A 2AUYA 3S7EA 5APAA 4JX0A 4MGIE 2O14A 4JTNA 1HRI1 2XWJB 5ABJC 4NVPA 5HXVA 1WBFA 3QACA 2R1BA 3LA2A 4B4QA 2W68A 4Q1RA 4BIOA 4DXRA 5JZGA 2ET7A 1RUD3 3ZXKA 1VAKA 2RHPA 2VCBA 1FOD2 2VVFA 2ZHMA 5I91A 2CYFA 1LENA 3AKPA 1W0PA 2JWPA 4LQRA 1UPIA 1FMD3 1MS3A 1ZNPA 2VCAA 4IEOA 1LNSA 1QY4A 1ODNA 2IXIA 4V2WA 5FQ0B 3RMXA 3ZR5A 5C4WC 1DQ5A 3B00A 5IK8A 1VBE1 3POJA 1QQP2 3VZOA 4CDXB 1US2A 2WYSA 3AP7A 2P1BA 1RUF3 3M8LA 5FOJB 3KVBA 5T3NA 3ON7A 2PLV2 5ERLA 3I8TA 3V0BA 4ZXKA 4XQDA 4NPMA 4PT6A 3MIBA 2ZGQA 3PUHA 5A7NA 4LKDA 2BBAA 5F5IA 3LGRA 1RUE2 4LO6B 4AQSA 1ACCA 1I5ZA 3IPVB 4Q26A 2DCZA 1V6KA 3JUUA 3AP9A 2WZR1 3HJRA 5FR3A 3FHQA 3PUQA 4YZ2A 4D0QA 4RGAA 1GP5A 4ES8A 3AXEA 3G6JB 1AUYA 3IT8A 4XF3A 2E9QA 4J1XA 3WDUA 3FLPA 5CEHA 4QQ2A 4XUPA 3SNMA 4Q2FA 2ORZA 5FK8A 3SH5A 5GALA 5EXOA 5HCBA 2P3YA 3AMHA 2QFEA 2YBPA 1VBA1 4NE9A 2ZKNA 2E33A 2OPKA 1A8DA 3WSOA 4XEZA 1B35C 3A0NA 3O1PA 4QDSA 2OUJA 4LO4B 4COYA 4HSJA 4YG0A 1H1AA 3VHOA 5KHHA 1HN0A 2VQAA 3BU7A 4Q4X2 4WM8C 1HV1A 5A7WB 5IK4A 2ZAAA 1W28A 1IQDC 1AXYA 1KJRA 5A7QA 4N53A 5EZWA 3QOPA 1NXD1 4XBLA 4FP3A 3FFZA 4LTAA 3MBWA 1REFA 3V65A 4B4RA 5AC91 1A3KA 5I0SA 4E4HA 4LXLA 1H1MA 3ZX7A 1H2MA 3PMSA 1VB4A 4KBZA 4C0BA 1UOFA 1TMF3 4HVRA 2G9ZA 4XF9A 1TEIA 2EVXA 4JCKA 3WF2A 5A33B 1GMMA 2UU8A 4BPZA 3RVHA 3FUOA 1C8M1 4Q4V2 4AXOA 2B9UA 2F6BA 1SCSA 1C4RA 4URTA 2R32A 2ZX4A 2VTXJ 1DZRA 1FPN2 4LEJA 1JTZX 1NT0A 4MHRA 2JXAA 2XUMA 5FYBA 3NKTA 5JR7B 2PHWA 2QZ2A 1PVC3 3DUIA 5IW0A 4FFIA 4XUOA 3Q8FA 1PGL1 2JDPA 3LE0A 4UBGA 1E5SA 3HWJA 3OJBA 4QMAA 3AMQA 5DQ0A 1KEXA 3EHKA 1REEA 2AH2A 2W0XA 4D7YA 3A23A 1PIV1 3LD8A 5C3PA 1OFNA 4LOTA 2JB4A 5HV4A 2EXJA 5SV5A 3J9SA 4Y24A 2VMCA 2HWE3 2WWJA 3LZZA 1SBFA 3H8RA 1WGPA 4PBOA 4XACA 1XOYA 3UJOA 2KM2A 1X8EA 3VZKA 1X36A 4E2QA 3OPWA 1NLSA 3L2HA 1OXCA 3HNBM 3J8F1 3OYWA 4YLZA 5FZCA 1NCQA 1WLDA 4HN0A 3VBHB 4AHYA 4AI2A 3MI8A 2DYCA 3T09A 3VL8A 4JVAA 4GH4C 4KWLA 4XCBA 1ND3B 3DPRA 1MZFA 5C8CB 1OKOA 2CWSA 4M01A 5FWEA 4B7EA 2V4AA 1L7LA 2BQPA 2CL2A 1TME2 3D6EA 3U4SA 4CEYB 1RITA 2HYKA 2WN2A 1DYOA 3C7OA 2RS11 2DTYA 1LOFC 3POIA 4XUNA 3JBG3 3TEYA 1GOGA 4FOYA 2WNVA 2XQXA 4XHXA 1OPMA 3EXUA 1J1LA 2QQJA 3FBMA 3LB9A 1BYHA 5H9QA 1XSQA 2UY8A 3EBRA 5B4NA 2HWB1 3PU8A 5FY8A 2PHFA 4H55A 4PIZA 4LNVA 1X9PA 3THDA 2CAUA 5A33A 4QX8A 3PHMA 1CVNA 2Y34A 3H3UA 3ST7A 3HN3A 1YQ6A 3V0AA 2JKBA 4YGEA 4A6SA 3VDDA 1ZRFA 2QQLA 3POEA 1ND2B 1VRH2 3UKVA 5FYTA 1VBD2 4H2AA 5FYHA 3RZLA 1H30A 1ZZBA 3E5XA 1RUF1 4PIXA 5FP9A 3USUB 3D8CA 4FO9A 4QD2A 2VCCA 1Z7S3 3LIGA 2WSVA 2BTVC 3KZ4C 3RS6A 4GMP3 1D2SA 1WKYA 4FOVA 3FL7A 1OLME 1HB2A 1Q8QA 3KV5A 4IV3B 5FYVA 4E2SA 5IFPA 2NP0A 4YWAA 4EWEA 1Z78A 2VG9A 5A3MA 1DLCA 3FZ3A 4B4PA 1WUVA 4IEPA 5IVJA 2JDZA 2HYXA 3ZFFB 3T1LA 3NSTA 4CVUA 1BLZA 1GICA 1R081 3KLSA 2YHJA 2GC2A 3ZM8A 2EXIA 3MW2A 2WYFA 3O0WA 4D6SA 2WJSA 5FYCA 5H9RA 1LEMA 4AGRA 3U11A 3W20A 4IEXA 4MGYE 4CCKA 1ZZ6A 2DCYA 2EALA 2MHFA 1AL23 1YYNA 4DEQA 1EV13 1ND3C 1XB9A 2DV9A 1HJFA 2JD9A 4HANA 4QDQA 3RYPA 4HONA 4QXCA 1W9FA 3VBHA 1JXNA 1K5MC 1PX3A 5C3SA 1W90A 1JS9A 4QKNA 1ZZ9A 1VBA2 2RMU3 2J1TA 5FZAA 5EWSA 2ZZJA 1CJPA 3BTAA 4R52A 2HWC3 3ZYPA 4GJYA 3HAGA 2ETEA 4LO5B 5M0TA 5A1LA 3IPVA 4IUGA 1N1YA 5BYNA 1NCRA 1W8WA 2PHDA 2CWMA 1UY2A 3RPQA 3VHNA 4BQ3A 4R9AA 2A75A 4A2UA 3KS7A 4OHWA 4K40A 2QE3A 2FDKA 3IBMA 4CPBD 4LBJA 2HWD3 3ENRA 2XL9A 4QX3A 1XYPA 5CAZA 2VJXA 4QX2A 1LHUA 4P9WA 4HMZA 3VGIA 2D6KA 1RUC3 1CGPA 2ZA9A 1XYOA 1GR3A 3BYWA 3FWEA 1W6OA 1UX6A 4SBVA 5KHJA 1O5UA 4QPGC 1GKBA 4FOQA 4LE4A 5T55A 3ZYRA 3KSCA 2DWRA 4Y4RA 1WCUA 4FPKA 1GWKA 4IDZA 3I59B 1SLTA 3LSEA 2EICA 2FDFA 2HH9A 4GJZA 1NLQA 1D7PM 4FPFA 5DMYA 1HW5A 3KCYA 5K0UC 3GCXA 2V72A 4QKBA 1GWMA 3W58A 4B7KA 3HQXA 4XJZA 2MNGA 3I2JA 2VMIA 3JBG2 4KI5M 1RXFA 2DCJA 4QGNA 4S2DA 5DUWA 2G19A 5GLTA 3NWKA 4OULA 1I3HA 2E7QA 3T2PA 3UV9A 4FPOB 5ANNA 4CSWA 4A41A 3ETPA 1S0BA 4IV1B 4QM8A 2OT7A 4YW7A 4AHWA 3FLRA 1O8SA 5A80A 4XFCA 5FRAA 1BK0A 1W6PB 3LEKA 3UGGA 5LEJA 1DQ6A 3ZSJA 1O3RA 2K0GA 2OS2A 4UAPA 4CCCA 3HOBA 3K3OA 2C1FA 1HN1A 2RDNA 3DGTA 4MLOA 3VBUB 5LK7B 2HWE2 2XLFA 4V1PA 2OYZA 3HEIA 3M1HA 3D0SA 3CL1A 3K4AA 3OD0A 4AHZA 1UD1A 2GAUA 4IE6A 3GGLA 1GZ9A 2EIEA 5EP9A 3WQ7A 5C3OA 2BP6A 2YROA 3DXUA 5E16A 3I59A 1OHFA 5CFCA 4GA9A 4NPLA 1XNAA 4INDA 2JDAA 1UO9A 4RR3B 4DQAA 1W6MA 1UX7A 1G9FA 2A3WA 1YQ5A 1NQDA 3IZOA 1RXGA 3NNGA 3JD73 4ONUA 4Q4W3 1JYWA 4LBQD 4LITA 1GU3A 2B4KA 5FY1A 4DB5A 1S0FA 1QF3A 2A70A 4Q4V3 3AX4A 1AL22 1U5IA 3IAPA 4NRQA 3KGLA 4Q0PA 3ZKUA 5HCAA 1CAXA 1VE0A 1MPXA 5FZ6A 3HBKA 4P9XA 4QQOA 2P3IA 2WNVC 1BK1A 1AJOA 3VBOA 3MW4A 4NO4A 1QJU1 1AF9A 2CGNA 5D8AC 1SFYA 3S30A 2TNFA 1FPN1 1CAUB 4CDWB 3R0RA 3WDVA 1RUJ2 4QU1A 2WKKA 1W8NA 1BHGA 2CV6A 4RA0A 4TTGA 5I0TA 3TEWA 4PQ9A 4JGZA 2EAAA 2Y6JA 1JOPA 3C7GA 3FHIB 3N9QA 1NA1B 3T2OA 4BOWA 5C3RA 1AHSA 1LAJA 3ZSMA 3JB8A 4MOAA 4O7XA 4CUGA 1K5MB 4UFIA 3WNPA 2ZGSA 1R082 3AMPA 3L9JT 1QNWA 4MXWA 3U07A 3WHTA 4XPVA 2MEV1 1UIKA 3BCWA 5C6CA 3D3AA 2ORXA 2WINB 2FDGA 1UZVA 5L7OC 1GQGA 1VPHA 1YNAA 2WZR2 2XH6A 4WVWA 2RR11 2XGXA 3ZXEA 1Y9GA 5FO7B 1AYN2 1HXS2 3HQUA 3NV3A 4XF4A 2YBKA 1G7YA 1RHI3 4KGQA 4XETA 1OD3A 2ZHNA 5FAXA 1IKQA 3J7HA 2RS31 3SCGA 3X29B 3F2ZA 1W9YA 4M3CA 1U5ZA 4HK8A 1TZOA 2E53A 1BKZA 5FZ8A 5FIXA 3ZVXA 2J1RA 2QVSB 2YV8A 2JIGA 1GV9A 1UOGA 1LGBA 3CJIC 5FMDA 1LULA 2O0OA 4HFSA 3TNPB 2VL4A 3ZN6B 4AI9A 1G9DA 3BUCA 1OQ1A 3M3EA 2UWCA 2LM3A 4X8PA 3W5NA 2ERFA 1OVPA 2D3SA 3PUSA 1WW5A 1W2OA 1WLCA 3MFCA 4IGQA 1H8TC 5CG8A 3I2KA 3USUA 2BEOA 3B94A 5FOBB 4ZHNA 1QEXA 4O9EA 4XMIA 1O8PA 2PAMA 4YW4A 2CGPA 1UKRA 3BN6A 3NJYA 3NNJA 2Q1ZB 4YYOA 3RYRA 5EYXA 1COV1 4XDPA 4LBQA 5F3IA 4CXWA 5AFBA 3ZR6A 5FZ3A 4QU2A 2QBXA 1PZ9A 3NAPA 3AL5A 5ACA3 1C5HA 2FMDA 4LBKA 5L7OB 1UOJA 4GWNA 4EWDA 3ZFFC 5C70A 1NA1C 1WLWA 1WMDA 2ZEXA 2AREA 1LOFA 2WA3A 2WO3A 4W8JA 1W6PA 3TYJA 2ZOEB 4NHKA 5GZEA 2NLRA 2HBUA 1IS6A 3P3NA 4I3GA 4OI4A 4AR2A 4QQLA 4QXHA 3ACLA 1D2QA 4MXVA 5LBEA 5EV7A 5FZMA 1QOSA 3ZYBA 3IMNA 4HVOA 1MS5A 3ILNA 1IPSA 5GLUA 2VZ3A 3DPRB 5C8CA 4WV8A 5JPNB 2ZEWA 2LALA 2E6VA 1UN1A 3I54A 4YW2A 1HXS1 3ZMNA 4HKOA 1R091 1KFXL 3LIHA 4XQWA 3U75A 1ULCA 2G9GA 4HN1A 4OHXA 2WAOA 1TMF2 1OOPB 4EQVA 1RC6A 2NZ9A 4GULA 2ZJCA 5FZDA 3VBSB 4M3CE 1UMHA 4LA2A 1WD4A 4Q5OA 1O7FA 1JUIA 4PQQA 2FDIA 1KQRA 2IXJA 2H6BA 3TRSB 2PA7A 1OLRA 1LTEA 1D4M3 1OMIA 2Z42A 3QLQA 1G86A 4YSFA 3W5MA 1N1SA 2FCUA 4GMP0 3P3PA 5DUVA 2LS6A 1J3QA 1VALA 1IQAA 2WLQA 5F39A 1UXXX 2OKXA 2IFWA 3RJRA 3H50A 3T2QA 4NR1A 2XXZA 2R49A 4NUBA 2ZS6B 3UESA 4DRRA 2XR4A 1GOFA 3IDCB 4GKYA 1AX0A 5KXDA 2XLAA 2XLGA 2QDRA 4HETA 4RD7A 2JENA 1QOTA 1KS5A 3NKGA 3QH6A 4AI3A 3OGVA 1MEC2 3C7FA 3VBRB 3VDDC 2VOTA 4B1MA 4B1LA 1JODA 2R063 5JPMB 2R061 4LA3A 4UFJA 1HX6A 1Z7S1 3P5BA 3VKNA 2XWBB 4L0PA 4Y1VA 4M0NA 4DS0A 1NXMA 4QT6A 3DF0A 4AW7A 2X5IA 1Q8VA 2IC1A 1OI6A 5DPNA 3WP6A 2WZ8A 1AR91 4HPKA 4OI1A 3WQ1A 3WW1A 4E8CA 1B09A 4OZOA 1CZVA 2KXLA 5J96B 2YC2A 1YLLA 4XF1A 3VD9A 3AP4A 4CXXA 1QHDA 3AFGA 4OHVA 4L11A 5IUQA 2H0VA 2QQKA 1L7QA 3CKHA 4ISQA 1BJQA 4NIAA 3PURA 1CZTA 1W2UA 4FFGA 5JI9A 4MH0E 1R64A 1UMIA 1ONAA 3DXTA 4N8MA 3RGBA 1PZ7A 1AZDA 1XRUA 3H9AA 3S5AA 4YGDA 5FZ7A 5JI7A 1RYYA 2WNEA 2XHKA 2P6CA 2KR2A 2PLV3 3O0VA 4YM2A 2PTMA 4CP9A 2OQ7A 3B01A 3WNXA 3PUIA 1OBNA 3I2OA 2GC1A 2OZJA 2Y0OA 3K4DA 1PVXA 4MG2A 1S0EA 1UU5A 1VBB3 3AZWA 2BNNA 2WLPA 5FPUA 4LIUA 3J7NA 2VBBA 3NJXA 4BHPA 1W6NB 2GN7A 2A6VA 3A4UA 2XONA 1RMU2 3D0JA 1YJLA 5A3OA 1CZSA 1CAUA 2VVDA 4ES9A 1LR5A 3PMEA 1X50A 1RUI1 1UCXA 4L97A 5KHIA 3UKTA 5JLVA 2YC0A 2PHXA 3GJBA 3WD5A 5JSOA 1O3QA 4WBBA 5FZBA 5GLVA 1W9TA 3LPGA 3O1TA 2D3PA 2PN5A 4KMQA 1YXWA 4WM7C 3WOGA 4ZZ8A 2XJQA 2JDMA 2NM1A 3CBNA 3AKQA 5D1IA 5LA9A 3U10A 2YGMA 4XXPA 3S0MA 3N7MA 3T2TA 4DNYA 2XPJA 1W6MB 1COV3 2R042 2HWF3 1POV1 2XJSA 2ZGTA 1VBC1 2WFPA 4P14A 2JDUA 1C8M3 4QDRA 3MICA 2EIGA 5FZLA 2C6SA 2CNAA 3ZMOA 4AWDA 3WX5A 5I8SA 2RS12 2RM22 4RR3C 5A6XA 3T0AA 2X29A 5JAXA 2C26A 2ET1A 4LR4A 2TBVA 2K2SA 3OPZA 5C8CC 3B9IA 2ZGPA 3FX3A 4YARA 1VLNA 1DYKA 5BNNB 2BNOA 2VZOA 1JU3A 1RUC1 4CPBA 1H0BA 4YRDA 4JAAA 3EMRA 1CONA 1GWLA 3ITQA 2KD7A 4ISRA 1ODMA 1SLIA 3J8F2 1W06A 3JXSA 3KT7A 3MPBA 2C9KA 1CAVA 2ES3A 4CUBA 4R4XA 1NQJA 5FJKA 3IKWA 1K3IA 4AHXA 2F17A 2G4IA 5JXIA 2GNBA 5A3LA 2IXKA 3ES1A 1QJX2 4IERA 5FREA 3WDTA 1OA4A 3CJIA 1KITA 4XIOA 4AOCA 4IV3A 3KGZA 3NAPB 3ZXDA 2WSUA 3HVDA 1O91A 2QTWB 4H7MA 1AYN1 5C9AC 5FPXA 4UFMA 1EYBA 1UYXA 4XVHA 4P08A 3VBRA 5BNOC 4W4ZA 3I2HA 4AVCA 1R083 3OUIA 5C5TA 1BBT3 1V6NA 1DG6A 3ZXLA 5ACA2 3H8OA 5FZ9A 1HQLA 2XVKA 2CHHA 2P6HA 4CDUB 2LTNA 2VM9A 3LCPA 2CGOA 3VV1A 1EV11 2WT2A 3HT1A 5H9PA 4UFKA 1QXRA 4AFMA 1SLBA 3R4SA 2C0ZA 1XNBA 1A8MA 1J58A 5J48A 5FZHA 5C71A 5F2SA 4JQTA 2Q30A 4R9CA 2Y60A 2DTWA 5DXDA 1ZZ7A 4DY3A 1O3SA 2VCMA 1ZZ8A 4YVSB 4MGSA 2R0HA 3BALA 5GKAC 5L7OA 4C1WA 1O59A 3N7KA 1G9CA 1AXZA 5FZKA 3CJIB 3AC0A 5K4LA 1UY4A 2ILMA 3LEGA 1MS0A 2YBSA 2PHUA 3VDBA 3MHZA 4I3PA 4C1XA 2HJIA 1SFNA 3BOWA 3ZYIB 1ST8A 3I3MA 1WWYA 4Q4Y3 4N7IA 1SDWA 1AR61 2VXJA 5IT6A 2E63A 4BMEA 2QQPA 5T54A 5FXWA 4CDUC 4I0WB 2DFBA 1MR5A 4LHNA 2ZGOA 4NIIA 1KGYA 1UQXA 4I09A 5BNPA 4XJ8A 3C8XA 3APBA 4GWIA 4RFT0 5F3EA 2J1VA 3I97A 2LW8A 5JZGC 2D6LX 3OBTA 3UJQA 1KJLA 3B93A 5A3UA 1RUF2 4BJ0A 2JB8A 3OUJA 4KG8A 4I0BA 4ARYA 4EN9B 5LRSA 2XBO1 4N90A 4DXTA 1OT5A 2UURA 2VE1A 3EYPA 3OEBA 2RS13 5FDBA 3SXWA 5E8AA 3ZN5A 3DECA 5J3UA 1J59A 1VBE3 5LBBA 4EROA 2BNMA 2WDBA 2I07B 3WDYA 4Y3OA 1S0CA 2P3JA 2WAAA 4UW5A 3IIAA 1DQ2A 2QDNA 5FP8A 2HWB3 2QQIA 1BEV3 1VB2A 2DVBA 4FXGB 2R071 5CISA 4ORFA 3WR0A 5C4WB 5JVVA 4ASMB 5CFCB 3RMYA 4BQ5A 3WNMA 5C3QA 3OOXA 1EAH3 3BGAA 5IVEA 2A6WA 1WMEA 2EF6A 2I74A 2XJTA 1S1AA 3NJVA 1X82A 3TN91 4OFGA 1DYPA 4YW6A 5E89A 4RN5A 1VMHA 5ACA1 1U0AA 1PHMA 2WNUB 5FLHA 1K42A 3U37A 2ENRA 2VR4A 3VKLA 3ORJA 4FPJA 1ZBE3 3O1OA 4X8NA 2CY6A 1NLRA 1BMV2 1RUG3 2EIDA 3AZYA 3RYKA 2GDFA 3H1MA 4JKLA 4QGLA 3OBRA 4SLIA 3T0DA 3FN9A 1R1A3 4P9IA 1SMVA 4CEWB 1EUUA 2VW2A 5A3NA 4GH4B 2E7AA 2A1XA 4DFSA 1YUDA 1MS1A 1SLCA 2IUWA 3OSDA 2GN3A 4I2OA 2C24A 3LPFA 1PGL2 5J98B 2WO1A 1W99A 3KT1A 3VN4A 2DBNA 3AVRA 5CADA 5GZGA 5IATA 5HCHA 1I5PA 1REDA 1N3OA 2BW8A 2Z5WA 3SC7X 4TLGA 2RS32 2VQ0A 1VMJA 1F9KA 4BIFA 5EJZB 5JSRA 3UETA 3ZFFA 4LO8A 2BOIA 3LEIA 2PAEA 3TWIA 1RHI1 3N7JA 3NL1A 4BQWA 4WM8B 2ZX1A 4N43B 1G8WA 3K51A 2UYBA 4CDWA 3IAQA 5A6ZA 3KVAA 2JKXA 4OUSA 5F3GA 3T4VA 4DXZA 3I3QA 1AR63 2XL7A 3OD4A 1FYUA 2CU5A 3WG4A 4FPCA 4AYUA 1RB8G 2FQPA 5BNOA 3KV4A 2GH8A 3NW4A 3VBFB 3RZJA 1BEV1 1XJAA 1VAVA 4EJRA 1YFYA 1AVBA 2R062 4QX7A 4CCOA 3VLBB 4YPJA 3LFIA 4O61A 1TE1B 2Q0AA 2QQOA 3J26N 1W8HA 4NPRA 4ZY9A 1RUJ3 4W65A 1RUJ1 5D21A 3ACFA 4AFDA 1SDDB 1NCRC 4FTEA 2RR13 3POWA 1CQ9A 2FCVA 4K20A 5L73A 3TOJA 1RGSA 3I3EA 2UYAA 2XBO3 3BTXA 1U12A 2QNKA 2R6QA 4N9IA 3UYJA 2IVJA 2QQWA 5LA2A 4PF1A 2ZBJA 4GB32 4K8FA 1JW6A 1G9AA 1Y3TA 2W94A 3I4IA 1IG3A 1JYXA 3THPA 3VBUA 1W0NA 4CP9B 4H7LA 2MEV2 3LOIA 1H6XA 1C8M2 4Q4V1 2LRPA 4BE3A 2MEV3 2IXHA 4OQ9A 4YZ1A 2GSYA 2DUOA 5FMBA 4LE3A 2RG4A 3M2MA 3PVNA 3VL9A 1RUH1 4A6OA 3GM8A 3M3IA 1A6CA 3BPSA 4E4DX 4E9KA 2ZCWA 1YI9A 5DABA 4IV1A 3H7YA 4LBOA 4AAPA 3A22A 4Z1VA 3SCHA 3WG2A 1EV12 2A7AA 2A71A 3AB0A 4XCAA 2VZRA 3WXPA 2B45X 1AR92 5JUVA 2JX9A 3AJZA 3OBAA 3WUDA 2ZTNA 4F83A 3LFMA 1UY3A 4W6WA 3ES4A 1GOHA 2XDVA 2E31A 4CCMA 5A3TA 3T1MA 2BGCA 4CCLA 1PNFA 1MVQA 2AACA 2FDJA 3J7LA 2JIJA 2Z79A 2OXBA 1XE8A 2J1AA 3ZYGA 4AVTA 2A3XA 4EN0A 3HBZA 1GZTA 1P8JA 3GHMA 1OPOA 2FBEA 3OB8A 1QH7A 4HL0A 5FY0A 3ZPOA 2ATFA 2PHLA 1JZ7A 2PMWB 2WQ4A 3OY8A 3WT3A 3VDAA 1PO12 4AFBA 4P9JA 1PX4A 2VUAA 2G9FA 3WHUA 2SLIA 1Z7S2 3FLTA 4DUWA 1RVF3 3E5QA 3LQCA 2J22A 1C5IA 2VMHA 4EE2A 3I49A 4A44A 1HRI2 1IG0A 1L7RA 4NHYA 1PO22 3R4DB 4BXSV 4XBQA 1AR82 2VECA 3N9NA 4XUQA 1XNKA 4RYDA 4UF0B 3MDPA 4RS5B 4MSVA 2RM21 3H7JA 3EO6A 2W08A 3SHRA 4PDWB 5K0UB 4KGGA 4O65A 2IFRA 4Q27A 2A3YA 1AR72 2W1UA 1ULOA 2WFF2 1FXZA 2FHRA 2YPDA 1H2KA 2VAUA 4L9BA 5FYYA 5J36A 3FE5A 2CAVA 5FYUA 3FJSA 1LEDA 2A73B 5DDJ3 2CSGA 1ND3A 3HPNA 1U5YA 3N9MA 4EN7B 2PLV1 3AMMA 4GH4A 1U5XA 4Q0VA 1TME3 1XNTA 4YNIA 5FXZA 5FZ0A 1RUH3 1ENXA 2XJUA 3KQRA 2HEVF 3WW4A 2V73A 1EPWA 1UU6A 1Y9QA 3M70A 2XJVA 1E5HA 2P2KA 2AEZA 1CR7A 1YQ8A 3ASIA 5BNNA 1CESA 3DL3A 4QB1A 1GNHA 2B8MA 2YZ4A 1VBD1 4AQ6A 3URFA 1PVC2 1QNYA 1O4YA 3HN1A 5FY7A 3E6CC 4IETA 2BDRA 1X9TA 5BNNC 3UK9A 4JC1A 4TSVA 5SV8A 1CJDA 1W2NA 2KA3A 4GZ9A 3WEZA 2CDOA 4BH9A 3H8UA 4FQ4A 1W05A 4M3CF 1POV3 3CDZB 2DU0A 5D8AA 2RV9A 3VB9A 4FI9A 1OH3A 2B42B 2HWD1 4UW6A 1YIPA 1CD3G 1QWRA 1IKPA 3R6SA 4AEDB 4B3NA 4C90A 2W46A 1WA4A 5CG9A 1JI6A 3NJZA 1XXNA 4LJHA 2H6CA 1DBNA 4YW1A 4PBPA 4URAA 1AR83 5DAPA 4YVWC 1CWPA 1OF3A 5FKBA 1S0DA 3Q8BA 2VZSA 2ZX2A 4UI9L 3ZFGB 1NE6A 1UY0A 1YCIA 3MZHA 4FQZA 2SBAA 5FQ0A 2C4XA 3W21A 5FPLA 3GZUC 1O5LA 1GSLA 3GALA 2QZ3A 4NIGA 2HWF2 2QQUA 1F4HA 5CFDA 2ZHKA 1ULEA 5CB7A 4XIKA 5BPXA 2C5DA 2Y6FA 1SACA 4GKXA 3C3VA 4QAWA 2Y6KA 2VU9A 5CIRA 1VAMA 5BNPB 3WQ0A 4CZSA 1CAVB 1UZWA 1FMD1 5DUUA 1A78A 3THCA 4FBFA 2ZGKA 5I0RA 5C9AA 5FYIA 4DINB 3KCCA 2VOWA 5EQUA 2R041 5JIUA 1ZA4A 1UU4A 5FO8B 5IAXA 3O7OA 2E7TA 5ABJA 4H14A 2R1DA 3PL0A 2X5IC 1YQ2A 4AQ2A 4COUA 3CHXA 4MVTA 3GDBA 1FI2A 1N3QA 3E5UA 4Q1PA 1TVGA 1F2NA 2IZWA 4PCRA 4NRPA 4IE7A 4YW5A 4HVQA 3BB6A 1FX5A 2NYYA 4QPIC 3SH3A 1IS3A 2YC4A 3JBG1 2XG3A 1AR73 1TQ5A 2WFF3 4JKMA 1OH4A 5DG2A 4MYEA 1RUC2 2UY9A 3U1XA 4LOSA 1BVVA 1RUG1 1DGRN 1D0HA 2LROA 1JYCA 4XDOA 3NV1A 5HCFA 4D69A 1OLQA 2AC1A 2WBKA 3ATGA 1S2BA 2BVVA 2WWUA 4I01A 4LBQB 5HBAA 1Q8SA 3FHAA 2JG8B 3WCRA 5JXJA 4EN8B 1VIWB 4WVMA 5C4WA 4CU7A 1ULGA 1JZ4A 3NNLA 3AXDA 4HLTA 4RS5C 1NKGA 4M00A 3P6BA 4JZRA 3U14A 4CCJA 1ULDA 4YZ5A 5KXBA 4CRQA 1M4WA 1JZ3A 3RZKA 4Q8LA 1F5FA 3PVOA 4XW3A 3MW3A 5HI0A 4RQPB 1PMHX 4N53B 5F1RA 4MGQA 2PHTA 2RMU2 1SPPB 5KC5A 1CPNA 4PIYA 2BFUL 3TN93 1OC1A 4BLJA 4ATFA 4ZS2A 4LLFA 1UWWA 4BQ2A 3O0XA 2HEYF 1POV0 5JMOA 1WW6A 4TN7A 4OUEA 2XJRA 4AFAA 1WZXA 2D44A 4AG4A 2YFZA 4CYDA 5BV6A 5HV0A 4XQ4A 2VUJA 3DCQA 3KM5A 1QU0A 3KHCA 4D3WA 1K5MA 5FXXA 5EFUA 5GZFA 2IXCA 3WNNA 1UZYA 5F37A 1ENQA 3GNEA 3WNLA 4M4PA 4CU8A 1S4CA 2VQUA 2E26A 5C7GA 1C57A 5A7SA 3NAPC 4HZFA 1WD3A 4I02A 1PIV2 3LF7A 2Y0IA 4E4ZA 3PJYA 1PIV3 1GZWB 5L36A 4FPHA 5JXHA 1XC6A 3VZMA 1S2EA 3RZHA 5FZEA 5JWPA 3T08A 2N7GA 1JBCA 5FZOB 3U0ZA 3RNSA 1PVC1 2PYTA 2R7EB 4QPGB 4RHV2 4PDWA 4AVVA 1LESA 2AGSA 4WZCA 3WP5A 5JOWA 5GLZA 1T2XA 3AZZA 4Q4Y1 2D6OX 2WQ8A 1LODA 1FOD1 4QM9A 3RZMA 2WO2A 5E88A 4D8MA 3AP6A 2EXHA 3N9OA 2WWSA 4A7KA 4MO3M 1NE4A 3LAGA 2V5YA 4XYXA 4Y1UA 3TN92 2IXLA 1X7NA 4BU2A 1ALYA 4XJWA 3POGA 2C9AA 5LBCA 2A5ZA 3OEAA 2CDPA 4CDUA 4IV3C 4GMP1 2YUEA 2JDYA 4N43A 4OI0A 2WRAA 4BLIA 5CKNA 4EYUA 1NOVA 1KS4A 5FCCA 3K4ZA 5LASA 3WQBA 1GP4A 2WIIB 5L9BA 1RUE1 2ID4A 4TZDA 1OQDA 2X8KA 2VTXA 5LEKA 1BCXA 4GB33 2VMFA 4RSUA 4AZZA 4CEYA 2VW1A 2Q8EA 1R1A2 3MUY1 3MV11 5EHDA 4B29A 2DVGA 3OGSA 5KBFA 4Q29A 1PK6A 1DZQA 4OMDA 5AVAA 4CP0A 1CX4A 4J6GA 1CX1A 2Q8OA 1UNBA 2RDQA 4XC9A 1EPZA 4ATEA 3B5LB 4D6RA 4TXWA 4L8QA 4JV4A 3MPPG 1WBLA 2ZAHA 4Y5SA 2W9XA 1O4TA 4XURA 1AYN3 4UOJA 1IZ3A 4AAXA 4CP2A 1AL0G 2D3RA 2FCTA 2OX0A 2WNUA 2WO7A 3CO2A 3ME2A 4Y20B 3E1F1 3DKQA 3RFRA 4OMCA 4DZGA 1GZCA 1N3PA 2YU2A 3HMYA 2B39A 4Q4Y2 4AL9A 2XOMA 1QJY1 1KDMA 2DUQA 3LA7A 2PQSA 1UY1A 2RJ2A 3KCXA 2NMNA 4XFIA 4XXAA 4D7SA 4JTOA 5BNQA 3O14A 1JOBA 4RL7A 4BDVB 5CBLA 3IIIA 4AQTA 2JG9B 2OIIA 1F35A 3VDCA 2BFUS 2DUPA 3N7LA 5F7UA 1DZTA 4EV0A 2XQRA 4HKLA 4QQHA 2J7MA 3R4UA 3I2FA 3SKVA 3PVEA 2ZGMA 2NQYA 3T3YA 4BQ1A 5BXXA 1UOBA 3W59A 3AL6A 1HB4A 2QKDA 5E1RA 1H2NA 1LOCA 1OQEA 4X6QB 2YXSA 5C5UA 1UW8A 1FATA 2DBIA 2VO5A 4IGOA 5IVCA 1NZCA 5IK7A 1HRI3 4L99A 5KC6A 1IPKA 4CA9A 3TEZA 3B69A 5FUPA 1UPSA 3VBFA 3K77A 4L2NA 1ULFA 3KHBA 3M3QA 1RUD1 3RJ2X 1MEC1 1OFSA 4PLNA 2XB6C 1YI7A 4Q4X3 5J09A 1VBB1 2D5FA 2IVIB 2FZ1A 2XKOA 4UW4A 1J84A 4WVVA 1DGWX 5I8YA 4H3WA 5FK7A 4NHLA 3I3BA 3RWNA 4ASLA 4LT5A 3ZFEA 2JECA 3VKOA 1AYM3 4P00B 1W2TA 1W2AX 4JKKA 4D7TA 4S2GA 1PGW1 3GYDA 3ALQA 5IJRA 2NPIA 4R9DA 3LDKA 1B35A 5A7OA 2DCTA 4JDOA 3FMGA 4COWA 1AL21 2ZX3A 3ZFGC 2UWAA 4J1WA 5F9TA 4MZUA 3NNFA 4FCAA 4D6QA 2W1QA 1YFWA 1ZBA2 4NMIA 2DDUA 4LHKA 1Y43B 3I7DA 5T50A 3ZSLA 4KNCA 2R16A 4XILA 4S2FA 2GNDA 1PNGA 2ZX0A 2PHRA 4IEQA 4XFHA 3ETQA 3IB3A 1RUI2 2V09A 3IDAA 4QPIB 1VJ2A 3WW2A 2W87A 2BRTA 2E32A 2Y33A 3OBZA 4FFHA 4JGYB 4LORA 3ECQA 1HJGA 1UL9A 4CCEA 2OW4A 2VOKA 5T5PA 1M06G 3LA3A 2VXRA 3B3QE 3ACIA 3NMBA 1JZ6A 1MQTA 3PTRB 1QDOA 3POYA 1QQP3 3IM0A 3E97A 4QQPA 2GNTA 2W95A 3K48A 4WVZA 2ARAA 2BUKA 3MF9A 1F31A 1W9SA 1OUXA 1V9U1 1UIJA 1MQTC 4JHZA 3ZXAC 4EN6B 4LULA 3WLUA 1AR81 4GQ7A 2WZEA 3ZLIA 5KXCA 3P1IA
chains in the Genus database with same CATH topology
2WO1A 1W99A 1WCQA 3A21A 3K46A 4M4RA 2ZXQA 1I5PA 2WABA 5EJZB 2EICA 3UETA 5EIYB 3LEIA 5I0DA 1D7PM 5DMYA 4ARXA 4ZZ5A 2V72A 3IAQA 2JKXA 3I2JA 4KI5M 5EJ1B 2EIBA 1JZ8A 2DCJA 2J1EA 2VZQA 2VZTA 2Z4FA 3T2PA 1PMJX 4A41A 3ETPA 4YPJA 5A1AA 2QQOA 1O8SA 4ZY9A 1SHWB 3ACFA 3LEKA 1SDDB 2BZDA 4UAPA 3I3EA 1DP0A 3HOBA 1HN1A 3I2GA 5LA2A 3HEIA 4PF1A 2BERA 4DUVA 4ZXEA 3K4AA 3WF0A 4LHSA 2W94A 2EIEA 3GGLA 1JYXA 1W0NA 3WF1A 1H6XA 2W1WA 1XNAA 2JDAA 2Y6GA 1UX7A 1UXZA 1K45A 3NNGA 4A6OA 2B9VA 3GM8A 1JYWA 4QPWA 1GU3A 2B4KA 2XHNA 3A22A 3IAPA 2VZRA 5CZKA 5JUVA 1MPXA 3OBAA 5G04L 1UY3A 1GNYA 2VZVA 2YG0A 1GOHA 2E31A 2V5DA 2QQMA 2VZPA 4A42A 1W8NA 1BHGA 2X05A 4TTGA 1W8OA 2J1AA 2WN3A 3WF4A 2Y6JA 3C7GA 4DUXA 1P8JA 3T2OA 4A45A 3OB8A 2Y6HA 1EUTA 4MOAA 1JZ7A 3WNPA 4ET7A 3VD3A 3VDAA 1PX4A 4QX0A 4DUWA 3LQCA 2J22A 1K12A 4A44A 3D3AA 1L7RA 2ORXA 5G05L 5IHRA 4BXSV 3WNKA 1JYNA 2YB7A 4XUQA 2QQNA 4RYDA 4LKSA 5J1XA 1OF4A 2VZUA 1OD3A 3J7HA 4P5YA 3F2ZA 3A7QA 2VTFA 2W1UA 3CZJA 1ULOA 2J1RA 3DYMA 4W50A 2VL4A 3HPNA 3CIHA 3W5NA 1XNTA 4E8DA 3MO4A 2BGOA 5LCWL 3I2KA 1XPWA 1CIYA 1UYYA 1O8PA 4BK4A 3BN6A 3ACGA 4QB1A 1NUKA 4QB2A 2RVAA 2QBXA 1JHJA 3VD5A 4A4AA 4GZ9A 2W92A 2CDOA 3WEZA 3CDZB 3I2IA 5C70A 2ZEXA 2RV9A 5HXMA 2WO3A 4FI9A 3GXUA 4W8JA 4MADA 4DEVA 3I3DA 2W46A 1JI6A 2W91A 2VZ3A 3SKJE 2ZEWA 5B4XA 1OF3A 2VC9A 2VZSA 5IFTA 4UI9L 2YFUA 1UY0A 2WAOA 1ULPA 2C4XA 4P02B 1UMHA 1F4HA 4PQQA 3UNPA 3W5MA 3EB7A 4QAWA 3VD7A 2Y6KA 1UYZA 2LS6A 3DYPA 4KWUA 1UXXX 2OKXA 3T2QA 3THCA 1US3A 3UESA 1UZ0A 3SEPA 1GOFA 3CZUA 2WUHA 2W1SA 1JU4A 2X10A 4LPLA 2Y8KA 3WNOA 3OGVA 3C7FA 2VOTA 2Y64A 1YQ2A 3NRUA 3GDBA 4JX0A 4L0PA 1TVGA 3OGRA 5DPNA 2X09A 2WZ8A 2YC4A 4DXRA 3WF3A 4E8CA 1JYVA 2VCBA 4OZOA 4JKMA 1CZVA 2YC2A 1OH4A 4LQRA 3VD9A 2VQTA 2VCAA 4XUTA 1LNSA 2QQKA 3CKHA 1L7QA 3ABZA 2WBKA 1CZTA 5IYYA 1SG3A 1US2A 2WYSA 1R64A 1UMIA 3FHAA 5JXJA 4CU7A 1JZ4A 1RYYA 4PT6A 1NKGA 3P6BA 3PUHA 4Z2AA 3PUIA 2VMEA 2BBAA 1JZ3A 3K4DA 1PMHX 4MGQA 5LA1A 3NJXA 1JZ5A 3HJRA 3FHQA 4BK5A 4D0QA 2XONA 1CZSA 5FUIA 1UWWA 4XUPA 2ORZA 5JMOA 3OG2A 4OUEA 4AG4A 1W9TA 2W5FA 2YFZA 3LPGA 4KMQA 4ZZ8A 5HPOA 3WNNA 2E33A 3WNLA 4CU8A 4M4PA 3WSOA 2VQUA 2E26A 5C7GA 4QDSA 4QB6A 4OYUA 3ACHA 1IQDC 4QDRA 2J1SA 5JXHA 1XC6A 3T08A 3MBWA 4QX1A 5CYYA 2R7EB 3VD4A 2VMDA 3T0AA 2C26A 1T2XA 2WQ8A 5JXGA 2WO2A 4D8MA 2VZOA 1JU3A 4MO3M 3CQOA 3WF2A 3K75B 1GMMA 2KD7A 3JXSA 2C9KA 4CUBA 3OEAA 2CDPA 1K3IA 4XUOA 5JXIA 4CU9A 3LE0A 3WQBA 3K4ZA 5DQ0A 1KEXA 2ZEZA 2ID4A 3A23A 3SEEA 1UYXA 4XVHA 4P08A 2VMFA 4W4ZA 3I2HA 2VMCA 3MUY1 3MV11 3OGSA 3HNMA 4OMDA 2VM9A 3HNBM 1CX1A 4CUCA 3T09A 4TXWA 5C71A 5JR2A 4A3ZA 2V4VA 2W9XA 3MUZ1 5DN2A 4XURA 4UOJA 4AAXA 2WN2A 1DYOA 3C7OA 3E1F1 4MGSA 4OMCA 4XUNA 1O59A 2DCKA 1GOGA 2XOMA 3AC0A 1UY4A 3LEGA 2XQXA 3VDBA 1GUIA 4HG6B 2W47A 2PQSA 1UY1A 2QQJA 2RJ2A 5B4NA 4BDVB 3IIIA 3THDA 3VDCA 4XZUG 5F7UA 3HN3A 3NQHA 2J7MA 3I2FA 3SKVA 3C7EA 2QQLA 3C7HA 1KGYA 2VCCA 2VO5A 3C8XA 1NX9A 4GWIA 1WKYA 2J1VA 3I97A 2L9LA 2LW8A 3FL7A 3K77A 5IFPA 4BJ0A 2JE8A 1TG7A 4ARYA 1DLCA 4DXTA 1NAEA 1OT5A 3EYPA 2HYXA 3OEBA 1J84A 3I3BA 4CVUA 3DECA 4P00B 3ZM8A 2WDBA 1GQPA 4JKKA 1JZ2A 5IJRA 2WAAA 2VZ1A 2QQIA 2Y6LA 4DEQA 2J1UA 2JD9A 1J83A 4QDQA 2W1QA 3WNMA 1PX3A 1W9WA 2DDUA 3BGAA 3HNYM 2J1TA 1H6YA 3NJVA 3IB3A 3T0BA 3IDAA 4IUGA 2W87A 4RN5A 2E32A 3DYOA 4CU6A 1F4AA 2HLEA 1K42A 3ECQA 4CUAA 3U37A 2VR4A 1UY2A 4GWJA 1JZ6A 3ACIA 4DXSA 2EIDA 4JKLA 4QX3A 3T0DA 3FN9A 5LA0A 2VJXA 3CMGA 4QX2A 1EUUA 2W95A 3MV01 1W9SA 2BGPA 2ZEYA 4JHZA 3P1IA 2W3JA 2WZEA 3LPFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WO1 A;  1W99 A;  1WCQ A;  3A21 A;  3K46 A;  4M4R A;  2ZXQ A;  1I5P A;  2WAB A;  5EJZ B;  2EIC A;  3UET A;  5EIY B;  3LEI A;  5I0D A;  1D7P M;  5DMY A;  4ARX A;  4ZZ5 A;  2V72 A;  3IAQ A;  2JKX A;  3I2J A;  4KI5 M;  5EJ1 B;  2EIB A;  1JZ8 A;  2DCJ A;  2J1E A;  2VZQ A;  2VZT A;  2Z4F A;  3T2P A;  1PMJ X;  4A41 A;  3ETP A;  4YPJ A;  5A1A A;  2QQO A;  1O8S A;  4ZY9 A;  1SHW B;  3ACF A;  3LEK A;  1SDD B;  2BZD A;  4UAP A;  3I3E A;  1DP0 A;  3HOB A;  1HN1 A;  3I2G A;  5LA2 A;  3HEI A;  4PF1 A;  2BER A;  4DUV A;  4ZXE A;  3K4A A;  3WF0 A;  4LHS A;  2W94 A;  2EIE A;  3GGL A;  1JYX A;  1W0N A;  3WF1 A;  1H6X A;  2W1W A;  1XNA A;  2JDA A;  2Y6G A;  1UX7 A;  1UXZ A;  1K45 A;  3NNG A;  4A6O A;  2B9V A;  3GM8 A;  1JYW A;  4QPW A;  1GU3 A;  2B4K A;  2XHN A;  3A22 A;  3IAP A;  2VZR A;  5CZK A;  5JUV A;  1MPX A;  3OBA A;  5G04 L;  1UY3 A;  1GNY A;  2VZV A;  2YG0 A;  1GOH A;  2E31 A;  2V5D A;  2QQM A;  2VZP A;  4A42 A;  1W8N A;  1BHG A;  2X05 A;  4TTG A;  1W8O A;  2J1A A;  2WN3 A;  3WF4 A;  2Y6J A;  3C7G A;  4DUX A;  1P8J A;  3T2O A;  4A45 A;  3OB8 A;  2Y6H A;  1EUT A;  4MOA A;  1JZ7 A;  3WNP A;  4ET7 A;  3VD3 A;  3VDA A;  1PX4 A;  4QX0 A;  4DUW A;  3LQC A;  2J22 A;  1K12 A;  4A44 A;  3D3A A;  1L7R A;  2ORX A;  5G05 L;  5IHR A;  4BXS V;  3WNK A;  1JYN A;  2YB7 A;  4XUQ A;  2QQN A;  4RYD A;  4LKS A;  5J1X A;  1OF4 A;  2VZU A;  1OD3 A;  3J7H A;  4P5Y A;  3F2Z A;  3A7Q A;  2VTF A;  2W1U A;  3CZJ A;  1ULO A;  2J1R A;  3DYM A;  4W50 A;  2VL4 A;  3HPN A;  3CIH A;  3W5N A;  1XNT A;  4E8D A;  3MO4 A;  2BGO A;  5LCW L;  3I2K A;  1XPW A;  1CIY A;  1UYY A;  1O8P A;  4BK4 A;  3BN6 A;  3ACG A;  4QB1 A;  1NUK A;  4QB2 A;  2RVA A;  2QBX A;  1JHJ A;  3VD5 A;  4A4A A;  4GZ9 A;  2W92 A;  2CDO A;  3WEZ A;  3CDZ B;  3I2I A;  5C70 A;  2ZEX A;  2RV9 A;  5HXM A;  2WO3 A;  4FI9 A;  3GXU A;  4W8J A;  4MAD A;  4DEV A;  3I3D A;  2W46 A;  1JI6 A;  2W91 A;  2VZ3 A;  3SKJ E;  2ZEW A;  5B4X A;  1OF3 A;  2VC9 A;  2VZS A;  5IFT A;  4UI9 L;  2YFU A;  1UY0 A;  2WAO A;  1ULP A;  2C4X A;  4P02 B;  1UMH A;  1F4H A;  4PQQ A;  3UNP A;  3W5M A;  3EB7 A;  4QAW A;  3VD7 A;  2Y6K A;  1UYZ A;  2LS6 A;  3DYP A;  4KWU A;  1UXX X;  2OKX A;  3T2Q A;  3THC A;  1US3 A;  3UES A;  1UZ0 A;  3SEP A;  1GOF A;  3CZU A;  2WUH A;  2W1S A;  1JU4 A;  2X10 A;  4LPL A;  2Y8K A;  3WNO A;  3OGV A;  3C7F A;  2VOT A;  2Y64 A;  1YQ2 A;  3NRU A;  3GDB A;  4JX0 A;  4L0P A;  1TVG A;  3OGR A;  5DPN A;  2X09 A;  2WZ8 A;  2YC4 A;  4DXR A;  3WF3 A;  4E8C A;  1JYV A;  2VCB A;  4OZO A;  4JKM A;  1CZV A;  2YC2 A;  1OH4 A;  4LQR A;  3VD9 A;  2VQT A;  2VCA A;  4XUT A;  1LNS A;  2QQK A;  3CKH A;  1L7Q A;  3ABZ A;  2WBK A;  1CZT A;  5IYY A;  1SG3 A;  1US2 A;  2WYS A;  1R64 A;  1UMI A;  3FHA A;  5JXJ A;  4CU7 A;  1JZ4 A;  1RYY A;  4PT6 A;  1NKG A;  3P6B A;  3PUH A;  4Z2A A;  3PUI A;  2VME A;  2BBA A;  1JZ3 A;  3K4D A;  1PMH X;  4MGQ A;  5LA1 A;  3NJX A;  1JZ5 A;  3HJR A;  3FHQ A;  4BK5 A;  4D0Q A;  2XON A;  1CZS A;  5FUI A;  1UWW A;  4XUP A;  2ORZ A;  5JMO A;  3OG2 A;  4OUE A;  4AG4 A;  1W9T A;  2W5F A;  2YFZ A;  3LPG A;  4KMQ A;  4ZZ8 A;  5HPO A;  3WNN A;  2E33 A;  3WNL A;  4CU8 A;  4M4P A;  3WSO A;  2VQU A;  2E26 A;  5C7G A;  4QDS A;  4QB6 A;  4OYU A;  3ACH A;  1IQD C;  4QDR A;  2J1S A;  5JXH A;  1XC6 A;  3T08 A;  3MBW A;  4QX1 A;  5CYY A;  2R7E B;  3VD4 A;  2VMD A;  3T0A A;  2C26 A;  1T2X A;  2WQ8 A;  5JXG A;  2WO2 A;  4D8M A;  2VZO A;  1JU3 A;  4MO3 M;  3CQO A;  3WF2 A;  3K75 B;  1GMM A;  2KD7 A;  3JXS A;  2C9K A;  4CUB A;  3OEA A;  2CDP A;  1K3I A;  4XUO A;  5JXI A;  4CU9 A;  3LE0 A;  3WQB A;  3K4Z A;  5DQ0 A;  1KEX A;  2ZEZ A;  2ID4 A;  3A23 A;  3SEE A;  1UYX A;  4XVH A;  4P08 A;  2VMF A;  4W4Z A;  3I2H A;  2VMC A;  3MUY 1;  3MV1 1;  3OGS A;  3HNM A;  4OMD A;  2VM9 A;  3HNB M;  1CX1 A;  4CUC A;  3T09 A;  4TXW A;  5C71 A;  5JR2 A;  4A3Z A;  2V4V A;  2W9X A;  3MUZ 1;  5DN2 A;  4XUR A;  4UOJ A;  4AAX A;  2WN2 A;  1DYO A;  3C7O A;  3E1F 1;  4MGS A;  4OMC A;  4XUN A;  1O59 A;  2DCK A;  1GOG A;  2XOM A;  3AC0 A;  1UY4 A;  3LEG A;  2XQX A;  3VDB A;  1GUI A;  4HG6 B;  2W47 A;  2PQS A;  1UY1 A;  2QQJ A;  2RJ2 A;  5B4N A;  4BDV B;  3III A;  3THD A;  3VDC A;  4XZU G;  5F7U A;  3HN3 A;  3NQH A;  2J7M A;  3I2F A;  3SKV A;  3C7E A;  2QQL A;  3C7H A;  1KGY A;  2VCC A;  2VO5 A;  3C8X A;  1NX9 A;  4GWI A;  1WKY A;  2J1V A;  3I97 A;  2L9L A;  2LW8 A;  3FL7 A;  3K77 A;  5IFP A;  4BJ0 A;  2JE8 A;  1TG7 A;  4ARY A;  1DLC A;  4DXT A;  1NAE A;  1OT5 A;  3EYP A;  2HYX A;  3OEB A;  1J84 A;  3I3B A;  4CVU A;  3DEC A;  4P00 B;  3ZM8 A;  2WDB A;  1GQP A;  4JKK A;  1JZ2 A;  5IJR A;  2WAA A;  2VZ1 A;  2QQI A;  2Y6L A;  4DEQ A;  2J1U A;  2JD9 A;  1J83 A;  4QDQ A;  2W1Q A;  3WNM A;  1PX3 A;  1W9W A;  2DDU A;  3BGA A;  3HNY M;  2J1T A;  1H6Y A;  3NJV A;  3IB3 A;  3T0B A;  3IDA A;  4IUG A;  2W87 A;  4RN5 A;  2E32 A;  3DYO A;  4CU6 A;  1F4A A;  2HLE A;  1K42 A;  3ECQ A;  4CUA A;  3U37 A;  2VR4 A;  1UY2 A;  4GWJ A;  1JZ6 A;  3ACI A;  4DXS A;  2EID A;  4JKL A;  4QX3 A;  3T0D A;  3FN9 A;  5LA0 A;  2VJX A;  3CMG A;  4QX2 A;  1EUU A;  2W95 A;  3MV0 1;  1W9S A;  2BGP A;  2ZEY A;  4JHZ A;  3P1I A;  2W3J A;  2WZE A;  3LPF A; 
#chains in the Genus database with same CATH topology
 1QJE A;  1WCQ A;  3A21 A;  4M4R A;  1H4H A;  1SFP A;  1FV3 A;  4W6Y A;  2ARX A;  3HIF A;  1Y7B A;  4LKE A;  3RQ0 A;  1YJK A;  4Q0Q A;  4UFL A;  1V9U 3;  3CJX A;  4YGB A;  5DAV A;  4YZ3 A;  3OPT A;  3MLJ A;  3NV4 A;  4CDW C;  3O1R A;  1DQ4 A;  2IWG B;  2OZ6 A;  3GZE A;  1SBE A;  5L9V A;  5K8S A;  5LK5 A;  1WCK A;  1FNY A;  2Z2S B;  3CLP A;  4XZP A;  1S0G A;  4J25 A;  3WCS A;  1MZE A;  4WM7 A;  4UW3 A;  1J3P A;  2ZKL A;  1LGC A;  1JZ8 A;  4Z8B A;  4GB3 1;  1GBG A;  1ZRR A;  4XFG A;  2VZQ A;  2Z4F A;  3KMH A;  4KQ7 A;  3VUO A;  1PMJ X;  4KU7 A;  5ABJ B;  1MZ6 A;  3J8F 3;  1V6O A;  3JD7 1;  4Q4W 1;  3ZSK A;  1PK6 B;  3JU9 A;  5ANQ A;  3M7A A;  1QJU 2;  2VMG A;  2VBD A;  1SLL A;  3OUH A;  3KF3 A;  1SHW B;  1XYN A;  2XKP A;  1UF2 C;  3D5O A;  3KF5 A;  2Y38 A;  4CDQ C;  2BZD A;  5JDB A;  3O1U A;  1LRH A;  2AYH A;  5KHG A;  1DP0 A;  4IE5 A;  3UKN A;  2W2I A;  5K9Y A;  3AVS A;  2HWD 2;  3I2G A;  5L19 A;  1RUG 2;  1OSG A;  3JCI A;  4U36 A;  3ZXF A;  3E6B A;  4DUV A;  1I6X A;  1SPP A;  2VGD A;  4ZXE A;  2VNG A;  3DEM A;  3RWK X;  1OKQ A;  1UAI A;  3GZT B;  4BIS A;  1FAY A;  3KB5 A;  4JHT A;  3WF1 A;  4KU8 A;  4FPG A;  4TYS A;  2VY0 A;  4O9G A;  4OVE A;  1QGL A;  2Y6G A;  3OF1 A;  1H8T B;  1R09 2;  1UXZ A;  3WVJ A;  4FSJ A;  1K45 A;  1R1A 1;  3RG0 A;  2VW0 A;  3CNA A;  3O5S A;  3UT0 A;  2ZGN A;  4LK6 A;  4RHV 3;  2WS9 1;  3BKZ A;  4FAH A;  1VR3 A;  3AFK A;  3JB4 C;  1NYW A;  4E27 A;  2JE9 A;  4LLO A;  1OUS A;  5CZK A;  3RI8 A;  2P34 A;  3IN9 A;  4BQX A;  4PHZ A;  3ZN6 A;  5C33 A;  1DHK B;  1W8U A;  5F5A A;  1SZB A;  4AEM A;  2HWB 2;  1VRB A;  4Y20 A;  4Q4X 1;  2VZP A;  3UGF A;  2BOJ A;  1C28 A;  2ADD A;  5DDJ 1;  2P5B A;  1OVS A;  1VRH 3;  2X05 A;  4YG3 A;  1DQ1 A;  1W0O A;  2RS5 1;  2WN3 A;  4QXK A;  3LOB A;  5T5O A;  1MZ5 A;  4PLO A;  2B7Y A;  4B8E A;  3ZIX A;  1I9R A;  1SBD A;  4C0H A;  4CTE A;  2RDR A;  4IES A;  4A45 A;  5BY5 A;  1DU3 D;  4FTS A;  2Y6H A;  2Y26 A;  3RI9 A;  3F95 A;  5A32 A;  2W39 A;  5FZI A;  4OUM A;  2VNV A;  2O8O A;  1TNF A;  4QKD A;  4ZON A;  4G9S B;  1PK6 C;  4ZKT B;  1I1E A;  4XDQ A;  3LSD A;  4COZ A;  3OGG A;  1VBC 3;  4LBM A;  1QDC A;  4AEK A;  1UKG A;  5G05 L;  3CEW A;  2RMU 1;  4FOW A;  4V2V A;  3WNK A;  5CFD C;  1ZA7 A;  1LOG A;  1JYN A;  4Q0S A;  1LJ7 A;  4CDX A;  2DUR A;  1RVF 1;  4WM7 B;  4YGC A;  4EZH A;  2QQN A;  3UGH A;  4ZU7 A;  4LKS A;  4QKF A;  4XAB A;  2VZU A;  1XSR A;  1AX2 A;  4P9G A;  5FXV A;  4FT8 A;  1FMD 2;  4I30 A;  4P5Y A;  5AFE A;  1AR6 2;  3VKF C;  4N43 C;  1DLL A;  3A7Q A;  2VTF A;  4NN0 A;  3ZKY A;  3CZJ A;  5JOZ A;  1LGN A;  1OA2 A;  1PMI A;  4MUV A;  5F32 A;  5FYM A;  3H1W A;  1J3R A;  1YHF A;  2AR6 A;  1HQW A;  4HXC A;  4NJ4 A;  4W50 A;  1O3T A;  4Q0U A;  3ZDV A;  1MVE A;  3CIH A;  4IV1 C;  4Z07 A;  2P3K A;  2ZML A;  3C2U A;  4IQP A;  5FYS A;  3ILR A;  3OY8 B;  1ND2 A;  3MIE A;  1LOE A;  4HT1 T;  3PIJ A;  4NRO A;  4ZU4 A;  2BGO A;  3DKW A;  5K7P A;  1F5J A;  1Z0H A;  4UBH A;  4UFH A;  1D4M 2;  2P37 A;  5GM0 A;  1UYY A;  3T30 A;  3MIG A;  3Q8A A;  1PM4 A;  4NAM A;  5A7P A;  2PEL A;  3MEP A;  1C3H A;  3MIH A;  1HRV 2;  4QB2 A;  1RMU 1;  1ZX5 A;  5BNP C;  1AXK A;  1RUI 3;  3MF6 A;  4Y5T A;  1BMV 1;  2ZMK A;  1FPN 3;  1JUH A;  5I0U A;  1ZBA 1;  4ZU5 A;  3K3N A;  3RDI A;  3VBF C;  3VD5 A;  1HIX A;  2W92 A;  1V6L A;  3KT4 A;  4UT5 A;  3I2I A;  5HXM A;  4LO7 A;  1YO8 A;  3GXU A;  4CCD A;  4FVV A;  2R07 2;  4MAD A;  1QJF A;  3I3D A;  2YU1 A;  5FZ4 A;  4BB3 A;  4BMB A;  1XND A;  2W91 A;  2YMZ A;  2DU1 A;  2WQZ C;  3AMN A;  1W3V A;  1W8T A;  5IVB A;  3H8X A;  1OOP C;  2BU9 A;  3N9P A;  2D7F A;  4QWN A;  4HK9 A;  5B4X A;  4YZ4 A;  5A32 B;  1XQN A;  3SCF A;  4OQ8 A;  2YYO A;  2VC9 A;  4AK3 A;  1B35 B;  3AJY A;  4NWW A;  2YFU A;  4QPY A;  3VZN A;  4EZ4 A;  3RRD A;  5FP7 A;  4CXY A;  3DPR C;  1ULP A;  4PI2 A;  3DV8 A;  1A34 A;  4M0H A;  4ZPI A;  2XML A;  3AZX A;  3CF6 E;  5J37 A;  1GLH A;  3ZFE C;  4BA6 A;  1RUO A;  2PXJ A;  2BWA A;  4RQP A;  2B5H A;  4ITC A;  1AR9 3;  4BWO A;  1F15 A;  3FC0 A;  2P17 A;  5FFO C;  5FKC A;  4Y4Y A;  3WDW A;  3EB7 A;  2R30 A;  3PTY A;  4XJA A;  3VD7 A;  5JSP A;  3BIE A;  1ND2 C;  1K5J A;  1UYZ A;  3DYP A;  4KWU A;  3ZFG A;  1NY7 2;  1ZM1 A;  1DGW A;  1W3X A;  1AJK A;  3ZYJ B;  3HD8 B;  1UZ0 A;  5DDJ 2;  2VH9 A;  3VBR C;  2DVA A;  2JJ6 A;  1DFQ A;  4OZX A;  5DZE A;  3VDD B;  4K9S A;  2WC2 A;  5T5L A;  3CZU A;  2WUH A;  5IAV A;  2F4L A;  2FZ2 A;  2W1S A;  4KWJ A;  4E4S A;  3N3H A;  1J1T A;  1JU4 A;  2X10 A;  4AEJ A;  4LPL A;  5DAX A;  1MQT B;  3M3C A;  3GZA A;  1BQP A;  1KDK A;  3MLK A;  1GAN A;  5JOY A;  3B7M A;  5L9R A;  1H1I A;  2JDK A;  3NRU A;  3AP5 A;  1STM A;  1HXS 3;  4EWA A;  2RS5 3;  2PFW A;  2JG9 C;  3D82 A;  4AGG A;  4FTB A;  5FLJ A;  2QQV A;  2XUE A;  3OGR A;  2X09 A;  4LMF A;  1CN1 A;  5FP4 A;  1GQH A;  2DVD A;  3WF3 A;  2PQQ A;  5ISL A;  1JYV A;  3J4U H;  5FYZ A;  3ZOI A;  2TUN A;  4TWT A;  4OLL A;  3SQO A;  1NCR B;  4FPE A;  2VQT A;  4XUT A;  3MIF A;  1RHI 2;  2W52 A;  3BIW E;  3ABZ A;  3VBS A;  2I2S A;  1AYM 1;  4DO0 A;  5IYY A;  4NHX A;  5FLI A;  4R8H A;  1SG3 A;  3ZN4 A;  1V6J A;  4PJY A;  2ARC A;  1QJY 3;  4P9Y A;  1NCQ B;  1IS5 A;  3WG1 A;  2XJP A;  3R05 A;  1N47 A;  1L3J A;  1CAW A;  4CDQ A;  3NNM A;  1QOO A;  2VVE A;  1XE0 A;  2GC3 A;  4ZS3 A;  4OHY A;  2GP3 A;  1ENS A;  2OVU A;  3IWZ A;  4Z2A A;  5KWR A;  4AI1 A;  5AVP A;  2VME A;  4IE4 A;  5CNA A;  2GME A;  1RUH 2;  5A3W A;  2EXK A;  2GH2 A;  1YEW A;  4UYB A;  5D2A A;  2UWB A;  2DFC A;  5K0U A;  5LA1 A;  4FPL A;  4XAE A;  2RDS A;  1JZ5 A;  3NV2 A;  5FMO S;  1LU2 A;  4BK5 A;  2HWC 1;  5FY4 A;  4PI0 A;  2NMO A;  5CFC C;  1OD5 A;  4YVS C;  1E5R A;  5FUI A;  2GP5 A;  1JMU B;  5JMC A;  1PGS A;  3WUC A;  2EA7 A;  2D40 A;  1QKQ A;  1POQ A;  5LZ6 A;  1W03 A;  1OA3 A;  4IXL A;  3HT2 A;  3OG2 A;  2A6X A;  2K9Z A;  2LUW A;  3N36 A;  5E6H A;  3SMH A;  1Q8O A;  1S0I A;  1QJX 3;  2RS5 2;  2W5F A;  1LOA A;  1VMF A;  5EPA A;  4F3J A;  3ZXG A;  1GP6 A;  3POB A;  5HPO A;  3NVC A;  5F8P A;  4Z82 A;  1APN A;  1PO2 3;  2PAK A;  3N35 A;  2VUD A;  1IHM A;  3RZZ A;  4NIH A;  1V6M A;  2JG9 A;  4XOG A;  3AK0 A;  4FFF A;  4QB6 A;  2GC0 A;  1H8T A;  4Z2W A;  2BVB A;  3ZYF A;  4XFF A;  4OYU A;  4K1Y A;  4Y1Z A;  3ACH A;  4LIV A;  2J1S A;  4QPG A;  3WZ1 A;  1T6B X;  5FO9 B;  1ZZC A;  1ASJ 3;  1ASJ 1;  4WM8 A;  4QX1 A;  5A7W A;  4I0A A;  1RL3 A;  5CYY A;  2WL1 A;  3VD4 A;  5JCT A;  1YRZ A;  4M3C B;  5LY2 A;  4QX5 A;  2VMD A;  5FWJ A;  1E57 A;  1LHO A;  1URX A;  3RZG A;  3MLL A;  4LK7 A;  1OOP A;  1JN2 P;  1RTV A;  5JXG A;  4A7Y A;  1RJ7 A;  1H9W A;  4YM3 A;  4MXW B;  1X33 A;  1PO2 1;  3JQW A;  1DCS A;  3CQO A;  1LOB A;  1S0J A;  3K75 B;  1QJZ A;  3POF A;  1GNZ A;  1E5I A;  2VOV A;  4OI2 A;  4CEW A;  5FTT C;  4C8D A;  1WLT A;  4IEV A;  2VUC A;  3POS A;  4Y5Z 0;  4A3X A;  1BVP 1;  2ARB A;  5FMO L;  1D4M 1;  5C9A B;  5CFD B;  1JYI A;  3WP4 A;  5F5Q A;  4CU9 A;  5EJ3 A;  1D4V B;  1NA1 A;  3VBO B;  3O1V A;  4JGZ C;  4ASK A;  1G6N A;  2ZEZ A;  1QH6 A;  1VBC 2;  2VBP A;  3MYX A;  4HPK B;  5F3C A;  1RVF 2;  1YIF A;  3SEE A;  3B9C A;  5FPZ A;  4FAG A;  1EP0 A;  2X53 S;  2GNM A;  2H0B A;  2Q8D A;  1ZRE A;  4YVS A;  1LHW A;  1D0G A;  1LKN A;  1SQ4 A;  3HNM A;  3ROU A;  4LBL A;  2QUO A;  2P4E A;  3H42 B;  4QHB A;  4X6R B;  4AED A;  1IOA A;  4CUC A;  3I2D A;  2G1M A;  4YW3 A;  4F7Z A;  2JD4 A;  4WVM B;  1TMF 1;  2F4P A;  1RUD 2;  1C1L A;  1MS9 A;  3EJK A;  2VOX A;  4GAZ A;  5D8A B;  2ZGU A;  5FJH A;  2YPJ A;  3H0O A;  4AED C;  1XU1 A;  4Q8K A;  2QJV A;  5JR2 A;  3IDB B;  4IEY A;  4A3Z A;  2V4V A;  3J7M A;  1QMJ A;  3MUZ 1;  1OLM A;  4CE8 A;  5DN2 A;  2HWC 2;  3O1S A;  4WZF A;  4RQP C;  2WNO A;  4Y1X A;  2AEY A;  3ELN A;  3SIS A;  2OA2 A;  3AYE A;  5FZO A;  1UMZ A;  1V6I A;  3H3Z A;  2DCK A;  5FZ1 A;  1EAH 2;  5FZF A;  1KXG A;  3VBS C;  2VUL A;  1GUI A;  1GZW A;  4HG6 B;  2W47 A;  1Q5O A;  3DN7 A;  1BXH A;  1WW7 A;  4NOT A;  4QPI A;  1LHV A;  1Y4W A;  1ZBE 1;  1QIQ A;  3S57 A;  4YVW A;  1BEV 2;  4IE0 A;  5GLW A;  4YM1 A;  3AKR A;  2WS9 2;  4XZU G;  4TLF A;  5GZD A;  4CEW C;  3NQH A;  1VBA 3;  4BQY A;  3B02 A;  1IS4 A;  3H3L A;  3C7E A;  4QGM A;  1NY7 1;  3GF6 A;  1IGO A;  3GJA A;  5DG1 A;  3C7H A;  3U78 A;  1H2L A;  3WW3 A;  1LB2 A;  4GIQ A;  2JEM A;  1RUN A;  1MEC 3;  4PF5 A;  2HWF 1;  3ZO0 B;  2I45 A;  2XBO 2;  1NX9 A;  2QCS B;  4JGY C;  2L9L A;  3T4H B;  2FMY A;  4XBN A;  2K46 A;  4RS5 A;  2VNR A;  1G9B A;  2JE8 A;  1TG7 A;  4JGZ B;  3LWC A;  4RHV 1;  5BUV A;  1HV0 A;  4JQR A;  1V0A A;  1FT9 A;  2X5I B;  4IEU A;  1NAE A;  3PNA A;  3TAY A;  4BXF A;  4CP1 A;  5DAQ A;  3KV9 A;  5FUN A;  1UZZ A;  1YC6 1;  4KL1 A;  5A3P A;  4NWV A;  5LWB A;  2GMM A;  4AVA A;  4UF0 A;  1GQP A;  1JZ2 A;  1ASJ 2;  2HBT A;  3PUA A;  5LB6 A;  2Q1M A;  5FBZ A;  3ZYH A;  1DIW A;  4MGZ E;  2VZ1 A;  3Q8E A;  4G3Y C;  3AYA A;  2Y6L A;  1JOJ A;  5LBF A;  3BTZ A;  3V0A B;  1R1Z A;  4GD4 A;  1AYM 2;  2J1U A;  2OUH A;  1J83 A;  2D98 A;  1HRV 1;  2O1Q A;  2VD7 A;  4Y1Y A;  4DY5 A;  3IMM A;  2BBV A;  1W9W A;  4AVS A;  2BV4 A;  2DF7 A;  3M4F A;  5FZG A;  4CCN A;  4YFW A;  3HNY M;  1DGR A;  1O6U A;  3V56 A;  1H6Y A;  3HR9 A;  2WNV B;  4XJ9 A;  4JDN A;  3T0B A;  1WMX A;  2BJS A;  1RUE 3;  1QJU 3;  4Y26 A;  1KD7 A;  3SH4 A;  2ZZQ A;  4E2G A;  4R4Z A;  2JE7 A;  5FV3 A;  3DYO A;  4CU6 A;  1F4A A;  2HLE A;  3BOP A;  5FPB A;  3RSJ A;  4CUA A;  1W6N A;  4DPN A;  5F6L B;  4FXK B;  4GWJ A;  5CVR A;  2ZPX A;  2TEP A;  3WP3 A;  3TBD A;  4S2H A;  4DXS A;  1Y9M A;  3WG3 A;  3S5Q A;  4DMI A;  2FDH A;  4K6B A;  3AYC A;  2J42 A;  2YDE A;  4MGT A;  2VPV A;  1BBT 2;  5LA0 A;  1CAW B;  3CMG A;  4CDQ B;  3ZPY A;  3MV0 1;  1FV2 A;  3GBG A;  3LEM A;  1HB1 A;  2CTV A;  3BPZ A;  4K1Z A;  3O12 A;  2BGP A;  2ZEY A;  4XHB A;  2W3J A;  4KBB A;  1KFU L;  4K3U A;  1VBD 3;  2YY1 A;  3VBO C;  1CIW A;  3FFQ A;  3K46 A;  2GU9 A;  2ZXQ A;  3ZSE A;  2WAB A;  2HEW F;  2Q1F A;  5DAW A;  1V9U 2;  1QJY 2;  1N1T A;  5DUX A;  2ZGR A;  5A6Y A;  4YVW B;  5EIY B;  2D93 A;  3FBY A;  4OHZ A;  5A6Q A;  5DZG A;  3SLI A;  1ZBA 3;  2WZP P;  1TNR A;  4FP2 A;  2O8Q A;  5I0D A;  4UXA A;  1V70 A;  4IW3 A;  4ARX A;  4ZZ5 A;  1QQP 1;  4IGP A;  3JQX A;  3VHR A;  1JHN A;  1LU1 A;  1W6Q A;  1NCQ C;  2B46 X;  1RJ8 A;  1YFX A;  5EJ1 B;  2EIB A;  5FPA A;  2J1E A;  2OQ6 A;  3EQE A;  4MGK E;  4XTP A;  2VNO A;  1YQC A;  4RGK A;  1LEC A;  2VZT A;  4QHO A;  3VZJ A;  1VP6 A;  4DRV A;  4C91 A;  1DDL A;  1ENR A;  1S55 A;  2BYV E;  3OTF A;  4MV2 A;  3U4X A;  2D6P A;  1O4Z A;  3WV6 A;  5A1A A;  3MGU A;  5CA6 A;  5TSW A;  2Z69 A;  4DOU A;  1DQ0 A;  5H9S A;  1EAH 1;  4UWD A;  3KQ4 B;  1W6Q B;  4IEW A;  1Q56 A;  4YFZ A;  2JDH A;  3AKT A;  4N9H A;  4R9B A;  5LAT A;  1ZYB A;  3VBH C;  1PO1 3;  4QHZ A;  3Q9O A;  2D6N A;  1LCL A;  3PDQ A;  3AKS A;  1ZBE 2;  4XF0 A;  3WIN E;  2HKX A;  4BM8 A;  1NZI A;  4HKW A;  3WY6 A;  2BER A;  1PGW 2;  1HB3 A;  4XJU A;  2WT1 A;  3WF0 A;  4YG6 A;  3BI3 A;  4LHS A;  5JIA A;  5J7M A;  3W9A A;  1W8F A;  4JRA A;  3TNQ A;  1MAC A;  1PO1 1;  2RJL A;  2WA4 A;  4P5H A;  5FY9 A;  3ZIW A;  1FNZ A;  4GAL A;  2W1W A;  4MET A;  3BU0 A;  1DGL A;  5FP3 A;  1R09 3;  1HLC A;  3OGJ A;  4N7U A;  3KWV A;  5FY5 A;  3O1M A;  5C8W A;  2R07 3;  3GHN A;  3BTY A;  3PIG A;  2B9V A;  4JRL A;  4P9L A;  4AF9 A;  3MID A;  4QPW A;  3E6D A;  4LUK A;  4OCT A;  1CPM A;  1PM7 A;  5LRR A;  2XHN A;  1Q43 A;  5DZF A;  1SCR A;  1W39 A;  4N53 C;  3HQR A;  1H8V A;  1WMF A;  5GJ6 A;  4K21 A;  4K7J A;  5G04 L;  3G7D A;  1VRH 1;  3JD7 2;  4Q4W 2;  2Q8C A;  4RGG A;  1N1V A;  1GNY A;  4AVB A;  2VZV A;  4Y22 B;  2WT0 A;  1ZRC A;  2YG0 A;  1AR7 1;  2RE9 A;  2WFF 1;  3LDR A;  5F5C A;  3VZL A;  1UYP A;  2V5D A;  2QQM A;  5AC9 3;  1X8M A;  1KRI A;  4A42 A;  1WCD J;  1XE7 A;  3TEX A;  1W8O A;  3IDE A;  4KH9 A;  3AM2 A;  3GBF A;  3VKM A;  1OUR A;  4HOO A;  3WF4 A;  4DUX A;  1JH5 A;  1AX1 A;  1ZRI A;  2XVL A;  1SEF A;  2WS9 3;  1EUT A;  1XU2 A;  3V0B B;  4Z92 B;  4HBN A;  4ET7 A;  1C1F A;  3SIT A;  2ZMN A;  3VD3 A;  5I8T A;  4XFA A;  5LY1 A;  3TB0 A;  2E51 A;  2OPW A;  4QX0 A;  2RR1 2;  1COV 2;  1WCS A;  2R04 3;  4MHU A;  5IVV A;  2FD8 A;  1K12 A;  4LBN A;  1RMU 3;  3MFA A;  2D43 A;  5IHR A;  2D97 A;  5JOX A;  3N4M A;  4RFR B;  3THT A;  3BVC A;  1GFF 2;  2YB7 A;  5FPV A;  3ZDS A;  5KHK A;  2GAL A;  4DIQ A;  3JZV A;  4GWM A;  4Y22 A;  3D4K A;  4D94 A;  1OF4 A;  4AGV A;  5J1X A;  3M3O A;  5JZG B;  5FBJ A;  2RS3 3;  4CEY C;  3QH7 A;  1ZVF A;  4L92 A;  2NN8 A;  4JDM A;  2ZGL A;  3N9L A;  3QBQ A;  5A1F A;  3QCW A;  2GZW A;  5F2W A;  1FOD 3;  2AEN A;  5GZC A;  1BBT 1;  3LKJ A;  4PLM A;  4QXB A;  5KR7 A;  1QJX 1;  1H9P A;  1SLA A;  4Y33 A;  5IWF A;  3DYM A;  2ZAB A;  4LHL A;  1F8V A;  2XVG A;  1JYT A;  1QXJ A;  2GMP A;  1VBB 2;  4PDW C;  4NHM A;  5CKQ A;  4NID A;  5T5J A;  4E8D A;  1PZ8 A;  3GBW A;  3MO4 A;  1HRV 3;  1WW4 A;  2BWC A;  5LCW L;  2JIC A;  4G4F A;  1XPW A;  1CIY A;  2D6M A;  1Q8P A;  5IK5 A;  4GXL A;  5CU1 A;  2A6Z A;  3K2O A;  3ZFE B;  1W8Z A;  2WNU C;  1S2K A;  4W6X A;  4AFC A;  3L2Y A;  4BK4 A;  1ZRD A;  4MX3 A;  5F6K A;  3ACG A;  5IVF A;  3ILF A;  3KV6 A;  2BPA 2;  4KG0 A;  1NG0 A;  1RIR A;  1NUK A;  4AI0 A;  3VHP A;  2RVA A;  1HDK A;  4BQ4 A;  5A70 A;  4HSL A;  1C8N A;  3V64 A;  1JHJ A;  3LDB A;  4IL7 A;  1GYK A;  1IPJ A;  4A4A A;  3A0K A;  2WZR 3;  2YGL A;  1XNC A;  4AI8 A;  4NRM A;  1Q3E A;  4BYY A;  4AE2 A;  1YWK A;  4F8A A;  2EAK A;  1W6O B;  3S7I A;  4LKF A;  4YM0 A;  1MS8 A;  5FMC A;  4DEV A;  1W04 A;  2JG8 C;  3UL2 A;  3AYD A;  1CAX B;  4RR3 A;  4CDX C;  4BCU A;  3SKJ E;  3KD4 A;  3PLQ A;  1H4G A;  2JG8 A;  1TME 1;  1VBE 2;  3H1Y A;  4KWK A;  1MS4 A;  1XBF A;  2WR9 A;  3PVB B;  5B2G B;  5IFT A;  2ZAC A;  5IVY A;  2Q5T A;  3ZXJ A;  2MPF A;  2D5H A;  4XAA A;  2AZ5 A;  3AZV A;  4XE9 A;  2ZHL A;  4LUM A;  4XMA A;  3CU7 A;  4COV A;  5CKM A;  1T6G C;  4XFB A;  3WDX A;  4FPY A;  3OCP A;  2DVF A;  4P02 B;  3S6P A;  5KXE A;  2ADE A;  5I93 A;  2Q4S A;  1QXP A;  4IEZ A;  3BOD A;  4JGY A;  4BZ4 A;  2RM2 3;  1EY2 A;  1HQN A;  3UNP A;  2R0F A;  5LW9 A;  5BNO B;  1RIN A;  4K8R B;  1BZW A;  2HWE 1;  4NAO A;  4A7Z A;  3FUQ A;  3GCW A;  1US3 A;  1LHN A;  3QD6 A;  4U2A A;  3INA A;  5AC9 2;  1HKD A;  1DF0 A;  5EYY A;  3NO8 A;  3SEP A;  2A6Y A;  3VBU C;  2RJK A;  3PJQ A;  4XTM A;  1WA6 X;  1YFU A;  3USS A;  2JDN A;  3OYW B;  2Y8K A;  3WNO A;  1V00 A;  3Q8C A;  5T52 A;  3PU3 A;  2Y64 A;  2AUY A;  3S7E A;  5APA A;  4JX0 A;  4MGI E;  2O14 A;  4JTN A;  1HRI 1;  2XWJ B;  5ABJ C;  4NVP A;  5HXV A;  1WBF A;  3QAC A;  2R1B A;  3LA2 A;  4B4Q A;  2W68 A;  4Q1R A;  4BIO A;  4DXR A;  5JZG A;  2ET7 A;  1RUD 3;  3ZXK A;  1VAK A;  2RHP A;  2VCB A;  1FOD 2;  2VVF A;  2ZHM A;  5I91 A;  2CYF A;  1LEN A;  3AKP A;  1W0P A;  2JWP A;  4LQR A;  1UPI A;  1FMD 3;  1MS3 A;  1ZNP A;  2VCA A;  4IEO A;  1LNS A;  1QY4 A;  1ODN A;  2IXI A;  4V2W A;  5FQ0 B;  3RMX A;  3ZR5 A;  5C4W C;  1DQ5 A;  3B00 A;  5IK8 A;  1VBE 1;  3POJ A;  1QQP 2;  3VZO A;  4CDX B;  1US2 A;  2WYS A;  3AP7 A;  2P1B A;  1RUF 3;  3M8L A;  5FOJ B;  3KVB A;  5T3N A;  3ON7 A;  2PLV 2;  5ERL A;  3I8T A;  3V0B A;  4ZXK A;  4XQD A;  4NPM A;  4PT6 A;  3MIB A;  2ZGQ A;  3PUH A;  5A7N A;  4LKD A;  2BBA A;  5F5I A;  3LGR A;  1RUE 2;  4LO6 B;  4AQS A;  1ACC A;  1I5Z A;  3IPV B;  4Q26 A;  2DCZ A;  1V6K A;  3JUU A;  3AP9 A;  2WZR 1;  3HJR A;  5FR3 A;  3FHQ A;  3PUQ A;  4YZ2 A;  4D0Q A;  4RGA A;  1GP5 A;  4ES8 A;  3AXE A;  3G6J B;  1AUY A;  3IT8 A;  4XF3 A;  2E9Q A;  4J1X A;  3WDU A;  3FLP A;  5CEH A;  4QQ2 A;  4XUP A;  3SNM A;  4Q2F A;  2ORZ A;  5FK8 A;  3SH5 A;  5GAL A;  5EXO A;  5HCB A;  2P3Y A;  3AMH A;  2QFE A;  2YBP A;  1VBA 1;  4NE9 A;  2ZKN A;  2E33 A;  2OPK A;  1A8D A;  3WSO A;  4XEZ A;  1B35 C;  3A0N A;  3O1P A;  4QDS A;  2OUJ A;  4LO4 B;  4COY A;  4HSJ A;  4YG0 A;  1H1A A;  3VHO A;  5KHH A;  1HN0 A;  2VQA A;  3BU7 A;  4Q4X 2;  4WM8 C;  1HV1 A;  5A7W B;  5IK4 A;  2ZAA A;  1W28 A;  1IQD C;  1AXY A;  1KJR A;  5A7Q A;  4N53 A;  5EZW A;  3QOP A;  1NXD 1;  4XBL A;  4FP3 A;  3FFZ A;  4LTA A;  3MBW A;  1REF A;  3V65 A;  4B4R A;  5AC9 1;  1A3K A;  5I0S A;  4E4H A;  4LXL A;  1H1M A;  3ZX7 A;  1H2M A;  3PMS A;  1VB4 A;  4KBZ A;  4C0B A;  1UOF A;  1TMF 3;  4HVR A;  2G9Z A;  4XF9 A;  1TEI A;  2EVX A;  4JCK A;  3WF2 A;  5A33 B;  1GMM A;  2UU8 A;  4BPZ A;  3RVH A;  3FUO A;  1C8M 1;  4Q4V 2;  4AXO A;  2B9U A;  2F6B A;  1SCS A;  1C4R A;  4URT A;  2R32 A;  2ZX4 A;  2VTX J;  1DZR A;  1FPN 2;  4LEJ A;  1JTZ X;  1NT0 A;  4MHR A;  2JXA A;  2XUM A;  5FYB A;  3NKT A;  5JR7 B;  2PHW A;  2QZ2 A;  1PVC 3;  3DUI A;  5IW0 A;  4FFI A;  4XUO A;  3Q8F A;  1PGL 1;  2JDP A;  3LE0 A;  4UBG A;  1E5S A;  3HWJ A;  3OJB A;  4QMA A;  3AMQ A;  5DQ0 A;  1KEX A;  3EHK A;  1REE A;  2AH2 A;  2W0X A;  4D7Y A;  3A23 A;  1PIV 1;  3LD8 A;  5C3P A;  1OFN A;  4LOT A;  2JB4 A;  5HV4 A;  2EXJ A;  5SV5 A;  3J9S A;  4Y24 A;  2VMC A;  2HWE 3;  2WWJ A;  3LZZ A;  1SBF A;  3H8R A;  1WGP A;  4PBO A;  4XAC A;  1XOY A;  3UJO A;  2KM2 A;  1X8E A;  3VZK A;  1X36 A;  4E2Q A;  3OPW A;  1NLS A;  3L2H A;  1OXC A;  3HNB M;  3J8F 1;  3OYW A;  4YLZ A;  5FZC A;  1NCQ A;  1WLD A;  4HN0 A;  3VBH B;  4AHY A;  4AI2 A;  3MI8 A;  2DYC A;  3T09 A;  3VL8 A;  4JVA A;  4GH4 C;  4KWL A;  4XCB A;  1ND3 B;  3DPR A;  1MZF A;  5C8C B;  1OKO A;  2CWS A;  4M01 A;  5FWE A;  4B7E A;  2V4A A;  1L7L A;  2BQP A;  2CL2 A;  1TME 2;  3D6E A;  3U4S A;  4CEY B;  1RIT A;  2HYK A;  2WN2 A;  1DYO A;  3C7O A;  2RS1 1;  2DTY A;  1LOF C;  3POI A;  4XUN A;  3JBG 3;  3TEY A;  1GOG A;  4FOY A;  2WNV A;  2XQX A;  4XHX A;  1OPM A;  3EXU A;  1J1L A;  2QQJ A;  3FBM A;  3LB9 A;  1BYH A;  5H9Q A;  1XSQ A;  2UY8 A;  3EBR A;  5B4N A;  2HWB 1;  3PU8 A;  5FY8 A;  2PHF A;  4H55 A;  4PIZ A;  4LNV A;  1X9P A;  3THD A;  2CAU A;  5A33 A;  4QX8 A;  3PHM A;  1CVN A;  2Y34 A;  3H3U A;  3ST7 A;  3HN3 A;  1YQ6 A;  3V0A A;  2JKB A;  4YGE A;  4A6S A;  3VDD A;  1ZRF A;  2QQL A;  3POE A;  1ND2 B;  1VRH 2;  3UKV A;  5FYT A;  1VBD 2;  4H2A A;  5FYH A;  3RZL A;  1H30 A;  1ZZB A;  3E5X A;  1RUF 1;  4PIX A;  5FP9 A;  3USU B;  3D8C A;  4FO9 A;  4QD2 A;  2VCC A;  1Z7S 3;  3LIG A;  2WSV A;  2BTV C;  3KZ4 C;  3RS6 A;  4GMP 3;  1D2S A;  1WKY A;  4FOV A;  3FL7 A;  1OLM E;  1HB2 A;  1Q8Q A;  3KV5 A;  4IV3 B;  5FYV A;  4E2S A;  5IFP A;  2NP0 A;  4YWA A;  4EWE A;  1Z78 A;  2VG9 A;  5A3M A;  1DLC A;  3FZ3 A;  4B4P A;  1WUV A;  4IEP A;  5IVJ A;  2JDZ A;  2HYX A;  3ZFF B;  3T1L A;  3NST A;  4CVU A;  1BLZ A;  1GIC A;  1R08 1;  3KLS A;  2YHJ A;  2GC2 A;  3ZM8 A;  2EXI A;  3MW2 A;  2WYF A;  3O0W A;  4D6S A;  2WJS A;  5FYC A;  5H9R A;  1LEM A;  4AGR A;  3U11 A;  3W20 A;  4IEX A;  4MGY E;  4CCK A;  1ZZ6 A;  2DCY A;  2EAL A;  2MHF A;  1AL2 3;  1YYN A;  4DEQ A;  1EV1 3;  1ND3 C;  1XB9 A;  2DV9 A;  1HJF A;  2JD9 A;  4HAN A;  4QDQ A;  3RYP A;  4HON A;  4QXC A;  1W9F A;  3VBH A;  1JXN A;  1K5M C;  1PX3 A;  5C3S A;  1W90 A;  1JS9 A;  4QKN A;  1ZZ9 A;  1VBA 2;  2RMU 3;  2J1T A;  5FZA A;  5EWS A;  2ZZJ A;  1CJP A;  3BTA A;  4R52 A;  2HWC 3;  3ZYP A;  4GJY A;  3HAG A;  2ETE A;  4LO5 B;  5M0T A;  5A1L A;  3IPV A;  4IUG A;  1N1Y A;  5BYN A;  1NCR A;  1W8W A;  2PHD A;  2CWM A;  1UY2 A;  3RPQ A;  3VHN A;  4BQ3 A;  4R9A A;  2A75 A;  4A2U A;  3KS7 A;  4OHW A;  4K40 A;  2QE3 A;  2FDK A;  3IBM A;  4CPB D;  4LBJ A;  2HWD 3;  3ENR A;  2XL9 A;  4QX3 A;  1XYP A;  5CAZ A;  2VJX A;  4QX2 A;  1LHU A;  4P9W A;  4HMZ A;  3VGI A;  2D6K A;  1RUC 3;  1CGP A;  2ZA9 A;  1XYO A;  1GR3 A;  3BYW A;  3FWE A;  1W6O A;  1UX6 A;  4SBV A;  5KHJ A;  1O5U A;  4QPG C;  1GKB A;  4FOQ A;  4LE4 A;  5T55 A;  3ZYR A;  3KSC A;  2DWR A;  4Y4R A;  1WCU A;  4FPK A;  1GWK A;  4IDZ A;  3I59 B;  1SLT A;  3LSE A;  2EIC A;  2FDF A;  2HH9 A;  4GJZ A;  1NLQ A;  1D7P M;  4FPF A;  5DMY A;  1HW5 A;  3KCY A;  5K0U C;  3GCX A;  2V72 A;  4QKB A;  1GWM A;  3W58 A;  4B7K A;  3HQX A;  4XJZ A;  2MNG A;  3I2J A;  2VMI A;  3JBG 2;  4KI5 M;  1RXF A;  2DCJ A;  4QGN A;  4S2D A;  5DUW A;  2G19 A;  5GLT A;  3NWK A;  4OUL A;  1I3H A;  2E7Q A;  3T2P A;  3UV9 A;  4FPO B;  5ANN A;  4CSW A;  4A41 A;  3ETP A;  1S0B A;  4IV1 B;  4QM8 A;  2OT7 A;  4YW7 A;  4AHW A;  3FLR A;  1O8S A;  5A80 A;  4XFC A;  5FRA A;  1BK0 A;  1W6P B;  3LEK A;  3UGG A;  5LEJ A;  1DQ6 A;  3ZSJ A;  1O3R A;  2K0G A;  2OS2 A;  4UAP A;  4CCC A;  3HOB A;  3K3O A;  2C1F A;  1HN1 A;  2RDN A;  3DGT A;  4MLO A;  3VBU B;  5LK7 B;  2HWE 2;  2XLF A;  4V1P A;  2OYZ A;  3HEI A;  3M1H A;  3D0S A;  3CL1 A;  3K4A A;  3OD0 A;  4AHZ A;  1UD1 A;  2GAU A;  4IE6 A;  3GGL A;  1GZ9 A;  2EIE A;  5EP9 A;  3WQ7 A;  5C3O A;  2BP6 A;  2YRO A;  3DXU A;  5E16 A;  3I59 A;  1OHF A;  5CFC A;  4GA9 A;  4NPL A;  1XNA A;  4IND A;  2JDA A;  1UO9 A;  4RR3 B;  4DQA A;  1W6M A;  1UX7 A;  1G9F A;  2A3W A;  1YQ5 A;  1NQD A;  3IZO A;  1RXG A;  3NNG A;  3JD7 3;  4ONU A;  4Q4W 3;  1JYW A;  4LBQ D;  4LIT A;  1GU3 A;  2B4K A;  5FY1 A;  4DB5 A;  1S0F A;  1QF3 A;  2A70 A;  4Q4V 3;  3AX4 A;  1AL2 2;  1U5I A;  3IAP A;  4NRQ A;  3KGL A;  4Q0P A;  3ZKU A;  5HCA A;  1CAX A;  1VE0 A;  1MPX A;  5FZ6 A;  3HBK A;  4P9X A;  4QQO A;  2P3I A;  2WNV C;  1BK1 A;  1AJO A;  3VBO A;  3MW4 A;  4NO4 A;  1QJU 1;  1AF9 A;  2CGN A;  5D8A C;  1SFY A;  3S30 A;  2TNF A;  1FPN 1;  1CAU B;  4CDW B;  3R0R A;  3WDV A;  1RUJ 2;  4QU1 A;  2WKK A;  1W8N A;  1BHG A;  2CV6 A;  4RA0 A;  4TTG A;  5I0T A;  3TEW A;  4PQ9 A;  4JGZ A;  2EAA A;  2Y6J A;  1JOP A;  3C7G A;  3FHI B;  3N9Q A;  1NA1 B;  3T2O A;  4BOW A;  5C3R A;  1AHS A;  1LAJ A;  3ZSM A;  3JB8 A;  4MOA A;  4O7X A;  4CUG A;  1K5M B;  4UFI A;  3WNP A;  2ZGS A;  1R08 2;  3AMP A;  3L9J T;  1QNW A;  4MXW A;  3U07 A;  3WHT A;  4XPV A;  2MEV 1;  1UIK A;  3BCW A;  5C6C A;  3D3A A;  2ORX A;  2WIN B;  2FDG A;  1UZV A;  5L7O C;  1GQG A;  1VPH A;  1YNA A;  2WZR 2;  2XH6 A;  4WVW A;  2RR1 1;  2XGX A;  3ZXE A;  1Y9G A;  5FO7 B;  1AYN 2;  1HXS 2;  3HQU A;  3NV3 A;  4XF4 A;  2YBK A;  1G7Y A;  1RHI 3;  4KGQ A;  4XET A;  1OD3 A;  2ZHN A;  5FAX A;  1IKQ A;  3J7H A;  2RS3 1;  3SCG A;  3X29 B;  3F2Z A;  1W9Y A;  4M3C A;  1U5Z A;  4HK8 A;  1TZO A;  2E53 A;  1BKZ A;  5FZ8 A;  5FIX A;  3ZVX A;  2J1R A;  2QVS B;  2YV8 A;  2JIG A;  1GV9 A;  1UOG A;  1LGB A;  3CJI C;  5FMD A;  1LUL A;  2O0O A;  4HFS A;  3TNP B;  2VL4 A;  3ZN6 B;  4AI9 A;  1G9D A;  3BUC A;  1OQ1 A;  3M3E A;  2UWC A;  2LM3 A;  4X8P A;  3W5N A;  2ERF A;  1OVP A;  2D3S A;  3PUS A;  1WW5 A;  1W2O A;  1WLC A;  3MFC A;  4IGQ A;  1H8T C;  5CG8 A;  3I2K A;  3USU A;  2BEO A;  3B94 A;  5FOB B;  4ZHN A;  1QEX A;  4O9E A;  4XMI A;  1O8P A;  2PAM A;  4YW4 A;  2CGP A;  1UKR A;  3BN6 A;  3NJY A;  3NNJ A;  2Q1Z B;  4YYO A;  3RYR A;  5EYX A;  1COV 1;  4XDP A;  4LBQ A;  5F3I A;  4CXW A;  5AFB A;  3ZR6 A;  5FZ3 A;  4QU2 A;  2QBX A;  1PZ9 A;  3NAP A;  3AL5 A;  5ACA 3;  1C5H A;  2FMD A;  4LBK A;  5L7O B;  1UOJ A;  4GWN A;  4EWD A;  3ZFF C;  5C70 A;  1NA1 C;  1WLW A;  1WMD A;  2ZEX A;  2ARE A;  1LOF A;  2WA3 A;  2WO3 A;  4W8J A;  1W6P A;  3TYJ A;  2ZOE B;  4NHK A;  5GZE A;  2NLR A;  2HBU A;  1IS6 A;  3P3N A;  4I3G A;  4OI4 A;  4AR2 A;  4QQL A;  4QXH A;  3ACL A;  1D2Q A;  4MXV A;  5LBE A;  5EV7 A;  5FZM A;  1QOS A;  3ZYB A;  3IMN A;  4HVO A;  1MS5 A;  3ILN A;  1IPS A;  5GLU A;  2VZ3 A;  3DPR B;  5C8C A;  4WV8 A;  5JPN B;  2ZEW A;  2LAL A;  2E6V A;  1UN1 A;  3I54 A;  4YW2 A;  1HXS 1;  3ZMN A;  4HKO A;  1R09 1;  1KFX L;  3LIH A;  4XQW A;  3U75 A;  1ULC A;  2G9G A;  4HN1 A;  4OHX A;  2WAO A;  1TMF 2;  1OOP B;  4EQV A;  1RC6 A;  2NZ9 A;  4GUL A;  2ZJC A;  5FZD A;  3VBS B;  4M3C E;  1UMH A;  4LA2 A;  1WD4 A;  4Q5O A;  1O7F A;  1JUI A;  4PQQ A;  2FDI A;  1KQR A;  2IXJ A;  2H6B A;  3TRS B;  2PA7 A;  1OLR A;  1LTE A;  1D4M 3;  1OMI A;  2Z42 A;  3QLQ A;  1G86 A;  4YSF A;  3W5M A;  1N1S A;  2FCU A;  4GMP 0;  3P3P A;  5DUV A;  2LS6 A;  1J3Q A;  1VAL A;  1IQA A;  2WLQ A;  5F39 A;  1UXX X;  2OKX A;  2IFW A;  3RJR A;  3H50 A;  3T2Q A;  4NR1 A;  2XXZ A;  2R49 A;  4NUB A;  2ZS6 B;  3UES A;  4DRR A;  2XR4 A;  1GOF A;  3IDC B;  4GKY A;  1AX0 A;  5KXD A;  2XLA A;  2XLG A;  2QDR A;  4HET A;  4RD7 A;  2JEN A;  1QOT A;  1KS5 A;  3NKG A;  3QH6 A;  4AI3 A;  3OGV A;  1MEC 2;  3C7F A;  3VBR B;  3VDD C;  2VOT A;  4B1M A;  4B1L A;  1JOD A;  2R06 3;  5JPM B;  2R06 1;  4LA3 A;  4UFJ A;  1HX6 A;  1Z7S 1;  3P5B A;  3VKN A;  2XWB B;  4L0P A;  4Y1V A;  4M0N A;  4DS0 A;  1NXM A;  4QT6 A;  3DF0 A;  4AW7 A;  2X5I A;  1Q8V A;  2IC1 A;  1OI6 A;  5DPN A;  3WP6 A;  2WZ8 A;  1AR9 1;  4HPK A;  4OI1 A;  3WQ1 A;  3WW1 A;  4E8C A;  1B09 A;  4OZO A;  1CZV A;  2KXL A;  5J96 B;  2YC2 A;  1YLL A;  4XF1 A;  3VD9 A;  3AP4 A;  4CXX A;  1QHD A;  3AFG A;  4OHV A;  4L11 A;  5IUQ A;  2H0V A;  2QQK A;  1L7Q A;  3CKH A;  4ISQ A;  1BJQ A;  4NIA A;  3PUR A;  1CZT A;  1W2U A;  4FFG A;  5JI9 A;  4MH0 E;  1R64 A;  1UMI A;  1ONA A;  3DXT A;  4N8M A;  3RGB A;  1PZ7 A;  1AZD A;  1XRU A;  3H9A A;  3S5A A;  4YGD A;  5FZ7 A;  5JI7 A;  1RYY A;  2WNE A;  2XHK A;  2P6C A;  2KR2 A;  2PLV 3;  3O0V A;  4YM2 A;  2PTM A;  4CP9 A;  2OQ7 A;  3B01 A;  3WNX A;  3PUI A;  1OBN A;  3I2O A;  2GC1 A;  2OZJ A;  2Y0O A;  3K4D A;  1PVX A;  4MG2 A;  1S0E A;  1UU5 A;  1VBB 3;  3AZW A;  2BNN A;  2WLP A;  5FPU A;  4LIU A;  3J7N A;  2VBB A;  3NJX A;  4BHP A;  1W6N B;  2GN7 A;  2A6V A;  3A4U A;  2XON A;  1RMU 2;  3D0J A;  1YJL A;  5A3O A;  1CZS A;  1CAU A;  2VVD A;  4ES9 A;  1LR5 A;  3PME A;  1X50 A;  1RUI 1;  1UCX A;  4L97 A;  5KHI A;  3UKT A;  5JLV A;  2YC0 A;  2PHX A;  3GJB A;  3WD5 A;  5JSO A;  1O3Q A;  4WBB A;  5FZB A;  5GLV A;  1W9T A;  3LPG A;  3O1T A;  2D3P A;  2PN5 A;  4KMQ A;  1YXW A;  4WM7 C;  3WOG A;  4ZZ8 A;  2XJQ A;  2JDM A;  2NM1 A;  3CBN A;  3AKQ A;  5D1I A;  5LA9 A;  3U10 A;  2YGM A;  4XXP A;  3S0M A;  3N7M A;  3T2T A;  4DNY A;  2XPJ A;  1W6M B;  1COV 3;  2R04 2;  2HWF 3;  1POV 1;  2XJS A;  2ZGT A;  1VBC 1;  2WFP A;  4P14 A;  2JDU A;  1C8M 3;  4QDR A;  3MIC A;  2EIG A;  5FZL A;  2C6S A;  2CNA A;  3ZMO A;  4AWD A;  3WX5 A;  5I8S A;  2RS1 2;  2RM2 2;  4RR3 C;  5A6X A;  3T0A A;  2X29 A;  5JAX A;  2C26 A;  2ET1 A;  4LR4 A;  2TBV A;  2K2S A;  3OPZ A;  5C8C C;  3B9I A;  2ZGP A;  3FX3 A;  4YAR A;  1VLN A;  1DYK A;  5BNN B;  2BNO A;  2VZO A;  1JU3 A;  1RUC 1;  4CPB A;  1H0B A;  4YRD A;  4JAA A;  3EMR A;  1CON A;  1GWL A;  3ITQ A;  2KD7 A;  4ISR A;  1ODM A;  1SLI A;  3J8F 2;  1W06 A;  3JXS A;  3KT7 A;  3MPB A;  2C9K A;  1CAV A;  2ES3 A;  4CUB A;  4R4X A;  1NQJ A;  5FJK A;  3IKW A;  1K3I A;  4AHX A;  2F17 A;  2G4I A;  5JXI A;  2GNB A;  5A3L A;  2IXK A;  3ES1 A;  1QJX 2;  4IER A;  5FRE A;  3WDT A;  1OA4 A;  3CJI A;  1KIT A;  4XIO A;  4AOC A;  4IV3 A;  3KGZ A;  3NAP B;  3ZXD A;  2WSU A;  3HVD A;  1O91 A;  2QTW B;  4H7M A;  1AYN 1;  5C9A C;  5FPX A;  4UFM A;  1EYB A;  1UYX A;  4XVH A;  4P08 A;  3VBR A;  5BNO C;  4W4Z A;  3I2H A;  4AVC A;  1R08 3;  3OUI A;  5C5T A;  1BBT 3;  1V6N A;  1DG6 A;  3ZXL A;  5ACA 2;  3H8O A;  5FZ9 A;  1HQL A;  2XVK A;  2CHH A;  2P6H A;  4CDU B;  2LTN A;  2VM9 A;  3LCP A;  2CGO A;  3VV1 A;  1EV1 1;  2WT2 A;  3HT1 A;  5H9P A;  4UFK A;  1QXR A;  4AFM A;  1SLB A;  3R4S A;  2C0Z A;  1XNB A;  1A8M A;  1J58 A;  5J48 A;  5FZH A;  5C71 A;  5F2S A;  4JQT A;  2Q30 A;  4R9C A;  2Y60 A;  2DTW A;  5DXD A;  1ZZ7 A;  4DY3 A;  1O3S A;  2VCM A;  1ZZ8 A;  4YVS B;  4MGS A;  2R0H A;  3BAL A;  5GKA C;  5L7O A;  4C1W A;  1O59 A;  3N7K A;  1G9C A;  1AXZ A;  5FZK A;  3CJI B;  3AC0 A;  5K4L A;  1UY4 A;  2ILM A;  3LEG A;  1MS0 A;  2YBS A;  2PHU A;  3VDB A;  3MHZ A;  4I3P A;  4C1X A;  2HJI A;  1SFN A;  3BOW A;  3ZYI B;  1ST8 A;  3I3M A;  1WWY A;  4Q4Y 3;  4N7I A;  1SDW A;  1AR6 1;  2VXJ A;  5IT6 A;  2E63 A;  4BME A;  2QQP A;  5T54 A;  5FXW A;  4CDU C;  4I0W B;  2DFB A;  1MR5 A;  4LHN A;  2ZGO A;  4NII A;  1KGY A;  1UQX A;  4I09 A;  5BNP A;  4XJ8 A;  3C8X A;  3APB A;  4GWI A;  4RFT 0;  5F3E A;  2J1V A;  3I97 A;  2LW8 A;  5JZG C;  2D6L X;  3OBT A;  3UJQ A;  1KJL A;  3B93 A;  5A3U A;  1RUF 2;  4BJ0 A;  2JB8 A;  3OUJ A;  4KG8 A;  4I0B A;  4ARY A;  4EN9 B;  5LRS A;  2XBO 1;  4N90 A;  4DXT A;  1OT5 A;  2UUR A;  2VE1 A;  3EYP A;  3OEB A;  2RS1 3;  5FDB A;  3SXW A;  5E8A A;  3ZN5 A;  3DEC A;  5J3U A;  1J59 A;  1VBE 3;  5LBB A;  4ERO A;  2BNM A;  2WDB A;  2I07 B;  3WDY A;  4Y3O A;  1S0C A;  2P3J A;  2WAA A;  4UW5 A;  3IIA A;  1DQ2 A;  2QDN A;  5FP8 A;  2HWB 3;  2QQI A;  1BEV 3;  1VB2 A;  2DVB A;  4FXG B;  2R07 1;  5CIS A;  4ORF A;  3WR0 A;  5C4W B;  5JVV A;  4ASM B;  5CFC B;  3RMY A;  4BQ5 A;  3WNM A;  5C3Q A;  3OOX A;  1EAH 3;  3BGA A;  5IVE A;  2A6W A;  1WME A;  2EF6 A;  2I74 A;  2XJT A;  1S1A A;  3NJV A;  1X82 A;  3TN9 1;  4OFG A;  1DYP A;  4YW6 A;  5E89 A;  4RN5 A;  1VMH A;  5ACA 1;  1U0A A;  1PHM A;  2WNU B;  5FLH A;  1K42 A;  3U37 A;  2ENR A;  2VR4 A;  3VKL A;  3ORJ A;  4FPJ A;  1ZBE 3;  3O1O A;  4X8N A;  2CY6 A;  1NLR A;  1BMV 2;  1RUG 3;  2EID A;  3AZY A;  3RYK A;  2GDF A;  3H1M A;  4JKL A;  4QGL A;  3OBR A;  4SLI A;  3T0D A;  3FN9 A;  1R1A 3;  4P9I A;  1SMV A;  4CEW B;  1EUU A;  2VW2 A;  5A3N A;  4GH4 B;  2E7A A;  2A1X A;  4DFS A;  1YUD A;  1MS1 A;  1SLC A;  2IUW A;  3OSD A;  2GN3 A;  4I2O A;  2C24 A;  3LPF A;  1PGL 2;  5J98 B;  2WO1 A;  1W99 A;  3KT1 A;  3VN4 A;  2DBN A;  3AVR A;  5CAD A;  5GZG A;  5IAT A;  5HCH A;  1I5P A;  1RED A;  1N3O A;  2BW8 A;  2Z5W A;  3SC7 X;  4TLG A;  2RS3 2;  2VQ0 A;  1VMJ A;  1F9K A;  4BIF A;  5EJZ B;  5JSR A;  3UET A;  3ZFF A;  4LO8 A;  2BOI A;  3LEI A;  2PAE A;  3TWI A;  1RHI 1;  3N7J A;  3NL1 A;  4BQW A;  4WM8 B;  2ZX1 A;  4N43 B;  1G8W A;  3K51 A;  2UYB A;  4CDW A;  3IAQ A;  5A6Z A;  3KVA A;  2JKX A;  4OUS A;  5F3G A;  3T4V A;  4DXZ A;  3I3Q A;  1AR6 3;  2XL7 A;  3OD4 A;  1FYU A;  2CU5 A;  3WG4 A;  4FPC A;  4AYU A;  1RB8 G;  2FQP A;  5BNO A;  3KV4 A;  2GH8 A;  3NW4 A;  3VBF B;  3RZJ A;  1BEV 1;  1XJA A;  1VAV A;  4EJR A;  1YFY A;  1AVB A;  2R06 2;  4QX7 A;  4CCO A;  3VLB B;  4YPJ A;  3LFI A;  4O61 A;  1TE1 B;  2Q0A A;  2QQO A;  3J26 N;  1W8H A;  4NPR A;  4ZY9 A;  1RUJ 3;  4W65 A;  1RUJ 1;  5D21 A;  3ACF A;  4AFD A;  1SDD B;  1NCR C;  4FTE A;  2RR1 3;  3POW A;  1CQ9 A;  2FCV A;  4K20 A;  5L73 A;  3TOJ A;  1RGS A;  3I3E A;  2UYA A;  2XBO 3;  3BTX A;  1U12 A;  2QNK A;  2R6Q A;  4N9I A;  3UYJ A;  2IVJ A;  2QQW A;  5LA2 A;  4PF1 A;  2ZBJ A;  4GB3 2;  4K8F A;  1JW6 A;  1G9A A;  1Y3T A;  2W94 A;  3I4I A;  1IG3 A;  1JYX A;  3THP A;  3VBU A;  1W0N A;  4CP9 B;  4H7L A;  2MEV 2;  3LOI A;  1H6X A;  1C8M 2;  4Q4V 1;  2LRP A;  4BE3 A;  2MEV 3;  2IXH A;  4OQ9 A;  4YZ1 A;  2GSY A;  2DUO A;  5FMB A;  4LE3 A;  2RG4 A;  3M2M A;  3PVN A;  3VL9 A;  1RUH 1;  4A6O A;  3GM8 A;  3M3I A;  1A6C A;  3BPS A;  4E4D X;  4E9K A;  2ZCW A;  1YI9 A;  5DAB A;  4IV1 A;  3H7Y A;  4LBO A;  4AAP A;  3A22 A;  4Z1V A;  3SCH A;  3WG2 A;  1EV1 2;  2A7A A;  2A71 A;  3AB0 A;  4XCA A;  2VZR A;  3WXP A;  2B45 X;  1AR9 2;  5JUV A;  2JX9 A;  3AJZ A;  3OBA A;  3WUD A;  2ZTN A;  4F83 A;  3LFM A;  1UY3 A;  4W6W A;  3ES4 A;  1GOH A;  2XDV A;  2E31 A;  4CCM A;  5A3T A;  3T1M A;  2BGC A;  4CCL A;  1PNF A;  1MVQ A;  2AAC A;  2FDJ A;  3J7L A;  2JIJ A;  2Z79 A;  2OXB A;  1XE8 A;  2J1A A;  3ZYG A;  4AVT A;  2A3X A;  4EN0 A;  3HBZ A;  1GZT A;  1P8J A;  3GHM A;  1OPO A;  2FBE A;  3OB8 A;  1QH7 A;  4HL0 A;  5FY0 A;  3ZPO A;  2ATF A;  2PHL A;  1JZ7 A;  2PMW B;  2WQ4 A;  3OY8 A;  3WT3 A;  3VDA A;  1PO1 2;  4AFB A;  4P9J A;  1PX4 A;  2VUA A;  2G9F A;  3WHU A;  2SLI A;  1Z7S 2;  3FLT A;  4DUW A;  1RVF 3;  3E5Q A;  3LQC A;  2J22 A;  1C5I A;  2VMH A;  4EE2 A;  3I49 A;  4A44 A;  1HRI 2;  1IG0 A;  1L7R A;  4NHY A;  1PO2 2;  3R4D B;  4BXS V;  4XBQ A;  1AR8 2;  2VEC A;  3N9N A;  4XUQ A;  1XNK A;  4RYD A;  4UF0 B;  3MDP A;  4RS5 B;  4MSV A;  2RM2 1;  3H7J A;  3EO6 A;  2W08 A;  3SHR A;  4PDW B;  5K0U B;  4KGG A;  4O65 A;  2IFR A;  4Q27 A;  2A3Y A;  1AR7 2;  2W1U A;  1ULO A;  2WFF 2;  1FXZ A;  2FHR A;  2YPD A;  1H2K A;  2VAU A;  4L9B A;  5FYY A;  5J36 A;  3FE5 A;  2CAV A;  5FYU A;  3FJS A;  1LED A;  2A73 B;  5DDJ 3;  2CSG A;  1ND3 A;  3HPN A;  1U5Y A;  3N9M A;  4EN7 B;  2PLV 1;  3AMM A;  4GH4 A;  1U5X A;  4Q0V A;  1TME 3;  1XNT A;  4YNI A;  5FXZ A;  5FZ0 A;  1RUH 3;  1ENX A;  2XJU A;  3KQR A;  2HEV F;  3WW4 A;  2V73 A;  1EPW A;  1UU6 A;  1Y9Q A;  3M70 A;  2XJV A;  1E5H A;  2P2K A;  2AEZ A;  1CR7 A;  1YQ8 A;  3ASI A;  5BNN A;  1CES A;  3DL3 A;  4QB1 A;  1GNH A;  2B8M A;  2YZ4 A;  1VBD 1;  4AQ6 A;  3URF A;  1PVC 2;  1QNY A;  1O4Y A;  3HN1 A;  5FY7 A;  3E6C C;  4IET A;  2BDR A;  1X9T A;  5BNN C;  3UK9 A;  4JC1 A;  4TSV A;  5SV8 A;  1CJD A;  1W2N A;  2KA3 A;  4GZ9 A;  3WEZ A;  2CDO A;  4BH9 A;  3H8U A;  4FQ4 A;  1W05 A;  4M3C F;  1POV 3;  3CDZ B;  2DU0 A;  5D8A A;  2RV9 A;  3VB9 A;  4FI9 A;  1OH3 A;  2B42 B;  2HWD 1;  4UW6 A;  1YIP A;  1CD3 G;  1QWR A;  1IKP A;  3R6S A;  4AED B;  4B3N A;  4C90 A;  2W46 A;  1WA4 A;  5CG9 A;  1JI6 A;  3NJZ A;  1XXN A;  4LJH A;  2H6C A;  1DBN A;  4YW1 A;  4PBP A;  4URA A;  1AR8 3;  5DAP A;  4YVW C;  1CWP A;  1OF3 A;  5FKB A;  1S0D A;  3Q8B A;  2VZS A;  2ZX2 A;  4UI9 L;  3ZFG B;  1NE6 A;  1UY0 A;  1YCI A;  3MZH A;  4FQZ A;  2SBA A;  5FQ0 A;  2C4X A;  3W21 A;  5FPL A;  3GZU C;  1O5L A;  1GSL A;  3GAL A;  2QZ3 A;  4NIG A;  2HWF 2;  2QQU A;  1F4H A;  5CFD A;  2ZHK A;  1ULE A;  5CB7 A;  4XIK A;  5BPX A;  2C5D A;  2Y6F A;  1SAC A;  4GKX A;  3C3V A;  4QAW A;  2Y6K A;  2VU9 A;  5CIR A;  1VAM A;  5BNP B;  3WQ0 A;  4CZS A;  1CAV B;  1UZW A;  1FMD 1;  5DUU A;  1A78 A;  3THC A;  4FBF A;  2ZGK A;  5I0R A;  5C9A A;  5FYI A;  4DIN B;  3KCC A;  2VOW A;  5EQU A;  2R04 1;  5JIU A;  1ZA4 A;  1UU4 A;  5FO8 B;  5IAX A;  3O7O A;  2E7T A;  5ABJ A;  4H14 A;  2R1D A;  3PL0 A;  2X5I C;  1YQ2 A;  4AQ2 A;  4COU A;  3CHX A;  4MVT A;  3GDB A;  1FI2 A;  1N3Q A;  3E5U A;  4Q1P A;  1TVG A;  1F2N A;  2IZW A;  4PCR A;  4NRP A;  4IE7 A;  4YW5 A;  4HVQ A;  3BB6 A;  1FX5 A;  2NYY A;  4QPI C;  3SH3 A;  1IS3 A;  2YC4 A;  3JBG 1;  2XG3 A;  1AR7 3;  1TQ5 A;  2WFF 3;  4JKM A;  1OH4 A;  5DG2 A;  4MYE A;  1RUC 2;  2UY9 A;  3U1X A;  4LOS A;  1BVV A;  1RUG 1;  1DGR N;  1D0H A;  2LRO A;  1JYC A;  4XDO A;  3NV1 A;  5HCF A;  4D69 A;  1OLQ A;  2AC1 A;  2WBK A;  3ATG A;  1S2B A;  2BVV A;  2WWU A;  4I01 A;  4LBQ B;  5HBA A;  1Q8S A;  3FHA A;  2JG8 B;  3WCR A;  5JXJ A;  4EN8 B;  1VIW B;  4WVM A;  5C4W A;  4CU7 A;  1ULG A;  1JZ4 A;  3NNL A;  3AXD A;  4HLT A;  4RS5 C;  1NKG A;  4M00 A;  3P6B A;  4JZR A;  3U14 A;  4CCJ A;  1ULD A;  4YZ5 A;  5KXB A;  4CRQ A;  1M4W A;  1JZ3 A;  3RZK A;  4Q8L A;  1F5F A;  3PVO A;  4XW3 A;  3MW3 A;  5HI0 A;  4RQP B;  1PMH X;  4N53 B;  5F1R A;  4MGQ A;  2PHT A;  2RMU 2;  1SPP B;  5KC5 A;  1CPN A;  4PIY A;  2BFU L;  3TN9 3;  1OC1 A;  4BLJ A;  4ATF A;  4ZS2 A;  4LLF A;  1UWW A;  4BQ2 A;  3O0X A;  2HEY F;  1POV 0;  5JMO A;  1WW6 A;  4TN7 A;  4OUE A;  2XJR A;  4AFA A;  1WZX A;  2D44 A;  4AG4 A;  2YFZ A;  4CYD A;  5BV6 A;  5HV0 A;  4XQ4 A;  2VUJ A;  3DCQ A;  3KM5 A;  1QU0 A;  3KHC A;  4D3W A;  1K5M A;  5FXX A;  5EFU A;  5GZF A;  2IXC A;  3WNN A;  1UZY A;  5F37 A;  1ENQ A;  3GNE A;  3WNL A;  4M4P A;  4CU8 A;  1S4C A;  2VQU A;  2E26 A;  5C7G A;  1C57 A;  5A7S A;  3NAP C;  4HZF A;  1WD3 A;  4I02 A;  1PIV 2;  3LF7 A;  2Y0I A;  4E4Z A;  3PJY A;  1PIV 3;  1GZW B;  5L36 A;  4FPH A;  5JXH A;  1XC6 A;  3VZM A;  1S2E A;  3RZH A;  5FZE A;  5JWP A;  3T08 A;  2N7G A;  1JBC A;  5FZO B;  3U0Z A;  3RNS A;  1PVC 1;  2PYT A;  2R7E B;  4QPG B;  4RHV 2;  4PDW A;  4AVV A;  1LES A;  2AGS A;  4WZC A;  3WP5 A;  5JOW A;  5GLZ A;  1T2X A;  3AZZ A;  4Q4Y 1;  2D6O X;  2WQ8 A;  1LOD A;  1FOD 1;  4QM9 A;  3RZM A;  2WO2 A;  5E88 A;  4D8M A;  3AP6 A;  2EXH A;  3N9O A;  2WWS A;  4A7K A;  4MO3 M;  1NE4 A;  3LAG A;  2V5Y A;  4XYX A;  4Y1U A;  3TN9 2;  2IXL A;  1X7N A;  4BU2 A;  1ALY A;  4XJW A;  3POG A;  2C9A A;  5LBC A;  2A5Z A;  3OEA A;  2CDP A;  4CDU A;  4IV3 C;  4GMP 1;  2YUE A;  2JDY A;  4N43 A;  4OI0 A;  2WRA A;  4BLI A;  5CKN A;  4EYU A;  1NOV A;  1KS4 A;  5FCC A;  3K4Z A;  5LAS A;  3WQB A;  1GP4 A;  2WII B;  5L9B A;  1RUE 1;  2ID4 A;  4TZD A;  1OQD A;  2X8K A;  2VTX A;  5LEK A;  1BCX A;  4GB3 3;  2VMF A;  4RSU A;  4AZZ A;  4CEY A;  2VW1 A;  2Q8E A;  1R1A 2;  3MUY 1;  3MV1 1;  5EHD A;  4B29 A;  2DVG A;  3OGS A;  5KBF A;  4Q29 A;  1PK6 A;  1DZQ A;  4OMD A;  5AVA A;  4CP0 A;  1CX4 A;  4J6G A;  1CX1 A;  2Q8O A;  1UNB A;  2RDQ A;  4XC9 A;  1EPZ A;  4ATE A;  3B5L B;  4D6R A;  4TXW A;  4L8Q A;  4JV4 A;  3MPP G;  1WBL A;  2ZAH A;  4Y5S A;  2W9X A;  1O4T A;  4XUR A;  1AYN 3;  4UOJ A;  1IZ3 A;  4AAX A;  4CP2 A;  1AL0 G;  2D3R A;  2FCT A;  2OX0 A;  2WNU A;  2WO7 A;  3CO2 A;  3ME2 A;  4Y20 B;  3E1F 1;  3DKQ A;  3RFR A;  4OMC A;  4DZG A;  1GZC A;  1N3P A;  2YU2 A;  3HMY A;  2B39 A;  4Q4Y 2;  4AL9 A;  2XOM A;  1QJY 1;  1KDM A;  2DUQ A;  3LA7 A;  2PQS A;  1UY1 A;  2RJ2 A;  3KCX A;  2NMN A;  4XFI A;  4XXA A;  4D7S A;  4JTO A;  5BNQ A;  3O14 A;  1JOB A;  4RL7 A;  4BDV B;  5CBL A;  3III A;  4AQT A;  2JG9 B;  2OII A;  1F35 A;  3VDC A;  2BFU S;  2DUP A;  3N7L A;  5F7U A;  1DZT A;  4EV0 A;  2XQR A;  4HKL A;  4QQH A;  2J7M A;  3R4U A;  3I2F A;  3SKV A;  3PVE A;  2ZGM A;  2NQY A;  3T3Y A;  4BQ1 A;  5BXX A;  1UOB A;  3W59 A;  3AL6 A;  1HB4 A;  2QKD A;  5E1R A;  1H2N A;  1LOC A;  1OQE A;  4X6Q B;  2YXS A;  5C5U A;  1UW8 A;  1FAT A;  2DBI A;  2VO5 A;  4IGO A;  5IVC A;  1NZC A;  5IK7 A;  1HRI 3;  4L99 A;  5KC6 A;  1IPK A;  4CA9 A;  3TEZ A;  3B69 A;  5FUP A;  1UPS A;  3VBF A;  3K77 A;  4L2N A;  1ULF A;  3KHB A;  3M3Q A;  1RUD 1;  3RJ2 X;  1MEC 1;  1OFS A;  4PLN A;  2XB6 C;  1YI7 A;  4Q4X 3;  5J09 A;  1VBB 1;  2D5F A;  2IVI B;  2FZ1 A;  2XKO A;  4UW4 A;  1J84 A;  4WVV A;  1DGW X;  5I8Y A;  4H3W A;  5FK7 A;  4NHL A;  3I3B A;  3RWN A;  4ASL A;  4LT5 A;  3ZFE A;  2JEC A;  3VKO A;  1AYM 3;  4P00 B;  1W2T A;  1W2A X;  4JKK A;  4D7T A;  4S2G A;  1PGW 1;  3GYD A;  3ALQ A;  5IJR A;  2NPI A;  4R9D A;  3LDK A;  1B35 A;  5A7O A;  2DCT A;  4JDO A;  3FMG A;  4COW A;  1AL2 1;  2ZX3 A;  3ZFG C;  2UWA A;  4J1W A;  5F9T A;  4MZU A;  3NNF A;  4FCA A;  4D6Q A;  2W1Q A;  1YFW A;  1ZBA 2;  4NMI A;  2DDU A;  4LHK A;  1Y43 B;  3I7D A;  5T50 A;  3ZSL A;  4KNC A;  2R16 A;  4XIL A;  4S2F A;  2GND A;  1PNG A;  2ZX0 A;  2PHR A;  4IEQ A;  4XFH A;  3ETQ A;  3IB3 A;  1RUI 2;  2V09 A;  3IDA A;  4QPI B;  1VJ2 A;  3WW2 A;  2W87 A;  2BRT A;  2E32 A;  2Y33 A;  3OBZ A;  4FFH A;  4JGY B;  4LOR A;  3ECQ A;  1HJG A;  1UL9 A;  4CCE A;  2OW4 A;  2VOK A;  5T5P A;  1M06 G;  3LA3 A;  2VXR A;  3B3Q E;  3ACI A;  3NMB A;  1JZ6 A;  1MQT A;  3PTR B;  1QDO A;  3POY A;  1QQP 3;  3IM0 A;  3E97 A;  4QQP A;  2GNT A;  2W95 A;  3K48 A;  4WVZ A;  2ARA A;  2BUK A;  3MF9 A;  1F31 A;  1W9S A;  1OUX A;  1V9U 1;  1UIJ A;  1MQT C;  4JHZ A;  3ZXA C;  4EN6 B;  4LUL A;  3WLU A;  1AR8 1;  4GQ7 A;  2WZE A;  3ZLI A;  5KXC A;  3P1I A; 
#chains in the Genus database with same CATH homology
 2WO1 A;  1W99 A;  1WCQ A;  3A21 A;  3K46 A;  4M4R A;  2ZXQ A;  1I5P A;  2WAB A;  5EJZ B;  2EIC A;  3UET A;  5EIY B;  3LEI A;  5I0D A;  1D7P M;  5DMY A;  4ARX A;  4ZZ5 A;  2V72 A;  3IAQ A;  2JKX A;  3I2J A;  4KI5 M;  5EJ1 B;  2EIB A;  1JZ8 A;  2DCJ A;  2J1E A;  2VZQ A;  2VZT A;  2Z4F A;  3T2P A;  1PMJ X;  4A41 A;  3ETP A;  4YPJ A;  5A1A A;  2QQO A;  1O8S A;  4ZY9 A;  1SHW B;  3ACF A;  3LEK A;  1SDD B;  2BZD A;  4UAP A;  3I3E A;  1DP0 A;  3HOB A;  1HN1 A;  3I2G A;  5LA2 A;  3HEI A;  4PF1 A;  2BER A;  4DUV A;  4ZXE A;  3K4A A;  3WF0 A;  4LHS A;  2W94 A;  2EIE A;  3GGL A;  1JYX A;  1W0N A;  3WF1 A;  1H6X A;  2W1W A;  1XNA A;  2JDA A;  2Y6G A;  1UX7 A;  1UXZ A;  1K45 A;  3NNG A;  4A6O A;  2B9V A;  3GM8 A;  1JYW A;  4QPW A;  1GU3 A;  2B4K A;  2XHN A;  3A22 A;  3IAP A;  2VZR A;  5CZK A;  5JUV A;  1MPX A;  3OBA A;  5G04 L;  1UY3 A;  1GNY A;  2VZV A;  2YG0 A;  1GOH A;  2E31 A;  2V5D A;  2QQM A;  2VZP A;  4A42 A;  1W8N A;  1BHG A;  2X05 A;  4TTG A;  1W8O A;  2J1A A;  2WN3 A;  3WF4 A;  2Y6J A;  3C7G A;  4DUX A;  1P8J A;  3T2O A;  4A45 A;  3OB8 A;  2Y6H A;  1EUT A;  4MOA A;  1JZ7 A;  3WNP A;  4ET7 A;  3VD3 A;  3VDA A;  1PX4 A;  4QX0 A;  4DUW A;  3LQC A;  2J22 A;  1K12 A;  4A44 A;  3D3A A;  1L7R A;  2ORX A;  5G05 L;  5IHR A;  4BXS V;  3WNK A;  1JYN A;  2YB7 A;  4XUQ A;  2QQN A;  4RYD A;  4LKS A;  5J1X A;  1OF4 A;  2VZU A;  1OD3 A;  3J7H A;  4P5Y A;  3F2Z A;  3A7Q A;  2VTF A;  2W1U A;  3CZJ A;  1ULO A;  2J1R A;  3DYM A;  4W50 A;  2VL4 A;  3HPN A;  3CIH A;  3W5N A;  1XNT A;  4E8D A;  3MO4 A;  2BGO A;  5LCW L;  3I2K A;  1XPW A;  1CIY A;  1UYY A;  1O8P A;  4BK4 A;  3BN6 A;  3ACG A;  4QB1 A;  1NUK A;  4QB2 A;  2RVA A;  2QBX A;  1JHJ A;  3VD5 A;  4A4A A;  4GZ9 A;  2W92 A;  2CDO A;  3WEZ A;  3CDZ B;  3I2I A;  5C70 A;  2ZEX A;  2RV9 A;  5HXM A;  2WO3 A;  4FI9 A;  3GXU A;  4W8J A;  4MAD A;  4DEV A;  3I3D A;  2W46 A;  1JI6 A;  2W91 A;  2VZ3 A;  3SKJ E;  2ZEW A;  5B4X A;  1OF3 A;  2VC9 A;  2VZS A;  5IFT A;  4UI9 L;  2YFU A;  1UY0 A;  2WAO A;  1ULP A;  2C4X A;  4P02 B;  1UMH A;  1F4H A;  4PQQ A;  3UNP A;  3W5M A;  3EB7 A;  4QAW A;  3VD7 A;  2Y6K A;  1UYZ A;  2LS6 A;  3DYP A;  4KWU A;  1UXX X;  2OKX A;  3T2Q A;  3THC A;  1US3 A;  3UES A;  1UZ0 A;  3SEP A;  1GOF A;  3CZU A;  2WUH A;  2W1S A;  1JU4 A;  2X10 A;  4LPL A;  2Y8K A;  3WNO A;  3OGV A;  3C7F A;  2VOT A;  2Y64 A;  1YQ2 A;  3NRU A;  3GDB A;  4JX0 A;  4L0P A;  1TVG A;  3OGR A;  5DPN A;  2X09 A;  2WZ8 A;  2YC4 A;  4DXR A;  3WF3 A;  4E8C A;  1JYV A;  2VCB A;  4OZO A;  4JKM A;  1CZV A;  2YC2 A;  1OH4 A;  4LQR A;  3VD9 A;  2VQT A;  2VCA A;  4XUT A;  1LNS A;  2QQK A;  3CKH A;  1L7Q A;  3ABZ A;  2WBK A;  1CZT A;  5IYY A;  1SG3 A;  1US2 A;  2WYS A;  1R64 A;  1UMI A;  3FHA A;  5JXJ A;  4CU7 A;  1JZ4 A;  1RYY A;  4PT6 A;  1NKG A;  3P6B A;  3PUH A;  4Z2A A;  3PUI A;  2VME A;  2BBA A;  1JZ3 A;  3K4D A;  1PMH X;  4MGQ A;  5LA1 A;  3NJX A;  1JZ5 A;  3HJR A;  3FHQ A;  4BK5 A;  4D0Q A;  2XON A;  1CZS A;  5FUI A;  1UWW A;  4XUP A;  2ORZ A;  5JMO A;  3OG2 A;  4OUE A;  4AG4 A;  1W9T A;  2W5F A;  2YFZ A;  3LPG A;  4KMQ A;  4ZZ8 A;  5HPO A;  3WNN A;  2E33 A;  3WNL A;  4CU8 A;  4M4P A;  3WSO A;  2VQU A;  2E26 A;  5C7G A;  4QDS A;  4QB6 A;  4OYU A;  3ACH A;  1IQD C;  4QDR A;  2J1S A;  5JXH A;  1XC6 A;  3T08 A;  3MBW A;  4QX1 A;  5CYY A;  2R7E B;  3VD4 A;  2VMD A;  3T0A A;  2C26 A;  1T2X A;  2WQ8 A;  5JXG A;  2WO2 A;  4D8M A;  2VZO A;  1JU3 A;  4MO3 M;  3CQO A;  3WF2 A;  3K75 B;  1GMM A;  2KD7 A;  3JXS A;  2C9K A;  4CUB A;  3OEA A;  2CDP A;  1K3I A;  4XUO A;  5JXI A;  4CU9 A;  3LE0 A;  3WQB A;  3K4Z A;  5DQ0 A;  1KEX A;  2ZEZ A;  2ID4 A;  3A23 A;  3SEE A;  1UYX A;  4XVH A;  4P08 A;  2VMF A;  4W4Z A;  3I2H A;  2VMC A;  3MUY 1;  3MV1 1;  3OGS A;  3HNM A;  4OMD A;  2VM9 A;  3HNB M;  1CX1 A;  4CUC A;  3T09 A;  4TXW A;  5C71 A;  5JR2 A;  4A3Z A;  2V4V A;  2W9X A;  3MUZ 1;  5DN2 A;  4XUR A;  4UOJ A;  4AAX A;  2WN2 A;  1DYO A;  3C7O A;  3E1F 1;  4MGS A;  4OMC A;  4XUN A;  1O59 A;  2DCK A;  1GOG A;  2XOM A;  3AC0 A;  1UY4 A;  3LEG A;  2XQX A;  3VDB A;  1GUI A;  4HG6 B;  2W47 A;  2PQS A;  1UY1 A;  2QQJ A;  2RJ2 A;  5B4N A;  4BDV B;  3III A;  3THD A;  3VDC A;  4XZU G;  5F7U A;  3HN3 A;  3NQH A;  2J7M A;  3I2F A;  3SKV A;  3C7E A;  2QQL A;  3C7H A;  1KGY A;  2VCC A;  2VO5 A;  3C8X A;  1NX9 A;  4GWI A;  1WKY A;  2J1V A;  3I97 A;  2L9L A;  2LW8 A;  3FL7 A;  3K77 A;  5IFP A;  4BJ0 A;  2JE8 A;  1TG7 A;  4ARY A;  1DLC A;  4DXT A;  1NAE A;  1OT5 A;  3EYP A;  2HYX A;  3OEB A;  1J84 A;  3I3B A;  4CVU A;  3DEC A;  4P00 B;  3ZM8 A;  2WDB A;  1GQP A;  4JKK A;  1JZ2 A;  5IJR A;  2WAA A;  2VZ1 A;  2QQI A;  2Y6L A;  4DEQ A;  2J1U A;  2JD9 A;  1J83 A;  4QDQ A;  2W1Q A;  3WNM A;  1PX3 A;  1W9W A;  2DDU A;  3BGA A;  3HNY M;  2J1T A;  1H6Y A;  3NJV A;  3IB3 A;  3T0B A;  3IDA A;  4IUG A;  2W87 A;  4RN5 A;  2E32 A;  3DYO A;  4CU6 A;  1F4A A;  2HLE A;  1K42 A;  3ECQ A;  4CUA A;  3U37 A;  2VR4 A;  1UY2 A;  4GWJ A;  1JZ6 A;  3ACI A;  4DXS A;  2EID A;  4JKL A;  4QX3 A;  3T0D A;  3FN9 A;  5LA0 A;  2VJX A;  3CMG A;  4QX2 A;  1EUU A;  2W95 A;  3MV0 1;  1W9S A;  2BGP A;  2ZEY A;  4JHZ A;  3P1I A;  2W3J A;  2WZE A;  3LPF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...